data_1U0E
# 
_entry.id   1U0E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1U0E         
RCSB  RCSB023088   
WWPDB D_1000023088 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1U0F . unspecified 
PDB 1U0G . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1U0E 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Solomons, J.T.G.'  1 
'Zimmerly, E.M.'    2 
'Burns, S.'         3 
'Krishnamurthy, N.' 4 
'Swan, M.K.'        5 
'Krings, S.'        6 
'Muirhead, H.'      7 
'Chirgwin, J.'      8 
'Davies, C.'        9 
# 
_citation.id                        primary 
_citation.title                     
;The crystal structure of mouse phosphoglucose isomerase at 1.6A resolution and its complex with glucose 6-phosphate reveals the catalytic mechanism of sugar ring opening.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            342 
_citation.page_first                847 
_citation.page_last                 860 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15342241 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.07.085 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Graham Solomons, J.T.' 1 
primary 'Zimmerly, E.M.'        2 
primary 'Burns, S.'             3 
primary 'Krishnamurthy, N.'     4 
primary 'Swan, M.K.'            5 
primary 'Krings, S.'            6 
primary 'Muirhead, H.'          7 
primary 'Chirgwin, J.'          8 
primary 'Davies, C.'            9 
# 
_cell.entry_id           1U0E 
_cell.length_a           69.2 
_cell.length_b           116.1 
_cell.length_c           73.1 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.3 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1U0E 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase' 63644.598 2    5.3.1.9 ? ? ? 
2 non-polymer syn 'SULFATE ION'                   96.063    10   ?       ? ? ? 
3 non-polymer syn BETA-MERCAPTOETHANOL            78.133    5    ?       ? ? ? 
4 non-polymer syn GLYCEROL                        92.094    7    ?       ? ? ? 
5 water       nat water                           18.015    1017 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI, Neuroleukin, NLK' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAA
RDNMFSGSKINYTEDRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGS
DLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMLEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLL
ALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTKLEHH
HHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAA
RDNMFSGSKINYTEDRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGS
DLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMLEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLL
ALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTKLEHH
HHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   LEU n 
1 5   THR n 
1 6   ARG n 
1 7   ASN n 
1 8   PRO n 
1 9   GLN n 
1 10  PHE n 
1 11  GLN n 
1 12  LYS n 
1 13  LEU n 
1 14  LEU n 
1 15  GLU n 
1 16  TRP n 
1 17  HIS n 
1 18  ARG n 
1 19  ALA n 
1 20  ASN n 
1 21  SER n 
1 22  ALA n 
1 23  ASN n 
1 24  LEU n 
1 25  LYS n 
1 26  LEU n 
1 27  ARG n 
1 28  GLU n 
1 29  LEU n 
1 30  PHE n 
1 31  GLU n 
1 32  ALA n 
1 33  ASP n 
1 34  PRO n 
1 35  GLU n 
1 36  ARG n 
1 37  PHE n 
1 38  ASN n 
1 39  ASN n 
1 40  PHE n 
1 41  SER n 
1 42  LEU n 
1 43  ASN n 
1 44  LEU n 
1 45  ASN n 
1 46  THR n 
1 47  ASN n 
1 48  HIS n 
1 49  GLY n 
1 50  HIS n 
1 51  ILE n 
1 52  LEU n 
1 53  VAL n 
1 54  ASP n 
1 55  TYR n 
1 56  SER n 
1 57  LYS n 
1 58  ASN n 
1 59  LEU n 
1 60  VAL n 
1 61  ASN n 
1 62  LYS n 
1 63  GLU n 
1 64  VAL n 
1 65  MET n 
1 66  GLN n 
1 67  MET n 
1 68  LEU n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  ALA n 
1 73  LYS n 
1 74  SER n 
1 75  ARG n 
1 76  GLY n 
1 77  VAL n 
1 78  GLU n 
1 79  ALA n 
1 80  ALA n 
1 81  ARG n 
1 82  ASP n 
1 83  ASN n 
1 84  MET n 
1 85  PHE n 
1 86  SER n 
1 87  GLY n 
1 88  SER n 
1 89  LYS n 
1 90  ILE n 
1 91  ASN n 
1 92  TYR n 
1 93  THR n 
1 94  GLU n 
1 95  ASP n 
1 96  ARG n 
1 97  ALA n 
1 98  VAL n 
1 99  LEU n 
1 100 HIS n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 ARG n 
1 105 ASN n 
1 106 ARG n 
1 107 SER n 
1 108 ASN n 
1 109 THR n 
1 110 PRO n 
1 111 ILE n 
1 112 LYS n 
1 113 VAL n 
1 114 ASP n 
1 115 GLY n 
1 116 LYS n 
1 117 ASP n 
1 118 VAL n 
1 119 MET n 
1 120 PRO n 
1 121 GLU n 
1 122 VAL n 
1 123 ASN n 
1 124 ARG n 
1 125 VAL n 
1 126 LEU n 
1 127 ASP n 
1 128 LYS n 
1 129 MET n 
1 130 LYS n 
1 131 SER n 
1 132 PHE n 
1 133 CYS n 
1 134 GLN n 
1 135 ARG n 
1 136 VAL n 
1 137 ARG n 
1 138 SER n 
1 139 GLY n 
1 140 ASP n 
1 141 TRP n 
1 142 LYS n 
1 143 GLY n 
1 144 TYR n 
1 145 THR n 
1 146 GLY n 
1 147 LYS n 
1 148 SER n 
1 149 ILE n 
1 150 THR n 
1 151 ASP n 
1 152 ILE n 
1 153 ILE n 
1 154 ASN n 
1 155 ILE n 
1 156 GLY n 
1 157 ILE n 
1 158 GLY n 
1 159 GLY n 
1 160 SER n 
1 161 ASP n 
1 162 LEU n 
1 163 GLY n 
1 164 PRO n 
1 165 LEU n 
1 166 MET n 
1 167 VAL n 
1 168 THR n 
1 169 GLU n 
1 170 ALA n 
1 171 LEU n 
1 172 LYS n 
1 173 PRO n 
1 174 TYR n 
1 175 SER n 
1 176 LYS n 
1 177 GLY n 
1 178 GLY n 
1 179 PRO n 
1 180 ARG n 
1 181 VAL n 
1 182 TRP n 
1 183 PHE n 
1 184 VAL n 
1 185 SER n 
1 186 ASN n 
1 187 ILE n 
1 188 ASP n 
1 189 GLY n 
1 190 THR n 
1 191 HIS n 
1 192 ILE n 
1 193 ALA n 
1 194 LYS n 
1 195 THR n 
1 196 LEU n 
1 197 ALA n 
1 198 SER n 
1 199 LEU n 
1 200 SER n 
1 201 PRO n 
1 202 GLU n 
1 203 THR n 
1 204 SER n 
1 205 LEU n 
1 206 PHE n 
1 207 ILE n 
1 208 ILE n 
1 209 ALA n 
1 210 SER n 
1 211 LYS n 
1 212 THR n 
1 213 PHE n 
1 214 THR n 
1 215 THR n 
1 216 GLN n 
1 217 GLU n 
1 218 THR n 
1 219 ILE n 
1 220 THR n 
1 221 ASN n 
1 222 ALA n 
1 223 GLU n 
1 224 THR n 
1 225 ALA n 
1 226 LYS n 
1 227 GLU n 
1 228 TRP n 
1 229 PHE n 
1 230 LEU n 
1 231 GLU n 
1 232 ALA n 
1 233 ALA n 
1 234 LYS n 
1 235 ASP n 
1 236 PRO n 
1 237 SER n 
1 238 ALA n 
1 239 VAL n 
1 240 ALA n 
1 241 LYS n 
1 242 HIS n 
1 243 PHE n 
1 244 VAL n 
1 245 ALA n 
1 246 LEU n 
1 247 SER n 
1 248 THR n 
1 249 ASN n 
1 250 THR n 
1 251 ALA n 
1 252 LYS n 
1 253 VAL n 
1 254 LYS n 
1 255 GLU n 
1 256 PHE n 
1 257 GLY n 
1 258 ILE n 
1 259 ASP n 
1 260 PRO n 
1 261 GLN n 
1 262 ASN n 
1 263 MET n 
1 264 LEU n 
1 265 GLU n 
1 266 PHE n 
1 267 TRP n 
1 268 ASP n 
1 269 TRP n 
1 270 VAL n 
1 271 GLY n 
1 272 GLY n 
1 273 ARG n 
1 274 TYR n 
1 275 SER n 
1 276 LEU n 
1 277 TRP n 
1 278 SER n 
1 279 ALA n 
1 280 ILE n 
1 281 GLY n 
1 282 LEU n 
1 283 SER n 
1 284 ILE n 
1 285 ALA n 
1 286 LEU n 
1 287 HIS n 
1 288 VAL n 
1 289 GLY n 
1 290 PHE n 
1 291 ASP n 
1 292 HIS n 
1 293 PHE n 
1 294 GLU n 
1 295 GLN n 
1 296 LEU n 
1 297 LEU n 
1 298 SER n 
1 299 GLY n 
1 300 ALA n 
1 301 HIS n 
1 302 TRP n 
1 303 MET n 
1 304 ASP n 
1 305 GLN n 
1 306 HIS n 
1 307 PHE n 
1 308 LEU n 
1 309 LYS n 
1 310 THR n 
1 311 PRO n 
1 312 LEU n 
1 313 GLU n 
1 314 LYS n 
1 315 ASN n 
1 316 ALA n 
1 317 PRO n 
1 318 VAL n 
1 319 LEU n 
1 320 LEU n 
1 321 ALA n 
1 322 LEU n 
1 323 LEU n 
1 324 GLY n 
1 325 ILE n 
1 326 TRP n 
1 327 TYR n 
1 328 ILE n 
1 329 ASN n 
1 330 CYS n 
1 331 TYR n 
1 332 GLY n 
1 333 CYS n 
1 334 GLU n 
1 335 THR n 
1 336 HIS n 
1 337 ALA n 
1 338 LEU n 
1 339 LEU n 
1 340 PRO n 
1 341 TYR n 
1 342 ASP n 
1 343 GLN n 
1 344 TYR n 
1 345 MET n 
1 346 HIS n 
1 347 ARG n 
1 348 PHE n 
1 349 ALA n 
1 350 ALA n 
1 351 TYR n 
1 352 PHE n 
1 353 GLN n 
1 354 GLN n 
1 355 GLY n 
1 356 ASP n 
1 357 MET n 
1 358 GLU n 
1 359 SER n 
1 360 ASN n 
1 361 GLY n 
1 362 LYS n 
1 363 TYR n 
1 364 ILE n 
1 365 THR n 
1 366 LYS n 
1 367 SER n 
1 368 GLY n 
1 369 ALA n 
1 370 ARG n 
1 371 VAL n 
1 372 ASP n 
1 373 HIS n 
1 374 GLN n 
1 375 THR n 
1 376 GLY n 
1 377 PRO n 
1 378 ILE n 
1 379 VAL n 
1 380 TRP n 
1 381 GLY n 
1 382 GLU n 
1 383 PRO n 
1 384 GLY n 
1 385 THR n 
1 386 ASN n 
1 387 GLY n 
1 388 GLN n 
1 389 HIS n 
1 390 ALA n 
1 391 PHE n 
1 392 TYR n 
1 393 GLN n 
1 394 LEU n 
1 395 ILE n 
1 396 HIS n 
1 397 GLN n 
1 398 GLY n 
1 399 THR n 
1 400 LYS n 
1 401 MET n 
1 402 ILE n 
1 403 PRO n 
1 404 CYS n 
1 405 ASP n 
1 406 PHE n 
1 407 LEU n 
1 408 ILE n 
1 409 PRO n 
1 410 VAL n 
1 411 GLN n 
1 412 THR n 
1 413 GLN n 
1 414 HIS n 
1 415 PRO n 
1 416 ILE n 
1 417 ARG n 
1 418 LYS n 
1 419 GLY n 
1 420 LEU n 
1 421 HIS n 
1 422 HIS n 
1 423 LYS n 
1 424 ILE n 
1 425 LEU n 
1 426 LEU n 
1 427 ALA n 
1 428 ASN n 
1 429 PHE n 
1 430 LEU n 
1 431 ALA n 
1 432 GLN n 
1 433 THR n 
1 434 GLU n 
1 435 ALA n 
1 436 LEU n 
1 437 MET n 
1 438 LYS n 
1 439 GLY n 
1 440 LYS n 
1 441 LEU n 
1 442 PRO n 
1 443 GLU n 
1 444 GLU n 
1 445 ALA n 
1 446 ARG n 
1 447 LYS n 
1 448 GLU n 
1 449 LEU n 
1 450 GLN n 
1 451 ALA n 
1 452 ALA n 
1 453 GLY n 
1 454 LYS n 
1 455 SER n 
1 456 PRO n 
1 457 GLU n 
1 458 ASP n 
1 459 LEU n 
1 460 GLU n 
1 461 LYS n 
1 462 LEU n 
1 463 LEU n 
1 464 PRO n 
1 465 HIS n 
1 466 LYS n 
1 467 VAL n 
1 468 PHE n 
1 469 GLU n 
1 470 GLY n 
1 471 ASN n 
1 472 ARG n 
1 473 PRO n 
1 474 THR n 
1 475 ASN n 
1 476 SER n 
1 477 ILE n 
1 478 VAL n 
1 479 PHE n 
1 480 THR n 
1 481 LYS n 
1 482 LEU n 
1 483 THR n 
1 484 PRO n 
1 485 PHE n 
1 486 ILE n 
1 487 LEU n 
1 488 GLY n 
1 489 ALA n 
1 490 LEU n 
1 491 ILE n 
1 492 ALA n 
1 493 MET n 
1 494 TYR n 
1 495 GLU n 
1 496 HIS n 
1 497 LYS n 
1 498 ILE n 
1 499 PHE n 
1 500 VAL n 
1 501 GLN n 
1 502 GLY n 
1 503 ILE n 
1 504 MET n 
1 505 TRP n 
1 506 ASP n 
1 507 ILE n 
1 508 ASN n 
1 509 SER n 
1 510 PHE n 
1 511 ASP n 
1 512 GLN n 
1 513 TRP n 
1 514 GLY n 
1 515 VAL n 
1 516 GLU n 
1 517 LEU n 
1 518 GLY n 
1 519 LYS n 
1 520 GLN n 
1 521 LEU n 
1 522 ALA n 
1 523 LYS n 
1 524 LYS n 
1 525 ILE n 
1 526 GLU n 
1 527 PRO n 
1 528 GLU n 
1 529 LEU n 
1 530 GLU n 
1 531 GLY n 
1 532 SER n 
1 533 SER n 
1 534 ALA n 
1 535 VAL n 
1 536 THR n 
1 537 SER n 
1 538 HIS n 
1 539 ASP n 
1 540 SER n 
1 541 SER n 
1 542 THR n 
1 543 ASN n 
1 544 GLY n 
1 545 LEU n 
1 546 ILE n 
1 547 SER n 
1 548 PHE n 
1 549 ILE n 
1 550 LYS n 
1 551 GLN n 
1 552 GLN n 
1 553 ARG n 
1 554 ASP n 
1 555 THR n 
1 556 LYS n 
1 557 LEU n 
1 558 GLU n 
1 559 HIS n 
1 560 HIS n 
1 561 HIS n 
1 562 HIS n 
1 563 HIS n 
1 564 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 Gpi 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3pLysS 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET5a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_MOUSE 
_struct_ref.pdbx_db_accession          P06745 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAA
RDNMFSGSKINYTEDRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGS
DLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLL
ALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTKLE
;
_struct_ref.pdbx_align_begin           0 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1U0E A 1 ? 558 ? P06745 0 ? 557 ? 0 557 
2 1 1U0E B 1 ? 558 ? P06745 0 ? 557 ? 0 557 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1U0E LEU A 264 ? UNP P06745 PHE 263 'SEE REMARK 999' 263 1  
1 1U0E HIS A 559 ? UNP P06745 ?   ?   'EXPRESSION TAG' 558 2  
1 1U0E HIS A 560 ? UNP P06745 ?   ?   'EXPRESSION TAG' 559 3  
1 1U0E HIS A 561 ? UNP P06745 ?   ?   'EXPRESSION TAG' 560 4  
1 1U0E HIS A 562 ? UNP P06745 ?   ?   'EXPRESSION TAG' 561 5  
1 1U0E HIS A 563 ? UNP P06745 ?   ?   'EXPRESSION TAG' 562 6  
1 1U0E HIS A 564 ? UNP P06745 ?   ?   'EXPRESSION TAG' 563 7  
2 1U0E LEU B 264 ? UNP P06745 PHE 263 'SEE REMARK 999' 263 8  
2 1U0E HIS B 559 ? UNP P06745 ?   ?   'EXPRESSION TAG' 558 9  
2 1U0E HIS B 560 ? UNP P06745 ?   ?   'EXPRESSION TAG' 559 10 
2 1U0E HIS B 561 ? UNP P06745 ?   ?   'EXPRESSION TAG' 560 11 
2 1U0E HIS B 562 ? UNP P06745 ?   ?   'EXPRESSION TAG' 561 12 
2 1U0E HIS B 563 ? UNP P06745 ?   ?   'EXPRESSION TAG' 562 13 
2 1U0E HIS B 564 ? UNP P06745 ?   ?   'EXPRESSION TAG' 563 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ?                               'C4 H7 N O4'     133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL ?                               'C2 H6 O S'      78.133  
CYS 'L-peptide linking' y CYSTEINE             ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE            ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1U0E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   41.5 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'1.9 M ammonium sulphate, 100 mM Tris-HCl, pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2001-07-01 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Osmic mirros' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     1U0E 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.6 
_reflns.d_resolution_low             49.7 
_reflns.number_all                   148767 
_reflns.number_obs                   147857 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        5.4 
_reflns.B_iso_Wilson_estimate        24.4 
_reflns.pdbx_redundancy              5.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   96.4 
_reflns_shell.Rmerge_I_obs           0.422 
_reflns_shell.pdbx_Rsym_value        0.422 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        5.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      14817 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1U0E 
_refine.ls_number_reflns_obs                     146126 
_refine.ls_number_reflns_all                     146126 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             14.96 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    98.9 
_refine.ls_R_factor_obs                          0.213 
_refine.ls_R_factor_all                          0.213 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  7322 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               24.439 
_refine.aniso_B[1][1]                            0.02 
_refine.aniso_B[2][2]                            0.01 
_refine.aniso_B[3][3]                            -0.02 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.02 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1N8T' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.109 
_refine.pdbx_overall_ESU_R_Free                  0.108 
_refine.overall_SU_ML                            0.086 
_refine.overall_SU_B                             2.670 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8814 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         112 
_refine_hist.number_atoms_solvent             1017 
_refine_hist.number_atoms_total               9943 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        14.96 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010 0.021 ? 9153  'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.160 1.947 ? 12378 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.587 5.000 ? 1110  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.085 0.200 ? 1348  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005 0.020 ? 6823  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.196 0.200 ? 4749  'X-RAY DIFFRACTION' ? 
r_nbd_other              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.133 0.200 ? 947   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.204 0.200 ? 57    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.107 0.200 ? 43    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.550 1.500 ? 5527  'X-RAY DIFFRACTION' ? 
r_mcbond_other           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.001 2.000 ? 8919  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.692 3.000 ? 3626  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.709 4.500 ? 3459  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.600 
_refine_ls_shell.d_res_low                        1.641 
_refine_ls_shell.number_reflns_R_work             9653 
_refine_ls_shell.R_factor_R_work                  0.54 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.56 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             484 
_refine_ls_shell.number_reflns_obs                10137 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1U0E 
_struct.title                     'Crystal structure of mouse phosphoglucose isomerase' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1U0E 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'aldose-ketose isomerase, dimer, ISOMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 2 ? 
R N N 2 ? 
S N N 2 ? 
T N N 2 ? 
U N N 2 ? 
V N N 2 ? 
W N N 4 ? 
X N N 4 ? 
Y N N 5 ? 
Z N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological unit is a dimer. The asymmetric unit is a dimer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 2   ? ASN A 7   ? ALA A 1   ASN A 6   1 ? 6  
HELX_P HELX_P2  2  ASN A 7   ? SER A 21  ? ASN A 6   SER A 20  1 ? 15 
HELX_P HELX_P3  3  ALA A 22  ? LEU A 24  ? ALA A 21  LEU A 23  5 ? 3  
HELX_P HELX_P4  4  LYS A 25  ? ASP A 33  ? LYS A 24  ASP A 32  1 ? 9  
HELX_P HELX_P5  5  GLU A 35  ? PHE A 40  ? GLU A 34  PHE A 39  1 ? 6  
HELX_P HELX_P6  6  ASN A 61  ? ARG A 75  ? ASN A 60  ARG A 74  1 ? 15 
HELX_P HELX_P7  7  GLY A 76  ? GLY A 87  ? GLY A 75  GLY A 86  1 ? 12 
HELX_P HELX_P8  8  LEU A 99  ? ARG A 104 ? LEU A 98  ARG A 103 1 ? 6  
HELX_P HELX_P9  9  VAL A 118 ? SER A 138 ? VAL A 117 SER A 137 1 ? 21 
HELX_P HELX_P10 10 ILE A 157 ? SER A 160 ? ILE A 156 SER A 159 5 ? 4  
HELX_P HELX_P11 11 ASP A 161 ? LEU A 171 ? ASP A 160 LEU A 170 1 ? 11 
HELX_P HELX_P12 12 LYS A 172 ? SER A 175 ? LYS A 171 SER A 174 5 ? 4  
HELX_P HELX_P13 13 ASP A 188 ? ALA A 197 ? ASP A 187 ALA A 196 1 ? 10 
HELX_P HELX_P14 14 SER A 198 ? LEU A 199 ? SER A 197 LEU A 198 5 ? 2  
HELX_P HELX_P15 15 SER A 200 ? GLU A 202 ? SER A 199 GLU A 201 5 ? 3  
HELX_P HELX_P16 16 THR A 215 ? LYS A 234 ? THR A 214 LYS A 233 1 ? 20 
HELX_P HELX_P17 17 ASP A 235 ? LYS A 241 ? ASP A 234 LYS A 240 5 ? 7  
HELX_P HELX_P18 18 ASN A 249 ? GLY A 257 ? ASN A 248 GLY A 256 1 ? 9  
HELX_P HELX_P19 19 ASP A 259 ? GLN A 261 ? ASP A 258 GLN A 260 5 ? 3  
HELX_P HELX_P20 20 GLY A 271 ? SER A 275 ? GLY A 270 SER A 274 5 ? 5  
HELX_P HELX_P21 21 SER A 278 ? ILE A 280 ? SER A 277 ILE A 279 5 ? 3  
HELX_P HELX_P22 22 GLY A 281 ? GLY A 289 ? GLY A 280 GLY A 288 1 ? 9  
HELX_P HELX_P23 23 GLY A 289 ? THR A 310 ? GLY A 288 THR A 309 1 ? 22 
HELX_P HELX_P24 24 PRO A 311 ? LYS A 314 ? PRO A 310 LYS A 313 5 ? 4  
HELX_P HELX_P25 25 ASN A 315 ? CYS A 330 ? ASN A 314 CYS A 329 1 ? 16 
HELX_P HELX_P26 26 ARG A 347 ? GLY A 361 ? ARG A 346 GLY A 360 1 ? 15 
HELX_P HELX_P27 27 ASN A 386 ? ALA A 390 ? ASN A 385 ALA A 389 5 ? 5  
HELX_P HELX_P28 28 PHE A 391 ? GLY A 398 ? PHE A 390 GLY A 397 1 ? 8  
HELX_P HELX_P29 29 ILE A 416 ? LYS A 418 ? ILE A 415 LYS A 417 5 ? 3  
HELX_P HELX_P30 30 GLY A 419 ? GLY A 439 ? GLY A 418 GLY A 438 1 ? 21 
HELX_P HELX_P31 31 LEU A 441 ? ALA A 452 ? LEU A 440 ALA A 451 1 ? 12 
HELX_P HELX_P32 32 SER A 455 ? LEU A 463 ? SER A 454 LEU A 462 1 ? 9  
HELX_P HELX_P33 33 PRO A 464 ? VAL A 467 ? PRO A 463 VAL A 466 5 ? 4  
HELX_P HELX_P34 34 THR A 483 ? ASP A 506 ? THR A 482 ASP A 505 1 ? 24 
HELX_P HELX_P35 35 GLN A 512 ? GLY A 514 ? GLN A 511 GLY A 513 5 ? 3  
HELX_P HELX_P36 36 VAL A 515 ? LEU A 529 ? VAL A 514 LEU A 528 1 ? 15 
HELX_P HELX_P37 37 ASP A 539 ? ARG A 553 ? ASP A 538 ARG A 552 1 ? 15 
HELX_P HELX_P38 38 ALA B 2   ? ASN B 7   ? ALA B 1   ASN B 6   1 ? 6  
HELX_P HELX_P39 39 ASN B 7   ? SER B 21  ? ASN B 6   SER B 20  1 ? 15 
HELX_P HELX_P40 40 ALA B 22  ? LEU B 24  ? ALA B 21  LEU B 23  5 ? 3  
HELX_P HELX_P41 41 LYS B 25  ? ASP B 33  ? LYS B 24  ASP B 32  1 ? 9  
HELX_P HELX_P42 42 GLU B 35  ? PHE B 40  ? GLU B 34  PHE B 39  1 ? 6  
HELX_P HELX_P43 43 ASN B 61  ? ARG B 75  ? ASN B 60  ARG B 74  1 ? 15 
HELX_P HELX_P44 44 GLY B 76  ? SER B 86  ? GLY B 75  SER B 85  1 ? 11 
HELX_P HELX_P45 45 LEU B 99  ? ARG B 104 ? LEU B 98  ARG B 103 1 ? 6  
HELX_P HELX_P46 46 VAL B 118 ? SER B 138 ? VAL B 117 SER B 137 1 ? 21 
HELX_P HELX_P47 47 ILE B 157 ? SER B 160 ? ILE B 156 SER B 159 5 ? 4  
HELX_P HELX_P48 48 ASP B 161 ? LEU B 171 ? ASP B 160 LEU B 170 1 ? 11 
HELX_P HELX_P49 49 LYS B 172 ? SER B 175 ? LYS B 171 SER B 174 5 ? 4  
HELX_P HELX_P50 50 ASP B 188 ? ALA B 197 ? ASP B 187 ALA B 196 1 ? 10 
HELX_P HELX_P51 51 THR B 215 ? LYS B 234 ? THR B 214 LYS B 233 1 ? 20 
HELX_P HELX_P52 52 ASP B 235 ? LYS B 241 ? ASP B 234 LYS B 240 5 ? 7  
HELX_P HELX_P53 53 ASN B 249 ? GLY B 257 ? ASN B 248 GLY B 256 1 ? 9  
HELX_P HELX_P54 54 ASP B 259 ? GLN B 261 ? ASP B 258 GLN B 260 5 ? 3  
HELX_P HELX_P55 55 GLY B 271 ? SER B 275 ? GLY B 270 SER B 274 5 ? 5  
HELX_P HELX_P56 56 SER B 278 ? ILE B 280 ? SER B 277 ILE B 279 5 ? 3  
HELX_P HELX_P57 57 GLY B 281 ? GLY B 289 ? GLY B 280 GLY B 288 1 ? 9  
HELX_P HELX_P58 58 GLY B 289 ? THR B 310 ? GLY B 288 THR B 309 1 ? 22 
HELX_P HELX_P59 59 PRO B 311 ? LYS B 314 ? PRO B 310 LYS B 313 5 ? 4  
HELX_P HELX_P60 60 ASN B 315 ? CYS B 330 ? ASN B 314 CYS B 329 1 ? 16 
HELX_P HELX_P61 61 ARG B 347 ? GLY B 361 ? ARG B 346 GLY B 360 1 ? 15 
HELX_P HELX_P62 62 THR B 385 ? ALA B 390 ? THR B 384 ALA B 389 5 ? 6  
HELX_P HELX_P63 63 PHE B 391 ? GLY B 398 ? PHE B 390 GLY B 397 1 ? 8  
HELX_P HELX_P64 64 ILE B 416 ? LYS B 418 ? ILE B 415 LYS B 417 5 ? 3  
HELX_P HELX_P65 65 GLY B 419 ? GLY B 439 ? GLY B 418 GLY B 438 1 ? 21 
HELX_P HELX_P66 66 LEU B 441 ? ALA B 452 ? LEU B 440 ALA B 451 1 ? 12 
HELX_P HELX_P67 67 SER B 455 ? VAL B 467 ? SER B 454 VAL B 466 1 ? 13 
HELX_P HELX_P68 68 THR B 483 ? ASP B 506 ? THR B 482 ASP B 505 1 ? 24 
HELX_P HELX_P69 69 GLN B 512 ? GLY B 514 ? GLN B 511 GLY B 513 5 ? 3  
HELX_P HELX_P70 70 VAL B 515 ? GLU B 530 ? VAL B 514 GLU B 529 1 ? 16 
HELX_P HELX_P71 71 ASP B 539 ? ARG B 553 ? ASP B 538 ARG B 552 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 384 A . ? GLY 383 A THR 385 A ? THR 384 A 1 3.15 
2 GLY 384 B . ? GLY 383 B THR 385 B ? THR 384 B 1 3.96 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 5 ? 
D ? 6 ? 
E ? 2 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 41  ? ASN A 45  ? SER A 40  ASN A 44  
A 2 HIS A 50  ? ASP A 54  ? HIS A 49  ASP A 53  
A 3 THR A 474 ? LYS A 481 ? THR A 473 LYS A 480 
A 4 CYS A 404 ? GLN A 411 ? CYS A 403 GLN A 410 
A 5 THR A 335 ? PRO A 340 ? THR A 334 PRO A 339 
A 6 ILE A 378 ? TRP A 380 ? ILE A 377 TRP A 379 
B 1 LYS A 112 ? VAL A 113 ? LYS A 111 VAL A 112 
B 2 LYS A 116 ? ASP A 117 ? LYS A 115 ASP A 116 
C 1 ARG A 180 ? VAL A 184 ? ARG A 179 VAL A 183 
C 2 ASP A 151 ? ILE A 155 ? ASP A 150 ILE A 154 
C 3 SER A 204 ? ALA A 209 ? SER A 203 ALA A 208 
C 4 PHE A 243 ? SER A 247 ? PHE A 242 SER A 246 
C 5 MET A 263 ? GLU A 265 ? MET A 262 GLU A 264 
D 1 SER B 41  ? ASN B 45  ? SER B 40  ASN B 44  
D 2 HIS B 50  ? ASP B 54  ? HIS B 49  ASP B 53  
D 3 THR B 474 ? LYS B 481 ? THR B 473 LYS B 480 
D 4 CYS B 404 ? GLN B 411 ? CYS B 403 GLN B 410 
D 5 THR B 335 ? PRO B 340 ? THR B 334 PRO B 339 
D 6 ILE B 378 ? TRP B 380 ? ILE B 377 TRP B 379 
E 1 LYS B 112 ? VAL B 113 ? LYS B 111 VAL B 112 
E 2 LYS B 116 ? ASP B 117 ? LYS B 115 ASP B 116 
F 1 ARG B 180 ? VAL B 184 ? ARG B 179 VAL B 183 
F 2 ASP B 151 ? ILE B 155 ? ASP B 150 ILE B 154 
F 3 SER B 204 ? ALA B 209 ? SER B 203 ALA B 208 
F 4 PHE B 243 ? LEU B 246 ? PHE B 242 LEU B 245 
F 5 MET B 263 ? LEU B 264 ? MET B 262 LEU B 263 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 42  ? N LEU A 41  O VAL A 53  ? O VAL A 52  
A 2 3 N LEU A 52  ? N LEU A 51  O VAL A 478 ? O VAL A 477 
A 3 4 O ILE A 477 ? O ILE A 476 N PHE A 406 ? N PHE A 405 
A 4 5 O ASP A 405 ? O ASP A 404 N LEU A 339 ? N LEU A 338 
A 5 6 N LEU A 338 ? N LEU A 337 O TRP A 380 ? O TRP A 379 
B 1 2 N VAL A 113 ? N VAL A 112 O LYS A 116 ? O LYS A 115 
C 1 2 O VAL A 184 ? O VAL A 183 N ASN A 154 ? N ASN A 153 
C 2 3 N ILE A 155 ? N ILE A 154 O ILE A 207 ? O ILE A 206 
C 3 4 N ILE A 208 ? N ILE A 207 O VAL A 244 ? O VAL A 243 
C 4 5 N ALA A 245 ? N ALA A 244 O LEU A 264 ? O LEU A 263 
D 1 2 N LEU B 44  ? N LEU B 43  O ILE B 51  ? O ILE B 50  
D 2 3 N LEU B 52  ? N LEU B 51  O VAL B 478 ? O VAL B 477 
D 3 4 O ASN B 475 ? O ASN B 474 N PHE B 406 ? N PHE B 405 
D 4 5 O ASP B 405 ? O ASP B 404 N LEU B 339 ? N LEU B 338 
D 5 6 N LEU B 338 ? N LEU B 337 O TRP B 380 ? O TRP B 379 
E 1 2 N VAL B 113 ? N VAL B 112 O LYS B 116 ? O LYS B 115 
F 1 2 O VAL B 184 ? O VAL B 183 N ASN B 154 ? N ASN B 153 
F 2 3 N ILE B 153 ? N ILE B 152 O ILE B 207 ? O ILE B 206 
F 3 4 N ILE B 208 ? N ILE B 207 O VAL B 244 ? O VAL B 243 
F 4 5 N ALA B 245 ? N ALA B 244 O LEU B 264 ? O LEU B 263 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 A 1201' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 1202' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 1203' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 1204' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 1205' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 1206' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 1207' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 1208' 
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 1209' 
BC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 B 1210' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BME A 1211' 
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE BME A 1212' 
BC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BME A 1213' 
BC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BME A 1214' 
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BME A 1215' 
BC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 1221' 
BC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL B 1222' 
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL A 1223' 
CC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL B 1224' 
CC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 1225' 
CC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 1226' 
CC4 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL A 1227' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 9 SER A 160 ? SER A 159  . ? 1_555 ? 
2   AC1 9 SER A 210 ? SER A 209  . ? 1_555 ? 
3   AC1 9 LYS A 211 ? LYS A 210  . ? 1_555 ? 
4   AC1 9 THR A 212 ? THR A 211  . ? 1_555 ? 
5   AC1 9 THR A 215 ? THR A 214  . ? 1_555 ? 
6   AC1 9 HOH Y .   ? HOH A 1259 . ? 1_555 ? 
7   AC1 9 HOH Y .   ? HOH A 1479 . ? 1_555 ? 
8   AC1 9 HOH Y .   ? HOH A 1638 . ? 1_555 ? 
9   AC1 9 HOH Y .   ? HOH A 1739 . ? 1_555 ? 
10  AC2 7 ALA A 2   ? ALA A 1    . ? 1_555 ? 
11  AC2 7 ALA A 3   ? ALA A 2    . ? 1_555 ? 
12  AC2 7 ARG A 6   ? ARG A 5    . ? 1_555 ? 
13  AC2 7 SER A 367 ? SER A 366  . ? 1_555 ? 
14  AC2 7 ALA A 369 ? ALA A 368  . ? 1_555 ? 
15  AC2 7 HOH Y .   ? HOH A 1364 . ? 1_555 ? 
16  AC2 7 HOH Y .   ? HOH A 1442 . ? 1_555 ? 
17  AC3 4 ARG B 137 ? ARG B 136  . ? 1_555 ? 
18  AC3 4 HOH Z .   ? HOH B 1279 . ? 1_555 ? 
19  AC3 4 HOH Z .   ? HOH B 1513 . ? 1_555 ? 
20  AC3 4 HOH Z .   ? HOH B 1612 . ? 1_555 ? 
21  AC4 3 ALA B 369 ? ALA B 368  . ? 1_555 ? 
22  AC4 3 ARG B 370 ? ARG B 369  . ? 1_555 ? 
23  AC4 3 HOH Z .   ? HOH B 1613 . ? 1_555 ? 
24  AC5 7 GLY B 159 ? GLY B 158  . ? 1_555 ? 
25  AC5 7 GLY B 272 ? GLY B 271  . ? 1_555 ? 
26  AC5 7 ARG B 273 ? ARG B 272  . ? 1_555 ? 
27  AC5 7 GLN B 354 ? GLN B 353  . ? 1_555 ? 
28  AC5 7 HOH Z .   ? HOH B 1366 . ? 1_555 ? 
29  AC5 7 HOH Z .   ? HOH B 1544 . ? 1_555 ? 
30  AC5 7 HOH Z .   ? HOH B 1704 . ? 1_555 ? 
31  AC6 4 ASN A 47  ? ASN A 46   . ? 1_555 ? 
32  AC6 4 HIS A 48  ? HIS A 47   . ? 1_555 ? 
33  AC6 4 HOH Y .   ? HOH A 1527 . ? 1_555 ? 
34  AC6 4 HOH Y .   ? HOH A 1745 . ? 1_555 ? 
35  AC7 3 ARG A 106 ? ARG A 105  . ? 1_555 ? 
36  AC7 3 SER A 298 ? SER A 297  . ? 1_555 ? 
37  AC7 3 HOH Y .   ? HOH A 1526 . ? 1_555 ? 
38  AC8 4 LYS B 147 ? LYS B 146  . ? 1_555 ? 
39  AC8 4 SER B 148 ? SER B 147  . ? 1_555 ? 
40  AC8 4 HOH Z .   ? HOH B 1283 . ? 1_555 ? 
41  AC8 4 HOH Z .   ? HOH B 1375 . ? 1_555 ? 
42  AC9 6 THR B 212 ? THR B 211  . ? 1_555 ? 
43  AC9 6 THR B 214 ? THR B 213  . ? 1_555 ? 
44  AC9 6 THR B 215 ? THR B 214  . ? 1_555 ? 
45  AC9 6 HOH Z .   ? HOH B 1448 . ? 1_555 ? 
46  AC9 6 HOH Z .   ? HOH B 1490 . ? 1_555 ? 
47  AC9 6 HOH Z .   ? HOH B 1645 . ? 1_555 ? 
48  BC1 8 LYS A 523 ? LYS A 522  . ? 1_655 ? 
49  BC1 8 HOH Y .   ? HOH A 1595 . ? 1_655 ? 
50  BC1 8 GLY B 531 ? GLY B 530  . ? 1_555 ? 
51  BC1 8 SER B 532 ? SER B 531  . ? 1_555 ? 
52  BC1 8 SER B 533 ? SER B 532  . ? 1_555 ? 
53  BC1 8 HOH Z .   ? HOH B 1552 . ? 1_555 ? 
54  BC1 8 HOH Z .   ? HOH B 1624 . ? 1_555 ? 
55  BC1 8 HOH Z .   ? HOH B 1641 . ? 1_555 ? 
56  BC2 4 GLY A 419 ? GLY A 418  . ? 1_555 ? 
57  BC2 4 HOH Y .   ? HOH A 1353 . ? 1_555 ? 
58  BC2 4 HOH Y .   ? HOH A 1438 . ? 1_555 ? 
59  BC2 4 ARG B 553 ? ARG B 552  . ? 1_555 ? 
60  BC3 6 ARG A 347 ? ARG A 346  . ? 1_555 ? 
61  BC3 6 GOL N .   ? GOL A 1225 . ? 1_555 ? 
62  BC3 6 HOH Y .   ? HOH A 1640 . ? 1_555 ? 
63  BC3 6 GLN B 343 ? GLN B 342  . ? 1_555 ? 
64  BC3 6 HOH Z .   ? HOH B 1352 . ? 1_555 ? 
65  BC3 6 HOH Z .   ? HOH B 1511 . ? 1_555 ? 
66  BC4 2 HIS A 50  ? HIS A 49   . ? 1_555 ? 
67  BC4 2 GLN B 552 ? GLN B 551  . ? 1_555 ? 
68  BC5 4 THR A 150 ? THR A 149  . ? 1_555 ? 
69  BC5 4 ARG A 180 ? ARG A 179  . ? 1_555 ? 
70  BC5 4 HOH Y .   ? HOH A 1545 . ? 1_555 ? 
71  BC5 4 HOH Y .   ? HOH A 1716 . ? 1_555 ? 
72  BC6 4 LEU A 196 ? LEU A 195  . ? 1_555 ? 
73  BC6 4 LEU A 199 ? LEU A 198  . ? 1_555 ? 
74  BC6 4 TRP A 228 ? TRP A 227  . ? 1_555 ? 
75  BC6 4 HOH Y .   ? HOH A 1451 . ? 1_555 ? 
76  BC7 8 ARG A 135 ? ARG A 134  . ? 1_555 ? 
77  BC7 8 ASP A 140 ? ASP A 139  . ? 1_555 ? 
78  BC7 8 TRP A 141 ? TRP A 140  . ? 1_555 ? 
79  BC7 8 LYS A 142 ? LYS A 141  . ? 1_555 ? 
80  BC7 8 LYS A 241 ? LYS A 240  . ? 1_555 ? 
81  BC7 8 HOH Y .   ? HOH A 1569 . ? 1_555 ? 
82  BC7 8 HOH Y .   ? HOH A 1616 . ? 1_555 ? 
83  BC7 8 HOH Y .   ? HOH A 1625 . ? 1_555 ? 
84  BC8 5 GLN B 9   ? GLN B 8    . ? 1_555 ? 
85  BC8 5 SER B 74  ? SER B 73   . ? 1_555 ? 
86  BC8 5 HOH Z .   ? HOH B 1505 . ? 1_555 ? 
87  BC8 5 HOH Z .   ? HOH B 1534 . ? 1_555 ? 
88  BC8 5 HOH Z .   ? HOH B 1536 . ? 1_555 ? 
89  BC9 2 ASN A 471 ? ASN A 470  . ? 1_555 ? 
90  BC9 2 ARG A 472 ? ARG A 471  . ? 1_555 ? 
91  CC1 6 ASN B 39  ? ASN B 38   . ? 1_555 ? 
92  CC1 6 TYR B 55  ? TYR B 54   . ? 1_555 ? 
93  CC1 6 LYS B 62  ? LYS B 61   . ? 1_555 ? 
94  CC1 6 MET B 65  ? MET B 64   . ? 1_555 ? 
95  CC1 6 HOH Z .   ? HOH B 1321 . ? 1_555 ? 
96  CC1 6 HOH Z .   ? HOH B 1498 . ? 1_555 ? 
97  CC2 7 GLU A 169 ? GLU A 168  . ? 1_555 ? 
98  CC2 7 PHE A 183 ? PHE A 182  . ? 1_555 ? 
99  CC2 7 HIS A 346 ? HIS A 345  . ? 1_555 ? 
100 CC2 7 BME H .   ? BME A 1212 . ? 1_555 ? 
101 CC2 7 HOH Y .   ? HOH A 1446 . ? 1_555 ? 
102 CC2 7 HOH Y .   ? HOH A 1536 . ? 1_555 ? 
103 CC2 7 HOH Y .   ? HOH A 1639 . ? 1_555 ? 
104 CC3 7 PHE A 132 ? PHE A 131  . ? 1_555 ? 
105 CC3 7 VAL A 244 ? VAL A 243  . ? 1_555 ? 
106 CC3 7 GLN A 261 ? GLN A 260  . ? 1_555 ? 
107 CC3 7 ASN A 262 ? ASN A 261  . ? 1_555 ? 
108 CC3 7 LEU A 264 ? LEU A 263  . ? 1_555 ? 
109 CC3 7 HOH Y .   ? HOH A 1443 . ? 1_555 ? 
110 CC3 7 HOH Y .   ? HOH A 1624 . ? 1_555 ? 
111 CC4 9 LYS A 172 ? LYS A 171  . ? 1_555 ? 
112 CC4 9 ARG A 180 ? ARG A 179  . ? 1_555 ? 
113 CC4 9 VAL A 181 ? VAL A 180  . ? 1_555 ? 
114 CC4 9 HIS A 287 ? HIS A 286  . ? 1_555 ? 
115 CC4 9 HOH Y .   ? HOH A 1400 . ? 1_555 ? 
116 CC4 9 HOH Y .   ? HOH A 1529 . ? 1_555 ? 
117 CC4 9 HOH Y .   ? HOH A 1581 . ? 1_555 ? 
118 CC4 9 HOH Y .   ? HOH A 1608 . ? 1_555 ? 
119 CC4 9 HOH Y .   ? HOH A 1637 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1U0E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1U0E 
_atom_sites.fract_transf_matrix[1][1]   0.014447 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002884 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008615 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013950 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 2   ? 9.837   -23.619 -8.783  1.00 24.59 ? 1    ALA A N   1 
ATOM   2    C CA  . ALA A 1 2   ? 10.603  -22.335 -8.872  1.00 24.58 ? 1    ALA A CA  1 
ATOM   3    C C   . ALA A 1 2   ? 11.736  -22.469 -9.884  1.00 24.87 ? 1    ALA A C   1 
ATOM   4    O O   . ALA A 1 2   ? 12.448  -23.471 -9.891  1.00 24.81 ? 1    ALA A O   1 
ATOM   5    C CB  . ALA A 1 2   ? 11.155  -21.973 -7.516  1.00 24.40 ? 1    ALA A CB  1 
ATOM   6    N N   . ALA A 1 3   ? 11.913  -21.447 -10.712 1.00 25.16 ? 2    ALA A N   1 
ATOM   7    C CA  . ALA A 1 3   ? 12.900  -21.487 -11.790 1.00 25.49 ? 2    ALA A CA  1 
ATOM   8    C C   . ALA A 1 3   ? 14.334  -21.770 -11.319 1.00 25.70 ? 2    ALA A C   1 
ATOM   9    O O   . ALA A 1 3   ? 15.036  -22.575 -11.944 1.00 25.45 ? 2    ALA A O   1 
ATOM   10   C CB  . ALA A 1 3   ? 12.836  -20.204 -12.624 1.00 25.36 ? 2    ALA A CB  1 
ATOM   11   N N   . LEU A 1 4   ? 14.763  -21.144 -10.214 1.00 25.77 ? 3    LEU A N   1 
ATOM   12   C CA  . LEU A 1 4   ? 16.152  -21.283 -9.759  1.00 26.12 ? 3    LEU A CA  1 
ATOM   13   C C   . LEU A 1 4   ? 16.514  -22.714 -9.357  1.00 26.24 ? 3    LEU A C   1 
ATOM   14   O O   . LEU A 1 4   ? 17.539  -23.243 -9.788  1.00 25.97 ? 3    LEU A O   1 
ATOM   15   C CB  . LEU A 1 4   ? 16.495  -20.322 -8.608  1.00 25.98 ? 3    LEU A CB  1 
ATOM   16   C CG  . LEU A 1 4   ? 17.932  -20.480 -8.067  1.00 26.21 ? 3    LEU A CG  1 
ATOM   17   C CD1 . LEU A 1 4   ? 18.958  -19.908 -9.065  1.00 27.21 ? 3    LEU A CD1 1 
ATOM   18   C CD2 . LEU A 1 4   ? 18.118  -19.893 -6.667  1.00 26.84 ? 3    LEU A CD2 1 
ATOM   19   N N   . THR A 1 5   ? 15.672  -23.332 -8.536  1.00 26.74 ? 4    THR A N   1 
ATOM   20   C CA  . THR A 1 5   ? 15.957  -24.682 -8.051  1.00 26.80 ? 4    THR A CA  1 
ATOM   21   C C   . THR A 1 5   ? 15.849  -25.755 -9.149  1.00 27.01 ? 4    THR A C   1 
ATOM   22   O O   . THR A 1 5   ? 16.483  -26.811 -9.047  1.00 26.41 ? 4    THR A O   1 
ATOM   23   C CB  . THR A 1 5   ? 15.077  -25.020 -6.844  1.00 27.47 ? 4    THR A CB  1 
ATOM   24   O OG1 . THR A 1 5   ? 13.789  -24.428 -7.022  1.00 27.48 ? 4    THR A OG1 1 
ATOM   25   C CG2 . THR A 1 5   ? 15.605  -24.326 -5.580  1.00 27.44 ? 4    THR A CG2 1 
ATOM   26   N N   . ARG A 1 6   ? 15.066  -25.466 -10.189 1.00 26.87 ? 5    ARG A N   1 
ATOM   27   C CA  . ARG A 1 6   ? 14.896  -26.363 -11.339 1.00 27.33 ? 5    ARG A CA  1 
ATOM   28   C C   . ARG A 1 6   ? 16.010  -26.187 -12.377 1.00 27.00 ? 5    ARG A C   1 
ATOM   29   O O   . ARG A 1 6   ? 16.147  -26.990 -13.314 1.00 27.40 ? 5    ARG A O   1 
ATOM   30   C CB  . ARG A 1 6   ? 13.527  -26.145 -11.988 1.00 27.28 ? 5    ARG A CB  1 
ATOM   31   C CG  . ARG A 1 6   ? 12.396  -26.793 -11.211 1.00 30.89 ? 5    ARG A CG  1 
ATOM   32   C CD  . ARG A 1 6   ? 11.016  -26.534 -11.782 1.00 36.38 ? 5    ARG A CD  1 
ATOM   33   N NE  . ARG A 1 6   ? 10.347  -27.784 -12.134 1.00 41.46 ? 5    ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 6   ? 10.184  -28.223 -13.375 1.00 43.65 ? 5    ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 6   ? 10.645  -27.514 -14.404 1.00 45.69 ? 5    ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 6   ? 9.558   -29.373 -13.590 1.00 44.07 ? 5    ARG A NH2 1 
ATOM   37   N N   . ASN A 1 7   ? 16.809  -25.137 -12.201 1.00 26.09 ? 6    ASN A N   1 
ATOM   38   C CA  . ASN A 1 7   ? 17.903  -24.822 -13.107 1.00 25.40 ? 6    ASN A CA  1 
ATOM   39   C C   . ASN A 1 7   ? 19.106  -25.761 -12.904 1.00 24.96 ? 6    ASN A C   1 
ATOM   40   O O   . ASN A 1 7   ? 19.604  -25.900 -11.790 1.00 24.33 ? 6    ASN A O   1 
ATOM   41   C CB  . ASN A 1 7   ? 18.298  -23.346 -12.943 1.00 25.13 ? 6    ASN A CB  1 
ATOM   42   C CG  . ASN A 1 7   ? 19.305  -22.893 -13.984 1.00 24.49 ? 6    ASN A CG  1 
ATOM   43   O OD1 . ASN A 1 7   ? 20.478  -23.229 -13.887 1.00 23.52 ? 6    ASN A OD1 1 
ATOM   44   N ND2 . ASN A 1 7   ? 18.846  -22.149 -14.996 1.00 23.89 ? 6    ASN A ND2 1 
ATOM   45   N N   . PRO A 1 8   ? 19.551  -26.425 -13.978 1.00 24.95 ? 7    PRO A N   1 
ATOM   46   C CA  . PRO A 1 8   ? 20.636  -27.408 -13.885 1.00 25.09 ? 7    PRO A CA  1 
ATOM   47   C C   . PRO A 1 8   ? 21.988  -26.805 -13.481 1.00 25.25 ? 7    PRO A C   1 
ATOM   48   O O   . PRO A 1 8   ? 22.765  -27.481 -12.796 1.00 25.08 ? 7    PRO A O   1 
ATOM   49   C CB  . PRO A 1 8   ? 20.701  -28.003 -15.296 1.00 25.48 ? 7    PRO A CB  1 
ATOM   50   C CG  . PRO A 1 8   ? 20.102  -26.983 -16.185 1.00 25.59 ? 7    PRO A CG  1 
ATOM   51   C CD  . PRO A 1 8   ? 19.031  -26.304 -15.353 1.00 24.91 ? 7    PRO A CD  1 
ATOM   52   N N   . GLN A 1 9   ? 22.257  -25.566 -13.890 1.00 25.21 ? 8    GLN A N   1 
ATOM   53   C CA  . GLN A 1 9   ? 23.492  -24.885 -13.493 1.00 25.37 ? 8    GLN A CA  1 
ATOM   54   C C   . GLN A 1 9   ? 23.494  -24.556 -12.010 1.00 24.71 ? 8    GLN A C   1 
ATOM   55   O O   . GLN A 1 9   ? 24.541  -24.590 -11.370 1.00 24.44 ? 8    GLN A O   1 
ATOM   56   C CB  . GLN A 1 9   ? 23.746  -23.633 -14.332 1.00 25.59 ? 8    GLN A CB  1 
ATOM   57   C CG  . GLN A 1 9   ? 24.301  -23.943 -15.732 1.00 27.12 ? 8    GLN A CG  1 
ATOM   58   C CD  . GLN A 1 9   ? 23.322  -24.741 -16.575 1.00 27.78 ? 8    GLN A CD  1 
ATOM   59   O OE1 . GLN A 1 9   ? 23.568  -25.913 -16.877 1.00 30.45 ? 8    GLN A OE1 1 
ATOM   60   N NE2 . GLN A 1 9   ? 22.203  -24.122 -16.935 1.00 25.98 ? 8    GLN A NE2 1 
ATOM   61   N N   . PHE A 1 10  ? 22.319  -24.261 -11.459 1.00 24.82 ? 9    PHE A N   1 
ATOM   62   C CA  . PHE A 1 10  ? 22.217  -24.072 -10.019 1.00 24.43 ? 9    PHE A CA  1 
ATOM   63   C C   . PHE A 1 10  ? 22.395  -25.400 -9.289  1.00 24.98 ? 9    PHE A C   1 
ATOM   64   O O   . PHE A 1 10  ? 23.087  -25.475 -8.274  1.00 24.66 ? 9    PHE A O   1 
ATOM   65   C CB  . PHE A 1 10  ? 20.890  -23.409 -9.612  1.00 24.88 ? 9    PHE A CB  1 
ATOM   66   C CG  . PHE A 1 10  ? 20.717  -23.321 -8.131  1.00 24.34 ? 9    PHE A CG  1 
ATOM   67   C CD1 . PHE A 1 10  ? 21.440  -22.378 -7.387  1.00 25.43 ? 9    PHE A CD1 1 
ATOM   68   C CD2 . PHE A 1 10  ? 19.893  -24.227 -7.458  1.00 24.70 ? 9    PHE A CD2 1 
ATOM   69   C CE1 . PHE A 1 10  ? 21.312  -22.319 -5.999  1.00 24.74 ? 9    PHE A CE1 1 
ATOM   70   C CE2 . PHE A 1 10  ? 19.754  -24.169 -6.060  1.00 25.65 ? 9    PHE A CE2 1 
ATOM   71   C CZ  . PHE A 1 10  ? 20.464  -23.214 -5.334  1.00 25.01 ? 9    PHE A CZ  1 
ATOM   72   N N   . GLN A 1 11  ? 21.783  -26.456 -9.818  1.00 25.34 ? 10   GLN A N   1 
ATOM   73   C CA  . GLN A 1 11  ? 21.908  -27.778 -9.207  1.00 26.31 ? 10   GLN A CA  1 
ATOM   74   C C   . GLN A 1 11  ? 23.370  -28.221 -9.161  1.00 25.84 ? 10   GLN A C   1 
ATOM   75   O O   . GLN A 1 11  ? 23.807  -28.809 -8.177  1.00 26.85 ? 10   GLN A O   1 
ATOM   76   C CB  . GLN A 1 11  ? 21.046  -28.805 -9.942  1.00 26.50 ? 10   GLN A CB  1 
ATOM   77   C CG  . GLN A 1 11  ? 19.574  -28.437 -9.935  1.00 29.42 ? 10   GLN A CG  1 
ATOM   78   C CD  . GLN A 1 11  ? 18.724  -29.324 -10.816 1.00 32.92 ? 10   GLN A CD  1 
ATOM   79   O OE1 . GLN A 1 11  ? 19.244  -30.125 -11.603 1.00 34.50 ? 10   GLN A OE1 1 
ATOM   80   N NE2 . GLN A 1 11  ? 17.408  -29.175 -10.699 1.00 34.17 ? 10   GLN A NE2 1 
ATOM   81   N N   . LYS A 1 12  ? 24.108  -27.916 -10.222 1.00 25.77 ? 11   LYS A N   1 
ATOM   82   C CA  . LYS A 1 12  ? 25.536  -28.207 -10.305 1.00 25.43 ? 11   LYS A CA  1 
ATOM   83   C C   . LYS A 1 12  ? 26.317  -27.434 -9.245  1.00 25.01 ? 11   LYS A C   1 
ATOM   84   O O   . LYS A 1 12  ? 27.227  -27.969 -8.593  1.00 24.94 ? 11   LYS A O   1 
ATOM   85   C CB  . LYS A 1 12  ? 26.051  -27.860 -11.704 1.00 26.06 ? 11   LYS A CB  1 
ATOM   86   C CG  . LYS A 1 12  ? 27.508  -28.241 -11.936 1.00 27.31 ? 11   LYS A CG  1 
ATOM   87   C CD  . LYS A 1 12  ? 27.939  -27.892 -13.352 1.00 31.15 ? 11   LYS A CD  1 
ATOM   88   C CE  . LYS A 1 12  ? 29.389  -28.284 -13.579 1.00 32.98 ? 11   LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 12  ? 29.941  -27.647 -14.805 1.00 35.43 ? 11   LYS A NZ  1 
ATOM   90   N N   . LEU A 1 13  ? 25.951  -26.165 -9.075  1.00 24.02 ? 12   LEU A N   1 
ATOM   91   C CA  . LEU A 1 13  ? 26.620  -25.301 -8.111  1.00 22.97 ? 12   LEU A CA  1 
ATOM   92   C C   . LEU A 1 13  ? 26.373  -25.795 -6.693  1.00 22.77 ? 12   LEU A C   1 
ATOM   93   O O   . LEU A 1 13  ? 27.304  -25.875 -5.889  1.00 21.82 ? 12   LEU A O   1 
ATOM   94   C CB  . LEU A 1 13  ? 26.158  -23.852 -8.293  1.00 22.89 ? 12   LEU A CB  1 
ATOM   95   C CG  . LEU A 1 13  ? 26.740  -22.772 -7.367  1.00 22.38 ? 12   LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 13  ? 28.126  -22.310 -7.850  1.00 19.45 ? 12   LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 13  ? 25.775  -21.590 -7.278  1.00 20.70 ? 12   LEU A CD2 1 
ATOM   98   N N   . LEU A 1 14  ? 25.118  -26.136 -6.398  1.00 22.43 ? 13   LEU A N   1 
ATOM   99   C CA  . LEU A 1 14  ? 24.745  -26.618 -5.077  1.00 22.74 ? 13   LEU A CA  1 
ATOM   100  C C   . LEU A 1 14  ? 25.461  -27.927 -4.745  1.00 23.04 ? 13   LEU A C   1 
ATOM   101  O O   . LEU A 1 14  ? 25.959  -28.103 -3.645  1.00 22.95 ? 13   LEU A O   1 
ATOM   102  C CB  . LEU A 1 14  ? 23.237  -26.818 -4.991  1.00 22.58 ? 13   LEU A CB  1 
ATOM   103  C CG  . LEU A 1 14  ? 22.659  -27.192 -3.624  1.00 23.84 ? 13   LEU A CG  1 
ATOM   104  C CD1 . LEU A 1 14  ? 23.137  -26.236 -2.505  1.00 24.45 ? 13   LEU A CD1 1 
ATOM   105  C CD2 . LEU A 1 14  ? 21.147  -27.213 -3.727  1.00 24.39 ? 13   LEU A CD2 1 
ATOM   106  N N   . GLU A 1 15  ? 25.492  -28.836 -5.712  1.00 24.16 ? 14   GLU A N   1 
ATOM   107  C CA  . GLU A 1 15  ? 26.114  -30.129 -5.515  1.00 24.99 ? 14   GLU A CA  1 
ATOM   108  C C   . GLU A 1 15  ? 27.613  -29.951 -5.293  1.00 24.14 ? 14   GLU A C   1 
ATOM   109  O O   . GLU A 1 15  ? 28.178  -30.571 -4.399  1.00 24.39 ? 14   GLU A O   1 
ATOM   110  C CB  . GLU A 1 15  ? 25.803  -31.055 -6.709  1.00 25.68 ? 14   GLU A CB  1 
ATOM   111  C CG  . GLU A 1 15  ? 26.524  -32.404 -6.707  1.00 30.32 ? 14   GLU A CG  1 
ATOM   112  C CD  . GLU A 1 15  ? 26.445  -33.168 -5.391  1.00 35.70 ? 14   GLU A CD  1 
ATOM   113  O OE1 . GLU A 1 15  ? 25.429  -33.045 -4.659  1.00 37.05 ? 14   GLU A OE1 1 
ATOM   114  O OE2 . GLU A 1 15  ? 27.415  -33.906 -5.087  1.00 38.45 ? 14   GLU A OE2 1 
ATOM   115  N N   . TRP A 1 16  ? 28.236  -29.084 -6.088  1.00 23.45 ? 15   TRP A N   1 
ATOM   116  C CA  . TRP A 1 16  ? 29.648  -28.747 -5.907  1.00 23.64 ? 15   TRP A CA  1 
ATOM   117  C C   . TRP A 1 16  ? 29.889  -28.198 -4.503  1.00 23.04 ? 15   TRP A C   1 
ATOM   118  O O   . TRP A 1 16  ? 30.843  -28.595 -3.837  1.00 22.84 ? 15   TRP A O   1 
ATOM   119  C CB  . TRP A 1 16  ? 30.137  -27.750 -6.968  1.00 23.36 ? 15   TRP A CB  1 
ATOM   120  C CG  . TRP A 1 16  ? 31.642  -27.625 -6.979  1.00 24.81 ? 15   TRP A CG  1 
ATOM   121  C CD1 . TRP A 1 16  ? 32.510  -28.213 -7.864  1.00 25.94 ? 15   TRP A CD1 1 
ATOM   122  C CD2 . TRP A 1 16  ? 32.457  -26.881 -6.055  1.00 25.45 ? 15   TRP A CD2 1 
ATOM   123  N NE1 . TRP A 1 16  ? 33.807  -27.885 -7.544  1.00 26.52 ? 15   TRP A NE1 1 
ATOM   124  C CE2 . TRP A 1 16  ? 33.806  -27.066 -6.442  1.00 25.78 ? 15   TRP A CE2 1 
ATOM   125  C CE3 . TRP A 1 16  ? 32.182  -26.069 -4.937  1.00 24.30 ? 15   TRP A CE3 1 
ATOM   126  C CZ2 . TRP A 1 16  ? 34.875  -26.476 -5.755  1.00 25.88 ? 15   TRP A CZ2 1 
ATOM   127  C CZ3 . TRP A 1 16  ? 33.243  -25.488 -4.245  1.00 25.58 ? 15   TRP A CZ3 1 
ATOM   128  C CH2 . TRP A 1 16  ? 34.580  -25.687 -4.669  1.00 26.06 ? 15   TRP A CH2 1 
ATOM   129  N N   . HIS A 1 17  ? 29.033  -27.272 -4.063  1.00 22.74 ? 16   HIS A N   1 
ATOM   130  C CA  . HIS A 1 17  ? 29.128  -26.736 -2.709  1.00 23.00 ? 16   HIS A CA  1 
ATOM   131  C C   . HIS A 1 17  ? 29.074  -27.857 -1.662  1.00 23.53 ? 16   HIS A C   1 
ATOM   132  O O   . HIS A 1 17  ? 29.897  -27.906 -0.752  1.00 24.09 ? 16   HIS A O   1 
ATOM   133  C CB  . HIS A 1 17  ? 28.011  -25.707 -2.468  1.00 22.70 ? 16   HIS A CB  1 
ATOM   134  C CG  . HIS A 1 17  ? 27.944  -25.205 -1.061  1.00 22.34 ? 16   HIS A CG  1 
ATOM   135  N ND1 . HIS A 1 17  ? 28.605  -24.070 -0.642  1.00 22.99 ? 16   HIS A ND1 1 
ATOM   136  C CD2 . HIS A 1 17  ? 27.296  -25.683 0.024   1.00 21.74 ? 16   HIS A CD2 1 
ATOM   137  C CE1 . HIS A 1 17  ? 28.366  -23.871 0.640   1.00 20.48 ? 16   HIS A CE1 1 
ATOM   138  N NE2 . HIS A 1 17  ? 27.566  -24.831 1.068   1.00 24.28 ? 16   HIS A NE2 1 
ATOM   139  N N   . ARG A 1 18  ? 28.098  -28.756 -1.797  1.00 24.13 ? 17   ARG A N   1 
ATOM   140  C CA  . ARG A 1 18  ? 27.945  -29.887 -0.877  1.00 25.01 ? 17   ARG A CA  1 
ATOM   141  C C   . ARG A 1 18  ? 29.237  -30.725 -0.757  1.00 24.57 ? 17   ARG A C   1 
ATOM   142  O O   . ARG A 1 18  ? 29.676  -31.085 0.347   1.00 24.62 ? 17   ARG A O   1 
ATOM   143  C CB  . ARG A 1 18  ? 26.786  -30.786 -1.336  1.00 25.17 ? 17   ARG A CB  1 
ATOM   144  C CG  . ARG A 1 18  ? 25.381  -30.167 -1.259  1.00 29.46 ? 17   ARG A CG  1 
ATOM   145  C CD  . ARG A 1 18  ? 24.254  -31.199 -1.087  1.00 35.39 ? 17   ARG A CD  1 
ATOM   146  N NE  . ARG A 1 18  ? 22.917  -30.702 -1.448  1.00 38.99 ? 17   ARG A NE  1 
ATOM   147  C CZ  . ARG A 1 18  ? 22.327  -30.878 -2.637  1.00 40.83 ? 17   ARG A CZ  1 
ATOM   148  N NH1 . ARG A 1 18  ? 22.948  -31.517 -3.624  1.00 41.27 ? 17   ARG A NH1 1 
ATOM   149  N NH2 . ARG A 1 18  ? 21.104  -30.400 -2.846  1.00 42.55 ? 17   ARG A NH2 1 
ATOM   150  N N   . ALA A 1 19  ? 29.843  -31.007 -1.902  1.00 24.59 ? 18   ALA A N   1 
ATOM   151  C CA  . ALA A 1 19  ? 30.986  -31.918 -1.978  1.00 24.89 ? 18   ALA A CA  1 
ATOM   152  C C   . ALA A 1 19  ? 32.322  -31.284 -1.564  1.00 25.22 ? 18   ALA A C   1 
ATOM   153  O O   . ALA A 1 19  ? 33.220  -31.988 -1.100  1.00 25.49 ? 18   ALA A O   1 
ATOM   154  C CB  . ALA A 1 19  ? 31.093  -32.510 -3.403  1.00 24.66 ? 18   ALA A CB  1 
ATOM   155  N N   . ASN A 1 20  ? 32.447  -29.962 -1.714  1.00 25.33 ? 19   ASN A N   1 
ATOM   156  C CA  . ASN A 1 20  ? 33.774  -29.327 -1.773  1.00 25.48 ? 19   ASN A CA  1 
ATOM   157  C C   . ASN A 1 20  ? 33.966  -28.095 -0.915  1.00 25.62 ? 19   ASN A C   1 
ATOM   158  O O   . ASN A 1 20  ? 35.106  -27.726 -0.619  1.00 25.29 ? 19   ASN A O   1 
ATOM   159  C CB  . ASN A 1 20  ? 34.135  -28.929 -3.216  1.00 26.18 ? 19   ASN A CB  1 
ATOM   160  C CG  . ASN A 1 20  ? 34.175  -30.103 -4.161  1.00 26.78 ? 19   ASN A CG  1 
ATOM   161  O OD1 . ASN A 1 20  ? 33.319  -30.242 -5.032  1.00 28.48 ? 19   ASN A OD1 1 
ATOM   162  N ND2 . ASN A 1 20  ? 35.192  -30.946 -4.012  1.00 28.48 ? 19   ASN A ND2 1 
ATOM   163  N N   . SER A 1 21  ? 32.868  -27.451 -0.522  1.00 25.26 ? 20   SER A N   1 
ATOM   164  C CA  . SER A 1 21  ? 32.976  -26.155 0.158   1.00 25.77 ? 20   SER A CA  1 
ATOM   165  C C   . SER A 1 21  ? 33.663  -26.226 1.523   1.00 26.11 ? 20   SER A C   1 
ATOM   166  O O   . SER A 1 21  ? 34.355  -25.293 1.919   1.00 25.53 ? 20   SER A O   1 
ATOM   167  C CB  . SER A 1 21  ? 31.619  -25.455 0.242   1.00 25.20 ? 20   SER A CB  1 
ATOM   168  O OG  . SER A 1 21  ? 30.749  -26.114 1.141   1.00 25.97 ? 20   SER A OG  1 
ATOM   169  N N   . ALA A 1 22  ? 33.498  -27.350 2.218   1.00 26.85 ? 21   ALA A N   1 
ATOM   170  C CA  . ALA A 1 22  ? 34.183  -27.593 3.486   1.00 27.43 ? 21   ALA A CA  1 
ATOM   171  C C   . ALA A 1 22  ? 35.715  -27.499 3.374   1.00 28.02 ? 21   ALA A C   1 
ATOM   172  O O   . ALA A 1 22  ? 36.406  -27.271 4.375   1.00 28.53 ? 21   ALA A O   1 
ATOM   173  C CB  . ALA A 1 22  ? 33.782  -28.956 4.046   1.00 27.66 ? 21   ALA A CB  1 
ATOM   174  N N   . ASN A 1 23  ? 36.232  -27.684 2.163   1.00 27.93 ? 22   ASN A N   1 
ATOM   175  C CA  . ASN A 1 23  ? 37.676  -27.709 1.922   1.00 28.53 ? 22   ASN A CA  1 
ATOM   176  C C   . ASN A 1 23  ? 38.241  -26.336 1.535   1.00 28.26 ? 22   ASN A C   1 
ATOM   177  O O   . ASN A 1 23  ? 39.458  -26.180 1.392   1.00 28.65 ? 22   ASN A O   1 
ATOM   178  C CB  . ASN A 1 23  ? 38.026  -28.767 0.861   1.00 29.07 ? 22   ASN A CB  1 
ATOM   179  C CG  . ASN A 1 23  ? 37.497  -30.166 1.217   1.00 30.41 ? 22   ASN A CG  1 
ATOM   180  O OD1 . ASN A 1 23  ? 36.992  -30.891 0.355   1.00 31.72 ? 22   ASN A OD1 1 
ATOM   181  N ND2 . ASN A 1 23  ? 37.597  -30.532 2.488   1.00 31.62 ? 22   ASN A ND2 1 
ATOM   182  N N   . LEU A 1 24  ? 37.352  -25.346 1.383   1.00 27.12 ? 23   LEU A N   1 
ATOM   183  C CA  . LEU A 1 24  ? 37.754  -23.982 1.050   1.00 26.41 ? 23   LEU A CA  1 
ATOM   184  C C   . LEU A 1 24  ? 38.183  -23.265 2.321   1.00 25.76 ? 23   LEU A C   1 
ATOM   185  O O   . LEU A 1 24  ? 37.400  -23.111 3.254   1.00 25.33 ? 23   LEU A O   1 
ATOM   186  C CB  . LEU A 1 24  ? 36.624  -23.212 0.339   1.00 26.13 ? 23   LEU A CB  1 
ATOM   187  C CG  . LEU A 1 24  ? 36.181  -23.641 -1.067  1.00 27.84 ? 23   LEU A CG  1 
ATOM   188  C CD1 . LEU A 1 24  ? 34.901  -22.941 -1.521  1.00 27.72 ? 23   LEU A CD1 1 
ATOM   189  C CD2 . LEU A 1 24  ? 37.259  -23.455 -2.122  1.00 28.60 ? 23   LEU A CD2 1 
ATOM   190  N N   . LYS A 1 25  ? 39.446  -22.852 2.352   1.00 24.96 ? 24   LYS A N   1 
ATOM   191  C CA  . LYS A 1 25  ? 40.028  -22.202 3.513   1.00 24.62 ? 24   LYS A CA  1 
ATOM   192  C C   . LYS A 1 25  ? 40.791  -20.962 3.041   1.00 23.96 ? 24   LYS A C   1 
ATOM   193  O O   . LYS A 1 25  ? 41.778  -21.082 2.313   1.00 23.69 ? 24   LYS A O   1 
ATOM   194  C CB  . LYS A 1 25  ? 40.963  -23.174 4.248   1.00 24.96 ? 24   LYS A CB  1 
ATOM   195  C CG  . LYS A 1 25  ? 40.302  -24.488 4.686   1.00 27.87 ? 24   LYS A CG  1 
ATOM   196  C CD  . LYS A 1 25  ? 39.333  -24.249 5.850   1.00 30.60 ? 24   LYS A CD  1 
ATOM   197  C CE  . LYS A 1 25  ? 38.978  -25.537 6.596   1.00 34.69 ? 24   LYS A CE  1 
ATOM   198  N NZ  . LYS A 1 25  ? 38.068  -25.235 7.750   1.00 36.04 ? 24   LYS A NZ  1 
ATOM   199  N N   . LEU A 1 26  ? 40.325  -19.778 3.433   1.00 22.75 ? 25   LEU A N   1 
ATOM   200  C CA  . LEU A 1 26  ? 40.845  -18.545 2.841   1.00 22.16 ? 25   LEU A CA  1 
ATOM   201  C C   . LEU A 1 26  ? 42.346  -18.412 3.042   1.00 22.28 ? 25   LEU A C   1 
ATOM   202  O O   . LEU A 1 26  ? 43.074  -18.033 2.118   1.00 21.61 ? 25   LEU A O   1 
ATOM   203  C CB  . LEU A 1 26  ? 40.140  -17.314 3.422   1.00 21.99 ? 25   LEU A CB  1 
ATOM   204  C CG  . LEU A 1 26  ? 38.674  -17.149 3.029   1.00 22.53 ? 25   LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 26  ? 38.012  -16.051 3.867   1.00 22.67 ? 25   LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 26  ? 38.586  -16.873 1.549   1.00 23.72 ? 25   LEU A CD2 1 
ATOM   207  N N   . ARG A 1 27  ? 42.797  -18.709 4.253   1.00 22.31 ? 26   ARG A N   1 
ATOM   208  C CA  . ARG A 1 27  ? 44.214  -18.593 4.580   1.00 23.65 ? 26   ARG A CA  1 
ATOM   209  C C   . ARG A 1 27  ? 45.048  -19.406 3.597   1.00 23.80 ? 26   ARG A C   1 
ATOM   210  O O   . ARG A 1 27  ? 46.058  -18.937 3.086   1.00 24.02 ? 26   ARG A O   1 
ATOM   211  C CB  . ARG A 1 27  ? 44.465  -19.072 6.001   1.00 23.94 ? 26   ARG A CB  1 
ATOM   212  C CG  . ARG A 1 27  ? 45.488  -18.281 6.748   1.00 25.10 ? 26   ARG A CG  1 
ATOM   213  C CD  . ARG A 1 27  ? 45.733  -18.801 8.156   1.00 26.52 ? 26   ARG A CD  1 
ATOM   214  N NE  . ARG A 1 27  ? 47.012  -18.332 8.677   1.00 32.40 ? 26   ARG A NE  1 
ATOM   215  C CZ  . ARG A 1 27  ? 47.263  -18.093 9.963   1.00 33.70 ? 26   ARG A CZ  1 
ATOM   216  N NH1 . ARG A 1 27  ? 46.312  -18.256 10.877  1.00 32.78 ? 26   ARG A NH1 1 
ATOM   217  N NH2 . ARG A 1 27  ? 48.469  -17.661 10.326  1.00 33.66 ? 26   ARG A NH2 1 
ATOM   218  N N   . GLU A 1 28  ? 44.589  -20.622 3.326   1.00 24.27 ? 27   GLU A N   1 
ATOM   219  C CA  . GLU A 1 28  ? 45.275  -21.546 2.432   1.00 24.23 ? 27   GLU A CA  1 
ATOM   220  C C   . GLU A 1 28  ? 45.163  -21.117 0.967   1.00 23.47 ? 27   GLU A C   1 
ATOM   221  O O   . GLU A 1 28  ? 46.113  -21.245 0.218   1.00 23.89 ? 27   GLU A O   1 
ATOM   222  C CB  . GLU A 1 28  ? 44.729  -22.967 2.651   1.00 24.83 ? 27   GLU A CB  1 
ATOM   223  C CG  . GLU A 1 28  ? 44.526  -23.285 4.134   1.00 28.64 ? 27   GLU A CG  1 
ATOM   224  C CD  . GLU A 1 28  ? 44.558  -24.769 4.492   1.00 31.42 ? 27   GLU A CD  1 
ATOM   225  O OE1 . GLU A 1 28  ? 44.911  -25.081 5.651   1.00 34.44 ? 27   GLU A OE1 1 
ATOM   226  O OE2 . GLU A 1 28  ? 44.214  -25.621 3.648   1.00 35.12 ? 27   GLU A OE2 1 
ATOM   227  N N   . LEU A 1 29  ? 44.010  -20.577 0.566   1.00 22.51 ? 28   LEU A N   1 
ATOM   228  C CA  . LEU A 1 29  ? 43.835  -20.105 -0.804  1.00 21.79 ? 28   LEU A CA  1 
ATOM   229  C C   . LEU A 1 29  ? 44.849  -19.009 -1.124  1.00 20.79 ? 28   LEU A C   1 
ATOM   230  O O   . LEU A 1 29  ? 45.411  -18.963 -2.226  1.00 21.28 ? 28   LEU A O   1 
ATOM   231  C CB  . LEU A 1 29  ? 42.415  -19.569 -1.022  1.00 21.43 ? 28   LEU A CB  1 
ATOM   232  C CG  . LEU A 1 29  ? 41.308  -20.635 -0.957  1.00 23.26 ? 28   LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 29  ? 39.937  -20.011 -0.712  1.00 23.52 ? 28   LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 29  ? 41.280  -21.489 -2.229  1.00 24.64 ? 28   LEU A CD2 1 
ATOM   235  N N   . PHE A 1 30  ? 45.056  -18.124 -0.155  1.00 20.95 ? 29   PHE A N   1 
ATOM   236  C CA  . PHE A 1 30  ? 45.979  -17.016 -0.321  1.00 20.50 ? 29   PHE A CA  1 
ATOM   237  C C   . PHE A 1 30  ? 47.431  -17.502 -0.342  1.00 21.14 ? 29   PHE A C   1 
ATOM   238  O O   . PHE A 1 30  ? 48.187  -17.078 -1.196  1.00 20.15 ? 29   PHE A O   1 
ATOM   239  C CB  . PHE A 1 30  ? 45.749  -15.935 0.738   1.00 20.46 ? 29   PHE A CB  1 
ATOM   240  C CG  . PHE A 1 30  ? 44.699  -14.938 0.340   1.00 20.07 ? 29   PHE A CG  1 
ATOM   241  C CD1 . PHE A 1 30  ? 43.408  -15.030 0.856   1.00 20.69 ? 29   PHE A CD1 1 
ATOM   242  C CD2 . PHE A 1 30  ? 44.996  -13.917 -0.571  1.00 19.54 ? 29   PHE A CD2 1 
ATOM   243  C CE1 . PHE A 1 30  ? 42.416  -14.118 0.470   1.00 19.38 ? 29   PHE A CE1 1 
ATOM   244  C CE2 . PHE A 1 30  ? 44.005  -12.990 -0.959  1.00 20.31 ? 29   PHE A CE2 1 
ATOM   245  C CZ  . PHE A 1 30  ? 42.727  -13.097 -0.440  1.00 19.90 ? 29   PHE A CZ  1 
ATOM   246  N N   . GLU A 1 31  ? 47.789  -18.419 0.556   1.00 22.01 ? 30   GLU A N   1 
ATOM   247  C CA  . GLU A 1 31  ? 49.162  -18.960 0.584   1.00 23.51 ? 30   GLU A CA  1 
ATOM   248  C C   . GLU A 1 31  ? 49.557  -19.685 -0.698  1.00 23.95 ? 30   GLU A C   1 
ATOM   249  O O   . GLU A 1 31  ? 50.732  -19.656 -1.101  1.00 24.65 ? 30   GLU A O   1 
ATOM   250  C CB  . GLU A 1 31  ? 49.371  -19.914 1.765   1.00 23.45 ? 30   GLU A CB  1 
ATOM   251  C CG  . GLU A 1 31  ? 49.540  -19.232 3.114   1.00 26.62 ? 30   GLU A CG  1 
ATOM   252  C CD  . GLU A 1 31  ? 50.845  -18.467 3.278   1.00 28.03 ? 30   GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 31  ? 50.992  -17.806 4.331   1.00 32.69 ? 30   GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 31  ? 51.726  -18.499 2.386   1.00 28.74 ? 30   GLU A OE2 1 
ATOM   255  N N   . ALA A 1 32  ? 48.586  -20.333 -1.336  1.00 23.19 ? 31   ALA A N   1 
ATOM   256  C CA  . ALA A 1 32  ? 48.856  -21.183 -2.498  1.00 24.15 ? 31   ALA A CA  1 
ATOM   257  C C   . ALA A 1 32  ? 48.895  -20.392 -3.802  1.00 24.43 ? 31   ALA A C   1 
ATOM   258  O O   . ALA A 1 32  ? 49.358  -20.894 -4.830  1.00 24.75 ? 31   ALA A O   1 
ATOM   259  C CB  . ALA A 1 32  ? 47.804  -22.297 -2.585  1.00 24.18 ? 31   ALA A CB  1 
ATOM   260  N N   . ASP A 1 33  ? 48.391  -19.155 -3.764  1.00 24.86 ? 32   ASP A N   1 
ATOM   261  C CA  . ASP A 1 33  ? 48.193  -18.384 -4.979  1.00 25.05 ? 32   ASP A CA  1 
ATOM   262  C C   . ASP A 1 33  ? 48.523  -16.902 -4.752  1.00 24.91 ? 32   ASP A C   1 
ATOM   263  O O   . ASP A 1 33  ? 47.657  -16.142 -4.317  1.00 24.79 ? 32   ASP A O   1 
ATOM   264  C CB  . ASP A 1 33  ? 46.744  -18.577 -5.459  1.00 26.25 ? 32   ASP A CB  1 
ATOM   265  C CG  . ASP A 1 33  ? 46.388  -17.719 -6.652  1.00 28.01 ? 32   ASP A CG  1 
ATOM   266  O OD1 . ASP A 1 33  ? 47.291  -17.362 -7.437  1.00 29.60 ? 32   ASP A OD1 1 
ATOM   267  O OD2 . ASP A 1 33  ? 45.209  -17.345 -6.885  1.00 30.19 ? 32   ASP A OD2 1 
ATOM   268  N N   . PRO A 1 34  ? 49.773  -16.502 -5.021  1.00 23.85 ? 33   PRO A N   1 
ATOM   269  C CA  . PRO A 1 34  ? 50.178  -15.087 -4.936  1.00 23.75 ? 33   PRO A CA  1 
ATOM   270  C C   . PRO A 1 34  ? 49.437  -14.156 -5.900  1.00 23.50 ? 33   PRO A C   1 
ATOM   271  O O   . PRO A 1 34  ? 49.467  -12.932 -5.698  1.00 24.40 ? 33   PRO A O   1 
ATOM   272  C CB  . PRO A 1 34  ? 51.667  -15.135 -5.294  1.00 23.93 ? 33   PRO A CB  1 
ATOM   273  C CG  . PRO A 1 34  ? 52.091  -16.531 -4.909  1.00 24.53 ? 33   PRO A CG  1 
ATOM   274  C CD  . PRO A 1 34  ? 50.916  -17.379 -5.356  1.00 24.12 ? 33   PRO A CD  1 
ATOM   275  N N   . GLU A 1 35  ? 48.805  -14.711 -6.932  1.00 23.08 ? 34   GLU A N   1 
ATOM   276  C CA  . GLU A 1 35  ? 47.999  -13.928 -7.861  1.00 22.96 ? 34   GLU A CA  1 
ATOM   277  C C   . GLU A 1 35  ? 46.541  -13.746 -7.413  1.00 22.05 ? 34   GLU A C   1 
ATOM   278  O O   . GLU A 1 35  ? 45.740  -13.158 -8.147  1.00 22.20 ? 34   GLU A O   1 
ATOM   279  C CB  . GLU A 1 35  ? 48.021  -14.544 -9.265  1.00 23.87 ? 34   GLU A CB  1 
ATOM   280  C CG  . GLU A 1 35  ? 49.345  -14.375 -10.017 1.00 27.15 ? 34   GLU A CG  1 
ATOM   281  C CD  . GLU A 1 35  ? 49.707  -12.917 -10.229 1.00 31.57 ? 34   GLU A CD  1 
ATOM   282  O OE1 . GLU A 1 35  ? 48.865  -12.155 -10.752 1.00 34.26 ? 34   GLU A OE1 1 
ATOM   283  O OE2 . GLU A 1 35  ? 50.830  -12.528 -9.858  1.00 36.28 ? 34   GLU A OE2 1 
ATOM   284  N N   . ARG A 1 36  ? 46.194  -14.226 -6.220  1.00 21.32 ? 35   ARG A N   1 
ATOM   285  C CA  . ARG A 1 36  ? 44.782  -14.252 -5.836  1.00 20.82 ? 35   ARG A CA  1 
ATOM   286  C C   . ARG A 1 36  ? 44.135  -12.869 -5.929  1.00 20.65 ? 35   ARG A C   1 
ATOM   287  O O   . ARG A 1 36  ? 43.073  -12.739 -6.512  1.00 20.86 ? 35   ARG A O   1 
ATOM   288  C CB  . ARG A 1 36  ? 44.557  -14.857 -4.443  1.00 20.99 ? 35   ARG A CB  1 
ATOM   289  C CG  . ARG A 1 36  ? 43.069  -15.144 -4.165  1.00 20.03 ? 35   ARG A CG  1 
ATOM   290  C CD  . ARG A 1 36  ? 42.780  -15.926 -2.897  1.00 22.14 ? 35   ARG A CD  1 
ATOM   291  N NE  . ARG A 1 36  ? 41.339  -15.925 -2.635  1.00 19.97 ? 35   ARG A NE  1 
ATOM   292  C CZ  . ARG A 1 36  ? 40.470  -16.754 -3.187  1.00 21.13 ? 35   ARG A CZ  1 
ATOM   293  N NH1 . ARG A 1 36  ? 40.869  -17.680 -4.052  1.00 20.14 ? 35   ARG A NH1 1 
ATOM   294  N NH2 . ARG A 1 36  ? 39.175  -16.643 -2.885  1.00 20.53 ? 35   ARG A NH2 1 
ATOM   295  N N   . PHE A 1 37  ? 44.780  -11.843 -5.377  1.00 20.46 ? 36   PHE A N   1 
ATOM   296  C CA  . PHE A 1 37  ? 44.181  -10.504 -5.421  1.00 20.01 ? 36   PHE A CA  1 
ATOM   297  C C   . PHE A 1 37  ? 43.974  -10.057 -6.866  1.00 21.11 ? 36   PHE A C   1 
ATOM   298  O O   . PHE A 1 37  ? 42.885  -9.607  -7.235  1.00 20.59 ? 36   PHE A O   1 
ATOM   299  C CB  . PHE A 1 37  ? 45.032  -9.488  -4.643  1.00 19.85 ? 36   PHE A CB  1 
ATOM   300  C CG  . PHE A 1 37  ? 44.649  -8.046  -4.906  1.00 18.80 ? 36   PHE A CG  1 
ATOM   301  C CD1 . PHE A 1 37  ? 43.554  -7.467  -4.261  1.00 19.36 ? 36   PHE A CD1 1 
ATOM   302  C CD2 . PHE A 1 37  ? 45.373  -7.276  -5.824  1.00 21.31 ? 36   PHE A CD2 1 
ATOM   303  C CE1 . PHE A 1 37  ? 43.201  -6.116  -4.511  1.00 18.85 ? 36   PHE A CE1 1 
ATOM   304  C CE2 . PHE A 1 37  ? 45.032  -5.944  -6.087  1.00 21.42 ? 36   PHE A CE2 1 
ATOM   305  C CZ  . PHE A 1 37  ? 43.937  -5.360  -5.420  1.00 18.50 ? 36   PHE A CZ  1 
ATOM   306  N N   . ASN A 1 38  ? 45.019  -10.192 -7.685  1.00 21.46 ? 37   ASN A N   1 
ATOM   307  C CA  . ASN A 1 38  ? 44.952  -9.804  -9.095  1.00 23.39 ? 37   ASN A CA  1 
ATOM   308  C C   . ASN A 1 38  ? 43.825  -10.479 -9.864  1.00 23.46 ? 37   ASN A C   1 
ATOM   309  O O   . ASN A 1 38  ? 43.194  -9.857  -10.708 1.00 24.59 ? 37   ASN A O   1 
ATOM   310  C CB  . ASN A 1 38  ? 46.279  -10.099 -9.804  1.00 24.27 ? 37   ASN A CB  1 
ATOM   311  C CG  . ASN A 1 38  ? 47.395  -9.191  -9.361  1.00 26.52 ? 37   ASN A CG  1 
ATOM   312  O OD1 . ASN A 1 38  ? 48.584  -9.564  -9.416  1.00 31.54 ? 37   ASN A OD1 1 
ATOM   313  N ND2 . ASN A 1 38  ? 47.041  -7.990  -8.925  1.00 28.55 ? 37   ASN A ND2 1 
ATOM   314  N N   . ASN A 1 39  ? 43.572  -11.751 -9.565  1.00 23.34 ? 38   ASN A N   1 
ATOM   315  C CA  . ASN A 1 39  ? 42.580  -12.521 -10.294 1.00 23.80 ? 38   ASN A CA  1 
ATOM   316  C C   . ASN A 1 39  ? 41.148  -12.422 -9.755  1.00 22.93 ? 38   ASN A C   1 
ATOM   317  O O   . ASN A 1 39  ? 40.213  -12.847 -10.430 1.00 23.64 ? 38   ASN A O   1 
ATOM   318  C CB  . ASN A 1 39  ? 43.015  -13.990 -10.374 1.00 24.92 ? 38   ASN A CB  1 
ATOM   319  C CG  . ASN A 1 39  ? 44.298  -14.183 -11.178 1.00 26.35 ? 38   ASN A CG  1 
ATOM   320  O OD1 . ASN A 1 39  ? 44.949  -15.220 -11.064 1.00 31.23 ? 38   ASN A OD1 1 
ATOM   321  N ND2 . ASN A 1 39  ? 44.670  -13.186 -11.980 1.00 27.21 ? 38   ASN A ND2 1 
ATOM   322  N N   . PHE A 1 40  ? 40.985  -11.889 -8.541  1.00 21.73 ? 39   PHE A N   1 
ATOM   323  C CA  . PHE A 1 40  ? 39.656  -11.791 -7.922  1.00 20.60 ? 39   PHE A CA  1 
ATOM   324  C C   . PHE A 1 40  ? 39.349  -10.374 -7.442  1.00 20.31 ? 39   PHE A C   1 
ATOM   325  O O   . PHE A 1 40  ? 38.850  -10.169 -6.323  1.00 19.44 ? 39   PHE A O   1 
ATOM   326  C CB  . PHE A 1 40  ? 39.519  -12.775 -6.771  1.00 20.31 ? 39   PHE A CB  1 
ATOM   327  C CG  . PHE A 1 40  ? 39.568  -14.210 -7.201  1.00 20.82 ? 39   PHE A CG  1 
ATOM   328  C CD1 . PHE A 1 40  ? 40.778  -14.903 -7.220  1.00 22.85 ? 39   PHE A CD1 1 
ATOM   329  C CD2 . PHE A 1 40  ? 38.408  -14.862 -7.601  1.00 23.16 ? 39   PHE A CD2 1 
ATOM   330  C CE1 . PHE A 1 40  ? 40.832  -16.245 -7.630  1.00 23.56 ? 39   PHE A CE1 1 
ATOM   331  C CE2 . PHE A 1 40  ? 38.439  -16.197 -8.022  1.00 22.91 ? 39   PHE A CE2 1 
ATOM   332  C CZ  . PHE A 1 40  ? 39.660  -16.890 -8.032  1.00 22.26 ? 39   PHE A CZ  1 
ATOM   333  N N   . SER A 1 41  ? 39.659  -9.407  -8.298  1.00 19.89 ? 40   SER A N   1 
ATOM   334  C CA  . SER A 1 41  ? 39.396  -7.998  -8.002  1.00 20.55 ? 40   SER A CA  1 
ATOM   335  C C   . SER A 1 41  ? 39.176  -7.247  -9.308  1.00 20.41 ? 40   SER A C   1 
ATOM   336  O O   . SER A 1 41  ? 39.613  -7.694  -10.372 1.00 19.48 ? 40   SER A O   1 
ATOM   337  C CB  . SER A 1 41  ? 40.527  -7.380  -7.165  1.00 21.28 ? 40   SER A CB  1 
ATOM   338  O OG  . SER A 1 41  ? 41.741  -7.252  -7.914  1.00 23.13 ? 40   SER A OG  1 
ATOM   339  N N   . LEU A 1 42  ? 38.467  -6.126  -9.221  1.00 20.23 ? 41   LEU A N   1 
ATOM   340  C CA  . LEU A 1 42  ? 38.206  -5.275  -10.374 1.00 20.53 ? 41   LEU A CA  1 
ATOM   341  C C   . LEU A 1 42  ? 38.609  -3.859  -10.000 1.00 20.46 ? 41   LEU A C   1 
ATOM   342  O O   . LEU A 1 42  ? 38.161  -3.334  -8.984  1.00 20.53 ? 41   LEU A O   1 
ATOM   343  C CB  . LEU A 1 42  ? 36.719  -5.256  -10.738 1.00 20.39 ? 41   LEU A CB  1 
ATOM   344  C CG  . LEU A 1 42  ? 35.920  -6.484  -11.178 1.00 23.35 ? 41   LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 42  ? 34.469  -6.044  -11.414 1.00 24.89 ? 41   LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 42  ? 36.479  -7.147  -12.430 1.00 23.84 ? 41   LEU A CD2 1 
ATOM   347  N N   . ASN A 1 43  ? 39.463  -3.255  -10.813 1.00 19.64 ? 42   ASN A N   1 
ATOM   348  C CA  . ASN A 1 43  ? 39.883  -1.880  -10.601 1.00 20.42 ? 42   ASN A CA  1 
ATOM   349  C C   . ASN A 1 43  ? 39.260  -1.079  -11.726 1.00 20.65 ? 42   ASN A C   1 
ATOM   350  O O   . ASN A 1 43  ? 39.738  -1.121  -12.871 1.00 21.33 ? 42   ASN A O   1 
ATOM   351  C CB  . ASN A 1 43  ? 41.423  -1.792  -10.592 1.00 19.83 ? 42   ASN A CB  1 
ATOM   352  C CG  . ASN A 1 43  ? 41.942  -0.419  -10.171 1.00 21.59 ? 42   ASN A CG  1 
ATOM   353  O OD1 . ASN A 1 43  ? 41.326  0.619   -10.461 1.00 23.82 ? 42   ASN A OD1 1 
ATOM   354  N ND2 . ASN A 1 43  ? 43.081  -0.407  -9.502  1.00 24.37 ? 42   ASN A ND2 1 
ATOM   355  N N   . LEU A 1 44  ? 38.167  -0.385  -11.415 1.00 20.27 ? 43   LEU A N   1 
ATOM   356  C CA  . LEU A 1 44  ? 37.436  0.390   -12.414 1.00 19.34 ? 43   LEU A CA  1 
ATOM   357  C C   . LEU A 1 44  ? 37.922  1.826   -12.454 1.00 19.58 ? 43   LEU A C   1 
ATOM   358  O O   . LEU A 1 44  ? 37.973  2.496   -11.423 1.00 18.94 ? 43   LEU A O   1 
ATOM   359  C CB  . LEU A 1 44  ? 35.928  0.385   -12.117 1.00 19.51 ? 43   LEU A CB  1 
ATOM   360  C CG  . LEU A 1 44  ? 35.241  -0.974  -11.992 1.00 20.18 ? 43   LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 44  ? 33.778  -0.789  -11.622 1.00 22.98 ? 43   LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 44  ? 35.404  -1.778  -13.306 1.00 21.14 ? 43   LEU A CD2 1 
ATOM   363  N N   . ASN A 1 45  ? 38.288  2.293   -13.643 1.00 19.55 ? 44   ASN A N   1 
ATOM   364  C CA  . ASN A 1 45  ? 38.648  3.692   -13.820 1.00 20.35 ? 44   ASN A CA  1 
ATOM   365  C C   . ASN A 1 45  ? 37.478  4.426   -14.472 1.00 21.29 ? 44   ASN A C   1 
ATOM   366  O O   . ASN A 1 45  ? 37.160  4.186   -15.641 1.00 21.79 ? 44   ASN A O   1 
ATOM   367  C CB  . ASN A 1 45  ? 39.914  3.817   -14.672 1.00 20.26 ? 44   ASN A CB  1 
ATOM   368  C CG  . ASN A 1 45  ? 40.393  5.252   -14.796 1.00 22.19 ? 44   ASN A CG  1 
ATOM   369  O OD1 . ASN A 1 45  ? 39.764  6.189   -14.284 1.00 21.96 ? 44   ASN A OD1 1 
ATOM   370  N ND2 . ASN A 1 45  ? 41.517  5.436   -15.474 1.00 24.26 ? 44   ASN A ND2 1 
ATOM   371  N N   . THR A 1 46  ? 36.837  5.317   -13.721 1.00 21.70 ? 45   THR A N   1 
ATOM   372  C CA  . THR A 1 46  ? 35.667  6.036   -14.232 1.00 23.89 ? 45   THR A CA  1 
ATOM   373  C C   . THR A 1 46  ? 36.052  7.331   -14.918 1.00 22.65 ? 45   THR A C   1 
ATOM   374  O O   . THR A 1 46  ? 35.181  8.039   -15.414 1.00 21.71 ? 45   THR A O   1 
ATOM   375  C CB  . THR A 1 46  ? 34.700  6.435   -13.113 1.00 23.44 ? 45   THR A CB  1 
ATOM   376  O OG1 . THR A 1 46  ? 35.331  7.420   -12.273 1.00 27.70 ? 45   THR A OG1 1 
ATOM   377  C CG2 . THR A 1 46  ? 34.429  5.258   -12.173 1.00 27.14 ? 45   THR A CG2 1 
ATOM   378  N N   . ASN A 1 47  ? 37.342  7.653   -14.883 1.00 22.87 ? 46   ASN A N   1 
ATOM   379  C CA  . ASN A 1 47  ? 37.863  8.951   -15.335 1.00 23.50 ? 46   ASN A CA  1 
ATOM   380  C C   . ASN A 1 47  ? 37.586  10.106  -14.371 1.00 23.14 ? 46   ASN A C   1 
ATOM   381  O O   . ASN A 1 47  ? 38.024  11.248  -14.589 1.00 23.24 ? 46   ASN A O   1 
ATOM   382  C CB  . ASN A 1 47  ? 37.438  9.240   -16.786 1.00 24.07 ? 46   ASN A CB  1 
ATOM   383  C CG  . ASN A 1 47  ? 38.167  8.334   -17.790 1.00 28.36 ? 46   ASN A CG  1 
ATOM   384  O OD1 . ASN A 1 47  ? 38.847  7.374   -17.404 1.00 32.36 ? 46   ASN A OD1 1 
ATOM   385  N ND2 . ASN A 1 47  ? 38.036  8.640   -19.074 1.00 31.63 ? 46   ASN A ND2 1 
ATOM   386  N N   . HIS A 1 48  ? 36.885  9.796   -13.282 1.00 22.20 ? 47   HIS A N   1 
ATOM   387  C CA  . HIS A 1 48  ? 36.634  10.744  -12.210 1.00 22.21 ? 47   HIS A CA  1 
ATOM   388  C C   . HIS A 1 48  ? 36.920  10.059  -10.871 1.00 21.15 ? 47   HIS A C   1 
ATOM   389  O O   . HIS A 1 48  ? 36.269  10.311  -9.860  1.00 21.00 ? 47   HIS A O   1 
ATOM   390  C CB  . HIS A 1 48  ? 35.195  11.248  -12.303 1.00 22.79 ? 47   HIS A CB  1 
ATOM   391  C CG  . HIS A 1 48  ? 34.903  11.939  -13.597 1.00 24.86 ? 47   HIS A CG  1 
ATOM   392  N ND1 . HIS A 1 48  ? 35.394  13.194  -13.894 1.00 27.17 ? 47   HIS A ND1 1 
ATOM   393  C CD2 . HIS A 1 48  ? 34.233  11.526  -14.699 1.00 26.97 ? 47   HIS A CD2 1 
ATOM   394  C CE1 . HIS A 1 48  ? 35.005  13.541  -15.108 1.00 27.70 ? 47   HIS A CE1 1 
ATOM   395  N NE2 . HIS A 1 48  ? 34.299  12.547  -15.618 1.00 28.27 ? 47   HIS A NE2 1 
ATOM   396  N N   . GLY A 1 49  ? 37.908  9.175   -10.888 1.00 20.26 ? 48   GLY A N   1 
ATOM   397  C CA  . GLY A 1 49  ? 38.239  8.374   -9.715  1.00 18.86 ? 48   GLY A CA  1 
ATOM   398  C C   . GLY A 1 49  ? 38.159  6.886   -10.031 1.00 18.02 ? 48   GLY A C   1 
ATOM   399  O O   . GLY A 1 49  ? 37.527  6.471   -11.014 1.00 17.93 ? 48   GLY A O   1 
ATOM   400  N N   . HIS A 1 50  ? 38.836  6.090   -9.218  1.00 17.35 ? 49   HIS A N   1 
ATOM   401  C CA  . HIS A 1 50  ? 38.815  4.643   -9.370  1.00 17.72 ? 49   HIS A CA  1 
ATOM   402  C C   . HIS A 1 50  ? 37.945  4.018   -8.297  1.00 17.11 ? 49   HIS A C   1 
ATOM   403  O O   . HIS A 1 50  ? 37.878  4.497   -7.166  1.00 17.70 ? 49   HIS A O   1 
ATOM   404  C CB  . HIS A 1 50  ? 40.229  4.077   -9.230  1.00 17.52 ? 49   HIS A CB  1 
ATOM   405  C CG  . HIS A 1 50  ? 41.111  4.333   -10.417 1.00 20.02 ? 49   HIS A CG  1 
ATOM   406  N ND1 . HIS A 1 50  ? 41.623  3.314   -11.193 1.00 22.75 ? 49   HIS A ND1 1 
ATOM   407  C CD2 . HIS A 1 50  ? 41.556  5.486   -10.966 1.00 22.14 ? 49   HIS A CD2 1 
ATOM   408  C CE1 . HIS A 1 50  ? 42.354  3.831   -12.165 1.00 23.84 ? 49   HIS A CE1 1 
ATOM   409  N NE2 . HIS A 1 50  ? 42.330  5.148   -12.050 1.00 22.66 ? 49   HIS A NE2 1 
ATOM   410  N N   . ILE A 1 51  ? 37.302  2.922   -8.648  1.00 17.20 ? 50   ILE A N   1 
ATOM   411  C CA  . ILE A 1 51  ? 36.634  2.080   -7.666  1.00 17.00 ? 50   ILE A CA  1 
ATOM   412  C C   . ILE A 1 51  ? 37.237  0.683   -7.775  1.00 16.82 ? 50   ILE A C   1 
ATOM   413  O O   . ILE A 1 51  ? 37.169  0.049   -8.828  1.00 17.91 ? 50   ILE A O   1 
ATOM   414  C CB  . ILE A 1 51  ? 35.129  2.015   -7.953  1.00 16.60 ? 50   ILE A CB  1 
ATOM   415  C CG1 . ILE A 1 51  ? 34.526  3.421   -7.963  1.00 17.00 ? 50   ILE A CG1 1 
ATOM   416  C CG2 . ILE A 1 51  ? 34.433  1.118   -6.924  1.00 16.56 ? 50   ILE A CG2 1 
ATOM   417  C CD1 . ILE A 1 51  ? 33.155  3.495   -8.662  1.00 18.43 ? 50   ILE A CD1 1 
ATOM   418  N N   . LEU A 1 52  ? 37.830  0.221   -6.689  1.00 16.36 ? 51   LEU A N   1 
ATOM   419  C CA  . LEU A 1 52  ? 38.389  -1.128  -6.632  1.00 15.85 ? 51   LEU A CA  1 
ATOM   420  C C   . LEU A 1 52  ? 37.385  -2.010  -5.899  1.00 16.34 ? 51   LEU A C   1 
ATOM   421  O O   . LEU A 1 52  ? 37.033  -1.745  -4.728  1.00 15.22 ? 51   LEU A O   1 
ATOM   422  C CB  . LEU A 1 52  ? 39.732  -1.111  -5.898  1.00 15.50 ? 51   LEU A CB  1 
ATOM   423  C CG  . LEU A 1 52  ? 40.372  -2.448  -5.497  1.00 16.84 ? 51   LEU A CG  1 
ATOM   424  C CD1 . LEU A 1 52  ? 40.640  -3.347  -6.733  1.00 17.29 ? 51   LEU A CD1 1 
ATOM   425  C CD2 . LEU A 1 52  ? 41.662  -2.155  -4.803  1.00 18.31 ? 51   LEU A CD2 1 
ATOM   426  N N   . VAL A 1 53  ? 36.897  -3.039  -6.592  1.00 15.72 ? 52   VAL A N   1 
ATOM   427  C CA  . VAL A 1 53  ? 36.028  -4.026  -5.960  1.00 16.18 ? 52   VAL A CA  1 
ATOM   428  C C   . VAL A 1 53  ? 36.873  -5.293  -5.751  1.00 16.47 ? 52   VAL A C   1 
ATOM   429  O O   . VAL A 1 53  ? 37.161  -6.013  -6.690  1.00 17.06 ? 52   VAL A O   1 
ATOM   430  C CB  . VAL A 1 53  ? 34.785  -4.308  -6.814  1.00 17.06 ? 52   VAL A CB  1 
ATOM   431  C CG1 . VAL A 1 53  ? 33.847  -5.333  -6.110  1.00 16.05 ? 52   VAL A CG1 1 
ATOM   432  C CG2 . VAL A 1 53  ? 34.039  -2.999  -7.135  1.00 16.90 ? 52   VAL A CG2 1 
ATOM   433  N N   . ASP A 1 54  ? 37.315  -5.502  -4.524  1.00 16.23 ? 53   ASP A N   1 
ATOM   434  C CA  . ASP A 1 54  ? 38.235  -6.596  -4.223  1.00 17.00 ? 53   ASP A CA  1 
ATOM   435  C C   . ASP A 1 54  ? 37.396  -7.686  -3.601  1.00 16.61 ? 53   ASP A C   1 
ATOM   436  O O   . ASP A 1 54  ? 36.967  -7.568  -2.461  1.00 16.67 ? 53   ASP A O   1 
ATOM   437  C CB  . ASP A 1 54  ? 39.318  -6.115  -3.263  1.00 17.40 ? 53   ASP A CB  1 
ATOM   438  C CG  . ASP A 1 54  ? 40.196  -7.250  -2.738  1.00 17.05 ? 53   ASP A CG  1 
ATOM   439  O OD1 . ASP A 1 54  ? 40.049  -8.432  -3.168  1.00 17.70 ? 53   ASP A OD1 1 
ATOM   440  O OD2 . ASP A 1 54  ? 41.047  -7.047  -1.872  1.00 20.06 ? 53   ASP A OD2 1 
ATOM   441  N N   . TYR A 1 55  ? 37.149  -8.740  -4.369  1.00 16.47 ? 54   TYR A N   1 
ATOM   442  C CA  . TYR A 1 55  ? 36.356  -9.851  -3.879  1.00 16.93 ? 54   TYR A CA  1 
ATOM   443  C C   . TYR A 1 55  ? 37.219  -11.088 -3.607  1.00 16.48 ? 54   TYR A C   1 
ATOM   444  O O   . TYR A 1 55  ? 36.703  -12.193 -3.517  1.00 17.23 ? 54   TYR A O   1 
ATOM   445  C CB  . TYR A 1 55  ? 35.188  -10.162 -4.841  1.00 16.88 ? 54   TYR A CB  1 
ATOM   446  C CG  . TYR A 1 55  ? 35.566  -10.500 -6.276  1.00 17.51 ? 54   TYR A CG  1 
ATOM   447  C CD1 . TYR A 1 55  ? 35.674  -11.836 -6.684  1.00 18.55 ? 54   TYR A CD1 1 
ATOM   448  C CD2 . TYR A 1 55  ? 35.795  -9.505  -7.223  1.00 17.29 ? 54   TYR A CD2 1 
ATOM   449  C CE1 . TYR A 1 55  ? 36.007  -12.161 -8.003  1.00 19.37 ? 54   TYR A CE1 1 
ATOM   450  C CE2 . TYR A 1 55  ? 36.139  -9.820  -8.535  1.00 19.36 ? 54   TYR A CE2 1 
ATOM   451  C CZ  . TYR A 1 55  ? 36.240  -11.159 -8.917  1.00 21.04 ? 54   TYR A CZ  1 
ATOM   452  O OH  . TYR A 1 55  ? 36.564  -11.504 -10.224 1.00 22.26 ? 54   TYR A OH  1 
ATOM   453  N N   . SER A 1 56  ? 38.527  -10.891 -3.450  1.00 16.56 ? 55   SER A N   1 
ATOM   454  C CA  . SER A 1 56  ? 39.440  -12.028 -3.222  1.00 17.19 ? 55   SER A CA  1 
ATOM   455  C C   . SER A 1 56  ? 39.277  -12.758 -1.876  1.00 17.22 ? 55   SER A C   1 
ATOM   456  O O   . SER A 1 56  ? 39.526  -13.975 -1.789  1.00 17.39 ? 55   SER A O   1 
ATOM   457  C CB  . SER A 1 56  ? 40.902  -11.614 -3.446  1.00 17.26 ? 55   SER A CB  1 
ATOM   458  O OG  . SER A 1 56  ? 41.285  -10.611 -2.543  1.00 17.48 ? 55   SER A OG  1 
ATOM   459  N N   . LYS A 1 57  ? 38.864  -12.037 -0.830  1.00 16.41 ? 56   LYS A N   1 
ATOM   460  C CA  . LYS A 1 57  ? 38.639  -12.639 0.473   1.00 17.19 ? 56   LYS A CA  1 
ATOM   461  C C   . LYS A 1 57  ? 37.286  -13.345 0.569   1.00 17.19 ? 56   LYS A C   1 
ATOM   462  O O   . LYS A 1 57  ? 36.695  -13.415 1.633   1.00 18.11 ? 56   LYS A O   1 
ATOM   463  C CB  . LYS A 1 57  ? 38.760  -11.605 1.606   1.00 16.38 ? 56   LYS A CB  1 
ATOM   464  C CG  . LYS A 1 57  ? 40.124  -10.874 1.700   1.00 17.75 ? 56   LYS A CG  1 
ATOM   465  C CD  . LYS A 1 57  ? 40.365  -10.327 3.108   1.00 18.28 ? 56   LYS A CD  1 
ATOM   466  C CE  . LYS A 1 57  ? 41.536  -9.322  3.201   1.00 18.27 ? 56   LYS A CE  1 
ATOM   467  N NZ  . LYS A 1 57  ? 41.276  -8.091  2.392   1.00 18.96 ? 56   LYS A NZ  1 
ATOM   468  N N   . ASN A 1 58  ? 36.817  -13.892 -0.541  1.00 17.94 ? 57   ASN A N   1 
ATOM   469  C CA  . ASN A 1 58  ? 35.595  -14.681 -0.544  1.00 18.33 ? 57   ASN A CA  1 
ATOM   470  C C   . ASN A 1 58  ? 35.885  -16.169 -0.708  1.00 18.63 ? 57   ASN A C   1 
ATOM   471  O O   . ASN A 1 58  ? 36.933  -16.546 -1.245  1.00 17.20 ? 57   ASN A O   1 
ATOM   472  C CB  . ASN A 1 58  ? 34.686  -14.209 -1.658  1.00 18.18 ? 57   ASN A CB  1 
ATOM   473  C CG  . ASN A 1 58  ? 33.926  -12.952 -1.284  1.00 19.44 ? 57   ASN A CG  1 
ATOM   474  O OD1 . ASN A 1 58  ? 33.018  -12.999 -0.453  1.00 20.20 ? 57   ASN A OD1 1 
ATOM   475  N ND2 . ASN A 1 58  ? 34.299  -11.824 -1.882  1.00 18.60 ? 57   ASN A ND2 1 
ATOM   476  N N   . LEU A 1 59  ? 34.950  -17.001 -0.235  1.00 18.35 ? 58   LEU A N   1 
ATOM   477  C CA  . LEU A 1 59  ? 35.112  -18.466 -0.305  1.00 19.27 ? 58   LEU A CA  1 
ATOM   478  C C   . LEU A 1 59  ? 34.796  -18.991 -1.708  1.00 19.93 ? 58   LEU A C   1 
ATOM   479  O O   . LEU A 1 59  ? 33.779  -19.669 -1.949  1.00 20.45 ? 58   LEU A O   1 
ATOM   480  C CB  . LEU A 1 59  ? 34.271  -19.154 0.786   1.00 19.14 ? 58   LEU A CB  1 
ATOM   481  C CG  . LEU A 1 59  ? 34.783  -18.899 2.210   1.00 19.50 ? 58   LEU A CG  1 
ATOM   482  C CD1 . LEU A 1 59  ? 33.662  -19.019 3.216   1.00 20.40 ? 58   LEU A CD1 1 
ATOM   483  C CD2 . LEU A 1 59  ? 35.951  -19.837 2.592   1.00 20.07 ? 58   LEU A CD2 1 
ATOM   484  N N   . VAL A 1 60  ? 35.674  -18.645 -2.644  1.00 19.89 ? 59   VAL A N   1 
ATOM   485  C CA  . VAL A 1 60  ? 35.507  -18.988 -4.047  1.00 20.59 ? 59   VAL A CA  1 
ATOM   486  C C   . VAL A 1 60  ? 36.856  -19.322 -4.680  1.00 20.89 ? 59   VAL A C   1 
ATOM   487  O O   . VAL A 1 60  ? 37.912  -18.930 -4.173  1.00 21.07 ? 59   VAL A O   1 
ATOM   488  C CB  . VAL A 1 60  ? 34.824  -17.838 -4.868  1.00 20.47 ? 59   VAL A CB  1 
ATOM   489  C CG1 . VAL A 1 60  ? 33.389  -17.549 -4.361  1.00 19.96 ? 59   VAL A CG1 1 
ATOM   490  C CG2 . VAL A 1 60  ? 35.693  -16.549 -4.877  1.00 20.03 ? 59   VAL A CG2 1 
ATOM   491  N N   . ASN A 1 61  ? 36.810  -20.055 -5.786  1.00 22.15 ? 60   ASN A N   1 
ATOM   492  C CA  . ASN A 1 61  ? 37.970  -20.223 -6.657  1.00 22.11 ? 60   ASN A CA  1 
ATOM   493  C C   . ASN A 1 61  ? 37.524  -20.012 -8.082  1.00 22.43 ? 60   ASN A C   1 
ATOM   494  O O   . ASN A 1 61  ? 36.362  -19.647 -8.319  1.00 21.81 ? 60   ASN A O   1 
ATOM   495  C CB  . ASN A 1 61  ? 38.634  -21.598 -6.478  1.00 22.95 ? 60   ASN A CB  1 
ATOM   496  C CG  . ASN A 1 61  ? 37.656  -22.754 -6.628  1.00 22.99 ? 60   ASN A CG  1 
ATOM   497  O OD1 . ASN A 1 61  ? 36.608  -22.617 -7.250  1.00 22.83 ? 60   ASN A OD1 1 
ATOM   498  N ND2 . ASN A 1 61  ? 38.006  -23.905 -6.060  1.00 24.26 ? 60   ASN A ND2 1 
ATOM   499  N N   . LYS A 1 62  ? 38.438  -20.234 -9.028  1.00 22.37 ? 61   LYS A N   1 
ATOM   500  C CA  . LYS A 1 62  ? 38.127  -20.107 -10.441 1.00 22.88 ? 61   LYS A CA  1 
ATOM   501  C C   . LYS A 1 62  ? 36.873  -20.884 -10.828 1.00 22.93 ? 61   LYS A C   1 
ATOM   502  O O   . LYS A 1 62  ? 36.022  -20.349 -11.535 1.00 21.94 ? 61   LYS A O   1 
ATOM   503  C CB  . LYS A 1 62  ? 39.311  -20.578 -11.291 1.00 23.46 ? 61   LYS A CB  1 
ATOM   504  C CG  . LYS A 1 62  ? 39.077  -20.559 -12.802 1.00 25.60 ? 61   LYS A CG  1 
ATOM   505  C CD  . LYS A 1 62  ? 40.403  -20.666 -13.574 1.00 31.31 ? 61   LYS A CD  1 
ATOM   506  C CE  . LYS A 1 62  ? 41.026  -22.060 -13.458 1.00 34.51 ? 61   LYS A CE  1 
ATOM   507  N NZ  . LYS A 1 62  ? 42.060  -22.333 -14.533 1.00 36.91 ? 61   LYS A NZ  1 
ATOM   508  N N   . GLU A 1 63  ? 36.778  -22.137 -10.380 1.00 23.41 ? 62   GLU A N   1 
ATOM   509  C CA  . GLU A 1 63  ? 35.664  -23.018 -10.772 1.00 24.22 ? 62   GLU A CA  1 
ATOM   510  C C   . GLU A 1 63  ? 34.326  -22.482 -10.266 1.00 23.76 ? 62   GLU A C   1 
ATOM   511  O O   . GLU A 1 63  ? 33.330  -22.441 -11.011 1.00 23.53 ? 62   GLU A O   1 
ATOM   512  C CB  . GLU A 1 63  ? 35.879  -24.452 -10.267 1.00 25.49 ? 62   GLU A CB  1 
ATOM   513  C CG  . GLU A 1 63  ? 37.251  -25.041 -10.578 1.00 29.67 ? 62   GLU A CG  1 
ATOM   514  C CD  . GLU A 1 63  ? 38.206  -24.992 -9.388  1.00 34.30 ? 62   GLU A CD  1 
ATOM   515  O OE1 . GLU A 1 63  ? 38.232  -25.983 -8.611  1.00 34.80 ? 62   GLU A OE1 1 
ATOM   516  O OE2 . GLU A 1 63  ? 38.943  -23.974 -9.242  1.00 33.75 ? 62   GLU A OE2 1 
ATOM   517  N N   . VAL A 1 64  ? 34.311  -22.058 -9.003  1.00 23.08 ? 63   VAL A N   1 
ATOM   518  C CA  . VAL A 1 64  ? 33.105  -21.509 -8.398  1.00 22.58 ? 63   VAL A CA  1 
ATOM   519  C C   . VAL A 1 64  ? 32.623  -20.281 -9.181  1.00 22.22 ? 63   VAL A C   1 
ATOM   520  O O   . VAL A 1 64  ? 31.432  -20.153 -9.481  1.00 22.75 ? 63   VAL A O   1 
ATOM   521  C CB  . VAL A 1 64  ? 33.306  -21.157 -6.901  1.00 22.63 ? 63   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 64  ? 32.042  -20.505 -6.317  1.00 21.47 ? 63   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 64  ? 33.687  -22.400 -6.094  1.00 22.73 ? 63   VAL A CG2 1 
ATOM   524  N N   . MET A 1 65  ? 33.546  -19.392 -9.526  1.00 22.27 ? 64   MET A N   1 
ATOM   525  C CA  . MET A 1 65  ? 33.189  -18.192 -10.284 1.00 22.05 ? 64   MET A CA  1 
ATOM   526  C C   . MET A 1 65  ? 32.653  -18.542 -11.678 1.00 22.12 ? 64   MET A C   1 
ATOM   527  O O   . MET A 1 65  ? 31.677  -17.945 -12.139 1.00 21.83 ? 64   MET A O   1 
ATOM   528  C CB  . MET A 1 65  ? 34.381  -17.231 -10.373 1.00 22.59 ? 64   MET A CB  1 
ATOM   529  C CG  . MET A 1 65  ? 34.829  -16.615 -9.032  1.00 22.03 ? 64   MET A CG  1 
ATOM   530  S SD  . MET A 1 65  ? 33.504  -15.944 -7.985  1.00 21.51 ? 64   MET A SD  1 
ATOM   531  C CE  . MET A 1 65  ? 32.981  -14.530 -8.956  1.00 21.24 ? 64   MET A CE  1 
ATOM   532  N N   . GLN A 1 66  ? 33.283  -19.517 -12.337 1.00 21.64 ? 65   GLN A N   1 
ATOM   533  C CA  . GLN A 1 66  ? 32.793  -20.008 -13.628 1.00 22.79 ? 65   GLN A CA  1 
ATOM   534  C C   . GLN A 1 66  ? 31.360  -20.543 -13.491 1.00 21.91 ? 65   GLN A C   1 
ATOM   535  O O   . GLN A 1 66  ? 30.491  -20.200 -14.288 1.00 21.30 ? 65   GLN A O   1 
ATOM   536  C CB  . GLN A 1 66  ? 33.706  -21.112 -14.191 1.00 22.56 ? 65   GLN A CB  1 
ATOM   537  C CG  . GLN A 1 66  ? 34.946  -20.605 -14.944 1.00 27.40 ? 65   GLN A CG  1 
ATOM   538  C CD  . GLN A 1 66  ? 35.968  -21.717 -15.265 1.00 31.77 ? 65   GLN A CD  1 
ATOM   539  O OE1 . GLN A 1 66  ? 36.968  -21.459 -15.934 1.00 36.92 ? 65   GLN A OE1 1 
ATOM   540  N NE2 . GLN A 1 66  ? 35.722  -22.931 -14.777 1.00 33.74 ? 65   GLN A NE2 1 
ATOM   541  N N   . MET A 1 67  ? 31.113  -21.347 -12.464 1.00 22.49 ? 66   MET A N   1 
ATOM   542  C CA  . MET A 1 67  ? 29.775  -21.918 -12.259 1.00 22.68 ? 66   MET A CA  1 
ATOM   543  C C   . MET A 1 67  ? 28.738  -20.829 -11.995 1.00 22.59 ? 66   MET A C   1 
ATOM   544  O O   . MET A 1 67  ? 27.597  -20.904 -12.487 1.00 22.56 ? 66   MET A O   1 
ATOM   545  C CB  . MET A 1 67  ? 29.782  -22.931 -11.118 1.00 23.09 ? 66   MET A CB  1 
ATOM   546  C CG  . MET A 1 67  ? 30.364  -24.289 -11.518 1.00 25.18 ? 66   MET A CG  1 
ATOM   547  S SD  . MET A 1 67  ? 30.220  -25.509 -10.209 1.00 25.84 ? 66   MET A SD  1 
ATOM   548  C CE  . MET A 1 67  ? 31.497  -24.931 -9.084  1.00 27.85 ? 66   MET A CE  1 
ATOM   549  N N   . LEU A 1 68  ? 29.144  -19.812 -11.235 1.00 21.95 ? 67   LEU A N   1 
ATOM   550  C CA  . LEU A 1 68  ? 28.251  -18.695 -10.936 1.00 21.75 ? 67   LEU A CA  1 
ATOM   551  C C   . LEU A 1 68  ? 27.913  -17.894 -12.183 1.00 21.69 ? 67   LEU A C   1 
ATOM   552  O O   . LEU A 1 68  ? 26.748  -17.569 -12.428 1.00 21.22 ? 67   LEU A O   1 
ATOM   553  C CB  . LEU A 1 68  ? 28.851  -17.806 -9.848  1.00 21.14 ? 67   LEU A CB  1 
ATOM   554  C CG  . LEU A 1 68  ? 28.770  -18.364 -8.429  1.00 20.55 ? 67   LEU A CG  1 
ATOM   555  C CD1 . LEU A 1 68  ? 29.671  -17.531 -7.529  1.00 19.88 ? 67   LEU A CD1 1 
ATOM   556  C CD2 . LEU A 1 68  ? 27.339  -18.362 -7.885  1.00 19.89 ? 67   LEU A CD2 1 
ATOM   557  N N   . VAL A 1 69  ? 28.931  -17.582 -12.977 1.00 22.49 ? 68   VAL A N   1 
ATOM   558  C CA  . VAL A 1 69  ? 28.714  -16.925 -14.259 1.00 23.39 ? 68   VAL A CA  1 
ATOM   559  C C   . VAL A 1 69  ? 27.822  -17.751 -15.202 1.00 24.07 ? 68   VAL A C   1 
ATOM   560  O O   . VAL A 1 69  ? 26.935  -17.183 -15.844 1.00 23.84 ? 68   VAL A O   1 
ATOM   561  C CB  . VAL A 1 69  ? 30.035  -16.511 -14.936 1.00 23.52 ? 68   VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 69  ? 29.760  -15.955 -16.323 1.00 24.54 ? 68   VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 69  ? 30.752  -15.463 -14.083 1.00 23.18 ? 68   VAL A CG2 1 
ATOM   564  N N   . GLU A 1 70  ? 28.035  -19.072 -15.260 1.00 24.40 ? 69   GLU A N   1 
ATOM   565  C CA  . GLU A 1 70  ? 27.174  -19.960 -16.073 1.00 25.29 ? 69   GLU A CA  1 
ATOM   566  C C   . GLU A 1 70  ? 25.718  -19.874 -15.642 1.00 24.38 ? 69   GLU A C   1 
ATOM   567  O O   . GLU A 1 70  ? 24.808  -19.899 -16.482 1.00 24.88 ? 69   GLU A O   1 
ATOM   568  C CB  . GLU A 1 70  ? 27.601  -21.430 -15.982 1.00 25.90 ? 69   GLU A CB  1 
ATOM   569  C CG  . GLU A 1 70  ? 29.098  -21.672 -16.009 1.00 31.35 ? 69   GLU A CG  1 
ATOM   570  C CD  . GLU A 1 70  ? 29.643  -21.853 -17.403 1.00 36.92 ? 69   GLU A CD  1 
ATOM   571  O OE1 . GLU A 1 70  ? 30.305  -22.894 -17.639 1.00 39.78 ? 69   GLU A OE1 1 
ATOM   572  O OE2 . GLU A 1 70  ? 29.418  -20.954 -18.253 1.00 39.13 ? 69   GLU A OE2 1 
ATOM   573  N N   . LEU A 1 71  ? 25.509  -19.777 -14.327 1.00 23.09 ? 70   LEU A N   1 
ATOM   574  C CA  . LEU A 1 71  ? 24.167  -19.680 -13.769 1.00 22.46 ? 70   LEU A CA  1 
ATOM   575  C C   . LEU A 1 71  ? 23.478  -18.373 -14.187 1.00 21.80 ? 70   LEU A C   1 
ATOM   576  O O   . LEU A 1 71  ? 22.304  -18.378 -14.552 1.00 21.96 ? 70   LEU A O   1 
ATOM   577  C CB  . LEU A 1 71  ? 24.200  -19.853 -12.246 1.00 22.04 ? 70   LEU A CB  1 
ATOM   578  C CG  . LEU A 1 71  ? 22.864  -19.732 -11.506 1.00 22.91 ? 70   LEU A CG  1 
ATOM   579  C CD1 . LEU A 1 71  ? 21.839  -20.733 -12.082 1.00 24.18 ? 70   LEU A CD1 1 
ATOM   580  C CD2 . LEU A 1 71  ? 23.038  -19.930 -9.997  1.00 21.71 ? 70   LEU A CD2 1 
ATOM   581  N N   . ALA A 1 72  ? 24.219  -17.263 -14.163 1.00 21.94 ? 71   ALA A N   1 
ATOM   582  C CA  . ALA A 1 72  ? 23.676  -15.960 -14.553 1.00 22.03 ? 71   ALA A CA  1 
ATOM   583  C C   . ALA A 1 72  ? 23.244  -15.978 -16.016 1.00 22.47 ? 71   ALA A C   1 
ATOM   584  O O   . ALA A 1 72  ? 22.177  -15.480 -16.355 1.00 22.66 ? 71   ALA A O   1 
ATOM   585  C CB  . ALA A 1 72  ? 24.702  -14.828 -14.298 1.00 22.28 ? 71   ALA A CB  1 
ATOM   586  N N   . LYS A 1 73  ? 24.084  -16.560 -16.869 1.00 23.12 ? 72   LYS A N   1 
ATOM   587  C CA  . LYS A 1 73  ? 23.747  -16.770 -18.276 1.00 24.03 ? 72   LYS A CA  1 
ATOM   588  C C   . LYS A 1 73  ? 22.487  -17.606 -18.452 1.00 23.60 ? 72   LYS A C   1 
ATOM   589  O O   . LYS A 1 73  ? 21.587  -17.209 -19.186 1.00 23.78 ? 72   LYS A O   1 
ATOM   590  C CB  . LYS A 1 73  ? 24.929  -17.382 -19.040 1.00 24.36 ? 72   LYS A CB  1 
ATOM   591  C CG  . LYS A 1 73  ? 26.047  -16.377 -19.266 1.00 26.44 ? 72   LYS A CG  1 
ATOM   592  C CD  . LYS A 1 73  ? 27.347  -17.012 -19.704 1.00 30.31 ? 72   LYS A CD  1 
ATOM   593  C CE  . LYS A 1 73  ? 28.435  -15.952 -19.827 1.00 32.37 ? 72   LYS A CE  1 
ATOM   594  N NZ  . LYS A 1 73  ? 29.386  -16.211 -20.963 1.00 33.81 ? 72   LYS A NZ  1 
ATOM   595  N N   . SER A 1 74  ? 22.428  -18.753 -17.778 1.00 24.23 ? 73   SER A N   1 
ATOM   596  C CA  . SER A 1 74  ? 21.288  -19.666 -17.869 1.00 23.75 ? 73   SER A CA  1 
ATOM   597  C C   . SER A 1 74  ? 19.983  -19.082 -17.284 1.00 24.28 ? 73   SER A C   1 
ATOM   598  O O   . SER A 1 74  ? 18.876  -19.470 -17.690 1.00 24.49 ? 73   SER A O   1 
ATOM   599  C CB  . SER A 1 74  ? 21.657  -21.047 -17.276 1.00 24.26 ? 73   SER A CB  1 
ATOM   600  O OG  A SER A 1 74  ? 21.431  -21.160 -15.881 0.50 23.71 ? 73   SER A OG  1 
ATOM   601  O OG  B SER A 1 74  ? 20.523  -21.875 -17.143 0.50 22.82 ? 73   SER A OG  1 
ATOM   602  N N   . ARG A 1 75  ? 20.118  -18.125 -16.358 1.00 23.52 ? 74   ARG A N   1 
ATOM   603  C CA  . ARG A 1 75  ? 18.957  -17.464 -15.758 1.00 22.89 ? 74   ARG A CA  1 
ATOM   604  C C   . ARG A 1 75  ? 18.522  -16.211 -16.539 1.00 22.64 ? 74   ARG A C   1 
ATOM   605  O O   . ARG A 1 75  ? 17.537  -15.546 -16.189 1.00 23.03 ? 74   ARG A O   1 
ATOM   606  C CB  . ARG A 1 75  ? 19.220  -17.166 -14.272 1.00 22.40 ? 74   ARG A CB  1 
ATOM   607  C CG  . ARG A 1 75  ? 19.307  -18.421 -13.402 1.00 22.38 ? 74   ARG A CG  1 
ATOM   608  C CD  . ARG A 1 75  ? 17.953  -19.138 -13.190 1.00 24.09 ? 74   ARG A CD  1 
ATOM   609  N NE  . ARG A 1 75  ? 16.930  -18.140 -12.893 1.00 22.51 ? 74   ARG A NE  1 
ATOM   610  C CZ  . ARG A 1 75  ? 15.823  -17.919 -13.591 1.00 23.92 ? 74   ARG A CZ  1 
ATOM   611  N NH1 . ARG A 1 75  ? 15.514  -18.659 -14.661 1.00 22.39 ? 74   ARG A NH1 1 
ATOM   612  N NH2 . ARG A 1 75  ? 15.017  -16.931 -13.205 1.00 23.92 ? 74   ARG A NH2 1 
ATOM   613  N N   . GLY A 1 76  ? 19.247  -15.919 -17.617 1.00 22.32 ? 75   GLY A N   1 
ATOM   614  C CA  . GLY A 1 76  ? 18.850  -14.897 -18.569 1.00 22.32 ? 75   GLY A CA  1 
ATOM   615  C C   . GLY A 1 76  ? 19.097  -13.482 -18.079 1.00 22.44 ? 75   GLY A C   1 
ATOM   616  O O   . GLY A 1 76  ? 18.337  -12.569 -18.413 1.00 22.58 ? 75   GLY A O   1 
ATOM   617  N N   . VAL A 1 77  ? 20.172  -13.291 -17.317 1.00 22.84 ? 76   VAL A N   1 
ATOM   618  C CA  . VAL A 1 77  ? 20.463  -11.972 -16.704 1.00 22.93 ? 76   VAL A CA  1 
ATOM   619  C C   . VAL A 1 77  ? 20.613  -10.858 -17.750 1.00 23.22 ? 76   VAL A C   1 
ATOM   620  O O   . VAL A 1 77  ? 20.050  -9.760  -17.602 1.00 22.68 ? 76   VAL A O   1 
ATOM   621  C CB  . VAL A 1 77  ? 21.686  -12.041 -15.741 1.00 22.71 ? 76   VAL A CB  1 
ATOM   622  C CG1 . VAL A 1 77  ? 22.192  -10.629 -15.325 1.00 23.74 ? 76   VAL A CG1 1 
ATOM   623  C CG2 . VAL A 1 77  ? 21.321  -12.803 -14.499 1.00 23.28 ? 76   VAL A CG2 1 
ATOM   624  N N   . GLU A 1 78  ? 21.324  -11.160 -18.833 1.00 23.33 ? 77   GLU A N   1 
ATOM   625  C CA  . GLU A 1 78  ? 21.654  -10.150 -19.827 1.00 23.39 ? 77   GLU A CA  1 
ATOM   626  C C   . GLU A 1 78  ? 20.448  -9.663  -20.620 1.00 22.85 ? 77   GLU A C   1 
ATOM   627  O O   . GLU A 1 78  ? 20.300  -8.470  -20.853 1.00 22.22 ? 77   GLU A O   1 
ATOM   628  C CB  . GLU A 1 78  ? 22.746  -10.651 -20.765 1.00 24.24 ? 77   GLU A CB  1 
ATOM   629  C CG  . GLU A 1 78  ? 24.120  -10.632 -20.120 1.00 25.88 ? 77   GLU A CG  1 
ATOM   630  C CD  . GLU A 1 78  ? 25.182  -11.258 -20.992 1.00 29.19 ? 77   GLU A CD  1 
ATOM   631  O OE1 . GLU A 1 78  ? 26.143  -10.550 -21.336 1.00 31.73 ? 77   GLU A OE1 1 
ATOM   632  O OE2 . GLU A 1 78  ? 25.059  -12.454 -21.329 1.00 28.61 ? 77   GLU A OE2 1 
ATOM   633  N N   . ALA A 1 79  ? 19.585  -10.594 -21.016 1.00 21.64 ? 78   ALA A N   1 
ATOM   634  C CA  . ALA A 1 79  ? 18.349  -10.249 -21.711 1.00 21.32 ? 78   ALA A CA  1 
ATOM   635  C C   . ALA A 1 79  ? 17.409  -9.458  -20.809 1.00 20.60 ? 78   ALA A C   1 
ATOM   636  O O   . ALA A 1 79  ? 16.746  -8.521  -21.262 1.00 20.49 ? 78   ALA A O   1 
ATOM   637  C CB  . ALA A 1 79  ? 17.667  -11.506 -22.215 1.00 20.82 ? 78   ALA A CB  1 
ATOM   638  N N   . ALA A 1 80  ? 17.344  -9.831  -19.533 1.00 20.97 ? 79   ALA A N   1 
ATOM   639  C CA  . ALA A 1 80  ? 16.478  -9.119  -18.599 1.00 20.80 ? 79   ALA A CA  1 
ATOM   640  C C   . ALA A 1 80  ? 16.980  -7.694  -18.400 1.00 21.19 ? 79   ALA A C   1 
ATOM   641  O O   . ALA A 1 80  ? 16.205  -6.734  -18.369 1.00 21.12 ? 79   ALA A O   1 
ATOM   642  C CB  . ALA A 1 80  ? 16.419  -9.840  -17.281 1.00 21.47 ? 79   ALA A CB  1 
ATOM   643  N N   . ARG A 1 81  ? 18.291  -7.574  -18.261 1.00 21.82 ? 80   ARG A N   1 
ATOM   644  C CA  . ARG A 1 81  ? 18.920  -6.263  -18.139 1.00 22.20 ? 80   ARG A CA  1 
ATOM   645  C C   . ARG A 1 81  ? 18.616  -5.349  -19.326 1.00 22.77 ? 80   ARG A C   1 
ATOM   646  O O   . ARG A 1 81  ? 18.196  -4.208  -19.131 1.00 22.52 ? 80   ARG A O   1 
ATOM   647  C CB  . ARG A 1 81  ? 20.423  -6.426  -17.952 1.00 22.01 ? 80   ARG A CB  1 
ATOM   648  C CG  . ARG A 1 81  ? 21.184  -5.104  -17.944 1.00 21.85 ? 80   ARG A CG  1 
ATOM   649  C CD  . ARG A 1 81  ? 22.647  -5.254  -18.281 1.00 21.92 ? 80   ARG A CD  1 
ATOM   650  N NE  . ARG A 1 81  ? 22.830  -5.832  -19.608 1.00 23.78 ? 80   ARG A NE  1 
ATOM   651  C CZ  . ARG A 1 81  ? 23.893  -6.545  -19.991 1.00 25.23 ? 80   ARG A CZ  1 
ATOM   652  N NH1 . ARG A 1 81  ? 24.911  -6.768  -19.156 1.00 22.80 ? 80   ARG A NH1 1 
ATOM   653  N NH2 . ARG A 1 81  ? 23.928  -7.044  -21.228 1.00 26.68 ? 80   ARG A NH2 1 
ATOM   654  N N   . ASP A 1 82  ? 18.845  -5.842  -20.551 1.00 23.68 ? 81   ASP A N   1 
ATOM   655  C CA  . ASP A 1 82  ? 18.530  -5.081  -21.770 1.00 24.62 ? 81   ASP A CA  1 
ATOM   656  C C   . ASP A 1 82  ? 17.055  -4.661  -21.824 1.00 24.36 ? 81   ASP A C   1 
ATOM   657  O O   . ASP A 1 82  ? 16.740  -3.532  -22.213 1.00 24.61 ? 81   ASP A O   1 
ATOM   658  C CB  . ASP A 1 82  ? 18.909  -5.871  -23.035 1.00 25.15 ? 81   ASP A CB  1 
ATOM   659  C CG  . ASP A 1 82  ? 20.390  -6.236  -23.090 1.00 26.36 ? 81   ASP A CG  1 
ATOM   660  O OD1 . ASP A 1 82  ? 21.192  -5.721  -22.280 1.00 26.35 ? 81   ASP A OD1 1 
ATOM   661  O OD2 . ASP A 1 82  ? 20.843  -7.060  -23.916 1.00 28.60 ? 81   ASP A OD2 1 
ATOM   662  N N   . ASN A 1 83  ? 16.159  -5.561  -21.406 1.00 24.29 ? 82   ASN A N   1 
ATOM   663  C CA  . ASN A 1 83  ? 14.732  -5.242  -21.309 1.00 24.35 ? 82   ASN A CA  1 
ATOM   664  C C   . ASN A 1 83  ? 14.429  -4.098  -20.329 1.00 23.92 ? 82   ASN A C   1 
ATOM   665  O O   . ASN A 1 83  ? 13.626  -3.214  -20.633 1.00 24.23 ? 82   ASN A O   1 
ATOM   666  C CB  . ASN A 1 83  ? 13.923  -6.493  -20.947 1.00 24.87 ? 82   ASN A CB  1 
ATOM   667  C CG  . ASN A 1 83  ? 13.796  -7.462  -22.117 1.00 27.63 ? 82   ASN A CG  1 
ATOM   668  O OD1 . ASN A 1 83  ? 13.707  -8.673  -21.929 1.00 31.49 ? 82   ASN A OD1 1 
ATOM   669  N ND2 . ASN A 1 83  ? 13.776  -6.929  -23.321 1.00 28.64 ? 82   ASN A ND2 1 
ATOM   670  N N   . MET A 1 84  ? 15.064  -4.115  -19.157 1.00 23.22 ? 83   MET A N   1 
ATOM   671  C CA  . MET A 1 84  ? 14.972  -2.968  -18.251 1.00 22.73 ? 83   MET A CA  1 
ATOM   672  C C   . MET A 1 84  ? 15.390  -1.679  -18.976 1.00 22.40 ? 83   MET A C   1 
ATOM   673  O O   . MET A 1 84  ? 14.639  -0.697  -18.994 1.00 21.68 ? 83   MET A O   1 
ATOM   674  C CB  . MET A 1 84  ? 15.820  -3.168  -16.990 1.00 22.67 ? 83   MET A CB  1 
ATOM   675  C CG  . MET A 1 84  ? 15.818  -1.924  -16.053 1.00 22.55 ? 83   MET A CG  1 
ATOM   676  S SD  . MET A 1 84  ? 16.484  -2.196  -14.397 1.00 22.79 ? 83   MET A SD  1 
ATOM   677  C CE  . MET A 1 84  ? 18.231  -2.124  -14.767 1.00 22.15 ? 83   MET A CE  1 
ATOM   678  N N   . PHE A 1 85  ? 16.581  -1.696  -19.576 1.00 22.17 ? 84   PHE A N   1 
ATOM   679  C CA  . PHE A 1 85  ? 17.162  -0.486  -20.163 1.00 22.91 ? 84   PHE A CA  1 
ATOM   680  C C   . PHE A 1 85  ? 16.363  0.044   -21.347 1.00 23.36 ? 84   PHE A C   1 
ATOM   681  O O   . PHE A 1 85  ? 16.439  1.229   -21.655 1.00 24.31 ? 84   PHE A O   1 
ATOM   682  C CB  . PHE A 1 85  ? 18.618  -0.704  -20.603 1.00 22.65 ? 84   PHE A CB  1 
ATOM   683  C CG  . PHE A 1 85  ? 19.635  -0.530  -19.507 1.00 22.34 ? 84   PHE A CG  1 
ATOM   684  C CD1 . PHE A 1 85  ? 19.781  -1.489  -18.502 1.00 22.20 ? 84   PHE A CD1 1 
ATOM   685  C CD2 . PHE A 1 85  ? 20.501  0.572   -19.512 1.00 23.22 ? 84   PHE A CD2 1 
ATOM   686  C CE1 . PHE A 1 85  ? 20.747  -1.342  -17.514 1.00 22.49 ? 84   PHE A CE1 1 
ATOM   687  C CE2 . PHE A 1 85  ? 21.474  0.725   -18.518 1.00 22.26 ? 84   PHE A CE2 1 
ATOM   688  C CZ  . PHE A 1 85  ? 21.598  -0.223  -17.519 1.00 21.97 ? 84   PHE A CZ  1 
ATOM   689  N N   . SER A 1 86  ? 15.611  -0.825  -22.023 1.00 23.63 ? 85   SER A N   1 
ATOM   690  C CA  . SER A 1 86  ? 14.895  -0.386  -23.221 1.00 24.23 ? 85   SER A CA  1 
ATOM   691  C C   . SER A 1 86  ? 13.442  -0.005  -22.947 1.00 23.75 ? 85   SER A C   1 
ATOM   692  O O   . SER A 1 86  ? 12.715  0.368   -23.864 1.00 24.25 ? 85   SER A O   1 
ATOM   693  C CB  . SER A 1 86  ? 14.989  -1.439  -24.336 1.00 24.60 ? 85   SER A CB  1 
ATOM   694  O OG  . SER A 1 86  ? 14.356  -2.645  -23.948 1.00 26.64 ? 85   SER A OG  1 
ATOM   695  N N   . GLY A 1 87  ? 13.020  -0.096  -21.686 1.00 23.19 ? 86   GLY A N   1 
ATOM   696  C CA  . GLY A 1 87  ? 11.683  0.328   -21.312 1.00 23.06 ? 86   GLY A CA  1 
ATOM   697  C C   . GLY A 1 87  ? 10.605  -0.738  -21.395 1.00 22.89 ? 86   GLY A C   1 
ATOM   698  O O   . GLY A 1 87  ? 9.401   -0.431  -21.381 1.00 22.87 ? 86   GLY A O   1 
ATOM   699  N N   . SER A 1 88  ? 11.022  -1.992  -21.477 1.00 23.29 ? 87   SER A N   1 
ATOM   700  C CA  . SER A 1 88  ? 10.076  -3.101  -21.376 1.00 23.78 ? 87   SER A CA  1 
ATOM   701  C C   . SER A 1 88  ? 9.424   -3.101  -19.996 1.00 24.18 ? 87   SER A C   1 
ATOM   702  O O   . SER A 1 88  ? 10.040  -2.690  -19.001 1.00 23.92 ? 87   SER A O   1 
ATOM   703  C CB  . SER A 1 88  ? 10.771  -4.423  -21.633 1.00 24.20 ? 87   SER A CB  1 
ATOM   704  O OG  A SER A 1 88  ? 9.820   -5.468  -21.716 0.70 24.80 ? 87   SER A OG  1 
ATOM   705  O OG  B SER A 1 88  ? 11.161  -4.539  -22.991 0.30 22.83 ? 87   SER A OG  1 
ATOM   706  N N   . LYS A 1 89  ? 8.174   -3.558  -19.938 1.00 24.42 ? 88   LYS A N   1 
ATOM   707  C CA  . LYS A 1 89  ? 7.411   -3.528  -18.688 1.00 24.67 ? 88   LYS A CA  1 
ATOM   708  C C   . LYS A 1 89  ? 7.710   -4.740  -17.809 1.00 24.40 ? 88   LYS A C   1 
ATOM   709  O O   . LYS A 1 89  ? 6.873   -5.626  -17.622 1.00 24.70 ? 88   LYS A O   1 
ATOM   710  C CB  . LYS A 1 89  ? 5.910   -3.328  -18.965 1.00 25.04 ? 88   LYS A CB  1 
ATOM   711  C CG  . LYS A 1 89  ? 5.620   -2.010  -19.681 1.00 25.55 ? 88   LYS A CG  1 
ATOM   712  C CD  . LYS A 1 89  ? 4.153   -1.877  -20.093 1.00 26.36 ? 88   LYS A CD  1 
ATOM   713  C CE  . LYS A 1 89  ? 3.872   -0.498  -20.671 1.00 28.19 ? 88   LYS A CE  1 
ATOM   714  N NZ  . LYS A 1 89  ? 2.417   -0.309  -21.002 1.00 29.07 ? 88   LYS A NZ  1 
ATOM   715  N N   . ILE A 1 90  ? 8.919   -4.752  -17.249 1.00 23.57 ? 89   ILE A N   1 
ATOM   716  C CA  . ILE A 1 90  ? 9.441   -5.914  -16.522 1.00 22.93 ? 89   ILE A CA  1 
ATOM   717  C C   . ILE A 1 90  ? 8.920   -5.975  -15.078 1.00 22.46 ? 89   ILE A C   1 
ATOM   718  O O   . ILE A 1 90  ? 9.091   -6.990  -14.389 1.00 22.73 ? 89   ILE A O   1 
ATOM   719  C CB  . ILE A 1 90  ? 11.009  -5.974  -16.595 1.00 22.71 ? 89   ILE A CB  1 
ATOM   720  C CG1 . ILE A 1 90  ? 11.653  -4.798  -15.847 1.00 22.31 ? 89   ILE A CG1 1 
ATOM   721  C CG2 . ILE A 1 90  ? 11.482  -6.002  -18.071 1.00 23.76 ? 89   ILE A CG2 1 
ATOM   722  C CD1 . ILE A 1 90  ? 13.039  -5.117  -15.267 1.00 24.00 ? 89   ILE A CD1 1 
ATOM   723  N N   . ASN A 1 91  ? 8.285   -4.892  -14.625 1.00 21.91 ? 90   ASN A N   1 
ATOM   724  C CA  . ASN A 1 91  ? 7.529   -4.937  -13.379 1.00 21.86 ? 90   ASN A CA  1 
ATOM   725  C C   . ASN A 1 91  ? 6.192   -5.567  -13.768 1.00 22.10 ? 90   ASN A C   1 
ATOM   726  O O   . ASN A 1 91  ? 5.223   -4.863  -14.029 1.00 21.56 ? 90   ASN A O   1 
ATOM   727  C CB  . ASN A 1 91  ? 7.356   -3.526  -12.787 1.00 21.56 ? 90   ASN A CB  1 
ATOM   728  C CG  . ASN A 1 91  ? 6.505   -3.503  -11.498 1.00 21.71 ? 90   ASN A CG  1 
ATOM   729  O OD1 . ASN A 1 91  ? 5.904   -4.504  -11.096 1.00 22.44 ? 90   ASN A OD1 1 
ATOM   730  N ND2 . ASN A 1 91  ? 6.429   -2.333  -10.876 1.00 20.22 ? 90   ASN A ND2 1 
ATOM   731  N N   . TYR A 1 92  ? 6.172   -6.897  -13.833 1.00 22.88 ? 91   TYR A N   1 
ATOM   732  C CA  . TYR A 1 92  ? 5.072   -7.616  -14.481 1.00 24.03 ? 91   TYR A CA  1 
ATOM   733  C C   . TYR A 1 92  ? 3.777   -7.629  -13.676 1.00 24.82 ? 91   TYR A C   1 
ATOM   734  O O   . TYR A 1 92  ? 2.695   -7.695  -14.260 1.00 26.39 ? 91   TYR A O   1 
ATOM   735  C CB  . TYR A 1 92  ? 5.503   -9.035  -14.884 1.00 24.36 ? 91   TYR A CB  1 
ATOM   736  C CG  . TYR A 1 92  ? 6.270   -9.802  -13.831 1.00 25.69 ? 91   TYR A CG  1 
ATOM   737  C CD1 . TYR A 1 92  ? 7.665   -9.882  -13.872 1.00 27.45 ? 91   TYR A CD1 1 
ATOM   738  C CD2 . TYR A 1 92  ? 5.596   -10.482 -12.809 1.00 26.46 ? 91   TYR A CD2 1 
ATOM   739  C CE1 . TYR A 1 92  ? 8.370   -10.595 -12.905 1.00 27.51 ? 91   TYR A CE1 1 
ATOM   740  C CE2 . TYR A 1 92  ? 6.287   -11.196 -11.844 1.00 25.92 ? 91   TYR A CE2 1 
ATOM   741  C CZ  . TYR A 1 92  ? 7.674   -11.244 -11.895 1.00 27.47 ? 91   TYR A CZ  1 
ATOM   742  O OH  . TYR A 1 92  ? 8.361   -11.960 -10.950 1.00 29.76 ? 91   TYR A OH  1 
ATOM   743  N N   . THR A 1 93  ? 3.869   -7.549  -12.349 1.00 24.46 ? 92   THR A N   1 
ATOM   744  C CA  . THR A 1 93  ? 2.658   -7.535  -11.521 1.00 23.94 ? 92   THR A CA  1 
ATOM   745  C C   . THR A 1 93  ? 1.914   -6.215  -11.604 1.00 23.88 ? 92   THR A C   1 
ATOM   746  O O   . THR A 1 93  ? 0.703   -6.178  -11.425 1.00 24.29 ? 92   THR A O   1 
ATOM   747  C CB  . THR A 1 93  ? 2.951   -7.843  -10.035 1.00 24.16 ? 92   THR A CB  1 
ATOM   748  O OG1 . THR A 1 93  ? 3.849   -6.845  -9.511  1.00 23.71 ? 92   THR A OG1 1 
ATOM   749  C CG2 . THR A 1 93  ? 3.680   -9.206  -9.866  1.00 23.31 ? 92   THR A CG2 1 
ATOM   750  N N   . GLU A 1 94  ? 2.639   -5.126  -11.851 1.00 24.04 ? 93   GLU A N   1 
ATOM   751  C CA  . GLU A 1 94  ? 2.014   -3.810  -11.959 1.00 24.08 ? 93   GLU A CA  1 
ATOM   752  C C   . GLU A 1 94  ? 1.905   -3.340  -13.412 1.00 23.80 ? 93   GLU A C   1 
ATOM   753  O O   . GLU A 1 94  ? 1.293   -2.306  -13.695 1.00 23.64 ? 93   GLU A O   1 
ATOM   754  C CB  . GLU A 1 94  ? 2.770   -2.793  -11.099 1.00 24.14 ? 93   GLU A CB  1 
ATOM   755  C CG  . GLU A 1 94  ? 2.493   -2.955  -9.607  1.00 25.25 ? 93   GLU A CG  1 
ATOM   756  C CD  . GLU A 1 94  ? 3.326   -2.030  -8.728  1.00 26.56 ? 93   GLU A CD  1 
ATOM   757  O OE1 . GLU A 1 94  ? 4.539   -1.865  -8.992  1.00 25.13 ? 93   GLU A OE1 1 
ATOM   758  O OE2 . GLU A 1 94  ? 2.765   -1.481  -7.754  1.00 27.53 ? 93   GLU A OE2 1 
ATOM   759  N N   . ASP A 1 95  ? 2.472   -4.139  -14.317 1.00 24.10 ? 94   ASP A N   1 
ATOM   760  C CA  . ASP A 1 95  ? 2.562   -3.825  -15.747 1.00 24.25 ? 94   ASP A CA  1 
ATOM   761  C C   . ASP A 1 95  ? 3.140   -2.422  -15.956 1.00 23.65 ? 94   ASP A C   1 
ATOM   762  O O   . ASP A 1 95  ? 2.469   -1.507  -16.465 1.00 24.18 ? 94   ASP A O   1 
ATOM   763  C CB  . ASP A 1 95  ? 1.203   -3.976  -16.442 1.00 24.92 ? 94   ASP A CB  1 
ATOM   764  C CG  . ASP A 1 95  ? 1.305   -3.820  -17.944 1.00 25.71 ? 94   ASP A CG  1 
ATOM   765  O OD1 . ASP A 1 95  ? 2.220   -4.422  -18.543 1.00 27.44 ? 94   ASP A OD1 1 
ATOM   766  O OD2 . ASP A 1 95  ? 0.519   -3.112  -18.611 1.00 29.92 ? 94   ASP A OD2 1 
ATOM   767  N N   . ARG A 1 96  ? 4.385   -2.268  -15.517 1.00 23.16 ? 95   ARG A N   1 
ATOM   768  C CA  . ARG A 1 96  ? 5.093   -0.995  -15.564 1.00 22.32 ? 95   ARG A CA  1 
ATOM   769  C C   . ARG A 1 96  ? 6.500   -1.211  -16.058 1.00 21.56 ? 95   ARG A C   1 
ATOM   770  O O   . ARG A 1 96  ? 7.095   -2.265  -15.823 1.00 22.04 ? 95   ARG A O   1 
ATOM   771  C CB  . ARG A 1 96  ? 5.182   -0.377  -14.165 1.00 22.55 ? 95   ARG A CB  1 
ATOM   772  C CG  . ARG A 1 96  ? 3.908   0.227   -13.625 1.00 23.40 ? 95   ARG A CG  1 
ATOM   773  C CD  . ARG A 1 96  ? 4.081   0.730   -12.204 1.00 23.10 ? 95   ARG A CD  1 
ATOM   774  N NE  . ARG A 1 96  ? 2.838   1.263   -11.644 1.00 26.04 ? 95   ARG A NE  1 
ATOM   775  C CZ  . ARG A 1 96  ? 2.697   1.713   -10.401 1.00 27.35 ? 95   ARG A CZ  1 
ATOM   776  N NH1 . ARG A 1 96  ? 3.728   1.720   -9.560  1.00 26.89 ? 95   ARG A NH1 1 
ATOM   777  N NH2 . ARG A 1 96  ? 1.512   2.172   -10.000 1.00 29.77 ? 95   ARG A NH2 1 
ATOM   778  N N   . ALA A 1 97  ? 7.041   -0.201  -16.733 1.00 21.16 ? 96   ALA A N   1 
ATOM   779  C CA  . ALA A 1 97  ? 8.464   -0.163  -17.003 1.00 20.41 ? 96   ALA A CA  1 
ATOM   780  C C   . ALA A 1 97  ? 9.230   0.081   -15.690 1.00 20.55 ? 96   ALA A C   1 
ATOM   781  O O   . ALA A 1 97  ? 8.638   0.361   -14.641 1.00 20.74 ? 96   ALA A O   1 
ATOM   782  C CB  . ALA A 1 97  ? 8.790   0.926   -18.041 1.00 20.30 ? 96   ALA A CB  1 
ATOM   783  N N   . VAL A 1 98  ? 10.548  -0.059  -15.754 1.00 19.82 ? 97   VAL A N   1 
ATOM   784  C CA  . VAL A 1 98  ? 11.404  0.123   -14.593 1.00 19.70 ? 97   VAL A CA  1 
ATOM   785  C C   . VAL A 1 98  ? 12.557  0.959   -15.130 1.00 19.61 ? 97   VAL A C   1 
ATOM   786  O O   . VAL A 1 98  ? 13.476  0.434   -15.768 1.00 19.67 ? 97   VAL A O   1 
ATOM   787  C CB  . VAL A 1 98  ? 11.862  -1.238  -14.016 1.00 20.09 ? 97   VAL A CB  1 
ATOM   788  C CG1 . VAL A 1 98  ? 13.013  -1.071  -13.005 1.00 20.56 ? 97   VAL A CG1 1 
ATOM   789  C CG2 . VAL A 1 98  ? 10.657  -1.986  -13.367 1.00 19.01 ? 97   VAL A CG2 1 
ATOM   790  N N   . LEU A 1 99  ? 12.483  2.269   -14.911 1.00 19.48 ? 98   LEU A N   1 
ATOM   791  C CA  . LEU A 1 99  ? 13.364  3.180   -15.650 1.00 19.04 ? 98   LEU A CA  1 
ATOM   792  C C   . LEU A 1 99  ? 14.086  4.215   -14.804 1.00 18.89 ? 98   LEU A C   1 
ATOM   793  O O   . LEU A 1 99  ? 14.252  5.366   -15.224 1.00 18.88 ? 98   LEU A O   1 
ATOM   794  C CB  . LEU A 1 99  ? 12.618  3.854   -16.810 1.00 19.79 ? 98   LEU A CB  1 
ATOM   795  C CG  . LEU A 1 99  ? 12.497  2.977   -18.061 1.00 20.27 ? 98   LEU A CG  1 
ATOM   796  C CD1 . LEU A 1 99  ? 11.670  3.676   -19.100 1.00 23.09 ? 98   LEU A CD1 1 
ATOM   797  C CD2 . LEU A 1 99  ? 13.885  2.628   -18.598 1.00 20.64 ? 98   LEU A CD2 1 
ATOM   798  N N   . HIS A 1 100 ? 14.531  3.819   -13.613 1.00 18.80 ? 99   HIS A N   1 
ATOM   799  C CA  . HIS A 1 100 ? 15.426  4.712   -12.883 1.00 18.86 ? 99   HIS A CA  1 
ATOM   800  C C   . HIS A 1 100 ? 16.685  4.978   -13.705 1.00 19.47 ? 99   HIS A C   1 
ATOM   801  O O   . HIS A 1 100 ? 17.279  6.063   -13.595 1.00 19.88 ? 99   HIS A O   1 
ATOM   802  C CB  . HIS A 1 100 ? 15.751  4.206   -11.469 1.00 17.97 ? 99   HIS A CB  1 
ATOM   803  C CG  . HIS A 1 100 ? 16.062  2.743   -11.404 1.00 16.04 ? 99   HIS A CG  1 
ATOM   804  N ND1 . HIS A 1 100 ? 15.082  1.774   -11.313 1.00 16.68 ? 99   HIS A ND1 1 
ATOM   805  C CD2 . HIS A 1 100 ? 17.244  2.087   -11.412 1.00 17.28 ? 99   HIS A CD2 1 
ATOM   806  C CE1 . HIS A 1 100 ? 15.652  0.583   -11.281 1.00 16.41 ? 99   HIS A CE1 1 
ATOM   807  N NE2 . HIS A 1 100 ? 16.960  0.744   -11.349 1.00 17.45 ? 99   HIS A NE2 1 
ATOM   808  N N   . VAL A 1 101 ? 17.071  4.041   -14.587 1.00 19.77 ? 100  VAL A N   1 
ATOM   809  C CA  . VAL A 1 101 ? 18.227  4.333   -15.461 1.00 19.45 ? 100  VAL A CA  1 
ATOM   810  C C   . VAL A 1 101 ? 17.989  5.505   -16.413 1.00 19.45 ? 100  VAL A C   1 
ATOM   811  O O   . VAL A 1 101 ? 18.940  6.157   -16.819 1.00 19.65 ? 100  VAL A O   1 
ATOM   812  C CB  . VAL A 1 101 ? 18.785  3.112   -16.243 1.00 20.03 ? 100  VAL A CB  1 
ATOM   813  C CG1 . VAL A 1 101 ? 19.316  2.053   -15.269 1.00 18.72 ? 100  VAL A CG1 1 
ATOM   814  C CG2 . VAL A 1 101 ? 17.734  2.529   -17.198 1.00 19.61 ? 100  VAL A CG2 1 
ATOM   815  N N   . ALA A 1 102 ? 16.728  5.783   -16.739 1.00 19.38 ? 101  ALA A N   1 
ATOM   816  C CA  . ALA A 1 102 ? 16.376  6.893   -17.630 1.00 18.95 ? 101  ALA A CA  1 
ATOM   817  C C   . ALA A 1 102 ? 16.562  8.226   -16.931 1.00 18.72 ? 101  ALA A C   1 
ATOM   818  O O   . ALA A 1 102 ? 16.915  9.209   -17.559 1.00 18.45 ? 101  ALA A O   1 
ATOM   819  C CB  . ALA A 1 102 ? 14.946  6.760   -18.123 1.00 19.58 ? 101  ALA A CB  1 
ATOM   820  N N   . LEU A 1 103 ? 16.322  8.244   -15.617 1.00 17.92 ? 102  LEU A N   1 
ATOM   821  C CA  . LEU A 1 103 ? 16.426  9.472   -14.837 1.00 17.79 ? 102  LEU A CA  1 
ATOM   822  C C   . LEU A 1 103 ? 17.813  10.099  -14.909 1.00 18.21 ? 102  LEU A C   1 
ATOM   823  O O   . LEU A 1 103 ? 17.947  11.337  -14.880 1.00 18.86 ? 102  LEU A O   1 
ATOM   824  C CB  . LEU A 1 103 ? 16.065  9.195   -13.374 1.00 17.13 ? 102  LEU A CB  1 
ATOM   825  C CG  . LEU A 1 103 ? 14.635  8.686   -13.170 1.00 17.41 ? 102  LEU A CG  1 
ATOM   826  C CD1 . LEU A 1 103 ? 14.440  8.295   -11.708 1.00 16.28 ? 102  LEU A CD1 1 
ATOM   827  C CD2 . LEU A 1 103 ? 13.603  9.732   -13.601 1.00 17.66 ? 102  LEU A CD2 1 
ATOM   828  N N   . ARG A 1 104 ? 18.828  9.242   -14.988 1.00 18.64 ? 103  ARG A N   1 
ATOM   829  C CA  . ARG A 1 104 ? 20.227  9.663   -15.049 1.00 19.10 ? 103  ARG A CA  1 
ATOM   830  C C   . ARG A 1 104 ? 20.887  9.410   -16.408 1.00 20.01 ? 103  ARG A C   1 
ATOM   831  O O   . ARG A 1 104 ? 22.121  9.377   -16.499 1.00 20.74 ? 103  ARG A O   1 
ATOM   832  C CB  . ARG A 1 104 ? 21.041  8.978   -13.941 1.00 18.33 ? 103  ARG A CB  1 
ATOM   833  C CG  . ARG A 1 104 ? 21.084  7.445   -14.063 1.00 17.73 ? 103  ARG A CG  1 
ATOM   834  C CD  . ARG A 1 104 ? 20.413  6.736   -12.916 1.00 16.32 ? 103  ARG A CD  1 
ATOM   835  N NE  . ARG A 1 104 ? 20.788  5.321   -12.827 1.00 15.28 ? 103  ARG A NE  1 
ATOM   836  C CZ  . ARG A 1 104 ? 20.499  4.525   -11.797 1.00 15.66 ? 103  ARG A CZ  1 
ATOM   837  N NH1 . ARG A 1 104 ? 19.797  4.985   -10.775 1.00 15.70 ? 103  ARG A NH1 1 
ATOM   838  N NH2 . ARG A 1 104 ? 20.896  3.260   -11.793 1.00 18.06 ? 103  ARG A NH2 1 
ATOM   839  N N   . ASN A 1 105 ? 20.066  9.224   -17.440 1.00 20.81 ? 104  ASN A N   1 
ATOM   840  C CA  . ASN A 1 105 ? 20.532  8.926   -18.800 1.00 21.46 ? 104  ASN A CA  1 
ATOM   841  C C   . ASN A 1 105 ? 21.132  10.190  -19.436 1.00 21.76 ? 104  ASN A C   1 
ATOM   842  O O   . ASN A 1 105 ? 20.477  10.910  -20.211 1.00 20.91 ? 104  ASN A O   1 
ATOM   843  C CB  . ASN A 1 105 ? 19.384  8.340   -19.632 1.00 22.13 ? 104  ASN A CB  1 
ATOM   844  C CG  . ASN A 1 105 ? 19.790  7.988   -21.081 1.00 23.85 ? 104  ASN A CG  1 
ATOM   845  O OD1 . ASN A 1 105 ? 18.934  7.932   -21.971 1.00 26.51 ? 104  ASN A OD1 1 
ATOM   846  N ND2 . ASN A 1 105 ? 21.071  7.742   -21.311 1.00 24.68 ? 104  ASN A ND2 1 
ATOM   847  N N   . ARG A 1 106 ? 22.384  10.450  -19.076 1.00 22.03 ? 105  ARG A N   1 
ATOM   848  C CA  . ARG A 1 106 ? 23.096  11.659  -19.492 1.00 23.35 ? 105  ARG A CA  1 
ATOM   849  C C   . ARG A 1 106 ? 23.351  11.685  -21.007 1.00 24.21 ? 105  ARG A C   1 
ATOM   850  O O   . ARG A 1 106 ? 23.498  12.757  -21.600 1.00 24.17 ? 105  ARG A O   1 
ATOM   851  C CB  . ARG A 1 106 ? 24.423  11.781  -18.717 1.00 22.83 ? 105  ARG A CB  1 
ATOM   852  C CG  . ARG A 1 106 ? 24.284  11.753  -17.168 1.00 22.69 ? 105  ARG A CG  1 
ATOM   853  C CD  . ARG A 1 106 ? 23.313  12.784  -16.582 1.00 19.98 ? 105  ARG A CD  1 
ATOM   854  N NE  . ARG A 1 106 ? 23.706  14.168  -16.874 1.00 22.96 ? 105  ARG A NE  1 
ATOM   855  C CZ  . ARG A 1 106 ? 22.894  15.224  -16.780 1.00 23.93 ? 105  ARG A CZ  1 
ATOM   856  N NH1 . ARG A 1 106 ? 21.617  15.075  -16.411 1.00 23.61 ? 105  ARG A NH1 1 
ATOM   857  N NH2 . ARG A 1 106 ? 23.352  16.437  -17.074 1.00 24.24 ? 105  ARG A NH2 1 
ATOM   858  N N   . SER A 1 107 ? 23.393  10.503  -21.619 1.00 25.55 ? 106  SER A N   1 
ATOM   859  C CA  . SER A 1 107 ? 23.605  10.362  -23.064 1.00 26.71 ? 106  SER A CA  1 
ATOM   860  C C   . SER A 1 107 ? 22.403  10.850  -23.861 1.00 27.46 ? 106  SER A C   1 
ATOM   861  O O   . SER A 1 107 ? 22.529  11.202  -25.036 1.00 27.42 ? 106  SER A O   1 
ATOM   862  C CB  . SER A 1 107 ? 23.869  8.900   -23.417 1.00 26.98 ? 106  SER A CB  1 
ATOM   863  O OG  . SER A 1 107 ? 22.638  8.181   -23.540 1.00 28.56 ? 106  SER A OG  1 
ATOM   864  N N   . ASN A 1 108 ? 21.238  10.861  -23.202 1.00 27.99 ? 107  ASN A N   1 
ATOM   865  C CA  . ASN A 1 108 ? 19.953  11.207  -23.807 1.00 28.83 ? 107  ASN A CA  1 
ATOM   866  C C   . ASN A 1 108 ? 19.494  10.308  -24.969 1.00 29.34 ? 107  ASN A C   1 
ATOM   867  O O   . ASN A 1 108 ? 18.580  10.681  -25.704 1.00 29.48 ? 107  ASN A O   1 
ATOM   868  C CB  . ASN A 1 108 ? 19.910  12.685  -24.213 1.00 29.21 ? 107  ASN A CB  1 
ATOM   869  C CG  . ASN A 1 108 ? 19.817  13.607  -23.026 1.00 29.77 ? 107  ASN A CG  1 
ATOM   870  O OD1 . ASN A 1 108 ? 19.067  13.349  -22.088 1.00 29.98 ? 107  ASN A OD1 1 
ATOM   871  N ND2 . ASN A 1 108 ? 20.591  14.687  -23.052 1.00 31.08 ? 107  ASN A ND2 1 
ATOM   872  N N   . THR A 1 109 ? 20.122  9.142   -25.124 1.00 30.05 ? 108  THR A N   1 
ATOM   873  C CA  . THR A 1 109 ? 19.649  8.123   -26.068 1.00 30.76 ? 108  THR A CA  1 
ATOM   874  C C   . THR A 1 109 ? 18.187  7.796   -25.710 1.00 30.50 ? 108  THR A C   1 
ATOM   875  O O   . THR A 1 109 ? 17.841  7.762   -24.525 1.00 29.83 ? 108  THR A O   1 
ATOM   876  C CB  . THR A 1 109 ? 20.556  6.871   -25.996 1.00 31.23 ? 108  THR A CB  1 
ATOM   877  O OG1 . THR A 1 109 ? 21.888  7.218   -26.406 1.00 33.54 ? 108  THR A OG1 1 
ATOM   878  C CG2 . THR A 1 109 ? 20.176  5.838   -27.042 1.00 32.31 ? 108  THR A CG2 1 
ATOM   879  N N   . PRO A 1 110 ? 17.319  7.629   -26.714 1.00 30.29 ? 109  PRO A N   1 
ATOM   880  C CA  . PRO A 1 110 ? 15.885  7.447   -26.454 1.00 29.51 ? 109  PRO A CA  1 
ATOM   881  C C   . PRO A 1 110 ? 15.604  6.184   -25.677 1.00 28.93 ? 109  PRO A C   1 
ATOM   882  O O   . PRO A 1 110 ? 16.257  5.161   -25.892 1.00 28.69 ? 109  PRO A O   1 
ATOM   883  C CB  . PRO A 1 110 ? 15.280  7.345   -27.861 1.00 29.61 ? 109  PRO A CB  1 
ATOM   884  C CG  . PRO A 1 110 ? 16.277  8.011   -28.745 1.00 30.36 ? 109  PRO A CG  1 
ATOM   885  C CD  . PRO A 1 110 ? 17.608  7.643   -28.166 1.00 30.22 ? 109  PRO A CD  1 
ATOM   886  N N   . ILE A 1 111 ? 14.668  6.289   -24.742 1.00 28.65 ? 110  ILE A N   1 
ATOM   887  C CA  . ILE A 1 111 ? 14.141  5.130   -24.042 1.00 28.01 ? 110  ILE A CA  1 
ATOM   888  C C   . ILE A 1 111 ? 12.633  5.274   -24.137 1.00 28.30 ? 110  ILE A C   1 
ATOM   889  O O   . ILE A 1 111 ? 12.045  6.240   -23.637 1.00 28.07 ? 110  ILE A O   1 
ATOM   890  C CB  . ILE A 1 111 ? 14.613  5.078   -22.576 1.00 28.01 ? 110  ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 111 ? 16.142  5.041   -22.486 1.00 27.35 ? 110  ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 111 ? 14.039  3.840   -21.887 1.00 26.87 ? 110  ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 111 ? 16.682  5.182   -21.050 1.00 25.71 ? 110  ILE A CD1 1 
ATOM   894  N N   . LYS A 1 112 ? 12.004  4.313   -24.791 1.00 28.51 ? 111  LYS A N   1 
ATOM   895  C CA  . LYS A 1 112 ? 10.583  4.446   -25.085 1.00 29.25 ? 111  LYS A CA  1 
ATOM   896  C C   . LYS A 1 112 ? 9.709   3.659   -24.128 1.00 29.18 ? 111  LYS A C   1 
ATOM   897  O O   . LYS A 1 112 ? 9.994   2.499   -23.825 1.00 29.09 ? 111  LYS A O   1 
ATOM   898  C CB  . LYS A 1 112 ? 10.298  4.031   -26.530 1.00 29.42 ? 111  LYS A CB  1 
ATOM   899  C CG  . LYS A 1 112 ? 10.869  5.015   -27.542 1.00 31.16 ? 111  LYS A CG  1 
ATOM   900  C CD  . LYS A 1 112 ? 10.480  4.668   -28.959 1.00 35.23 ? 111  LYS A CD  1 
ATOM   901  C CE  . LYS A 1 112 ? 11.293  5.502   -29.950 1.00 36.83 ? 111  LYS A CE  1 
ATOM   902  N NZ  . LYS A 1 112 ? 12.749  5.120   -29.958 1.00 37.29 ? 111  LYS A NZ  1 
ATOM   903  N N   . VAL A 1 113 ? 8.654   4.311   -23.650 1.00 29.32 ? 112  VAL A N   1 
ATOM   904  C CA  . VAL A 1 113 ? 7.554   3.622   -22.971 1.00 29.41 ? 112  VAL A CA  1 
ATOM   905  C C   . VAL A 1 113 ? 6.268   3.875   -23.761 1.00 29.77 ? 112  VAL A C   1 
ATOM   906  O O   . VAL A 1 113 ? 5.909   5.030   -24.005 1.00 29.25 ? 112  VAL A O   1 
ATOM   907  C CB  . VAL A 1 113 ? 7.391   4.079   -21.498 1.00 29.09 ? 112  VAL A CB  1 
ATOM   908  C CG1 . VAL A 1 113 ? 6.142   3.472   -20.884 1.00 28.81 ? 112  VAL A CG1 1 
ATOM   909  C CG2 . VAL A 1 113 ? 8.614   3.670   -20.684 1.00 28.22 ? 112  VAL A CG2 1 
ATOM   910  N N   . ASP A 1 114 ? 5.579   2.796   -24.147 1.00 30.71 ? 113  ASP A N   1 
ATOM   911  C CA  . ASP A 1 114 ? 4.351   2.892   -24.948 1.00 31.69 ? 113  ASP A CA  1 
ATOM   912  C C   . ASP A 1 114 ? 4.648   3.686   -26.218 1.00 31.83 ? 113  ASP A C   1 
ATOM   913  O O   . ASP A 1 114 ? 3.908   4.609   -26.569 1.00 32.63 ? 113  ASP A O   1 
ATOM   914  C CB  . ASP A 1 114 ? 3.217   3.585   -24.167 1.00 31.89 ? 113  ASP A CB  1 
ATOM   915  C CG  . ASP A 1 114 ? 2.767   2.809   -22.939 1.00 32.80 ? 113  ASP A CG  1 
ATOM   916  O OD1 . ASP A 1 114 ? 2.612   1.570   -23.024 1.00 33.88 ? 113  ASP A OD1 1 
ATOM   917  O OD2 . ASP A 1 114 ? 2.520   3.372   -21.843 1.00 33.97 ? 113  ASP A OD2 1 
ATOM   918  N N   . GLY A 1 115 ? 5.764   3.350   -26.868 1.00 32.49 ? 114  GLY A N   1 
ATOM   919  C CA  . GLY A 1 115 ? 6.184   3.984   -28.110 1.00 32.21 ? 114  GLY A CA  1 
ATOM   920  C C   . GLY A 1 115 ? 6.653   5.429   -28.013 1.00 32.27 ? 114  GLY A C   1 
ATOM   921  O O   . GLY A 1 115 ? 6.858   6.076   -29.037 1.00 32.44 ? 114  GLY A O   1 
ATOM   922  N N   . LYS A 1 116 ? 6.838   5.935   -26.793 1.00 31.86 ? 115  LYS A N   1 
ATOM   923  C CA  . LYS A 1 116 ? 7.184   7.338   -26.594 1.00 31.50 ? 115  LYS A CA  1 
ATOM   924  C C   . LYS A 1 116 ? 8.455   7.519   -25.749 1.00 30.83 ? 115  LYS A C   1 
ATOM   925  O O   . LYS A 1 116 ? 8.570   6.961   -24.654 1.00 30.07 ? 115  LYS A O   1 
ATOM   926  C CB  . LYS A 1 116 ? 6.008   8.064   -25.950 1.00 31.71 ? 115  LYS A CB  1 
ATOM   927  C CG  . LYS A 1 116 ? 6.082   9.567   -25.988 1.00 34.03 ? 115  LYS A CG  1 
ATOM   928  C CD  . LYS A 1 116 ? 4.862   10.167  -25.293 1.00 37.41 ? 115  LYS A CD  1 
ATOM   929  C CE  . LYS A 1 116 ? 5.238   10.915  -24.011 1.00 39.38 ? 115  LYS A CE  1 
ATOM   930  N NZ  . LYS A 1 116 ? 5.544   9.996   -22.865 1.00 40.47 ? 115  LYS A NZ  1 
ATOM   931  N N   . ASP A 1 117 ? 9.388   8.315   -26.273 1.00 29.52 ? 116  ASP A N   1 
ATOM   932  C CA  . ASP A 1 117 ? 10.634  8.626   -25.586 1.00 28.88 ? 116  ASP A CA  1 
ATOM   933  C C   . ASP A 1 117 ? 10.345  9.352   -24.275 1.00 27.66 ? 116  ASP A C   1 
ATOM   934  O O   . ASP A 1 117 ? 9.609   10.348  -24.254 1.00 27.64 ? 116  ASP A O   1 
ATOM   935  C CB  . ASP A 1 117 ? 11.541  9.484   -26.471 1.00 28.74 ? 116  ASP A CB  1 
ATOM   936  C CG  . ASP A 1 117 ? 12.958  9.618   -25.919 1.00 30.59 ? 116  ASP A CG  1 
ATOM   937  O OD1 . ASP A 1 117 ? 13.294  8.971   -24.898 1.00 29.28 ? 116  ASP A OD1 1 
ATOM   938  O OD2 . ASP A 1 117 ? 13.814  10.350  -26.464 1.00 33.57 ? 116  ASP A OD2 1 
ATOM   939  N N   . VAL A 1 118 ? 10.921  8.848   -23.188 1.00 25.85 ? 117  VAL A N   1 
ATOM   940  C CA  . VAL A 1 118 ? 10.701  9.448   -21.865 1.00 25.23 ? 117  VAL A CA  1 
ATOM   941  C C   . VAL A 1 118 ? 11.685  10.579  -21.598 1.00 25.08 ? 117  VAL A C   1 
ATOM   942  O O   . VAL A 1 118 ? 11.485  11.387  -20.691 1.00 25.49 ? 117  VAL A O   1 
ATOM   943  C CB  . VAL A 1 118 ? 10.791  8.400   -20.717 1.00 24.85 ? 117  VAL A CB  1 
ATOM   944  C CG1 . VAL A 1 118 ? 9.788   7.289   -20.952 1.00 24.21 ? 117  VAL A CG1 1 
ATOM   945  C CG2 . VAL A 1 118 ? 12.206  7.822   -20.572 1.00 23.58 ? 117  VAL A CG2 1 
ATOM   946  N N   . MET A 1 119 ? 12.747  10.620  -22.392 1.00 24.97 ? 118  MET A N   1 
ATOM   947  C CA  . MET A 1 119 ? 13.862  11.514  -22.105 1.00 25.02 ? 118  MET A CA  1 
ATOM   948  C C   . MET A 1 119 ? 13.504  12.996  -22.115 1.00 25.39 ? 118  MET A C   1 
ATOM   949  O O   . MET A 1 119 ? 13.960  13.726  -21.231 1.00 26.13 ? 118  MET A O   1 
ATOM   950  C CB  . MET A 1 119 ? 15.064  11.215  -23.000 1.00 24.39 ? 118  MET A CB  1 
ATOM   951  C CG  . MET A 1 119 ? 15.806  9.919   -22.643 1.00 24.26 ? 118  MET A CG  1 
ATOM   952  S SD  . MET A 1 119 ? 16.070  9.596   -20.855 1.00 22.76 ? 118  MET A SD  1 
ATOM   953  C CE  . MET A 1 119 ? 16.954  11.129  -20.282 1.00 21.29 ? 118  MET A CE  1 
ATOM   954  N N   . PRO A 1 120 ? 12.725  13.476  -23.096 1.00 25.93 ? 119  PRO A N   1 
ATOM   955  C CA  . PRO A 1 120 ? 12.270  14.868  -23.045 1.00 25.58 ? 119  PRO A CA  1 
ATOM   956  C C   . PRO A 1 120 ? 11.597  15.262  -21.721 1.00 25.45 ? 119  PRO A C   1 
ATOM   957  O O   . PRO A 1 120 ? 11.933  16.314  -21.196 1.00 24.37 ? 119  PRO A O   1 
ATOM   958  C CB  . PRO A 1 120 ? 11.320  14.965  -24.236 1.00 26.14 ? 119  PRO A CB  1 
ATOM   959  C CG  . PRO A 1 120 ? 11.900  14.012  -25.191 1.00 26.28 ? 119  PRO A CG  1 
ATOM   960  C CD  . PRO A 1 120 ? 12.275  12.815  -24.339 1.00 25.71 ? 119  PRO A CD  1 
ATOM   961  N N   . GLU A 1 121 ? 10.688  14.443  -21.193 1.00 24.92 ? 120  GLU A N   1 
ATOM   962  C CA  . GLU A 1 121 ? 10.057  14.773  -19.914 1.00 25.35 ? 120  GLU A CA  1 
ATOM   963  C C   . GLU A 1 121 ? 11.007  14.679  -18.707 1.00 24.05 ? 120  GLU A C   1 
ATOM   964  O O   . GLU A 1 121 ? 10.927  15.505  -17.796 1.00 23.15 ? 120  GLU A O   1 
ATOM   965  C CB  . GLU A 1 121 ? 8.773   13.969  -19.692 1.00 26.00 ? 120  GLU A CB  1 
ATOM   966  C CG  . GLU A 1 121 ? 7.551   14.557  -20.397 1.00 29.08 ? 120  GLU A CG  1 
ATOM   967  C CD  . GLU A 1 121 ? 7.165   15.935  -19.883 1.00 33.13 ? 120  GLU A CD  1 
ATOM   968  O OE1 . GLU A 1 121 ? 7.470   16.944  -20.566 1.00 33.40 ? 120  GLU A OE1 1 
ATOM   969  O OE2 . GLU A 1 121 ? 6.560   16.016  -18.790 1.00 36.90 ? 120  GLU A OE2 1 
ATOM   970  N N   . VAL A 1 122 ? 11.902  13.690  -18.705 1.00 23.33 ? 121  VAL A N   1 
ATOM   971  C CA  . VAL A 1 122 ? 12.945  13.606  -17.676 1.00 22.36 ? 121  VAL A CA  1 
ATOM   972  C C   . VAL A 1 122 ? 13.760  14.901  -17.632 1.00 22.71 ? 121  VAL A C   1 
ATOM   973  O O   . VAL A 1 122 ? 13.932  15.516  -16.574 1.00 21.75 ? 121  VAL A O   1 
ATOM   974  C CB  . VAL A 1 122 ? 13.877  12.391  -17.900 1.00 22.74 ? 121  VAL A CB  1 
ATOM   975  C CG1 . VAL A 1 122 ? 15.109  12.465  -16.983 1.00 20.85 ? 121  VAL A CG1 1 
ATOM   976  C CG2 . VAL A 1 122 ? 13.107  11.094  -17.681 1.00 21.85 ? 121  VAL A CG2 1 
ATOM   977  N N   . ASN A 1 123 ? 14.222  15.333  -18.802 1.00 22.60 ? 122  ASN A N   1 
ATOM   978  C CA  . ASN A 1 123 ? 15.050  16.533  -18.910 1.00 22.91 ? 122  ASN A CA  1 
ATOM   979  C C   . ASN A 1 123 ? 14.300  17.827  -18.599 1.00 22.81 ? 122  ASN A C   1 
ATOM   980  O O   . ASN A 1 123 ? 14.874  18.750  -18.014 1.00 22.59 ? 122  ASN A O   1 
ATOM   981  C CB  . ASN A 1 123 ? 15.704  16.588  -20.295 1.00 23.01 ? 122  ASN A CB  1 
ATOM   982  C CG  . ASN A 1 123 ? 16.759  15.525  -20.465 1.00 24.62 ? 122  ASN A CG  1 
ATOM   983  O OD1 . ASN A 1 123 ? 17.384  15.102  -19.488 1.00 25.45 ? 122  ASN A OD1 1 
ATOM   984  N ND2 . ASN A 1 123 ? 16.970  15.081  -21.703 1.00 25.10 ? 122  ASN A ND2 1 
ATOM   985  N N   . ARG A 1 124 ? 13.020  17.886  -18.972 1.00 22.99 ? 123  ARG A N   1 
ATOM   986  C CA  . ARG A 1 124 ? 12.160  19.015  -18.603 1.00 23.69 ? 123  ARG A CA  1 
ATOM   987  C C   . ARG A 1 124 ? 12.083  19.185  -17.086 1.00 22.42 ? 123  ARG A C   1 
ATOM   988  O O   . ARG A 1 124 ? 12.186  20.306  -16.581 1.00 21.77 ? 123  ARG A O   1 
ATOM   989  C CB  . ARG A 1 124 ? 10.734  18.872  -19.169 1.00 24.58 ? 123  ARG A CB  1 
ATOM   990  C CG  . ARG A 1 124 ? 9.773   19.983  -18.704 1.00 28.44 ? 123  ARG A CG  1 
ATOM   991  C CD  . ARG A 1 124 ? 8.262   19.724  -18.947 1.00 34.20 ? 123  ARG A CD  1 
ATOM   992  N NE  . ARG A 1 124 ? 7.747   18.547  -18.229 1.00 39.03 ? 123  ARG A NE  1 
ATOM   993  C CZ  . ARG A 1 124 ? 7.306   18.539  -16.969 1.00 40.77 ? 123  ARG A CZ  1 
ATOM   994  N NH1 . ARG A 1 124 ? 7.302   19.651  -16.242 1.00 42.07 ? 123  ARG A NH1 1 
ATOM   995  N NH2 . ARG A 1 124 ? 6.866   17.408  -16.432 1.00 41.77 ? 123  ARG A NH2 1 
ATOM   996  N N   . VAL A 1 125 ? 11.867  18.085  -16.368 1.00 21.89 ? 124  VAL A N   1 
ATOM   997  C CA  . VAL A 1 125 ? 11.804  18.170  -14.902 1.00 21.04 ? 124  VAL A CA  1 
ATOM   998  C C   . VAL A 1 125 ? 13.164  18.568  -14.315 1.00 20.85 ? 124  VAL A C   1 
ATOM   999  O O   . VAL A 1 125 ? 13.215  19.400  -13.421 1.00 20.07 ? 124  VAL A O   1 
ATOM   1000 C CB  . VAL A 1 125 ? 11.259  16.882  -14.222 1.00 20.77 ? 124  VAL A CB  1 
ATOM   1001 C CG1 . VAL A 1 125 ? 11.300  17.030  -12.697 1.00 21.89 ? 124  VAL A CG1 1 
ATOM   1002 C CG2 . VAL A 1 125 ? 9.826   16.602  -14.686 1.00 21.98 ? 124  VAL A CG2 1 
ATOM   1003 N N   . LEU A 1 126 ? 14.247  17.995  -14.837 1.00 20.15 ? 125  LEU A N   1 
ATOM   1004 C CA  . LEU A 1 126 ? 15.596  18.361  -14.395 1.00 21.00 ? 125  LEU A CA  1 
ATOM   1005 C C   . LEU A 1 126 ? 15.838  19.856  -14.583 1.00 21.26 ? 125  LEU A C   1 
ATOM   1006 O O   . LEU A 1 126 ? 16.376  20.514  -13.695 1.00 21.58 ? 125  LEU A O   1 
ATOM   1007 C CB  . LEU A 1 126 ? 16.671  17.546  -15.122 1.00 20.39 ? 125  LEU A CB  1 
ATOM   1008 C CG  . LEU A 1 126 ? 16.853  16.103  -14.641 1.00 21.31 ? 125  LEU A CG  1 
ATOM   1009 C CD1 . LEU A 1 126 ? 17.781  15.360  -15.570 1.00 21.66 ? 125  LEU A CD1 1 
ATOM   1010 C CD2 . LEU A 1 126 ? 17.354  16.030  -13.161 1.00 22.02 ? 125  LEU A CD2 1 
ATOM   1011 N N   . ASP A 1 127 ? 15.401  20.392  -15.723 1.00 21.57 ? 126  ASP A N   1 
ATOM   1012 C CA  . ASP A 1 127 ? 15.544  21.828  -15.991 1.00 22.50 ? 126  ASP A CA  1 
ATOM   1013 C C   . ASP A 1 127 ? 14.774  22.663  -14.979 1.00 22.47 ? 126  ASP A C   1 
ATOM   1014 O O   . ASP A 1 127 ? 15.242  23.729  -14.562 1.00 22.26 ? 126  ASP A O   1 
ATOM   1015 C CB  . ASP A 1 127 ? 15.072  22.185  -17.414 1.00 22.85 ? 126  ASP A CB  1 
ATOM   1016 C CG  . ASP A 1 127 ? 16.014  21.688  -18.503 1.00 25.32 ? 126  ASP A CG  1 
ATOM   1017 O OD1 . ASP A 1 127 ? 17.202  21.411  -18.242 1.00 28.79 ? 126  ASP A OD1 1 
ATOM   1018 O OD2 . ASP A 1 127 ? 15.638  21.536  -19.678 1.00 30.20 ? 126  ASP A OD2 1 
ATOM   1019 N N   . LYS A 1 128 ? 13.580  22.200  -14.604 1.00 22.74 ? 127  LYS A N   1 
ATOM   1020 C CA  . LYS A 1 128 ? 12.766  22.890  -13.596 1.00 23.39 ? 127  LYS A CA  1 
ATOM   1021 C C   . LYS A 1 128 ? 13.422  22.834  -12.217 1.00 22.61 ? 127  LYS A C   1 
ATOM   1022 O O   . LYS A 1 128 ? 13.414  23.816  -11.473 1.00 22.52 ? 127  LYS A O   1 
ATOM   1023 C CB  . LYS A 1 128 ? 11.351  22.303  -13.529 1.00 23.81 ? 127  LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 128 ? 10.476  22.645  -14.728 1.00 27.21 ? 127  LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 128 ? 9.065   22.041  -14.618 1.00 31.37 ? 127  LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 128 ? 8.229   22.669  -13.497 1.00 33.64 ? 127  LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 128 ? 6.830   22.120  -13.453 1.00 35.56 ? 127  LYS A NZ  1 
ATOM   1028 N N   . MET A 1 129 ? 13.990  21.678  -11.884 1.00 21.88 ? 128  MET A N   1 
ATOM   1029 C CA  . MET A 1 129 ? 14.754  21.527  -10.650 1.00 21.21 ? 128  MET A CA  1 
ATOM   1030 C C   . MET A 1 129 ? 15.931  22.505  -10.612 1.00 21.40 ? 128  MET A C   1 
ATOM   1031 O O   . MET A 1 129 ? 16.144  23.178  -9.604  1.00 20.87 ? 128  MET A O   1 
ATOM   1032 C CB  . MET A 1 129 ? 15.268  20.093  -10.515 1.00 20.86 ? 128  MET A CB  1 
ATOM   1033 C CG  . MET A 1 129 ? 14.154  19.066  -10.301 1.00 21.33 ? 128  MET A CG  1 
ATOM   1034 S SD  . MET A 1 129 ? 14.806  17.377  -10.284 1.00 24.75 ? 128  MET A SD  1 
ATOM   1035 C CE  . MET A 1 129 ? 15.623  17.372  -8.669  1.00 19.81 ? 128  MET A CE  1 
ATOM   1036 N N   . LYS A 1 130 ? 16.655  22.598  -11.728 1.00 21.02 ? 129  LYS A N   1 
ATOM   1037 C CA  . LYS A 1 130 ? 17.828  23.479  -11.838 1.00 22.10 ? 129  LYS A CA  1 
ATOM   1038 C C   . LYS A 1 130 ? 17.432  24.918  -11.587 1.00 21.91 ? 129  LYS A C   1 
ATOM   1039 O O   . LYS A 1 130 ? 18.039  25.604  -10.776 1.00 23.42 ? 129  LYS A O   1 
ATOM   1040 C CB  . LYS A 1 130 ? 18.458  23.364  -13.220 1.00 21.53 ? 129  LYS A CB  1 
ATOM   1041 C CG  . LYS A 1 130 ? 19.769  24.130  -13.342 1.00 23.83 ? 129  LYS A CG  1 
ATOM   1042 C CD  . LYS A 1 130 ? 20.376  23.914  -14.707 1.00 26.39 ? 129  LYS A CD  1 
ATOM   1043 C CE  . LYS A 1 130 ? 21.273  25.081  -15.071 1.00 30.78 ? 129  LYS A CE  1 
ATOM   1044 N NZ  . LYS A 1 130 ? 22.519  25.069  -14.252 1.00 32.74 ? 129  LYS A NZ  1 
ATOM   1045 N N   . SER A 1 131 ? 16.385  25.349  -12.276 1.00 22.63 ? 130  SER A N   1 
ATOM   1046 C CA  . SER A 1 131 ? 15.862  26.705  -12.159 1.00 22.47 ? 130  SER A CA  1 
ATOM   1047 C C   . SER A 1 131 ? 15.407  27.017  -10.727 1.00 22.07 ? 130  SER A C   1 
ATOM   1048 O O   . SER A 1 131 ? 15.739  28.062  -10.173 1.00 22.72 ? 130  SER A O   1 
ATOM   1049 C CB  . SER A 1 131 ? 14.717  26.901  -13.171 1.00 22.83 ? 130  SER A CB  1 
ATOM   1050 O OG  . SER A 1 131 ? 14.129  28.187  -13.049 1.00 26.81 ? 130  SER A OG  1 
ATOM   1051 N N   . PHE A 1 132 ? 14.649  26.108  -10.125 1.00 21.88 ? 131  PHE A N   1 
ATOM   1052 C CA  . PHE A 1 132 ? 14.177  26.313  -8.766  1.00 21.34 ? 131  PHE A CA  1 
ATOM   1053 C C   . PHE A 1 132 ? 15.336  26.418  -7.766  1.00 20.98 ? 131  PHE A C   1 
ATOM   1054 O O   . PHE A 1 132 ? 15.342  27.292  -6.907  1.00 20.82 ? 131  PHE A O   1 
ATOM   1055 C CB  . PHE A 1 132 ? 13.216  25.192  -8.371  1.00 21.69 ? 131  PHE A CB  1 
ATOM   1056 C CG  . PHE A 1 132 ? 12.582  25.388  -7.033  1.00 22.80 ? 131  PHE A CG  1 
ATOM   1057 C CD1 . PHE A 1 132 ? 11.805  26.508  -6.783  1.00 22.15 ? 131  PHE A CD1 1 
ATOM   1058 C CD2 . PHE A 1 132 ? 12.779  24.468  -6.014  1.00 23.18 ? 131  PHE A CD2 1 
ATOM   1059 C CE1 . PHE A 1 132 ? 11.209  26.707  -5.543  1.00 25.11 ? 131  PHE A CE1 1 
ATOM   1060 C CE2 . PHE A 1 132 ? 12.183  24.652  -4.765  1.00 22.51 ? 131  PHE A CE2 1 
ATOM   1061 C CZ  . PHE A 1 132 ? 11.392  25.777  -4.532  1.00 25.23 ? 131  PHE A CZ  1 
ATOM   1062 N N   . CYS A 1 133 ? 16.320  25.528  -7.893  1.00 20.38 ? 132  CYS A N   1 
ATOM   1063 C CA  . CYS A 1 133 ? 17.464  25.533  -6.985  1.00 20.61 ? 132  CYS A CA  1 
ATOM   1064 C C   . CYS A 1 133 ? 18.233  26.853  -7.041  1.00 20.43 ? 132  CYS A C   1 
ATOM   1065 O O   . CYS A 1 133 ? 18.631  27.375  -6.000  1.00 19.54 ? 132  CYS A O   1 
ATOM   1066 C CB  . CYS A 1 133 ? 18.412  24.364  -7.287  1.00 20.21 ? 132  CYS A CB  1 
ATOM   1067 S SG  . CYS A 1 133 ? 17.759  22.778  -6.768  1.00 22.19 ? 132  CYS A SG  1 
ATOM   1068 N N   . GLN A 1 134 ? 18.440  27.375  -8.254  1.00 21.15 ? 133  GLN A N   1 
ATOM   1069 C CA  . GLN A 1 134 ? 19.096  28.679  -8.438  1.00 22.32 ? 133  GLN A CA  1 
ATOM   1070 C C   . GLN A 1 134 ? 18.331  29.767  -7.701  1.00 22.01 ? 133  GLN A C   1 
ATOM   1071 O O   . GLN A 1 134 ? 18.932  30.573  -6.996  1.00 22.96 ? 133  GLN A O   1 
ATOM   1072 C CB  . GLN A 1 134 ? 19.206  29.043  -9.921  1.00 22.48 ? 133  GLN A CB  1 
ATOM   1073 C CG  . GLN A 1 134 ? 20.108  30.255  -10.229 1.00 25.51 ? 133  GLN A CG  1 
ATOM   1074 C CD  . GLN A 1 134 ? 19.459  31.624  -9.971  1.00 29.71 ? 133  GLN A CD  1 
ATOM   1075 O OE1 . GLN A 1 134 ? 18.229  31.783  -10.052 1.00 30.56 ? 133  GLN A OE1 1 
ATOM   1076 N NE2 . GLN A 1 134 ? 20.297  32.623  -9.665  1.00 31.78 ? 133  GLN A NE2 1 
ATOM   1077 N N   . ARG A 1 135 ? 17.008  29.780  -7.854  1.00 21.61 ? 134  ARG A N   1 
ATOM   1078 C CA  . ARG A 1 135 ? 16.171  30.809  -7.234  1.00 21.36 ? 134  ARG A CA  1 
ATOM   1079 C C   . ARG A 1 135 ? 16.252  30.744  -5.705  1.00 20.67 ? 134  ARG A C   1 
ATOM   1080 O O   . ARG A 1 135 ? 16.371  31.763  -5.033  1.00 19.88 ? 134  ARG A O   1 
ATOM   1081 C CB  . ARG A 1 135 ? 14.716  30.689  -7.714  1.00 21.69 ? 134  ARG A CB  1 
ATOM   1082 C CG  . ARG A 1 135 ? 14.540  30.957  -9.215  1.00 25.49 ? 134  ARG A CG  1 
ATOM   1083 C CD  . ARG A 1 135 ? 13.098  31.239  -9.661  1.00 31.05 ? 134  ARG A CD  1 
ATOM   1084 N NE  . ARG A 1 135 ? 12.589  32.475  -9.062  1.00 36.24 ? 134  ARG A NE  1 
ATOM   1085 C CZ  . ARG A 1 135 ? 11.302  32.801  -8.954  1.00 36.97 ? 134  ARG A CZ  1 
ATOM   1086 N NH1 . ARG A 1 135 ? 10.965  33.950  -8.388  1.00 38.45 ? 134  ARG A NH1 1 
ATOM   1087 N NH2 . ARG A 1 135 ? 10.352  31.994  -9.408  1.00 38.26 ? 134  ARG A NH2 1 
ATOM   1088 N N   . VAL A 1 136 ? 16.207  29.531  -5.153  1.00 18.77 ? 135  VAL A N   1 
ATOM   1089 C CA  . VAL A 1 136 ? 16.284  29.380  -3.711  1.00 18.41 ? 135  VAL A CA  1 
ATOM   1090 C C   . VAL A 1 136 ? 17.684  29.659  -3.132  1.00 18.42 ? 135  VAL A C   1 
ATOM   1091 O O   . VAL A 1 136 ? 17.824  30.449  -2.200  1.00 18.30 ? 135  VAL A O   1 
ATOM   1092 C CB  . VAL A 1 136 ? 15.786  27.988  -3.268  1.00 18.04 ? 135  VAL A CB  1 
ATOM   1093 C CG1 . VAL A 1 136 ? 15.937  27.840  -1.761  1.00 17.03 ? 135  VAL A CG1 1 
ATOM   1094 C CG2 . VAL A 1 136 ? 14.323  27.808  -3.694  1.00 17.16 ? 135  VAL A CG2 1 
ATOM   1095 N N   . ARG A 1 137 ? 18.711  29.005  -3.681  1.00 18.66 ? 136  ARG A N   1 
ATOM   1096 C CA  . ARG A 1 137 ? 20.057  29.085  -3.120  1.00 18.80 ? 136  ARG A CA  1 
ATOM   1097 C C   . ARG A 1 137 ? 20.657  30.488  -3.277  1.00 19.76 ? 136  ARG A C   1 
ATOM   1098 O O   . ARG A 1 137 ? 21.441  30.909  -2.445  1.00 20.25 ? 136  ARG A O   1 
ATOM   1099 C CB  . ARG A 1 137 ? 20.967  28.073  -3.796  1.00 19.25 ? 136  ARG A CB  1 
ATOM   1100 C CG  . ARG A 1 137 ? 20.696  26.645  -3.384  1.00 18.69 ? 136  ARG A CG  1 
ATOM   1101 C CD  . ARG A 1 137 ? 21.347  25.640  -4.322  1.00 20.82 ? 136  ARG A CD  1 
ATOM   1102 N NE  . ARG A 1 137 ? 22.812  25.763  -4.338  1.00 21.94 ? 136  ARG A NE  1 
ATOM   1103 C CZ  . ARG A 1 137 ? 23.621  25.273  -3.406  1.00 22.16 ? 136  ARG A CZ  1 
ATOM   1104 N NH1 . ARG A 1 137 ? 23.136  24.631  -2.349  1.00 19.96 ? 136  ARG A NH1 1 
ATOM   1105 N NH2 . ARG A 1 137 ? 24.932  25.423  -3.536  1.00 23.83 ? 136  ARG A NH2 1 
ATOM   1106 N N   . SER A 1 138 ? 20.271  31.197  -4.336  1.00 19.68 ? 137  SER A N   1 
ATOM   1107 C CA  . SER A 1 138 ? 20.764  32.559  -4.576  1.00 20.19 ? 137  SER A CA  1 
ATOM   1108 C C   . SER A 1 138 ? 20.188  33.568  -3.580  1.00 20.63 ? 137  SER A C   1 
ATOM   1109 O O   . SER A 1 138 ? 20.712  34.683  -3.438  1.00 20.93 ? 137  SER A O   1 
ATOM   1110 C CB  . SER A 1 138 ? 20.460  32.993  -6.012  1.00 20.33 ? 137  SER A CB  1 
ATOM   1111 O OG  . SER A 1 138 ? 19.088  33.317  -6.179  1.00 21.78 ? 137  SER A OG  1 
ATOM   1112 N N   . GLY A 1 139 ? 19.114  33.185  -2.894  1.00 20.38 ? 138  GLY A N   1 
ATOM   1113 C CA  . GLY A 1 139 ? 18.398  34.108  -2.024  1.00 20.95 ? 138  GLY A CA  1 
ATOM   1114 C C   . GLY A 1 139 ? 17.284  34.867  -2.722  1.00 21.32 ? 138  GLY A C   1 
ATOM   1115 O O   . GLY A 1 139 ? 16.594  35.635  -2.083  1.00 21.38 ? 138  GLY A O   1 
ATOM   1116 N N   . ASP A 1 140 ? 17.094  34.638  -4.020  1.00 21.76 ? 139  ASP A N   1 
ATOM   1117 C CA  . ASP A 1 140 ? 16.045  35.323  -4.788  1.00 22.07 ? 139  ASP A CA  1 
ATOM   1118 C C   . ASP A 1 140 ? 14.626  34.946  -4.363  1.00 21.62 ? 139  ASP A C   1 
ATOM   1119 O O   . ASP A 1 140 ? 13.759  35.816  -4.212  1.00 21.31 ? 139  ASP A O   1 
ATOM   1120 C CB  . ASP A 1 140 ? 16.225  35.080  -6.284  1.00 22.89 ? 139  ASP A CB  1 
ATOM   1121 C CG  . ASP A 1 140 ? 17.300  35.956  -6.887  1.00 26.86 ? 139  ASP A CG  1 
ATOM   1122 O OD1 . ASP A 1 140 ? 17.586  35.793  -8.095  1.00 30.52 ? 139  ASP A OD1 1 
ATOM   1123 O OD2 . ASP A 1 140 ? 17.906  36.848  -6.240  1.00 29.22 ? 139  ASP A OD2 1 
ATOM   1124 N N   . TRP A 1 141 ? 14.393  33.649  -4.166  1.00 20.68 ? 140  TRP A N   1 
ATOM   1125 C CA  . TRP A 1 141 ? 13.098  33.164  -3.694  1.00 19.88 ? 140  TRP A CA  1 
ATOM   1126 C C   . TRP A 1 141 ? 12.845  33.673  -2.284  1.00 19.67 ? 140  TRP A C   1 
ATOM   1127 O O   . TRP A 1 141 ? 13.628  33.393  -1.363  1.00 18.89 ? 140  TRP A O   1 
ATOM   1128 C CB  . TRP A 1 141 ? 13.082  31.632  -3.715  1.00 19.97 ? 140  TRP A CB  1 
ATOM   1129 C CG  . TRP A 1 141 ? 11.736  31.014  -3.477  1.00 20.11 ? 140  TRP A CG  1 
ATOM   1130 C CD1 . TRP A 1 141 ? 11.132  30.796  -2.262  1.00 19.67 ? 140  TRP A CD1 1 
ATOM   1131 C CD2 . TRP A 1 141 ? 10.830  30.509  -4.465  1.00 20.24 ? 140  TRP A CD2 1 
ATOM   1132 N NE1 . TRP A 1 141 ? 9.907   30.200  -2.440  1.00 21.01 ? 140  TRP A NE1 1 
ATOM   1133 C CE2 . TRP A 1 141 ? 9.693   30.009  -3.778  1.00 21.24 ? 140  TRP A CE2 1 
ATOM   1134 C CE3 . TRP A 1 141 ? 10.855  30.426  -5.864  1.00 22.20 ? 140  TRP A CE3 1 
ATOM   1135 C CZ2 . TRP A 1 141 ? 8.596   29.436  -4.443  1.00 22.54 ? 140  TRP A CZ2 1 
ATOM   1136 C CZ3 . TRP A 1 141 ? 9.761   29.853  -6.524  1.00 24.57 ? 140  TRP A CZ3 1 
ATOM   1137 C CH2 . TRP A 1 141 ? 8.650   29.365  -5.807  1.00 23.78 ? 140  TRP A CH2 1 
ATOM   1138 N N   . LYS A 1 142 ? 11.750  34.428  -2.117  1.00 19.17 ? 141  LYS A N   1 
ATOM   1139 C CA  . LYS A 1 142 ? 11.405  35.006  -0.826  1.00 19.76 ? 141  LYS A CA  1 
ATOM   1140 C C   . LYS A 1 142 ? 10.185  34.362  -0.175  1.00 19.03 ? 141  LYS A C   1 
ATOM   1141 O O   . LYS A 1 142 ? 9.277   33.902  -0.860  1.00 20.32 ? 141  LYS A O   1 
ATOM   1142 C CB  . LYS A 1 142 ? 11.182  36.525  -0.956  1.00 19.75 ? 141  LYS A CB  1 
ATOM   1143 C CG  . LYS A 1 142 ? 12.367  37.285  -1.586  1.00 20.07 ? 141  LYS A CG  1 
ATOM   1144 C CD  . LYS A 1 142 ? 13.571  37.331  -0.639  1.00 20.46 ? 141  LYS A CD  1 
ATOM   1145 C CE  . LYS A 1 142 ? 14.777  38.005  -1.302  1.00 22.00 ? 141  LYS A CE  1 
ATOM   1146 N NZ  . LYS A 1 142 ? 15.865  38.281  -0.319  1.00 22.92 ? 141  LYS A NZ  1 
ATOM   1147 N N   . GLY A 1 143 ? 10.181  34.337  1.153   1.00 19.12 ? 142  GLY A N   1 
ATOM   1148 C CA  . GLY A 1 143 ? 9.052   33.828  1.908   1.00 18.13 ? 142  GLY A CA  1 
ATOM   1149 C C   . GLY A 1 143 ? 7.985   34.900  2.020   1.00 18.79 ? 142  GLY A C   1 
ATOM   1150 O O   . GLY A 1 143 ? 8.123   35.983  1.443   1.00 19.24 ? 142  GLY A O   1 
ATOM   1151 N N   . TYR A 1 144 ? 6.940   34.610  2.788   1.00 18.51 ? 143  TYR A N   1 
ATOM   1152 C CA  . TYR A 1 144 ? 5.753   35.469  2.809   1.00 19.98 ? 143  TYR A CA  1 
ATOM   1153 C C   . TYR A 1 144 ? 5.997   36.819  3.463   1.00 19.91 ? 143  TYR A C   1 
ATOM   1154 O O   . TYR A 1 144 ? 5.188   37.741  3.292   1.00 20.51 ? 143  TYR A O   1 
ATOM   1155 C CB  . TYR A 1 144 ? 4.547   34.757  3.442   1.00 19.95 ? 143  TYR A CB  1 
ATOM   1156 C CG  . TYR A 1 144 ? 4.575   34.666  4.949   1.00 20.63 ? 143  TYR A CG  1 
ATOM   1157 C CD1 . TYR A 1 144 ? 3.907   35.611  5.737   1.00 20.33 ? 143  TYR A CD1 1 
ATOM   1158 C CD2 . TYR A 1 144 ? 5.260   33.628  5.601   1.00 21.19 ? 143  TYR A CD2 1 
ATOM   1159 C CE1 . TYR A 1 144 ? 3.923   35.533  7.121   1.00 21.96 ? 143  TYR A CE1 1 
ATOM   1160 C CE2 . TYR A 1 144 ? 5.280   33.551  6.998   1.00 20.42 ? 143  TYR A CE2 1 
ATOM   1161 C CZ  . TYR A 1 144 ? 4.604   34.510  7.745   1.00 22.90 ? 143  TYR A CZ  1 
ATOM   1162 O OH  . TYR A 1 144 ? 4.609   34.459  9.122   1.00 23.26 ? 143  TYR A OH  1 
ATOM   1163 N N   . THR A 1 145 ? 7.087   36.947  4.222   1.00 19.65 ? 144  THR A N   1 
ATOM   1164 C CA  . THR A 1 145 ? 7.440   38.254  4.787   1.00 20.38 ? 144  THR A CA  1 
ATOM   1165 C C   . THR A 1 145 ? 8.600   38.941  4.072   1.00 20.38 ? 144  THR A C   1 
ATOM   1166 O O   . THR A 1 145 ? 9.096   39.946  4.554   1.00 21.46 ? 144  THR A O   1 
ATOM   1167 C CB  . THR A 1 145 ? 7.747   38.194  6.299   1.00 19.76 ? 144  THR A CB  1 
ATOM   1168 O OG1 . THR A 1 145 ? 8.915   37.387  6.526   1.00 21.41 ? 144  THR A OG1 1 
ATOM   1169 C CG2 . THR A 1 145 ? 6.635   37.533  7.080   1.00 19.27 ? 144  THR A CG2 1 
ATOM   1170 N N   . GLY A 1 146 ? 9.023   38.404  2.929   1.00 20.73 ? 145  GLY A N   1 
ATOM   1171 C CA  . GLY A 1 146 ? 10.073  39.016  2.128   1.00 20.29 ? 145  GLY A CA  1 
ATOM   1172 C C   . GLY A 1 146 ? 11.513  38.628  2.466   1.00 20.88 ? 145  GLY A C   1 
ATOM   1173 O O   . GLY A 1 146 ? 12.454  39.333  2.068   1.00 20.47 ? 145  GLY A O   1 
ATOM   1174 N N   . LYS A 1 147 ? 11.682  37.520  3.191   1.00 20.52 ? 146  LYS A N   1 
ATOM   1175 C CA  . LYS A 1 147 ? 13.010  37.027  3.616   1.00 20.17 ? 146  LYS A CA  1 
ATOM   1176 C C   . LYS A 1 147 ? 13.480  35.846  2.768   1.00 20.29 ? 146  LYS A C   1 
ATOM   1177 O O   . LYS A 1 147 ? 12.668  35.022  2.335   1.00 19.68 ? 146  LYS A O   1 
ATOM   1178 C CB  . LYS A 1 147 ? 12.974  36.584  5.083   1.00 20.46 ? 146  LYS A CB  1 
ATOM   1179 C CG  . LYS A 1 147 ? 12.772  37.708  6.084   1.00 21.07 ? 146  LYS A CG  1 
ATOM   1180 C CD  . LYS A 1 147 ? 13.045  37.231  7.500   1.00 25.73 ? 146  LYS A CD  1 
ATOM   1181 C CE  . LYS A 1 147 ? 12.594  38.220  8.542   1.00 27.35 ? 146  LYS A CE  1 
ATOM   1182 N NZ  . LYS A 1 147 ? 12.399  37.560  9.867   1.00 29.45 ? 146  LYS A NZ  1 
ATOM   1183 N N   . SER A 1 148 ? 14.793  35.750  2.536   1.00 19.32 ? 147  SER A N   1 
ATOM   1184 C CA  . SER A 1 148 ? 15.354  34.576  1.859   1.00 19.57 ? 147  SER A CA  1 
ATOM   1185 C C   . SER A 1 148 ? 15.113  33.300  2.680   1.00 19.09 ? 147  SER A C   1 
ATOM   1186 O O   . SER A 1 148 ? 14.930  33.354  3.907   1.00 19.09 ? 147  SER A O   1 
ATOM   1187 C CB  . SER A 1 148 ? 16.851  34.781  1.581   1.00 19.66 ? 147  SER A CB  1 
ATOM   1188 O OG  . SER A 1 148 ? 17.044  35.834  0.632   1.00 21.86 ? 147  SER A OG  1 
ATOM   1189 N N   . ILE A 1 149 ? 15.092  32.157  1.995   1.00 19.13 ? 148  ILE A N   1 
ATOM   1190 C CA  . ILE A 1 149 ? 14.876  30.857  2.647   1.00 18.59 ? 148  ILE A CA  1 
ATOM   1191 C C   . ILE A 1 149 ? 16.183  30.360  3.296   1.00 18.66 ? 148  ILE A C   1 
ATOM   1192 O O   . ILE A 1 149 ? 17.248  30.405  2.654   1.00 18.28 ? 148  ILE A O   1 
ATOM   1193 C CB  . ILE A 1 149 ? 14.365  29.829  1.604   1.00 18.53 ? 148  ILE A CB  1 
ATOM   1194 C CG1 . ILE A 1 149 ? 12.997  30.238  1.014   1.00 18.64 ? 148  ILE A CG1 1 
ATOM   1195 C CG2 . ILE A 1 149 ? 14.364  28.391  2.174   1.00 19.31 ? 148  ILE A CG2 1 
ATOM   1196 C CD1 . ILE A 1 149 ? 11.911  30.506  2.035   1.00 15.94 ? 148  ILE A CD1 1 
ATOM   1197 N N   . THR A 1 150 ? 16.097  29.921  4.555   1.00 18.34 ? 149  THR A N   1 
ATOM   1198 C CA  . THR A 1 150 ? 17.254  29.390  5.289   1.00 18.06 ? 149  THR A CA  1 
ATOM   1199 C C   . THR A 1 150 ? 17.163  27.903  5.535   1.00 17.86 ? 149  THR A C   1 
ATOM   1200 O O   . THR A 1 150 ? 18.173  27.274  5.829   1.00 18.34 ? 149  THR A O   1 
ATOM   1201 C CB  . THR A 1 150 ? 17.462  30.083  6.657   1.00 18.56 ? 149  THR A CB  1 
ATOM   1202 O OG1 . THR A 1 150 ? 16.270  29.980  7.460   1.00 17.59 ? 149  THR A OG1 1 
ATOM   1203 C CG2 . THR A 1 150 ? 17.735  31.608  6.483   1.00 18.07 ? 149  THR A CG2 1 
ATOM   1204 N N   . ASP A 1 151 ? 15.951  27.356  5.454   1.00 17.14 ? 150  ASP A N   1 
ATOM   1205 C CA  . ASP A 1 151 ? 15.729  25.973  5.869   1.00 17.28 ? 150  ASP A CA  1 
ATOM   1206 C C   . ASP A 1 151 ? 14.837  25.258  4.862   1.00 17.40 ? 150  ASP A C   1 
ATOM   1207 O O   . ASP A 1 151 ? 13.799  25.780  4.463   1.00 16.77 ? 150  ASP A O   1 
ATOM   1208 C CB  . ASP A 1 151 ? 15.066  25.943  7.256   1.00 17.16 ? 150  ASP A CB  1 
ATOM   1209 C CG  . ASP A 1 151 ? 15.991  26.446  8.362   1.00 18.85 ? 150  ASP A CG  1 
ATOM   1210 O OD1 . ASP A 1 151 ? 15.935  27.651  8.706   1.00 18.74 ? 150  ASP A OD1 1 
ATOM   1211 O OD2 . ASP A 1 151 ? 16.812  25.706  8.938   1.00 19.23 ? 150  ASP A OD2 1 
ATOM   1212 N N   . ILE A 1 152 ? 15.252  24.062  4.459   1.00 17.05 ? 151  ILE A N   1 
ATOM   1213 C CA  . ILE A 1 152 ? 14.460  23.221  3.582   1.00 17.74 ? 151  ILE A CA  1 
ATOM   1214 C C   . ILE A 1 152 ? 13.975  22.046  4.425   1.00 18.23 ? 151  ILE A C   1 
ATOM   1215 O O   . ILE A 1 152 ? 14.778  21.442  5.149   1.00 18.54 ? 151  ILE A O   1 
ATOM   1216 C CB  . ILE A 1 152 ? 15.341  22.697  2.423   1.00 18.16 ? 151  ILE A CB  1 
ATOM   1217 C CG1 . ILE A 1 152 ? 16.019  23.851  1.678   1.00 19.43 ? 151  ILE A CG1 1 
ATOM   1218 C CG2 . ILE A 1 152 ? 14.530  21.808  1.469   1.00 19.56 ? 151  ILE A CG2 1 
ATOM   1219 C CD1 . ILE A 1 152 ? 15.043  24.829  1.052   1.00 21.97 ? 151  ILE A CD1 1 
ATOM   1220 N N   . ILE A 1 153 ? 12.682  21.732  4.360   1.00 17.01 ? 152  ILE A N   1 
ATOM   1221 C CA  . ILE A 1 153 ? 12.183  20.587  5.114   1.00 18.28 ? 152  ILE A CA  1 
ATOM   1222 C C   . ILE A 1 153 ? 11.531  19.576  4.191   1.00 17.98 ? 152  ILE A C   1 
ATOM   1223 O O   . ILE A 1 153 ? 10.439  19.818  3.638   1.00 17.54 ? 152  ILE A O   1 
ATOM   1224 C CB  . ILE A 1 153 ? 11.192  20.984  6.262   1.00 17.91 ? 152  ILE A CB  1 
ATOM   1225 C CG1 . ILE A 1 153 ? 11.816  21.994  7.225   1.00 19.09 ? 152  ILE A CG1 1 
ATOM   1226 C CG2 . ILE A 1 153 ? 10.796  19.748  7.056   1.00 18.58 ? 152  ILE A CG2 1 
ATOM   1227 C CD1 . ILE A 1 153 ? 11.640  23.448  6.805   1.00 20.04 ? 152  ILE A CD1 1 
ATOM   1228 N N   . ASN A 1 154 ? 12.189  18.433  4.044   1.00 18.61 ? 153  ASN A N   1 
ATOM   1229 C CA  . ASN A 1 154 ? 11.627  17.346  3.272   1.00 18.79 ? 153  ASN A CA  1 
ATOM   1230 C C   . ASN A 1 154 ? 10.657  16.573  4.138   1.00 18.41 ? 153  ASN A C   1 
ATOM   1231 O O   . ASN A 1 154 ? 11.027  16.116  5.222   1.00 19.13 ? 153  ASN A O   1 
ATOM   1232 C CB  . ASN A 1 154 ? 12.720  16.397  2.802   1.00 18.78 ? 153  ASN A CB  1 
ATOM   1233 C CG  . ASN A 1 154 ? 12.243  15.480  1.701   1.00 20.28 ? 153  ASN A CG  1 
ATOM   1234 O OD1 . ASN A 1 154 ? 12.066  15.905  0.553   1.00 22.17 ? 153  ASN A OD1 1 
ATOM   1235 N ND2 . ASN A 1 154 ? 12.018  14.207  2.045   1.00 20.71 ? 153  ASN A ND2 1 
ATOM   1236 N N   . ILE A 1 155 ? 9.419   16.446  3.674   1.00 17.93 ? 154  ILE A N   1 
ATOM   1237 C CA  . ILE A 1 155 ? 8.432   15.605  4.351   1.00 17.83 ? 154  ILE A CA  1 
ATOM   1238 C C   . ILE A 1 155 ? 8.118   14.434  3.433   1.00 17.78 ? 154  ILE A C   1 
ATOM   1239 O O   . ILE A 1 155 ? 7.708   14.614  2.282   1.00 19.39 ? 154  ILE A O   1 
ATOM   1240 C CB  . ILE A 1 155 ? 7.142   16.400  4.718   1.00 17.25 ? 154  ILE A CB  1 
ATOM   1241 C CG1 . ILE A 1 155 ? 7.464   17.610  5.601   1.00 17.11 ? 154  ILE A CG1 1 
ATOM   1242 C CG2 . ILE A 1 155 ? 6.108   15.479  5.408   1.00 17.64 ? 154  ILE A CG2 1 
ATOM   1243 C CD1 . ILE A 1 155 ? 6.221   18.380  6.128   1.00 17.50 ? 154  ILE A CD1 1 
ATOM   1244 N N   . GLY A 1 156 ? 8.319   13.227  3.940   1.00 18.31 ? 155  GLY A N   1 
ATOM   1245 C CA  . GLY A 1 156 ? 8.176   12.041  3.126   1.00 17.68 ? 155  GLY A CA  1 
ATOM   1246 C C   . GLY A 1 156 ? 8.674   10.854  3.917   1.00 18.42 ? 155  GLY A C   1 
ATOM   1247 O O   . GLY A 1 156 ? 9.359   11.026  4.920   1.00 17.45 ? 155  GLY A O   1 
ATOM   1248 N N   . ILE A 1 157 ? 8.364   9.655   3.445   1.00 18.55 ? 156  ILE A N   1 
ATOM   1249 C CA  . ILE A 1 157 ? 8.728   8.458   4.185   1.00 19.02 ? 156  ILE A CA  1 
ATOM   1250 C C   . ILE A 1 157 ? 9.179   7.361   3.231   1.00 18.42 ? 156  ILE A C   1 
ATOM   1251 O O   . ILE A 1 157 ? 8.802   7.368   2.077   1.00 18.14 ? 156  ILE A O   1 
ATOM   1252 C CB  . ILE A 1 157 ? 7.579   8.035   5.149   1.00 19.23 ? 156  ILE A CB  1 
ATOM   1253 C CG1 . ILE A 1 157 ? 8.104   7.085   6.246   1.00 19.23 ? 156  ILE A CG1 1 
ATOM   1254 C CG2 . ILE A 1 157 ? 6.367   7.540   4.371   1.00 19.51 ? 156  ILE A CG2 1 
ATOM   1255 C CD1 . ILE A 1 157 ? 7.135   6.859   7.472   1.00 19.64 ? 156  ILE A CD1 1 
ATOM   1256 N N   . GLY A 1 158 ? 10.036  6.468   3.707   1.00 19.52 ? 157  GLY A N   1 
ATOM   1257 C CA  . GLY A 1 158 ? 10.560  5.395   2.878   1.00 19.38 ? 157  GLY A CA  1 
ATOM   1258 C C   . GLY A 1 158 ? 11.332  5.928   1.685   1.00 19.30 ? 157  GLY A C   1 
ATOM   1259 O O   . GLY A 1 158 ? 12.331  6.639   1.845   1.00 20.25 ? 157  GLY A O   1 
ATOM   1260 N N   . GLY A 1 159 ? 10.855  5.597   0.486   1.00 19.39 ? 158  GLY A N   1 
ATOM   1261 C CA  . GLY A 1 159 ? 11.539  5.962   -0.741  1.00 18.90 ? 158  GLY A CA  1 
ATOM   1262 C C   . GLY A 1 159 ? 11.607  7.467   -0.949  1.00 19.26 ? 158  GLY A C   1 
ATOM   1263 O O   . GLY A 1 159 ? 12.473  7.961   -1.648  1.00 19.79 ? 158  GLY A O   1 
ATOM   1264 N N   . SER A 1 160 ? 10.691  8.188   -0.314  1.00 19.13 ? 159  SER A N   1 
ATOM   1265 C CA  . SER A 1 160 ? 10.664  9.654   -0.387  1.00 19.28 ? 159  SER A CA  1 
ATOM   1266 C C   . SER A 1 160 ? 11.492  10.343  0.720   1.00 19.17 ? 159  SER A C   1 
ATOM   1267 O O   . SER A 1 160 ? 11.458  11.588  0.844   1.00 20.57 ? 159  SER A O   1 
ATOM   1268 C CB  . SER A 1 160 ? 9.211   10.120  -0.303  1.00 19.48 ? 159  SER A CB  1 
ATOM   1269 O OG  . SER A 1 160 ? 8.503   9.826   -1.494  1.00 20.27 ? 159  SER A OG  1 
ATOM   1270 N N   . ASP A 1 161 ? 12.241  9.560   1.496   1.00 17.59 ? 160  ASP A N   1 
ATOM   1271 C CA  . ASP A 1 161 ? 12.977  10.060  2.652   1.00 17.81 ? 160  ASP A CA  1 
ATOM   1272 C C   . ASP A 1 161 ? 14.416  9.533   2.701   1.00 17.35 ? 160  ASP A C   1 
ATOM   1273 O O   . ASP A 1 161 ? 15.357  10.313  2.776   1.00 16.98 ? 160  ASP A O   1 
ATOM   1274 C CB  . ASP A 1 161 ? 12.230  9.691   3.946   1.00 17.35 ? 160  ASP A CB  1 
ATOM   1275 C CG  . ASP A 1 161 ? 13.095  9.798   5.203   1.00 19.30 ? 160  ASP A CG  1 
ATOM   1276 O OD1 . ASP A 1 161 ? 13.404  10.935  5.647   1.00 19.40 ? 160  ASP A OD1 1 
ATOM   1277 O OD2 . ASP A 1 161 ? 13.464  8.791   5.865   1.00 20.79 ? 160  ASP A OD2 1 
ATOM   1278 N N   . LEU A 1 162 ? 14.563  8.207   2.619   1.00 17.07 ? 161  LEU A N   1 
ATOM   1279 C CA  . LEU A 1 162 ? 15.844  7.560   2.872   1.00 17.06 ? 161  LEU A CA  1 
ATOM   1280 C C   . LEU A 1 162 ? 16.935  7.974   1.889   1.00 16.70 ? 161  LEU A C   1 
ATOM   1281 O O   . LEU A 1 162 ? 18.078  8.159   2.293   1.00 17.92 ? 161  LEU A O   1 
ATOM   1282 C CB  . LEU A 1 162 ? 15.723  6.013   2.891   1.00 17.54 ? 161  LEU A CB  1 
ATOM   1283 C CG  . LEU A 1 162 ? 14.904  5.369   4.024   1.00 20.18 ? 161  LEU A CG  1 
ATOM   1284 C CD1 . LEU A 1 162 ? 14.876  3.847   3.858   1.00 21.06 ? 161  LEU A CD1 1 
ATOM   1285 C CD2 . LEU A 1 162 ? 15.444  5.722   5.411   1.00 20.96 ? 161  LEU A CD2 1 
ATOM   1286 N N   . GLY A 1 163 ? 16.589  8.106   0.617   1.00 16.59 ? 162  GLY A N   1 
ATOM   1287 C CA  . GLY A 1 163 ? 17.557  8.501   -0.395  1.00 17.21 ? 162  GLY A CA  1 
ATOM   1288 C C   . GLY A 1 163 ? 18.076  9.921   -0.179  1.00 17.32 ? 162  GLY A C   1 
ATOM   1289 O O   . GLY A 1 163 ? 19.290  10.146  -0.067  1.00 16.68 ? 162  GLY A O   1 
ATOM   1290 N N   . PRO A 1 164 ? 17.165  10.887  -0.174  1.00 17.52 ? 163  PRO A N   1 
ATOM   1291 C CA  . PRO A 1 164 ? 17.542  12.282  0.076   1.00 17.49 ? 163  PRO A CA  1 
ATOM   1292 C C   . PRO A 1 164 ? 18.313  12.438  1.386   1.00 17.14 ? 163  PRO A C   1 
ATOM   1293 O O   . PRO A 1 164 ? 19.317  13.169  1.405   1.00 17.46 ? 163  PRO A O   1 
ATOM   1294 C CB  . PRO A 1 164 ? 16.179  13.008  0.103   1.00 18.37 ? 163  PRO A CB  1 
ATOM   1295 C CG  . PRO A 1 164 ? 15.348  12.189  -0.820  1.00 16.78 ? 163  PRO A CG  1 
ATOM   1296 C CD  . PRO A 1 164 ? 15.746  10.755  -0.551  1.00 17.25 ? 163  PRO A CD  1 
ATOM   1297 N N   . LEU A 1 165 ? 17.867  11.772  2.449   1.00 16.17 ? 164  LEU A N   1 
ATOM   1298 C CA  . LEU A 1 165 ? 18.558  11.829  3.722   1.00 16.25 ? 164  LEU A CA  1 
ATOM   1299 C C   . LEU A 1 165 ? 19.972  11.244  3.595   1.00 16.10 ? 164  LEU A C   1 
ATOM   1300 O O   . LEU A 1 165 ? 20.961  11.887  3.977   1.00 14.69 ? 164  LEU A O   1 
ATOM   1301 C CB  . LEU A 1 165 ? 17.769  11.097  4.820   1.00 16.44 ? 164  LEU A CB  1 
ATOM   1302 C CG  . LEU A 1 165 ? 18.218  11.294  6.270   1.00 18.22 ? 164  LEU A CG  1 
ATOM   1303 C CD1 . LEU A 1 165 ? 17.063  10.987  7.213   1.00 22.61 ? 164  LEU A CD1 1 
ATOM   1304 C CD2 . LEU A 1 165 ? 19.415  10.444  6.656   1.00 21.15 ? 164  LEU A CD2 1 
ATOM   1305 N N   . MET A 1 166 ? 20.077  10.025  3.073   1.00 15.23 ? 165  MET A N   1 
ATOM   1306 C CA  . MET A 1 166 ? 21.403  9.404   3.012   1.00 15.05 ? 165  MET A CA  1 
ATOM   1307 C C   . MET A 1 166 ? 22.369  10.222  2.147   1.00 14.92 ? 165  MET A C   1 
ATOM   1308 O O   . MET A 1 166 ? 23.538  10.368  2.504   1.00 15.51 ? 165  MET A O   1 
ATOM   1309 C CB  . MET A 1 166 ? 21.321  7.963   2.505   1.00 15.65 ? 165  MET A CB  1 
ATOM   1310 C CG  . MET A 1 166 ? 22.677  7.229   2.417   1.00 15.03 ? 165  MET A CG  1 
ATOM   1311 S SD  . MET A 1 166 ? 23.466  7.452   0.834   1.00 18.07 ? 165  MET A SD  1 
ATOM   1312 C CE  . MET A 1 166 ? 22.549  6.249   -0.163  1.00 18.29 ? 165  MET A CE  1 
ATOM   1313 N N   . VAL A 1 167 ? 21.876  10.767  1.031   1.00 15.08 ? 166  VAL A N   1 
ATOM   1314 C CA  . VAL A 1 167 ? 22.748  11.476  0.092   1.00 14.73 ? 166  VAL A CA  1 
ATOM   1315 C C   . VAL A 1 167 ? 23.194  12.835  0.656   1.00 14.91 ? 166  VAL A C   1 
ATOM   1316 O O   . VAL A 1 167 ? 24.365  13.174  0.549   1.00 14.89 ? 166  VAL A O   1 
ATOM   1317 C CB  . VAL A 1 167 ? 22.126  11.578  -1.329  1.00 15.18 ? 166  VAL A CB  1 
ATOM   1318 C CG1 . VAL A 1 167 ? 22.966  12.461  -2.255  1.00 16.16 ? 166  VAL A CG1 1 
ATOM   1319 C CG2 . VAL A 1 167 ? 22.005  10.166  -1.928  1.00 14.28 ? 166  VAL A CG2 1 
ATOM   1320 N N   . THR A 1 168 ? 22.274  13.604  1.231   1.00 14.70 ? 167  THR A N   1 
ATOM   1321 C CA  . THR A 1 168 ? 22.686  14.883  1.852   1.00 15.42 ? 167  THR A CA  1 
ATOM   1322 C C   . THR A 1 168 ? 23.651  14.677  3.032   1.00 16.39 ? 167  THR A C   1 
ATOM   1323 O O   . THR A 1 168 ? 24.615  15.428  3.197   1.00 16.97 ? 167  THR A O   1 
ATOM   1324 C CB  . THR A 1 168 ? 21.477  15.748  2.242   1.00 15.57 ? 167  THR A CB  1 
ATOM   1325 O OG1 . THR A 1 168 ? 20.609  14.996  3.094   1.00 16.13 ? 167  THR A OG1 1 
ATOM   1326 C CG2 . THR A 1 168 ? 20.636  16.075  0.980   1.00 16.88 ? 167  THR A CG2 1 
ATOM   1327 N N   . GLU A 1 169 ? 23.440  13.608  3.810   1.00 16.33 ? 168  GLU A N   1 
ATOM   1328 C CA  . GLU A 1 169 ? 24.403  13.252  4.846   1.00 16.36 ? 168  GLU A CA  1 
ATOM   1329 C C   . GLU A 1 169 ? 25.772  12.913  4.265   1.00 16.98 ? 168  GLU A C   1 
ATOM   1330 O O   . GLU A 1 169 ? 26.801  13.392  4.766   1.00 16.31 ? 168  GLU A O   1 
ATOM   1331 C CB  . GLU A 1 169 ? 23.883  12.093  5.713   1.00 16.54 ? 168  GLU A CB  1 
ATOM   1332 C CG  . GLU A 1 169 ? 22.775  12.501  6.671   1.00 17.72 ? 168  GLU A CG  1 
ATOM   1333 C CD  . GLU A 1 169 ? 23.208  13.584  7.644   1.00 20.02 ? 168  GLU A CD  1 
ATOM   1334 O OE1 . GLU A 1 169 ? 22.640  14.692  7.598   1.00 21.69 ? 168  GLU A OE1 1 
ATOM   1335 O OE2 . GLU A 1 169 ? 24.111  13.331  8.457   1.00 17.68 ? 168  GLU A OE2 1 
ATOM   1336 N N   . ALA A 1 170 ? 25.781  12.086  3.217   1.00 16.54 ? 169  ALA A N   1 
ATOM   1337 C CA  . ALA A 1 170 ? 27.032  11.605  2.613   1.00 16.43 ? 169  ALA A CA  1 
ATOM   1338 C C   . ALA A 1 170 ? 27.803  12.723  1.901   1.00 16.54 ? 169  ALA A C   1 
ATOM   1339 O O   . ALA A 1 170 ? 29.037  12.700  1.840   1.00 15.64 ? 169  ALA A O   1 
ATOM   1340 C CB  . ALA A 1 170 ? 26.731  10.469  1.639   1.00 17.07 ? 169  ALA A CB  1 
ATOM   1341 N N   . LEU A 1 171 ? 27.059  13.686  1.364   1.00 15.83 ? 170  LEU A N   1 
ATOM   1342 C CA  . LEU A 1 171 ? 27.635  14.767  0.559   1.00 16.63 ? 170  LEU A CA  1 
ATOM   1343 C C   . LEU A 1 171 ? 27.666  16.106  1.301   1.00 17.34 ? 170  LEU A C   1 
ATOM   1344 O O   . LEU A 1 171 ? 27.761  17.161  0.685   1.00 17.02 ? 170  LEU A O   1 
ATOM   1345 C CB  . LEU A 1 171 ? 26.877  14.893  -0.768  1.00 16.65 ? 170  LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 171 ? 26.951  13.654  -1.672  1.00 17.37 ? 170  LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 171 ? 26.307  13.994  -3.016  1.00 15.66 ? 170  LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 171 ? 28.412  13.195  -1.873  1.00 18.02 ? 170  LEU A CD2 1 
ATOM   1349 N N   . LYS A 1 172 ? 27.604  16.038  2.629   1.00 17.93 ? 171  LYS A N   1 
ATOM   1350 C CA  . LYS A 1 172 ? 27.600  17.214  3.509   1.00 18.38 ? 171  LYS A CA  1 
ATOM   1351 C C   . LYS A 1 172 ? 28.706  18.267  3.222   1.00 18.85 ? 171  LYS A C   1 
ATOM   1352 O O   . LYS A 1 172 ? 28.419  19.472  3.247   1.00 18.89 ? 171  LYS A O   1 
ATOM   1353 C CB  . LYS A 1 172 ? 27.609  16.723  4.974   1.00 18.48 ? 171  LYS A CB  1 
ATOM   1354 C CG  . LYS A 1 172 ? 27.213  17.731  6.056   1.00 19.42 ? 171  LYS A CG  1 
ATOM   1355 C CD  . LYS A 1 172 ? 25.808  18.313  5.855   1.00 21.98 ? 171  LYS A CD  1 
ATOM   1356 C CE  . LYS A 1 172 ? 24.710  17.288  6.142   1.00 20.30 ? 171  LYS A CE  1 
ATOM   1357 N NZ  . LYS A 1 172 ? 23.355  17.925  5.973   1.00 20.29 ? 171  LYS A NZ  1 
ATOM   1358 N N   . PRO A 1 173 ? 29.948  17.859  2.930   1.00 19.37 ? 172  PRO A N   1 
ATOM   1359 C CA  . PRO A 1 173 ? 30.995  18.837  2.554   1.00 19.82 ? 172  PRO A CA  1 
ATOM   1360 C C   . PRO A 1 173 ? 30.679  19.643  1.291   1.00 20.73 ? 172  PRO A C   1 
ATOM   1361 O O   . PRO A 1 173 ? 31.300  20.693  1.072   1.00 22.23 ? 172  PRO A O   1 
ATOM   1362 C CB  . PRO A 1 173 ? 32.227  17.965  2.289   1.00 20.32 ? 172  PRO A CB  1 
ATOM   1363 C CG  . PRO A 1 173 ? 31.972  16.712  2.946   1.00 19.17 ? 172  PRO A CG  1 
ATOM   1364 C CD  . PRO A 1 173 ? 30.491  16.490  2.973   1.00 19.33 ? 172  PRO A CD  1 
ATOM   1365 N N   . TYR A 1 174 ? 29.743  19.170  0.480   1.00 20.29 ? 173  TYR A N   1 
ATOM   1366 C CA  . TYR A 1 174 ? 29.387  19.856  -0.762  1.00 20.94 ? 173  TYR A CA  1 
ATOM   1367 C C   . TYR A 1 174 ? 28.232  20.839  -0.618  1.00 21.46 ? 173  TYR A C   1 
ATOM   1368 O O   . TYR A 1 174 ? 27.790  21.401  -1.621  1.00 22.09 ? 173  TYR A O   1 
ATOM   1369 C CB  . TYR A 1 174 ? 29.114  18.835  -1.876  1.00 20.65 ? 173  TYR A CB  1 
ATOM   1370 C CG  . TYR A 1 174 ? 30.345  18.015  -2.141  1.00 20.60 ? 173  TYR A CG  1 
ATOM   1371 C CD1 . TYR A 1 174 ? 30.510  16.777  -1.542  1.00 19.43 ? 173  TYR A CD1 1 
ATOM   1372 C CD2 . TYR A 1 174 ? 31.373  18.510  -2.945  1.00 19.66 ? 173  TYR A CD2 1 
ATOM   1373 C CE1 . TYR A 1 174 ? 31.672  16.020  -1.730  1.00 17.95 ? 173  TYR A CE1 1 
ATOM   1374 C CE2 . TYR A 1 174 ? 32.540  17.767  -3.153  1.00 20.60 ? 173  TYR A CE2 1 
ATOM   1375 C CZ  . TYR A 1 174 ? 32.676  16.515  -2.537  1.00 18.98 ? 173  TYR A CZ  1 
ATOM   1376 O OH  . TYR A 1 174 ? 33.805  15.768  -2.735  1.00 17.79 ? 173  TYR A OH  1 
ATOM   1377 N N   . SER A 1 175 ? 27.781  21.050  0.621   1.00 22.06 ? 174  SER A N   1 
ATOM   1378 C CA  . SER A 1 175 ? 26.614  21.892  0.924   1.00 23.36 ? 174  SER A CA  1 
ATOM   1379 C C   . SER A 1 175 ? 26.946  23.290  1.456   1.00 24.25 ? 174  SER A C   1 
ATOM   1380 O O   . SER A 1 175 ? 26.061  23.992  1.959   1.00 23.99 ? 174  SER A O   1 
ATOM   1381 C CB  . SER A 1 175 ? 25.726  21.186  1.952   1.00 23.30 ? 174  SER A CB  1 
ATOM   1382 O OG  . SER A 1 175 ? 26.346  21.162  3.224   1.00 23.85 ? 174  SER A OG  1 
ATOM   1383 N N   . LYS A 1 176 ? 28.203  23.703  1.344   1.00 25.06 ? 175  LYS A N   1 
ATOM   1384 C CA  . LYS A 1 176 ? 28.606  24.991  1.899   1.00 26.28 ? 175  LYS A CA  1 
ATOM   1385 C C   . LYS A 1 176 ? 27.863  26.096  1.174   1.00 26.46 ? 175  LYS A C   1 
ATOM   1386 O O   . LYS A 1 176 ? 27.707  26.050  -0.041  1.00 26.96 ? 175  LYS A O   1 
ATOM   1387 C CB  . LYS A 1 176 ? 30.122  25.169  1.804   1.00 26.22 ? 175  LYS A CB  1 
ATOM   1388 C CG  . LYS A 1 176 ? 30.876  24.406  2.881   1.00 27.38 ? 175  LYS A CG  1 
ATOM   1389 C CD  . LYS A 1 176 ? 32.361  24.744  2.866   1.00 30.44 ? 175  LYS A CD  1 
ATOM   1390 C CE  . LYS A 1 176 ? 33.166  23.841  1.949   1.00 31.76 ? 175  LYS A CE  1 
ATOM   1391 N NZ  . LYS A 1 176 ? 33.354  22.453  2.522   1.00 33.18 ? 175  LYS A NZ  1 
ATOM   1392 N N   . GLY A 1 177 ? 27.363  27.063  1.929   1.00 27.33 ? 176  GLY A N   1 
ATOM   1393 C CA  . GLY A 1 177 ? 26.549  28.105  1.337   1.00 28.13 ? 176  GLY A CA  1 
ATOM   1394 C C   . GLY A 1 177 ? 25.111  27.730  1.030   1.00 28.06 ? 176  GLY A C   1 
ATOM   1395 O O   . GLY A 1 177 ? 24.323  28.623  0.716   1.00 29.49 ? 176  GLY A O   1 
ATOM   1396 N N   . GLY A 1 178 ? 24.768  26.435  1.085   1.00 26.57 ? 177  GLY A N   1 
ATOM   1397 C CA  . GLY A 1 178 ? 23.398  25.988  0.825   1.00 24.52 ? 177  GLY A CA  1 
ATOM   1398 C C   . GLY A 1 178 ? 22.529  26.101  2.073   1.00 22.57 ? 177  GLY A C   1 
ATOM   1399 O O   . GLY A 1 178 ? 23.054  26.290  3.169   1.00 22.59 ? 177  GLY A O   1 
ATOM   1400 N N   . PRO A 1 179 ? 21.208  26.002  1.922   1.00 21.59 ? 178  PRO A N   1 
ATOM   1401 C CA  . PRO A 1 179 ? 20.306  26.082  3.075   1.00 20.76 ? 178  PRO A CA  1 
ATOM   1402 C C   . PRO A 1 179 ? 20.411  24.808  3.902   1.00 20.47 ? 178  PRO A C   1 
ATOM   1403 O O   . PRO A 1 179 ? 20.833  23.764  3.380   1.00 20.84 ? 178  PRO A O   1 
ATOM   1404 C CB  . PRO A 1 179 ? 18.916  26.189  2.437   1.00 21.10 ? 178  PRO A CB  1 
ATOM   1405 C CG  . PRO A 1 179 ? 19.073  25.534  1.052   1.00 21.41 ? 178  PRO A CG  1 
ATOM   1406 C CD  . PRO A 1 179 ? 20.489  25.805  0.650   1.00 21.70 ? 178  PRO A CD  1 
ATOM   1407 N N   . ARG A 1 180 ? 20.040  24.899  5.173   1.00 19.84 ? 179  ARG A N   1 
ATOM   1408 C CA  . ARG A 1 180 ? 19.996  23.727  6.043   1.00 19.64 ? 179  ARG A CA  1 
ATOM   1409 C C   . ARG A 1 180 ? 18.898  22.818  5.526   1.00 18.93 ? 179  ARG A C   1 
ATOM   1410 O O   . ARG A 1 180 ? 17.906  23.311  5.001   1.00 17.86 ? 179  ARG A O   1 
ATOM   1411 C CB  . ARG A 1 180 ? 19.668  24.147  7.473   1.00 19.61 ? 179  ARG A CB  1 
ATOM   1412 C CG  . ARG A 1 180 ? 20.727  24.968  8.185   1.00 22.29 ? 179  ARG A CG  1 
ATOM   1413 C CD  . ARG A 1 180 ? 20.312  25.372  9.603   1.00 24.43 ? 179  ARG A CD  1 
ATOM   1414 N NE  . ARG A 1 180 ? 19.343  26.472  9.570   1.00 26.58 ? 179  ARG A NE  1 
ATOM   1415 C CZ  . ARG A 1 180 ? 19.653  27.747  9.753   1.00 29.09 ? 179  ARG A CZ  1 
ATOM   1416 N NH1 . ARG A 1 180 ? 20.911  28.100  10.008  1.00 29.15 ? 179  ARG A NH1 1 
ATOM   1417 N NH2 . ARG A 1 180 ? 18.706  28.677  9.694   1.00 28.64 ? 179  ARG A NH2 1 
ATOM   1418 N N   . VAL A 1 181 ? 19.063  21.499  5.669   1.00 18.23 ? 180  VAL A N   1 
ATOM   1419 C CA  . VAL A 1 181 ? 18.005  20.564  5.266   1.00 18.08 ? 180  VAL A CA  1 
ATOM   1420 C C   . VAL A 1 181 ? 17.576  19.694  6.442   1.00 17.52 ? 180  VAL A C   1 
ATOM   1421 O O   . VAL A 1 181 ? 18.395  19.256  7.249   1.00 17.10 ? 180  VAL A O   1 
ATOM   1422 C CB  . VAL A 1 181 ? 18.369  19.685  4.022   1.00 18.54 ? 180  VAL A CB  1 
ATOM   1423 C CG1 A VAL A 1 181 ? 18.431  20.516  2.747   0.50 19.11 ? 180  VAL A CG1 1 
ATOM   1424 C CG1 B VAL A 1 181 ? 17.171  18.903  3.545   0.50 17.35 ? 180  VAL A CG1 1 
ATOM   1425 C CG2 A VAL A 1 181 ? 19.673  18.903  4.256   0.50 15.82 ? 180  VAL A CG2 1 
ATOM   1426 C CG2 B VAL A 1 181 ? 18.830  20.563  2.881   0.50 19.51 ? 180  VAL A CG2 1 
ATOM   1427 N N   . TRP A 1 182 ? 16.270  19.473  6.529   1.00 17.84 ? 181  TRP A N   1 
ATOM   1428 C CA  . TRP A 1 182 ? 15.663  18.714  7.601   1.00 17.94 ? 181  TRP A CA  1 
ATOM   1429 C C   . TRP A 1 182 ? 14.805  17.641  6.971   1.00 17.55 ? 181  TRP A C   1 
ATOM   1430 O O   . TRP A 1 182 ? 14.236  17.847  5.896   1.00 17.35 ? 181  TRP A O   1 
ATOM   1431 C CB  . TRP A 1 182 ? 14.765  19.610  8.463   1.00 18.40 ? 181  TRP A CB  1 
ATOM   1432 C CG  . TRP A 1 182 ? 15.440  20.825  9.064   1.00 19.07 ? 181  TRP A CG  1 
ATOM   1433 C CD1 . TRP A 1 182 ? 15.835  21.955  8.407   1.00 19.53 ? 181  TRP A CD1 1 
ATOM   1434 C CD2 . TRP A 1 182 ? 15.729  21.047  10.448  1.00 20.75 ? 181  TRP A CD2 1 
ATOM   1435 N NE1 . TRP A 1 182 ? 16.372  22.858  9.292   1.00 19.60 ? 181  TRP A NE1 1 
ATOM   1436 C CE2 . TRP A 1 182 ? 16.326  22.327  10.553  1.00 21.50 ? 181  TRP A CE2 1 
ATOM   1437 C CE3 . TRP A 1 182 ? 15.572  20.283  11.617  1.00 22.52 ? 181  TRP A CE3 1 
ATOM   1438 C CZ2 . TRP A 1 182 ? 16.758  22.865  11.775  1.00 22.18 ? 181  TRP A CZ2 1 
ATOM   1439 C CZ3 . TRP A 1 182 ? 15.991  20.821  12.835  1.00 24.06 ? 181  TRP A CZ3 1 
ATOM   1440 C CH2 . TRP A 1 182 ? 16.576  22.104  12.901  1.00 25.01 ? 181  TRP A CH2 1 
ATOM   1441 N N   . PHE A 1 183 ? 14.737  16.484  7.626   1.00 17.34 ? 182  PHE A N   1 
ATOM   1442 C CA  . PHE A 1 183 ? 13.897  15.383  7.137   1.00 17.09 ? 182  PHE A CA  1 
ATOM   1443 C C   . PHE A 1 183 ? 12.873  14.986  8.166   1.00 17.79 ? 182  PHE A C   1 
ATOM   1444 O O   . PHE A 1 183 ? 13.223  14.615  9.290   1.00 18.97 ? 182  PHE A O   1 
ATOM   1445 C CB  . PHE A 1 183 ? 14.778  14.200  6.717   1.00 17.60 ? 182  PHE A CB  1 
ATOM   1446 C CG  . PHE A 1 183 ? 15.649  14.531  5.560   1.00 16.51 ? 182  PHE A CG  1 
ATOM   1447 C CD1 . PHE A 1 183 ? 16.889  15.154  5.757   1.00 17.89 ? 182  PHE A CD1 1 
ATOM   1448 C CD2 . PHE A 1 183 ? 15.193  14.321  4.265   1.00 18.61 ? 182  PHE A CD2 1 
ATOM   1449 C CE1 . PHE A 1 183 ? 17.687  15.515  4.669   1.00 16.87 ? 182  PHE A CE1 1 
ATOM   1450 C CE2 . PHE A 1 183 ? 15.975  14.674  3.172   1.00 18.92 ? 182  PHE A CE2 1 
ATOM   1451 C CZ  . PHE A 1 183 ? 17.230  15.275  3.373   1.00 18.75 ? 182  PHE A CZ  1 
ATOM   1452 N N   . VAL A 1 184 ? 11.609  15.112  7.793   1.00 17.35 ? 183  VAL A N   1 
ATOM   1453 C CA  . VAL A 1 184 ? 10.517  14.655  8.633   1.00 17.91 ? 183  VAL A CA  1 
ATOM   1454 C C   . VAL A 1 184 ? 9.891   13.472  7.907   1.00 17.24 ? 183  VAL A C   1 
ATOM   1455 O O   . VAL A 1 184 ? 9.554   13.578  6.734   1.00 18.11 ? 183  VAL A O   1 
ATOM   1456 C CB  . VAL A 1 184 ? 9.456   15.762  8.863   1.00 17.80 ? 183  VAL A CB  1 
ATOM   1457 C CG1 . VAL A 1 184 ? 8.317   15.222  9.735   1.00 18.24 ? 183  VAL A CG1 1 
ATOM   1458 C CG2 . VAL A 1 184 ? 10.083  16.987  9.537   1.00 18.66 ? 183  VAL A CG2 1 
ATOM   1459 N N   . SER A 1 185 ? 9.711   12.352  8.599   1.00 17.42 ? 184  SER A N   1 
ATOM   1460 C CA  . SER A 1 185 ? 9.268   11.130  7.950   1.00 17.42 ? 184  SER A CA  1 
ATOM   1461 C C   . SER A 1 185 ? 8.301   10.353  8.823   1.00 17.12 ? 184  SER A C   1 
ATOM   1462 O O   . SER A 1 185 ? 7.230   9.935   8.366   1.00 17.84 ? 184  SER A O   1 
ATOM   1463 C CB  . SER A 1 185 ? 10.480  10.243  7.617   1.00 18.07 ? 184  SER A CB  1 
ATOM   1464 O OG  . SER A 1 185 ? 11.204  9.955   8.801   1.00 18.93 ? 184  SER A OG  1 
ATOM   1465 N N   . ASN A 1 186 ? 8.668   10.148  10.081  1.00 16.65 ? 185  ASN A N   1 
ATOM   1466 C CA  . ASN A 1 186 ? 7.790   9.383   10.971  1.00 15.80 ? 185  ASN A CA  1 
ATOM   1467 C C   . ASN A 1 186 ? 6.435   10.075  11.153  1.00 16.24 ? 185  ASN A C   1 
ATOM   1468 O O   . ASN A 1 186 ? 6.387   11.311  11.220  1.00 16.63 ? 185  ASN A O   1 
ATOM   1469 C CB  . ASN A 1 186 ? 8.456   9.183   12.324  1.00 15.93 ? 185  ASN A CB  1 
ATOM   1470 C CG  . ASN A 1 186 ? 8.012   7.910   13.021  1.00 15.72 ? 185  ASN A CG  1 
ATOM   1471 O OD1 . ASN A 1 186 ? 6.867   7.452   12.871  1.00 16.95 ? 185  ASN A OD1 1 
ATOM   1472 N ND2 . ASN A 1 186 ? 8.913   7.345   13.822  1.00 18.05 ? 185  ASN A ND2 1 
ATOM   1473 N N   . ILE A 1 187 ? 5.344   9.303   11.217  1.00 16.45 ? 186  ILE A N   1 
ATOM   1474 C CA  . ILE A 1 187 ? 4.060   9.883   11.652  1.00 16.23 ? 186  ILE A CA  1 
ATOM   1475 C C   . ILE A 1 187 ? 4.153   10.323  13.115  1.00 16.90 ? 186  ILE A C   1 
ATOM   1476 O O   . ILE A 1 187 ? 3.482   11.283  13.530  1.00 16.74 ? 186  ILE A O   1 
ATOM   1477 C CB  . ILE A 1 187 ? 2.844   8.920   11.415  1.00 15.67 ? 186  ILE A CB  1 
ATOM   1478 C CG1 . ILE A 1 187 ? 1.507   9.587   11.806  1.00 17.08 ? 186  ILE A CG1 1 
ATOM   1479 C CG2 . ILE A 1 187 ? 3.003   7.606   12.168  1.00 17.16 ? 186  ILE A CG2 1 
ATOM   1480 C CD1 . ILE A 1 187 ? 1.195   10.847  10.997  1.00 20.05 ? 186  ILE A CD1 1 
ATOM   1481 N N   . ASP A 1 188 ? 4.992   9.634   13.890  1.00 16.86 ? 187  ASP A N   1 
ATOM   1482 C CA  . ASP A 1 188 ? 5.196   9.971   15.297  1.00 16.99 ? 187  ASP A CA  1 
ATOM   1483 C C   . ASP A 1 188 ? 5.357   11.497  15.426  1.00 17.60 ? 187  ASP A C   1 
ATOM   1484 O O   . ASP A 1 188 ? 6.328   12.054  14.896  1.00 17.19 ? 187  ASP A O   1 
ATOM   1485 C CB  . ASP A 1 188 ? 6.458   9.292   15.829  1.00 17.45 ? 187  ASP A CB  1 
ATOM   1486 C CG  . ASP A 1 188 ? 6.740   9.623   17.289  1.00 18.15 ? 187  ASP A CG  1 
ATOM   1487 O OD1 . ASP A 1 188 ? 7.685   9.027   17.853  1.00 19.41 ? 187  ASP A OD1 1 
ATOM   1488 O OD2 . ASP A 1 188 ? 6.068   10.438  17.964  1.00 18.74 ? 187  ASP A OD2 1 
ATOM   1489 N N   . GLY A 1 189 ? 4.428   12.148  16.134  1.00 16.91 ? 188  GLY A N   1 
ATOM   1490 C CA  . GLY A 1 189 ? 4.384   13.605  16.203  1.00 17.37 ? 188  GLY A CA  1 
ATOM   1491 C C   . GLY A 1 189 ? 5.656   14.275  16.701  1.00 17.52 ? 188  GLY A C   1 
ATOM   1492 O O   . GLY A 1 189 ? 5.915   15.442  16.401  1.00 17.44 ? 188  GLY A O   1 
ATOM   1493 N N   . THR A 1 190 ? 6.445   13.547  17.484  1.00 17.63 ? 189  THR A N   1 
ATOM   1494 C CA  . THR A 1 190 ? 7.799   13.955  17.892  1.00 17.92 ? 189  THR A CA  1 
ATOM   1495 C C   . THR A 1 190 ? 8.600   14.488  16.706  1.00 17.51 ? 189  THR A C   1 
ATOM   1496 O O   . THR A 1 190 ? 9.313   15.493  16.819  1.00 17.15 ? 189  THR A O   1 
ATOM   1497 C CB  . THR A 1 190 ? 8.524   12.731  18.531  1.00 17.79 ? 189  THR A CB  1 
ATOM   1498 O OG1 . THR A 1 190 ? 7.992   12.512  19.847  1.00 18.45 ? 189  THR A OG1 1 
ATOM   1499 C CG2 . THR A 1 190 ? 10.021  12.979  18.760  1.00 17.92 ? 189  THR A CG2 1 
ATOM   1500 N N   . HIS A 1 191 ? 8.494   13.807  15.576  1.00 17.29 ? 190  HIS A N   1 
ATOM   1501 C CA  . HIS A 1 191 ? 9.364   14.110  14.455  1.00 17.66 ? 190  HIS A CA  1 
ATOM   1502 C C   . HIS A 1 191 ? 9.106   15.528  13.942  1.00 17.87 ? 190  HIS A C   1 
ATOM   1503 O O   . HIS A 1 191 ? 10.018  16.343  13.919  1.00 18.03 ? 190  HIS A O   1 
ATOM   1504 C CB  . HIS A 1 191 ? 9.261   13.071  13.334  1.00 17.54 ? 190  HIS A CB  1 
ATOM   1505 C CG  . HIS A 1 191 ? 10.563  12.842  12.629  1.00 18.80 ? 190  HIS A CG  1 
ATOM   1506 N ND1 . HIS A 1 191 ? 10.699  11.992  11.554  1.00 18.14 ? 190  HIS A ND1 1 
ATOM   1507 C CD2 . HIS A 1 191 ? 11.799  13.349  12.867  1.00 18.93 ? 190  HIS A CD2 1 
ATOM   1508 C CE1 . HIS A 1 191 ? 11.961  11.988  11.155  1.00 19.28 ? 190  HIS A CE1 1 
ATOM   1509 N NE2 . HIS A 1 191 ? 12.648  12.807  11.934  1.00 19.74 ? 190  HIS A NE2 1 
ATOM   1510 N N   . ILE A 1 192 ? 7.861   15.832  13.587  1.00 16.83 ? 191  ILE A N   1 
ATOM   1511 C CA  . ILE A 1 192 ? 7.541   17.171  13.082  1.00 17.59 ? 191  ILE A CA  1 
ATOM   1512 C C   . ILE A 1 192 ? 7.586   18.219  14.196  1.00 18.49 ? 191  ILE A C   1 
ATOM   1513 O O   . ILE A 1 192 ? 8.054   19.342  13.961  1.00 18.53 ? 191  ILE A O   1 
ATOM   1514 C CB  . ILE A 1 192 ? 6.194   17.184  12.314  1.00 17.85 ? 191  ILE A CB  1 
ATOM   1515 C CG1 . ILE A 1 192 ? 6.027   18.506  11.552  1.00 18.16 ? 191  ILE A CG1 1 
ATOM   1516 C CG2 . ILE A 1 192 ? 4.996   16.922  13.262  1.00 16.41 ? 191  ILE A CG2 1 
ATOM   1517 C CD1 . ILE A 1 192 ? 5.318   18.393  10.257  1.00 21.66 ? 191  ILE A CD1 1 
ATOM   1518 N N   . ALA A 1 193 ? 7.146   17.856  15.400  1.00 18.90 ? 192  ALA A N   1 
ATOM   1519 C CA  . ALA A 1 193 ? 7.127   18.806  16.521  1.00 19.99 ? 192  ALA A CA  1 
ATOM   1520 C C   . ALA A 1 193 ? 8.519   19.351  16.816  1.00 21.01 ? 192  ALA A C   1 
ATOM   1521 O O   . ALA A 1 193 ? 8.711   20.570  16.903  1.00 21.29 ? 192  ALA A O   1 
ATOM   1522 C CB  . ALA A 1 193 ? 6.521   18.170  17.769  1.00 20.29 ? 192  ALA A CB  1 
ATOM   1523 N N   . LYS A 1 194 ? 9.496   18.448  16.911  1.00 21.31 ? 193  LYS A N   1 
ATOM   1524 C CA  . LYS A 1 194 ? 10.865  18.838  17.230  1.00 22.69 ? 193  LYS A CA  1 
ATOM   1525 C C   . LYS A 1 194 ? 11.513  19.630  16.104  1.00 22.72 ? 193  LYS A C   1 
ATOM   1526 O O   . LYS A 1 194 ? 12.345  20.515  16.357  1.00 23.51 ? 193  LYS A O   1 
ATOM   1527 C CB  . LYS A 1 194 ? 11.723  17.606  17.547  1.00 23.10 ? 193  LYS A CB  1 
ATOM   1528 C CG  . LYS A 1 194 ? 11.757  17.221  19.020  1.00 27.62 ? 193  LYS A CG  1 
ATOM   1529 C CD  . LYS A 1 194 ? 11.934  18.447  19.944  1.00 32.41 ? 193  LYS A CD  1 
ATOM   1530 C CE  . LYS A 1 194 ? 13.369  18.588  20.454  1.00 34.33 ? 193  LYS A CE  1 
ATOM   1531 N NZ  . LYS A 1 194 ? 14.334  18.834  19.330  1.00 37.20 ? 193  LYS A NZ  1 
ATOM   1532 N N   . THR A 1 195 ? 11.125  19.316  14.871  1.00 21.82 ? 194  THR A N   1 
ATOM   1533 C CA  . THR A 1 195 ? 11.652  19.999  13.701  1.00 21.89 ? 194  THR A CA  1 
ATOM   1534 C C   . THR A 1 195 ? 11.079  21.410  13.622  1.00 22.09 ? 194  THR A C   1 
ATOM   1535 O O   . THR A 1 195 ? 11.833  22.365  13.388  1.00 22.39 ? 194  THR A O   1 
ATOM   1536 C CB  . THR A 1 195 ? 11.335  19.204  12.415  1.00 22.13 ? 194  THR A CB  1 
ATOM   1537 O OG1 . THR A 1 195 ? 11.979  17.921  12.468  1.00 20.16 ? 194  THR A OG1 1 
ATOM   1538 C CG2 . THR A 1 195 ? 11.955  19.873  11.195  1.00 19.22 ? 194  THR A CG2 1 
ATOM   1539 N N   . LEU A 1 196 ? 9.768   21.540  13.834  1.00 22.09 ? 195  LEU A N   1 
ATOM   1540 C CA  . LEU A 1 196 ? 9.103   22.844  13.742  1.00 22.52 ? 195  LEU A CA  1 
ATOM   1541 C C   . LEU A 1 196 ? 9.526   23.780  14.862  1.00 23.20 ? 195  LEU A C   1 
ATOM   1542 O O   . LEU A 1 196 ? 9.513   25.012  14.684  1.00 22.90 ? 195  LEU A O   1 
ATOM   1543 C CB  . LEU A 1 196 ? 7.572   22.702  13.733  1.00 22.45 ? 195  LEU A CB  1 
ATOM   1544 C CG  . LEU A 1 196 ? 6.926   21.990  12.545  1.00 22.33 ? 195  LEU A CG  1 
ATOM   1545 C CD1 . LEU A 1 196 ? 5.418   21.910  12.739  1.00 21.39 ? 195  LEU A CD1 1 
ATOM   1546 C CD2 . LEU A 1 196 ? 7.306   22.600  11.191  1.00 21.56 ? 195  LEU A CD2 1 
ATOM   1547 N N   . ALA A 1 197 ? 9.915   23.196  16.003  1.00 23.61 ? 196  ALA A N   1 
ATOM   1548 C CA  . ALA A 1 197 ? 10.339  23.971  17.171  1.00 24.44 ? 196  ALA A CA  1 
ATOM   1549 C C   . ALA A 1 197 ? 11.581  24.803  16.865  1.00 24.68 ? 196  ALA A C   1 
ATOM   1550 O O   . ALA A 1 197 ? 11.791  25.841  17.470  1.00 25.05 ? 196  ALA A O   1 
ATOM   1551 C CB  . ALA A 1 197 ? 10.585  23.066  18.386  1.00 24.85 ? 196  ALA A CB  1 
ATOM   1552 N N   . SER A 1 198 ? 12.368  24.356  15.895  1.00 24.45 ? 197  SER A N   1 
ATOM   1553 C CA  . SER A 1 198 ? 13.615  25.011  15.553  1.00 25.45 ? 197  SER A CA  1 
ATOM   1554 C C   . SER A 1 198 ? 13.525  25.862  14.288  1.00 24.43 ? 197  SER A C   1 
ATOM   1555 O O   . SER A 1 198 ? 14.546  26.308  13.764  1.00 25.47 ? 197  SER A O   1 
ATOM   1556 C CB  . SER A 1 198 ? 14.720  23.956  15.418  1.00 25.64 ? 197  SER A CB  1 
ATOM   1557 O OG  . SER A 1 198 ? 15.033  23.439  16.706  1.00 29.18 ? 197  SER A OG  1 
ATOM   1558 N N   . LEU A 1 199 ? 12.312  26.095  13.804  1.00 23.03 ? 198  LEU A N   1 
ATOM   1559 C CA  . LEU A 1 199 ? 12.134  26.794  12.533  1.00 22.41 ? 198  LEU A CA  1 
ATOM   1560 C C   . LEU A 1 199 ? 11.238  28.003  12.650  1.00 22.21 ? 198  LEU A C   1 
ATOM   1561 O O   . LEU A 1 199 ? 10.430  28.108  13.576  1.00 21.67 ? 198  LEU A O   1 
ATOM   1562 C CB  . LEU A 1 199 ? 11.515  25.872  11.494  1.00 22.44 ? 198  LEU A CB  1 
ATOM   1563 C CG  . LEU A 1 199 ? 12.233  24.585  11.108  1.00 22.84 ? 198  LEU A CG  1 
ATOM   1564 C CD1 . LEU A 1 199 ? 11.234  23.717  10.339  1.00 21.51 ? 198  LEU A CD1 1 
ATOM   1565 C CD2 . LEU A 1 199 ? 13.457  24.873  10.279  1.00 22.82 ? 198  LEU A CD2 1 
ATOM   1566 N N   . SER A 1 200 ? 11.377  28.893  11.670  1.00 21.59 ? 199  SER A N   1 
ATOM   1567 C CA  . SER A 1 200 ? 10.492  30.032  11.510  1.00 21.84 ? 199  SER A CA  1 
ATOM   1568 C C   . SER A 1 200 ? 9.693   29.819  10.217  1.00 20.95 ? 199  SER A C   1 
ATOM   1569 O O   . SER A 1 200 ? 10.264  29.478  9.173   1.00 20.21 ? 199  SER A O   1 
ATOM   1570 C CB  . SER A 1 200 ? 11.325  31.324  11.439  1.00 22.16 ? 199  SER A CB  1 
ATOM   1571 O OG  . SER A 1 200 ? 10.546  32.406  10.928  1.00 23.88 ? 199  SER A OG  1 
ATOM   1572 N N   . PRO A 1 201 ? 8.374   30.009  10.271  1.00 21.36 ? 200  PRO A N   1 
ATOM   1573 C CA  . PRO A 1 201 ? 7.535   29.857  9.068   1.00 21.28 ? 200  PRO A CA  1 
ATOM   1574 C C   . PRO A 1 201 ? 7.975   30.801  7.952   1.00 20.85 ? 200  PRO A C   1 
ATOM   1575 O O   . PRO A 1 201 ? 7.842   30.470  6.764   1.00 21.46 ? 200  PRO A O   1 
ATOM   1576 C CB  . PRO A 1 201 ? 6.114   30.212  9.559   1.00 21.21 ? 200  PRO A CB  1 
ATOM   1577 C CG  . PRO A 1 201 ? 6.170   30.120  11.058  1.00 22.19 ? 200  PRO A CG  1 
ATOM   1578 C CD  . PRO A 1 201 ? 7.597   30.409  11.459  1.00 21.26 ? 200  PRO A CD  1 
ATOM   1579 N N   . GLU A 1 202 ? 8.545   31.944  8.335   1.00 20.96 ? 201  GLU A N   1 
ATOM   1580 C CA  . GLU A 1 202 ? 8.963   32.980  7.379   1.00 20.38 ? 201  GLU A CA  1 
ATOM   1581 C C   . GLU A 1 202 ? 10.080  32.545  6.432   1.00 19.53 ? 201  GLU A C   1 
ATOM   1582 O O   . GLU A 1 202 ? 10.211  33.067  5.315   1.00 19.38 ? 201  GLU A O   1 
ATOM   1583 C CB  . GLU A 1 202 ? 9.404   34.242  8.133   1.00 20.42 ? 201  GLU A CB  1 
ATOM   1584 C CG  . GLU A 1 202 ? 8.304   34.869  8.974   1.00 23.16 ? 201  GLU A CG  1 
ATOM   1585 C CD  . GLU A 1 202 ? 8.766   36.079  9.764   1.00 24.54 ? 201  GLU A CD  1 
ATOM   1586 O OE1 . GLU A 1 202 ? 8.425   36.137  10.967  1.00 28.39 ? 201  GLU A OE1 1 
ATOM   1587 O OE2 . GLU A 1 202 ? 9.435   36.976  9.199   1.00 24.51 ? 201  GLU A OE2 1 
ATOM   1588 N N   . THR A 1 203 ? 10.892  31.583  6.879   1.00 18.46 ? 202  THR A N   1 
ATOM   1589 C CA  . THR A 1 203 ? 12.148  31.294  6.187   1.00 17.82 ? 202  THR A CA  1 
ATOM   1590 C C   . THR A 1 203 ? 12.326  29.824  5.850   1.00 17.64 ? 202  THR A C   1 
ATOM   1591 O O   . THR A 1 203 ? 13.401  29.398  5.436   1.00 16.38 ? 202  THR A O   1 
ATOM   1592 C CB  . THR A 1 203 ? 13.361  31.817  7.015   1.00 17.38 ? 202  THR A CB  1 
ATOM   1593 O OG1 . THR A 1 203 ? 13.281  31.342  8.361   1.00 19.13 ? 202  THR A OG1 1 
ATOM   1594 C CG2 . THR A 1 203 ? 13.295  33.339  7.168   1.00 17.91 ? 202  THR A CG2 1 
ATOM   1595 N N   . SER A 1 204 ? 11.233  29.085  5.976   1.00 16.80 ? 203  SER A N   1 
ATOM   1596 C CA  . SER A 1 204 ? 11.225  27.639  5.816   1.00 18.15 ? 203  SER A CA  1 
ATOM   1597 C C   . SER A 1 204 ? 10.484  27.231  4.546   1.00 17.91 ? 203  SER A C   1 
ATOM   1598 O O   . SER A 1 204 ? 9.351   27.680  4.295   1.00 18.61 ? 203  SER A O   1 
ATOM   1599 C CB  . SER A 1 204 ? 10.544  26.994  7.020   1.00 17.66 ? 203  SER A CB  1 
ATOM   1600 O OG  . SER A 1 204 ? 11.330  27.102  8.185   1.00 18.97 ? 203  SER A OG  1 
ATOM   1601 N N   . LEU A 1 205 ? 11.093  26.345  3.761   1.00 18.34 ? 204  LEU A N   1 
ATOM   1602 C CA  . LEU A 1 205 ? 10.430  25.819  2.579   1.00 18.50 ? 204  LEU A CA  1 
ATOM   1603 C C   . LEU A 1 205 ? 10.174  24.329  2.801   1.00 18.66 ? 204  LEU A C   1 
ATOM   1604 O O   . LEU A 1 205 ? 11.112  23.592  3.099   1.00 18.47 ? 204  LEU A O   1 
ATOM   1605 C CB  . LEU A 1 205 ? 11.296  26.045  1.316   1.00 18.97 ? 204  LEU A CB  1 
ATOM   1606 C CG  . LEU A 1 205 ? 10.949  25.353  -0.025  1.00 20.36 ? 204  LEU A CG  1 
ATOM   1607 C CD1 . LEU A 1 205 ? 9.638   25.901  -0.611  1.00 21.22 ? 204  LEU A CD1 1 
ATOM   1608 C CD2 . LEU A 1 205 ? 12.088  25.589  -1.060  1.00 22.16 ? 204  LEU A CD2 1 
ATOM   1609 N N   . PHE A 1 206 ? 8.911   23.917  2.682   1.00 18.05 ? 205  PHE A N   1 
ATOM   1610 C CA  . PHE A 1 206 ? 8.517   22.513  2.808   1.00 17.59 ? 205  PHE A CA  1 
ATOM   1611 C C   . PHE A 1 206 ? 8.439   21.829  1.450   1.00 17.64 ? 205  PHE A C   1 
ATOM   1612 O O   . PHE A 1 206 ? 7.881   22.352  0.491   1.00 17.22 ? 205  PHE A O   1 
ATOM   1613 C CB  . PHE A 1 206 ? 7.183   22.384  3.544   1.00 17.33 ? 205  PHE A CB  1 
ATOM   1614 C CG  . PHE A 1 206 ? 7.233   22.851  4.951   1.00 17.50 ? 205  PHE A CG  1 
ATOM   1615 C CD1 . PHE A 1 206 ? 6.907   24.167  5.278   1.00 18.10 ? 205  PHE A CD1 1 
ATOM   1616 C CD2 . PHE A 1 206 ? 7.627   21.978  5.963   1.00 18.42 ? 205  PHE A CD2 1 
ATOM   1617 C CE1 . PHE A 1 206 ? 6.968   24.596  6.606   1.00 19.61 ? 205  PHE A CE1 1 
ATOM   1618 C CE2 . PHE A 1 206 ? 7.704   22.401  7.286   1.00 19.94 ? 205  PHE A CE2 1 
ATOM   1619 C CZ  . PHE A 1 206 ? 7.365   23.715  7.607   1.00 21.11 ? 205  PHE A CZ  1 
ATOM   1620 N N   . ILE A 1 207 ? 9.002   20.630  1.380   1.00 18.57 ? 206  ILE A N   1 
ATOM   1621 C CA  . ILE A 1 207 ? 8.935   19.820  0.184   1.00 19.36 ? 206  ILE A CA  1 
ATOM   1622 C C   . ILE A 1 207 ? 8.107   18.600  0.566   1.00 19.29 ? 206  ILE A C   1 
ATOM   1623 O O   . ILE A 1 207 ? 8.528   17.833  1.416   1.00 19.15 ? 206  ILE A O   1 
ATOM   1624 C CB  . ILE A 1 207 ? 10.349  19.359  -0.234  1.00 19.88 ? 206  ILE A CB  1 
ATOM   1625 C CG1 . ILE A 1 207 ? 11.234  20.565  -0.542  1.00 21.23 ? 206  ILE A CG1 1 
ATOM   1626 C CG2 . ILE A 1 207 ? 10.278  18.407  -1.435  1.00 21.44 ? 206  ILE A CG2 1 
ATOM   1627 C CD1 . ILE A 1 207 ? 12.647  20.194  -0.915  1.00 23.19 ? 206  ILE A CD1 1 
ATOM   1628 N N   . ILE A 1 208 ? 6.939   18.440  -0.052  1.00 18.73 ? 207  ILE A N   1 
ATOM   1629 C CA  . ILE A 1 208 ? 6.106   17.285  0.235   1.00 19.31 ? 207  ILE A CA  1 
ATOM   1630 C C   . ILE A 1 208 ? 6.352   16.255  -0.860  1.00 19.46 ? 207  ILE A C   1 
ATOM   1631 O O   . ILE A 1 208 ? 5.997   16.466  -2.025  1.00 19.44 ? 207  ILE A O   1 
ATOM   1632 C CB  . ILE A 1 208 ? 4.616   17.675  0.330   1.00 19.44 ? 207  ILE A CB  1 
ATOM   1633 C CG1 . ILE A 1 208 ? 4.419   18.986  1.119   1.00 19.45 ? 207  ILE A CG1 1 
ATOM   1634 C CG2 . ILE A 1 208 ? 3.825   16.505  0.931   1.00 19.14 ? 207  ILE A CG2 1 
ATOM   1635 C CD1 . ILE A 1 208 ? 5.044   18.987  2.548   1.00 18.69 ? 207  ILE A CD1 1 
ATOM   1636 N N   . ALA A 1 209 ? 6.988   15.154  -0.457  1.00 19.42 ? 208  ALA A N   1 
ATOM   1637 C CA  . ALA A 1 209 ? 7.529   14.140  -1.352  1.00 19.81 ? 208  ALA A CA  1 
ATOM   1638 C C   . ALA A 1 209 ? 6.746   12.844  -1.155  1.00 20.81 ? 208  ALA A C   1 
ATOM   1639 O O   . ALA A 1 209 ? 6.788   12.248  -0.080  1.00 20.12 ? 208  ALA A O   1 
ATOM   1640 C CB  . ALA A 1 209 ? 8.992   13.917  -1.045  1.00 19.74 ? 208  ALA A CB  1 
ATOM   1641 N N   . SER A 1 210 ? 6.016   12.441  -2.186  1.00 21.38 ? 209  SER A N   1 
ATOM   1642 C CA  . SER A 1 210 ? 5.204   11.210  -2.148  1.00 21.78 ? 209  SER A CA  1 
ATOM   1643 C C   . SER A 1 210 ? 4.727   10.805  -3.540  1.00 21.94 ? 209  SER A C   1 
ATOM   1644 O O   . SER A 1 210 ? 4.024   11.566  -4.217  1.00 20.78 ? 209  SER A O   1 
ATOM   1645 C CB  . SER A 1 210 ? 3.992   11.411  -1.237  1.00 22.68 ? 209  SER A CB  1 
ATOM   1646 O OG  . SER A 1 210 ? 3.108   10.302  -1.304  1.00 23.40 ? 209  SER A OG  1 
ATOM   1647 N N   . LYS A 1 211 ? 5.082   9.588   -3.951  1.00 22.46 ? 210  LYS A N   1 
ATOM   1648 C CA  . LYS A 1 211 ? 4.736   9.100   -5.281  1.00 23.06 ? 210  LYS A CA  1 
ATOM   1649 C C   . LYS A 1 211 ? 3.224   9.168   -5.505  1.00 23.17 ? 210  LYS A C   1 
ATOM   1650 O O   . LYS A 1 211 ? 2.764   9.719   -6.511  1.00 23.30 ? 210  LYS A O   1 
ATOM   1651 C CB  . LYS A 1 211 ? 5.253   7.673   -5.498  1.00 22.31 ? 210  LYS A CB  1 
ATOM   1652 C CG  . LYS A 1 211 ? 5.148   7.225   -6.945  1.00 23.13 ? 210  LYS A CG  1 
ATOM   1653 C CD  . LYS A 1 211 ? 5.732   5.844   -7.160  1.00 20.82 ? 210  LYS A CD  1 
ATOM   1654 C CE  . LYS A 1 211 ? 5.571   5.416   -8.614  1.00 21.18 ? 210  LYS A CE  1 
ATOM   1655 N NZ  . LYS A 1 211 ? 6.194   4.067   -8.856  1.00 20.84 ? 210  LYS A NZ  1 
ATOM   1656 N N   . THR A 1 212 ? 2.468   8.622   -4.554  1.00 23.24 ? 211  THR A N   1 
ATOM   1657 C CA  . THR A 1 212 ? 1.010   8.548   -4.669  1.00 23.70 ? 211  THR A CA  1 
ATOM   1658 C C   . THR A 1 212 ? 0.333   9.827   -4.191  1.00 23.89 ? 211  THR A C   1 
ATOM   1659 O O   . THR A 1 212 ? -0.778  10.125  -4.604  1.00 23.50 ? 211  THR A O   1 
ATOM   1660 C CB  . THR A 1 212 ? 0.472   7.383   -3.842  1.00 23.72 ? 211  THR A CB  1 
ATOM   1661 O OG1 . THR A 1 212 ? 0.898   7.542   -2.482  1.00 24.04 ? 211  THR A OG1 1 
ATOM   1662 C CG2 . THR A 1 212 ? 1.102   6.063   -4.294  1.00 24.44 ? 211  THR A CG2 1 
ATOM   1663 N N   . PHE A 1 213 ? 1.028   10.569  -3.319  1.00 23.79 ? 212  PHE A N   1 
ATOM   1664 C CA  . PHE A 1 213 ? 0.477   11.698  -2.558  1.00 23.60 ? 212  PHE A CA  1 
ATOM   1665 C C   . PHE A 1 213 ? -0.735  11.310  -1.707  1.00 23.20 ? 212  PHE A C   1 
ATOM   1666 O O   . PHE A 1 213 ? -1.596  12.147  -1.431  1.00 22.80 ? 212  PHE A O   1 
ATOM   1667 C CB  . PHE A 1 213 ? 0.156   12.902  -3.455  1.00 23.32 ? 212  PHE A CB  1 
ATOM   1668 C CG  . PHE A 1 213 ? 0.654   14.211  -2.906  1.00 23.47 ? 212  PHE A CG  1 
ATOM   1669 C CD1 . PHE A 1 213 ? 2.018   14.501  -2.882  1.00 23.19 ? 212  PHE A CD1 1 
ATOM   1670 C CD2 . PHE A 1 213 ? -0.240  15.166  -2.420  1.00 23.23 ? 212  PHE A CD2 1 
ATOM   1671 C CE1 . PHE A 1 213 ? 2.485   15.719  -2.380  1.00 22.89 ? 212  PHE A CE1 1 
ATOM   1672 C CE2 . PHE A 1 213 ? 0.225   16.371  -1.909  1.00 23.85 ? 212  PHE A CE2 1 
ATOM   1673 C CZ  . PHE A 1 213 ? 1.601   16.647  -1.896  1.00 21.25 ? 212  PHE A CZ  1 
ATOM   1674 N N   . THR A 1 214 ? -0.805  10.042  -1.303  1.00 23.17 ? 213  THR A N   1 
ATOM   1675 C CA  . THR A 1 214 ? -1.865  9.603   -0.381  1.00 23.24 ? 213  THR A CA  1 
ATOM   1676 C C   . THR A 1 214 ? -1.338  8.906   0.865   1.00 23.19 ? 213  THR A C   1 
ATOM   1677 O O   . THR A 1 214 ? -2.125  8.515   1.750   1.00 22.94 ? 213  THR A O   1 
ATOM   1678 C CB  . THR A 1 214 ? -2.908  8.679   -1.092  1.00 22.74 ? 213  THR A CB  1 
ATOM   1679 O OG1 . THR A 1 214 ? -2.263  7.476   -1.544  1.00 25.63 ? 213  THR A OG1 1 
ATOM   1680 C CG2 . THR A 1 214 ? -3.455  9.332   -2.351  1.00 23.60 ? 213  THR A CG2 1 
ATOM   1681 N N   . THR A 1 215 ? -0.018  8.746   0.935   1.00 22.78 ? 214  THR A N   1 
ATOM   1682 C CA  . THR A 1 215 ? 0.643   8.118   2.081   1.00 22.95 ? 214  THR A CA  1 
ATOM   1683 C C   . THR A 1 215 ? 0.187   8.787   3.369   1.00 22.81 ? 214  THR A C   1 
ATOM   1684 O O   . THR A 1 215 ? 0.316   10.008  3.531   1.00 22.71 ? 214  THR A O   1 
ATOM   1685 C CB  . THR A 1 215 ? 2.158   8.237   1.909   1.00 22.57 ? 214  THR A CB  1 
ATOM   1686 O OG1 . THR A 1 215 ? 2.500   7.700   0.635   1.00 23.79 ? 214  THR A OG1 1 
ATOM   1687 C CG2 . THR A 1 215 ? 2.913   7.336   2.891   1.00 23.45 ? 214  THR A CG2 1 
ATOM   1688 N N   . GLN A 1 216 ? -0.353  7.985   4.281   1.00 22.30 ? 215  GLN A N   1 
ATOM   1689 C CA  . GLN A 1 216 ? -0.939  8.523   5.503   1.00 22.67 ? 215  GLN A CA  1 
ATOM   1690 C C   . GLN A 1 216 ? 0.051   9.408   6.273   1.00 22.02 ? 215  GLN A C   1 
ATOM   1691 O O   . GLN A 1 216 ? -0.267  10.553  6.592   1.00 22.65 ? 215  GLN A O   1 
ATOM   1692 C CB  . GLN A 1 216 ? -1.498  7.392   6.388   1.00 22.97 ? 215  GLN A CB  1 
ATOM   1693 C CG  . GLN A 1 216 ? -1.908  7.852   7.807   1.00 24.30 ? 215  GLN A CG  1 
ATOM   1694 C CD  A GLN A 1 216 ? -3.267  8.508   7.858   0.50 25.56 ? 215  GLN A CD  1 
ATOM   1695 C CD  B GLN A 1 216 ? -2.905  6.924   8.471   0.50 22.45 ? 215  GLN A CD  1 
ATOM   1696 O OE1 A GLN A 1 216 ? -3.561  9.402   7.067   0.50 26.62 ? 215  GLN A OE1 1 
ATOM   1697 O OE1 B GLN A 1 216 ? -4.047  7.308   8.712   0.50 25.86 ? 215  GLN A OE1 1 
ATOM   1698 N NE2 A GLN A 1 216 ? -4.094  8.085   8.806   0.50 26.87 ? 215  GLN A NE2 1 
ATOM   1699 N NE2 B GLN A 1 216 ? -2.477  5.711   8.774   0.50 23.80 ? 215  GLN A NE2 1 
ATOM   1700 N N   . GLU A 1 217 ? 1.245   8.885   6.538   1.00 21.32 ? 216  GLU A N   1 
ATOM   1701 C CA  . GLU A 1 217 ? 2.258   9.619   7.294   1.00 21.19 ? 216  GLU A CA  1 
ATOM   1702 C C   . GLU A 1 217 ? 2.599   10.961  6.653   1.00 20.12 ? 216  GLU A C   1 
ATOM   1703 O O   . GLU A 1 217 ? 2.617   11.998  7.326   1.00 19.81 ? 216  GLU A O   1 
ATOM   1704 C CB  . GLU A 1 217 ? 3.539   8.785   7.481   1.00 20.98 ? 216  GLU A CB  1 
ATOM   1705 C CG  . GLU A 1 217 ? 3.363   7.555   8.377   1.00 23.65 ? 216  GLU A CG  1 
ATOM   1706 C CD  . GLU A 1 217 ? 3.095   6.277   7.592   1.00 25.86 ? 216  GLU A CD  1 
ATOM   1707 O OE1 . GLU A 1 217 ? 3.563   5.212   8.057   1.00 24.09 ? 216  GLU A OE1 1 
ATOM   1708 O OE2 . GLU A 1 217 ? 2.411   6.328   6.530   1.00 25.74 ? 216  GLU A OE2 1 
ATOM   1709 N N   . THR A 1 218 ? 2.838   10.943  5.348   1.00 19.56 ? 217  THR A N   1 
ATOM   1710 C CA  . THR A 1 218 ? 3.324   12.123  4.648   1.00 19.15 ? 217  THR A CA  1 
ATOM   1711 C C   . THR A 1 218 ? 2.260   13.203  4.532   1.00 19.44 ? 217  THR A C   1 
ATOM   1712 O O   . THR A 1 218 ? 2.528   14.366  4.785   1.00 18.81 ? 217  THR A O   1 
ATOM   1713 C CB  . THR A 1 218 ? 3.842   11.735  3.270   1.00 19.36 ? 217  THR A CB  1 
ATOM   1714 O OG1 . THR A 1 218 ? 4.929   10.818  3.439   1.00 19.23 ? 217  THR A OG1 1 
ATOM   1715 C CG2 . THR A 1 218 ? 4.461   12.945  2.557   1.00 19.47 ? 217  THR A CG2 1 
ATOM   1716 N N   . ILE A 1 219 ? 1.053   12.802  4.163   1.00 19.67 ? 218  ILE A N   1 
ATOM   1717 C CA  . ILE A 1 219 ? -0.053  13.747  4.049   1.00 19.74 ? 218  ILE A CA  1 
ATOM   1718 C C   . ILE A 1 219 ? -0.439  14.339  5.408   1.00 19.00 ? 218  ILE A C   1 
ATOM   1719 O O   . ILE A 1 219 ? -0.713  15.543  5.504   1.00 18.73 ? 218  ILE A O   1 
ATOM   1720 C CB  . ILE A 1 219 ? -1.267  13.099  3.317   1.00 20.49 ? 218  ILE A CB  1 
ATOM   1721 C CG1 . ILE A 1 219 ? -0.889  12.653  1.890   1.00 22.64 ? 218  ILE A CG1 1 
ATOM   1722 C CG2 . ILE A 1 219 ? -2.466  14.058  3.290   1.00 22.52 ? 218  ILE A CG2 1 
ATOM   1723 C CD1 . ILE A 1 219 ? -0.409  13.770  0.943   1.00 25.39 ? 218  ILE A CD1 1 
ATOM   1724 N N   . THR A 1 220 ? -0.438  13.514  6.455   1.00 18.19 ? 219  THR A N   1 
ATOM   1725 C CA  . THR A 1 220 ? -0.729  13.997  7.805   1.00 18.32 ? 219  THR A CA  1 
ATOM   1726 C C   . THR A 1 220 ? 0.345   14.975  8.261   1.00 17.69 ? 219  THR A C   1 
ATOM   1727 O O   . THR A 1 220 ? 0.030   16.077  8.736   1.00 18.47 ? 219  THR A O   1 
ATOM   1728 C CB  . THR A 1 220 ? -0.887  12.827  8.788   1.00 17.92 ? 219  THR A CB  1 
ATOM   1729 O OG1 . THR A 1 220 ? -1.978  11.994  8.356   1.00 18.88 ? 219  THR A OG1 1 
ATOM   1730 C CG2 . THR A 1 220 ? -1.317  13.342  10.168  1.00 17.47 ? 219  THR A CG2 1 
ATOM   1731 N N   . ASN A 1 221 ? 1.615   14.604  8.067   1.00 16.66 ? 220  ASN A N   1 
ATOM   1732 C CA  . ASN A 1 221 ? 2.712   15.511  8.401   1.00 16.54 ? 220  ASN A CA  1 
ATOM   1733 C C   . ASN A 1 221 ? 2.623   16.832  7.646   1.00 16.51 ? 220  ASN A C   1 
ATOM   1734 O O   . ASN A 1 221 ? 2.849   17.911  8.239   1.00 17.84 ? 220  ASN A O   1 
ATOM   1735 C CB  . ASN A 1 221 ? 4.079   14.847  8.161   1.00 15.64 ? 220  ASN A CB  1 
ATOM   1736 C CG  . ASN A 1 221 ? 4.551   14.041  9.354   1.00 14.56 ? 220  ASN A CG  1 
ATOM   1737 O OD1 . ASN A 1 221 ? 4.283   14.386  10.499  1.00 17.83 ? 220  ASN A OD1 1 
ATOM   1738 N ND2 . ASN A 1 221 ? 5.272   12.941  9.082   1.00 14.95 ? 220  ASN A ND2 1 
ATOM   1739 N N   . ALA A 1 222 ? 2.289   16.741  6.357   1.00 16.44 ? 221  ALA A N   1 
ATOM   1740 C CA  . ALA A 1 222 ? 2.201   17.915  5.480   1.00 17.26 ? 221  ALA A CA  1 
ATOM   1741 C C   . ALA A 1 222 ? 1.058   18.813  5.928   1.00 17.43 ? 221  ALA A C   1 
ATOM   1742 O O   . ALA A 1 222 ? 1.190   20.040  5.926   1.00 17.46 ? 221  ALA A O   1 
ATOM   1743 C CB  . ALA A 1 222 ? 2.011   17.487  4.024   1.00 16.53 ? 221  ALA A CB  1 
ATOM   1744 N N   . GLU A 1 223 ? -0.055  18.196  6.316   1.00 18.33 ? 222  GLU A N   1 
ATOM   1745 C CA  . GLU A 1 223 ? -1.189  18.960  6.851   1.00 19.22 ? 222  GLU A CA  1 
ATOM   1746 C C   . GLU A 1 223 ? -0.867  19.666  8.176   1.00 18.70 ? 222  GLU A C   1 
ATOM   1747 O O   . GLU A 1 223 ? -1.273  20.817  8.373   1.00 18.47 ? 222  GLU A O   1 
ATOM   1748 C CB  . GLU A 1 223 ? -2.445  18.080  6.922   1.00 19.88 ? 222  GLU A CB  1 
ATOM   1749 C CG  . GLU A 1 223 ? -2.901  17.682  5.518   1.00 24.04 ? 222  GLU A CG  1 
ATOM   1750 C CD  . GLU A 1 223 ? -4.350  17.223  5.391   1.00 30.50 ? 222  GLU A CD  1 
ATOM   1751 O OE1 . GLU A 1 223 ? -4.869  16.524  6.293   1.00 31.75 ? 222  GLU A OE1 1 
ATOM   1752 O OE2 . GLU A 1 223 ? -4.959  17.535  4.334   1.00 32.66 ? 222  GLU A OE2 1 
ATOM   1753 N N   . THR A 1 224 ? -0.118  19.004  9.063   1.00 17.76 ? 223  THR A N   1 
ATOM   1754 C CA  . THR A 1 224 ? 0.350   19.617  10.300  1.00 17.41 ? 223  THR A CA  1 
ATOM   1755 C C   . THR A 1 224 ? 1.277   20.795  9.986   1.00 17.71 ? 223  THR A C   1 
ATOM   1756 O O   . THR A 1 224 ? 1.121   21.890  10.535  1.00 17.34 ? 223  THR A O   1 
ATOM   1757 C CB  . THR A 1 224 ? 1.055   18.558  11.200  1.00 17.16 ? 223  THR A CB  1 
ATOM   1758 O OG1 . THR A 1 224 ? 0.082   17.588  11.611  1.00 17.79 ? 223  THR A OG1 1 
ATOM   1759 C CG2 . THR A 1 224 ? 1.538   19.169  12.525  1.00 17.63 ? 223  THR A CG2 1 
ATOM   1760 N N   . ALA A 1 225 ? 2.205   20.585  9.057   1.00 17.24 ? 224  ALA A N   1 
ATOM   1761 C CA  . ALA A 1 225 ? 3.098   21.671  8.636   1.00 17.58 ? 224  ALA A CA  1 
ATOM   1762 C C   . ALA A 1 225 ? 2.331   22.876  8.063   1.00 18.28 ? 224  ALA A C   1 
ATOM   1763 O O   . ALA A 1 225 ? 2.640   24.037  8.398   1.00 18.49 ? 224  ALA A O   1 
ATOM   1764 C CB  . ALA A 1 225 ? 4.099   21.160  7.626   1.00 17.94 ? 224  ALA A CB  1 
ATOM   1765 N N   . LYS A 1 226 ? 1.346   22.601  7.209   1.00 18.71 ? 225  LYS A N   1 
ATOM   1766 C CA  . LYS A 1 226 ? 0.545   23.677  6.603   1.00 19.76 ? 225  LYS A CA  1 
ATOM   1767 C C   . LYS A 1 226 ? -0.283  24.403  7.646   1.00 19.93 ? 225  LYS A C   1 
ATOM   1768 O O   . LYS A 1 226 ? -0.417  25.630  7.586   1.00 19.72 ? 225  LYS A O   1 
ATOM   1769 C CB  . LYS A 1 226 ? -0.326  23.151  5.459   1.00 20.39 ? 225  LYS A CB  1 
ATOM   1770 C CG  . LYS A 1 226 ? -1.140  24.223  4.727   1.00 22.98 ? 225  LYS A CG  1 
ATOM   1771 C CD  . LYS A 1 226 ? -1.608  23.704  3.380   1.00 28.08 ? 225  LYS A CD  1 
ATOM   1772 C CE  . LYS A 1 226 ? -2.904  22.914  3.483   1.00 30.36 ? 225  LYS A CE  1 
ATOM   1773 N NZ  . LYS A 1 226 ? -4.085  23.822  3.628   1.00 34.17 ? 225  LYS A NZ  1 
ATOM   1774 N N   . GLU A 1 227 ? -0.832  23.656  8.611   1.00 19.91 ? 226  GLU A N   1 
ATOM   1775 C CA  . GLU A 1 227 ? -1.562  24.278  9.718   1.00 21.16 ? 226  GLU A CA  1 
ATOM   1776 C C   . GLU A 1 227 ? -0.658  25.200  10.557  1.00 20.72 ? 226  GLU A C   1 
ATOM   1777 O O   . GLU A 1 227 ? -1.051  26.325  10.916  1.00 20.52 ? 226  GLU A O   1 
ATOM   1778 C CB  . GLU A 1 227 ? -2.248  23.211  10.586  1.00 21.64 ? 226  GLU A CB  1 
ATOM   1779 C CG  . GLU A 1 227 ? -3.057  23.794  11.728  1.00 26.27 ? 226  GLU A CG  1 
ATOM   1780 C CD  . GLU A 1 227 ? -3.360  22.777  12.815  1.00 31.35 ? 226  GLU A CD  1 
ATOM   1781 O OE1 . GLU A 1 227 ? -2.415  22.348  13.504  1.00 33.92 ? 226  GLU A OE1 1 
ATOM   1782 O OE2 . GLU A 1 227 ? -4.545  22.416  12.984  1.00 34.78 ? 226  GLU A OE2 1 
ATOM   1783 N N   . TRP A 1 228 ? 0.557   24.737  10.845  1.00 20.05 ? 227  TRP A N   1 
ATOM   1784 C CA  . TRP A 1 228 ? 1.543   25.524  11.592  1.00 20.17 ? 227  TRP A CA  1 
ATOM   1785 C C   . TRP A 1 228 ? 1.914   26.770  10.806  1.00 19.81 ? 227  TRP A C   1 
ATOM   1786 O O   . TRP A 1 228 ? 1.980   27.874  11.367  1.00 19.25 ? 227  TRP A O   1 
ATOM   1787 C CB  . TRP A 1 228 ? 2.779   24.659  11.859  1.00 19.71 ? 227  TRP A CB  1 
ATOM   1788 C CG  . TRP A 1 228 ? 4.021   25.328  12.412  1.00 19.34 ? 227  TRP A CG  1 
ATOM   1789 C CD1 . TRP A 1 228 ? 4.306   25.556  13.723  1.00 19.88 ? 227  TRP A CD1 1 
ATOM   1790 C CD2 . TRP A 1 228 ? 5.182   25.753  11.672  1.00 18.61 ? 227  TRP A CD2 1 
ATOM   1791 N NE1 . TRP A 1 228 ? 5.555   26.109  13.847  1.00 20.58 ? 227  TRP A NE1 1 
ATOM   1792 C CE2 . TRP A 1 228 ? 6.118   26.246  12.608  1.00 19.86 ? 227  TRP A CE2 1 
ATOM   1793 C CE3 . TRP A 1 228 ? 5.522   25.778  10.310  1.00 18.81 ? 227  TRP A CE3 1 
ATOM   1794 C CZ2 . TRP A 1 228 ? 7.365   26.761  12.232  1.00 18.88 ? 227  TRP A CZ2 1 
ATOM   1795 C CZ3 . TRP A 1 228 ? 6.773   26.281  9.935   1.00 19.70 ? 227  TRP A CZ3 1 
ATOM   1796 C CH2 . TRP A 1 228 ? 7.677   26.762  10.897  1.00 17.77 ? 227  TRP A CH2 1 
ATOM   1797 N N   . PHE A 1 229 ? 2.129   26.596  9.504   1.00 19.06 ? 228  PHE A N   1 
ATOM   1798 C CA  . PHE A 1 229 ? 2.493   27.716  8.652   1.00 19.52 ? 228  PHE A CA  1 
ATOM   1799 C C   . PHE A 1 229 ? 1.386   28.776  8.606   1.00 20.03 ? 228  PHE A C   1 
ATOM   1800 O O   . PHE A 1 229 ? 1.646   29.974  8.781   1.00 19.55 ? 228  PHE A O   1 
ATOM   1801 C CB  . PHE A 1 229 ? 2.782   27.233  7.241   1.00 19.75 ? 228  PHE A CB  1 
ATOM   1802 C CG  . PHE A 1 229 ? 2.998   28.350  6.263   1.00 19.91 ? 228  PHE A CG  1 
ATOM   1803 C CD1 . PHE A 1 229 ? 4.190   29.060  6.270   1.00 20.81 ? 228  PHE A CD1 1 
ATOM   1804 C CD2 . PHE A 1 229 ? 1.990   28.702  5.361   1.00 21.31 ? 228  PHE A CD2 1 
ATOM   1805 C CE1 . PHE A 1 229 ? 4.394   30.107  5.380   1.00 22.63 ? 228  PHE A CE1 1 
ATOM   1806 C CE2 . PHE A 1 229 ? 2.179   29.742  4.445   1.00 22.36 ? 228  PHE A CE2 1 
ATOM   1807 C CZ  . PHE A 1 229 ? 3.375   30.446  4.456   1.00 22.03 ? 228  PHE A CZ  1 
ATOM   1808 N N   . LEU A 1 230 ? 0.162   28.325  8.368   1.00 20.40 ? 229  LEU A N   1 
ATOM   1809 C CA  . LEU A 1 230 ? -0.980  29.241  8.247   1.00 21.84 ? 229  LEU A CA  1 
ATOM   1810 C C   . LEU A 1 230 ? -1.349  29.934  9.573   1.00 22.61 ? 229  LEU A C   1 
ATOM   1811 O O   . LEU A 1 230 ? -1.909  31.047  9.573   1.00 22.67 ? 229  LEU A O   1 
ATOM   1812 C CB  . LEU A 1 230 ? -2.188  28.528  7.624   1.00 21.42 ? 229  LEU A CB  1 
ATOM   1813 C CG  . LEU A 1 230 ? -2.136  28.273  6.115   1.00 23.13 ? 229  LEU A CG  1 
ATOM   1814 C CD1 . LEU A 1 230 ? -3.359  27.488  5.638   1.00 23.88 ? 229  LEU A CD1 1 
ATOM   1815 C CD2 . LEU A 1 230 ? -2.007  29.594  5.357   1.00 22.55 ? 229  LEU A CD2 1 
ATOM   1816 N N   . GLU A 1 231 ? -1.025  29.301  10.699  1.00 23.24 ? 230  GLU A N   1 
ATOM   1817 C CA  . GLU A 1 231 ? -1.210  29.941  12.003  1.00 24.56 ? 230  GLU A CA  1 
ATOM   1818 C C   . GLU A 1 231 ? -0.377  31.234  12.088  1.00 24.21 ? 230  GLU A C   1 
ATOM   1819 O O   . GLU A 1 231 ? -0.818  32.224  12.681  1.00 24.65 ? 230  GLU A O   1 
ATOM   1820 C CB  . GLU A 1 231 ? -0.917  28.964  13.156  1.00 25.30 ? 230  GLU A CB  1 
ATOM   1821 C CG  A GLU A 1 231 ? -2.144  28.135  13.539  0.50 26.39 ? 230  GLU A CG  1 
ATOM   1822 C CG  B GLU A 1 231 ? -1.317  29.454  14.547  0.50 26.32 ? 230  GLU A CG  1 
ATOM   1823 C CD  A GLU A 1 231 ? -1.846  26.906  14.393  0.50 28.73 ? 230  GLU A CD  1 
ATOM   1824 C CD  B GLU A 1 231 ? -0.357  30.465  15.163  0.50 28.35 ? 230  GLU A CD  1 
ATOM   1825 O OE1 A GLU A 1 231 ? -2.697  25.994  14.429  0.50 29.83 ? 230  GLU A OE1 1 
ATOM   1826 O OE1 B GLU A 1 231 ? -0.807  31.245  16.037  0.50 29.55 ? 230  GLU A OE1 1 
ATOM   1827 O OE2 A GLU A 1 231 ? -0.782  26.844  15.044  0.50 30.49 ? 230  GLU A OE2 1 
ATOM   1828 O OE2 B GLU A 1 231 ? 0.840   30.502  14.789  0.50 30.45 ? 230  GLU A OE2 1 
ATOM   1829 N N   . ALA A 1 232 ? 0.810   31.219  11.480  1.00 24.10 ? 231  ALA A N   1 
ATOM   1830 C CA  . ALA A 1 232 ? 1.682   32.394  11.400  1.00 23.69 ? 231  ALA A CA  1 
ATOM   1831 C C   . ALA A 1 232 ? 1.367   33.331  10.219  1.00 23.74 ? 231  ALA A C   1 
ATOM   1832 O O   . ALA A 1 232 ? 1.268   34.558  10.409  1.00 24.11 ? 231  ALA A O   1 
ATOM   1833 C CB  . ALA A 1 232 ? 3.156   31.957  11.355  1.00 24.04 ? 231  ALA A CB  1 
ATOM   1834 N N   . ALA A 1 233 ? 1.235   32.765  9.015   1.00 23.60 ? 232  ALA A N   1 
ATOM   1835 C CA  . ALA A 1 233 ? 1.066   33.548  7.778   1.00 23.41 ? 232  ALA A CA  1 
ATOM   1836 C C   . ALA A 1 233 ? -0.332  34.125  7.574   1.00 23.54 ? 232  ALA A C   1 
ATOM   1837 O O   . ALA A 1 233 ? -0.474  35.241  7.047   1.00 22.50 ? 232  ALA A O   1 
ATOM   1838 C CB  . ALA A 1 233 ? 1.489   32.741  6.550   1.00 23.17 ? 232  ALA A CB  1 
ATOM   1839 N N   . LYS A 1 234 ? -1.354  33.359  7.968   1.00 23.65 ? 233  LYS A N   1 
ATOM   1840 C CA  . LYS A 1 234 ? -2.751  33.827  7.970   1.00 24.04 ? 233  LYS A CA  1 
ATOM   1841 C C   . LYS A 1 234 ? -3.209  34.214  6.557   1.00 23.72 ? 233  LYS A C   1 
ATOM   1842 O O   . LYS A 1 234 ? -4.068  35.089  6.362   1.00 23.41 ? 233  LYS A O   1 
ATOM   1843 C CB  . LYS A 1 234 ? -2.914  34.990  8.960   1.00 24.47 ? 233  LYS A CB  1 
ATOM   1844 C CG  . LYS A 1 234 ? -2.587  34.661  10.413  1.00 26.25 ? 233  LYS A CG  1 
ATOM   1845 C CD  . LYS A 1 234 ? -2.971  35.787  11.372  1.00 28.65 ? 233  LYS A CD  1 
ATOM   1846 C CE  . LYS A 1 234 ? -2.261  35.639  12.708  1.00 31.35 ? 233  LYS A CE  1 
ATOM   1847 N NZ  . LYS A 1 234 ? -2.765  36.600  13.752  1.00 32.90 ? 233  LYS A NZ  1 
ATOM   1848 N N   . ASP A 1 235 ? -2.616  33.547  5.572   1.00 23.29 ? 234  ASP A N   1 
ATOM   1849 C CA  . ASP A 1 235 ? -2.802  33.886  4.180   1.00 23.43 ? 234  ASP A CA  1 
ATOM   1850 C C   . ASP A 1 235 ? -2.614  32.640  3.302   1.00 23.49 ? 234  ASP A C   1 
ATOM   1851 O O   . ASP A 1 235 ? -1.486  32.181  3.078   1.00 22.12 ? 234  ASP A O   1 
ATOM   1852 C CB  . ASP A 1 235 ? -1.826  35.008  3.802   1.00 23.79 ? 234  ASP A CB  1 
ATOM   1853 C CG  . ASP A 1 235 ? -1.922  35.409  2.344   1.00 24.31 ? 234  ASP A CG  1 
ATOM   1854 O OD1 . ASP A 1 235 ? -1.228  36.398  1.977   1.00 24.24 ? 234  ASP A OD1 1 
ATOM   1855 O OD2 . ASP A 1 235 ? -2.651  34.818  1.506   1.00 22.84 ? 234  ASP A OD2 1 
ATOM   1856 N N   . PRO A 1 236 ? -3.726  32.089  2.811   1.00 23.78 ? 235  PRO A N   1 
ATOM   1857 C CA  . PRO A 1 236 ? -3.697  30.862  2.006   1.00 23.61 ? 235  PRO A CA  1 
ATOM   1858 C C   . PRO A 1 236 ? -2.839  30.965  0.757   1.00 22.69 ? 235  PRO A C   1 
ATOM   1859 O O   . PRO A 1 236 ? -2.297  29.963  0.331   1.00 22.61 ? 235  PRO A O   1 
ATOM   1860 C CB  . PRO A 1 236 ? -5.164  30.666  1.616   1.00 24.40 ? 235  PRO A CB  1 
ATOM   1861 C CG  . PRO A 1 236 ? -5.918  31.362  2.685   1.00 24.67 ? 235  PRO A CG  1 
ATOM   1862 C CD  . PRO A 1 236 ? -5.102  32.582  3.013   1.00 24.26 ? 235  PRO A CD  1 
ATOM   1863 N N   . SER A 1 237 ? -2.707  32.163  0.188   1.00 22.14 ? 236  SER A N   1 
ATOM   1864 C CA  . SER A 1 237 ? -1.933  32.338  -1.033  1.00 22.27 ? 236  SER A CA  1 
ATOM   1865 C C   . SER A 1 237 ? -0.418  32.229  -0.765  1.00 21.75 ? 236  SER A C   1 
ATOM   1866 O O   . SER A 1 237 ? 0.369   32.007  -1.683  1.00 22.69 ? 236  SER A O   1 
ATOM   1867 C CB  . SER A 1 237 ? -2.268  33.683  -1.673  1.00 22.59 ? 236  SER A CB  1 
ATOM   1868 O OG  . SER A 1 237 ? -1.784  34.731  -0.855  1.00 22.74 ? 236  SER A OG  1 
ATOM   1869 N N   . ALA A 1 238 ? -0.033  32.375  0.501   1.00 21.64 ? 237  ALA A N   1 
ATOM   1870 C CA  . ALA A 1 238 ? 1.364   32.307  0.929   1.00 21.76 ? 237  ALA A CA  1 
ATOM   1871 C C   . ALA A 1 238 ? 1.888   30.872  0.905   1.00 21.49 ? 237  ALA A C   1 
ATOM   1872 O O   . ALA A 1 238 ? 3.103   30.657  0.869   1.00 21.82 ? 237  ALA A O   1 
ATOM   1873 C CB  . ALA A 1 238 ? 1.511   32.905  2.323   1.00 21.72 ? 237  ALA A CB  1 
ATOM   1874 N N   . VAL A 1 239 ? 0.976   29.896  0.914   1.00 21.09 ? 238  VAL A N   1 
ATOM   1875 C CA  . VAL A 1 239 ? 1.358   28.482  0.801   1.00 21.00 ? 238  VAL A CA  1 
ATOM   1876 C C   . VAL A 1 239 ? 2.233   28.230  -0.443  1.00 21.24 ? 238  VAL A C   1 
ATOM   1877 O O   . VAL A 1 239 ? 3.213   27.473  -0.372  1.00 21.71 ? 238  VAL A O   1 
ATOM   1878 C CB  . VAL A 1 239 ? 0.104   27.528  0.826   1.00 21.30 ? 238  VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 239 ? 0.461   26.102  0.381   1.00 21.77 ? 238  VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 239 ? -0.538  27.494  2.205   1.00 21.15 ? 238  VAL A CG2 1 
ATOM   1881 N N   . ALA A 1 240 ? 1.914   28.884  -1.563  1.00 20.99 ? 239  ALA A N   1 
ATOM   1882 C CA  . ALA A 1 240 ? 2.708   28.752  -2.797  1.00 20.99 ? 239  ALA A CA  1 
ATOM   1883 C C   . ALA A 1 240 ? 4.171   29.201  -2.687  1.00 20.31 ? 239  ALA A C   1 
ATOM   1884 O O   . ALA A 1 240 ? 4.991   28.795  -3.497  1.00 21.20 ? 239  ALA A O   1 
ATOM   1885 C CB  . ALA A 1 240 ? 2.015   29.454  -3.983  1.00 21.20 ? 239  ALA A CB  1 
ATOM   1886 N N   . LYS A 1 241 ? 4.497   30.028  -1.696  1.00 19.88 ? 240  LYS A N   1 
ATOM   1887 C CA  . LYS A 1 241 ? 5.880   30.467  -1.475  1.00 19.42 ? 240  LYS A CA  1 
ATOM   1888 C C   . LYS A 1 241 ? 6.669   29.512  -0.566  1.00 19.44 ? 240  LYS A C   1 
ATOM   1889 O O   . LYS A 1 241 ? 7.894   29.629  -0.448  1.00 19.22 ? 240  LYS A O   1 
ATOM   1890 C CB  . LYS A 1 241 ? 5.926   31.875  -0.882  1.00 19.83 ? 240  LYS A CB  1 
ATOM   1891 C CG  . LYS A 1 241 ? 5.427   32.990  -1.822  1.00 21.64 ? 240  LYS A CG  1 
ATOM   1892 C CD  . LYS A 1 241 ? 5.334   34.323  -1.071  1.00 23.54 ? 240  LYS A CD  1 
ATOM   1893 C CE  . LYS A 1 241 ? 4.850   35.463  -1.988  1.00 24.67 ? 240  LYS A CE  1 
ATOM   1894 N NZ  . LYS A 1 241 ? 5.863   35.880  -2.998  1.00 27.86 ? 240  LYS A NZ  1 
ATOM   1895 N N   . HIS A 1 242 ? 5.973   28.549  0.031   1.00 18.45 ? 241  HIS A N   1 
ATOM   1896 C CA  . HIS A 1 242 ? 6.540   27.781  1.128   1.00 18.23 ? 241  HIS A CA  1 
ATOM   1897 C C   . HIS A 1 242 ? 6.363   26.274  1.025   1.00 18.19 ? 241  HIS A C   1 
ATOM   1898 O O   . HIS A 1 242 ? 6.903   25.548  1.861   1.00 18.15 ? 241  HIS A O   1 
ATOM   1899 C CB  . HIS A 1 242 ? 5.988   28.292  2.457   1.00 18.82 ? 241  HIS A CB  1 
ATOM   1900 C CG  . HIS A 1 242 ? 6.526   29.640  2.839   1.00 18.69 ? 241  HIS A CG  1 
ATOM   1901 N ND1 . HIS A 1 242 ? 7.714   29.803  3.517   1.00 16.85 ? 241  HIS A ND1 1 
ATOM   1902 C CD2 . HIS A 1 242 ? 6.039   30.884  2.627   1.00 17.54 ? 241  HIS A CD2 1 
ATOM   1903 C CE1 . HIS A 1 242 ? 7.933   31.092  3.715   1.00 17.69 ? 241  HIS A CE1 1 
ATOM   1904 N NE2 . HIS A 1 242 ? 6.937   31.770  3.173   1.00 19.34 ? 241  HIS A NE2 1 
ATOM   1905 N N   . PHE A 1 243 ? 5.588   25.829  0.040   1.00 18.22 ? 242  PHE A N   1 
ATOM   1906 C CA  . PHE A 1 243 ? 5.336   24.396  -0.177  1.00 18.64 ? 242  PHE A CA  1 
ATOM   1907 C C   . PHE A 1 243 ? 5.510   24.012  -1.640  1.00 19.45 ? 242  PHE A C   1 
ATOM   1908 O O   . PHE A 1 243 ? 4.979   24.666  -2.533  1.00 20.24 ? 242  PHE A O   1 
ATOM   1909 C CB  . PHE A 1 243 ? 3.933   24.016  0.289   1.00 18.38 ? 242  PHE A CB  1 
ATOM   1910 C CG  . PHE A 1 243 ? 3.756   24.020  1.797   1.00 18.45 ? 242  PHE A CG  1 
ATOM   1911 C CD1 . PHE A 1 243 ? 3.593   25.214  2.497   1.00 16.96 ? 242  PHE A CD1 1 
ATOM   1912 C CD2 . PHE A 1 243 ? 3.726   22.820  2.505   1.00 17.10 ? 242  PHE A CD2 1 
ATOM   1913 C CE1 . PHE A 1 243 ? 3.442   25.223  3.879   1.00 19.62 ? 242  PHE A CE1 1 
ATOM   1914 C CE2 . PHE A 1 243 ? 3.551   22.815  3.883   1.00 17.89 ? 242  PHE A CE2 1 
ATOM   1915 C CZ  . PHE A 1 243 ? 3.416   24.022  4.575   1.00 18.78 ? 242  PHE A CZ  1 
ATOM   1916 N N   . VAL A 1 244 ? 6.265   22.941  -1.869  1.00 19.94 ? 243  VAL A N   1 
ATOM   1917 C CA  . VAL A 1 244 ? 6.488   22.381  -3.189  1.00 20.17 ? 243  VAL A CA  1 
ATOM   1918 C C   . VAL A 1 244 ? 6.145   20.901  -3.105  1.00 20.41 ? 243  VAL A C   1 
ATOM   1919 O O   . VAL A 1 244 ? 6.416   20.266  -2.093  1.00 20.91 ? 243  VAL A O   1 
ATOM   1920 C CB  . VAL A 1 244 ? 7.963   22.548  -3.636  1.00 20.89 ? 243  VAL A CB  1 
ATOM   1921 C CG1 . VAL A 1 244 ? 8.220   21.819  -4.943  1.00 22.42 ? 243  VAL A CG1 1 
ATOM   1922 C CG2 . VAL A 1 244 ? 8.293   24.026  -3.781  1.00 21.70 ? 243  VAL A CG2 1 
ATOM   1923 N N   . ALA A 1 245 ? 5.518   20.372  -4.146  1.00 19.63 ? 244  ALA A N   1 
ATOM   1924 C CA  . ALA A 1 245 ? 5.170   18.952  -4.184  1.00 20.22 ? 244  ALA A CA  1 
ATOM   1925 C C   . ALA A 1 245 ? 6.039   18.178  -5.180  1.00 19.87 ? 244  ALA A C   1 
ATOM   1926 O O   . ALA A 1 245 ? 6.332   18.661  -6.281  1.00 19.37 ? 244  ALA A O   1 
ATOM   1927 C CB  . ALA A 1 245 ? 3.698   18.789  -4.533  1.00 20.27 ? 244  ALA A CB  1 
ATOM   1928 N N   . LEU A 1 246 ? 6.416   16.966  -4.791  1.00 20.15 ? 245  LEU A N   1 
ATOM   1929 C CA  . LEU A 1 246 ? 7.091   16.040  -5.686  1.00 20.73 ? 245  LEU A CA  1 
ATOM   1930 C C   . LEU A 1 246 ? 6.223   14.799  -5.719  1.00 21.34 ? 245  LEU A C   1 
ATOM   1931 O O   . LEU A 1 246 ? 6.100   14.105  -4.708  1.00 21.47 ? 245  LEU A O   1 
ATOM   1932 C CB  . LEU A 1 246 ? 8.495   15.684  -5.186  1.00 20.74 ? 245  LEU A CB  1 
ATOM   1933 C CG  . LEU A 1 246 ? 9.354   16.789  -4.552  1.00 20.16 ? 245  LEU A CG  1 
ATOM   1934 C CD1 . LEU A 1 246 ? 10.606  16.181  -3.840  1.00 20.33 ? 245  LEU A CD1 1 
ATOM   1935 C CD2 . LEU A 1 246 ? 9.774   17.846  -5.581  1.00 20.69 ? 245  LEU A CD2 1 
ATOM   1936 N N   . SER A 1 247 ? 5.619   14.535  -6.870  1.00 23.12 ? 246  SER A N   1 
ATOM   1937 C CA  . SER A 1 247 ? 4.638   13.459  -6.988  1.00 23.65 ? 246  SER A CA  1 
ATOM   1938 C C   . SER A 1 247 ? 4.416   12.994  -8.428  1.00 25.00 ? 246  SER A C   1 
ATOM   1939 O O   . SER A 1 247 ? 4.938   13.589  -9.364  1.00 24.21 ? 246  SER A O   1 
ATOM   1940 C CB  . SER A 1 247 ? 3.318   13.914  -6.375  1.00 23.86 ? 246  SER A CB  1 
ATOM   1941 O OG  . SER A 1 247 ? 2.500   12.807  -6.061  1.00 24.75 ? 246  SER A OG  1 
ATOM   1942 N N   . THR A 1 248 ? 3.671   11.901  -8.582  1.00 25.83 ? 247  THR A N   1 
ATOM   1943 C CA  . THR A 1 248 ? 3.149   11.483  -9.880  1.00 27.20 ? 247  THR A CA  1 
ATOM   1944 C C   . THR A 1 248 ? 1.651   11.825  -9.949  1.00 27.87 ? 247  THR A C   1 
ATOM   1945 O O   . THR A 1 248 ? 1.054   11.811  -11.023 1.00 27.47 ? 247  THR A O   1 
ATOM   1946 C CB  . THR A 1 248 ? 3.348   9.963   -10.104 1.00 27.45 ? 247  THR A CB  1 
ATOM   1947 O OG1 . THR A 1 248 ? 2.506   9.231   -9.201  1.00 29.68 ? 247  THR A OG1 1 
ATOM   1948 C CG2 . THR A 1 248 ? 4.770   9.515   -9.716  1.00 26.89 ? 247  THR A CG2 1 
ATOM   1949 N N   . ASN A 1 249 ? 1.062   12.164  -8.799  1.00 28.43 ? 248  ASN A N   1 
ATOM   1950 C CA  . ASN A 1 249 ? -0.395  12.288  -8.675  1.00 29.31 ? 248  ASN A CA  1 
ATOM   1951 C C   . ASN A 1 249 ? -0.878  13.738  -8.572  1.00 29.47 ? 248  ASN A C   1 
ATOM   1952 O O   . ASN A 1 249 ? -1.172  14.234  -7.479  1.00 28.98 ? 248  ASN A O   1 
ATOM   1953 C CB  . ASN A 1 249 ? -0.896  11.461  -7.487  1.00 29.20 ? 248  ASN A CB  1 
ATOM   1954 C CG  . ASN A 1 249 ? -2.402  11.220  -7.516  1.00 30.63 ? 248  ASN A CG  1 
ATOM   1955 O OD1 . ASN A 1 249 ? -3.180  12.034  -8.035  1.00 28.39 ? 248  ASN A OD1 1 
ATOM   1956 N ND2 . ASN A 1 249 ? -2.822  10.097  -6.937  1.00 31.86 ? 248  ASN A ND2 1 
ATOM   1957 N N   . THR A 1 250 ? -0.969  14.389  -9.729  1.00 29.81 ? 249  THR A N   1 
ATOM   1958 C CA  . THR A 1 250 ? -1.358  15.800  -9.839  1.00 30.48 ? 249  THR A CA  1 
ATOM   1959 C C   . THR A 1 250 ? -2.669  16.122  -9.124  1.00 30.62 ? 249  THR A C   1 
ATOM   1960 O O   . THR A 1 250 ? -2.756  17.120  -8.416  1.00 30.52 ? 249  THR A O   1 
ATOM   1961 C CB  . THR A 1 250 ? -1.422  16.205  -11.335 1.00 30.95 ? 249  THR A CB  1 
ATOM   1962 O OG1 . THR A 1 250 ? -0.206  15.811  -11.980 1.00 31.15 ? 249  THR A OG1 1 
ATOM   1963 C CG2 . THR A 1 250 ? -1.428  17.721  -11.506 1.00 31.12 ? 249  THR A CG2 1 
ATOM   1964 N N   . ALA A 1 251 ? -3.669  15.251  -9.293  1.00 31.19 ? 250  ALA A N   1 
ATOM   1965 C CA  . ALA A 1 251 ? -4.994  15.430  -8.690  1.00 31.04 ? 250  ALA A CA  1 
ATOM   1966 C C   . ALA A 1 251 ? -4.961  15.449  -7.166  1.00 31.24 ? 250  ALA A C   1 
ATOM   1967 O O   . ALA A 1 251 ? -5.646  16.269  -6.535  1.00 31.57 ? 250  ALA A O   1 
ATOM   1968 C CB  . ALA A 1 251 ? -5.960  14.353  -9.189  1.00 31.20 ? 250  ALA A CB  1 
ATOM   1969 N N   . LYS A 1 252 ? -4.184  14.545  -6.568  1.00 31.03 ? 251  LYS A N   1 
ATOM   1970 C CA  . LYS A 1 252 ? -4.095  14.511  -5.109  1.00 30.80 ? 251  LYS A CA  1 
ATOM   1971 C C   . LYS A 1 252 ? -3.265  15.683  -4.585  1.00 30.42 ? 251  LYS A C   1 
ATOM   1972 O O   . LYS A 1 252 ? -3.496  16.178  -3.481  1.00 30.00 ? 251  LYS A O   1 
ATOM   1973 C CB  . LYS A 1 252 ? -3.563  13.162  -4.610  1.00 30.75 ? 251  LYS A CB  1 
ATOM   1974 C CG  . LYS A 1 252 ? -4.568  12.004  -4.789  1.00 31.01 ? 251  LYS A CG  1 
ATOM   1975 C CD  . LYS A 1 252 ? -5.846  12.268  -4.006  1.00 33.63 ? 251  LYS A CD  1 
ATOM   1976 C CE  . LYS A 1 252 ? -6.725  11.029  -3.885  1.00 35.14 ? 251  LYS A CE  1 
ATOM   1977 N NZ  . LYS A 1 252 ? -7.696  11.224  -2.763  1.00 36.60 ? 251  LYS A NZ  1 
ATOM   1978 N N   . VAL A 1 253 ? -2.310  16.136  -5.395  1.00 30.06 ? 252  VAL A N   1 
ATOM   1979 C CA  . VAL A 1 253 ? -1.532  17.321  -5.058  1.00 30.17 ? 252  VAL A CA  1 
ATOM   1980 C C   . VAL A 1 253 ? -2.440  18.552  -5.025  1.00 30.64 ? 252  VAL A C   1 
ATOM   1981 O O   . VAL A 1 253 ? -2.367  19.356  -4.091  1.00 30.98 ? 252  VAL A O   1 
ATOM   1982 C CB  . VAL A 1 253 ? -0.337  17.502  -6.026  1.00 30.05 ? 252  VAL A CB  1 
ATOM   1983 C CG1 . VAL A 1 253 ? 0.220   18.923  -5.976  1.00 28.92 ? 252  VAL A CG1 1 
ATOM   1984 C CG2 . VAL A 1 253 ? 0.747   16.484  -5.691  1.00 29.14 ? 252  VAL A CG2 1 
ATOM   1985 N N   . LYS A 1 254 ? -3.300  18.668  -6.036  1.00 31.78 ? 253  LYS A N   1 
ATOM   1986 C CA  . LYS A 1 254 ? -4.292  19.738  -6.123  1.00 32.89 ? 253  LYS A CA  1 
ATOM   1987 C C   . LYS A 1 254 ? -5.254  19.680  -4.953  1.00 33.18 ? 253  LYS A C   1 
ATOM   1988 O O   . LYS A 1 254 ? -5.569  20.711  -4.355  1.00 33.12 ? 253  LYS A O   1 
ATOM   1989 C CB  . LYS A 1 254 ? -5.090  19.629  -7.418  1.00 32.95 ? 253  LYS A CB  1 
ATOM   1990 C CG  . LYS A 1 254 ? -4.315  19.957  -8.681  1.00 34.56 ? 253  LYS A CG  1 
ATOM   1991 C CD  . LYS A 1 254 ? -5.036  19.363  -9.891  1.00 37.61 ? 253  LYS A CD  1 
ATOM   1992 C CE  . LYS A 1 254 ? -5.111  20.353  -11.047 1.00 39.01 ? 253  LYS A CE  1 
ATOM   1993 N NZ  . LYS A 1 254 ? -5.620  19.689  -12.290 1.00 39.07 ? 253  LYS A NZ  1 
ATOM   1994 N N   . GLU A 1 255 ? -5.717  18.464  -4.649  1.00 33.97 ? 254  GLU A N   1 
ATOM   1995 C CA  . GLU A 1 255 ? -6.594  18.182  -3.506  1.00 34.75 ? 254  GLU A CA  1 
ATOM   1996 C C   . GLU A 1 255 ? -6.008  18.668  -2.174  1.00 34.62 ? 254  GLU A C   1 
ATOM   1997 O O   . GLU A 1 255 ? -6.731  19.248  -1.348  1.00 34.61 ? 254  GLU A O   1 
ATOM   1998 C CB  . GLU A 1 255 ? -6.859  16.675  -3.419  1.00 35.21 ? 254  GLU A CB  1 
ATOM   1999 C CG  . GLU A 1 255 ? -8.313  16.287  -3.216  1.00 38.02 ? 254  GLU A CG  1 
ATOM   2000 C CD  . GLU A 1 255 ? -8.525  14.788  -3.334  1.00 41.58 ? 254  GLU A CD  1 
ATOM   2001 O OE1 . GLU A 1 255 ? -8.746  14.136  -2.289  1.00 43.78 ? 254  GLU A OE1 1 
ATOM   2002 O OE2 . GLU A 1 255 ? -8.463  14.257  -4.471  1.00 42.01 ? 254  GLU A OE2 1 
ATOM   2003 N N   . PHE A 1 256 ? -4.709  18.427  -1.967  1.00 34.20 ? 255  PHE A N   1 
ATOM   2004 C CA  . PHE A 1 256 ? -4.023  18.863  -0.749  1.00 33.72 ? 255  PHE A CA  1 
ATOM   2005 C C   . PHE A 1 256 ? -3.960  20.385  -0.639  1.00 33.85 ? 255  PHE A C   1 
ATOM   2006 O O   . PHE A 1 256 ? -3.993  20.934  0.465   1.00 34.03 ? 255  PHE A O   1 
ATOM   2007 C CB  . PHE A 1 256 ? -2.603  18.274  -0.649  1.00 33.45 ? 255  PHE A CB  1 
ATOM   2008 C CG  . PHE A 1 256 ? -1.805  18.818  0.507   1.00 32.71 ? 255  PHE A CG  1 
ATOM   2009 C CD1 . PHE A 1 256 ? -2.016  18.344  1.804   1.00 31.72 ? 255  PHE A CD1 1 
ATOM   2010 C CD2 . PHE A 1 256 ? -0.865  19.827  0.311   1.00 31.75 ? 255  PHE A CD2 1 
ATOM   2011 C CE1 . PHE A 1 256 ? -1.287  18.865  2.885   1.00 31.07 ? 255  PHE A CE1 1 
ATOM   2012 C CE2 . PHE A 1 256 ? -0.143  20.345  1.383   1.00 32.00 ? 255  PHE A CE2 1 
ATOM   2013 C CZ  . PHE A 1 256 ? -0.357  19.859  2.672   1.00 29.80 ? 255  PHE A CZ  1 
ATOM   2014 N N   . GLY A 1 257 ? -3.855  21.059  -1.782  1.00 33.78 ? 256  GLY A N   1 
ATOM   2015 C CA  . GLY A 1 257 ? -3.887  22.507  -1.814  1.00 33.74 ? 256  GLY A CA  1 
ATOM   2016 C C   . GLY A 1 257 ? -2.680  23.137  -2.469  1.00 33.89 ? 256  GLY A C   1 
ATOM   2017 O O   . GLY A 1 257 ? -2.374  24.304  -2.197  1.00 33.90 ? 256  GLY A O   1 
ATOM   2018 N N   . ILE A 1 258 ? -1.995  22.375  -3.325  1.00 33.72 ? 257  ILE A N   1 
ATOM   2019 C CA  . ILE A 1 258 ? -0.833  22.883  -4.051  1.00 33.89 ? 257  ILE A CA  1 
ATOM   2020 C C   . ILE A 1 258 ? -1.122  22.874  -5.546  1.00 34.35 ? 257  ILE A C   1 
ATOM   2021 O O   . ILE A 1 258 ? -1.627  21.883  -6.093  1.00 34.74 ? 257  ILE A O   1 
ATOM   2022 C CB  . ILE A 1 258 ? 0.466   22.067  -3.717  1.00 33.56 ? 257  ILE A CB  1 
ATOM   2023 C CG1 . ILE A 1 258 ? 1.003   22.430  -2.323  1.00 33.51 ? 257  ILE A CG1 1 
ATOM   2024 C CG2 . ILE A 1 258 ? 1.558   22.308  -4.770  1.00 33.07 ? 257  ILE A CG2 1 
ATOM   2025 C CD1 . ILE A 1 258 ? 1.945   21.372  -1.710  1.00 32.22 ? 257  ILE A CD1 1 
ATOM   2026 N N   . ASP A 1 259 ? -0.818  23.989  -6.198  1.00 34.72 ? 258  ASP A N   1 
ATOM   2027 C CA  . ASP A 1 259 ? -0.955  24.091  -7.644  1.00 35.77 ? 258  ASP A CA  1 
ATOM   2028 C C   . ASP A 1 259 ? 0.128   23.280  -8.371  1.00 35.52 ? 258  ASP A C   1 
ATOM   2029 O O   . ASP A 1 259 ? 1.260   23.224  -7.903  1.00 35.54 ? 258  ASP A O   1 
ATOM   2030 C CB  . ASP A 1 259 ? -0.898  25.555  -8.071  1.00 36.28 ? 258  ASP A CB  1 
ATOM   2031 C CG  . ASP A 1 259 ? -1.381  25.755  -9.480  1.00 38.45 ? 258  ASP A CG  1 
ATOM   2032 O OD1 . ASP A 1 259 ? -2.524  26.244  -9.659  1.00 41.67 ? 258  ASP A OD1 1 
ATOM   2033 O OD2 . ASP A 1 259 ? -0.694  25.434  -10.472 1.00 40.05 ? 258  ASP A OD2 1 
ATOM   2034 N N   . PRO A 1 260 ? -0.219  22.637  -9.493  1.00 35.61 ? 259  PRO A N   1 
ATOM   2035 C CA  . PRO A 1 260 ? 0.774   21.938  -10.332 1.00 35.46 ? 259  PRO A CA  1 
ATOM   2036 C C   . PRO A 1 260 ? 2.003   22.767  -10.746 1.00 35.12 ? 259  PRO A C   1 
ATOM   2037 O O   . PRO A 1 260 ? 3.038   22.168  -11.025 1.00 35.14 ? 259  PRO A O   1 
ATOM   2038 C CB  . PRO A 1 260 ? -0.036  21.523  -11.561 1.00 35.72 ? 259  PRO A CB  1 
ATOM   2039 C CG  . PRO A 1 260 ? -1.435  21.361  -11.030 1.00 35.96 ? 259  PRO A CG  1 
ATOM   2040 C CD  . PRO A 1 260 ? -1.592  22.465  -10.011 1.00 35.78 ? 259  PRO A CD  1 
ATOM   2041 N N   . GLN A 1 261 ? 1.902   24.095  -10.784 1.00 34.73 ? 260  GLN A N   1 
ATOM   2042 C CA  . GLN A 1 261 ? 3.072   24.951  -11.015 1.00 34.55 ? 260  GLN A CA  1 
ATOM   2043 C C   . GLN A 1 261 ? 4.116   24.747  -9.916  1.00 33.54 ? 260  GLN A C   1 
ATOM   2044 O O   . GLN A 1 261 ? 5.322   24.856  -10.153 1.00 32.95 ? 260  GLN A O   1 
ATOM   2045 C CB  . GLN A 1 261 ? 2.676   26.437  -11.082 1.00 35.22 ? 260  GLN A CB  1 
ATOM   2046 C CG  . GLN A 1 261 ? 1.945   26.959  -9.823  1.00 37.88 ? 260  GLN A CG  1 
ATOM   2047 C CD  . GLN A 1 261 ? 1.929   28.473  -9.676  1.00 40.75 ? 260  GLN A CD  1 
ATOM   2048 O OE1 . GLN A 1 261 ? 2.138   28.988  -8.572  1.00 42.62 ? 260  GLN A OE1 1 
ATOM   2049 N NE2 . GLN A 1 261 ? 1.656   29.188  -10.771 1.00 41.76 ? 260  GLN A NE2 1 
ATOM   2050 N N   . ASN A 1 262 ? 3.630   24.461  -8.710  1.00 32.65 ? 261  ASN A N   1 
ATOM   2051 C CA  . ASN A 1 262 ? 4.492   24.230  -7.560  1.00 31.54 ? 261  ASN A CA  1 
ATOM   2052 C C   . ASN A 1 262 ? 4.733   22.736  -7.350  1.00 30.40 ? 261  ASN A C   1 
ATOM   2053 O O   . ASN A 1 262 ? 5.038   22.290  -6.236  1.00 29.20 ? 261  ASN A O   1 
ATOM   2054 C CB  . ASN A 1 262 ? 3.901   24.897  -6.311  1.00 32.31 ? 261  ASN A CB  1 
ATOM   2055 C CG  . ASN A 1 262 ? 3.654   26.395  -6.511  1.00 33.61 ? 261  ASN A CG  1 
ATOM   2056 O OD1 . ASN A 1 262 ? 2.505   26.858  -6.494  1.00 36.78 ? 261  ASN A OD1 1 
ATOM   2057 N ND2 . ASN A 1 262 ? 4.732   27.153  -6.711  1.00 34.66 ? 261  ASN A ND2 1 
ATOM   2058 N N   . MET A 1 263 ? 4.597   21.981  -8.441  1.00 28.61 ? 262  MET A N   1 
ATOM   2059 C CA  . MET A 1 263 ? 4.762   20.528  -8.432  1.00 27.33 ? 262  MET A CA  1 
ATOM   2060 C C   . MET A 1 263 ? 5.812   20.108  -9.451  1.00 26.48 ? 262  MET A C   1 
ATOM   2061 O O   . MET A 1 263 ? 5.808   20.596  -10.579 1.00 26.45 ? 262  MET A O   1 
ATOM   2062 C CB  . MET A 1 263 ? 3.426   19.840  -8.735  1.00 27.16 ? 262  MET A CB  1 
ATOM   2063 C CG  . MET A 1 263 ? 3.485   18.326  -8.772  1.00 27.79 ? 262  MET A CG  1 
ATOM   2064 S SD  . MET A 1 263 ? 1.965   17.594  -9.406  1.00 30.11 ? 262  MET A SD  1 
ATOM   2065 C CE  . MET A 1 263 ? 2.489   15.935  -9.586  1.00 27.90 ? 262  MET A CE  1 
ATOM   2066 N N   . LEU A 1 264 ? 6.722   19.221  -9.036  1.00 25.11 ? 263  LEU A N   1 
ATOM   2067 C CA  . LEU A 1 264 ? 7.707   18.631  -9.936  1.00 24.40 ? 263  LEU A CA  1 
ATOM   2068 C C   . LEU A 1 264 ? 7.347   17.165  -10.035 1.00 23.89 ? 263  LEU A C   1 
ATOM   2069 O O   . LEU A 1 264 ? 7.206   16.478  -9.018  1.00 24.22 ? 263  LEU A O   1 
ATOM   2070 C CB  . LEU A 1 264 ? 9.133   18.793  -9.396  1.00 24.48 ? 263  LEU A CB  1 
ATOM   2071 C CG  . LEU A 1 264 ? 9.663   20.226  -9.221  1.00 24.79 ? 263  LEU A CG  1 
ATOM   2072 C CD1 . LEU A 1 264 ? 11.011  20.198  -8.552  1.00 25.89 ? 263  LEU A CD1 1 
ATOM   2073 C CD2 . LEU A 1 264 ? 9.762   20.936  -10.552 1.00 27.91 ? 263  LEU A CD2 1 
ATOM   2074 N N   . GLU A 1 265 ? 7.163   16.684  -11.250 1.00 23.25 ? 264  GLU A N   1 
ATOM   2075 C CA  . GLU A 1 265 ? 6.616   15.349  -11.387 1.00 23.52 ? 264  GLU A CA  1 
ATOM   2076 C C   . GLU A 1 265 ? 7.644   14.281  -11.661 1.00 22.23 ? 264  GLU A C   1 
ATOM   2077 O O   . GLU A 1 265 ? 8.759   14.557  -12.101 1.00 21.89 ? 264  GLU A O   1 
ATOM   2078 C CB  . GLU A 1 265 ? 5.456   15.307  -12.377 1.00 24.15 ? 264  GLU A CB  1 
ATOM   2079 C CG  . GLU A 1 265 ? 5.789   15.524  -13.831 1.00 28.29 ? 264  GLU A CG  1 
ATOM   2080 C CD  . GLU A 1 265 ? 4.518   15.579  -14.668 1.00 33.97 ? 264  GLU A CD  1 
ATOM   2081 O OE1 . GLU A 1 265 ? 4.140   14.541  -15.256 1.00 36.52 ? 264  GLU A OE1 1 
ATOM   2082 O OE2 . GLU A 1 265 ? 3.884   16.658  -14.722 1.00 37.77 ? 264  GLU A OE2 1 
ATOM   2083 N N   . PHE A 1 266 ? 7.261   13.058  -11.321 1.00 21.12 ? 265  PHE A N   1 
ATOM   2084 C CA  . PHE A 1 266 ? 7.953   11.884  -11.809 1.00 20.73 ? 265  PHE A CA  1 
ATOM   2085 C C   . PHE A 1 266 ? 6.891   10.896  -12.287 1.00 20.42 ? 265  PHE A C   1 
ATOM   2086 O O   . PHE A 1 266 ? 5.717   11.284  -12.458 1.00 20.14 ? 265  PHE A O   1 
ATOM   2087 C CB  . PHE A 1 266 ? 9.003   11.311  -10.826 1.00 20.26 ? 265  PHE A CB  1 
ATOM   2088 C CG  . PHE A 1 266 ? 8.491   10.989  -9.433  1.00 19.92 ? 265  PHE A CG  1 
ATOM   2089 C CD1 . PHE A 1 266 ? 8.519   9.679   -8.960  1.00 21.30 ? 265  PHE A CD1 1 
ATOM   2090 C CD2 . PHE A 1 266 ? 8.059   11.990  -8.575  1.00 20.16 ? 265  PHE A CD2 1 
ATOM   2091 C CE1 . PHE A 1 266 ? 8.071   9.379   -7.649  1.00 20.24 ? 265  PHE A CE1 1 
ATOM   2092 C CE2 . PHE A 1 266 ? 7.626   11.699  -7.267  1.00 18.95 ? 265  PHE A CE2 1 
ATOM   2093 C CZ  . PHE A 1 266 ? 7.628   10.391  -6.816  1.00 20.36 ? 265  PHE A CZ  1 
ATOM   2094 N N   . TRP A 1 267 ? 7.290   9.655   -12.539 1.00 20.81 ? 266  TRP A N   1 
ATOM   2095 C CA  . TRP A 1 267 ? 6.477   8.748   -13.361 1.00 21.44 ? 266  TRP A CA  1 
ATOM   2096 C C   . TRP A 1 267 ? 6.333   7.402   -12.685 1.00 21.08 ? 266  TRP A C   1 
ATOM   2097 O O   . TRP A 1 267 ? 7.101   7.083   -11.785 1.00 20.49 ? 266  TRP A O   1 
ATOM   2098 C CB  . TRP A 1 267 ? 7.112   8.628   -14.760 1.00 21.82 ? 266  TRP A CB  1 
ATOM   2099 C CG  . TRP A 1 267 ? 7.207   9.988   -15.346 1.00 22.98 ? 266  TRP A CG  1 
ATOM   2100 C CD1 . TRP A 1 267 ? 6.206   10.683  -15.976 1.00 23.59 ? 266  TRP A CD1 1 
ATOM   2101 C CD2 . TRP A 1 267 ? 8.323   10.878  -15.265 1.00 23.62 ? 266  TRP A CD2 1 
ATOM   2102 N NE1 . TRP A 1 267 ? 6.646   11.945  -16.313 1.00 25.77 ? 266  TRP A NE1 1 
ATOM   2103 C CE2 . TRP A 1 267 ? 7.938   12.093  -15.878 1.00 23.62 ? 266  TRP A CE2 1 
ATOM   2104 C CE3 . TRP A 1 267 ? 9.614   10.777  -14.725 1.00 22.36 ? 266  TRP A CE3 1 
ATOM   2105 C CZ2 . TRP A 1 267 ? 8.804   13.184  -15.989 1.00 25.36 ? 266  TRP A CZ2 1 
ATOM   2106 C CZ3 . TRP A 1 267 ? 10.473  11.861  -14.835 1.00 23.04 ? 266  TRP A CZ3 1 
ATOM   2107 C CH2 . TRP A 1 267 ? 10.062  13.048  -15.461 1.00 22.42 ? 266  TRP A CH2 1 
ATOM   2108 N N   . ASP A 1 268 ? 5.347   6.614   -13.113 1.00 21.42 ? 267  ASP A N   1 
ATOM   2109 C CA  . ASP A 1 268 ? 5.067   5.356   -12.444 1.00 22.14 ? 267  ASP A CA  1 
ATOM   2110 C C   . ASP A 1 268 ? 6.212   4.357   -12.557 1.00 21.53 ? 267  ASP A C   1 
ATOM   2111 O O   . ASP A 1 268 ? 6.332   3.472   -11.720 1.00 22.51 ? 267  ASP A O   1 
ATOM   2112 C CB  . ASP A 1 268 ? 3.718   4.745   -12.890 1.00 22.58 ? 267  ASP A CB  1 
ATOM   2113 C CG  . ASP A 1 268 ? 3.717   4.260   -14.336 1.00 25.47 ? 267  ASP A CG  1 
ATOM   2114 O OD1 . ASP A 1 268 ? 4.745   4.345   -15.046 1.00 27.44 ? 267  ASP A OD1 1 
ATOM   2115 O OD2 . ASP A 1 268 ? 2.690   3.773   -14.850 1.00 29.00 ? 267  ASP A OD2 1 
ATOM   2116 N N   . TRP A 1 269 ? 7.062   4.515   -13.574 1.00 20.72 ? 268  TRP A N   1 
ATOM   2117 C CA  . TRP A 1 269 ? 8.217   3.636   -13.764 1.00 19.62 ? 268  TRP A CA  1 
ATOM   2118 C C   . TRP A 1 269 ? 9.435   4.024   -12.907 1.00 19.21 ? 268  TRP A C   1 
ATOM   2119 O O   . TRP A 1 269 ? 10.517  3.474   -13.074 1.00 19.28 ? 268  TRP A O   1 
ATOM   2120 C CB  . TRP A 1 269 ? 8.603   3.503   -15.260 1.00 20.24 ? 268  TRP A CB  1 
ATOM   2121 C CG  . TRP A 1 269 ? 8.495   4.763   -16.088 1.00 19.44 ? 268  TRP A CG  1 
ATOM   2122 C CD1 . TRP A 1 269 ? 7.515   5.067   -16.992 1.00 21.85 ? 268  TRP A CD1 1 
ATOM   2123 C CD2 . TRP A 1 269 ? 9.421   5.858   -16.126 1.00 21.20 ? 268  TRP A CD2 1 
ATOM   2124 N NE1 . TRP A 1 269 ? 7.754   6.296   -17.559 1.00 22.89 ? 268  TRP A NE1 1 
ATOM   2125 C CE2 . TRP A 1 269 ? 8.923   6.800   -17.053 1.00 21.71 ? 268  TRP A CE2 1 
ATOM   2126 C CE3 . TRP A 1 269 ? 10.616  6.151   -15.454 1.00 21.52 ? 268  TRP A CE3 1 
ATOM   2127 C CZ2 . TRP A 1 269 ? 9.569   8.011   -17.321 1.00 22.80 ? 268  TRP A CZ2 1 
ATOM   2128 C CZ3 . TRP A 1 269 ? 11.262  7.355   -15.725 1.00 21.23 ? 268  TRP A CZ3 1 
ATOM   2129 C CH2 . TRP A 1 269 ? 10.742  8.263   -16.659 1.00 22.49 ? 268  TRP A CH2 1 
ATOM   2130 N N   . VAL A 1 270 ? 9.232   4.967   -11.990 1.00 18.63 ? 269  VAL A N   1 
ATOM   2131 C CA  . VAL A 1 270 ? 10.205  5.301   -10.948 1.00 18.16 ? 269  VAL A CA  1 
ATOM   2132 C C   . VAL A 1 270 ? 9.724   4.714   -9.625  1.00 18.16 ? 269  VAL A C   1 
ATOM   2133 O O   . VAL A 1 270 ? 8.804   5.263   -8.985  1.00 18.58 ? 269  VAL A O   1 
ATOM   2134 C CB  . VAL A 1 270 ? 10.376  6.828   -10.811 1.00 18.08 ? 269  VAL A CB  1 
ATOM   2135 C CG1 . VAL A 1 270 ? 11.365  7.162   -9.706  1.00 18.99 ? 269  VAL A CG1 1 
ATOM   2136 C CG2 . VAL A 1 270 ? 10.791  7.465   -12.146 1.00 18.25 ? 269  VAL A CG2 1 
ATOM   2137 N N   . GLY A 1 271 ? 10.319  3.590   -9.226  1.00 17.70 ? 270  GLY A N   1 
ATOM   2138 C CA  . GLY A 1 271 ? 10.008  2.995   -7.931  1.00 18.23 ? 270  GLY A CA  1 
ATOM   2139 C C   . GLY A 1 271 ? 10.451  3.895   -6.788  1.00 18.16 ? 270  GLY A C   1 
ATOM   2140 O O   . GLY A 1 271 ? 11.514  4.502   -6.864  1.00 18.18 ? 270  GLY A O   1 
ATOM   2141 N N   . GLY A 1 272 ? 9.646   4.002   -5.730  1.00 18.07 ? 271  GLY A N   1 
ATOM   2142 C CA  . GLY A 1 272 ? 10.026  4.812   -4.570  1.00 18.47 ? 271  GLY A CA  1 
ATOM   2143 C C   . GLY A 1 272 ? 11.475  4.617   -4.130  1.00 18.14 ? 271  GLY A C   1 
ATOM   2144 O O   . GLY A 1 272 ? 12.242  5.578   -3.932  1.00 18.16 ? 271  GLY A O   1 
ATOM   2145 N N   . ARG A 1 273 ? 11.878  3.358   -4.017  1.00 17.64 ? 272  ARG A N   1 
ATOM   2146 C CA  . ARG A 1 273 ? 13.214  3.044   -3.526  1.00 16.90 ? 272  ARG A CA  1 
ATOM   2147 C C   . ARG A 1 273 ? 14.314  3.200   -4.580  1.00 16.88 ? 272  ARG A C   1 
ATOM   2148 O O   . ARG A 1 273 ? 15.489  2.892   -4.306  1.00 16.16 ? 272  ARG A O   1 
ATOM   2149 C CB  . ARG A 1 273 ? 13.255  1.640   -2.907  1.00 17.28 ? 272  ARG A CB  1 
ATOM   2150 C CG  . ARG A 1 273 ? 12.893  0.528   -3.870  1.00 18.23 ? 272  ARG A CG  1 
ATOM   2151 C CD  . ARG A 1 273 ? 12.642  -0.799  -3.163  1.00 17.78 ? 272  ARG A CD  1 
ATOM   2152 N NE  . ARG A 1 273 ? 12.099  -1.804  -4.082  1.00 18.95 ? 272  ARG A NE  1 
ATOM   2153 C CZ  . ARG A 1 273 ? 10.807  -2.039  -4.265  1.00 19.78 ? 272  ARG A CZ  1 
ATOM   2154 N NH1 . ARG A 1 273 ? 9.889   -1.349  -3.585  1.00 17.85 ? 272  ARG A NH1 1 
ATOM   2155 N NH2 . ARG A 1 273 ? 10.435  -2.974  -5.133  1.00 17.55 ? 272  ARG A NH2 1 
ATOM   2156 N N   . TYR A 1 274 ? 13.932  3.707   -5.755  1.00 16.62 ? 273  TYR A N   1 
ATOM   2157 C CA  . TYR A 1 274 ? 14.868  4.032   -6.832  1.00 16.80 ? 273  TYR A CA  1 
ATOM   2158 C C   . TYR A 1 274 ? 14.628  5.455   -7.299  1.00 16.19 ? 273  TYR A C   1 
ATOM   2159 O O   . TYR A 1 274 ? 14.918  5.788   -8.460  1.00 17.23 ? 273  TYR A O   1 
ATOM   2160 C CB  . TYR A 1 274 ? 14.637  3.105   -8.023  1.00 16.44 ? 273  TYR A CB  1 
ATOM   2161 C CG  . TYR A 1 274 ? 14.904  1.653   -7.732  1.00 16.82 ? 273  TYR A CG  1 
ATOM   2162 C CD1 . TYR A 1 274 ? 13.862  0.776   -7.448  1.00 18.06 ? 273  TYR A CD1 1 
ATOM   2163 C CD2 . TYR A 1 274 ? 16.208  1.164   -7.710  1.00 16.92 ? 273  TYR A CD2 1 
ATOM   2164 C CE1 . TYR A 1 274 ? 14.118  -0.568  -7.165  1.00 15.95 ? 273  TYR A CE1 1 
ATOM   2165 C CE2 . TYR A 1 274 ? 16.475  -0.169  -7.432  1.00 18.40 ? 273  TYR A CE2 1 
ATOM   2166 C CZ  . TYR A 1 274 ? 15.421  -1.026  -7.162  1.00 15.66 ? 273  TYR A CZ  1 
ATOM   2167 O OH  . TYR A 1 274 ? 15.698  -2.348  -6.891  1.00 16.82 ? 273  TYR A OH  1 
ATOM   2168 N N   . SER A 1 275 ? 14.072  6.280   -6.416  1.00 16.07 ? 274  SER A N   1 
ATOM   2169 C CA  . SER A 1 275 ? 13.552  7.583   -6.815  1.00 15.60 ? 274  SER A CA  1 
ATOM   2170 C C   . SER A 1 275 ? 14.430  8.788   -6.525  1.00 16.26 ? 274  SER A C   1 
ATOM   2171 O O   . SER A 1 275 ? 14.073  9.892   -6.938  1.00 16.02 ? 274  SER A O   1 
ATOM   2172 C CB  . SER A 1 275 ? 12.168  7.833   -6.218  1.00 16.09 ? 274  SER A CB  1 
ATOM   2173 O OG  . SER A 1 275 ? 12.248  8.022   -4.817  1.00 16.86 ? 274  SER A OG  1 
ATOM   2174 N N   . LEU A 1 276 ? 15.552  8.628   -5.829  1.00 15.40 ? 275  LEU A N   1 
ATOM   2175 C CA  . LEU A 1 276 ? 16.345  9.842   -5.503  1.00 16.10 ? 275  LEU A CA  1 
ATOM   2176 C C   . LEU A 1 276 ? 16.883  10.572  -6.745  1.00 16.16 ? 275  LEU A C   1 
ATOM   2177 O O   . LEU A 1 276 ? 17.181  11.789  -6.697  1.00 16.65 ? 275  LEU A O   1 
ATOM   2178 C CB  . LEU A 1 276 ? 17.464  9.539   -4.502  1.00 16.14 ? 275  LEU A CB  1 
ATOM   2179 C CG  . LEU A 1 276 ? 18.632  8.675   -4.961  1.00 15.45 ? 275  LEU A CG  1 
ATOM   2180 C CD1 . LEU A 1 276 ? 19.652  9.601   -5.622  1.00 16.34 ? 275  LEU A CD1 1 
ATOM   2181 C CD2 . LEU A 1 276 ? 19.249  7.981   -3.758  1.00 17.55 ? 275  LEU A CD2 1 
ATOM   2182 N N   . TRP A 1 277 ? 16.984  9.836   -7.845  1.00 15.60 ? 276  TRP A N   1 
ATOM   2183 C CA  . TRP A 1 277 ? 17.486  10.377  -9.118  1.00 16.39 ? 276  TRP A CA  1 
ATOM   2184 C C   . TRP A 1 277 ? 16.472  11.270  -9.827  1.00 15.74 ? 276  TRP A C   1 
ATOM   2185 O O   . TRP A 1 277 ? 16.813  11.919  -10.797 1.00 17.25 ? 276  TRP A O   1 
ATOM   2186 C CB  . TRP A 1 277 ? 17.874  9.217   -10.042 1.00 15.98 ? 276  TRP A CB  1 
ATOM   2187 C CG  . TRP A 1 277 ? 18.537  8.072   -9.292  1.00 16.64 ? 276  TRP A CG  1 
ATOM   2188 C CD1 . TRP A 1 277 ? 17.926  6.925   -8.850  1.00 16.65 ? 276  TRP A CD1 1 
ATOM   2189 C CD2 . TRP A 1 277 ? 19.904  7.981   -8.879  1.00 16.81 ? 276  TRP A CD2 1 
ATOM   2190 N NE1 . TRP A 1 277 ? 18.835  6.122   -8.206  1.00 16.54 ? 276  TRP A NE1 1 
ATOM   2191 C CE2 . TRP A 1 277 ? 20.055  6.748   -8.195  1.00 17.32 ? 276  TRP A CE2 1 
ATOM   2192 C CE3 . TRP A 1 277 ? 21.027  8.814   -9.017  1.00 15.26 ? 276  TRP A CE3 1 
ATOM   2193 C CZ2 . TRP A 1 277 ? 21.283  6.314   -7.686  1.00 16.41 ? 276  TRP A CZ2 1 
ATOM   2194 C CZ3 . TRP A 1 277 ? 22.248  8.400   -8.481  1.00 14.90 ? 276  TRP A CZ3 1 
ATOM   2195 C CH2 . TRP A 1 277 ? 22.370  7.153   -7.826  1.00 15.82 ? 276  TRP A CH2 1 
ATOM   2196 N N   . SER A 1 278 ? 15.231  11.265  -9.342  1.00 15.65 ? 277  SER A N   1 
ATOM   2197 C CA  . SER A 1 278 ? 14.128  11.980  -9.961  1.00 16.19 ? 277  SER A CA  1 
ATOM   2198 C C   . SER A 1 278 ? 13.886  13.276  -9.207  1.00 15.94 ? 277  SER A C   1 
ATOM   2199 O O   . SER A 1 278 ? 14.752  13.716  -8.452  1.00 16.52 ? 277  SER A O   1 
ATOM   2200 C CB  . SER A 1 278 ? 12.855  11.119  -9.908  1.00 15.84 ? 277  SER A CB  1 
ATOM   2201 O OG  . SER A 1 278 ? 12.280  11.192  -8.610  1.00 17.51 ? 277  SER A OG  1 
ATOM   2202 N N   . ALA A 1 279 ? 12.700  13.861  -9.400  1.00 16.49 ? 278  ALA A N   1 
ATOM   2203 C CA  . ALA A 1 279 ? 12.225  15.025  -8.657  1.00 16.61 ? 278  ALA A CA  1 
ATOM   2204 C C   . ALA A 1 279 ? 12.389  14.845  -7.163  1.00 16.77 ? 278  ALA A C   1 
ATOM   2205 O O   . ALA A 1 279 ? 12.655  15.796  -6.466  1.00 17.16 ? 278  ALA A O   1 
ATOM   2206 C CB  . ALA A 1 279 ? 10.729  15.306  -8.978  1.00 16.74 ? 278  ALA A CB  1 
ATOM   2207 N N   . ILE A 1 280 ? 12.222  13.612  -6.683  1.00 16.85 ? 279  ILE A N   1 
ATOM   2208 C CA  . ILE A 1 280 ? 12.432  13.282  -5.271  1.00 17.08 ? 279  ILE A CA  1 
ATOM   2209 C C   . ILE A 1 280 ? 13.806  13.744  -4.745  1.00 17.19 ? 279  ILE A C   1 
ATOM   2210 O O   . ILE A 1 280 ? 13.960  14.042  -3.555  1.00 17.33 ? 279  ILE A O   1 
ATOM   2211 C CB  . ILE A 1 280 ? 12.221  11.766  -5.054  1.00 16.98 ? 279  ILE A CB  1 
ATOM   2212 C CG1 . ILE A 1 280 ? 10.747  11.389  -5.288  1.00 17.24 ? 279  ILE A CG1 1 
ATOM   2213 C CG2 . ILE A 1 280 ? 12.743  11.303  -3.673  1.00 18.79 ? 279  ILE A CG2 1 
ATOM   2214 C CD1 . ILE A 1 280 ? 9.780   11.882  -4.208  1.00 18.46 ? 279  ILE A CD1 1 
ATOM   2215 N N   . GLY A 1 281 ? 14.788  13.859  -5.635  1.00 17.23 ? 280  GLY A N   1 
ATOM   2216 C CA  . GLY A 1 281 ? 16.098  14.349  -5.228  1.00 16.80 ? 280  GLY A CA  1 
ATOM   2217 C C   . GLY A 1 281 ? 16.197  15.859  -5.088  1.00 16.98 ? 280  GLY A C   1 
ATOM   2218 O O   . GLY A 1 281 ? 17.289  16.396  -4.918  1.00 16.97 ? 280  GLY A O   1 
ATOM   2219 N N   . LEU A 1 282 ? 15.065  16.549  -5.141  1.00 17.35 ? 281  LEU A N   1 
ATOM   2220 C CA  . LEU A 1 282 ? 15.084  18.008  -5.032  1.00 17.86 ? 281  LEU A CA  1 
ATOM   2221 C C   . LEU A 1 282 ? 15.826  18.524  -3.792  1.00 17.98 ? 281  LEU A C   1 
ATOM   2222 O O   . LEU A 1 282 ? 16.633  19.450  -3.902  1.00 18.11 ? 281  LEU A O   1 
ATOM   2223 C CB  . LEU A 1 282 ? 13.664  18.592  -5.112  1.00 17.63 ? 281  LEU A CB  1 
ATOM   2224 C CG  . LEU A 1 282 ? 13.636  20.128  -5.031  1.00 19.62 ? 281  LEU A CG  1 
ATOM   2225 C CD1 . LEU A 1 282 ? 14.268  20.721  -6.275  1.00 17.00 ? 281  LEU A CD1 1 
ATOM   2226 C CD2 . LEU A 1 282 ? 12.224  20.630  -4.864  1.00 19.29 ? 281  LEU A CD2 1 
ATOM   2227 N N   . SER A 1 283 ? 15.553  17.941  -2.622  1.00 17.73 ? 282  SER A N   1 
ATOM   2228 C CA  . SER A 1 283 ? 16.210  18.375  -1.396  1.00 17.73 ? 282  SER A CA  1 
ATOM   2229 C C   . SER A 1 283 ? 17.742  18.171  -1.452  1.00 17.52 ? 282  SER A C   1 
ATOM   2230 O O   . SER A 1 283 ? 18.482  18.937  -0.839  1.00 17.13 ? 282  SER A O   1 
ATOM   2231 C CB  . SER A 1 283 ? 15.588  17.700  -0.160  1.00 17.63 ? 282  SER A CB  1 
ATOM   2232 O OG  . SER A 1 283 ? 15.788  16.298  -0.206  1.00 18.86 ? 282  SER A OG  1 
ATOM   2233 N N   . ILE A 1 284 ? 18.210  17.150  -2.180  1.00 17.66 ? 283  ILE A N   1 
ATOM   2234 C CA  . ILE A 1 284 ? 19.658  16.994  -2.431  1.00 18.21 ? 283  ILE A CA  1 
ATOM   2235 C C   . ILE A 1 284 ? 20.185  18.185  -3.233  1.00 18.80 ? 283  ILE A C   1 
ATOM   2236 O O   . ILE A 1 284 ? 21.179  18.814  -2.861  1.00 19.26 ? 283  ILE A O   1 
ATOM   2237 C CB  . ILE A 1 284 ? 19.978  15.686  -3.205  1.00 17.93 ? 283  ILE A CB  1 
ATOM   2238 C CG1 . ILE A 1 284 ? 19.358  14.460  -2.514  1.00 17.67 ? 283  ILE A CG1 1 
ATOM   2239 C CG2 . ILE A 1 284 ? 21.496  15.552  -3.396  1.00 18.20 ? 283  ILE A CG2 1 
ATOM   2240 C CD1 . ILE A 1 284 ? 19.315  13.194  -3.409  1.00 19.27 ? 283  ILE A CD1 1 
ATOM   2241 N N   . ALA A 1 285 ? 19.504  18.484  -4.334  1.00 18.77 ? 284  ALA A N   1 
ATOM   2242 C CA  . ALA A 1 285 ? 19.955  19.537  -5.231  1.00 18.74 ? 284  ALA A CA  1 
ATOM   2243 C C   . ALA A 1 285 ? 19.895  20.896  -4.535  1.00 18.63 ? 284  ALA A C   1 
ATOM   2244 O O   . ALA A 1 285 ? 20.793  21.715  -4.705  1.00 18.79 ? 284  ALA A O   1 
ATOM   2245 C CB  . ALA A 1 285 ? 19.160  19.515  -6.541  1.00 19.27 ? 284  ALA A CB  1 
ATOM   2246 N N   . LEU A 1 286 ? 18.881  21.119  -3.705  1.00 18.89 ? 285  LEU A N   1 
ATOM   2247 C CA  . LEU A 1 286 ? 18.810  22.379  -2.958  1.00 18.75 ? 285  LEU A CA  1 
ATOM   2248 C C   . LEU A 1 286 ? 19.966  22.533  -1.977  1.00 19.08 ? 285  LEU A C   1 
ATOM   2249 O O   . LEU A 1 286 ? 20.467  23.633  -1.762  1.00 18.67 ? 285  LEU A O   1 
ATOM   2250 C CB  . LEU A 1 286 ? 17.481  22.507  -2.207  1.00 18.73 ? 285  LEU A CB  1 
ATOM   2251 C CG  . LEU A 1 286 ? 16.267  22.867  -3.071  1.00 20.70 ? 285  LEU A CG  1 
ATOM   2252 C CD1 . LEU A 1 286 ? 14.984  22.507  -2.330  1.00 19.72 ? 285  LEU A CD1 1 
ATOM   2253 C CD2 . LEU A 1 286 ? 16.275  24.356  -3.445  1.00 21.43 ? 285  LEU A CD2 1 
ATOM   2254 N N   . HIS A 1 287 ? 20.377  21.419  -1.378  1.00 19.54 ? 286  HIS A N   1 
ATOM   2255 C CA  . HIS A 1 287 ? 21.375  21.431  -0.326  1.00 20.23 ? 286  HIS A CA  1 
ATOM   2256 C C   . HIS A 1 287 ? 22.782  21.568  -0.892  1.00 20.58 ? 286  HIS A C   1 
ATOM   2257 O O   . HIS A 1 287 ? 23.536  22.428  -0.440  1.00 20.87 ? 286  HIS A O   1 
ATOM   2258 C CB  . HIS A 1 287 ? 21.248  20.155  0.498   1.00 19.95 ? 286  HIS A CB  1 
ATOM   2259 C CG  . HIS A 1 287 ? 21.996  20.169  1.793   1.00 20.09 ? 286  HIS A CG  1 
ATOM   2260 N ND1 . HIS A 1 287 ? 21.931  21.210  2.692   1.00 20.64 ? 286  HIS A ND1 1 
ATOM   2261 C CD2 . HIS A 1 287 ? 22.795  19.231  2.357   1.00 20.41 ? 286  HIS A CD2 1 
ATOM   2262 C CE1 . HIS A 1 287 ? 22.674  20.923  3.746   1.00 21.53 ? 286  HIS A CE1 1 
ATOM   2263 N NE2 . HIS A 1 287 ? 23.194  19.719  3.575   1.00 21.68 ? 286  HIS A NE2 1 
ATOM   2264 N N   . VAL A 1 288 ? 23.122  20.749  -1.885  1.00 20.75 ? 287  VAL A N   1 
ATOM   2265 C CA  . VAL A 1 288 ? 24.483  20.733  -2.447  1.00 21.04 ? 287  VAL A CA  1 
ATOM   2266 C C   . VAL A 1 288 ? 24.618  21.487  -3.782  1.00 20.98 ? 287  VAL A C   1 
ATOM   2267 O O   . VAL A 1 288 ? 25.737  21.682  -4.288  1.00 20.51 ? 287  VAL A O   1 
ATOM   2268 C CB  . VAL A 1 288 ? 25.062  19.274  -2.575  1.00 20.99 ? 287  VAL A CB  1 
ATOM   2269 C CG1 . VAL A 1 288 ? 25.110  18.586  -1.209  1.00 20.81 ? 287  VAL A CG1 1 
ATOM   2270 C CG2 . VAL A 1 288 ? 24.273  18.411  -3.583  1.00 21.81 ? 287  VAL A CG2 1 
ATOM   2271 N N   . GLY A 1 289 ? 23.482  21.906  -4.345  1.00 20.97 ? 288  GLY A N   1 
ATOM   2272 C CA  . GLY A 1 289 ? 23.464  22.566  -5.638  1.00 21.44 ? 288  GLY A CA  1 
ATOM   2273 C C   . GLY A 1 289 ? 23.194  21.614  -6.787  1.00 21.12 ? 288  GLY A C   1 
ATOM   2274 O O   . GLY A 1 289 ? 23.520  20.414  -6.735  1.00 20.92 ? 288  GLY A O   1 
ATOM   2275 N N   . PHE A 1 290 ? 22.598  22.158  -7.838  1.00 21.43 ? 289  PHE A N   1 
ATOM   2276 C CA  . PHE A 1 290 ? 22.245  21.358  -8.995  1.00 21.34 ? 289  PHE A CA  1 
ATOM   2277 C C   . PHE A 1 290 ? 23.451  20.746  -9.719  1.00 21.26 ? 289  PHE A C   1 
ATOM   2278 O O   . PHE A 1 290 ? 23.383  19.601  -10.178 1.00 21.48 ? 289  PHE A O   1 
ATOM   2279 C CB  . PHE A 1 290 ? 21.365  22.143  -9.966  1.00 21.32 ? 289  PHE A CB  1 
ATOM   2280 C CG  . PHE A 1 290 ? 20.735  21.270  -11.004 1.00 21.34 ? 289  PHE A CG  1 
ATOM   2281 C CD1 . PHE A 1 290 ? 19.585  20.548  -10.708 1.00 21.86 ? 289  PHE A CD1 1 
ATOM   2282 C CD2 . PHE A 1 290 ? 21.342  21.104  -12.244 1.00 21.56 ? 289  PHE A CD2 1 
ATOM   2283 C CE1 . PHE A 1 290 ? 19.018  19.713  -11.657 1.00 21.85 ? 289  PHE A CE1 1 
ATOM   2284 C CE2 . PHE A 1 290 ? 20.773  20.272  -13.201 1.00 22.78 ? 289  PHE A CE2 1 
ATOM   2285 C CZ  . PHE A 1 290 ? 19.617  19.569  -12.895 1.00 23.38 ? 289  PHE A CZ  1 
ATOM   2286 N N   . ASP A 1 291 ? 24.555  21.489  -9.805  1.00 21.29 ? 290  ASP A N   1 
ATOM   2287 C CA  . ASP A 1 291 ? 25.770  20.958  -10.432 1.00 22.28 ? 290  ASP A CA  1 
ATOM   2288 C C   . ASP A 1 291 ? 26.206  19.648  -9.761  1.00 20.81 ? 290  ASP A C   1 
ATOM   2289 O O   . ASP A 1 291 ? 26.488  18.662  -10.452 1.00 21.63 ? 290  ASP A O   1 
ATOM   2290 C CB  . ASP A 1 291 ? 26.923  21.968  -10.376 1.00 22.90 ? 290  ASP A CB  1 
ATOM   2291 C CG  . ASP A 1 291 ? 26.733  23.156  -11.331 1.00 27.44 ? 290  ASP A CG  1 
ATOM   2292 O OD1 . ASP A 1 291 ? 25.750  23.190  -12.119 1.00 31.28 ? 290  ASP A OD1 1 
ATOM   2293 O OD2 . ASP A 1 291 ? 27.543  24.110  -11.361 1.00 30.66 ? 290  ASP A OD2 1 
ATOM   2294 N N   . HIS A 1 292 ? 26.248  19.638  -8.427  1.00 19.45 ? 291  HIS A N   1 
ATOM   2295 C CA  . HIS A 1 292 ? 26.648  18.429  -7.685  1.00 19.23 ? 291  HIS A CA  1 
ATOM   2296 C C   . HIS A 1 292 ? 25.612  17.314  -7.828  1.00 18.60 ? 291  HIS A C   1 
ATOM   2297 O O   . HIS A 1 292 ? 25.980  16.139  -7.899  1.00 18.02 ? 291  HIS A O   1 
ATOM   2298 C CB  . HIS A 1 292 ? 26.911  18.718  -6.204  1.00 18.25 ? 291  HIS A CB  1 
ATOM   2299 C CG  . HIS A 1 292 ? 28.192  19.454  -5.948  1.00 19.40 ? 291  HIS A CG  1 
ATOM   2300 N ND1 . HIS A 1 292 ? 28.309  20.435  -4.987  1.00 20.65 ? 291  HIS A ND1 1 
ATOM   2301 C CD2 . HIS A 1 292 ? 29.406  19.361  -6.540  1.00 19.74 ? 291  HIS A CD2 1 
ATOM   2302 C CE1 . HIS A 1 292 ? 29.544  20.906  -4.988  1.00 21.43 ? 291  HIS A CE1 1 
ATOM   2303 N NE2 . HIS A 1 292 ? 30.228  20.278  -5.925  1.00 22.93 ? 291  HIS A NE2 1 
ATOM   2304 N N   . PHE A 1 293 ? 24.324  17.683  -7.860  1.00 18.46 ? 292  PHE A N   1 
ATOM   2305 C CA  . PHE A 1 293 ? 23.261  16.716  -8.191  1.00 18.63 ? 292  PHE A CA  1 
ATOM   2306 C C   . PHE A 1 293 ? 23.447  16.094  -9.598  1.00 18.38 ? 292  PHE A C   1 
ATOM   2307 O O   . PHE A 1 293 ? 23.303  14.891  -9.770  1.00 17.52 ? 292  PHE A O   1 
ATOM   2308 C CB  . PHE A 1 293 ? 21.880  17.355  -8.032  1.00 18.24 ? 292  PHE A CB  1 
ATOM   2309 C CG  . PHE A 1 293 ? 20.743  16.379  -8.192  1.00 18.52 ? 292  PHE A CG  1 
ATOM   2310 C CD1 . PHE A 1 293 ? 20.481  15.426  -7.212  1.00 18.60 ? 292  PHE A CD1 1 
ATOM   2311 C CD2 . PHE A 1 293 ? 19.944  16.416  -9.331  1.00 18.99 ? 292  PHE A CD2 1 
ATOM   2312 C CE1 . PHE A 1 293 ? 19.425  14.507  -7.364  1.00 18.96 ? 292  PHE A CE1 1 
ATOM   2313 C CE2 . PHE A 1 293 ? 18.897  15.516  -9.494  1.00 19.05 ? 292  PHE A CE2 1 
ATOM   2314 C CZ  . PHE A 1 293 ? 18.640  14.557  -8.506  1.00 18.14 ? 292  PHE A CZ  1 
ATOM   2315 N N   . GLU A 1 294 ? 23.795  16.906  -10.591 1.00 18.84 ? 293  GLU A N   1 
ATOM   2316 C CA  . GLU A 1 294 ? 24.134  16.385  -11.921 1.00 20.47 ? 293  GLU A CA  1 
ATOM   2317 C C   . GLU A 1 294 ? 25.323  15.426  -11.899 1.00 19.84 ? 293  GLU A C   1 
ATOM   2318 O O   . GLU A 1 294 ? 25.325  14.430  -12.617 1.00 20.64 ? 293  GLU A O   1 
ATOM   2319 C CB  . GLU A 1 294 ? 24.429  17.521  -12.883 1.00 21.12 ? 293  GLU A CB  1 
ATOM   2320 C CG  . GLU A 1 294 ? 23.202  18.053  -13.573 1.00 25.28 ? 293  GLU A CG  1 
ATOM   2321 C CD  . GLU A 1 294 ? 23.550  19.001  -14.707 1.00 28.58 ? 293  GLU A CD  1 
ATOM   2322 O OE1 . GLU A 1 294 ? 24.610  19.662  -14.642 1.00 31.06 ? 293  GLU A OE1 1 
ATOM   2323 O OE2 . GLU A 1 294 ? 22.755  19.082  -15.656 1.00 30.11 ? 293  GLU A OE2 1 
ATOM   2324 N N   . GLN A 1 295 ? 26.332  15.722  -11.077 1.00 19.45 ? 294  GLN A N   1 
ATOM   2325 C CA  . GLN A 1 295 ? 27.491  14.821  -10.957 1.00 18.65 ? 294  GLN A CA  1 
ATOM   2326 C C   . GLN A 1 295 ? 27.078  13.501  -10.310 1.00 17.95 ? 294  GLN A C   1 
ATOM   2327 O O   . GLN A 1 295 ? 27.521  12.449  -10.733 1.00 16.55 ? 294  GLN A O   1 
ATOM   2328 C CB  . GLN A 1 295 ? 28.632  15.460  -10.171 1.00 18.54 ? 294  GLN A CB  1 
ATOM   2329 C CG  . GLN A 1 295 ? 29.244  16.670  -10.843 1.00 20.52 ? 294  GLN A CG  1 
ATOM   2330 C CD  . GLN A 1 295 ? 29.904  17.630  -9.843  1.00 22.71 ? 294  GLN A CD  1 
ATOM   2331 O OE1 . GLN A 1 295 ? 30.297  17.229  -8.731  1.00 22.71 ? 294  GLN A OE1 1 
ATOM   2332 N NE2 . GLN A 1 295 ? 30.021  18.909  -10.239 1.00 23.24 ? 294  GLN A NE2 1 
ATOM   2333 N N   . LEU A 1 296 ? 26.210  13.561  -9.302  1.00 16.87 ? 295  LEU A N   1 
ATOM   2334 C CA  . LEU A 1 296 ? 25.626  12.332  -8.745  1.00 17.01 ? 295  LEU A CA  1 
ATOM   2335 C C   . LEU A 1 296 ? 24.922  11.467  -9.816  1.00 17.44 ? 295  LEU A C   1 
ATOM   2336 O O   . LEU A 1 296 ? 25.203  10.267  -9.930  1.00 16.60 ? 295  LEU A O   1 
ATOM   2337 C CB  . LEU A 1 296 ? 24.675  12.665  -7.583  1.00 17.19 ? 295  LEU A CB  1 
ATOM   2338 C CG  . LEU A 1 296 ? 23.930  11.529  -6.879  1.00 17.42 ? 295  LEU A CG  1 
ATOM   2339 C CD1 . LEU A 1 296 ? 24.748  10.892  -5.759  1.00 19.53 ? 295  LEU A CD1 1 
ATOM   2340 C CD2 . LEU A 1 296 ? 22.635  12.095  -6.315  1.00 18.67 ? 295  LEU A CD2 1 
ATOM   2341 N N   . LEU A 1 297 ? 24.025  12.079  -10.587 1.00 17.82 ? 296  LEU A N   1 
ATOM   2342 C CA  . LEU A 1 297 ? 23.377  11.434  -11.744 1.00 18.92 ? 296  LEU A CA  1 
ATOM   2343 C C   . LEU A 1 297 ? 24.382  10.848  -12.734 1.00 18.79 ? 296  LEU A C   1 
ATOM   2344 O O   . LEU A 1 297 ? 24.225  9.715   -13.215 1.00 18.94 ? 296  LEU A O   1 
ATOM   2345 C CB  . LEU A 1 297 ? 22.475  12.433  -12.495 1.00 19.36 ? 296  LEU A CB  1 
ATOM   2346 C CG  . LEU A 1 297 ? 21.266  13.005  -11.752 1.00 21.51 ? 296  LEU A CG  1 
ATOM   2347 C CD1 . LEU A 1 297 ? 20.525  13.997  -12.635 1.00 24.00 ? 296  LEU A CD1 1 
ATOM   2348 C CD2 . LEU A 1 297 ? 20.358  11.889  -11.319 1.00 22.86 ? 296  LEU A CD2 1 
ATOM   2349 N N   . SER A 1 298 ? 25.427  11.621  -13.023 1.00 17.96 ? 297  SER A N   1 
ATOM   2350 C CA  . SER A 1 298 ? 26.459  11.200  -13.963 1.00 17.83 ? 297  SER A CA  1 
ATOM   2351 C C   . SER A 1 298 ? 27.221  9.963   -13.495 1.00 17.72 ? 297  SER A C   1 
ATOM   2352 O O   . SER A 1 298 ? 27.562  9.101   -14.312 1.00 18.75 ? 297  SER A O   1 
ATOM   2353 C CB  . SER A 1 298 ? 27.447  12.335  -14.221 1.00 17.54 ? 297  SER A CB  1 
ATOM   2354 O OG  A SER A 1 298 ? 26.822  13.351  -14.981 0.55 16.52 ? 297  SER A OG  1 
ATOM   2355 O OG  B SER A 1 298 ? 28.376  11.952  -15.217 0.45 17.17 ? 297  SER A OG  1 
ATOM   2356 N N   . GLY A 1 299 ? 27.496  9.879   -12.185 1.00 17.64 ? 298  GLY A N   1 
ATOM   2357 C CA  . GLY A 1 299 ? 28.201  8.731   -11.637 1.00 16.70 ? 298  GLY A CA  1 
ATOM   2358 C C   . GLY A 1 299 ? 27.352  7.482   -11.767 1.00 17.37 ? 298  GLY A C   1 
ATOM   2359 O O   . GLY A 1 299 ? 27.848  6.414   -12.121 1.00 17.37 ? 298  GLY A O   1 
ATOM   2360 N N   . ALA A 1 300 ? 26.059  7.630   -11.508 1.00 17.39 ? 299  ALA A N   1 
ATOM   2361 C CA  . ALA A 1 300 ? 25.130  6.508   -11.677 1.00 17.84 ? 299  ALA A CA  1 
ATOM   2362 C C   . ALA A 1 300 ? 25.106  6.076   -13.148 1.00 17.71 ? 299  ALA A C   1 
ATOM   2363 O O   . ALA A 1 300 ? 25.178  4.889   -13.448 1.00 18.07 ? 299  ALA A O   1 
ATOM   2364 C CB  . ALA A 1 300 ? 23.737  6.889   -11.205 1.00 17.71 ? 299  ALA A CB  1 
ATOM   2365 N N   . HIS A 1 301 ? 25.028  7.044   -14.049 1.00 17.79 ? 300  HIS A N   1 
ATOM   2366 C CA  . HIS A 1 301 ? 25.090  6.770   -15.484 1.00 18.55 ? 300  HIS A CA  1 
ATOM   2367 C C   . HIS A 1 301 ? 26.336  5.984   -15.898 1.00 17.92 ? 300  HIS A C   1 
ATOM   2368 O O   . HIS A 1 301 ? 26.240  5.063   -16.716 1.00 18.57 ? 300  HIS A O   1 
ATOM   2369 C CB  . HIS A 1 301 ? 24.968  8.062   -16.308 1.00 18.14 ? 300  HIS A CB  1 
ATOM   2370 C CG  . HIS A 1 301 ? 24.878  7.827   -17.785 1.00 20.82 ? 300  HIS A CG  1 
ATOM   2371 N ND1 . HIS A 1 301 ? 23.816  7.176   -18.376 1.00 22.39 ? 300  HIS A ND1 1 
ATOM   2372 C CD2 . HIS A 1 301 ? 25.720  8.168   -18.790 1.00 22.49 ? 300  HIS A CD2 1 
ATOM   2373 C CE1 . HIS A 1 301 ? 24.014  7.116   -19.683 1.00 23.16 ? 300  HIS A CE1 1 
ATOM   2374 N NE2 . HIS A 1 301 ? 25.160  7.712   -19.959 1.00 23.32 ? 300  HIS A NE2 1 
ATOM   2375 N N   . TRP A 1 302 ? 27.494  6.337   -15.337 1.00 17.90 ? 301  TRP A N   1 
ATOM   2376 C CA  . TRP A 1 302 ? 28.722  5.613   -15.621 1.00 17.78 ? 301  TRP A CA  1 
ATOM   2377 C C   . TRP A 1 302 ? 28.552  4.149   -15.217 1.00 18.15 ? 301  TRP A C   1 
ATOM   2378 O O   . TRP A 1 302 ? 28.846  3.248   -16.000 1.00 18.32 ? 301  TRP A O   1 
ATOM   2379 C CB  . TRP A 1 302 ? 29.935  6.234   -14.908 1.00 18.12 ? 301  TRP A CB  1 
ATOM   2380 C CG  . TRP A 1 302 ? 31.213  5.607   -15.346 1.00 17.93 ? 301  TRP A CG  1 
ATOM   2381 C CD1 . TRP A 1 302 ? 32.078  6.082   -16.297 1.00 18.85 ? 301  TRP A CD1 1 
ATOM   2382 C CD2 . TRP A 1 302 ? 31.762  4.369   -14.887 1.00 17.74 ? 301  TRP A CD2 1 
ATOM   2383 N NE1 . TRP A 1 302 ? 33.131  5.212   -16.455 1.00 17.17 ? 301  TRP A NE1 1 
ATOM   2384 C CE2 . TRP A 1 302 ? 32.956  4.142   -15.616 1.00 16.38 ? 301  TRP A CE2 1 
ATOM   2385 C CE3 . TRP A 1 302 ? 31.349  3.399   -13.950 1.00 15.97 ? 301  TRP A CE3 1 
ATOM   2386 C CZ2 . TRP A 1 302 ? 33.755  3.009   -15.418 1.00 17.63 ? 301  TRP A CZ2 1 
ATOM   2387 C CZ3 . TRP A 1 302 ? 32.133  2.275   -13.762 1.00 18.17 ? 301  TRP A CZ3 1 
ATOM   2388 C CH2 . TRP A 1 302 ? 33.331  2.084   -14.492 1.00 16.43 ? 301  TRP A CH2 1 
ATOM   2389 N N   . MET A 1 303 ? 28.073  3.922   -13.992 1.00 18.16 ? 302  MET A N   1 
ATOM   2390 C CA  . MET A 1 303 ? 27.832  2.562   -13.518 1.00 18.41 ? 302  MET A CA  1 
ATOM   2391 C C   . MET A 1 303 ? 26.748  1.826   -14.334 1.00 18.23 ? 302  MET A C   1 
ATOM   2392 O O   . MET A 1 303 ? 26.860  0.611   -14.524 1.00 18.30 ? 302  MET A O   1 
ATOM   2393 C CB  . MET A 1 303 ? 27.509  2.554   -12.014 1.00 18.24 ? 302  MET A CB  1 
ATOM   2394 C CG  . MET A 1 303 ? 27.397  1.147   -11.420 1.00 19.51 ? 302  MET A CG  1 
ATOM   2395 S SD  . MET A 1 303 ? 28.923  0.178   -11.544 1.00 19.58 ? 302  MET A SD  1 
ATOM   2396 C CE  . MET A 1 303 ? 30.054  1.118   -10.472 1.00 19.31 ? 302  MET A CE  1 
ATOM   2397 N N   . ASP A 1 304 ? 25.711  2.549   -14.779 1.00 18.28 ? 303  ASP A N   1 
ATOM   2398 C CA  . ASP A 1 304 ? 24.689  1.992   -15.670 1.00 19.16 ? 303  ASP A CA  1 
ATOM   2399 C C   . ASP A 1 304 ? 25.346  1.446   -16.943 1.00 19.35 ? 303  ASP A C   1 
ATOM   2400 O O   . ASP A 1 304 ? 25.072  0.326   -17.374 1.00 19.24 ? 303  ASP A O   1 
ATOM   2401 C CB  . ASP A 1 304 ? 23.657  3.052   -16.067 1.00 18.98 ? 303  ASP A CB  1 
ATOM   2402 C CG  . ASP A 1 304 ? 22.748  3.473   -14.912 1.00 17.12 ? 303  ASP A CG  1 
ATOM   2403 O OD1 . ASP A 1 304 ? 22.726  2.805   -13.858 1.00 18.76 ? 303  ASP A OD1 1 
ATOM   2404 O OD2 . ASP A 1 304 ? 22.024  4.477   -14.974 1.00 19.72 ? 303  ASP A OD2 1 
ATOM   2405 N N   . GLN A 1 305 ? 26.242  2.239   -17.517 1.00 19.96 ? 304  GLN A N   1 
ATOM   2406 C CA  . GLN A 1 305 ? 26.926  1.850   -18.748 1.00 20.72 ? 304  GLN A CA  1 
ATOM   2407 C C   . GLN A 1 305 ? 27.886  0.681   -18.507 1.00 20.20 ? 304  GLN A C   1 
ATOM   2408 O O   . GLN A 1 305 ? 27.991  -0.225  -19.344 1.00 20.30 ? 304  GLN A O   1 
ATOM   2409 C CB  . GLN A 1 305 ? 27.635  3.066   -19.362 1.00 21.12 ? 304  GLN A CB  1 
ATOM   2410 C CG  . GLN A 1 305 ? 26.649  4.127   -19.916 1.00 24.39 ? 304  GLN A CG  1 
ATOM   2411 C CD  . GLN A 1 305 ? 25.868  3.635   -21.145 1.00 29.09 ? 304  GLN A CD  1 
ATOM   2412 O OE1 . GLN A 1 305 ? 24.628  3.641   -21.161 1.00 31.70 ? 304  GLN A OE1 1 
ATOM   2413 N NE2 . GLN A 1 305 ? 26.595  3.212   -22.170 1.00 29.66 ? 304  GLN A NE2 1 
ATOM   2414 N N   . HIS A 1 306 ? 28.545  0.677   -17.343 1.00 19.65 ? 305  HIS A N   1 
ATOM   2415 C CA  . HIS A 1 306 ? 29.411  -0.434  -16.952 1.00 19.52 ? 305  HIS A CA  1 
ATOM   2416 C C   . HIS A 1 306 ? 28.609  -1.725  -16.890 1.00 19.19 ? 305  HIS A C   1 
ATOM   2417 O O   . HIS A 1 306 ? 29.059  -2.781  -17.357 1.00 18.47 ? 305  HIS A O   1 
ATOM   2418 C CB  . HIS A 1 306 ? 30.065  -0.172  -15.593 1.00 19.83 ? 305  HIS A CB  1 
ATOM   2419 C CG  . HIS A 1 306 ? 30.776  -1.367  -15.036 1.00 19.48 ? 305  HIS A CG  1 
ATOM   2420 N ND1 . HIS A 1 306 ? 32.038  -1.739  -15.441 1.00 18.69 ? 305  HIS A ND1 1 
ATOM   2421 C CD2 . HIS A 1 306 ? 30.377  -2.302  -14.141 1.00 18.47 ? 305  HIS A CD2 1 
ATOM   2422 C CE1 . HIS A 1 306 ? 32.393  -2.842  -14.806 1.00 19.11 ? 305  HIS A CE1 1 
ATOM   2423 N NE2 . HIS A 1 306 ? 31.401  -3.203  -14.014 1.00 18.70 ? 305  HIS A NE2 1 
ATOM   2424 N N   . PHE A 1 307 ? 27.418  -1.637  -16.315 1.00 18.37 ? 306  PHE A N   1 
ATOM   2425 C CA  . PHE A 1 307 ? 26.587  -2.816  -16.115 1.00 19.16 ? 306  PHE A CA  1 
ATOM   2426 C C   . PHE A 1 307 ? 26.034  -3.313  -17.449 1.00 19.70 ? 306  PHE A C   1 
ATOM   2427 O O   . PHE A 1 307 ? 26.015  -4.525  -17.719 1.00 20.55 ? 306  PHE A O   1 
ATOM   2428 C CB  . PHE A 1 307 ? 25.487  -2.486  -15.103 1.00 18.49 ? 306  PHE A CB  1 
ATOM   2429 C CG  . PHE A 1 307 ? 24.442  -3.550  -14.954 1.00 18.19 ? 306  PHE A CG  1 
ATOM   2430 C CD1 . PHE A 1 307 ? 24.793  -4.870  -14.693 1.00 18.43 ? 306  PHE A CD1 1 
ATOM   2431 C CD2 . PHE A 1 307 ? 23.096  -3.216  -15.028 1.00 17.85 ? 306  PHE A CD2 1 
ATOM   2432 C CE1 . PHE A 1 307 ? 23.809  -5.862  -14.545 1.00 19.47 ? 306  PHE A CE1 1 
ATOM   2433 C CE2 . PHE A 1 307 ? 22.114  -4.192  -14.870 1.00 16.40 ? 306  PHE A CE2 1 
ATOM   2434 C CZ  . PHE A 1 307 ? 22.469  -5.509  -14.625 1.00 19.27 ? 306  PHE A CZ  1 
ATOM   2435 N N   . LEU A 1 308 ? 25.619  -2.371  -18.285 1.00 20.61 ? 307  LEU A N   1 
ATOM   2436 C CA  . LEU A 1 308 ? 25.068  -2.674  -19.594 1.00 21.53 ? 307  LEU A CA  1 
ATOM   2437 C C   . LEU A 1 308 ? 26.087  -3.295  -20.551 1.00 22.41 ? 307  LEU A C   1 
ATOM   2438 O O   . LEU A 1 308 ? 25.743  -4.218  -21.287 1.00 22.34 ? 307  LEU A O   1 
ATOM   2439 C CB  . LEU A 1 308 ? 24.453  -1.421  -20.209 1.00 21.82 ? 307  LEU A CB  1 
ATOM   2440 C CG  . LEU A 1 308 ? 23.657  -1.497  -21.515 1.00 23.00 ? 307  LEU A CG  1 
ATOM   2441 C CD1 . LEU A 1 308 ? 22.448  -2.433  -21.399 1.00 23.19 ? 307  LEU A CD1 1 
ATOM   2442 C CD2 . LEU A 1 308 ? 23.233  -0.096  -21.894 1.00 24.16 ? 307  LEU A CD2 1 
ATOM   2443 N N   . LYS A 1 309 ? 27.335  -2.822  -20.512 1.00 23.01 ? 308  LYS A N   1 
ATOM   2444 C CA  . LYS A 1 309 ? 28.295  -3.101  -21.594 1.00 23.90 ? 308  LYS A CA  1 
ATOM   2445 C C   . LYS A 1 309 ? 29.430  -4.085  -21.295 1.00 24.00 ? 308  LYS A C   1 
ATOM   2446 O O   . LYS A 1 309 ? 30.173  -4.477  -22.224 1.00 25.25 ? 308  LYS A O   1 
ATOM   2447 C CB  . LYS A 1 309 ? 28.873  -1.793  -22.150 1.00 23.94 ? 308  LYS A CB  1 
ATOM   2448 C CG  . LYS A 1 309 ? 27.833  -0.755  -22.541 1.00 26.64 ? 308  LYS A CG  1 
ATOM   2449 C CD  . LYS A 1 309 ? 26.985  -1.217  -23.723 1.00 30.07 ? 308  LYS A CD  1 
ATOM   2450 C CE  . LYS A 1 309 ? 26.157  -0.079  -24.320 1.00 33.01 ? 308  LYS A CE  1 
ATOM   2451 N NZ  . LYS A 1 309 ? 26.984  1.115   -24.689 1.00 35.08 ? 308  LYS A NZ  1 
ATOM   2452 N N   . THR A 1 310 ? 29.566  -4.482  -20.031 1.00 23.64 ? 309  THR A N   1 
ATOM   2453 C CA  . THR A 1 310 ? 30.660  -5.344  -19.579 1.00 23.49 ? 309  THR A CA  1 
ATOM   2454 C C   . THR A 1 310 ? 30.260  -6.822  -19.524 1.00 23.38 ? 309  THR A C   1 
ATOM   2455 O O   . THR A 1 310 ? 29.193  -7.156  -18.994 1.00 23.53 ? 309  THR A O   1 
ATOM   2456 C CB  . THR A 1 310 ? 31.144  -4.883  -18.177 1.00 23.87 ? 309  THR A CB  1 
ATOM   2457 O OG1 . THR A 1 310 ? 31.475  -3.489  -18.234 1.00 24.20 ? 309  THR A OG1 1 
ATOM   2458 C CG2 . THR A 1 310 ? 32.451  -5.536  -17.804 1.00 24.62 ? 309  THR A CG2 1 
ATOM   2459 N N   . PRO A 1 311 ? 31.117  -7.704  -20.051 1.00 23.44 ? 310  PRO A N   1 
ATOM   2460 C CA  . PRO A 1 311 ? 30.906  -9.154  -19.937 1.00 23.22 ? 310  PRO A CA  1 
ATOM   2461 C C   . PRO A 1 311 ? 30.720  -9.554  -18.485 1.00 23.52 ? 310  PRO A C   1 
ATOM   2462 O O   . PRO A 1 311 ? 31.399  -9.008  -17.605 1.00 22.44 ? 310  PRO A O   1 
ATOM   2463 C CB  . PRO A 1 311 ? 32.236  -9.743  -20.421 1.00 23.62 ? 310  PRO A CB  1 
ATOM   2464 C CG  . PRO A 1 311 ? 32.809  -8.744  -21.287 1.00 23.85 ? 310  PRO A CG  1 
ATOM   2465 C CD  . PRO A 1 311 ? 32.353  -7.391  -20.793 1.00 22.84 ? 310  PRO A CD  1 
ATOM   2466 N N   . LEU A 1 312 ? 29.842  -10.525 -18.255 1.00 23.99 ? 311  LEU A N   1 
ATOM   2467 C CA  . LEU A 1 312 ? 29.457  -10.936 -16.906 1.00 24.60 ? 311  LEU A CA  1 
ATOM   2468 C C   . LEU A 1 312 ? 30.625  -11.189 -15.941 1.00 24.89 ? 311  LEU A C   1 
ATOM   2469 O O   . LEU A 1 312 ? 30.583  -10.741 -14.806 1.00 23.64 ? 311  LEU A O   1 
ATOM   2470 C CB  . LEU A 1 312 ? 28.536  -12.163 -16.977 1.00 25.01 ? 311  LEU A CB  1 
ATOM   2471 C CG  . LEU A 1 312 ? 27.217  -12.013 -17.745 1.00 25.59 ? 311  LEU A CG  1 
ATOM   2472 C CD1 . LEU A 1 312 ? 26.552  -13.352 -17.834 1.00 28.66 ? 311  LEU A CD1 1 
ATOM   2473 C CD2 . LEU A 1 312 ? 26.281  -11.006 -17.078 1.00 26.23 ? 311  LEU A CD2 1 
ATOM   2474 N N   . GLU A 1 313 ? 31.674  -11.888 -16.386 1.00 25.43 ? 312  GLU A N   1 
ATOM   2475 C CA  . GLU A 1 313 ? 32.760  -12.273 -15.473 1.00 26.10 ? 312  GLU A CA  1 
ATOM   2476 C C   . GLU A 1 313 ? 33.660  -11.117 -15.038 1.00 25.51 ? 312  GLU A C   1 
ATOM   2477 O O   . GLU A 1 313 ? 34.495  -11.304 -14.158 1.00 26.24 ? 312  GLU A O   1 
ATOM   2478 C CB  . GLU A 1 313 ? 33.632  -13.425 -16.004 1.00 26.79 ? 312  GLU A CB  1 
ATOM   2479 C CG  . GLU A 1 313 ? 33.200  -14.097 -17.290 1.00 29.96 ? 312  GLU A CG  1 
ATOM   2480 C CD  . GLU A 1 313 ? 33.255  -13.178 -18.487 1.00 31.36 ? 312  GLU A CD  1 
ATOM   2481 O OE1 . GLU A 1 313 ? 34.339  -12.630 -18.805 1.00 34.71 ? 312  GLU A OE1 1 
ATOM   2482 O OE2 . GLU A 1 313 ? 32.197  -13.007 -19.096 1.00 31.00 ? 312  GLU A OE2 1 
ATOM   2483 N N   . LYS A 1 314 ? 33.473  -9.936  -15.635 1.00 25.11 ? 313  LYS A N   1 
ATOM   2484 C CA  . LYS A 1 314 ? 34.207  -8.722  -15.235 1.00 24.30 ? 313  LYS A CA  1 
ATOM   2485 C C   . LYS A 1 314 ? 33.287  -7.555  -14.885 1.00 23.25 ? 313  LYS A C   1 
ATOM   2486 O O   . LYS A 1 314 ? 33.729  -6.404  -14.835 1.00 23.07 ? 313  LYS A O   1 
ATOM   2487 C CB  . LYS A 1 314 ? 35.151  -8.278  -16.343 1.00 24.94 ? 313  LYS A CB  1 
ATOM   2488 C CG  . LYS A 1 314 ? 36.453  -9.050  -16.351 1.00 27.38 ? 313  LYS A CG  1 
ATOM   2489 C CD  . LYS A 1 314 ? 37.281  -8.727  -17.576 1.00 31.54 ? 313  LYS A CD  1 
ATOM   2490 C CE  . LYS A 1 314 ? 38.701  -9.273  -17.426 1.00 33.55 ? 313  LYS A CE  1 
ATOM   2491 N NZ  . LYS A 1 314 ? 38.738  -10.580 -16.709 1.00 34.80 ? 313  LYS A NZ  1 
ATOM   2492 N N   . ASN A 1 315 ? 32.014  -7.868  -14.647 1.00 22.52 ? 314  ASN A N   1 
ATOM   2493 C CA  . ASN A 1 315 ? 30.948  -6.888  -14.436 1.00 20.82 ? 314  ASN A CA  1 
ATOM   2494 C C   . ASN A 1 315 ? 30.699  -6.712  -12.927 1.00 20.46 ? 314  ASN A C   1 
ATOM   2495 O O   . ASN A 1 315 ? 30.238  -7.636  -12.275 1.00 20.02 ? 314  ASN A O   1 
ATOM   2496 C CB  . ASN A 1 315 ? 29.688  -7.425  -15.119 1.00 20.89 ? 314  ASN A CB  1 
ATOM   2497 C CG  . ASN A 1 315 ? 28.594  -6.382  -15.294 1.00 21.12 ? 314  ASN A CG  1 
ATOM   2498 O OD1 . ASN A 1 315 ? 28.156  -5.740  -14.335 1.00 19.82 ? 314  ASN A OD1 1 
ATOM   2499 N ND2 . ASN A 1 315 ? 28.096  -6.255  -16.526 1.00 20.56 ? 314  ASN A ND2 1 
ATOM   2500 N N   . ALA A 1 316 ? 31.001  -5.530  -12.381 1.00 18.93 ? 315  ALA A N   1 
ATOM   2501 C CA  . ALA A 1 316 ? 30.980  -5.350  -10.924 1.00 19.03 ? 315  ALA A CA  1 
ATOM   2502 C C   . ALA A 1 316 ? 29.666  -5.735  -10.222 1.00 19.11 ? 315  ALA A C   1 
ATOM   2503 O O   . ALA A 1 316 ? 29.694  -6.581  -9.325  1.00 19.40 ? 315  ALA A O   1 
ATOM   2504 C CB  . ALA A 1 316 ? 31.406  -3.916  -10.549 1.00 18.77 ? 315  ALA A CB  1 
ATOM   2505 N N   . PRO A 1 317 ? 28.528  -5.133  -10.581 1.00 19.84 ? 316  PRO A N   1 
ATOM   2506 C CA  . PRO A 1 317 ? 27.267  -5.516  -9.916  1.00 19.54 ? 316  PRO A CA  1 
ATOM   2507 C C   . PRO A 1 317 ? 26.901  -6.984  -10.128 1.00 19.18 ? 316  PRO A C   1 
ATOM   2508 O O   . PRO A 1 317 ? 26.345  -7.596  -9.223  1.00 18.65 ? 316  PRO A O   1 
ATOM   2509 C CB  . PRO A 1 317 ? 26.210  -4.579  -10.523 1.00 19.93 ? 316  PRO A CB  1 
ATOM   2510 C CG  . PRO A 1 317 ? 26.860  -3.932  -11.739 1.00 19.80 ? 316  PRO A CG  1 
ATOM   2511 C CD  . PRO A 1 317 ? 28.339  -4.050  -11.561 1.00 19.54 ? 316  PRO A CD  1 
ATOM   2512 N N   . VAL A 1 318 ? 27.256  -7.551  -11.277 1.00 18.85 ? 317  VAL A N   1 
ATOM   2513 C CA  . VAL A 1 318 ? 26.997  -8.974  -11.519 1.00 19.48 ? 317  VAL A CA  1 
ATOM   2514 C C   . VAL A 1 318 ? 27.770  -9.838  -10.519 1.00 19.05 ? 317  VAL A C   1 
ATOM   2515 O O   . VAL A 1 318 ? 27.191  -10.723 -9.894  1.00 18.98 ? 317  VAL A O   1 
ATOM   2516 C CB  . VAL A 1 318 ? 27.302  -9.388  -12.989 1.00 19.41 ? 317  VAL A CB  1 
ATOM   2517 C CG1 . VAL A 1 318 ? 27.244  -10.920 -13.160 1.00 21.16 ? 317  VAL A CG1 1 
ATOM   2518 C CG2 . VAL A 1 318 ? 26.321  -8.715  -13.942 1.00 19.05 ? 317  VAL A CG2 1 
ATOM   2519 N N   . LEU A 1 319 ? 29.072  -9.581  -10.369 1.00 18.60 ? 318  LEU A N   1 
ATOM   2520 C CA  . LEU A 1 319 ? 29.913  -10.390 -9.496  1.00 18.42 ? 318  LEU A CA  1 
ATOM   2521 C C   . LEU A 1 319 ? 29.451  -10.270 -8.035  1.00 17.94 ? 318  LEU A C   1 
ATOM   2522 O O   . LEU A 1 319 ? 29.434  -11.248 -7.296  1.00 17.53 ? 318  LEU A O   1 
ATOM   2523 C CB  . LEU A 1 319 ? 31.385  -9.993  -9.637  1.00 19.01 ? 318  LEU A CB  1 
ATOM   2524 C CG  . LEU A 1 319 ? 32.060  -10.372 -10.962 1.00 19.84 ? 318  LEU A CG  1 
ATOM   2525 C CD1 . LEU A 1 319 ? 33.528  -10.062 -10.904 1.00 23.68 ? 318  LEU A CD1 1 
ATOM   2526 C CD2 . LEU A 1 319 ? 31.894  -11.859 -11.311 1.00 20.18 ? 318  LEU A CD2 1 
ATOM   2527 N N   . LEU A 1 320 ? 29.048  -9.069  -7.630  1.00 17.09 ? 319  LEU A N   1 
ATOM   2528 C CA  . LEU A 1 320 ? 28.553  -8.885  -6.266  1.00 16.50 ? 319  LEU A CA  1 
ATOM   2529 C C   . LEU A 1 320 ? 27.272  -9.684  -6.057  1.00 16.04 ? 319  LEU A C   1 
ATOM   2530 O O   . LEU A 1 320 ? 27.082  -10.302 -5.013  1.00 16.84 ? 319  LEU A O   1 
ATOM   2531 C CB  . LEU A 1 320 ? 28.279  -7.410  -5.981  1.00 16.38 ? 319  LEU A CB  1 
ATOM   2532 C CG  . LEU A 1 320 ? 29.542  -6.541  -5.831  1.00 17.08 ? 319  LEU A CG  1 
ATOM   2533 C CD1 . LEU A 1 320 ? 29.110  -5.096  -5.619  1.00 18.53 ? 319  LEU A CD1 1 
ATOM   2534 C CD2 . LEU A 1 320 ? 30.470  -7.009  -4.733  1.00 18.02 ? 319  LEU A CD2 1 
ATOM   2535 N N   . ALA A 1 321 ? 26.411  -9.657  -7.069  1.00 15.98 ? 320  ALA A N   1 
ATOM   2536 C CA  . ALA A 1 321 ? 25.142  -10.364 -7.009  1.00 15.62 ? 320  ALA A CA  1 
ATOM   2537 C C   . ALA A 1 321 ? 25.408  -11.853 -6.888  1.00 16.22 ? 320  ALA A C   1 
ATOM   2538 O O   . ALA A 1 321 ? 24.798  -12.526 -6.069  1.00 16.37 ? 320  ALA A O   1 
ATOM   2539 C CB  . ALA A 1 321 ? 24.336  -10.074 -8.258  1.00 14.95 ? 320  ALA A CB  1 
ATOM   2540 N N   . LEU A 1 322 ? 26.313  -12.367 -7.721  1.00 17.16 ? 321  LEU A N   1 
ATOM   2541 C CA  . LEU A 1 322 ? 26.637  -13.813 -7.707  1.00 17.91 ? 321  LEU A CA  1 
ATOM   2542 C C   . LEU A 1 322 ? 27.217  -14.289 -6.385  1.00 18.02 ? 321  LEU A C   1 
ATOM   2543 O O   . LEU A 1 322 ? 26.843  -15.366 -5.892  1.00 18.77 ? 321  LEU A O   1 
ATOM   2544 C CB  . LEU A 1 322 ? 27.562  -14.179 -8.881  1.00 18.05 ? 321  LEU A CB  1 
ATOM   2545 C CG  . LEU A 1 322 ? 26.930  -13.998 -10.265 1.00 19.66 ? 321  LEU A CG  1 
ATOM   2546 C CD1 . LEU A 1 322 ? 27.985  -14.070 -11.351 1.00 20.48 ? 321  LEU A CD1 1 
ATOM   2547 C CD2 . LEU A 1 322 ? 25.851  -15.070 -10.487 1.00 20.94 ? 321  LEU A CD2 1 
ATOM   2548 N N   . LEU A 1 323 ? 28.162  -13.523 -5.824  1.00 17.93 ? 322  LEU A N   1 
ATOM   2549 C CA  . LEU A 1 323 ? 28.721  -13.851 -4.517  1.00 17.49 ? 322  LEU A CA  1 
ATOM   2550 C C   . LEU A 1 323 ? 27.608  -13.948 -3.481  1.00 17.66 ? 322  LEU A C   1 
ATOM   2551 O O   . LEU A 1 323 ? 27.615  -14.825 -2.637  1.00 16.78 ? 322  LEU A O   1 
ATOM   2552 C CB  . LEU A 1 323 ? 29.779  -12.818 -4.088  1.00 17.04 ? 322  LEU A CB  1 
ATOM   2553 C CG  . LEU A 1 323 ? 31.050  -12.839 -4.956  1.00 16.13 ? 322  LEU A CG  1 
ATOM   2554 C CD1 . LEU A 1 323 ? 31.844  -11.564 -4.796  1.00 17.63 ? 322  LEU A CD1 1 
ATOM   2555 C CD2 . LEU A 1 323 ? 31.910  -14.060 -4.610  1.00 18.46 ? 322  LEU A CD2 1 
ATOM   2556 N N   . GLY A 1 324 ? 26.656  -13.019 -3.562  1.00 18.22 ? 323  GLY A N   1 
ATOM   2557 C CA  . GLY A 1 324 ? 25.495  -13.039 -2.683  1.00 18.21 ? 323  GLY A CA  1 
ATOM   2558 C C   . GLY A 1 324 ? 24.692  -14.324 -2.854  1.00 18.50 ? 323  GLY A C   1 
ATOM   2559 O O   . GLY A 1 324 ? 24.304  -14.943 -1.864  1.00 18.91 ? 323  GLY A O   1 
ATOM   2560 N N   . ILE A 1 325 ? 24.407  -14.699 -4.099  1.00 18.58 ? 324  ILE A N   1 
ATOM   2561 C CA  . ILE A 1 325 ? 23.677  -15.951 -4.394  1.00 19.62 ? 324  ILE A CA  1 
ATOM   2562 C C   . ILE A 1 325 ? 24.399  -17.140 -3.754  1.00 19.52 ? 324  ILE A C   1 
ATOM   2563 O O   . ILE A 1 325 ? 23.782  -17.981 -3.106  1.00 19.67 ? 324  ILE A O   1 
ATOM   2564 C CB  . ILE A 1 325 ? 23.528  -16.167 -5.944  1.00 19.79 ? 324  ILE A CB  1 
ATOM   2565 C CG1 . ILE A 1 325 ? 22.707  -15.047 -6.602  1.00 21.45 ? 324  ILE A CG1 1 
ATOM   2566 C CG2 . ILE A 1 325 ? 22.897  -17.560 -6.272  1.00 20.34 ? 324  ILE A CG2 1 
ATOM   2567 C CD1 . ILE A 1 325 ? 21.278  -14.947 -6.110  1.00 22.72 ? 324  ILE A CD1 1 
ATOM   2568 N N   . TRP A 1 326 ? 25.720  -17.185 -3.931  1.00 19.38 ? 325  TRP A N   1 
ATOM   2569 C CA  . TRP A 1 326 ? 26.568  -18.228 -3.351  1.00 19.45 ? 325  TRP A CA  1 
ATOM   2570 C C   . TRP A 1 326 ? 26.343  -18.314 -1.832  1.00 19.29 ? 325  TRP A C   1 
ATOM   2571 O O   . TRP A 1 326 ? 26.112  -19.385 -1.301  1.00 19.92 ? 325  TRP A O   1 
ATOM   2572 C CB  . TRP A 1 326 ? 28.038  -17.926 -3.703  1.00 19.30 ? 325  TRP A CB  1 
ATOM   2573 C CG  . TRP A 1 326 ? 29.132  -18.851 -3.193  1.00 19.31 ? 325  TRP A CG  1 
ATOM   2574 C CD1 . TRP A 1 326 ? 30.210  -18.495 -2.415  1.00 20.27 ? 325  TRP A CD1 1 
ATOM   2575 C CD2 . TRP A 1 326 ? 29.313  -20.241 -3.492  1.00 20.30 ? 325  TRP A CD2 1 
ATOM   2576 N NE1 . TRP A 1 326 ? 31.028  -19.581 -2.196  1.00 20.66 ? 325  TRP A NE1 1 
ATOM   2577 C CE2 . TRP A 1 326 ? 30.503  -20.665 -2.844  1.00 19.73 ? 325  TRP A CE2 1 
ATOM   2578 C CE3 . TRP A 1 326 ? 28.592  -21.181 -4.244  1.00 20.52 ? 325  TRP A CE3 1 
ATOM   2579 C CZ2 . TRP A 1 326 ? 30.965  -21.978 -2.908  1.00 21.07 ? 325  TRP A CZ2 1 
ATOM   2580 C CZ3 . TRP A 1 326 ? 29.055  -22.495 -4.297  1.00 21.66 ? 325  TRP A CZ3 1 
ATOM   2581 C CH2 . TRP A 1 326 ? 30.231  -22.872 -3.641  1.00 20.41 ? 325  TRP A CH2 1 
ATOM   2582 N N   . TYR A 1 327 ? 26.360  -17.178 -1.139  1.00 18.74 ? 326  TYR A N   1 
ATOM   2583 C CA  . TYR A 1 327 ? 26.222  -17.197 0.306   1.00 18.06 ? 326  TYR A CA  1 
ATOM   2584 C C   . TYR A 1 327 ? 24.790  -17.430 0.753   1.00 18.27 ? 326  TYR A C   1 
ATOM   2585 O O   . TYR A 1 327 ? 24.579  -18.058 1.783   1.00 18.02 ? 326  TYR A O   1 
ATOM   2586 C CB  . TYR A 1 327 ? 26.792  -15.914 0.951   1.00 17.77 ? 326  TYR A CB  1 
ATOM   2587 C CG  . TYR A 1 327 ? 28.284  -15.795 0.776   1.00 16.79 ? 326  TYR A CG  1 
ATOM   2588 C CD1 . TYR A 1 327 ? 29.122  -16.847 1.123   1.00 16.49 ? 326  TYR A CD1 1 
ATOM   2589 C CD2 . TYR A 1 327 ? 28.858  -14.641 0.235   1.00 19.09 ? 326  TYR A CD2 1 
ATOM   2590 C CE1 . TYR A 1 327 ? 30.492  -16.779 0.939   1.00 16.66 ? 326  TYR A CE1 1 
ATOM   2591 C CE2 . TYR A 1 327 ? 30.234  -14.552 0.045   1.00 17.59 ? 326  TYR A CE2 1 
ATOM   2592 C CZ  . TYR A 1 327 ? 31.043  -15.620 0.411   1.00 18.68 ? 326  TYR A CZ  1 
ATOM   2593 O OH  . TYR A 1 327 ? 32.399  -15.542 0.233   1.00 17.76 ? 326  TYR A OH  1 
ATOM   2594 N N   . ILE A 1 328 ? 23.825  -16.942 -0.024  1.00 18.18 ? 327  ILE A N   1 
ATOM   2595 C CA  . ILE A 1 328 ? 22.417  -17.051 0.358   1.00 19.24 ? 327  ILE A CA  1 
ATOM   2596 C C   . ILE A 1 328 ? 21.880  -18.452 0.045   1.00 19.41 ? 327  ILE A C   1 
ATOM   2597 O O   . ILE A 1 328 ? 21.336  -19.126 0.916   1.00 20.37 ? 327  ILE A O   1 
ATOM   2598 C CB  . ILE A 1 328 ? 21.564  -15.965 -0.340  1.00 18.61 ? 327  ILE A CB  1 
ATOM   2599 C CG1 . ILE A 1 328 ? 21.877  -14.586 0.271   1.00 18.33 ? 327  ILE A CG1 1 
ATOM   2600 C CG2 . ILE A 1 328 ? 20.056  -16.273 -0.251  1.00 19.85 ? 327  ILE A CG2 1 
ATOM   2601 C CD1 . ILE A 1 328 ? 21.442  -13.410 -0.598  1.00 17.53 ? 327  ILE A CD1 1 
ATOM   2602 N N   . ASN A 1 329 ? 22.050  -18.872 -1.195  1.00 20.42 ? 328  ASN A N   1 
ATOM   2603 C CA  . ASN A 1 329 ? 21.413  -20.101 -1.663  1.00 20.71 ? 328  ASN A CA  1 
ATOM   2604 C C   . ASN A 1 329 ? 22.245  -21.369 -1.482  1.00 21.19 ? 328  ASN A C   1 
ATOM   2605 O O   . ASN A 1 329 ? 21.696  -22.474 -1.523  1.00 21.51 ? 328  ASN A O   1 
ATOM   2606 C CB  . ASN A 1 329 ? 20.995  -19.941 -3.110  1.00 21.00 ? 328  ASN A CB  1 
ATOM   2607 C CG  . ASN A 1 329 ? 19.923  -18.881 -3.282  1.00 21.06 ? 328  ASN A CG  1 
ATOM   2608 O OD1 . ASN A 1 329 ? 20.118  -17.918 -4.004  1.00 22.20 ? 328  ASN A OD1 1 
ATOM   2609 N ND2 . ASN A 1 329 ? 18.786  -19.070 -2.628  1.00 20.44 ? 328  ASN A ND2 1 
ATOM   2610 N N   . CYS A 1 330 ? 23.552  -21.220 -1.296  1.00 20.98 ? 329  CYS A N   1 
ATOM   2611 C CA  . CYS A 1 330 ? 24.410  -22.372 -1.000  1.00 21.71 ? 329  CYS A CA  1 
ATOM   2612 C C   . CYS A 1 330 ? 24.822  -22.438 0.485   1.00 21.70 ? 329  CYS A C   1 
ATOM   2613 O O   . CYS A 1 330 ? 24.627  -23.469 1.126   1.00 23.12 ? 329  CYS A O   1 
ATOM   2614 C CB  . CYS A 1 330 ? 25.605  -22.444 -1.962  1.00 20.88 ? 329  CYS A CB  1 
ATOM   2615 S SG  . CYS A 1 330 ? 25.090  -22.556 -3.693  1.00 23.75 ? 329  CYS A SG  1 
ATOM   2616 N N   . TYR A 1 331 ? 25.331  -21.343 1.054   1.00 21.53 ? 330  TYR A N   1 
ATOM   2617 C CA  . TYR A 1 331 ? 25.726  -21.326 2.474   1.00 21.75 ? 330  TYR A CA  1 
ATOM   2618 C C   . TYR A 1 331 ? 24.559  -21.075 3.447   1.00 22.12 ? 330  TYR A C   1 
ATOM   2619 O O   . TYR A 1 331 ? 24.675  -21.363 4.638   1.00 23.15 ? 330  TYR A O   1 
ATOM   2620 C CB  . TYR A 1 331 ? 26.834  -20.299 2.728   1.00 22.18 ? 330  TYR A CB  1 
ATOM   2621 C CG  . TYR A 1 331 ? 28.223  -20.779 2.356   1.00 21.82 ? 330  TYR A CG  1 
ATOM   2622 C CD1 . TYR A 1 331 ? 28.985  -21.523 3.252   1.00 20.90 ? 330  TYR A CD1 1 
ATOM   2623 C CD2 . TYR A 1 331 ? 28.761  -20.502 1.100   1.00 22.38 ? 330  TYR A CD2 1 
ATOM   2624 C CE1 . TYR A 1 331 ? 30.266  -21.957 2.928   1.00 21.67 ? 330  TYR A CE1 1 
ATOM   2625 C CE2 . TYR A 1 331 ? 30.029  -20.928 0.759   1.00 21.03 ? 330  TYR A CE2 1 
ATOM   2626 C CZ  . TYR A 1 331 ? 30.776  -21.659 1.679   1.00 23.20 ? 330  TYR A CZ  1 
ATOM   2627 O OH  . TYR A 1 331 ? 32.037  -22.088 1.364   1.00 25.15 ? 330  TYR A OH  1 
ATOM   2628 N N   . GLY A 1 332 ? 23.458  -20.526 2.943   1.00 21.58 ? 331  GLY A N   1 
ATOM   2629 C CA  . GLY A 1 332 ? 22.279  -20.277 3.763   1.00 20.99 ? 331  GLY A CA  1 
ATOM   2630 C C   . GLY A 1 332 ? 22.420  -19.091 4.706   1.00 20.52 ? 331  GLY A C   1 
ATOM   2631 O O   . GLY A 1 332 ? 21.818  -19.073 5.776   1.00 20.57 ? 331  GLY A O   1 
ATOM   2632 N N   . CYS A 1 333 ? 23.234  -18.105 4.338   1.00 19.38 ? 332  CYS A N   1 
ATOM   2633 C CA  . CYS A 1 333 ? 23.411  -16.931 5.210   1.00 18.41 ? 332  CYS A CA  1 
ATOM   2634 C C   . CYS A 1 333 ? 22.221  -15.982 5.102   1.00 17.71 ? 332  CYS A C   1 
ATOM   2635 O O   . CYS A 1 333 ? 21.897  -15.542 4.008   1.00 18.33 ? 332  CYS A O   1 
ATOM   2636 C CB  . CYS A 1 333 ? 24.662  -16.148 4.830   1.00 17.94 ? 332  CYS A CB  1 
ATOM   2637 S SG  . CYS A 1 333 ? 26.198  -17.090 4.851   1.00 18.08 ? 332  CYS A SG  1 
ATOM   2638 N N   . GLU A 1 334 ? 21.618  -15.636 6.241   1.00 17.51 ? 333  GLU A N   1 
ATOM   2639 C CA  . GLU A 1 334 ? 20.408  -14.832 6.259   1.00 16.75 ? 333  GLU A CA  1 
ATOM   2640 C C   . GLU A 1 334 ? 20.680  -13.357 6.000   1.00 16.91 ? 333  GLU A C   1 
ATOM   2641 O O   . GLU A 1 334 ? 19.783  -12.627 5.571   1.00 16.28 ? 333  GLU A O   1 
ATOM   2642 C CB  . GLU A 1 334 ? 19.730  -14.916 7.623   1.00 17.27 ? 333  GLU A CB  1 
ATOM   2643 C CG  . GLU A 1 334 ? 18.934  -16.188 7.867   1.00 17.15 ? 333  GLU A CG  1 
ATOM   2644 C CD  . GLU A 1 334 ? 17.988  -16.036 9.039   1.00 19.29 ? 333  GLU A CD  1 
ATOM   2645 O OE1 . GLU A 1 334 ? 17.567  -14.891 9.338   1.00 20.46 ? 333  GLU A OE1 1 
ATOM   2646 O OE2 . GLU A 1 334 ? 17.652  -17.063 9.659   1.00 20.22 ? 333  GLU A OE2 1 
ATOM   2647 N N   . THR A 1 335 ? 21.889  -12.909 6.293   1.00 16.69 ? 334  THR A N   1 
ATOM   2648 C CA  . THR A 1 335 ? 22.128  -11.463 6.295   1.00 16.52 ? 334  THR A CA  1 
ATOM   2649 C C   . THR A 1 335 ? 23.315  -11.031 5.461   1.00 17.33 ? 334  THR A C   1 
ATOM   2650 O O   . THR A 1 335 ? 24.146  -11.841 5.053   1.00 17.48 ? 334  THR A O   1 
ATOM   2651 C CB  . THR A 1 335 ? 22.308  -10.934 7.732   1.00 16.04 ? 334  THR A CB  1 
ATOM   2652 O OG1 . THR A 1 335 ? 23.651  -11.188 8.174   1.00 17.97 ? 334  THR A OG1 1 
ATOM   2653 C CG2 . THR A 1 335 ? 21.402  -11.663 8.708   1.00 15.78 ? 334  THR A CG2 1 
ATOM   2654 N N   . HIS A 1 336 ? 23.382  -9.721  5.234   1.00 16.35 ? 335  HIS A N   1 
ATOM   2655 C CA  . HIS A 1 336 ? 24.468  -9.126  4.501   1.00 17.32 ? 335  HIS A CA  1 
ATOM   2656 C C   . HIS A 1 336 ? 24.757  -7.803  5.206   1.00 16.19 ? 335  HIS A C   1 
ATOM   2657 O O   . HIS A 1 336 ? 23.846  -6.991  5.377   1.00 16.63 ? 335  HIS A O   1 
ATOM   2658 C CB  . HIS A 1 336 ? 24.039  -8.874  3.054   1.00 17.44 ? 335  HIS A CB  1 
ATOM   2659 C CG  . HIS A 1 336 ? 25.134  -8.320  2.208   1.00 19.41 ? 335  HIS A CG  1 
ATOM   2660 N ND1 . HIS A 1 336 ? 26.062  -9.122  1.581   1.00 18.87 ? 335  HIS A ND1 1 
ATOM   2661 C CD2 . HIS A 1 336 ? 25.466  -7.044  1.902   1.00 20.39 ? 335  HIS A CD2 1 
ATOM   2662 C CE1 . HIS A 1 336 ? 26.924  -8.362  0.928   1.00 22.36 ? 335  HIS A CE1 1 
ATOM   2663 N NE2 . HIS A 1 336 ? 26.587  -7.098  1.110   1.00 21.06 ? 335  HIS A NE2 1 
ATOM   2664 N N   . ALA A 1 337 ? 26.005  -7.590  5.616   1.00 16.18 ? 336  ALA A N   1 
ATOM   2665 C CA  . ALA A 1 337 ? 26.354  -6.365  6.329   1.00 16.12 ? 336  ALA A CA  1 
ATOM   2666 C C   . ALA A 1 337 ? 27.071  -5.399  5.419   1.00 16.53 ? 336  ALA A C   1 
ATOM   2667 O O   . ALA A 1 337 ? 27.937  -5.804  4.647   1.00 16.52 ? 336  ALA A O   1 
ATOM   2668 C CB  . ALA A 1 337 ? 27.209  -6.671  7.569   1.00 15.86 ? 336  ALA A CB  1 
ATOM   2669 N N   . LEU A 1 338 ? 26.684  -4.125  5.524   1.00 16.43 ? 337  LEU A N   1 
ATOM   2670 C CA  . LEU A 1 338 ? 27.284  -3.025  4.802   1.00 16.91 ? 337  LEU A CA  1 
ATOM   2671 C C   . LEU A 1 338 ? 27.982  -2.138  5.822   1.00 16.88 ? 337  LEU A C   1 
ATOM   2672 O O   . LEU A 1 338 ? 27.346  -1.586  6.750   1.00 17.66 ? 337  LEU A O   1 
ATOM   2673 C CB  . LEU A 1 338 ? 26.207  -2.233  4.030   1.00 16.41 ? 337  LEU A CB  1 
ATOM   2674 C CG  . LEU A 1 338 ? 25.427  -2.931  2.905   1.00 16.90 ? 337  LEU A CG  1 
ATOM   2675 C CD1 . LEU A 1 338 ? 24.442  -1.946  2.285   1.00 17.16 ? 337  LEU A CD1 1 
ATOM   2676 C CD2 . LEU A 1 338 ? 26.348  -3.540  1.837   1.00 17.24 ? 337  LEU A CD2 1 
ATOM   2677 N N   . LEU A 1 339 ? 29.303  -2.045  5.682   1.00 16.33 ? 338  LEU A N   1 
ATOM   2678 C CA  . LEU A 1 339 ? 30.151  -1.414  6.685   1.00 15.63 ? 338  LEU A CA  1 
ATOM   2679 C C   . LEU A 1 339 ? 31.075  -0.406  6.012   1.00 15.51 ? 338  LEU A C   1 
ATOM   2680 O O   . LEU A 1 339 ? 32.258  -0.693  5.785   1.00 14.59 ? 338  LEU A O   1 
ATOM   2681 C CB  . LEU A 1 339 ? 30.982  -2.467  7.457   1.00 14.69 ? 338  LEU A CB  1 
ATOM   2682 C CG  . LEU A 1 339 ? 30.164  -3.642  8.031   1.00 14.86 ? 338  LEU A CG  1 
ATOM   2683 C CD1 . LEU A 1 339 ? 31.065  -4.802  8.436   1.00 13.54 ? 338  LEU A CD1 1 
ATOM   2684 C CD2 . LEU A 1 339 ? 29.284  -3.210  9.201   1.00 12.73 ? 338  LEU A CD2 1 
ATOM   2685 N N   . PRO A 1 340 ? 30.550  0.782   5.708   1.00 15.58 ? 339  PRO A N   1 
ATOM   2686 C CA  . PRO A 1 340 ? 31.369  1.882   5.196   1.00 15.39 ? 339  PRO A CA  1 
ATOM   2687 C C   . PRO A 1 340 ? 32.194  2.529   6.321   1.00 15.66 ? 339  PRO A C   1 
ATOM   2688 O O   . PRO A 1 340 ? 31.684  2.912   7.370   1.00 16.08 ? 339  PRO A O   1 
ATOM   2689 C CB  . PRO A 1 340 ? 30.329  2.865   4.625   1.00 15.81 ? 339  PRO A CB  1 
ATOM   2690 C CG  . PRO A 1 340 ? 29.069  2.583   5.398   1.00 15.79 ? 339  PRO A CG  1 
ATOM   2691 C CD  . PRO A 1 340 ? 29.133  1.159   5.830   1.00 15.77 ? 339  PRO A CD  1 
ATOM   2692 N N   . TYR A 1 341 ? 33.492  2.607   6.100   1.00 14.93 ? 340  TYR A N   1 
ATOM   2693 C CA  . TYR A 1 341 ? 34.371  3.228   7.056   1.00 14.96 ? 340  TYR A CA  1 
ATOM   2694 C C   . TYR A 1 341 ? 34.344  4.722   6.753   1.00 14.55 ? 340  TYR A C   1 
ATOM   2695 O O   . TYR A 1 341 ? 35.334  5.325   6.316   1.00 15.82 ? 340  TYR A O   1 
ATOM   2696 C CB  . TYR A 1 341 ? 35.764  2.594   7.004   1.00 15.12 ? 340  TYR A CB  1 
ATOM   2697 C CG  . TYR A 1 341 ? 35.828  1.395   7.931   1.00 14.60 ? 340  TYR A CG  1 
ATOM   2698 C CD1 . TYR A 1 341 ? 34.946  0.322   7.763   1.00 13.54 ? 340  TYR A CD1 1 
ATOM   2699 C CD2 . TYR A 1 341 ? 36.727  1.346   8.990   1.00 14.06 ? 340  TYR A CD2 1 
ATOM   2700 C CE1 . TYR A 1 341 ? 34.939  -0.745  8.611   1.00 15.10 ? 340  TYR A CE1 1 
ATOM   2701 C CE2 . TYR A 1 341 ? 36.744  0.270   9.868   1.00 17.22 ? 340  TYR A CE2 1 
ATOM   2702 C CZ  . TYR A 1 341 ? 35.848  -0.787  9.667   1.00 15.39 ? 340  TYR A CZ  1 
ATOM   2703 O OH  . TYR A 1 341 ? 35.835  -1.864  10.512  1.00 17.19 ? 340  TYR A OH  1 
ATOM   2704 N N   . ASP A 1 342 ? 33.186  5.314   6.991   1.00 14.47 ? 341  ASP A N   1 
ATOM   2705 C CA  . ASP A 1 342 ? 32.976  6.706   6.614   1.00 14.36 ? 341  ASP A CA  1 
ATOM   2706 C C   . ASP A 1 342 ? 31.762  7.211   7.360   1.00 14.49 ? 341  ASP A C   1 
ATOM   2707 O O   . ASP A 1 342 ? 30.647  6.724   7.148   1.00 14.62 ? 341  ASP A O   1 
ATOM   2708 C CB  . ASP A 1 342 ? 32.757  6.819   5.101   1.00 14.45 ? 341  ASP A CB  1 
ATOM   2709 C CG  . ASP A 1 342 ? 32.660  8.256   4.643   1.00 16.31 ? 341  ASP A CG  1 
ATOM   2710 O OD1 . ASP A 1 342 ? 33.700  8.872   4.345   1.00 17.56 ? 341  ASP A OD1 1 
ATOM   2711 O OD2 . ASP A 1 342 ? 31.574  8.851   4.608   1.00 16.07 ? 341  ASP A OD2 1 
ATOM   2712 N N   . GLN A 1 343 ? 31.992  8.187   8.236   1.00 14.81 ? 342  GLN A N   1 
ATOM   2713 C CA  . GLN A 1 343 ? 30.942  8.767   9.068   1.00 15.82 ? 342  GLN A CA  1 
ATOM   2714 C C   . GLN A 1 343 ? 29.877  9.484   8.230   1.00 15.59 ? 342  GLN A C   1 
ATOM   2715 O O   . GLN A 1 343 ? 28.693  9.459   8.576   1.00 15.48 ? 342  GLN A O   1 
ATOM   2716 C CB  . GLN A 1 343 ? 31.563  9.741   10.084  1.00 16.32 ? 342  GLN A CB  1 
ATOM   2717 C CG  . GLN A 1 343 ? 30.624  10.179  11.240  1.00 17.82 ? 342  GLN A CG  1 
ATOM   2718 C CD  . GLN A 1 343 ? 30.011  9.010   12.006  1.00 19.08 ? 342  GLN A CD  1 
ATOM   2719 O OE1 . GLN A 1 343 ? 30.679  8.012   12.286  1.00 20.24 ? 342  GLN A OE1 1 
ATOM   2720 N NE2 . GLN A 1 343 ? 28.727  9.128   12.332  1.00 20.40 ? 342  GLN A NE2 1 
ATOM   2721 N N   . TYR A 1 344 ? 30.294  10.146  7.149   1.00 15.91 ? 343  TYR A N   1 
ATOM   2722 C CA  . TYR A 1 344 ? 29.320  10.763  6.246   1.00 15.52 ? 343  TYR A CA  1 
ATOM   2723 C C   . TYR A 1 344 ? 28.351  9.716   5.661   1.00 15.16 ? 343  TYR A C   1 
ATOM   2724 O O   . TYR A 1 344 ? 27.182  9.997   5.484   1.00 14.14 ? 343  TYR A O   1 
ATOM   2725 C CB  . TYR A 1 344 ? 30.012  11.553  5.134   1.00 16.11 ? 343  TYR A CB  1 
ATOM   2726 C CG  . TYR A 1 344 ? 30.520  12.913  5.556   1.00 15.82 ? 343  TYR A CG  1 
ATOM   2727 C CD1 . TYR A 1 344 ? 31.793  13.361  5.158   1.00 18.30 ? 343  TYR A CD1 1 
ATOM   2728 C CD2 . TYR A 1 344 ? 29.740  13.760  6.355   1.00 15.98 ? 343  TYR A CD2 1 
ATOM   2729 C CE1 . TYR A 1 344 ? 32.264  14.634  5.534   1.00 14.42 ? 343  TYR A CE1 1 
ATOM   2730 C CE2 . TYR A 1 344 ? 30.203  15.021  6.730   1.00 15.79 ? 343  TYR A CE2 1 
ATOM   2731 C CZ  . TYR A 1 344 ? 31.449  15.455  6.317   1.00 16.37 ? 343  TYR A CZ  1 
ATOM   2732 O OH  . TYR A 1 344 ? 31.867  16.712  6.721   1.00 16.06 ? 343  TYR A OH  1 
ATOM   2733 N N   . MET A 1 345 ? 28.836  8.496   5.432   1.00 15.04 ? 344  MET A N   1 
ATOM   2734 C CA  . MET A 1 345 ? 27.987  7.400   4.930   1.00 15.37 ? 344  MET A CA  1 
ATOM   2735 C C   . MET A 1 345 ? 27.175  6.704   6.033   1.00 15.69 ? 344  MET A C   1 
ATOM   2736 O O   . MET A 1 345 ? 26.743  5.551   5.853   1.00 15.34 ? 344  MET A O   1 
ATOM   2737 C CB  . MET A 1 345 ? 28.856  6.374   4.192   1.00 15.18 ? 344  MET A CB  1 
ATOM   2738 C CG  . MET A 1 345 ? 29.454  6.908   2.886   1.00 16.19 ? 344  MET A CG  1 
ATOM   2739 S SD  . MET A 1 345 ? 30.596  5.752   2.064   1.00 18.93 ? 344  MET A SD  1 
ATOM   2740 C CE  . MET A 1 345 ? 29.348  4.633   1.326   1.00 17.34 ? 344  MET A CE  1 
ATOM   2741 N N   . HIS A 1 346 ? 26.949  7.379   7.165   1.00 15.64 ? 345  HIS A N   1 
ATOM   2742 C CA  . HIS A 1 346 ? 26.323  6.707   8.306   1.00 16.68 ? 345  HIS A CA  1 
ATOM   2743 C C   . HIS A 1 346 ? 24.913  6.156   8.028   1.00 17.16 ? 345  HIS A C   1 
ATOM   2744 O O   . HIS A 1 346 ? 24.472  5.242   8.727   1.00 17.46 ? 345  HIS A O   1 
ATOM   2745 C CB  . HIS A 1 346 ? 26.355  7.566   9.582   1.00 16.32 ? 345  HIS A CB  1 
ATOM   2746 C CG  . HIS A 1 346 ? 25.500  8.795   9.514   1.00 16.66 ? 345  HIS A CG  1 
ATOM   2747 N ND1 . HIS A 1 346 ? 24.414  8.987   10.347  1.00 18.66 ? 345  HIS A ND1 1 
ATOM   2748 C CD2 . HIS A 1 346 ? 25.562  9.889   8.717   1.00 17.69 ? 345  HIS A CD2 1 
ATOM   2749 C CE1 . HIS A 1 346 ? 23.856  10.154  10.074  1.00 18.47 ? 345  HIS A CE1 1 
ATOM   2750 N NE2 . HIS A 1 346 ? 24.524  10.719  9.086   1.00 15.66 ? 345  HIS A NE2 1 
ATOM   2751 N N   . ARG A 1 347 ? 24.237  6.664   6.990   1.00 16.22 ? 346  ARG A N   1 
ATOM   2752 C CA  . ARG A 1 347 ? 22.902  6.150   6.645   1.00 16.87 ? 346  ARG A CA  1 
ATOM   2753 C C   . ARG A 1 347 ? 22.874  5.301   5.375   1.00 16.45 ? 346  ARG A C   1 
ATOM   2754 O O   . ARG A 1 347 ? 21.803  5.047   4.817   1.00 17.15 ? 346  ARG A O   1 
ATOM   2755 C CB  . ARG A 1 347 ? 21.892  7.300   6.560   1.00 17.23 ? 346  ARG A CB  1 
ATOM   2756 C CG  . ARG A 1 347 ? 21.744  8.056   7.880   1.00 16.47 ? 346  ARG A CG  1 
ATOM   2757 C CD  . ARG A 1 347 ? 21.553  7.151   9.137   1.00 18.80 ? 346  ARG A CD  1 
ATOM   2758 N NE  . ARG A 1 347 ? 20.203  6.585   9.172   1.00 18.52 ? 346  ARG A NE  1 
ATOM   2759 C CZ  . ARG A 1 347 ? 19.821  5.505   9.853   1.00 18.68 ? 346  ARG A CZ  1 
ATOM   2760 N NH1 . ARG A 1 347 ? 20.671  4.807   10.592  1.00 18.45 ? 346  ARG A NH1 1 
ATOM   2761 N NH2 . ARG A 1 347 ? 18.561  5.126   9.792   1.00 16.62 ? 346  ARG A NH2 1 
ATOM   2762 N N   . PHE A 1 348 ? 24.043  4.836   4.937   1.00 15.58 ? 347  PHE A N   1 
ATOM   2763 C CA  . PHE A 1 348 ? 24.138  4.084   3.675   1.00 16.11 ? 347  PHE A CA  1 
ATOM   2764 C C   . PHE A 1 348 ? 23.494  2.710   3.829   1.00 15.84 ? 347  PHE A C   1 
ATOM   2765 O O   . PHE A 1 348 ? 22.734  2.264   2.956   1.00 16.65 ? 347  PHE A O   1 
ATOM   2766 C CB  . PHE A 1 348 ? 25.603  3.950   3.267   1.00 14.88 ? 347  PHE A CB  1 
ATOM   2767 C CG  . PHE A 1 348 ? 25.833  3.319   1.921   1.00 16.74 ? 347  PHE A CG  1 
ATOM   2768 C CD1 . PHE A 1 348 ? 25.743  4.072   0.757   1.00 15.47 ? 347  PHE A CD1 1 
ATOM   2769 C CD2 . PHE A 1 348 ? 26.218  1.977   1.833   1.00 18.38 ? 347  PHE A CD2 1 
ATOM   2770 C CE1 . PHE A 1 348 ? 26.009  3.503   -0.481  1.00 19.47 ? 347  PHE A CE1 1 
ATOM   2771 C CE2 . PHE A 1 348 ? 26.477  1.390   0.593   1.00 19.92 ? 347  PHE A CE2 1 
ATOM   2772 C CZ  . PHE A 1 348 ? 26.377  2.151   -0.562  1.00 19.38 ? 347  PHE A CZ  1 
ATOM   2773 N N   . ALA A 1 349 ? 23.784  2.041   4.945   1.00 16.77 ? 348  ALA A N   1 
ATOM   2774 C CA  . ALA A 1 349 ? 23.180  0.729   5.216   1.00 16.74 ? 348  ALA A CA  1 
ATOM   2775 C C   . ALA A 1 349 ? 21.661  0.818   5.328   1.00 16.56 ? 348  ALA A C   1 
ATOM   2776 O O   . ALA A 1 349 ? 20.938  -0.022  4.763   1.00 17.45 ? 348  ALA A O   1 
ATOM   2777 C CB  . ALA A 1 349 ? 23.789  0.104   6.497   1.00 17.44 ? 348  ALA A CB  1 
ATOM   2778 N N   . ALA A 1 350 ? 21.165  1.832   6.043   1.00 16.08 ? 349  ALA A N   1 
ATOM   2779 C CA  . ALA A 1 350 ? 19.721  2.054   6.196   1.00 16.51 ? 349  ALA A CA  1 
ATOM   2780 C C   . ALA A 1 350 ? 19.041  2.280   4.846   1.00 16.35 ? 349  ALA A C   1 
ATOM   2781 O O   . ALA A 1 350 ? 17.942  1.792   4.623   1.00 17.07 ? 349  ALA A O   1 
ATOM   2782 C CB  . ALA A 1 350 ? 19.421  3.218   7.167   1.00 16.40 ? 349  ALA A CB  1 
ATOM   2783 N N   . TYR A 1 351 ? 19.695  3.010   3.941   1.00 15.67 ? 350  TYR A N   1 
ATOM   2784 C CA  . TYR A 1 351 ? 19.142  3.185   2.608   1.00 16.26 ? 350  TYR A CA  1 
ATOM   2785 C C   . TYR A 1 351 ? 18.982  1.825   1.913   1.00 16.60 ? 350  TYR A C   1 
ATOM   2786 O O   . TYR A 1 351 ? 17.916  1.509   1.361   1.00 16.85 ? 350  TYR A O   1 
ATOM   2787 C CB  . TYR A 1 351 ? 20.046  4.090   1.761   1.00 16.55 ? 350  TYR A CB  1 
ATOM   2788 C CG  . TYR A 1 351 ? 19.538  4.258   0.348   1.00 17.00 ? 350  TYR A CG  1 
ATOM   2789 C CD1 . TYR A 1 351 ? 18.515  5.154   0.063   1.00 17.18 ? 350  TYR A CD1 1 
ATOM   2790 C CD2 . TYR A 1 351 ? 20.068  3.504   -0.699  1.00 17.57 ? 350  TYR A CD2 1 
ATOM   2791 C CE1 . TYR A 1 351 ? 18.051  5.317   -1.227  1.00 17.41 ? 350  TYR A CE1 1 
ATOM   2792 C CE2 . TYR A 1 351 ? 19.606  3.659   -1.984  1.00 17.54 ? 350  TYR A CE2 1 
ATOM   2793 C CZ  . TYR A 1 351 ? 18.599  4.571   -2.237  1.00 18.03 ? 350  TYR A CZ  1 
ATOM   2794 O OH  . TYR A 1 351 ? 18.128  4.741   -3.507  1.00 19.43 ? 350  TYR A OH  1 
ATOM   2795 N N   . PHE A 1 352 ? 20.037  1.019   1.948   1.00 17.04 ? 351  PHE A N   1 
ATOM   2796 C CA  . PHE A 1 352 ? 19.989  -0.271  1.258   1.00 17.93 ? 351  PHE A CA  1 
ATOM   2797 C C   . PHE A 1 352 ? 19.186  -1.344  1.978   1.00 18.53 ? 351  PHE A C   1 
ATOM   2798 O O   . PHE A 1 352 ? 18.834  -2.380  1.384   1.00 18.74 ? 351  PHE A O   1 
ATOM   2799 C CB  . PHE A 1 352 ? 21.375  -0.709  0.780   1.00 18.11 ? 351  PHE A CB  1 
ATOM   2800 C CG  . PHE A 1 352 ? 21.753  -0.062  -0.505  1.00 18.01 ? 351  PHE A CG  1 
ATOM   2801 C CD1 . PHE A 1 352 ? 22.744  0.910   -0.554  1.00 19.20 ? 351  PHE A CD1 1 
ATOM   2802 C CD2 . PHE A 1 352 ? 21.044  -0.356  -1.662  1.00 18.12 ? 351  PHE A CD2 1 
ATOM   2803 C CE1 . PHE A 1 352 ? 23.055  1.529   -1.747  1.00 18.10 ? 351  PHE A CE1 1 
ATOM   2804 C CE2 . PHE A 1 352 ? 21.343  0.256   -2.844  1.00 18.64 ? 351  PHE A CE2 1 
ATOM   2805 C CZ  . PHE A 1 352 ? 22.347  1.213   -2.889  1.00 19.22 ? 351  PHE A CZ  1 
ATOM   2806 N N   . GLN A 1 353 ? 18.817  -1.093  3.230   1.00 19.04 ? 352  GLN A N   1 
ATOM   2807 C CA  . GLN A 1 353 ? 17.767  -1.924  3.823   1.00 19.54 ? 352  GLN A CA  1 
ATOM   2808 C C   . GLN A 1 353 ? 16.503  -1.835  2.993   1.00 20.34 ? 352  GLN A C   1 
ATOM   2809 O O   . GLN A 1 353 ? 15.921  -2.870  2.690   1.00 20.56 ? 352  GLN A O   1 
ATOM   2810 C CB  . GLN A 1 353 ? 17.447  -1.574  5.266   1.00 20.12 ? 352  GLN A CB  1 
ATOM   2811 C CG  . GLN A 1 353 ? 18.459  -2.084  6.226   1.00 19.79 ? 352  GLN A CG  1 
ATOM   2812 C CD  . GLN A 1 353 ? 18.110  -1.753  7.651   1.00 19.98 ? 352  GLN A CD  1 
ATOM   2813 O OE1 . GLN A 1 353 ? 17.516  -0.702  7.932   1.00 20.73 ? 352  GLN A OE1 1 
ATOM   2814 N NE2 . GLN A 1 353 ? 18.485  -2.633  8.560   1.00 18.10 ? 352  GLN A NE2 1 
ATOM   2815 N N   . GLN A 1 354 ? 16.076  -0.624  2.603   1.00 19.99 ? 353  GLN A N   1 
ATOM   2816 C CA  . GLN A 1 354 ? 14.937  -0.526  1.696   1.00 19.46 ? 353  GLN A CA  1 
ATOM   2817 C C   . GLN A 1 354 ? 15.272  -1.032  0.302   1.00 19.50 ? 353  GLN A C   1 
ATOM   2818 O O   . GLN A 1 354 ? 14.524  -1.825  -0.261  1.00 18.76 ? 353  GLN A O   1 
ATOM   2819 C CB  . GLN A 1 354 ? 14.334  0.893   1.589   1.00 19.08 ? 353  GLN A CB  1 
ATOM   2820 C CG  . GLN A 1 354 ? 12.991  0.853   0.813   1.00 20.53 ? 353  GLN A CG  1 
ATOM   2821 C CD  . GLN A 1 354 ? 12.297  2.193   0.675   1.00 20.81 ? 353  GLN A CD  1 
ATOM   2822 O OE1 . GLN A 1 354 ? 12.855  3.239   1.027   1.00 22.32 ? 353  GLN A OE1 1 
ATOM   2823 N NE2 . GLN A 1 354 ? 11.082  2.169   0.136   1.00 19.73 ? 353  GLN A NE2 1 
ATOM   2824 N N   . GLY A 1 355 ? 16.390  -0.559  -0.260  1.00 18.64 ? 354  GLY A N   1 
ATOM   2825 C CA  . GLY A 1 355 ? 16.716  -0.860  -1.643  1.00 18.45 ? 354  GLY A CA  1 
ATOM   2826 C C   . GLY A 1 355 ? 16.737  -2.352  -1.885  1.00 18.34 ? 354  GLY A C   1 
ATOM   2827 O O   . GLY A 1 355 ? 16.201  -2.834  -2.888  1.00 19.00 ? 354  GLY A O   1 
ATOM   2828 N N   . ASP A 1 356 ? 17.355  -3.069  -0.958  1.00 17.40 ? 355  ASP A N   1 
ATOM   2829 C CA  . ASP A 1 356 ? 17.549  -4.509  -1.097  1.00 16.91 ? 355  ASP A CA  1 
ATOM   2830 C C   . ASP A 1 356 ? 16.315  -5.240  -0.578  1.00 16.67 ? 355  ASP A C   1 
ATOM   2831 O O   . ASP A 1 356 ? 15.650  -5.957  -1.330  1.00 16.96 ? 355  ASP A O   1 
ATOM   2832 C CB  . ASP A 1 356 ? 18.820  -4.898  -0.354  1.00 16.71 ? 355  ASP A CB  1 
ATOM   2833 C CG  . ASP A 1 356 ? 19.364  -6.235  -0.768  1.00 17.33 ? 355  ASP A CG  1 
ATOM   2834 O OD1 . ASP A 1 356 ? 18.558  -7.105  -1.173  1.00 19.31 ? 355  ASP A OD1 1 
ATOM   2835 O OD2 . ASP A 1 356 ? 20.592  -6.496  -0.739  1.00 16.88 ? 355  ASP A OD2 1 
ATOM   2836 N N   . MET A 1 357 ? 15.974  -5.023  0.686   1.00 17.08 ? 356  MET A N   1 
ATOM   2837 C CA  . MET A 1 357 ? 14.927  -5.827  1.320   1.00 17.20 ? 356  MET A CA  1 
ATOM   2838 C C   . MET A 1 357 ? 13.521  -5.617  0.753   1.00 16.91 ? 356  MET A C   1 
ATOM   2839 O O   . MET A 1 357 ? 12.734  -6.574  0.673   1.00 17.42 ? 356  MET A O   1 
ATOM   2840 C CB  . MET A 1 357 ? 14.948  -5.619  2.834   1.00 17.59 ? 356  MET A CB  1 
ATOM   2841 C CG  . MET A 1 357 ? 16.284  -6.059  3.478   1.00 17.42 ? 356  MET A CG  1 
ATOM   2842 S SD  . MET A 1 357 ? 16.339  -5.678  5.203   1.00 17.36 ? 356  MET A SD  1 
ATOM   2843 C CE  . MET A 1 357 ? 15.228  -6.927  5.864   1.00 14.27 ? 356  MET A CE  1 
ATOM   2844 N N   . GLU A 1 358 ? 13.187  -4.392  0.368   1.00 16.28 ? 357  GLU A N   1 
ATOM   2845 C CA  . GLU A 1 358 ? 11.863  -4.165  -0.211  1.00 16.74 ? 357  GLU A CA  1 
ATOM   2846 C C   . GLU A 1 358 ? 11.796  -4.696  -1.651  1.00 16.94 ? 357  GLU A C   1 
ATOM   2847 O O   . GLU A 1 358 ? 10.726  -5.108  -2.109  1.00 16.77 ? 357  GLU A O   1 
ATOM   2848 C CB  . GLU A 1 358 ? 11.439  -2.688  -0.130  1.00 16.76 ? 357  GLU A CB  1 
ATOM   2849 C CG  . GLU A 1 358 ? 9.944   -2.477  -0.342  1.00 18.89 ? 357  GLU A CG  1 
ATOM   2850 C CD  . GLU A 1 358 ? 9.520   -1.034  -0.140  1.00 21.83 ? 357  GLU A CD  1 
ATOM   2851 O OE1 . GLU A 1 358 ? 8.887   -0.765  0.904   1.00 24.73 ? 357  GLU A OE1 1 
ATOM   2852 O OE2 . GLU A 1 358 ? 9.805   -0.169  -1.016  1.00 22.79 ? 357  GLU A OE2 1 
ATOM   2853 N N   . SER A 1 359 ? 12.934  -4.712  -2.347  1.00 16.00 ? 358  SER A N   1 
ATOM   2854 C CA  . SER A 1 359 ? 12.995  -5.224  -3.725  1.00 16.31 ? 358  SER A CA  1 
ATOM   2855 C C   . SER A 1 359 ? 12.888  -6.745  -3.734  1.00 16.25 ? 358  SER A C   1 
ATOM   2856 O O   . SER A 1 359 ? 12.039  -7.320  -4.435  1.00 16.96 ? 358  SER A O   1 
ATOM   2857 C CB  . SER A 1 359 ? 14.300  -4.809  -4.427  1.00 15.84 ? 358  SER A CB  1 
ATOM   2858 O OG  . SER A 1 359 ? 14.365  -3.397  -4.642  1.00 15.61 ? 358  SER A OG  1 
ATOM   2859 N N   . ASN A 1 360 ? 13.738  -7.383  -2.941  1.00 16.10 ? 359  ASN A N   1 
ATOM   2860 C CA  . ASN A 1 360 ? 13.911  -8.832  -3.053  1.00 16.35 ? 359  ASN A CA  1 
ATOM   2861 C C   . ASN A 1 360 ? 13.366  -9.682  -1.918  1.00 16.69 ? 359  ASN A C   1 
ATOM   2862 O O   . ASN A 1 360 ? 13.511  -10.912 -1.947  1.00 16.07 ? 359  ASN A O   1 
ATOM   2863 C CB  . ASN A 1 360 ? 15.376  -9.150  -3.351  1.00 16.66 ? 359  ASN A CB  1 
ATOM   2864 C CG  . ASN A 1 360 ? 15.780  -8.673  -4.718  1.00 17.53 ? 359  ASN A CG  1 
ATOM   2865 O OD1 . ASN A 1 360 ? 14.925  -8.373  -5.543  1.00 19.33 ? 359  ASN A OD1 1 
ATOM   2866 N ND2 . ASN A 1 360 ? 17.080  -8.570  -4.960  1.00 17.79 ? 359  ASN A ND2 1 
ATOM   2867 N N   . GLY A 1 361 ? 12.731  -9.034  -0.942  1.00 16.51 ? 360  GLY A N   1 
ATOM   2868 C CA  . GLY A 1 361 ? 11.969  -9.733  0.093   1.00 16.96 ? 360  GLY A CA  1 
ATOM   2869 C C   . GLY A 1 361 ? 10.642  -10.226 -0.472  1.00 17.29 ? 360  GLY A C   1 
ATOM   2870 O O   . GLY A 1 361 ? 9.581   -9.692  -0.150  1.00 17.02 ? 360  GLY A O   1 
ATOM   2871 N N   . LYS A 1 362 ? 10.715  -11.286 -1.285  1.00 17.29 ? 361  LYS A N   1 
ATOM   2872 C CA  . LYS A 1 362 ? 9.595   -11.752 -2.115  1.00 16.64 ? 361  LYS A CA  1 
ATOM   2873 C C   . LYS A 1 362 ? 9.550   -13.272 -2.071  1.00 17.32 ? 361  LYS A C   1 
ATOM   2874 O O   . LYS A 1 362 ? 10.567  -13.927 -1.812  1.00 16.63 ? 361  LYS A O   1 
ATOM   2875 C CB  . LYS A 1 362 ? 9.808   -11.307 -3.561  1.00 17.28 ? 361  LYS A CB  1 
ATOM   2876 C CG  . LYS A 1 362 ? 9.943   -9.800  -3.760  1.00 16.18 ? 361  LYS A CG  1 
ATOM   2877 C CD  . LYS A 1 362 ? 8.605   -9.076  -3.579  1.00 14.70 ? 361  LYS A CD  1 
ATOM   2878 C CE  . LYS A 1 362 ? 8.859   -7.570  -3.402  1.00 15.08 ? 361  LYS A CE  1 
ATOM   2879 N NZ  . LYS A 1 362 ? 9.326   -6.925  -4.671  1.00 15.28 ? 361  LYS A NZ  1 
ATOM   2880 N N   . TYR A 1 363 ? 8.380   -13.842 -2.337  1.00 17.38 ? 362  TYR A N   1 
ATOM   2881 C CA  . TYR A 1 363 ? 8.260   -15.298 -2.271  1.00 18.20 ? 362  TYR A CA  1 
ATOM   2882 C C   . TYR A 1 363 ? 7.500   -15.926 -3.440  1.00 18.80 ? 362  TYR A C   1 
ATOM   2883 O O   . TYR A 1 363 ? 7.345   -17.150 -3.488  1.00 19.30 ? 362  TYR A O   1 
ATOM   2884 C CB  . TYR A 1 363 ? 7.692   -15.725 -0.906  1.00 18.78 ? 362  TYR A CB  1 
ATOM   2885 C CG  . TYR A 1 363 ? 6.188   -15.602 -0.739  1.00 17.56 ? 362  TYR A CG  1 
ATOM   2886 C CD1 . TYR A 1 363 ? 5.404   -16.749 -0.566  1.00 18.10 ? 362  TYR A CD1 1 
ATOM   2887 C CD2 . TYR A 1 363 ? 5.549   -14.355 -0.720  1.00 16.99 ? 362  TYR A CD2 1 
ATOM   2888 C CE1 . TYR A 1 363 ? 4.024   -16.671 -0.371  1.00 20.29 ? 362  TYR A CE1 1 
ATOM   2889 C CE2 . TYR A 1 363 ? 4.160   -14.269 -0.535  1.00 19.62 ? 362  TYR A CE2 1 
ATOM   2890 C CZ  . TYR A 1 363 ? 3.408   -15.442 -0.368  1.00 20.12 ? 362  TYR A CZ  1 
ATOM   2891 O OH  . TYR A 1 363 ? 2.047   -15.382 -0.183  1.00 19.72 ? 362  TYR A OH  1 
ATOM   2892 N N   . ILE A 1 364 ? 7.070   -15.099 -4.390  1.00 18.86 ? 363  ILE A N   1 
ATOM   2893 C CA  . ILE A 1 364 ? 6.353   -15.567 -5.590  1.00 19.11 ? 363  ILE A CA  1 
ATOM   2894 C C   . ILE A 1 364 ? 7.120   -15.227 -6.866  1.00 18.85 ? 363  ILE A C   1 
ATOM   2895 O O   . ILE A 1 364 ? 7.546   -14.078 -7.074  1.00 18.29 ? 363  ILE A O   1 
ATOM   2896 C CB  . ILE A 1 364 ? 4.906   -14.963 -5.670  1.00 18.92 ? 363  ILE A CB  1 
ATOM   2897 C CG1 . ILE A 1 364 ? 4.104   -15.198 -4.364  1.00 19.39 ? 363  ILE A CG1 1 
ATOM   2898 C CG2 . ILE A 1 364 ? 4.146   -15.467 -6.905  1.00 18.86 ? 363  ILE A CG2 1 
ATOM   2899 C CD1 . ILE A 1 364 ? 3.848   -16.678 -3.980  1.00 17.54 ? 363  ILE A CD1 1 
ATOM   2900 N N   . THR A 1 365 ? 7.261   -16.214 -7.747  1.00 19.23 ? 364  THR A N   1 
ATOM   2901 C CA  . THR A 1 365 ? 8.016   -15.999 -8.985  1.00 20.04 ? 364  THR A CA  1 
ATOM   2902 C C   . THR A 1 365 ? 7.156   -15.527 -10.134 1.00 20.94 ? 364  THR A C   1 
ATOM   2903 O O   . THR A 1 365 ? 5.921   -15.490 -10.041 1.00 21.10 ? 364  THR A O   1 
ATOM   2904 C CB  . THR A 1 365 ? 8.763   -17.268 -9.438  1.00 20.65 ? 364  THR A CB  1 
ATOM   2905 O OG1 . THR A 1 365 ? 7.806   -18.225 -9.915  1.00 20.01 ? 364  THR A OG1 1 
ATOM   2906 C CG2 . THR A 1 365 ? 9.463   -17.926 -8.282  1.00 20.15 ? 364  THR A CG2 1 
ATOM   2907 N N   . LYS A 1 366 ? 7.828   -15.206 -11.229 1.00 22.16 ? 365  LYS A N   1 
ATOM   2908 C CA  . LYS A 1 366 ? 7.180   -14.780 -12.459 1.00 22.96 ? 365  LYS A CA  1 
ATOM   2909 C C   . LYS A 1 366 ? 6.174   -15.838 -12.947 1.00 23.52 ? 365  LYS A C   1 
ATOM   2910 O O   . LYS A 1 366 ? 5.194   -15.495 -13.593 1.00 23.98 ? 365  LYS A O   1 
ATOM   2911 C CB  . LYS A 1 366 ? 8.229   -14.472 -13.541 1.00 23.76 ? 365  LYS A CB  1 
ATOM   2912 C CG  . LYS A 1 366 ? 7.690   -13.794 -14.798 1.00 24.79 ? 365  LYS A CG  1 
ATOM   2913 C CD  . LYS A 1 366 ? 8.839   -13.485 -15.782 1.00 28.88 ? 365  LYS A CD  1 
ATOM   2914 C CE  . LYS A 1 366 ? 8.398   -12.480 -16.839 1.00 32.87 ? 365  LYS A CE  1 
ATOM   2915 N NZ  . LYS A 1 366 ? 9.469   -12.226 -17.864 1.00 35.28 ? 365  LYS A NZ  1 
ATOM   2916 N N   . SER A 1 367 ? 6.399   -17.104 -12.616 1.00 23.47 ? 366  SER A N   1 
ATOM   2917 C CA  . SER A 1 367 ? 5.487   -18.169 -13.055 1.00 23.90 ? 366  SER A CA  1 
ATOM   2918 C C   . SER A 1 367 ? 4.275   -18.334 -12.137 1.00 23.89 ? 366  SER A C   1 
ATOM   2919 O O   . SER A 1 367 ? 3.333   -19.073 -12.465 1.00 24.12 ? 366  SER A O   1 
ATOM   2920 C CB  . SER A 1 367 ? 6.235   -19.491 -13.150 1.00 23.62 ? 366  SER A CB  1 
ATOM   2921 O OG  . SER A 1 367 ? 6.510   -19.979 -11.853 1.00 24.46 ? 366  SER A OG  1 
ATOM   2922 N N   . GLY A 1 368 ? 4.293   -17.659 -10.989 1.00 23.17 ? 367  GLY A N   1 
ATOM   2923 C CA  . GLY A 1 368 ? 3.261   -17.853 -9.981  1.00 23.24 ? 367  GLY A CA  1 
ATOM   2924 C C   . GLY A 1 368 ? 3.669   -18.869 -8.932  1.00 22.45 ? 367  GLY A C   1 
ATOM   2925 O O   . GLY A 1 368 ? 2.938   -19.083 -7.962  1.00 22.75 ? 367  GLY A O   1 
ATOM   2926 N N   . ALA A 1 369 ? 4.841   -19.484 -9.107  1.00 22.06 ? 368  ALA A N   1 
ATOM   2927 C CA  . ALA A 1 369 ? 5.349   -20.474 -8.154  1.00 21.66 ? 368  ALA A CA  1 
ATOM   2928 C C   . ALA A 1 369 ? 5.741   -19.865 -6.819  1.00 21.73 ? 368  ALA A C   1 
ATOM   2929 O O   . ALA A 1 369 ? 6.259   -18.754 -6.766  1.00 21.43 ? 368  ALA A O   1 
ATOM   2930 C CB  . ALA A 1 369 ? 6.532   -21.228 -8.731  1.00 21.41 ? 368  ALA A CB  1 
ATOM   2931 N N   . ARG A 1 370 ? 5.513   -20.610 -5.742  1.00 21.24 ? 369  ARG A N   1 
ATOM   2932 C CA  . ARG A 1 370 ? 6.067   -20.230 -4.458  1.00 22.21 ? 369  ARG A CA  1 
ATOM   2933 C C   . ARG A 1 370 ? 7.526   -20.682 -4.448  1.00 21.82 ? 369  ARG A C   1 
ATOM   2934 O O   . ARG A 1 370 ? 7.809   -21.852 -4.698  1.00 21.58 ? 369  ARG A O   1 
ATOM   2935 C CB  . ARG A 1 370 ? 5.300   -20.876 -3.310  1.00 22.75 ? 369  ARG A CB  1 
ATOM   2936 C CG  . ARG A 1 370 ? 5.515   -20.162 -1.970  1.00 25.38 ? 369  ARG A CG  1 
ATOM   2937 C CD  . ARG A 1 370 ? 5.582   -21.068 -0.752  1.00 30.69 ? 369  ARG A CD  1 
ATOM   2938 N NE  . ARG A 1 370 ? 5.729   -20.309 0.497   1.00 33.21 ? 369  ARG A NE  1 
ATOM   2939 C CZ  . ARG A 1 370 ? 6.879   -19.811 0.988   1.00 35.88 ? 369  ARG A CZ  1 
ATOM   2940 N NH1 . ARG A 1 370 ? 8.050   -19.969 0.354   1.00 36.81 ? 369  ARG A NH1 1 
ATOM   2941 N NH2 . ARG A 1 370 ? 6.859   -19.143 2.141   1.00 36.21 ? 369  ARG A NH2 1 
ATOM   2942 N N   . VAL A 1 371 ? 8.450   -19.768 -4.155  1.00 20.86 ? 370  VAL A N   1 
ATOM   2943 C CA  . VAL A 1 371 ? 9.859   -20.156 -4.060  1.00 20.78 ? 370  VAL A CA  1 
ATOM   2944 C C   . VAL A 1 371 ? 10.052  -21.269 -3.034  1.00 21.06 ? 370  VAL A C   1 
ATOM   2945 O O   . VAL A 1 371 ? 9.392   -21.301 -1.980  1.00 21.49 ? 370  VAL A O   1 
ATOM   2946 C CB  . VAL A 1 371 ? 10.795  -18.949 -3.699  1.00 20.50 ? 370  VAL A CB  1 
ATOM   2947 C CG1 . VAL A 1 371 ? 10.658  -17.840 -4.708  1.00 19.72 ? 370  VAL A CG1 1 
ATOM   2948 C CG2 . VAL A 1 371 ? 10.491  -18.426 -2.297  1.00 19.77 ? 370  VAL A CG2 1 
ATOM   2949 N N   . ASP A 1 372 ? 10.951  -22.195 -3.354  1.00 21.12 ? 371  ASP A N   1 
ATOM   2950 C CA  . ASP A 1 372 ? 11.369  -23.215 -2.402  1.00 21.40 ? 371  ASP A CA  1 
ATOM   2951 C C   . ASP A 1 372 ? 12.855  -23.035 -2.078  1.00 20.98 ? 371  ASP A C   1 
ATOM   2952 O O   . ASP A 1 372 ? 13.582  -23.987 -1.830  1.00 21.79 ? 371  ASP A O   1 
ATOM   2953 C CB  . ASP A 1 372 ? 11.071  -24.620 -2.962  1.00 21.17 ? 371  ASP A CB  1 
ATOM   2954 C CG  . ASP A 1 372 ? 11.682  -24.848 -4.342  1.00 23.57 ? 371  ASP A CG  1 
ATOM   2955 O OD1 . ASP A 1 372 ? 12.316  -23.925 -4.910  1.00 23.78 ? 371  ASP A OD1 1 
ATOM   2956 O OD2 . ASP A 1 372 ? 11.583  -25.942 -4.932  1.00 25.49 ? 371  ASP A OD2 1 
ATOM   2957 N N   . HIS A 1 373 ? 13.283  -21.777 -2.098  1.00 20.11 ? 372  HIS A N   1 
ATOM   2958 C CA  . HIS A 1 373 ? 14.664  -21.400 -1.862  1.00 19.36 ? 372  HIS A CA  1 
ATOM   2959 C C   . HIS A 1 373 ? 14.632  -20.004 -1.259  1.00 19.20 ? 372  HIS A C   1 
ATOM   2960 O O   . HIS A 1 373 ? 13.632  -19.292 -1.363  1.00 19.41 ? 372  HIS A O   1 
ATOM   2961 C CB  . HIS A 1 373 ? 15.464  -21.388 -3.174  1.00 19.20 ? 372  HIS A CB  1 
ATOM   2962 C CG  . HIS A 1 373 ? 14.890  -20.491 -4.233  1.00 17.92 ? 372  HIS A CG  1 
ATOM   2963 N ND1 . HIS A 1 373 ? 15.149  -19.135 -4.286  1.00 17.93 ? 372  HIS A ND1 1 
ATOM   2964 C CD2 . HIS A 1 373 ? 14.085  -20.758 -5.287  1.00 16.81 ? 372  HIS A CD2 1 
ATOM   2965 C CE1 . HIS A 1 373 ? 14.522  -18.607 -5.325  1.00 19.27 ? 372  HIS A CE1 1 
ATOM   2966 N NE2 . HIS A 1 373 ? 13.858  -19.570 -5.941  1.00 19.66 ? 372  HIS A NE2 1 
ATOM   2967 N N   . GLN A 1 374 ? 15.732  -19.619 -0.646  1.00 18.58 ? 373  GLN A N   1 
ATOM   2968 C CA  . GLN A 1 374 ? 15.846  -18.295 -0.044  1.00 19.00 ? 373  GLN A CA  1 
ATOM   2969 C C   . GLN A 1 374 ? 15.829  -17.194 -1.102  1.00 19.05 ? 373  GLN A C   1 
ATOM   2970 O O   . GLN A 1 374 ? 16.344  -17.383 -2.212  1.00 18.89 ? 373  GLN A O   1 
ATOM   2971 C CB  . GLN A 1 374 ? 17.156  -18.235 0.747   1.00 19.24 ? 373  GLN A CB  1 
ATOM   2972 C CG  . GLN A 1 374 ? 17.105  -18.924 2.116   1.00 20.71 ? 373  GLN A CG  1 
ATOM   2973 C CD  . GLN A 1 374 ? 15.997  -18.373 2.995   1.00 23.48 ? 373  GLN A CD  1 
ATOM   2974 O OE1 . GLN A 1 374 ? 15.837  -17.153 3.115   1.00 23.20 ? 373  GLN A OE1 1 
ATOM   2975 N NE2 . GLN A 1 374 ? 15.194  -19.268 3.568   1.00 25.20 ? 373  GLN A NE2 1 
ATOM   2976 N N   . THR A 1 375 ? 15.252  -16.041 -0.752  1.00 18.04 ? 374  THR A N   1 
ATOM   2977 C CA  . THR A 1 375 ? 15.428  -14.840 -1.571  1.00 17.93 ? 374  THR A CA  1 
ATOM   2978 C C   . THR A 1 375 ? 16.245  -13.793 -0.793  1.00 17.74 ? 374  THR A C   1 
ATOM   2979 O O   . THR A 1 375 ? 17.232  -14.141 -0.156  1.00 17.31 ? 374  THR A O   1 
ATOM   2980 C CB  . THR A 1 375 ? 14.089  -14.271 -2.052  1.00 17.79 ? 374  THR A CB  1 
ATOM   2981 O OG1 . THR A 1 375 ? 13.200  -14.177 -0.933  1.00 17.82 ? 374  THR A OG1 1 
ATOM   2982 C CG2 . THR A 1 375 ? 13.389  -15.252 -3.058  1.00 17.81 ? 374  THR A CG2 1 
ATOM   2983 N N   . GLY A 1 376 ? 15.845  -12.521 -0.867  1.00 17.83 ? 375  GLY A N   1 
ATOM   2984 C CA  . GLY A 1 376 ? 16.679  -11.424 -0.370  1.00 17.11 ? 375  GLY A CA  1 
ATOM   2985 C C   . GLY A 1 376 ? 17.129  -11.569 1.089   1.00 17.39 ? 375  GLY A C   1 
ATOM   2986 O O   . GLY A 1 376 ? 16.395  -12.101 1.932   1.00 16.88 ? 375  GLY A O   1 
ATOM   2987 N N   . PRO A 1 377 ? 18.347  -11.101 1.395   1.00 17.66 ? 376  PRO A N   1 
ATOM   2988 C CA  . PRO A 1 377 ? 18.864  -11.186 2.760   1.00 17.64 ? 376  PRO A CA  1 
ATOM   2989 C C   . PRO A 1 377 ? 18.415  -10.013 3.609   1.00 17.89 ? 376  PRO A C   1 
ATOM   2990 O O   . PRO A 1 377 ? 17.927  -9.004  3.092   1.00 18.13 ? 376  PRO A O   1 
ATOM   2991 C CB  . PRO A 1 377 ? 20.371  -11.118 2.556   1.00 17.81 ? 376  PRO A CB  1 
ATOM   2992 C CG  . PRO A 1 377 ? 20.535  -10.222 1.314   1.00 17.92 ? 376  PRO A CG  1 
ATOM   2993 C CD  . PRO A 1 377 ? 19.308  -10.457 0.475   1.00 16.37 ? 376  PRO A CD  1 
ATOM   2994 N N   . ILE A 1 378 ? 18.600  -10.153 4.913   1.00 17.68 ? 377  ILE A N   1 
ATOM   2995 C CA  . ILE A 1 378 ? 18.450  -9.022  5.814   1.00 17.11 ? 377  ILE A CA  1 
ATOM   2996 C C   . ILE A 1 378 ? 19.742  -8.198  5.759   1.00 16.24 ? 377  ILE A C   1 
ATOM   2997 O O   . ILE A 1 378 ? 20.818  -8.719  6.009   1.00 16.65 ? 377  ILE A O   1 
ATOM   2998 C CB  . ILE A 1 378 ? 18.180  -9.526  7.233   1.00 17.61 ? 377  ILE A CB  1 
ATOM   2999 C CG1 . ILE A 1 378 ? 16.835  -10.258 7.278   1.00 18.27 ? 377  ILE A CG1 1 
ATOM   3000 C CG2 . ILE A 1 378 ? 18.244  -8.392  8.243   1.00 17.91 ? 377  ILE A CG2 1 
ATOM   3001 C CD1 . ILE A 1 378 ? 16.755  -11.318 8.378   1.00 19.68 ? 377  ILE A CD1 1 
ATOM   3002 N N   . VAL A 1 379 ? 19.604  -6.920  5.410   1.00 16.02 ? 378  VAL A N   1 
ATOM   3003 C CA  . VAL A 1 379 ? 20.720  -5.983  5.281   1.00 16.44 ? 378  VAL A CA  1 
ATOM   3004 C C   . VAL A 1 379 ? 20.794  -5.151  6.542   1.00 16.67 ? 378  VAL A C   1 
ATOM   3005 O O   . VAL A 1 379 ? 19.761  -4.743  7.062   1.00 16.23 ? 378  VAL A O   1 
ATOM   3006 C CB  . VAL A 1 379 ? 20.549  -5.109  3.996   1.00 17.13 ? 378  VAL A CB  1 
ATOM   3007 C CG1 . VAL A 1 379 ? 21.619  -3.980  3.909   1.00 18.19 ? 378  VAL A CG1 1 
ATOM   3008 C CG2 . VAL A 1 379 ? 20.593  -6.006  2.766   1.00 17.04 ? 378  VAL A CG2 1 
ATOM   3009 N N   . TRP A 1 380 ? 22.017  -4.942  7.049   1.00 16.40 ? 379  TRP A N   1 
ATOM   3010 C CA  . TRP A 1 380 ? 22.239  -4.192  8.275   1.00 16.72 ? 379  TRP A CA  1 
ATOM   3011 C C   . TRP A 1 380 ? 23.662  -3.634  8.310   1.00 16.85 ? 379  TRP A C   1 
ATOM   3012 O O   . TRP A 1 380 ? 24.459  -3.893  7.413   1.00 17.04 ? 379  TRP A O   1 
ATOM   3013 C CB  . TRP A 1 380 ? 21.964  -5.082  9.500   1.00 16.14 ? 379  TRP A CB  1 
ATOM   3014 C CG  . TRP A 1 380 ? 22.894  -6.257  9.607   1.00 16.72 ? 379  TRP A CG  1 
ATOM   3015 C CD1 . TRP A 1 380 ? 22.887  -7.384  8.828   1.00 17.23 ? 379  TRP A CD1 1 
ATOM   3016 C CD2 . TRP A 1 380 ? 23.961  -6.422  10.543  1.00 18.48 ? 379  TRP A CD2 1 
ATOM   3017 N NE1 . TRP A 1 380 ? 23.888  -8.235  9.225   1.00 16.32 ? 379  TRP A NE1 1 
ATOM   3018 C CE2 . TRP A 1 380 ? 24.566  -7.671  10.275  1.00 17.28 ? 379  TRP A CE2 1 
ATOM   3019 C CE3 . TRP A 1 380 ? 24.478  -5.637  11.583  1.00 17.96 ? 379  TRP A CE3 1 
ATOM   3020 C CZ2 . TRP A 1 380 ? 25.656  -8.149  11.008  1.00 17.51 ? 379  TRP A CZ2 1 
ATOM   3021 C CZ3 . TRP A 1 380 ? 25.550  -6.108  12.309  1.00 18.70 ? 379  TRP A CZ3 1 
ATOM   3022 C CH2 . TRP A 1 380 ? 26.137  -7.358  12.021  1.00 18.90 ? 379  TRP A CH2 1 
ATOM   3023 N N   . GLY A 1 381 ? 23.960  -2.827  9.321   1.00 16.46 ? 380  GLY A N   1 
ATOM   3024 C CA  . GLY A 1 381 ? 25.317  -2.335  9.494   1.00 16.10 ? 380  GLY A CA  1 
ATOM   3025 C C   . GLY A 1 381 ? 25.355  -0.945  10.090  1.00 16.23 ? 380  GLY A C   1 
ATOM   3026 O O   . GLY A 1 381 ? 24.349  -0.251  10.128  1.00 15.49 ? 380  GLY A O   1 
ATOM   3027 N N   . GLU A 1 382 ? 26.524  -0.591  10.604  1.00 16.27 ? 381  GLU A N   1 
ATOM   3028 C CA  . GLU A 1 382 ? 26.839  0.763   11.056  1.00 16.73 ? 381  GLU A CA  1 
ATOM   3029 C C   . GLU A 1 382 ? 28.199  1.079   10.460  1.00 16.80 ? 381  GLU A C   1 
ATOM   3030 O O   . GLU A 1 382 ? 28.965  0.168   10.138  1.00 16.52 ? 381  GLU A O   1 
ATOM   3031 C CB  . GLU A 1 382 ? 26.925  0.821   12.581  1.00 15.96 ? 381  GLU A CB  1 
ATOM   3032 C CG  . GLU A 1 382 ? 25.597  0.722   13.323  1.00 17.13 ? 381  GLU A CG  1 
ATOM   3033 C CD  . GLU A 1 382 ? 24.715  1.952   13.152  1.00 19.46 ? 381  GLU A CD  1 
ATOM   3034 O OE1 . GLU A 1 382 ? 25.205  3.011   12.714  1.00 19.92 ? 381  GLU A OE1 1 
ATOM   3035 O OE2 . GLU A 1 382 ? 23.519  1.881   13.459  1.00 21.83 ? 381  GLU A OE2 1 
ATOM   3036 N N   . PRO A 1 383 ? 28.517  2.357   10.277  1.00 16.40 ? 382  PRO A N   1 
ATOM   3037 C CA  . PRO A 1 383 ? 29.828  2.715   9.741   1.00 16.50 ? 382  PRO A CA  1 
ATOM   3038 C C   . PRO A 1 383 ? 30.978  2.334   10.687  1.00 16.71 ? 382  PRO A C   1 
ATOM   3039 O O   . PRO A 1 383 ? 30.818  2.339   11.903  1.00 17.66 ? 382  PRO A O   1 
ATOM   3040 C CB  . PRO A 1 383 ? 29.740  4.241   9.614   1.00 16.57 ? 382  PRO A CB  1 
ATOM   3041 C CG  . PRO A 1 383 ? 28.723  4.621   10.639  1.00 16.08 ? 382  PRO A CG  1 
ATOM   3042 C CD  . PRO A 1 383 ? 27.674  3.543   10.513  1.00 16.45 ? 382  PRO A CD  1 
ATOM   3043 N N   . GLY A 1 384 ? 32.114  1.957   10.113  1.00 17.07 ? 383  GLY A N   1 
ATOM   3044 C CA  . GLY A 1 384 ? 33.338  1.795   10.883  1.00 17.44 ? 383  GLY A CA  1 
ATOM   3045 C C   . GLY A 1 384 ? 33.910  3.164   11.216  1.00 17.64 ? 383  GLY A C   1 
ATOM   3046 O O   . GLY A 1 384 ? 33.742  4.103   10.427  1.00 17.04 ? 383  GLY A O   1 
ATOM   3047 N N   . THR A 1 385 ? 34.572  3.314   12.364  1.00 18.12 ? 384  THR A N   1 
ATOM   3048 C CA  . THR A 1 385 ? 34.865  2.250   13.331  1.00 19.09 ? 384  THR A CA  1 
ATOM   3049 C C   . THR A 1 385 ? 33.779  2.016   14.369  1.00 19.56 ? 384  THR A C   1 
ATOM   3050 O O   . THR A 1 385 ? 33.956  1.162   15.241  1.00 21.17 ? 384  THR A O   1 
ATOM   3051 C CB  . THR A 1 385 ? 36.188  2.541   14.084  1.00 19.77 ? 384  THR A CB  1 
ATOM   3052 O OG1 . THR A 1 385 ? 36.151  3.894   14.584  1.00 19.96 ? 384  THR A OG1 1 
ATOM   3053 C CG2 . THR A 1 385 ? 37.365  2.504   13.118  1.00 19.91 ? 384  THR A CG2 1 
ATOM   3054 N N   . ASN A 1 386 ? 32.668  2.744   14.272  1.00 19.34 ? 385  ASN A N   1 
ATOM   3055 C CA  . ASN A 1 386 ? 31.557  2.604   15.220  1.00 20.26 ? 385  ASN A CA  1 
ATOM   3056 C C   . ASN A 1 386 ? 31.065  1.156   15.356  1.00 20.76 ? 385  ASN A C   1 
ATOM   3057 O O   . ASN A 1 386 ? 31.013  0.608   16.468  1.00 20.70 ? 385  ASN A O   1 
ATOM   3058 C CB  . ASN A 1 386 ? 30.389  3.521   14.847  1.00 20.24 ? 385  ASN A CB  1 
ATOM   3059 C CG  . ASN A 1 386 ? 30.801  4.988   14.702  1.00 22.66 ? 385  ASN A CG  1 
ATOM   3060 O OD1 . ASN A 1 386 ? 31.862  5.409   15.176  1.00 24.02 ? 385  ASN A OD1 1 
ATOM   3061 N ND2 . ASN A 1 386 ? 29.940  5.777   14.065  1.00 22.84 ? 385  ASN A ND2 1 
ATOM   3062 N N   . GLY A 1 387 ? 30.707  0.543   14.229  1.00 21.12 ? 386  GLY A N   1 
ATOM   3063 C CA  . GLY A 1 387 ? 30.212  -0.826  14.232  1.00 21.90 ? 386  GLY A CA  1 
ATOM   3064 C C   . GLY A 1 387 ? 31.248  -1.779  14.791  1.00 22.06 ? 386  GLY A C   1 
ATOM   3065 O O   . GLY A 1 387 ? 30.926  -2.770  15.445  1.00 22.28 ? 386  GLY A O   1 
ATOM   3066 N N   . GLN A 1 388 ? 32.510  -1.444  14.551  1.00 22.81 ? 387  GLN A N   1 
ATOM   3067 C CA  . GLN A 1 388 ? 33.642  -2.228  15.012  1.00 23.19 ? 387  GLN A CA  1 
ATOM   3068 C C   . GLN A 1 388 ? 33.658  -2.383  16.539  1.00 23.96 ? 387  GLN A C   1 
ATOM   3069 O O   . GLN A 1 388 ? 33.940  -3.466  17.061  1.00 23.80 ? 387  GLN A O   1 
ATOM   3070 C CB  . GLN A 1 388 ? 34.918  -1.571  14.478  1.00 23.25 ? 387  GLN A CB  1 
ATOM   3071 C CG  . GLN A 1 388 ? 36.160  -2.393  14.540  1.00 21.62 ? 387  GLN A CG  1 
ATOM   3072 C CD  . GLN A 1 388 ? 37.362  -1.602  14.074  1.00 19.40 ? 387  GLN A CD  1 
ATOM   3073 O OE1 . GLN A 1 388 ? 38.251  -1.256  14.878  1.00 20.19 ? 387  GLN A OE1 1 
ATOM   3074 N NE2 . GLN A 1 388 ? 37.411  -1.324  12.786  1.00 14.73 ? 387  GLN A NE2 1 
ATOM   3075 N N   . HIS A 1 389 ? 33.296  -1.312  17.252  1.00 24.30 ? 388  HIS A N   1 
ATOM   3076 C CA  . HIS A 1 389 ? 33.222  -1.320  18.716  1.00 24.77 ? 388  HIS A CA  1 
ATOM   3077 C C   . HIS A 1 389 ? 31.853  -1.708  19.262  1.00 24.43 ? 388  HIS A C   1 
ATOM   3078 O O   . HIS A 1 389 ? 31.617  -1.649  20.472  1.00 25.35 ? 388  HIS A O   1 
ATOM   3079 C CB  . HIS A 1 389 ? 33.657  0.048   19.270  1.00 25.11 ? 388  HIS A CB  1 
ATOM   3080 C CG  . HIS A 1 389 ? 34.996  0.486   18.767  1.00 26.46 ? 388  HIS A CG  1 
ATOM   3081 N ND1 . HIS A 1 389 ? 36.129  -0.273  18.940  1.00 29.25 ? 388  HIS A ND1 1 
ATOM   3082 C CD2 . HIS A 1 389 ? 35.376  1.570   18.052  1.00 28.64 ? 388  HIS A CD2 1 
ATOM   3083 C CE1 . HIS A 1 389 ? 37.156  0.335   18.374  1.00 29.92 ? 388  HIS A CE1 1 
ATOM   3084 N NE2 . HIS A 1 389 ? 36.723  1.453   17.822  1.00 30.15 ? 388  HIS A NE2 1 
ATOM   3085 N N   . ALA A 1 390 ? 30.942  -2.095  18.372  1.00 23.90 ? 389  ALA A N   1 
ATOM   3086 C CA  . ALA A 1 390 ? 29.622  -2.536  18.793  1.00 22.49 ? 389  ALA A CA  1 
ATOM   3087 C C   . ALA A 1 390 ? 29.445  -4.055  18.663  1.00 22.40 ? 389  ALA A C   1 
ATOM   3088 O O   . ALA A 1 390 ? 29.223  -4.736  19.650  1.00 23.08 ? 389  ALA A O   1 
ATOM   3089 C CB  . ALA A 1 390 ? 28.549  -1.800  18.029  1.00 22.76 ? 389  ALA A CB  1 
ATOM   3090 N N   . PHE A 1 391 ? 29.610  -4.591  17.459  1.00 20.59 ? 390  PHE A N   1 
ATOM   3091 C CA  . PHE A 1 391 ? 29.125  -5.940  17.182  1.00 19.77 ? 390  PHE A CA  1 
ATOM   3092 C C   . PHE A 1 391 ? 30.131  -6.868  16.502  1.00 18.80 ? 390  PHE A C   1 
ATOM   3093 O O   . PHE A 1 391 ? 29.811  -8.022  16.223  1.00 19.84 ? 390  PHE A O   1 
ATOM   3094 C CB  . PHE A 1 391 ? 27.816  -5.875  16.374  1.00 19.00 ? 390  PHE A CB  1 
ATOM   3095 C CG  . PHE A 1 391 ? 27.905  -5.016  15.129  1.00 19.12 ? 390  PHE A CG  1 
ATOM   3096 C CD1 . PHE A 1 391 ? 28.575  -5.468  13.991  1.00 17.40 ? 390  PHE A CD1 1 
ATOM   3097 C CD2 . PHE A 1 391 ? 27.311  -3.748  15.098  1.00 18.77 ? 390  PHE A CD2 1 
ATOM   3098 C CE1 . PHE A 1 391 ? 28.670  -4.664  12.823  1.00 18.00 ? 390  PHE A CE1 1 
ATOM   3099 C CE2 . PHE A 1 391 ? 27.395  -2.947  13.949  1.00 18.83 ? 390  PHE A CE2 1 
ATOM   3100 C CZ  . PHE A 1 391 ? 28.079  -3.402  12.814  1.00 17.06 ? 390  PHE A CZ  1 
ATOM   3101 N N   . TYR A 1 392 ? 31.342  -6.383  16.218  1.00 17.89 ? 391  TYR A N   1 
ATOM   3102 C CA  . TYR A 1 392 ? 32.315  -7.236  15.514  1.00 17.41 ? 391  TYR A CA  1 
ATOM   3103 C C   . TYR A 1 392 ? 32.708  -8.457  16.341  1.00 17.23 ? 391  TYR A C   1 
ATOM   3104 O O   . TYR A 1 392 ? 33.138  -9.473  15.786  1.00 16.97 ? 391  TYR A O   1 
ATOM   3105 C CB  . TYR A 1 392 ? 33.565  -6.466  15.096  1.00 17.34 ? 391  TYR A CB  1 
ATOM   3106 C CG  . TYR A 1 392 ? 33.430  -5.583  13.870  1.00 18.15 ? 391  TYR A CG  1 
ATOM   3107 C CD1 . TYR A 1 392 ? 32.211  -4.959  13.529  1.00 18.54 ? 391  TYR A CD1 1 
ATOM   3108 C CD2 . TYR A 1 392 ? 34.550  -5.328  13.066  1.00 17.19 ? 391  TYR A CD2 1 
ATOM   3109 C CE1 . TYR A 1 392 ? 32.126  -4.102  12.403  1.00 17.62 ? 391  TYR A CE1 1 
ATOM   3110 C CE2 . TYR A 1 392 ? 34.475  -4.475  11.960  1.00 17.89 ? 391  TYR A CE2 1 
ATOM   3111 C CZ  . TYR A 1 392 ? 33.267  -3.857  11.640  1.00 18.83 ? 391  TYR A CZ  1 
ATOM   3112 O OH  . TYR A 1 392 ? 33.201  -2.994  10.548  1.00 17.87 ? 391  TYR A OH  1 
ATOM   3113 N N   . GLN A 1 393 ? 32.548  -8.375  17.662  1.00 16.54 ? 392  GLN A N   1 
ATOM   3114 C CA  . GLN A 1 393 ? 32.765  -9.560  18.505  1.00 15.96 ? 392  GLN A CA  1 
ATOM   3115 C C   . GLN A 1 393 ? 32.026  -10.780 17.917  1.00 15.71 ? 392  GLN A C   1 
ATOM   3116 O O   . GLN A 1 393 ? 32.596  -11.885 17.779  1.00 15.14 ? 392  GLN A O   1 
ATOM   3117 C CB  . GLN A 1 393 ? 32.320  -9.288  19.950  1.00 15.81 ? 392  GLN A CB  1 
ATOM   3118 C CG  . GLN A 1 393 ? 32.098  -10.544 20.819  1.00 16.13 ? 392  GLN A CG  1 
ATOM   3119 C CD  . GLN A 1 393 ? 33.394  -11.277 21.138  1.00 15.17 ? 392  GLN A CD  1 
ATOM   3120 O OE1 . GLN A 1 393 ? 34.405  -10.649 21.415  1.00 19.76 ? 392  GLN A OE1 1 
ATOM   3121 N NE2 . GLN A 1 393 ? 33.372  -12.608 21.069  1.00 17.59 ? 392  GLN A NE2 1 
ATOM   3122 N N   . LEU A 1 394 ? 30.769  -10.560 17.534  1.00 16.07 ? 393  LEU A N   1 
ATOM   3123 C CA  . LEU A 1 394 ? 29.933  -11.619 16.974  1.00 15.73 ? 393  LEU A CA  1 
ATOM   3124 C C   . LEU A 1 394 ? 30.387  -12.065 15.584  1.00 15.66 ? 393  LEU A C   1 
ATOM   3125 O O   . LEU A 1 394 ? 30.294  -13.250 15.245  1.00 16.06 ? 393  LEU A O   1 
ATOM   3126 C CB  . LEU A 1 394 ? 28.454  -11.187 16.939  1.00 16.11 ? 393  LEU A CB  1 
ATOM   3127 C CG  . LEU A 1 394 ? 27.440  -12.301 16.651  1.00 16.29 ? 393  LEU A CG  1 
ATOM   3128 C CD1 . LEU A 1 394 ? 26.186  -12.039 17.446  1.00 17.43 ? 393  LEU A CD1 1 
ATOM   3129 C CD2 . LEU A 1 394 ? 27.100  -12.438 15.130  1.00 18.22 ? 393  LEU A CD2 1 
ATOM   3130 N N   . ILE A 1 395 ? 30.825  -11.112 14.769  1.00 15.79 ? 394  ILE A N   1 
ATOM   3131 C CA  . ILE A 1 395 ? 31.283  -11.425 13.422  1.00 16.43 ? 394  ILE A CA  1 
ATOM   3132 C C   . ILE A 1 395 ? 32.527  -12.305 13.502  1.00 17.00 ? 394  ILE A C   1 
ATOM   3133 O O   . ILE A 1 395 ? 32.641  -13.289 12.755  1.00 17.29 ? 394  ILE A O   1 
ATOM   3134 C CB  . ILE A 1 395 ? 31.553  -10.130 12.602  1.00 15.50 ? 394  ILE A CB  1 
ATOM   3135 C CG1 . ILE A 1 395 ? 30.313  -9.221  12.611  1.00 18.01 ? 394  ILE A CG1 1 
ATOM   3136 C CG2 . ILE A 1 395 ? 31.959  -10.479 11.162  1.00 14.67 ? 394  ILE A CG2 1 
ATOM   3137 C CD1 . ILE A 1 395 ? 30.402  -7.998  11.663  1.00 17.53 ? 394  ILE A CD1 1 
ATOM   3138 N N   . HIS A 1 396 ? 33.430  -11.982 14.430  1.00 17.18 ? 395  HIS A N   1 
ATOM   3139 C CA  . HIS A 1 396 ? 34.666  -12.755 14.601  1.00 18.23 ? 395  HIS A CA  1 
ATOM   3140 C C   . HIS A 1 396 ? 34.485  -14.093 15.306  1.00 18.42 ? 395  HIS A C   1 
ATOM   3141 O O   . HIS A 1 396 ? 35.137  -15.070 14.932  1.00 18.64 ? 395  HIS A O   1 
ATOM   3142 C CB  . HIS A 1 396 ? 35.735  -11.947 15.356  1.00 18.05 ? 395  HIS A CB  1 
ATOM   3143 C CG  . HIS A 1 396 ? 36.342  -10.838 14.556  1.00 17.14 ? 395  HIS A CG  1 
ATOM   3144 N ND1 . HIS A 1 396 ? 37.391  -11.037 13.683  1.00 16.34 ? 395  HIS A ND1 1 
ATOM   3145 C CD2 . HIS A 1 396 ? 36.048  -9.517  14.496  1.00 18.69 ? 395  HIS A CD2 1 
ATOM   3146 C CE1 . HIS A 1 396 ? 37.716  -9.887  13.117  1.00 18.31 ? 395  HIS A CE1 1 
ATOM   3147 N NE2 . HIS A 1 396 ? 36.911  -8.951  13.586  1.00 19.39 ? 395  HIS A NE2 1 
ATOM   3148 N N   . GLN A 1 397 ? 33.618  -14.138 16.324  1.00 18.55 ? 396  GLN A N   1 
ATOM   3149 C CA  . GLN A 1 397 ? 33.589  -15.279 17.259  1.00 19.16 ? 396  GLN A CA  1 
ATOM   3150 C C   . GLN A 1 397 ? 32.202  -15.780 17.655  1.00 19.24 ? 396  GLN A C   1 
ATOM   3151 O O   . GLN A 1 397 ? 32.066  -16.489 18.670  1.00 20.36 ? 396  GLN A O   1 
ATOM   3152 C CB  . GLN A 1 397 ? 34.343  -14.907 18.540  1.00 19.22 ? 396  GLN A CB  1 
ATOM   3153 C CG  . GLN A 1 397 ? 35.880  -14.913 18.457  1.00 19.00 ? 396  GLN A CG  1 
ATOM   3154 C CD  . GLN A 1 397 ? 36.545  -14.862 19.840  1.00 20.21 ? 396  GLN A CD  1 
ATOM   3155 O OE1 . GLN A 1 397 ? 36.044  -14.203 20.768  1.00 19.18 ? 396  GLN A OE1 1 
ATOM   3156 N NE2 . GLN A 1 397 ? 37.675  -15.568 19.978  1.00 18.84 ? 396  GLN A NE2 1 
ATOM   3157 N N   . GLY A 1 398 ? 31.164  -15.400 16.905  1.00 19.20 ? 397  GLY A N   1 
ATOM   3158 C CA  . GLY A 1 398 ? 29.838  -15.959 17.127  1.00 19.36 ? 397  GLY A CA  1 
ATOM   3159 C C   . GLY A 1 398 ? 29.666  -17.203 16.276  1.00 19.41 ? 397  GLY A C   1 
ATOM   3160 O O   . GLY A 1 398 ? 30.659  -17.812 15.841  1.00 19.99 ? 397  GLY A O   1 
ATOM   3161 N N   . THR A 1 399 ? 28.421  -17.562 15.990  1.00 19.43 ? 398  THR A N   1 
ATOM   3162 C CA  . THR A 1 399 ? 28.113  -18.808 15.285  1.00 19.53 ? 398  THR A CA  1 
ATOM   3163 C C   . THR A 1 399 ? 27.390  -18.582 13.966  1.00 20.31 ? 398  THR A C   1 
ATOM   3164 O O   . THR A 1 399 ? 26.726  -19.491 13.467  1.00 20.48 ? 398  THR A O   1 
ATOM   3165 C CB  . THR A 1 399 ? 27.215  -19.709 16.168  1.00 19.63 ? 398  THR A CB  1 
ATOM   3166 O OG1 . THR A 1 399 ? 26.016  -18.986 16.473  1.00 19.11 ? 398  THR A OG1 1 
ATOM   3167 C CG2 . THR A 1 399 ? 27.863  -19.965 17.531  1.00 19.68 ? 398  THR A CG2 1 
ATOM   3168 N N   . LYS A 1 400 ? 27.511  -17.371 13.420  1.00 20.44 ? 399  LYS A N   1 
ATOM   3169 C CA  . LYS A 1 400 ? 26.865  -16.992 12.165  1.00 20.78 ? 399  LYS A CA  1 
ATOM   3170 C C   . LYS A 1 400 ? 27.920  -16.658 11.116  1.00 20.03 ? 399  LYS A C   1 
ATOM   3171 O O   . LYS A 1 400 ? 28.910  -15.983 11.407  1.00 19.84 ? 399  LYS A O   1 
ATOM   3172 C CB  . LYS A 1 400 ? 25.992  -15.743 12.367  1.00 21.42 ? 399  LYS A CB  1 
ATOM   3173 C CG  . LYS A 1 400 ? 24.569  -16.000 12.855  1.00 22.63 ? 399  LYS A CG  1 
ATOM   3174 C CD  . LYS A 1 400 ? 24.464  -15.979 14.373  1.00 24.82 ? 399  LYS A CD  1 
ATOM   3175 C CE  . LYS A 1 400 ? 23.023  -16.263 14.760  1.00 24.52 ? 399  LYS A CE  1 
ATOM   3176 N NZ  . LYS A 1 400 ? 22.896  -16.899 16.107  1.00 22.81 ? 399  LYS A NZ  1 
ATOM   3177 N N   . MET A 1 401 ? 27.716  -17.149 9.901   1.00 19.74 ? 400  MET A N   1 
ATOM   3178 C CA  . MET A 1 401 ? 28.460  -16.653 8.755   1.00 19.58 ? 400  MET A CA  1 
ATOM   3179 C C   . MET A 1 401 ? 27.745  -15.415 8.213   1.00 18.93 ? 400  MET A C   1 
ATOM   3180 O O   . MET A 1 401 ? 26.520  -15.436 7.977   1.00 18.58 ? 400  MET A O   1 
ATOM   3181 C CB  . MET A 1 401 ? 28.559  -17.724 7.683   1.00 19.71 ? 400  MET A CB  1 
ATOM   3182 C CG  . MET A 1 401 ? 29.325  -17.308 6.451   1.00 22.21 ? 400  MET A CG  1 
ATOM   3183 S SD  . MET A 1 401 ? 29.281  -18.763 5.381   1.00 26.53 ? 400  MET A SD  1 
ATOM   3184 C CE  . MET A 1 401 ? 30.170  -18.197 4.097   1.00 26.47 ? 400  MET A CE  1 
ATOM   3185 N N   . ILE A 1 402 ? 28.514  -14.335 8.045   1.00 17.48 ? 401  ILE A N   1 
ATOM   3186 C CA  . ILE A 1 402 ? 27.951  -13.022 7.740   1.00 17.34 ? 401  ILE A CA  1 
ATOM   3187 C C   . ILE A 1 402 ? 28.789  -12.378 6.656   1.00 16.21 ? 401  ILE A C   1 
ATOM   3188 O O   . ILE A 1 402 ? 29.833  -11.821 6.947   1.00 17.92 ? 401  ILE A O   1 
ATOM   3189 C CB  . ILE A 1 402 ? 27.964  -12.118 8.993   1.00 17.08 ? 401  ILE A CB  1 
ATOM   3190 C CG1 . ILE A 1 402 ? 27.179  -12.761 10.150  1.00 17.92 ? 401  ILE A CG1 1 
ATOM   3191 C CG2 . ILE A 1 402 ? 27.412  -10.697 8.651   1.00 15.96 ? 401  ILE A CG2 1 
ATOM   3192 C CD1 . ILE A 1 402 ? 27.431  -12.105 11.495  1.00 18.79 ? 401  ILE A CD1 1 
ATOM   3193 N N   . PRO A 1 403 ? 28.369  -12.458 5.405   1.00 16.38 ? 402  PRO A N   1 
ATOM   3194 C CA  . PRO A 1 403 ? 29.125  -11.766 4.361   1.00 15.50 ? 402  PRO A CA  1 
ATOM   3195 C C   . PRO A 1 403 ? 29.078  -10.258 4.642   1.00 15.29 ? 402  PRO A C   1 
ATOM   3196 O O   . PRO A 1 403 ? 28.020  -9.727  4.955   1.00 15.08 ? 402  PRO A O   1 
ATOM   3197 C CB  . PRO A 1 403 ? 28.358  -12.107 3.085   1.00 15.64 ? 402  PRO A CB  1 
ATOM   3198 C CG  . PRO A 1 403 ? 27.550  -13.363 3.438   1.00 17.13 ? 402  PRO A CG  1 
ATOM   3199 C CD  . PRO A 1 403 ? 27.198  -13.190 4.876   1.00 15.96 ? 402  PRO A CD  1 
ATOM   3200 N N   . CYS A 1 404 ? 30.230  -9.609  4.563   1.00 14.99 ? 403  CYS A N   1 
ATOM   3201 C CA  . CYS A 1 404 ? 30.301  -8.167  4.822   1.00 15.69 ? 403  CYS A CA  1 
ATOM   3202 C C   . CYS A 1 404 ? 30.922  -7.446  3.650   1.00 15.24 ? 403  CYS A C   1 
ATOM   3203 O O   . CYS A 1 404 ? 31.910  -7.916  3.070   1.00 16.23 ? 403  CYS A O   1 
ATOM   3204 C CB  . CYS A 1 404 ? 31.189  -7.884  6.032   1.00 15.31 ? 403  CYS A CB  1 
ATOM   3205 S SG  . CYS A 1 404 ? 30.646  -8.576  7.587   1.00 17.02 ? 403  CYS A SG  1 
ATOM   3206 N N   . ASP A 1 405 ? 30.358  -6.289  3.303   1.00 15.42 ? 404  ASP A N   1 
ATOM   3207 C CA  . ASP A 1 405 ? 31.036  -5.384  2.382   1.00 14.96 ? 404  ASP A CA  1 
ATOM   3208 C C   . ASP A 1 405 ? 31.619  -4.233  3.194   1.00 15.14 ? 404  ASP A C   1 
ATOM   3209 O O   . ASP A 1 405 ? 30.883  -3.517  3.865   1.00 15.24 ? 404  ASP A O   1 
ATOM   3210 C CB  . ASP A 1 405 ? 30.068  -4.781  1.366   1.00 14.82 ? 404  ASP A CB  1 
ATOM   3211 C CG  . ASP A 1 405 ? 29.503  -5.788  0.403   1.00 15.72 ? 404  ASP A CG  1 
ATOM   3212 O OD1 . ASP A 1 405 ? 29.991  -6.963  0.289   1.00 14.13 ? 404  ASP A OD1 1 
ATOM   3213 O OD2 . ASP A 1 405 ? 28.547  -5.442  -0.317  1.00 17.45 ? 404  ASP A OD2 1 
ATOM   3214 N N   . PHE A 1 406 ? 32.940  -4.083  3.120   1.00 14.58 ? 405  PHE A N   1 
ATOM   3215 C CA  . PHE A 1 406 ? 33.684  -2.993  3.748   1.00 14.72 ? 405  PHE A CA  1 
ATOM   3216 C C   . PHE A 1 406 ? 33.953  -1.947  2.677   1.00 14.74 ? 405  PHE A C   1 
ATOM   3217 O O   . PHE A 1 406 ? 34.433  -2.294  1.602   1.00 14.40 ? 405  PHE A O   1 
ATOM   3218 C CB  . PHE A 1 406 ? 35.026  -3.536  4.291   1.00 14.23 ? 405  PHE A CB  1 
ATOM   3219 C CG  . PHE A 1 406 ? 34.908  -4.239  5.618   1.00 14.61 ? 405  PHE A CG  1 
ATOM   3220 C CD1 . PHE A 1 406 ? 34.298  -5.504  5.718   1.00 16.21 ? 405  PHE A CD1 1 
ATOM   3221 C CD2 . PHE A 1 406 ? 35.434  -3.657  6.764   1.00 13.52 ? 405  PHE A CD2 1 
ATOM   3222 C CE1 . PHE A 1 406 ? 34.190  -6.156  6.965   1.00 15.68 ? 405  PHE A CE1 1 
ATOM   3223 C CE2 . PHE A 1 406 ? 35.349  -4.313  8.018   1.00 15.43 ? 405  PHE A CE2 1 
ATOM   3224 C CZ  . PHE A 1 406 ? 34.723  -5.562  8.109   1.00 16.23 ? 405  PHE A CZ  1 
ATOM   3225 N N   . LEU A 1 407 ? 33.613  -0.681  2.943   1.00 14.76 ? 406  LEU A N   1 
ATOM   3226 C CA  . LEU A 1 407 ? 33.764  0.375   1.955   1.00 15.17 ? 406  LEU A CA  1 
ATOM   3227 C C   . LEU A 1 407 ? 34.570  1.533   2.560   1.00 15.08 ? 406  LEU A C   1 
ATOM   3228 O O   . LEU A 1 407 ? 34.417  1.838   3.743   1.00 15.40 ? 406  LEU A O   1 
ATOM   3229 C CB  . LEU A 1 407 ? 32.386  0.882   1.461   1.00 16.16 ? 406  LEU A CB  1 
ATOM   3230 C CG  . LEU A 1 407 ? 31.398  -0.163  0.935   1.00 16.66 ? 406  LEU A CG  1 
ATOM   3231 C CD1 . LEU A 1 407 ? 30.427  -0.519  2.068   1.00 16.33 ? 406  LEU A CD1 1 
ATOM   3232 C CD2 . LEU A 1 407 ? 30.648  0.363   -0.292  1.00 19.61 ? 406  LEU A CD2 1 
ATOM   3233 N N   . ILE A 1 408 ? 35.440  2.150   1.766   1.00 14.44 ? 407  ILE A N   1 
ATOM   3234 C CA  . ILE A 1 408 ? 36.180  3.334   2.257   1.00 14.58 ? 407  ILE A CA  1 
ATOM   3235 C C   . ILE A 1 408 ? 36.663  4.223   1.115   1.00 14.10 ? 407  ILE A C   1 
ATOM   3236 O O   . ILE A 1 408 ? 37.068  3.714   0.072   1.00 12.86 ? 407  ILE A O   1 
ATOM   3237 C CB  . ILE A 1 408 ? 37.373  2.933   3.228   1.00 15.01 ? 407  ILE A CB  1 
ATOM   3238 C CG1 . ILE A 1 408 ? 37.794  4.109   4.140   1.00 15.09 ? 407  ILE A CG1 1 
ATOM   3239 C CG2 . ILE A 1 408 ? 38.594  2.440   2.449   1.00 14.68 ? 407  ILE A CG2 1 
ATOM   3240 C CD1 . ILE A 1 408 ? 38.774  3.730   5.288   1.00 17.28 ? 407  ILE A CD1 1 
ATOM   3241 N N   . PRO A 1 409 ? 36.584  5.544   1.274   1.00 13.60 ? 408  PRO A N   1 
ATOM   3242 C CA  . PRO A 1 409 ? 37.360  6.439   0.394   1.00 14.29 ? 408  PRO A CA  1 
ATOM   3243 C C   . PRO A 1 409 ? 38.833  6.515   0.806   1.00 14.48 ? 408  PRO A C   1 
ATOM   3244 O O   . PRO A 1 409 ? 39.161  6.587   2.001   1.00 14.92 ? 408  PRO A O   1 
ATOM   3245 C CB  . PRO A 1 409 ? 36.689  7.808   0.586   1.00 13.94 ? 408  PRO A CB  1 
ATOM   3246 C CG  . PRO A 1 409 ? 36.165  7.764   2.019   1.00 14.09 ? 408  PRO A CG  1 
ATOM   3247 C CD  . PRO A 1 409 ? 35.719  6.294   2.210   1.00 14.43 ? 408  PRO A CD  1 
ATOM   3248 N N   . VAL A 1 410 ? 39.715  6.533   -0.194  1.00 14.91 ? 409  VAL A N   1 
ATOM   3249 C CA  . VAL A 1 410 ? 41.145  6.715   0.041   1.00 15.67 ? 409  VAL A CA  1 
ATOM   3250 C C   . VAL A 1 410 ? 41.404  8.112   0.613   1.00 15.22 ? 409  VAL A C   1 
ATOM   3251 O O   . VAL A 1 410 ? 42.123  8.275   1.608   1.00 15.60 ? 409  VAL A O   1 
ATOM   3252 C CB  . VAL A 1 410 ? 41.942  6.519   -1.256  1.00 15.18 ? 409  VAL A CB  1 
ATOM   3253 C CG1 . VAL A 1 410 ? 43.416  6.852   -1.037  1.00 16.23 ? 409  VAL A CG1 1 
ATOM   3254 C CG2 . VAL A 1 410 ? 41.817  5.087   -1.735  1.00 16.62 ? 409  VAL A CG2 1 
ATOM   3255 N N   . GLN A 1 411 ? 40.785  9.111   -0.001  1.00 15.42 ? 410  GLN A N   1 
ATOM   3256 C CA  . GLN A 1 411 ? 40.984  10.502  0.395   1.00 15.81 ? 410  GLN A CA  1 
ATOM   3257 C C   . GLN A 1 411 ? 39.824  10.931  1.270   1.00 16.47 ? 410  GLN A C   1 
ATOM   3258 O O   . GLN A 1 411 ? 38.668  10.748  0.911   1.00 16.92 ? 410  GLN A O   1 
ATOM   3259 C CB  . GLN A 1 411 ? 41.061  11.403  -0.836  1.00 16.19 ? 410  GLN A CB  1 
ATOM   3260 C CG  . GLN A 1 411 ? 42.207  11.051  -1.790  1.00 17.11 ? 410  GLN A CG  1 
ATOM   3261 C CD  . GLN A 1 411 ? 42.232  11.932  -3.007  1.00 18.88 ? 410  GLN A CD  1 
ATOM   3262 O OE1 . GLN A 1 411 ? 41.659  13.036  -3.003  1.00 19.49 ? 410  GLN A OE1 1 
ATOM   3263 N NE2 . GLN A 1 411 ? 42.888  11.459  -4.067  1.00 19.60 ? 410  GLN A NE2 1 
ATOM   3264 N N   . THR A 1 412 ? 40.144  11.496  2.428   1.00 17.46 ? 411  THR A N   1 
ATOM   3265 C CA  . THR A 1 412 ? 39.123  11.992  3.334   1.00 16.65 ? 411  THR A CA  1 
ATOM   3266 C C   . THR A 1 412 ? 38.742  13.437  2.952   1.00 16.91 ? 411  THR A C   1 
ATOM   3267 O O   . THR A 1 412 ? 39.534  14.181  2.348   1.00 16.37 ? 411  THR A O   1 
ATOM   3268 C CB  . THR A 1 412 ? 39.594  11.847  4.807   1.00 16.54 ? 411  THR A CB  1 
ATOM   3269 O OG1 . THR A 1 412 ? 38.586  12.327  5.709   1.00 16.92 ? 411  THR A OG1 1 
ATOM   3270 C CG2 . THR A 1 412 ? 40.821  12.729  5.112   1.00 17.42 ? 411  THR A CG2 1 
ATOM   3271 N N   . GLN A 1 413 ? 37.507  13.803  3.275   1.00 17.33 ? 412  GLN A N   1 
ATOM   3272 C CA  . GLN A 1 413 ? 37.049  15.178  3.140   1.00 18.31 ? 412  GLN A CA  1 
ATOM   3273 C C   . GLN A 1 413 ? 37.648  16.090  4.221   1.00 19.28 ? 412  GLN A C   1 
ATOM   3274 O O   . GLN A 1 413 ? 37.587  17.319  4.107   1.00 19.65 ? 412  GLN A O   1 
ATOM   3275 C CB  . GLN A 1 413 ? 35.520  15.213  3.214   1.00 18.62 ? 412  GLN A CB  1 
ATOM   3276 C CG  . GLN A 1 413 ? 34.831  14.419  2.114   1.00 18.15 ? 412  GLN A CG  1 
ATOM   3277 C CD  . GLN A 1 413 ? 34.775  15.144  0.773   1.00 19.39 ? 412  GLN A CD  1 
ATOM   3278 O OE1 . GLN A 1 413 ? 34.994  16.363  0.688   1.00 20.84 ? 412  GLN A OE1 1 
ATOM   3279 N NE2 . GLN A 1 413 ? 34.502  14.388  -0.285  1.00 18.87 ? 412  GLN A NE2 1 
ATOM   3280 N N   . HIS A 1 414 ? 38.217  15.490  5.266   1.00 18.99 ? 413  HIS A N   1 
ATOM   3281 C CA  . HIS A 1 414 ? 38.779  16.246  6.389   1.00 20.03 ? 413  HIS A CA  1 
ATOM   3282 C C   . HIS A 1 414 ? 40.138  15.691  6.809   1.00 19.87 ? 413  HIS A C   1 
ATOM   3283 O O   . HIS A 1 414 ? 40.210  14.920  7.768   1.00 19.45 ? 413  HIS A O   1 
ATOM   3284 C CB  . HIS A 1 414 ? 37.813  16.219  7.592   1.00 20.33 ? 413  HIS A CB  1 
ATOM   3285 C CG  . HIS A 1 414 ? 36.480  16.831  7.302   1.00 21.63 ? 413  HIS A CG  1 
ATOM   3286 N ND1 . HIS A 1 414 ? 36.280  18.197  7.263   1.00 22.69 ? 413  HIS A ND1 1 
ATOM   3287 C CD2 . HIS A 1 414 ? 35.283  16.265  7.019   1.00 20.26 ? 413  HIS A CD2 1 
ATOM   3288 C CE1 . HIS A 1 414 ? 35.012  18.442  6.977   1.00 23.68 ? 413  HIS A CE1 1 
ATOM   3289 N NE2 . HIS A 1 414 ? 34.385  17.286  6.834   1.00 21.10 ? 413  HIS A NE2 1 
ATOM   3290 N N   . PRO A 1 415 ? 41.206  16.059  6.090   1.00 20.33 ? 414  PRO A N   1 
ATOM   3291 C CA  . PRO A 1 415 ? 42.558  15.550  6.384   1.00 20.54 ? 414  PRO A CA  1 
ATOM   3292 C C   . PRO A 1 415 ? 43.207  16.249  7.575   1.00 20.98 ? 414  PRO A C   1 
ATOM   3293 O O   . PRO A 1 415 ? 44.320  16.783  7.480   1.00 21.00 ? 414  PRO A O   1 
ATOM   3294 C CB  . PRO A 1 415 ? 43.328  15.814  5.084   1.00 20.74 ? 414  PRO A CB  1 
ATOM   3295 C CG  . PRO A 1 415 ? 42.639  16.989  4.467   1.00 20.95 ? 414  PRO A CG  1 
ATOM   3296 C CD  . PRO A 1 415 ? 41.201  16.971  4.931   1.00 20.29 ? 414  PRO A CD  1 
ATOM   3297 N N   . ILE A 1 416 ? 42.508  16.220  8.706   1.00 20.91 ? 415  ILE A N   1 
ATOM   3298 C CA  . ILE A 1 416 ? 42.995  16.848  9.929   1.00 21.40 ? 415  ILE A CA  1 
ATOM   3299 C C   . ILE A 1 416 ? 44.206  16.124  10.523  1.00 21.45 ? 415  ILE A C   1 
ATOM   3300 O O   . ILE A 1 416 ? 44.448  14.951  10.234  1.00 20.99 ? 415  ILE A O   1 
ATOM   3301 C CB  . ILE A 1 416 ? 41.862  16.967  10.983  1.00 21.36 ? 415  ILE A CB  1 
ATOM   3302 C CG1 . ILE A 1 416 ? 41.286  15.581  11.320  1.00 21.02 ? 415  ILE A CG1 1 
ATOM   3303 C CG2 . ILE A 1 416 ? 40.786  17.942  10.505  1.00 21.67 ? 415  ILE A CG2 1 
ATOM   3304 C CD1 . ILE A 1 416 ? 40.375  15.564  12.533  1.00 19.35 ? 415  ILE A CD1 1 
ATOM   3305 N N   . ARG A 1 417 ? 44.959  16.838  11.357  1.00 22.32 ? 416  ARG A N   1 
ATOM   3306 C CA  . ARG A 1 417 ? 46.142  16.289  12.024  1.00 22.20 ? 416  ARG A CA  1 
ATOM   3307 C C   . ARG A 1 417 ? 47.087  15.663  10.998  1.00 21.94 ? 416  ARG A C   1 
ATOM   3308 O O   . ARG A 1 417 ? 47.628  14.584  11.232  1.00 21.54 ? 416  ARG A O   1 
ATOM   3309 C CB  . ARG A 1 417 ? 45.753  15.246  13.088  1.00 22.19 ? 416  ARG A CB  1 
ATOM   3310 C CG  . ARG A 1 417 ? 44.729  15.705  14.141  1.00 23.93 ? 416  ARG A CG  1 
ATOM   3311 C CD  . ARG A 1 417 ? 45.307  16.441  15.354  1.00 23.91 ? 416  ARG A CD  1 
ATOM   3312 N NE  . ARG A 1 417 ? 46.512  15.821  15.902  1.00 24.52 ? 416  ARG A NE  1 
ATOM   3313 C CZ  . ARG A 1 417 ? 46.554  14.839  16.803  1.00 24.51 ? 416  ARG A CZ  1 
ATOM   3314 N NH1 . ARG A 1 417 ? 45.448  14.295  17.303  1.00 24.28 ? 416  ARG A NH1 1 
ATOM   3315 N NH2 . ARG A 1 417 ? 47.734  14.390  17.205  1.00 26.80 ? 416  ARG A NH2 1 
ATOM   3316 N N   . LYS A 1 418 ? 47.259  16.337  9.859   1.00 21.69 ? 417  LYS A N   1 
ATOM   3317 C CA  . LYS A 1 418 ? 48.133  15.865  8.774   1.00 22.27 ? 417  LYS A CA  1 
ATOM   3318 C C   . LYS A 1 418 ? 47.823  14.425  8.327   1.00 21.85 ? 417  LYS A C   1 
ATOM   3319 O O   . LYS A 1 418 ? 48.728  13.668  7.939   1.00 22.45 ? 417  LYS A O   1 
ATOM   3320 C CB  . LYS A 1 418 ? 49.609  16.012  9.175   1.00 22.53 ? 417  LYS A CB  1 
ATOM   3321 C CG  . LYS A 1 418 ? 50.056  17.468  9.316   1.00 25.84 ? 417  LYS A CG  1 
ATOM   3322 C CD  . LYS A 1 418 ? 51.176  17.616  10.353  1.00 31.32 ? 417  LYS A CD  1 
ATOM   3323 C CE  . LYS A 1 418 ? 52.509  17.084  9.852   1.00 33.41 ? 417  LYS A CE  1 
ATOM   3324 N NZ  . LYS A 1 418 ? 53.663  17.550  10.697  1.00 36.06 ? 417  LYS A NZ  1 
ATOM   3325 N N   . GLY A 1 419 ? 46.541  14.062  8.377   1.00 20.95 ? 418  GLY A N   1 
ATOM   3326 C CA  . GLY A 1 419 ? 46.099  12.752  7.907   1.00 20.44 ? 418  GLY A CA  1 
ATOM   3327 C C   . GLY A 1 419 ? 46.064  11.646  8.954   1.00 19.82 ? 418  GLY A C   1 
ATOM   3328 O O   . GLY A 1 419 ? 45.761  10.506  8.619   1.00 19.35 ? 418  GLY A O   1 
ATOM   3329 N N   . LEU A 1 420 ? 46.321  11.982  10.218  1.00 19.50 ? 419  LEU A N   1 
ATOM   3330 C CA  . LEU A 1 420 ? 46.443  10.978  11.288  1.00 19.42 ? 419  LEU A CA  1 
ATOM   3331 C C   . LEU A 1 420 ? 45.179  10.156  11.504  1.00 18.32 ? 419  LEU A C   1 
ATOM   3332 O O   . LEU A 1 420 ? 45.239  8.932   11.630  1.00 18.15 ? 419  LEU A O   1 
ATOM   3333 C CB  . LEU A 1 420 ? 46.843  11.635  12.624  1.00 20.21 ? 419  LEU A CB  1 
ATOM   3334 C CG  . LEU A 1 420 ? 46.887  10.775  13.902  1.00 21.18 ? 419  LEU A CG  1 
ATOM   3335 C CD1 . LEU A 1 420 ? 47.879  9.598   13.799  1.00 23.80 ? 419  LEU A CD1 1 
ATOM   3336 C CD2 . LEU A 1 420 ? 47.201  11.612  15.146  1.00 23.05 ? 419  LEU A CD2 1 
ATOM   3337 N N   . HIS A 1 421 ? 44.036  10.833  11.580  1.00 17.98 ? 420  HIS A N   1 
ATOM   3338 C CA  . HIS A 1 421 ? 42.766  10.144  11.771  1.00 17.40 ? 420  HIS A CA  1 
ATOM   3339 C C   . HIS A 1 421 ? 42.453  9.169   10.636  1.00 16.96 ? 420  HIS A C   1 
ATOM   3340 O O   . HIS A 1 421 ? 42.020  8.038   10.890  1.00 16.78 ? 420  HIS A O   1 
ATOM   3341 C CB  . HIS A 1 421 ? 41.622  11.150  11.884  1.00 17.20 ? 420  HIS A CB  1 
ATOM   3342 C CG  . HIS A 1 421 ? 41.585  11.881  13.187  1.00 17.41 ? 420  HIS A CG  1 
ATOM   3343 N ND1 . HIS A 1 421 ? 40.589  11.688  14.119  1.00 15.12 ? 420  HIS A ND1 1 
ATOM   3344 C CD2 . HIS A 1 421 ? 42.402  12.832  13.699  1.00 18.95 ? 420  HIS A CD2 1 
ATOM   3345 C CE1 . HIS A 1 421 ? 40.803  12.476  15.158  1.00 19.08 ? 420  HIS A CE1 1 
ATOM   3346 N NE2 . HIS A 1 421 ? 41.891  13.186  14.925  1.00 16.93 ? 420  HIS A NE2 1 
ATOM   3347 N N   . HIS A 1 422 ? 42.665  9.602   9.396   1.00 17.43 ? 421  HIS A N   1 
ATOM   3348 C CA  . HIS A 1 422 ? 42.372  8.755   8.250   1.00 17.12 ? 421  HIS A CA  1 
ATOM   3349 C C   . HIS A 1 422 ? 43.330  7.582   8.134   1.00 17.07 ? 421  HIS A C   1 
ATOM   3350 O O   . HIS A 1 422 ? 42.954  6.499   7.693   1.00 17.09 ? 421  HIS A O   1 
ATOM   3351 C CB  . HIS A 1 422 ? 42.372  9.546   6.940   1.00 17.18 ? 421  HIS A CB  1 
ATOM   3352 C CG  . HIS A 1 422 ? 41.493  8.944   5.888   1.00 16.03 ? 421  HIS A CG  1 
ATOM   3353 N ND1 . HIS A 1 422 ? 40.192  8.567   6.143   1.00 17.51 ? 421  HIS A ND1 1 
ATOM   3354 C CD2 . HIS A 1 422 ? 41.740  8.601   4.602   1.00 17.58 ? 421  HIS A CD2 1 
ATOM   3355 C CE1 . HIS A 1 422 ? 39.663  8.048   5.050   1.00 15.24 ? 421  HIS A CE1 1 
ATOM   3356 N NE2 . HIS A 1 422 ? 40.583  8.061   4.097   1.00 16.55 ? 421  HIS A NE2 1 
ATOM   3357 N N   . LYS A 1 423 ? 44.580  7.811   8.494   1.00 17.39 ? 422  LYS A N   1 
ATOM   3358 C CA  . LYS A 1 423 ? 45.558  6.725   8.524   1.00 18.48 ? 422  LYS A CA  1 
ATOM   3359 C C   . LYS A 1 423 ? 45.096  5.602   9.463   1.00 18.18 ? 422  LYS A C   1 
ATOM   3360 O O   . LYS A 1 423 ? 45.125  4.418   9.094   1.00 18.81 ? 422  LYS A O   1 
ATOM   3361 C CB  . LYS A 1 423 ? 46.936  7.267   8.908   1.00 18.98 ? 422  LYS A CB  1 
ATOM   3362 C CG  . LYS A 1 423 ? 48.004  6.186   9.050   1.00 21.68 ? 422  LYS A CG  1 
ATOM   3363 C CD  . LYS A 1 423 ? 49.326  6.783   9.493   1.00 26.95 ? 422  LYS A CD  1 
ATOM   3364 C CE  . LYS A 1 423 ? 49.386  6.960   10.995  1.00 30.26 ? 422  LYS A CE  1 
ATOM   3365 N NZ  . LYS A 1 423 ? 50.472  7.912   11.360  1.00 33.74 ? 422  LYS A NZ  1 
ATOM   3366 N N   . ILE A 1 424 ? 44.648  5.978   10.666  1.00 17.88 ? 423  ILE A N   1 
ATOM   3367 C CA  . ILE A 1 424 ? 44.119  5.021   11.640  1.00 17.77 ? 423  ILE A CA  1 
ATOM   3368 C C   . ILE A 1 424 ? 42.847  4.332   11.096  1.00 17.05 ? 423  ILE A C   1 
ATOM   3369 O O   . ILE A 1 424 ? 42.708  3.098   11.185  1.00 16.95 ? 423  ILE A O   1 
ATOM   3370 C CB  . ILE A 1 424 ? 43.878  5.721   13.006  1.00 17.57 ? 423  ILE A CB  1 
ATOM   3371 C CG1 . ILE A 1 424 ? 45.204  6.310   13.547  1.00 19.65 ? 423  ILE A CG1 1 
ATOM   3372 C CG2 . ILE A 1 424 ? 43.224  4.761   13.997  1.00 17.75 ? 423  ILE A CG2 1 
ATOM   3373 C CD1 . ILE A 1 424 ? 45.063  7.157   14.826  1.00 20.44 ? 423  ILE A CD1 1 
ATOM   3374 N N   . LEU A 1 425 ? 41.925  5.124   10.538  1.00 16.63 ? 424  LEU A N   1 
ATOM   3375 C CA  . LEU A 1 425 ? 40.709  4.592   9.901   1.00 16.75 ? 424  LEU A CA  1 
ATOM   3376 C C   . LEU A 1 425 ? 41.013  3.560   8.821   1.00 16.78 ? 424  LEU A C   1 
ATOM   3377 O O   . LEU A 1 425 ? 40.461  2.451   8.838   1.00 17.31 ? 424  LEU A O   1 
ATOM   3378 C CB  . LEU A 1 425 ? 39.859  5.729   9.307   1.00 16.21 ? 424  LEU A CB  1 
ATOM   3379 C CG  . LEU A 1 425 ? 38.451  5.382   8.791   1.00 15.36 ? 424  LEU A CG  1 
ATOM   3380 C CD1 . LEU A 1 425 ? 37.527  5.010   9.963   1.00 14.89 ? 424  LEU A CD1 1 
ATOM   3381 C CD2 . LEU A 1 425 ? 37.876  6.564   7.994   1.00 15.60 ? 424  LEU A CD2 1 
ATOM   3382 N N   . LEU A 1 426 ? 41.916  3.912   7.910   1.00 16.33 ? 425  LEU A N   1 
ATOM   3383 C CA  . LEU A 1 426 ? 42.346  2.981   6.859   1.00 16.06 ? 425  LEU A CA  1 
ATOM   3384 C C   . LEU A 1 426 ? 42.943  1.693   7.452   1.00 16.20 ? 425  LEU A C   1 
ATOM   3385 O O   . LEU A 1 426 ? 42.624  0.570   6.996   1.00 16.48 ? 425  LEU A O   1 
ATOM   3386 C CB  . LEU A 1 426 ? 43.368  3.648   5.932   1.00 16.08 ? 425  LEU A CB  1 
ATOM   3387 C CG  . LEU A 1 426 ? 42.744  4.627   4.936   1.00 15.33 ? 425  LEU A CG  1 
ATOM   3388 C CD1 . LEU A 1 426 ? 43.775  5.659   4.495   1.00 17.99 ? 425  LEU A CD1 1 
ATOM   3389 C CD2 . LEU A 1 426 ? 42.178  3.892   3.743   1.00 15.93 ? 425  LEU A CD2 1 
ATOM   3390 N N   . ALA A 1 427 ? 43.789  1.854   8.466   1.00 15.88 ? 426  ALA A N   1 
ATOM   3391 C CA  . ALA A 1 427 ? 44.443  0.703   9.105   1.00 16.49 ? 426  ALA A CA  1 
ATOM   3392 C C   . ALA A 1 427 ? 43.423  -0.268  9.664   1.00 16.59 ? 426  ALA A C   1 
ATOM   3393 O O   . ALA A 1 427 ? 43.570  -1.487  9.540   1.00 16.44 ? 426  ALA A O   1 
ATOM   3394 C CB  . ALA A 1 427 ? 45.386  1.159   10.200  1.00 16.12 ? 426  ALA A CB  1 
ATOM   3395 N N   . ASN A 1 428 ? 42.390  0.269   10.301  1.00 17.25 ? 427  ASN A N   1 
ATOM   3396 C CA  . ASN A 1 428 ? 41.300  -0.558  10.810  1.00 16.96 ? 427  ASN A CA  1 
ATOM   3397 C C   . ASN A 1 428 ? 40.473  -1.228  9.717   1.00 16.91 ? 427  ASN A C   1 
ATOM   3398 O O   . ASN A 1 428 ? 40.158  -2.412  9.818   1.00 17.30 ? 427  ASN A O   1 
ATOM   3399 C CB  . ASN A 1 428 ? 40.423  0.275   11.742  1.00 17.47 ? 427  ASN A CB  1 
ATOM   3400 C CG  . ASN A 1 428 ? 41.044  0.427   13.095  1.00 18.97 ? 427  ASN A CG  1 
ATOM   3401 O OD1 . ASN A 1 428 ? 40.869  -0.424  13.968  1.00 20.63 ? 427  ASN A OD1 1 
ATOM   3402 N ND2 . ASN A 1 428 ? 41.804  1.496   13.278  1.00 20.23 ? 427  ASN A ND2 1 
ATOM   3403 N N   . PHE A 1 429 ? 40.143  -0.473  8.664   1.00 16.73 ? 428  PHE A N   1 
ATOM   3404 C CA  . PHE A 1 429 ? 39.431  -1.005  7.499   1.00 17.30 ? 428  PHE A CA  1 
ATOM   3405 C C   . PHE A 1 429 ? 40.196  -2.224  6.954   1.00 17.29 ? 428  PHE A C   1 
ATOM   3406 O O   . PHE A 1 429 ? 39.618  -3.276  6.712   1.00 17.36 ? 428  PHE A O   1 
ATOM   3407 C CB  . PHE A 1 429 ? 39.312  0.085   6.438   1.00 17.18 ? 428  PHE A CB  1 
ATOM   3408 C CG  . PHE A 1 429 ? 38.872  -0.397  5.072   1.00 17.46 ? 428  PHE A CG  1 
ATOM   3409 C CD1 . PHE A 1 429 ? 37.521  -0.388  4.725   1.00 16.90 ? 428  PHE A CD1 1 
ATOM   3410 C CD2 . PHE A 1 429 ? 39.810  -0.782  4.115   1.00 16.44 ? 428  PHE A CD2 1 
ATOM   3411 C CE1 . PHE A 1 429 ? 37.091  -0.799  3.454   1.00 17.15 ? 428  PHE A CE1 1 
ATOM   3412 C CE2 . PHE A 1 429 ? 39.399  -1.188  2.828   1.00 18.31 ? 428  PHE A CE2 1 
ATOM   3413 C CZ  . PHE A 1 429 ? 38.025  -1.188  2.501   1.00 18.50 ? 428  PHE A CZ  1 
ATOM   3414 N N   . LEU A 1 430 ? 41.503  -2.054  6.790   1.00 17.31 ? 429  LEU A N   1 
ATOM   3415 C CA  . LEU A 1 430 ? 42.358  -3.112  6.252   1.00 17.71 ? 429  LEU A CA  1 
ATOM   3416 C C   . LEU A 1 430 ? 42.521  -4.279  7.212   1.00 17.84 ? 429  LEU A C   1 
ATOM   3417 O O   . LEU A 1 430 ? 42.437  -5.443  6.798   1.00 17.69 ? 429  LEU A O   1 
ATOM   3418 C CB  . LEU A 1 430 ? 43.723  -2.558  5.867   1.00 17.86 ? 429  LEU A CB  1 
ATOM   3419 C CG  . LEU A 1 430 ? 43.742  -1.538  4.728   1.00 18.67 ? 429  LEU A CG  1 
ATOM   3420 C CD1 . LEU A 1 430 ? 45.030  -0.696  4.791   1.00 18.78 ? 429  LEU A CD1 1 
ATOM   3421 C CD2 . LEU A 1 430 ? 43.575  -2.216  3.375   1.00 16.59 ? 429  LEU A CD2 1 
ATOM   3422 N N   . ALA A 1 431 ? 42.767  -3.974  8.486   1.00 18.12 ? 430  ALA A N   1 
ATOM   3423 C CA  . ALA A 1 431 ? 43.038  -5.016  9.475   1.00 17.77 ? 430  ALA A CA  1 
ATOM   3424 C C   . ALA A 1 431 ? 41.846  -5.904  9.755   1.00 17.29 ? 430  ALA A C   1 
ATOM   3425 O O   . ALA A 1 431 ? 41.999  -7.105  10.000  1.00 17.89 ? 430  ALA A O   1 
ATOM   3426 C CB  . ALA A 1 431 ? 43.525  -4.394  10.772  1.00 18.02 ? 430  ALA A CB  1 
ATOM   3427 N N   . GLN A 1 432 ? 40.648  -5.329  9.739   1.00 16.86 ? 431  GLN A N   1 
ATOM   3428 C CA  . GLN A 1 432 ? 39.472  -6.124  10.090  1.00 16.46 ? 431  GLN A CA  1 
ATOM   3429 C C   . GLN A 1 432 ? 39.177  -7.238  9.079   1.00 15.88 ? 431  GLN A C   1 
ATOM   3430 O O   . GLN A 1 432 ? 38.857  -8.372  9.473   1.00 15.70 ? 431  GLN A O   1 
ATOM   3431 C CB  . GLN A 1 432 ? 38.267  -5.210  10.311  1.00 16.64 ? 431  GLN A CB  1 
ATOM   3432 C CG  . GLN A 1 432 ? 38.392  -4.416  11.605  1.00 16.53 ? 431  GLN A CG  1 
ATOM   3433 C CD  . GLN A 1 432 ? 38.144  -5.277  12.847  1.00 16.11 ? 431  GLN A CD  1 
ATOM   3434 O OE1 . GLN A 1 432 ? 37.505  -6.325  12.763  1.00 20.45 ? 431  GLN A OE1 1 
ATOM   3435 N NE2 . GLN A 1 432 ? 38.688  -4.852  13.979  1.00 18.04 ? 431  GLN A NE2 1 
ATOM   3436 N N   . THR A 1 433 ? 39.313  -6.940  7.790   1.00 15.72 ? 432  THR A N   1 
ATOM   3437 C CA  . THR A 1 433 ? 39.057  -7.969  6.786   1.00 16.01 ? 432  THR A CA  1 
ATOM   3438 C C   . THR A 1 433 ? 40.164  -9.004  6.814   1.00 16.03 ? 432  THR A C   1 
ATOM   3439 O O   . THR A 1 433 ? 39.881  -10.192 6.624   1.00 15.76 ? 432  THR A O   1 
ATOM   3440 C CB  . THR A 1 433 ? 38.894  -7.415  5.330   1.00 16.32 ? 432  THR A CB  1 
ATOM   3441 O OG1 . THR A 1 433 ? 40.088  -6.738  4.915   1.00 15.53 ? 432  THR A OG1 1 
ATOM   3442 C CG2 . THR A 1 433 ? 37.754  -6.386  5.200   1.00 15.03 ? 432  THR A CG2 1 
ATOM   3443 N N   . GLU A 1 434 ? 41.408  -8.548  7.029   1.00 16.63 ? 433  GLU A N   1 
ATOM   3444 C CA  . GLU A 1 434 ? 42.564  -9.444  7.177   1.00 16.74 ? 433  GLU A CA  1 
ATOM   3445 C C   . GLU A 1 434 ? 42.325  -10.403 8.331   1.00 17.27 ? 433  GLU A C   1 
ATOM   3446 O O   . GLU A 1 434 ? 42.494  -11.627 8.190   1.00 17.83 ? 433  GLU A O   1 
ATOM   3447 C CB  . GLU A 1 434 ? 43.836  -8.644  7.450   1.00 17.05 ? 433  GLU A CB  1 
ATOM   3448 C CG  . GLU A 1 434 ? 45.105  -9.490  7.411   1.00 18.15 ? 433  GLU A CG  1 
ATOM   3449 C CD  . GLU A 1 434 ? 46.342  -8.708  7.828   1.00 21.72 ? 433  GLU A CD  1 
ATOM   3450 O OE1 . GLU A 1 434 ? 46.190  -7.623  8.423   1.00 21.35 ? 433  GLU A OE1 1 
ATOM   3451 O OE2 . GLU A 1 434 ? 47.459  -9.171  7.552   1.00 22.64 ? 433  GLU A OE2 1 
ATOM   3452 N N   . ALA A 1 435 ? 41.918  -9.849  9.468   1.00 17.27 ? 434  ALA A N   1 
ATOM   3453 C CA  . ALA A 1 435 ? 41.617  -10.644 10.667  1.00 17.49 ? 434  ALA A CA  1 
ATOM   3454 C C   . ALA A 1 435 ? 40.495  -11.662 10.435  1.00 18.43 ? 434  ALA A C   1 
ATOM   3455 O O   . ALA A 1 435 ? 40.594  -12.824 10.865  1.00 17.56 ? 434  ALA A O   1 
ATOM   3456 C CB  . ALA A 1 435 ? 41.282  -9.729  11.862  1.00 17.75 ? 434  ALA A CB  1 
ATOM   3457 N N   . LEU A 1 436 ? 39.417  -11.212 9.797   1.00 18.30 ? 435  LEU A N   1 
ATOM   3458 C CA  . LEU A 1 436 ? 38.284  -12.088 9.499   1.00 18.86 ? 435  LEU A CA  1 
ATOM   3459 C C   . LEU A 1 436 ? 38.689  -13.227 8.578   1.00 19.66 ? 435  LEU A C   1 
ATOM   3460 O O   . LEU A 1 436 ? 38.210  -14.351 8.718   1.00 19.78 ? 435  LEU A O   1 
ATOM   3461 C CB  . LEU A 1 436 ? 37.143  -11.300 8.871   1.00 18.39 ? 435  LEU A CB  1 
ATOM   3462 C CG  . LEU A 1 436 ? 36.399  -10.403 9.872   1.00 17.69 ? 435  LEU A CG  1 
ATOM   3463 C CD1 . LEU A 1 436 ? 35.579  -9.381  9.079   1.00 19.90 ? 435  LEU A CD1 1 
ATOM   3464 C CD2 . LEU A 1 436 ? 35.522  -11.239 10.777  1.00 17.08 ? 435  LEU A CD2 1 
ATOM   3465 N N   . MET A 1 437 ? 39.567  -12.917 7.628   1.00 20.17 ? 436  MET A N   1 
ATOM   3466 C CA  . MET A 1 437 ? 40.102  -13.913 6.706   1.00 21.21 ? 436  MET A CA  1 
ATOM   3467 C C   . MET A 1 437 ? 41.032  -14.914 7.435   1.00 21.10 ? 436  MET A C   1 
ATOM   3468 O O   . MET A 1 437 ? 40.855  -16.131 7.346   1.00 20.66 ? 436  MET A O   1 
ATOM   3469 C CB  . MET A 1 437 ? 40.876  -13.177 5.595   1.00 21.69 ? 436  MET A CB  1 
ATOM   3470 C CG  . MET A 1 437 ? 41.346  -14.047 4.426   1.00 24.42 ? 436  MET A CG  1 
ATOM   3471 S SD  . MET A 1 437 ? 42.863  -14.926 4.819   1.00 27.43 ? 436  MET A SD  1 
ATOM   3472 C CE  . MET A 1 437 ? 44.104  -13.739 4.308   1.00 29.02 ? 436  MET A CE  1 
ATOM   3473 N N   . LYS A 1 438 ? 42.001  -14.368 8.162   1.00 21.52 ? 437  LYS A N   1 
ATOM   3474 C CA  . LYS A 1 438 ? 43.161  -15.107 8.680   1.00 22.65 ? 437  LYS A CA  1 
ATOM   3475 C C   . LYS A 1 438 ? 42.858  -15.913 9.941   1.00 22.59 ? 437  LYS A C   1 
ATOM   3476 O O   . LYS A 1 438 ? 43.249  -17.089 10.056  1.00 22.13 ? 437  LYS A O   1 
ATOM   3477 C CB  . LYS A 1 438 ? 44.287  -14.099 8.956   1.00 23.55 ? 437  LYS A CB  1 
ATOM   3478 C CG  . LYS A 1 438 ? 45.611  -14.668 9.399   1.00 26.25 ? 437  LYS A CG  1 
ATOM   3479 C CD  . LYS A 1 438 ? 46.604  -13.529 9.605   1.00 30.06 ? 437  LYS A CD  1 
ATOM   3480 C CE  . LYS A 1 438 ? 47.702  -13.884 10.571  1.00 32.10 ? 437  LYS A CE  1 
ATOM   3481 N NZ  . LYS A 1 438 ? 49.022  -13.827 9.897   1.00 33.70 ? 437  LYS A NZ  1 
ATOM   3482 N N   . GLY A 1 439 ? 42.175  -15.269 10.893  1.00 22.52 ? 438  GLY A N   1 
ATOM   3483 C CA  . GLY A 1 439 ? 41.922  -15.838 12.206  1.00 22.80 ? 438  GLY A CA  1 
ATOM   3484 C C   . GLY A 1 439 ? 43.210  -15.975 13.005  1.00 23.15 ? 438  GLY A C   1 
ATOM   3485 O O   . GLY A 1 439 ? 44.227  -15.360 12.682  1.00 23.35 ? 438  GLY A O   1 
ATOM   3486 N N   . LYS A 1 440 ? 43.161  -16.795 14.049  1.00 23.46 ? 439  LYS A N   1 
ATOM   3487 C CA  . LYS A 1 440 ? 44.313  -17.052 14.904  1.00 23.77 ? 439  LYS A CA  1 
ATOM   3488 C C   . LYS A 1 440 ? 44.197  -18.484 15.400  1.00 24.28 ? 439  LYS A C   1 
ATOM   3489 O O   . LYS A 1 440 ? 43.295  -18.799 16.172  1.00 24.39 ? 439  LYS A O   1 
ATOM   3490 C CB  . LYS A 1 440 ? 44.372  -16.065 16.075  1.00 23.75 ? 439  LYS A CB  1 
ATOM   3491 C CG  . LYS A 1 440 ? 45.657  -16.166 16.924  1.00 23.33 ? 439  LYS A CG  1 
ATOM   3492 C CD  . LYS A 1 440 ? 45.605  -15.301 18.184  1.00 25.34 ? 439  LYS A CD  1 
ATOM   3493 C CE  . LYS A 1 440 ? 45.511  -13.819 17.848  1.00 24.63 ? 439  LYS A CE  1 
ATOM   3494 N NZ  . LYS A 1 440 ? 45.586  -12.996 19.076  1.00 26.57 ? 439  LYS A NZ  1 
ATOM   3495 N N   . LEU A 1 441 ? 45.119  -19.336 14.948  1.00 24.93 ? 440  LEU A N   1 
ATOM   3496 C CA  . LEU A 1 441 ? 45.127  -20.755 15.299  1.00 25.40 ? 440  LEU A CA  1 
ATOM   3497 C C   . LEU A 1 441 ? 45.453  -20.991 16.781  1.00 25.75 ? 440  LEU A C   1 
ATOM   3498 O O   . LEU A 1 441 ? 46.099  -20.168 17.417  1.00 25.33 ? 440  LEU A O   1 
ATOM   3499 C CB  . LEU A 1 441 ? 46.129  -21.520 14.406  1.00 25.20 ? 440  LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 441 ? 45.795  -21.668 12.915  1.00 26.54 ? 440  LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 441 ? 47.071  -21.965 12.140  1.00 27.61 ? 440  LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 441 ? 44.723  -22.742 12.652  1.00 27.81 ? 440  LEU A CD2 1 
ATOM   3503 N N   . PRO A 1 442 ? 44.987  -22.110 17.335  1.00 26.72 ? 441  PRO A N   1 
ATOM   3504 C CA  . PRO A 1 442 ? 45.315  -22.477 18.721  1.00 27.68 ? 441  PRO A CA  1 
ATOM   3505 C C   . PRO A 1 442 ? 46.807  -22.319 19.032  1.00 28.35 ? 441  PRO A C   1 
ATOM   3506 O O   . PRO A 1 442 ? 47.166  -21.724 20.048  1.00 28.70 ? 441  PRO A O   1 
ATOM   3507 C CB  . PRO A 1 442 ? 44.873  -23.941 18.797  1.00 27.54 ? 441  PRO A CB  1 
ATOM   3508 C CG  . PRO A 1 442 ? 43.702  -23.997 17.862  1.00 27.05 ? 441  PRO A CG  1 
ATOM   3509 C CD  . PRO A 1 442 ? 44.077  -23.085 16.712  1.00 26.58 ? 441  PRO A CD  1 
ATOM   3510 N N   . GLU A 1 443 ? 47.666  -22.793 18.136  1.00 29.78 ? 442  GLU A N   1 
ATOM   3511 C CA  . GLU A 1 443 ? 49.111  -22.761 18.375  1.00 30.93 ? 442  GLU A CA  1 
ATOM   3512 C C   . GLU A 1 443 ? 49.690  -21.342 18.379  1.00 30.85 ? 442  GLU A C   1 
ATOM   3513 O O   . GLU A 1 443 ? 50.615  -21.042 19.135  1.00 30.88 ? 442  GLU A O   1 
ATOM   3514 C CB  . GLU A 1 443 ? 49.826  -23.718 17.409  1.00 31.62 ? 442  GLU A CB  1 
ATOM   3515 C CG  . GLU A 1 443 ? 50.828  -23.105 16.446  1.00 34.76 ? 442  GLU A CG  1 
ATOM   3516 C CD  . GLU A 1 443 ? 51.950  -24.072 16.123  1.00 39.76 ? 442  GLU A CD  1 
ATOM   3517 O OE1 . GLU A 1 443 ? 52.991  -24.032 16.823  1.00 42.47 ? 442  GLU A OE1 1 
ATOM   3518 O OE2 . GLU A 1 443 ? 51.779  -24.888 15.184  1.00 42.62 ? 442  GLU A OE2 1 
ATOM   3519 N N   . GLU A 1 444 ? 49.115  -20.460 17.560  1.00 30.78 ? 443  GLU A N   1 
ATOM   3520 C CA  . GLU A 1 444 ? 49.472  -19.038 17.576  1.00 30.60 ? 443  GLU A CA  1 
ATOM   3521 C C   . GLU A 1 444 ? 49.037  -18.322 18.875  1.00 30.28 ? 443  GLU A C   1 
ATOM   3522 O O   . GLU A 1 444 ? 49.799  -17.526 19.437  1.00 29.95 ? 443  GLU A O   1 
ATOM   3523 C CB  . GLU A 1 444 ? 48.916  -18.330 16.330  1.00 30.77 ? 443  GLU A CB  1 
ATOM   3524 C CG  . GLU A 1 444 ? 49.416  -18.920 15.016  1.00 31.09 ? 443  GLU A CG  1 
ATOM   3525 C CD  . GLU A 1 444 ? 48.693  -18.413 13.770  1.00 33.18 ? 443  GLU A CD  1 
ATOM   3526 O OE1 . GLU A 1 444 ? 47.484  -18.091 13.818  1.00 30.96 ? 443  GLU A OE1 1 
ATOM   3527 O OE2 . GLU A 1 444 ? 49.346  -18.367 12.705  1.00 33.03 ? 443  GLU A OE2 1 
ATOM   3528 N N   . ALA A 1 445 ? 47.820  -18.595 19.348  1.00 30.46 ? 444  ALA A N   1 
ATOM   3529 C CA  . ALA A 1 445 ? 47.343  -17.993 20.597  1.00 30.39 ? 444  ALA A CA  1 
ATOM   3530 C C   . ALA A 1 445 ? 48.117  -18.506 21.817  1.00 30.70 ? 444  ALA A C   1 
ATOM   3531 O O   . ALA A 1 445 ? 48.336  -17.761 22.782  1.00 30.53 ? 444  ALA A O   1 
ATOM   3532 C CB  . ALA A 1 445 ? 45.842  -18.211 20.781  1.00 30.89 ? 444  ALA A CB  1 
ATOM   3533 N N   . ARG A 1 446 ? 48.513  -19.778 21.753  1.00 31.07 ? 445  ARG A N   1 
ATOM   3534 C CA  . ARG A 1 446 ? 49.308  -20.446 22.791  1.00 31.71 ? 445  ARG A CA  1 
ATOM   3535 C C   . ARG A 1 446 ? 50.634  -19.713 22.986  1.00 31.76 ? 445  ARG A C   1 
ATOM   3536 O O   . ARG A 1 446 ? 50.979  -19.339 24.109  1.00 31.53 ? 445  ARG A O   1 
ATOM   3537 C CB  . ARG A 1 446 ? 49.514  -21.921 22.415  1.00 31.74 ? 445  ARG A CB  1 
ATOM   3538 C CG  . ARG A 1 446 ? 50.245  -22.779 23.434  1.00 33.40 ? 445  ARG A CG  1 
ATOM   3539 C CD  . ARG A 1 446 ? 50.444  -24.229 22.990  1.00 35.40 ? 445  ARG A CD  1 
ATOM   3540 N NE  . ARG A 1 446 ? 49.240  -25.046 23.163  1.00 37.07 ? 445  ARG A NE  1 
ATOM   3541 C CZ  . ARG A 1 446 ? 48.755  -25.441 24.344  1.00 39.59 ? 445  ARG A CZ  1 
ATOM   3542 N NH1 . ARG A 1 446 ? 49.361  -25.092 25.478  1.00 39.75 ? 445  ARG A NH1 1 
ATOM   3543 N NH2 . ARG A 1 446 ? 47.654  -26.182 24.397  1.00 39.61 ? 445  ARG A NH2 1 
ATOM   3544 N N   . LYS A 1 447 ? 51.336  -19.457 21.883  1.00 31.95 ? 446  LYS A N   1 
ATOM   3545 C CA  . LYS A 1 447 ? 52.615  -18.753 21.913  1.00 32.86 ? 446  LYS A CA  1 
ATOM   3546 C C   . LYS A 1 447 ? 52.490  -17.334 22.466  1.00 33.01 ? 446  LYS A C   1 
ATOM   3547 O O   . LYS A 1 447 ? 53.388  -16.856 23.161  1.00 33.04 ? 446  LYS A O   1 
ATOM   3548 C CB  . LYS A 1 447 ? 53.273  -18.736 20.525  1.00 32.73 ? 446  LYS A CB  1 
ATOM   3549 C CG  . LYS A 1 447 ? 53.681  -20.119 20.013  1.00 34.09 ? 446  LYS A CG  1 
ATOM   3550 C CD  . LYS A 1 447 ? 55.188  -20.322 20.090  1.00 35.75 ? 446  LYS A CD  1 
ATOM   3551 C CE  . LYS A 1 447 ? 55.556  -21.807 20.085  1.00 37.21 ? 446  LYS A CE  1 
ATOM   3552 N NZ  . LYS A 1 447 ? 56.637  -22.128 21.081  1.00 36.98 ? 446  LYS A NZ  1 
ATOM   3553 N N   . GLU A 1 448 ? 51.375  -16.669 22.164  1.00 33.19 ? 447  GLU A N   1 
ATOM   3554 C CA  . GLU A 1 448 ? 51.134  -15.316 22.655  1.00 33.24 ? 447  GLU A CA  1 
ATOM   3555 C C   . GLU A 1 448 ? 50.955  -15.310 24.165  1.00 33.41 ? 447  GLU A C   1 
ATOM   3556 O O   . GLU A 1 448 ? 51.452  -14.420 24.856  1.00 33.12 ? 447  GLU A O   1 
ATOM   3557 C CB  . GLU A 1 448 ? 49.904  -14.705 21.985  1.00 33.49 ? 447  GLU A CB  1 
ATOM   3558 C CG  . GLU A 1 448 ? 50.141  -14.223 20.560  1.00 33.99 ? 447  GLU A CG  1 
ATOM   3559 C CD  . GLU A 1 448 ? 48.887  -13.625 19.941  1.00 34.44 ? 447  GLU A CD  1 
ATOM   3560 O OE1 . GLU A 1 448 ? 47.820  -13.649 20.599  1.00 33.60 ? 447  GLU A OE1 1 
ATOM   3561 O OE2 . GLU A 1 448 ? 48.973  -13.131 18.799  1.00 35.55 ? 447  GLU A OE2 1 
ATOM   3562 N N   . LEU A 1 449 ? 50.242  -16.314 24.660  1.00 33.72 ? 448  LEU A N   1 
ATOM   3563 C CA  . LEU A 1 449 ? 49.997  -16.461 26.084  1.00 34.69 ? 448  LEU A CA  1 
ATOM   3564 C C   . LEU A 1 449 ? 51.301  -16.798 26.806  1.00 35.47 ? 448  LEU A C   1 
ATOM   3565 O O   . LEU A 1 449 ? 51.561  -16.274 27.888  1.00 36.02 ? 448  LEU A O   1 
ATOM   3566 C CB  . LEU A 1 449 ? 48.913  -17.513 26.336  1.00 33.77 ? 448  LEU A CB  1 
ATOM   3567 C CG  . LEU A 1 449 ? 47.497  -17.071 25.943  1.00 33.28 ? 448  LEU A CG  1 
ATOM   3568 C CD1 . LEU A 1 449 ? 46.563  -18.259 25.809  1.00 32.51 ? 448  LEU A CD1 1 
ATOM   3569 C CD2 . LEU A 1 449 ? 46.954  -16.070 26.940  1.00 32.55 ? 448  LEU A CD2 1 
ATOM   3570 N N   . GLN A 1 450 ? 52.117  -17.657 26.193  1.00 36.42 ? 449  GLN A N   1 
ATOM   3571 C CA  . GLN A 1 450 ? 53.443  -18.001 26.721  1.00 37.18 ? 449  GLN A CA  1 
ATOM   3572 C C   . GLN A 1 450 ? 54.299  -16.744 26.877  1.00 37.80 ? 449  GLN A C   1 
ATOM   3573 O O   . GLN A 1 450 ? 54.844  -16.479 27.961  1.00 37.83 ? 449  GLN A O   1 
ATOM   3574 C CB  . GLN A 1 450 ? 54.147  -18.996 25.791  1.00 37.42 ? 449  GLN A CB  1 
ATOM   3575 C CG  . GLN A 1 450 ? 53.701  -20.447 25.942  1.00 37.37 ? 449  GLN A CG  1 
ATOM   3576 C CD  . GLN A 1 450 ? 54.146  -21.347 24.788  1.00 39.19 ? 449  GLN A CD  1 
ATOM   3577 O OE1 . GLN A 1 450 ? 53.605  -22.446 24.615  1.00 39.34 ? 449  GLN A OE1 1 
ATOM   3578 N NE2 . GLN A 1 450 ? 55.129  -20.892 24.002  1.00 39.37 ? 449  GLN A NE2 1 
ATOM   3579 N N   . ALA A 1 451 ? 54.397  -15.968 25.796  1.00 38.08 ? 450  ALA A N   1 
ATOM   3580 C CA  . ALA A 1 451 ? 55.188  -14.741 25.782  1.00 39.15 ? 450  ALA A CA  1 
ATOM   3581 C C   . ALA A 1 451 ? 54.683  -13.716 26.796  1.00 39.88 ? 450  ALA A C   1 
ATOM   3582 O O   . ALA A 1 451 ? 55.458  -12.883 27.282  1.00 40.53 ? 450  ALA A O   1 
ATOM   3583 C CB  . ALA A 1 451 ? 55.228  -14.143 24.379  1.00 38.89 ? 450  ALA A CB  1 
ATOM   3584 N N   . ALA A 1 452 ? 53.388  -13.794 27.108  1.00 40.65 ? 451  ALA A N   1 
ATOM   3585 C CA  . ALA A 1 452 ? 52.733  -12.902 28.069  1.00 41.40 ? 451  ALA A CA  1 
ATOM   3586 C C   . ALA A 1 452 ? 53.040  -13.243 29.533  1.00 41.96 ? 451  ALA A C   1 
ATOM   3587 O O   . ALA A 1 452 ? 52.593  -12.539 30.447  1.00 42.36 ? 451  ALA A O   1 
ATOM   3588 C CB  . ALA A 1 452 ? 51.220  -12.900 27.838  1.00 41.29 ? 451  ALA A CB  1 
ATOM   3589 N N   . GLY A 1 453 ? 53.784  -14.326 29.748  1.00 42.21 ? 452  GLY A N   1 
ATOM   3590 C CA  . GLY A 1 453 ? 54.161  -14.756 31.083  1.00 42.70 ? 452  GLY A CA  1 
ATOM   3591 C C   . GLY A 1 453 ? 53.083  -15.514 31.838  1.00 42.66 ? 452  GLY A C   1 
ATOM   3592 O O   . GLY A 1 453 ? 53.147  -15.622 33.064  1.00 43.07 ? 452  GLY A O   1 
ATOM   3593 N N   . LYS A 1 454 ? 52.097  -16.032 31.106  1.00 42.63 ? 453  LYS A N   1 
ATOM   3594 C CA  . LYS A 1 454 ? 50.997  -16.801 31.681  1.00 42.39 ? 453  LYS A CA  1 
ATOM   3595 C C   . LYS A 1 454 ? 51.467  -18.170 32.148  1.00 42.67 ? 453  LYS A C   1 
ATOM   3596 O O   . LYS A 1 454 ? 52.282  -18.809 31.480  1.00 42.61 ? 453  LYS A O   1 
ATOM   3597 C CB  . LYS A 1 454 ? 49.879  -16.979 30.641  1.00 42.52 ? 453  LYS A CB  1 
ATOM   3598 C CG  . LYS A 1 454 ? 48.556  -16.275 30.960  1.00 41.62 ? 453  LYS A CG  1 
ATOM   3599 C CD  . LYS A 1 454 ? 48.664  -14.756 30.861  1.00 40.49 ? 453  LYS A CD  1 
ATOM   3600 C CE  . LYS A 1 454 ? 47.293  -14.110 30.665  1.00 39.57 ? 453  LYS A CE  1 
ATOM   3601 N NZ  . LYS A 1 454 ? 46.695  -13.641 31.958  1.00 38.68 ? 453  LYS A NZ  1 
ATOM   3602 N N   . SER A 1 455 ? 50.947  -18.613 33.294  1.00 42.79 ? 454  SER A N   1 
ATOM   3603 C CA  . SER A 1 455 ? 51.207  -19.956 33.814  1.00 42.68 ? 454  SER A CA  1 
ATOM   3604 C C   . SER A 1 455 ? 50.455  -20.998 32.989  1.00 42.62 ? 454  SER A C   1 
ATOM   3605 O O   . SER A 1 455 ? 49.388  -20.692 32.457  1.00 42.47 ? 454  SER A O   1 
ATOM   3606 C CB  . SER A 1 455 ? 50.799  -20.045 35.289  1.00 42.88 ? 454  SER A CB  1 
ATOM   3607 O OG  . SER A 1 455 ? 49.417  -20.349 35.446  1.00 43.14 ? 454  SER A OG  1 
ATOM   3608 N N   . PRO A 1 456 ? 51.002  -22.214 32.871  1.00 42.63 ? 455  PRO A N   1 
ATOM   3609 C CA  . PRO A 1 456 ? 50.303  -23.321 32.197  1.00 42.53 ? 455  PRO A CA  1 
ATOM   3610 C C   . PRO A 1 456 ? 48.851  -23.492 32.640  1.00 42.61 ? 455  PRO A C   1 
ATOM   3611 O O   . PRO A 1 456 ? 48.003  -23.910 31.835  1.00 42.92 ? 455  PRO A O   1 
ATOM   3612 C CB  . PRO A 1 456 ? 51.128  -24.556 32.596  1.00 42.48 ? 455  PRO A CB  1 
ATOM   3613 C CG  . PRO A 1 456 ? 52.087  -24.074 33.633  1.00 42.53 ? 455  PRO A CG  1 
ATOM   3614 C CD  . PRO A 1 456 ? 52.339  -22.629 33.336  1.00 42.34 ? 455  PRO A CD  1 
ATOM   3615 N N   . GLU A 1 457 ? 48.572  -23.178 33.905  1.00 42.37 ? 456  GLU A N   1 
ATOM   3616 C CA  . GLU A 1 457 ? 47.222  -23.261 34.451  1.00 41.89 ? 456  GLU A CA  1 
ATOM   3617 C C   . GLU A 1 457 ? 46.316  -22.194 33.823  1.00 40.92 ? 456  GLU A C   1 
ATOM   3618 O O   . GLU A 1 457 ? 45.250  -22.506 33.277  1.00 40.60 ? 456  GLU A O   1 
ATOM   3619 C CB  . GLU A 1 457 ? 47.274  -23.119 35.982  1.00 42.39 ? 456  GLU A CB  1 
ATOM   3620 C CG  . GLU A 1 457 ? 45.935  -22.860 36.664  1.00 44.07 ? 456  GLU A CG  1 
ATOM   3621 C CD  . GLU A 1 457 ? 45.071  -24.106 36.770  1.00 46.74 ? 456  GLU A CD  1 
ATOM   3622 O OE1 . GLU A 1 457 ? 45.569  -25.216 36.476  1.00 47.96 ? 456  GLU A OE1 1 
ATOM   3623 O OE2 . GLU A 1 457 ? 43.884  -23.973 37.151  1.00 47.99 ? 456  GLU A OE2 1 
ATOM   3624 N N   . ASP A 1 458 ? 46.758  -20.942 33.914  1.00 40.05 ? 457  ASP A N   1 
ATOM   3625 C CA  . ASP A 1 458 ? 46.031  -19.803 33.370  1.00 39.09 ? 457  ASP A CA  1 
ATOM   3626 C C   . ASP A 1 458 ? 45.943  -19.899 31.845  1.00 38.28 ? 457  ASP A C   1 
ATOM   3627 O O   . ASP A 1 458 ? 44.882  -19.646 31.267  1.00 37.92 ? 457  ASP A O   1 
ATOM   3628 C CB  . ASP A 1 458 ? 46.702  -18.491 33.796  1.00 39.40 ? 457  ASP A CB  1 
ATOM   3629 C CG  . ASP A 1 458 ? 46.419  -18.123 35.257  1.00 40.07 ? 457  ASP A CG  1 
ATOM   3630 O OD1 . ASP A 1 458 ? 46.613  -16.940 35.612  1.00 41.65 ? 457  ASP A OD1 1 
ATOM   3631 O OD2 . ASP A 1 458 ? 46.006  -18.931 36.120  1.00 40.59 ? 457  ASP A OD2 1 
ATOM   3632 N N   . LEU A 1 459 ? 47.052  -20.298 31.213  1.00 37.00 ? 458  LEU A N   1 
ATOM   3633 C CA  . LEU A 1 459 ? 47.133  -20.435 29.760  1.00 36.17 ? 458  LEU A CA  1 
ATOM   3634 C C   . LEU A 1 459 ? 46.056  -21.354 29.205  1.00 35.85 ? 458  LEU A C   1 
ATOM   3635 O O   . LEU A 1 459 ? 45.338  -20.976 28.286  1.00 35.32 ? 458  LEU A O   1 
ATOM   3636 C CB  . LEU A 1 459 ? 48.527  -20.916 29.308  1.00 35.82 ? 458  LEU A CB  1 
ATOM   3637 C CG  . LEU A 1 459 ? 48.804  -20.939 27.791  1.00 35.01 ? 458  LEU A CG  1 
ATOM   3638 C CD1 . LEU A 1 459 ? 50.286  -20.762 27.503  1.00 34.27 ? 458  LEU A CD1 1 
ATOM   3639 C CD2 . LEU A 1 459 ? 48.281  -22.203 27.097  1.00 33.74 ? 458  LEU A CD2 1 
ATOM   3640 N N   . GLU A 1 460 ? 45.949  -22.558 29.759  1.00 35.79 ? 459  GLU A N   1 
ATOM   3641 C CA  . GLU A 1 460 ? 45.048  -23.576 29.212  1.00 35.81 ? 459  GLU A CA  1 
ATOM   3642 C C   . GLU A 1 460 ? 43.557  -23.261 29.383  1.00 35.39 ? 459  GLU A C   1 
ATOM   3643 O O   . GLU A 1 460 ? 42.740  -23.663 28.550  1.00 35.63 ? 459  GLU A O   1 
ATOM   3644 C CB  . GLU A 1 460 ? 45.370  -24.970 29.775  1.00 36.25 ? 459  GLU A CB  1 
ATOM   3645 C CG  . GLU A 1 460 ? 46.730  -25.532 29.368  1.00 37.64 ? 459  GLU A CG  1 
ATOM   3646 C CD  . GLU A 1 460 ? 46.795  -26.024 27.930  1.00 39.67 ? 459  GLU A CD  1 
ATOM   3647 O OE1 . GLU A 1 460 ? 47.919  -26.124 27.396  1.00 41.63 ? 459  GLU A OE1 1 
ATOM   3648 O OE2 . GLU A 1 460 ? 45.741  -26.320 27.327  1.00 41.29 ? 459  GLU A OE2 1 
ATOM   3649 N N   . LYS A 1 461 ? 43.197  -22.561 30.456  1.00 34.94 ? 460  LYS A N   1 
ATOM   3650 C CA  . LYS A 1 461 ? 41.804  -22.157 30.640  1.00 34.74 ? 460  LYS A CA  1 
ATOM   3651 C C   . LYS A 1 461 ? 41.402  -21.015 29.679  1.00 33.80 ? 460  LYS A C   1 
ATOM   3652 O O   . LYS A 1 461 ? 40.298  -21.019 29.141  1.00 33.77 ? 460  LYS A O   1 
ATOM   3653 C CB  . LYS A 1 461 ? 41.500  -21.850 32.120  1.00 35.21 ? 460  LYS A CB  1 
ATOM   3654 C CG  . LYS A 1 461 ? 41.421  -20.386 32.496  1.00 36.91 ? 460  LYS A CG  1 
ATOM   3655 C CD  . LYS A 1 461 ? 39.969  -19.910 32.575  1.00 38.85 ? 460  LYS A CD  1 
ATOM   3656 C CE  . LYS A 1 461 ? 39.780  -18.543 31.910  1.00 38.28 ? 460  LYS A CE  1 
ATOM   3657 N NZ  . LYS A 1 461 ? 40.657  -17.484 32.514  1.00 39.53 ? 460  LYS A NZ  1 
ATOM   3658 N N   . LEU A 1 462 ? 42.320  -20.074 29.459  1.00 32.90 ? 461  LEU A N   1 
ATOM   3659 C CA  . LEU A 1 462 ? 42.131  -18.937 28.554  1.00 31.60 ? 461  LEU A CA  1 
ATOM   3660 C C   . LEU A 1 462 ? 42.259  -19.291 27.060  1.00 30.87 ? 461  LEU A C   1 
ATOM   3661 O O   . LEU A 1 462 ? 41.649  -18.632 26.216  1.00 30.75 ? 461  LEU A O   1 
ATOM   3662 C CB  . LEU A 1 462 ? 43.147  -17.834 28.884  1.00 31.59 ? 461  LEU A CB  1 
ATOM   3663 C CG  . LEU A 1 462 ? 42.706  -16.392 29.187  1.00 32.61 ? 461  LEU A CG  1 
ATOM   3664 C CD1 . LEU A 1 462 ? 43.886  -15.422 29.113  1.00 32.85 ? 461  LEU A CD1 1 
ATOM   3665 C CD2 . LEU A 1 462 ? 41.555  -15.912 28.289  1.00 32.04 ? 461  LEU A CD2 1 
ATOM   3666 N N   . LEU A 1 463 ? 43.047  -20.318 26.737  1.00 29.84 ? 462  LEU A N   1 
ATOM   3667 C CA  . LEU A 1 463 ? 43.423  -20.607 25.338  1.00 28.87 ? 462  LEU A CA  1 
ATOM   3668 C C   . LEU A 1 463 ? 42.273  -20.618 24.296  1.00 28.07 ? 462  LEU A C   1 
ATOM   3669 O O   . LEU A 1 463 ? 42.333  -19.846 23.331  1.00 27.34 ? 462  LEU A O   1 
ATOM   3670 C CB  . LEU A 1 463 ? 44.340  -21.842 25.217  1.00 28.93 ? 462  LEU A CB  1 
ATOM   3671 C CG  . LEU A 1 463 ? 44.774  -22.300 23.814  1.00 29.81 ? 462  LEU A CG  1 
ATOM   3672 C CD1 . LEU A 1 463 ? 45.532  -21.238 23.009  1.00 30.46 ? 462  LEU A CD1 1 
ATOM   3673 C CD2 . LEU A 1 463 ? 45.616  -23.573 23.903  1.00 30.88 ? 462  LEU A CD2 1 
ATOM   3674 N N   . PRO A 1 464 ? 41.241  -21.458 24.475  1.00 27.50 ? 463  PRO A N   1 
ATOM   3675 C CA  . PRO A 1 464 ? 40.196  -21.596 23.451  1.00 26.84 ? 463  PRO A CA  1 
ATOM   3676 C C   . PRO A 1 464 ? 39.463  -20.277 23.172  1.00 25.75 ? 463  PRO A C   1 
ATOM   3677 O O   . PRO A 1 464 ? 39.074  -20.042 22.036  1.00 25.21 ? 463  PRO A O   1 
ATOM   3678 C CB  . PRO A 1 464 ? 39.230  -22.617 24.062  1.00 27.19 ? 463  PRO A CB  1 
ATOM   3679 C CG  . PRO A 1 464 ? 39.475  -22.552 25.527  1.00 27.64 ? 463  PRO A CG  1 
ATOM   3680 C CD  . PRO A 1 464 ? 40.963  -22.321 25.644  1.00 27.86 ? 463  PRO A CD  1 
ATOM   3681 N N   . HIS A 1 465 ? 39.295  -19.458 24.206  1.00 25.41 ? 464  HIS A N   1 
ATOM   3682 C CA  . HIS A 1 465 ? 38.671  -18.130 24.106  1.00 24.80 ? 464  HIS A CA  1 
ATOM   3683 C C   . HIS A 1 465 ? 39.471  -17.159 23.244  1.00 24.74 ? 464  HIS A C   1 
ATOM   3684 O O   . HIS A 1 465 ? 38.914  -16.199 22.703  1.00 24.54 ? 464  HIS A O   1 
ATOM   3685 C CB  . HIS A 1 465 ? 38.503  -17.528 25.502  1.00 24.83 ? 464  HIS A CB  1 
ATOM   3686 C CG  . HIS A 1 465 ? 37.648  -18.353 26.407  1.00 25.36 ? 464  HIS A CG  1 
ATOM   3687 N ND1 . HIS A 1 465 ? 36.274  -18.256 26.418  1.00 25.49 ? 464  HIS A ND1 1 
ATOM   3688 C CD2 . HIS A 1 465 ? 37.969  -19.301 27.319  1.00 25.78 ? 464  HIS A CD2 1 
ATOM   3689 C CE1 . HIS A 1 465 ? 35.782  -19.115 27.296  1.00 26.00 ? 464  HIS A CE1 1 
ATOM   3690 N NE2 . HIS A 1 465 ? 36.790  -19.759 27.858  1.00 25.84 ? 464  HIS A NE2 1 
ATOM   3691 N N   . LYS A 1 466 ? 40.775  -17.401 23.125  1.00 24.21 ? 465  LYS A N   1 
ATOM   3692 C CA  . LYS A 1 466 ? 41.670  -16.546 22.334  1.00 24.79 ? 465  LYS A CA  1 
ATOM   3693 C C   . LYS A 1 466 ? 41.787  -16.959 20.857  1.00 23.85 ? 465  LYS A C   1 
ATOM   3694 O O   . LYS A 1 466 ? 42.423  -16.263 20.066  1.00 23.50 ? 465  LYS A O   1 
ATOM   3695 C CB  . LYS A 1 466 ? 43.067  -16.495 22.970  1.00 25.18 ? 465  LYS A CB  1 
ATOM   3696 C CG  . LYS A 1 466 ? 43.104  -16.075 24.437  1.00 28.36 ? 465  LYS A CG  1 
ATOM   3697 C CD  . LYS A 1 466 ? 42.998  -14.577 24.611  1.00 32.12 ? 465  LYS A CD  1 
ATOM   3698 C CE  . LYS A 1 466 ? 44.341  -13.928 24.836  1.00 34.07 ? 465  LYS A CE  1 
ATOM   3699 N NZ  . LYS A 1 466 ? 44.432  -13.294 26.186  1.00 36.76 ? 465  LYS A NZ  1 
ATOM   3700 N N   . VAL A 1 467 ? 41.190  -18.097 20.500  1.00 23.92 ? 466  VAL A N   1 
ATOM   3701 C CA  . VAL A 1 467 ? 41.245  -18.627 19.137  1.00 23.48 ? 466  VAL A CA  1 
ATOM   3702 C C   . VAL A 1 467 ? 40.210  -17.951 18.206  1.00 23.10 ? 466  VAL A C   1 
ATOM   3703 O O   . VAL A 1 467 ? 39.027  -17.792 18.567  1.00 23.46 ? 466  VAL A O   1 
ATOM   3704 C CB  . VAL A 1 467 ? 41.095  -20.182 19.141  1.00 23.51 ? 466  VAL A CB  1 
ATOM   3705 C CG1 . VAL A 1 467 ? 41.051  -20.748 17.730  1.00 24.03 ? 466  VAL A CG1 1 
ATOM   3706 C CG2 . VAL A 1 467 ? 42.249  -20.810 19.928  1.00 23.77 ? 466  VAL A CG2 1 
ATOM   3707 N N   . PHE A 1 468 ? 40.676  -17.530 17.032  1.00 22.27 ? 467  PHE A N   1 
ATOM   3708 C CA  . PHE A 1 468 ? 39.815  -16.989 15.976  1.00 21.89 ? 467  PHE A CA  1 
ATOM   3709 C C   . PHE A 1 468 ? 39.818  -17.983 14.824  1.00 21.87 ? 467  PHE A C   1 
ATOM   3710 O O   . PHE A 1 468 ? 40.852  -18.219 14.204  1.00 21.49 ? 467  PHE A O   1 
ATOM   3711 C CB  . PHE A 1 468 ? 40.325  -15.626 15.484  1.00 21.55 ? 467  PHE A CB  1 
ATOM   3712 C CG  . PHE A 1 468 ? 40.186  -14.504 16.496  1.00 21.38 ? 467  PHE A CG  1 
ATOM   3713 C CD1 . PHE A 1 468 ? 40.954  -14.489 17.671  1.00 20.01 ? 467  PHE A CD1 1 
ATOM   3714 C CD2 . PHE A 1 468 ? 39.289  -13.452 16.263  1.00 20.06 ? 467  PHE A CD2 1 
ATOM   3715 C CE1 . PHE A 1 468 ? 40.830  -13.448 18.601  1.00 19.76 ? 467  PHE A CE1 1 
ATOM   3716 C CE2 . PHE A 1 468 ? 39.150  -12.406 17.184  1.00 19.00 ? 467  PHE A CE2 1 
ATOM   3717 C CZ  . PHE A 1 468 ? 39.927  -12.407 18.368  1.00 18.10 ? 467  PHE A CZ  1 
ATOM   3718 N N   . GLU A 1 469 ? 38.669  -18.588 14.551  1.00 21.32 ? 468  GLU A N   1 
ATOM   3719 C CA  . GLU A 1 469 ? 38.591  -19.569 13.473  1.00 22.33 ? 468  GLU A CA  1 
ATOM   3720 C C   . GLU A 1 469 ? 38.791  -18.976 12.073  1.00 22.03 ? 468  GLU A C   1 
ATOM   3721 O O   . GLU A 1 469 ? 39.220  -19.678 11.172  1.00 22.17 ? 468  GLU A O   1 
ATOM   3722 C CB  . GLU A 1 469 ? 37.313  -20.399 13.565  1.00 23.32 ? 468  GLU A CB  1 
ATOM   3723 C CG  . GLU A 1 469 ? 37.236  -21.196 14.866  1.00 25.97 ? 468  GLU A CG  1 
ATOM   3724 C CD  . GLU A 1 469 ? 36.085  -22.179 14.907  1.00 30.59 ? 468  GLU A CD  1 
ATOM   3725 O OE1 . GLU A 1 469 ? 34.948  -21.791 14.580  1.00 33.36 ? 468  GLU A OE1 1 
ATOM   3726 O OE2 . GLU A 1 469 ? 36.315  -23.350 15.284  1.00 32.88 ? 468  GLU A OE2 1 
ATOM   3727 N N   . GLY A 1 470 ? 38.514  -17.680 11.904  1.00 21.24 ? 469  GLY A N   1 
ATOM   3728 C CA  . GLY A 1 470 ? 38.748  -17.023 10.624  1.00 20.82 ? 469  GLY A CA  1 
ATOM   3729 C C   . GLY A 1 470 ? 37.861  -17.609 9.545   1.00 20.10 ? 469  GLY A C   1 
ATOM   3730 O O   . GLY A 1 470 ? 36.767  -18.105 9.839   1.00 20.30 ? 469  GLY A O   1 
ATOM   3731 N N   . ASN A 1 471 ? 38.337  -17.569 8.299   1.00 20.01 ? 470  ASN A N   1 
ATOM   3732 C CA  . ASN A 1 471 ? 37.590  -18.077 7.164   1.00 20.55 ? 470  ASN A CA  1 
ATOM   3733 C C   . ASN A 1 471 ? 36.258  -17.346 7.005   1.00 19.96 ? 470  ASN A C   1 
ATOM   3734 O O   . ASN A 1 471 ? 35.273  -17.919 6.544   1.00 20.14 ? 470  ASN A O   1 
ATOM   3735 C CB  . ASN A 1 471 ? 37.383  -19.606 7.287   1.00 20.76 ? 470  ASN A CB  1 
ATOM   3736 C CG  . ASN A 1 471 ? 37.468  -20.308 5.951   1.00 22.51 ? 470  ASN A CG  1 
ATOM   3737 O OD1 . ASN A 1 471 ? 38.173  -19.861 5.059   1.00 23.10 ? 470  ASN A OD1 1 
ATOM   3738 N ND2 . ASN A 1 471 ? 36.747  -21.415 5.807   1.00 23.33 ? 470  ASN A ND2 1 
ATOM   3739 N N   . ARG A 1 472 ? 36.248  -16.076 7.409   1.00 18.82 ? 471  ARG A N   1 
ATOM   3740 C CA  . ARG A 1 472 ? 35.062  -15.236 7.298   1.00 19.36 ? 471  ARG A CA  1 
ATOM   3741 C C   . ARG A 1 472 ? 35.220  -14.230 6.157   1.00 18.79 ? 471  ARG A C   1 
ATOM   3742 O O   . ARG A 1 472 ? 36.107  -13.358 6.199   1.00 18.92 ? 471  ARG A O   1 
ATOM   3743 C CB  . ARG A 1 472 ? 34.790  -14.539 8.626   1.00 19.13 ? 471  ARG A CB  1 
ATOM   3744 C CG  . ARG A 1 472 ? 34.266  -15.509 9.688   1.00 20.72 ? 471  ARG A CG  1 
ATOM   3745 C CD  . ARG A 1 472 ? 34.779  -15.260 11.069  1.00 21.04 ? 471  ARG A CD  1 
ATOM   3746 N NE  . ARG A 1 472 ? 33.862  -15.741 12.109  1.00 21.84 ? 471  ARG A NE  1 
ATOM   3747 C CZ  . ARG A 1 472 ? 33.880  -16.967 12.635  1.00 22.41 ? 471  ARG A CZ  1 
ATOM   3748 N NH1 . ARG A 1 472 ? 34.764  -17.870 12.225  1.00 22.31 ? 471  ARG A NH1 1 
ATOM   3749 N NH2 . ARG A 1 472 ? 33.004  -17.292 13.585  1.00 23.28 ? 471  ARG A NH2 1 
ATOM   3750 N N   . PRO A 1 473 ? 34.377  -14.385 5.133   1.00 18.67 ? 472  PRO A N   1 
ATOM   3751 C CA  . PRO A 1 473 ? 34.585  -13.756 3.827   1.00 18.58 ? 472  PRO A CA  1 
ATOM   3752 C C   . PRO A 1 473 ? 34.089  -12.324 3.786   1.00 18.35 ? 472  PRO A C   1 
ATOM   3753 O O   . PRO A 1 473 ? 33.080  -12.000 4.410   1.00 18.08 ? 472  PRO A O   1 
ATOM   3754 C CB  . PRO A 1 473 ? 33.761  -14.626 2.886   1.00 19.30 ? 472  PRO A CB  1 
ATOM   3755 C CG  . PRO A 1 473 ? 32.675  -15.195 3.747   1.00 18.86 ? 472  PRO A CG  1 
ATOM   3756 C CD  . PRO A 1 473 ? 33.165  -15.226 5.154   1.00 19.05 ? 472  PRO A CD  1 
ATOM   3757 N N   . THR A 1 474 ? 34.824  -11.484 3.070   1.00 17.19 ? 473  THR A N   1 
ATOM   3758 C CA  . THR A 1 474 ? 34.459  -10.078 2.909   1.00 16.98 ? 473  THR A CA  1 
ATOM   3759 C C   . THR A 1 474 ? 34.684  -9.588  1.472   1.00 16.88 ? 473  THR A C   1 
ATOM   3760 O O   . THR A 1 474 ? 35.439  -10.190 0.690   1.00 15.35 ? 473  THR A O   1 
ATOM   3761 C CB  . THR A 1 474 ? 35.259  -9.171  3.894   1.00 17.22 ? 473  THR A CB  1 
ATOM   3762 O OG1 . THR A 1 474 ? 36.679  -9.329  3.685   1.00 17.51 ? 473  THR A OG1 1 
ATOM   3763 C CG2 . THR A 1 474 ? 35.011  -9.557  5.370   1.00 16.83 ? 473  THR A CG2 1 
ATOM   3764 N N   . ASN A 1 475 ? 34.019  -8.483  1.138   1.00 16.36 ? 474  ASN A N   1 
ATOM   3765 C CA  . ASN A 1 475 ? 34.375  -7.680  -0.013  1.00 16.47 ? 474  ASN A CA  1 
ATOM   3766 C C   . ASN A 1 475 ? 34.977  -6.401  0.544   1.00 16.88 ? 474  ASN A C   1 
ATOM   3767 O O   . ASN A 1 475 ? 34.559  -5.929  1.622   1.00 15.85 ? 474  ASN A O   1 
ATOM   3768 C CB  . ASN A 1 475 ? 33.129  -7.304  -0.834  1.00 16.28 ? 474  ASN A CB  1 
ATOM   3769 C CG  . ASN A 1 475 ? 32.554  -8.479  -1.602  1.00 17.58 ? 474  ASN A CG  1 
ATOM   3770 O OD1 . ASN A 1 475 ? 33.301  -9.283  -2.181  1.00 16.86 ? 474  ASN A OD1 1 
ATOM   3771 N ND2 . ASN A 1 475 ? 31.226  -8.591  -1.611  1.00 15.37 ? 474  ASN A ND2 1 
ATOM   3772 N N   . SER A 1 476 ? 35.980  -5.882  -0.160  1.00 15.90 ? 475  SER A N   1 
ATOM   3773 C CA  . SER A 1 476 ? 36.513  -4.553  0.149   1.00 16.74 ? 475  SER A CA  1 
ATOM   3774 C C   . SER A 1 476 ? 36.327  -3.702  -1.093  1.00 16.81 ? 475  SER A C   1 
ATOM   3775 O O   . SER A 1 476 ? 36.778  -4.070  -2.199  1.00 17.28 ? 475  SER A O   1 
ATOM   3776 C CB  . SER A 1 476 ? 37.997  -4.627  0.568   1.00 16.18 ? 475  SER A CB  1 
ATOM   3777 O OG  . SER A 1 476 ? 38.142  -5.184  1.874   1.00 16.49 ? 475  SER A OG  1 
ATOM   3778 N N   . ILE A 1 477 ? 35.623  -2.581  -0.919  1.00 16.91 ? 476  ILE A N   1 
ATOM   3779 C CA  . ILE A 1 477 ? 35.324  -1.672  -2.005  1.00 16.54 ? 476  ILE A CA  1 
ATOM   3780 C C   . ILE A 1 477 ? 35.953  -0.340  -1.613  1.00 16.26 ? 476  ILE A C   1 
ATOM   3781 O O   . ILE A 1 477 ? 35.560  0.258   -0.629  1.00 15.63 ? 476  ILE A O   1 
ATOM   3782 C CB  . ILE A 1 477 ? 33.791  -1.530  -2.163  1.00 17.10 ? 476  ILE A CB  1 
ATOM   3783 C CG1 . ILE A 1 477 ? 33.162  -2.900  -2.493  1.00 17.43 ? 476  ILE A CG1 1 
ATOM   3784 C CG2 . ILE A 1 477 ? 33.436  -0.465  -3.199  1.00 17.86 ? 476  ILE A CG2 1 
ATOM   3785 C CD1 . ILE A 1 477 ? 31.659  -2.915  -2.420  1.00 19.23 ? 476  ILE A CD1 1 
ATOM   3786 N N   . VAL A 1 478 ? 36.949  0.089   -2.372  1.00 16.39 ? 477  VAL A N   1 
ATOM   3787 C CA  . VAL A 1 478 ? 37.744  1.267   -2.026  1.00 17.02 ? 477  VAL A CA  1 
ATOM   3788 C C   . VAL A 1 478 ? 37.680  2.174   -3.242  1.00 16.43 ? 477  VAL A C   1 
ATOM   3789 O O   . VAL A 1 478 ? 37.755  1.724   -4.380  1.00 17.11 ? 477  VAL A O   1 
ATOM   3790 C CB  . VAL A 1 478 ? 39.230  0.881   -1.704  1.00 17.44 ? 477  VAL A CB  1 
ATOM   3791 C CG1 . VAL A 1 478 ? 40.028  2.076   -1.160  1.00 17.79 ? 477  VAL A CG1 1 
ATOM   3792 C CG2 . VAL A 1 478 ? 39.289  -0.288  -0.717  1.00 18.67 ? 477  VAL A CG2 1 
ATOM   3793 N N   . PHE A 1 479 ? 37.532  3.470   -3.009  1.00 16.05 ? 478  PHE A N   1 
ATOM   3794 C CA  . PHE A 1 479 ? 37.359  4.380   -4.121  1.00 15.91 ? 478  PHE A CA  1 
ATOM   3795 C C   . PHE A 1 479 ? 38.182  5.620   -3.811  1.00 15.33 ? 478  PHE A C   1 
ATOM   3796 O O   . PHE A 1 479 ? 38.480  5.889   -2.655  1.00 13.65 ? 478  PHE A O   1 
ATOM   3797 C CB  . PHE A 1 479 ? 35.871  4.719   -4.315  1.00 15.97 ? 478  PHE A CB  1 
ATOM   3798 C CG  . PHE A 1 479 ? 35.077  4.657   -3.049  1.00 16.24 ? 478  PHE A CG  1 
ATOM   3799 C CD1 . PHE A 1 479 ? 34.813  5.820   -2.321  1.00 15.66 ? 478  PHE A CD1 1 
ATOM   3800 C CD2 . PHE A 1 479 ? 34.605  3.445   -2.574  1.00 15.47 ? 478  PHE A CD2 1 
ATOM   3801 C CE1 . PHE A 1 479 ? 34.071  5.776   -1.123  1.00 12.97 ? 478  PHE A CE1 1 
ATOM   3802 C CE2 . PHE A 1 479 ? 33.863  3.375   -1.363  1.00 15.78 ? 478  PHE A CE2 1 
ATOM   3803 C CZ  . PHE A 1 479 ? 33.598  4.539   -0.637  1.00 12.58 ? 478  PHE A CZ  1 
ATOM   3804 N N   . THR A 1 480 ? 38.582  6.345   -4.852  1.00 15.13 ? 479  THR A N   1 
ATOM   3805 C CA  . THR A 1 480 ? 39.471  7.490   -4.685  1.00 15.34 ? 479  THR A CA  1 
ATOM   3806 C C   . THR A 1 480 ? 38.987  8.485   -3.621  1.00 15.39 ? 479  THR A C   1 
ATOM   3807 O O   . THR A 1 480 ? 39.735  8.859   -2.706  1.00 13.95 ? 479  THR A O   1 
ATOM   3808 C CB  . THR A 1 480 ? 39.642  8.193   -6.026  1.00 16.17 ? 479  THR A CB  1 
ATOM   3809 O OG1 . THR A 1 480 ? 40.192  7.248   -6.964  1.00 16.88 ? 479  THR A OG1 1 
ATOM   3810 C CG2 . THR A 1 480 ? 40.700  9.301   -5.893  1.00 17.12 ? 479  THR A CG2 1 
ATOM   3811 N N   . LYS A 1 481 ? 37.729  8.903   -3.747  1.00 15.07 ? 480  LYS A N   1 
ATOM   3812 C CA  . LYS A 1 481 ? 37.150  9.889   -2.842  1.00 15.83 ? 480  LYS A CA  1 
ATOM   3813 C C   . LYS A 1 481 ? 35.649  9.773   -2.954  1.00 15.77 ? 480  LYS A C   1 
ATOM   3814 O O   . LYS A 1 481 ? 35.129  9.417   -4.033  1.00 15.55 ? 480  LYS A O   1 
ATOM   3815 C CB  . LYS A 1 481 ? 37.611  11.312  -3.242  1.00 15.61 ? 480  LYS A CB  1 
ATOM   3816 C CG  . LYS A 1 481 ? 37.357  12.394  -2.188  1.00 17.02 ? 480  LYS A CG  1 
ATOM   3817 C CD  . LYS A 1 481 ? 38.180  13.649  -2.482  1.00 20.37 ? 480  LYS A CD  1 
ATOM   3818 C CE  . LYS A 1 481 ? 38.124  14.658  -1.347  1.00 22.25 ? 480  LYS A CE  1 
ATOM   3819 N NZ  . LYS A 1 481 ? 38.572  16.010  -1.812  1.00 23.11 ? 480  LYS A NZ  1 
ATOM   3820 N N   . LEU A 1 482 ? 34.943  10.085  -1.870  1.00 15.30 ? 481  LEU A N   1 
ATOM   3821 C CA  . LEU A 1 482 ? 33.481  10.081  -1.925  1.00 15.26 ? 481  LEU A CA  1 
ATOM   3822 C C   . LEU A 1 482 ? 32.942  11.442  -2.405  1.00 15.60 ? 481  LEU A C   1 
ATOM   3823 O O   . LEU A 1 482 ? 32.475  12.269  -1.617  1.00 16.42 ? 481  LEU A O   1 
ATOM   3824 C CB  . LEU A 1 482 ? 32.869  9.661   -0.580  1.00 15.25 ? 481  LEU A CB  1 
ATOM   3825 C CG  . LEU A 1 482 ? 31.366  9.364   -0.676  1.00 15.73 ? 481  LEU A CG  1 
ATOM   3826 C CD1 . LEU A 1 482 ? 31.070  8.071   -1.476  1.00 17.06 ? 481  LEU A CD1 1 
ATOM   3827 C CD2 . LEU A 1 482 ? 30.713  9.330   0.703   1.00 18.55 ? 481  LEU A CD2 1 
ATOM   3828 N N   . THR A 1 483 ? 33.018  11.639  -3.719  1.00 15.51 ? 482  THR A N   1 
ATOM   3829 C CA  . THR A 1 483 ? 32.472  12.804  -4.408  1.00 16.47 ? 482  THR A CA  1 
ATOM   3830 C C   . THR A 1 483 ? 31.045  12.454  -4.779  1.00 15.99 ? 482  THR A C   1 
ATOM   3831 O O   . THR A 1 483 ? 30.658  11.280  -4.695  1.00 15.86 ? 482  THR A O   1 
ATOM   3832 C CB  . THR A 1 483 ? 33.239  13.049  -5.706  1.00 16.32 ? 482  THR A CB  1 
ATOM   3833 O OG1 . THR A 1 483 ? 33.234  11.845  -6.496  1.00 17.43 ? 482  THR A OG1 1 
ATOM   3834 C CG2 . THR A 1 483 ? 34.721  13.326  -5.440  1.00 17.53 ? 482  THR A CG2 1 
ATOM   3835 N N   . PRO A 1 484 ? 30.258  13.444  -5.210  1.00 16.46 ? 483  PRO A N   1 
ATOM   3836 C CA  . PRO A 1 484 ? 28.918  13.176  -5.739  1.00 16.18 ? 483  PRO A CA  1 
ATOM   3837 C C   . PRO A 1 484 ? 28.946  12.148  -6.888  1.00 16.54 ? 483  PRO A C   1 
ATOM   3838 O O   . PRO A 1 484 ? 28.151  11.230  -6.867  1.00 16.64 ? 483  PRO A O   1 
ATOM   3839 C CB  . PRO A 1 484 ? 28.461  14.553  -6.231  1.00 16.07 ? 483  PRO A CB  1 
ATOM   3840 C CG  . PRO A 1 484 ? 29.193  15.505  -5.352  1.00 15.47 ? 483  PRO A CG  1 
ATOM   3841 C CD  . PRO A 1 484 ? 30.545  14.900  -5.160  1.00 16.43 ? 483  PRO A CD  1 
ATOM   3842 N N   . PHE A 1 485 ? 29.873  12.279  -7.838  1.00 16.31 ? 484  PHE A N   1 
ATOM   3843 C CA  . PHE A 1 485 ? 29.994  11.303  -8.924  1.00 16.30 ? 484  PHE A CA  1 
ATOM   3844 C C   . PHE A 1 485 ? 30.230  9.886   -8.397  1.00 16.31 ? 484  PHE A C   1 
ATOM   3845 O O   . PHE A 1 485 ? 29.524  8.948   -8.781  1.00 17.15 ? 484  PHE A O   1 
ATOM   3846 C CB  . PHE A 1 485 ? 31.111  11.720  -9.891  1.00 16.47 ? 484  PHE A CB  1 
ATOM   3847 C CG  . PHE A 1 485 ? 31.280  10.805  -11.059 1.00 15.60 ? 484  PHE A CG  1 
ATOM   3848 C CD1 . PHE A 1 485 ? 30.750  11.145  -12.306 1.00 17.96 ? 484  PHE A CD1 1 
ATOM   3849 C CD2 . PHE A 1 485 ? 32.001  9.608   -10.927 1.00 17.43 ? 484  PHE A CD2 1 
ATOM   3850 C CE1 . PHE A 1 485 ? 30.915  10.292  -13.394 1.00 20.28 ? 484  PHE A CE1 1 
ATOM   3851 C CE2 . PHE A 1 485 ? 32.170  8.755   -12.022 1.00 17.54 ? 484  PHE A CE2 1 
ATOM   3852 C CZ  . PHE A 1 485 ? 31.635  9.105   -13.247 1.00 20.15 ? 484  PHE A CZ  1 
ATOM   3853 N N   . ILE A 1 486 ? 31.207  9.728   -7.509  1.00 15.79 ? 485  ILE A N   1 
ATOM   3854 C CA  . ILE A 1 486 ? 31.552  8.381   -7.028  1.00 15.54 ? 485  ILE A CA  1 
ATOM   3855 C C   . ILE A 1 486 ? 30.395  7.775   -6.210  1.00 15.87 ? 485  ILE A C   1 
ATOM   3856 O O   . ILE A 1 486 ? 30.059  6.582   -6.370  1.00 15.83 ? 485  ILE A O   1 
ATOM   3857 C CB  . ILE A 1 486 ? 32.895  8.414   -6.263  1.00 15.99 ? 485  ILE A CB  1 
ATOM   3858 C CG1 . ILE A 1 486 ? 34.044  8.709   -7.248  1.00 16.18 ? 485  ILE A CG1 1 
ATOM   3859 C CG2 . ILE A 1 486 ? 33.185  7.091   -5.508  1.00 16.78 ? 485  ILE A CG2 1 
ATOM   3860 C CD1 . ILE A 1 486 ? 34.383  7.542   -8.209  1.00 18.53 ? 485  ILE A CD1 1 
ATOM   3861 N N   . LEU A 1 487 ? 29.772  8.598   -5.361  1.00 15.33 ? 486  LEU A N   1 
ATOM   3862 C CA  . LEU A 1 487 ? 28.616  8.139   -4.592  1.00 15.47 ? 486  LEU A CA  1 
ATOM   3863 C C   . LEU A 1 487 ? 27.503  7.659   -5.527  1.00 14.55 ? 486  LEU A C   1 
ATOM   3864 O O   . LEU A 1 487 ? 26.913  6.594   -5.285  1.00 14.77 ? 486  LEU A O   1 
ATOM   3865 C CB  . LEU A 1 487 ? 28.098  9.230   -3.639  1.00 15.06 ? 486  LEU A CB  1 
ATOM   3866 C CG  . LEU A 1 487 ? 26.808  8.842   -2.895  1.00 14.90 ? 486  LEU A CG  1 
ATOM   3867 C CD1 . LEU A 1 487 ? 27.056  7.660   -1.940  1.00 15.80 ? 486  LEU A CD1 1 
ATOM   3868 C CD2 . LEU A 1 487 ? 26.192  10.019  -2.157  1.00 14.24 ? 486  LEU A CD2 1 
ATOM   3869 N N   . GLY A 1 488 ? 27.233  8.431   -6.591  1.00 15.11 ? 487  GLY A N   1 
ATOM   3870 C CA  . GLY A 1 488 ? 26.245  8.041   -7.586  1.00 15.27 ? 487  GLY A CA  1 
ATOM   3871 C C   . GLY A 1 488 ? 26.561  6.694   -8.229  1.00 15.85 ? 487  GLY A C   1 
ATOM   3872 O O   . GLY A 1 488 ? 25.677  5.852   -8.407  1.00 15.45 ? 487  GLY A O   1 
ATOM   3873 N N   . ALA A 1 489 ? 27.838  6.470   -8.541  1.00 15.07 ? 488  ALA A N   1 
ATOM   3874 C CA  . ALA A 1 489 ? 28.273  5.186   -9.097  1.00 15.61 ? 488  ALA A CA  1 
ATOM   3875 C C   . ALA A 1 489 ? 28.104  4.025   -8.107  1.00 15.82 ? 488  ALA A C   1 
ATOM   3876 O O   . ALA A 1 489 ? 27.718  2.906   -8.505  1.00 16.59 ? 488  ALA A O   1 
ATOM   3877 C CB  . ALA A 1 489 ? 29.721  5.283   -9.599  1.00 15.98 ? 488  ALA A CB  1 
ATOM   3878 N N   . LEU A 1 490 ? 28.382  4.285   -6.828  1.00 15.26 ? 489  LEU A N   1 
ATOM   3879 C CA  . LEU A 1 490 ? 28.253  3.262   -5.777  1.00 15.53 ? 489  LEU A CA  1 
ATOM   3880 C C   . LEU A 1 490 ? 26.794  2.843   -5.534  1.00 15.72 ? 489  LEU A C   1 
ATOM   3881 O O   . LEU A 1 490 ? 26.498  1.654   -5.412  1.00 15.57 ? 489  LEU A O   1 
ATOM   3882 C CB  . LEU A 1 490 ? 28.925  3.692   -4.472  1.00 15.10 ? 489  LEU A CB  1 
ATOM   3883 C CG  . LEU A 1 490 ? 30.452  3.840   -4.503  1.00 15.17 ? 489  LEU A CG  1 
ATOM   3884 C CD1 . LEU A 1 490 ? 30.931  4.533   -3.226  1.00 15.78 ? 489  LEU A CD1 1 
ATOM   3885 C CD2 . LEU A 1 490 ? 31.114  2.456   -4.660  1.00 15.56 ? 489  LEU A CD2 1 
ATOM   3886 N N   . ILE A 1 491 ? 25.897  3.817   -5.477  1.00 15.82 ? 490  ILE A N   1 
ATOM   3887 C CA  . ILE A 1 491 ? 24.468  3.511   -5.315  1.00 15.53 ? 490  ILE A CA  1 
ATOM   3888 C C   . ILE A 1 491 ? 23.931  2.705   -6.492  1.00 15.78 ? 490  ILE A C   1 
ATOM   3889 O O   . ILE A 1 491 ? 23.267  1.695   -6.288  1.00 16.10 ? 490  ILE A O   1 
ATOM   3890 C CB  . ILE A 1 491 ? 23.636  4.800   -5.116  1.00 15.33 ? 490  ILE A CB  1 
ATOM   3891 C CG1 . ILE A 1 491 ? 24.153  5.574   -3.892  1.00 16.07 ? 490  ILE A CG1 1 
ATOM   3892 C CG2 . ILE A 1 491 ? 22.156  4.430   -4.917  1.00 17.01 ? 490  ILE A CG2 1 
ATOM   3893 C CD1 . ILE A 1 491 ? 23.663  7.005   -3.793  1.00 16.35 ? 490  ILE A CD1 1 
ATOM   3894 N N   . ALA A 1 492 ? 24.273  3.126   -7.706  1.00 15.99 ? 491  ALA A N   1 
ATOM   3895 C CA  . ALA A 1 492 ? 23.825  2.422   -8.921  1.00 16.88 ? 491  ALA A CA  1 
ATOM   3896 C C   . ALA A 1 492 ? 24.349  0.990   -8.930  1.00 16.97 ? 491  ALA A C   1 
ATOM   3897 O O   . ALA A 1 492 ? 23.667  0.077   -9.407  1.00 17.62 ? 491  ALA A O   1 
ATOM   3898 C CB  . ALA A 1 492 ? 24.283  3.144   -10.188 1.00 16.82 ? 491  ALA A CB  1 
ATOM   3899 N N   . MET A 1 493 ? 25.582  0.810   -8.463  1.00 16.55 ? 492  MET A N   1 
ATOM   3900 C CA  . MET A 1 493 ? 26.201  -0.511  -8.445  1.00 16.53 ? 492  MET A CA  1 
ATOM   3901 C C   . MET A 1 493 ? 25.364  -1.460  -7.603  1.00 16.86 ? 492  MET A C   1 
ATOM   3902 O O   . MET A 1 493 ? 25.091  -2.595  -8.004  1.00 16.23 ? 492  MET A O   1 
ATOM   3903 C CB  . MET A 1 493 ? 27.631  -0.425  -7.906  1.00 17.04 ? 492  MET A CB  1 
ATOM   3904 C CG  . MET A 1 493 ? 28.351  -1.767  -7.824  1.00 16.83 ? 492  MET A CG  1 
ATOM   3905 S SD  . MET A 1 493 ? 30.101  -1.608  -7.320  1.00 19.62 ? 492  MET A SD  1 
ATOM   3906 C CE  . MET A 1 493 ? 29.987  -1.375  -5.627  1.00 19.23 ? 492  MET A CE  1 
ATOM   3907 N N   . TYR A 1 494 ? 24.952  -0.991  -6.425  1.00 16.95 ? 493  TYR A N   1 
ATOM   3908 C CA  . TYR A 1 494 ? 24.094  -1.804  -5.568  1.00 17.31 ? 493  TYR A CA  1 
ATOM   3909 C C   . TYR A 1 494 ? 22.685  -2.018  -6.125  1.00 17.93 ? 493  TYR A C   1 
ATOM   3910 O O   . TYR A 1 494 ? 22.135  -3.117  -6.000  1.00 18.15 ? 493  TYR A O   1 
ATOM   3911 C CB  . TYR A 1 494 ? 24.073  -1.256  -4.127  1.00 16.37 ? 493  TYR A CB  1 
ATOM   3912 C CG  . TYR A 1 494 ? 25.272  -1.675  -3.316  1.00 17.15 ? 493  TYR A CG  1 
ATOM   3913 C CD1 . TYR A 1 494 ? 26.337  -0.784  -3.090  1.00 16.71 ? 493  TYR A CD1 1 
ATOM   3914 C CD2 . TYR A 1 494 ? 25.370  -2.974  -2.809  1.00 18.25 ? 493  TYR A CD2 1 
ATOM   3915 C CE1 . TYR A 1 494 ? 27.451  -1.180  -2.347  1.00 18.42 ? 493  TYR A CE1 1 
ATOM   3916 C CE2 . TYR A 1 494 ? 26.471  -3.374  -2.073  1.00 18.33 ? 493  TYR A CE2 1 
ATOM   3917 C CZ  . TYR A 1 494 ? 27.510  -2.477  -1.851  1.00 19.92 ? 493  TYR A CZ  1 
ATOM   3918 O OH  . TYR A 1 494 ? 28.588  -2.890  -1.128  1.00 18.90 ? 493  TYR A OH  1 
ATOM   3919 N N   . GLU A 1 495 ? 22.114  -0.986  -6.757  1.00 17.18 ? 494  GLU A N   1 
ATOM   3920 C CA  . GLU A 1 495 ? 20.826  -1.116  -7.444  1.00 17.23 ? 494  GLU A CA  1 
ATOM   3921 C C   . GLU A 1 495 ? 20.904  -2.268  -8.454  1.00 17.69 ? 494  GLU A C   1 
ATOM   3922 O O   . GLU A 1 495 ? 19.995  -3.099  -8.548  1.00 18.45 ? 494  GLU A O   1 
ATOM   3923 C CB  . GLU A 1 495 ? 20.467  0.189   -8.163  1.00 16.99 ? 494  GLU A CB  1 
ATOM   3924 C CG  . GLU A 1 495 ? 19.990  1.276   -7.207  1.00 16.95 ? 494  GLU A CG  1 
ATOM   3925 C CD  . GLU A 1 495 ? 19.661  2.602   -7.887  1.00 18.64 ? 494  GLU A CD  1 
ATOM   3926 O OE1 . GLU A 1 495 ? 20.071  2.807   -9.050  1.00 19.11 ? 494  GLU A OE1 1 
ATOM   3927 O OE2 . GLU A 1 495 ? 18.980  3.438   -7.252  1.00 19.32 ? 494  GLU A OE2 1 
ATOM   3928 N N   . HIS A 1 496 ? 22.004  -2.322  -9.204  1.00 17.11 ? 495  HIS A N   1 
ATOM   3929 C CA  . HIS A 1 496 ? 22.139  -3.367  -10.219 1.00 17.64 ? 495  HIS A CA  1 
ATOM   3930 C C   . HIS A 1 496 ? 22.461  -4.755  -9.663  1.00 17.83 ? 495  HIS A C   1 
ATOM   3931 O O   . HIS A 1 496 ? 22.005  -5.757  -10.234 1.00 18.83 ? 495  HIS A O   1 
ATOM   3932 C CB  . HIS A 1 496 ? 23.096  -2.930  -11.327 1.00 17.51 ? 495  HIS A CB  1 
ATOM   3933 C CG  . HIS A 1 496 ? 22.606  -1.742  -12.090 1.00 17.64 ? 495  HIS A CG  1 
ATOM   3934 N ND1 . HIS A 1 496 ? 21.280  -1.569  -12.426 1.00 19.20 ? 495  HIS A ND1 1 
ATOM   3935 C CD2 . HIS A 1 496 ? 23.261  -0.659  -12.564 1.00 16.97 ? 495  HIS A CD2 1 
ATOM   3936 C CE1 . HIS A 1 496 ? 21.143  -0.428  -13.074 1.00 19.36 ? 495  HIS A CE1 1 
ATOM   3937 N NE2 . HIS A 1 496 ? 22.333  0.138   -13.177 1.00 17.71 ? 495  HIS A NE2 1 
ATOM   3938 N N   . LYS A 1 497 ? 23.205  -4.820  -8.555  1.00 18.04 ? 496  LYS A N   1 
ATOM   3939 C CA  . LYS A 1 497 ? 23.399  -6.086  -7.836  1.00 17.37 ? 496  LYS A CA  1 
ATOM   3940 C C   . LYS A 1 497 ? 22.024  -6.648  -7.445  1.00 17.29 ? 496  LYS A C   1 
ATOM   3941 O O   . LYS A 1 497 ? 21.707  -7.824  -7.686  1.00 16.76 ? 496  LYS A O   1 
ATOM   3942 C CB  . LYS A 1 497 ? 24.255  -5.867  -6.581  1.00 16.85 ? 496  LYS A CB  1 
ATOM   3943 C CG  . LYS A 1 497 ? 24.343  -7.081  -5.656  1.00 17.38 ? 496  LYS A CG  1 
ATOM   3944 C CD  . LYS A 1 497 ? 24.678  -6.737  -4.207  1.00 17.01 ? 496  LYS A CD  1 
ATOM   3945 C CE  . LYS A 1 497 ? 24.588  -7.981  -3.327  1.00 16.90 ? 496  LYS A CE  1 
ATOM   3946 N NZ  . LYS A 1 497 ? 24.890  -7.731  -1.861  1.00 16.48 ? 496  LYS A NZ  1 
ATOM   3947 N N   . ILE A 1 498 ? 21.212  -5.795  -6.830  1.00 17.34 ? 497  ILE A N   1 
ATOM   3948 C CA  . ILE A 1 498 ? 19.840  -6.164  -6.455  1.00 17.25 ? 497  ILE A CA  1 
ATOM   3949 C C   . ILE A 1 498 ? 19.016  -6.675  -7.658  1.00 17.65 ? 497  ILE A C   1 
ATOM   3950 O O   . ILE A 1 498 ? 18.334  -7.708  -7.562  1.00 17.10 ? 497  ILE A O   1 
ATOM   3951 C CB  . ILE A 1 498 ? 19.159  -4.961  -5.739  1.00 16.20 ? 497  ILE A CB  1 
ATOM   3952 C CG1 . ILE A 1 498 ? 19.744  -4.828  -4.324  1.00 14.77 ? 497  ILE A CG1 1 
ATOM   3953 C CG2 . ILE A 1 498 ? 17.616  -5.116  -5.677  1.00 16.69 ? 497  ILE A CG2 1 
ATOM   3954 C CD1 . ILE A 1 498 ? 19.645  -3.384  -3.756  1.00 16.69 ? 497  ILE A CD1 1 
ATOM   3955 N N   . PHE A 1 499 ? 19.078  -5.961  -8.779  1.00 18.09 ? 498  PHE A N   1 
ATOM   3956 C CA  . PHE A 1 499 ? 18.407  -6.385  -10.009 1.00 18.30 ? 498  PHE A CA  1 
ATOM   3957 C C   . PHE A 1 499 ? 18.828  -7.794  -10.452 1.00 18.43 ? 498  PHE A C   1 
ATOM   3958 O O   . PHE A 1 499 ? 17.973  -8.665  -10.691 1.00 17.59 ? 498  PHE A O   1 
ATOM   3959 C CB  . PHE A 1 499 ? 18.708  -5.416  -11.151 1.00 18.53 ? 498  PHE A CB  1 
ATOM   3960 C CG  . PHE A 1 499 ? 18.171  -5.863  -12.487 1.00 19.01 ? 498  PHE A CG  1 
ATOM   3961 C CD1 . PHE A 1 499 ? 16.826  -5.705  -12.797 1.00 18.62 ? 498  PHE A CD1 1 
ATOM   3962 C CD2 . PHE A 1 499 ? 19.016  -6.444  -13.433 1.00 20.24 ? 498  PHE A CD2 1 
ATOM   3963 C CE1 . PHE A 1 499 ? 16.324  -6.118  -14.042 1.00 20.30 ? 498  PHE A CE1 1 
ATOM   3964 C CE2 . PHE A 1 499 ? 18.522  -6.860  -14.673 1.00 22.43 ? 498  PHE A CE2 1 
ATOM   3965 C CZ  . PHE A 1 499 ? 17.170  -6.694  -14.973 1.00 21.05 ? 498  PHE A CZ  1 
ATOM   3966 N N   . VAL A 1 500 ? 20.138  -8.004  -10.563 1.00 17.52 ? 499  VAL A N   1 
ATOM   3967 C CA  . VAL A 1 500 ? 20.667  -9.293  -11.010 1.00 17.46 ? 499  VAL A CA  1 
ATOM   3968 C C   . VAL A 1 500 ? 20.185  -10.430 -10.088 1.00 17.50 ? 499  VAL A C   1 
ATOM   3969 O O   . VAL A 1 500 ? 19.772  -11.501 -10.567 1.00 17.71 ? 499  VAL A O   1 
ATOM   3970 C CB  . VAL A 1 500 ? 22.211  -9.302  -11.070 1.00 17.33 ? 499  VAL A CB  1 
ATOM   3971 C CG1 . VAL A 1 500 ? 22.715  -10.737 -11.283 1.00 17.48 ? 499  VAL A CG1 1 
ATOM   3972 C CG2 . VAL A 1 500 ? 22.737  -8.376  -12.199 1.00 18.62 ? 499  VAL A CG2 1 
ATOM   3973 N N   . GLN A 1 501 ? 20.222  -10.205 -8.776  1.00 16.63 ? 500  GLN A N   1 
ATOM   3974 C CA  . GLN A 1 501 ? 19.724  -11.227 -7.839  1.00 16.89 ? 500  GLN A CA  1 
ATOM   3975 C C   . GLN A 1 501 ? 18.230  -11.551 -8.024  1.00 17.20 ? 500  GLN A C   1 
ATOM   3976 O O   . GLN A 1 501 ? 17.847  -12.733 -8.035  1.00 17.64 ? 500  GLN A O   1 
ATOM   3977 C CB  . GLN A 1 501 ? 20.047  -10.882 -6.373  1.00 16.51 ? 500  GLN A CB  1 
ATOM   3978 C CG  . GLN A 1 501 ? 21.544  -10.718 -6.079  1.00 16.65 ? 500  GLN A CG  1 
ATOM   3979 C CD  . GLN A 1 501 ? 21.835  -10.532 -4.600  1.00 16.69 ? 500  GLN A CD  1 
ATOM   3980 O OE1 . GLN A 1 501 ? 21.134  -9.788  -3.930  1.00 17.65 ? 500  GLN A OE1 1 
ATOM   3981 N NE2 . GLN A 1 501 ? 22.882  -11.186 -4.098  1.00 16.36 ? 500  GLN A NE2 1 
ATOM   3982 N N   . GLY A 1 502 ? 17.404  -10.516 -8.185  1.00 17.18 ? 501  GLY A N   1 
ATOM   3983 C CA  . GLY A 1 502 ? 15.985  -10.704 -8.445  1.00 18.19 ? 501  GLY A CA  1 
ATOM   3984 C C   . GLY A 1 502 ? 15.715  -11.499 -9.716  1.00 18.59 ? 501  GLY A C   1 
ATOM   3985 O O   . GLY A 1 502 ? 14.835  -12.355 -9.737  1.00 18.93 ? 501  GLY A O   1 
ATOM   3986 N N   . ILE A 1 503 ? 16.484  -11.246 -10.774 1.00 18.55 ? 502  ILE A N   1 
ATOM   3987 C CA  . ILE A 1 503 ? 16.312  -12.009 -12.008 1.00 18.92 ? 502  ILE A CA  1 
ATOM   3988 C C   . ILE A 1 503 ? 16.642  -13.464 -11.769 1.00 19.44 ? 502  ILE A C   1 
ATOM   3989 O O   . ILE A 1 503 ? 15.887  -14.348 -12.184 1.00 19.93 ? 502  ILE A O   1 
ATOM   3990 C CB  . ILE A 1 503 ? 17.158  -11.431 -13.175 1.00 18.57 ? 502  ILE A CB  1 
ATOM   3991 C CG1 . ILE A 1 503 ? 16.661  -10.027 -13.547 1.00 17.05 ? 502  ILE A CG1 1 
ATOM   3992 C CG2 . ILE A 1 503 ? 17.114  -12.363 -14.423 1.00 19.69 ? 502  ILE A CG2 1 
ATOM   3993 C CD1 . ILE A 1 503 ? 15.163  -9.926  -13.806 1.00 20.46 ? 502  ILE A CD1 1 
ATOM   3994 N N   . MET A 1 504 ? 17.764  -13.711 -11.102 1.00 19.37 ? 503  MET A N   1 
ATOM   3995 C CA  . MET A 1 504 ? 18.203  -15.077 -10.851 1.00 19.97 ? 503  MET A CA  1 
ATOM   3996 C C   . MET A 1 504 ? 17.226  -15.848 -9.957  1.00 20.05 ? 503  MET A C   1 
ATOM   3997 O O   . MET A 1 504 ? 17.043  -17.066 -10.136 1.00 19.89 ? 503  MET A O   1 
ATOM   3998 C CB  . MET A 1 504 ? 19.621  -15.073 -10.292 1.00 20.25 ? 503  MET A CB  1 
ATOM   3999 C CG  . MET A 1 504 ? 20.609  -14.628 -11.357 1.00 22.84 ? 503  MET A CG  1 
ATOM   4000 S SD  . MET A 1 504 ? 22.295  -14.583 -10.810 1.00 27.77 ? 503  MET A SD  1 
ATOM   4001 C CE  . MET A 1 504 ? 22.672  -16.351 -10.816 1.00 26.78 ? 503  MET A CE  1 
ATOM   4002 N N   . TRP A 1 505 ? 16.577  -15.144 -9.025  1.00 19.14 ? 504  TRP A N   1 
ATOM   4003 C CA  . TRP A 1 505 ? 15.512  -15.745 -8.196  1.00 19.76 ? 504  TRP A CA  1 
ATOM   4004 C C   . TRP A 1 505 ? 14.131  -15.833 -8.874  1.00 19.79 ? 504  TRP A C   1 
ATOM   4005 O O   . TRP A 1 505 ? 13.209  -16.432 -8.317  1.00 21.04 ? 504  TRP A O   1 
ATOM   4006 C CB  . TRP A 1 505 ? 15.386  -15.022 -6.838  1.00 18.81 ? 504  TRP A CB  1 
ATOM   4007 C CG  . TRP A 1 505 ? 16.552  -15.228 -5.912  1.00 19.71 ? 504  TRP A CG  1 
ATOM   4008 C CD1 . TRP A 1 505 ? 17.260  -16.375 -5.712  1.00 18.55 ? 504  TRP A CD1 1 
ATOM   4009 C CD2 . TRP A 1 505 ? 17.139  -14.246 -5.068  1.00 18.62 ? 504  TRP A CD2 1 
ATOM   4010 N NE1 . TRP A 1 505 ? 18.253  -16.170 -4.786  1.00 18.05 ? 504  TRP A NE1 1 
ATOM   4011 C CE2 . TRP A 1 505 ? 18.202  -14.865 -4.373  1.00 20.28 ? 504  TRP A CE2 1 
ATOM   4012 C CE3 . TRP A 1 505 ? 16.867  -12.892 -4.814  1.00 21.14 ? 504  TRP A CE3 1 
ATOM   4013 C CZ2 . TRP A 1 505 ? 19.009  -14.175 -3.453  1.00 18.52 ? 504  TRP A CZ2 1 
ATOM   4014 C CZ3 . TRP A 1 505 ? 17.673  -12.205 -3.901  1.00 17.46 ? 504  TRP A CZ3 1 
ATOM   4015 C CH2 . TRP A 1 505 ? 18.723  -12.847 -3.232  1.00 19.34 ? 504  TRP A CH2 1 
ATOM   4016 N N   . ASP A 1 506 ? 14.006  -15.280 -10.082 1.00 20.54 ? 505  ASP A N   1 
ATOM   4017 C CA  . ASP A 1 506 ? 12.756  -15.261 -10.859 1.00 20.93 ? 505  ASP A CA  1 
ATOM   4018 C C   . ASP A 1 506 ? 11.647  -14.449 -10.188 1.00 20.45 ? 505  ASP A C   1 
ATOM   4019 O O   . ASP A 1 506 ? 10.469  -14.720 -10.395 1.00 20.90 ? 505  ASP A O   1 
ATOM   4020 C CB  . ASP A 1 506 ? 12.256  -16.687 -11.163 1.00 21.47 ? 505  ASP A CB  1 
ATOM   4021 C CG  . ASP A 1 506 ? 11.494  -16.780 -12.484 1.00 23.24 ? 505  ASP A CG  1 
ATOM   4022 O OD1 . ASP A 1 506 ? 11.921  -16.144 -13.478 1.00 26.41 ? 505  ASP A OD1 1 
ATOM   4023 O OD2 . ASP A 1 506 ? 10.468  -17.491 -12.633 1.00 22.78 ? 505  ASP A OD2 1 
ATOM   4024 N N   . ILE A 1 507 ? 12.026  -13.447 -9.399  1.00 20.18 ? 506  ILE A N   1 
ATOM   4025 C CA  . ILE A 1 507 ? 11.059  -12.630 -8.664  1.00 19.24 ? 506  ILE A CA  1 
ATOM   4026 C C   . ILE A 1 507 ? 10.986  -11.228 -9.275  1.00 19.60 ? 506  ILE A C   1 
ATOM   4027 O O   . ILE A 1 507 ? 11.790  -10.867 -10.161 1.00 19.19 ? 506  ILE A O   1 
ATOM   4028 C CB  . ILE A 1 507 ? 11.405  -12.578 -7.134  1.00 18.94 ? 506  ILE A CB  1 
ATOM   4029 C CG1 . ILE A 1 507 ? 12.790  -11.939 -6.913  1.00 19.45 ? 506  ILE A CG1 1 
ATOM   4030 C CG2 . ILE A 1 507 ? 11.307  -14.004 -6.512  1.00 20.01 ? 506  ILE A CG2 1 
ATOM   4031 C CD1 . ILE A 1 507 ? 13.145  -11.680 -5.448  1.00 20.15 ? 506  ILE A CD1 1 
ATOM   4032 N N   . ASN A 1 508 ? 9.986   -10.465 -8.841  1.00 18.92 ? 507  ASN A N   1 
ATOM   4033 C CA  . ASN A 1 508 ? 9.829   -9.082  -9.253  1.00 18.80 ? 507  ASN A CA  1 
ATOM   4034 C C   . ASN A 1 508 ? 10.469  -8.153  -8.216  1.00 18.58 ? 507  ASN A C   1 
ATOM   4035 O O   . ASN A 1 508 ? 9.923   -7.966  -7.124  1.00 18.97 ? 507  ASN A O   1 
ATOM   4036 C CB  . ASN A 1 508 ? 8.331   -8.758  -9.418  1.00 18.89 ? 507  ASN A CB  1 
ATOM   4037 C CG  . ASN A 1 508 ? 8.083   -7.401  -10.045 1.00 19.67 ? 507  ASN A CG  1 
ATOM   4038 O OD1 . ASN A 1 508 ? 9.019   -6.626  -10.294 1.00 20.54 ? 507  ASN A OD1 1 
ATOM   4039 N ND2 . ASN A 1 508 ? 6.812   -7.103  -10.313 1.00 19.70 ? 507  ASN A ND2 1 
ATOM   4040 N N   . SER A 1 509 ? 11.616  -7.570  -8.564  1.00 18.50 ? 508  SER A N   1 
ATOM   4041 C CA  . SER A 1 509 ? 12.334  -6.698  -7.641  1.00 18.31 ? 508  SER A CA  1 
ATOM   4042 C C   . SER A 1 509 ? 11.633  -5.342  -7.482  1.00 18.30 ? 508  SER A C   1 
ATOM   4043 O O   . SER A 1 509 ? 12.059  -4.500  -6.689  1.00 18.13 ? 508  SER A O   1 
ATOM   4044 C CB  . SER A 1 509 ? 13.787  -6.467  -8.104  1.00 18.23 ? 508  SER A CB  1 
ATOM   4045 O OG  . SER A 1 509 ? 14.573  -7.650  -8.026  1.00 17.28 ? 508  SER A OG  1 
ATOM   4046 N N   . PHE A 1 510 ? 10.564  -5.113  -8.235  1.00 18.33 ? 509  PHE A N   1 
ATOM   4047 C CA  . PHE A 1 510 ? 10.099  -3.744  -8.408  1.00 17.99 ? 509  PHE A CA  1 
ATOM   4048 C C   . PHE A 1 510 ? 8.669   -3.441  -7.943  1.00 18.12 ? 509  PHE A C   1 
ATOM   4049 O O   . PHE A 1 510 ? 8.212   -2.296  -8.019  1.00 18.46 ? 509  PHE A O   1 
ATOM   4050 C CB  . PHE A 1 510 ? 10.357  -3.316  -9.854  1.00 18.13 ? 509  PHE A CB  1 
ATOM   4051 C CG  . PHE A 1 510 ? 11.790  -3.496  -10.264 1.00 19.14 ? 509  PHE A CG  1 
ATOM   4052 C CD1 . PHE A 1 510 ? 12.169  -4.575  -11.055 1.00 19.84 ? 509  PHE A CD1 1 
ATOM   4053 C CD2 . PHE A 1 510 ? 12.770  -2.626  -9.787  1.00 17.37 ? 509  PHE A CD2 1 
ATOM   4054 C CE1 . PHE A 1 510 ? 13.501  -4.765  -11.421 1.00 19.02 ? 509  PHE A CE1 1 
ATOM   4055 C CE2 . PHE A 1 510 ? 14.108  -2.798  -10.142 1.00 18.40 ? 509  PHE A CE2 1 
ATOM   4056 C CZ  . PHE A 1 510 ? 14.481  -3.869  -10.953 1.00 17.83 ? 509  PHE A CZ  1 
ATOM   4057 N N   . ASP A 1 511 ? 7.978   -4.467  -7.451  1.00 18.57 ? 510  ASP A N   1 
ATOM   4058 C CA  . ASP A 1 511 ? 6.692   -4.269  -6.778  1.00 19.01 ? 510  ASP A CA  1 
ATOM   4059 C C   . ASP A 1 511 ? 6.890   -4.332  -5.262  1.00 18.37 ? 510  ASP A C   1 
ATOM   4060 O O   . ASP A 1 511 ? 8.018   -4.512  -4.783  1.00 18.19 ? 510  ASP A O   1 
ATOM   4061 C CB  . ASP A 1 511 ? 5.632   -5.270  -7.294  1.00 19.08 ? 510  ASP A CB  1 
ATOM   4062 C CG  . ASP A 1 511 ? 5.995   -6.731  -7.025  1.00 20.03 ? 510  ASP A CG  1 
ATOM   4063 O OD1 . ASP A 1 511 ? 6.951   -6.999  -6.273  1.00 19.58 ? 510  ASP A OD1 1 
ATOM   4064 O OD2 . ASP A 1 511 ? 5.365   -7.700  -7.527  1.00 18.42 ? 510  ASP A OD2 1 
ATOM   4065 N N   . GLN A 1 512 ? 5.808   -4.167  -4.503  1.00 18.36 ? 511  GLN A N   1 
ATOM   4066 C CA  . GLN A 1 512 ? 5.839   -4.237  -3.034  1.00 17.87 ? 511  GLN A CA  1 
ATOM   4067 C C   . GLN A 1 512 ? 4.439   -4.475  -2.487  1.00 18.00 ? 511  GLN A C   1 
ATOM   4068 O O   . GLN A 1 512 ? 3.892   -3.672  -1.733  1.00 17.73 ? 511  GLN A O   1 
ATOM   4069 C CB  . GLN A 1 512 ? 6.509   -3.007  -2.376  1.00 18.86 ? 511  GLN A CB  1 
ATOM   4070 C CG  . GLN A 1 512 ? 5.894   -1.633  -2.712  1.00 19.25 ? 511  GLN A CG  1 
ATOM   4071 C CD  . GLN A 1 512 ? 6.183   -1.184  -4.144  1.00 20.06 ? 511  GLN A CD  1 
ATOM   4072 O OE1 . GLN A 1 512 ? 7.314   -1.292  -4.624  1.00 17.98 ? 511  GLN A OE1 1 
ATOM   4073 N NE2 . GLN A 1 512 ? 5.160   -0.674  -4.822  1.00 21.35 ? 511  GLN A NE2 1 
ATOM   4074 N N   . TRP A 1 513 ? 3.851   -5.610  -2.863  1.00 18.00 ? 512  TRP A N   1 
ATOM   4075 C CA  . TRP A 1 513 ? 2.509   -5.926  -2.392  1.00 18.79 ? 512  TRP A CA  1 
ATOM   4076 C C   . TRP A 1 513 ? 2.474   -6.150  -0.881  1.00 19.06 ? 512  TRP A C   1 
ATOM   4077 O O   . TRP A 1 513 ? 1.401   -6.074  -0.239  1.00 19.21 ? 512  TRP A O   1 
ATOM   4078 C CB  . TRP A 1 513 ? 1.972   -7.150  -3.141  1.00 18.75 ? 512  TRP A CB  1 
ATOM   4079 C CG  . TRP A 1 513 ? 1.887   -6.920  -4.611  1.00 19.17 ? 512  TRP A CG  1 
ATOM   4080 C CD1 . TRP A 1 513 ? 2.702   -7.450  -5.576  1.00 20.20 ? 512  TRP A CD1 1 
ATOM   4081 C CD2 . TRP A 1 513 ? 0.949   -6.092  -5.295  1.00 21.98 ? 512  TRP A CD2 1 
ATOM   4082 N NE1 . TRP A 1 513 ? 2.332   -6.991  -6.816  1.00 23.91 ? 512  TRP A NE1 1 
ATOM   4083 C CE2 . TRP A 1 513 ? 1.260   -6.152  -6.676  1.00 23.32 ? 512  TRP A CE2 1 
ATOM   4084 C CE3 . TRP A 1 513 ? -0.118  -5.275  -4.881  1.00 24.79 ? 512  TRP A CE3 1 
ATOM   4085 C CZ2 . TRP A 1 513 ? 0.537   -5.453  -7.640  1.00 24.87 ? 512  TRP A CZ2 1 
ATOM   4086 C CZ3 . TRP A 1 513 ? -0.838  -4.577  -5.847  1.00 27.21 ? 512  TRP A CZ3 1 
ATOM   4087 C CH2 . TRP A 1 513 ? -0.505  -4.675  -7.209  1.00 26.35 ? 512  TRP A CH2 1 
ATOM   4088 N N   . GLY A 1 514 ? 3.651   -6.399  -0.312  1.00 18.35 ? 513  GLY A N   1 
ATOM   4089 C CA  . GLY A 1 514 ? 3.772   -6.782  1.084   1.00 19.01 ? 513  GLY A CA  1 
ATOM   4090 C C   . GLY A 1 514 ? 3.527   -5.700  2.108   1.00 19.50 ? 513  GLY A C   1 
ATOM   4091 O O   . GLY A 1 514 ? 3.464   -5.991  3.294   1.00 19.21 ? 513  GLY A O   1 
ATOM   4092 N N   . VAL A 1 515 ? 3.409   -4.449  1.665   1.00 20.24 ? 514  VAL A N   1 
ATOM   4093 C CA  . VAL A 1 515 ? 3.141   -3.366  2.599   1.00 20.73 ? 514  VAL A CA  1 
ATOM   4094 C C   . VAL A 1 515 ? 1.649   -3.052  2.740   1.00 21.07 ? 514  VAL A C   1 
ATOM   4095 O O   . VAL A 1 515 ? 1.266   -2.264  3.607   1.00 21.53 ? 514  VAL A O   1 
ATOM   4096 C CB  . VAL A 1 515 ? 3.925   -2.078  2.227   1.00 20.87 ? 514  VAL A CB  1 
ATOM   4097 C CG1 . VAL A 1 515 ? 5.437   -2.345  2.229   1.00 21.17 ? 514  VAL A CG1 1 
ATOM   4098 C CG2 . VAL A 1 515 ? 3.464   -1.524  0.895   1.00 21.96 ? 514  VAL A CG2 1 
ATOM   4099 N N   . GLU A 1 516 ? 0.812   -3.703  1.924   1.00 20.88 ? 515  GLU A N   1 
ATOM   4100 C CA  . GLU A 1 516 ? -0.608  -3.342  1.853   1.00 20.76 ? 515  GLU A CA  1 
ATOM   4101 C C   . GLU A 1 516 ? -1.379  -3.733  3.109   1.00 19.41 ? 515  GLU A C   1 
ATOM   4102 O O   . GLU A 1 516 ? -2.117  -2.916  3.658   1.00 17.98 ? 515  GLU A O   1 
ATOM   4103 C CB  . GLU A 1 516 ? -1.285  -3.929  0.600   1.00 21.23 ? 515  GLU A CB  1 
ATOM   4104 C CG  . GLU A 1 516 ? -2.769  -3.575  0.505   1.00 25.86 ? 515  GLU A CG  1 
ATOM   4105 C CD  . GLU A 1 516 ? -3.410  -3.886  -0.843  1.00 31.91 ? 515  GLU A CD  1 
ATOM   4106 O OE1 . GLU A 1 516 ? -4.550  -3.401  -1.054  1.00 34.67 ? 515  GLU A OE1 1 
ATOM   4107 O OE2 . GLU A 1 516 ? -2.804  -4.601  -1.687  1.00 33.00 ? 515  GLU A OE2 1 
ATOM   4108 N N   . LEU A 1 517 ? -1.218  -4.975  3.558   1.00 18.50 ? 516  LEU A N   1 
ATOM   4109 C CA  . LEU A 1 517 ? -2.022  -5.474  4.670   1.00 19.14 ? 516  LEU A CA  1 
ATOM   4110 C C   . LEU A 1 517 ? -1.903  -4.603  5.930   1.00 19.81 ? 516  LEU A C   1 
ATOM   4111 O O   . LEU A 1 517 ? -2.909  -4.238  6.531   1.00 19.66 ? 516  LEU A O   1 
ATOM   4112 C CB  . LEU A 1 517 ? -1.677  -6.929  4.984   1.00 19.12 ? 516  LEU A CB  1 
ATOM   4113 C CG  . LEU A 1 517 ? -2.447  -7.561  6.152   1.00 19.20 ? 516  LEU A CG  1 
ATOM   4114 C CD1 . LEU A 1 517 ? -3.967  -7.588  5.896   1.00 21.96 ? 516  LEU A CD1 1 
ATOM   4115 C CD2 . LEU A 1 517 ? -1.937  -8.954  6.426   1.00 17.94 ? 516  LEU A CD2 1 
ATOM   4116 N N   . GLY A 1 518 ? -0.680  -4.235  6.299   1.00 19.52 ? 517  GLY A N   1 
ATOM   4117 C CA  . GLY A 1 518 ? -0.474  -3.402  7.475   1.00 19.07 ? 517  GLY A CA  1 
ATOM   4118 C C   . GLY A 1 518 ? -1.223  -2.079  7.417   1.00 19.03 ? 517  GLY A C   1 
ATOM   4119 O O   . GLY A 1 518 ? -1.759  -1.611  8.434   1.00 19.14 ? 517  GLY A O   1 
ATOM   4120 N N   . LYS A 1 519 ? -1.257  -1.481  6.232   1.00 18.81 ? 518  LYS A N   1 
ATOM   4121 C CA  . LYS A 1 519 ? -1.981  -0.229  6.008   1.00 19.44 ? 518  LYS A CA  1 
ATOM   4122 C C   . LYS A 1 519 ? -3.477  -0.428  6.183   1.00 19.60 ? 518  LYS A C   1 
ATOM   4123 O O   . LYS A 1 519 ? -4.141  0.392   6.806   1.00 19.86 ? 518  LYS A O   1 
ATOM   4124 C CB  . LYS A 1 519 ? -1.706  0.323   4.609   1.00 19.22 ? 518  LYS A CB  1 
ATOM   4125 C CG  . LYS A 1 519 ? -0.321  0.909   4.417   1.00 19.53 ? 518  LYS A CG  1 
ATOM   4126 C CD  . LYS A 1 519 ? -0.005  0.946   2.934   1.00 21.01 ? 518  LYS A CD  1 
ATOM   4127 C CE  . LYS A 1 519 ? 1.342   1.569   2.658   1.00 23.27 ? 518  LYS A CE  1 
ATOM   4128 N NZ  . LYS A 1 519 ? 1.531   1.691   1.178   1.00 23.49 ? 518  LYS A NZ  1 
ATOM   4129 N N   . GLN A 1 520 ? -4.005  -1.527  5.641   1.00 19.72 ? 519  GLN A N   1 
ATOM   4130 C CA  . GLN A 1 520 ? -5.433  -1.816  5.769   1.00 19.48 ? 519  GLN A CA  1 
ATOM   4131 C C   . GLN A 1 520 ? -5.838  -2.032  7.224   1.00 19.10 ? 519  GLN A C   1 
ATOM   4132 O O   . GLN A 1 520 ? -6.873  -1.513  7.674   1.00 19.07 ? 519  GLN A O   1 
ATOM   4133 C CB  . GLN A 1 520 ? -5.826  -3.034  4.924   1.00 19.53 ? 519  GLN A CB  1 
ATOM   4134 C CG  . GLN A 1 520 ? -5.601  -2.871  3.428   1.00 21.89 ? 519  GLN A CG  1 
ATOM   4135 C CD  . GLN A 1 520 ? -5.872  -4.163  2.680   1.00 24.16 ? 519  GLN A CD  1 
ATOM   4136 O OE1 . GLN A 1 520 ? -5.058  -5.080  2.716   1.00 25.04 ? 519  GLN A OE1 1 
ATOM   4137 N NE2 . GLN A 1 520 ? -7.022  -4.245  2.024   1.00 24.42 ? 519  GLN A NE2 1 
ATOM   4138 N N   . LEU A 1 521 ? -5.048  -2.811  7.967   1.00 18.89 ? 520  LEU A N   1 
ATOM   4139 C CA  . LEU A 1 521 ? -5.434  -3.107  9.348   1.00 19.21 ? 520  LEU A CA  1 
ATOM   4140 C C   . LEU A 1 521 ? -5.301  -1.885  10.259  1.00 19.63 ? 520  LEU A C   1 
ATOM   4141 O O   . LEU A 1 521 ? -6.013  -1.766  11.243  1.00 19.66 ? 520  LEU A O   1 
ATOM   4142 C CB  . LEU A 1 521 ? -4.677  -4.320  9.915   1.00 19.61 ? 520  LEU A CB  1 
ATOM   4143 C CG  . LEU A 1 521 ? -4.844  -5.629  9.144   1.00 19.82 ? 520  LEU A CG  1 
ATOM   4144 C CD1 . LEU A 1 521 ? -4.159  -6.800  9.839   1.00 19.85 ? 520  LEU A CD1 1 
ATOM   4145 C CD2 . LEU A 1 521 ? -6.334  -5.942  8.903   1.00 20.60 ? 520  LEU A CD2 1 
ATOM   4146 N N   . ALA A 1 522 ? -4.397  -0.969  9.912   1.00 19.98 ? 521  ALA A N   1 
ATOM   4147 C CA  . ALA A 1 522 ? -4.226  0.250   10.680  1.00 19.65 ? 521  ALA A CA  1 
ATOM   4148 C C   . ALA A 1 522 ? -5.435  1.169   10.475  1.00 20.40 ? 521  ALA A C   1 
ATOM   4149 O O   . ALA A 1 522 ? -5.887  1.813   11.413  1.00 20.50 ? 521  ALA A O   1 
ATOM   4150 C CB  . ALA A 1 522 ? -2.921  0.958   10.291  1.00 19.49 ? 521  ALA A CB  1 
ATOM   4151 N N   . LYS A 1 523 ? -5.948  1.234   9.246   1.00 21.02 ? 522  LYS A N   1 
ATOM   4152 C CA  . LYS A 1 523 ? -7.121  2.081   8.975   1.00 21.75 ? 522  LYS A CA  1 
ATOM   4153 C C   . LYS A 1 523 ? -8.358  1.596   9.742   1.00 22.65 ? 522  LYS A C   1 
ATOM   4154 O O   . LYS A 1 523 ? -9.205  2.411   10.123  1.00 22.95 ? 522  LYS A O   1 
ATOM   4155 C CB  . LYS A 1 523 ? -7.410  2.177   7.473   1.00 22.10 ? 522  LYS A CB  1 
ATOM   4156 C CG  . LYS A 1 523 ? -6.391  2.996   6.693   1.00 24.18 ? 522  LYS A CG  1 
ATOM   4157 C CD  . LYS A 1 523 ? -6.617  2.860   5.190   0.50 27.12 ? 522  LYS A CD  1 
ATOM   4158 C CE  . LYS A 1 523 ? -6.471  4.190   4.461   0.50 28.20 ? 522  LYS A CE  1 
ATOM   4159 N NZ  . LYS A 1 523 ? -6.529  4.000   2.976   0.50 29.57 ? 522  LYS A NZ  1 
ATOM   4160 N N   . LYS A 1 524 ? -8.445  0.281   9.966   1.00 22.34 ? 523  LYS A N   1 
ATOM   4161 C CA  . LYS A 1 524 ? -9.521  -0.315  10.772  1.00 23.78 ? 523  LYS A CA  1 
ATOM   4162 C C   . LYS A 1 524 ? -9.395  -0.016  12.271  1.00 23.54 ? 523  LYS A C   1 
ATOM   4163 O O   . LYS A 1 524 ? -10.394 0.242   12.934  1.00 24.33 ? 523  LYS A O   1 
ATOM   4164 C CB  . LYS A 1 524 ? -9.598  -1.832  10.538  1.00 24.01 ? 523  LYS A CB  1 
ATOM   4165 C CG  . LYS A 1 524 ? -10.204 -2.214  9.193   1.00 27.11 ? 523  LYS A CG  1 
ATOM   4166 C CD  . LYS A 1 524 ? -10.011 -3.707  8.874   1.00 30.08 ? 523  LYS A CD  1 
ATOM   4167 C CE  . LYS A 1 524 ? -10.088 -3.957  7.363   1.00 32.04 ? 523  LYS A CE  1 
ATOM   4168 N NZ  . LYS A 1 524 ? -9.171  -5.054  6.886   1.00 33.57 ? 523  LYS A NZ  1 
ATOM   4169 N N   . ILE A 1 525 ? -8.170  -0.046  12.794  1.00 23.46 ? 524  ILE A N   1 
ATOM   4170 C CA  . ILE A 1 525 ? -7.935  0.152   14.224  1.00 22.91 ? 524  ILE A CA  1 
ATOM   4171 C C   . ILE A 1 525 ? -8.080  1.618   14.626  1.00 23.66 ? 524  ILE A C   1 
ATOM   4172 O O   . ILE A 1 525 ? -8.450  1.909   15.766  1.00 23.87 ? 524  ILE A O   1 
ATOM   4173 C CB  . ILE A 1 525 ? -6.554  -0.430  14.649  1.00 22.76 ? 524  ILE A CB  1 
ATOM   4174 C CG1 . ILE A 1 525 ? -6.610  -1.962  14.671  1.00 21.80 ? 524  ILE A CG1 1 
ATOM   4175 C CG2 . ILE A 1 525 ? -6.145  0.038   16.046  1.00 19.95 ? 524  ILE A CG2 1 
ATOM   4176 C CD1 . ILE A 1 525 ? -5.261  -2.615  14.591  1.00 21.45 ? 524  ILE A CD1 1 
ATOM   4177 N N   . GLU A 1 526 ? -7.820  2.530   13.690  1.00 24.18 ? 525  GLU A N   1 
ATOM   4178 C CA  . GLU A 1 526 ? -7.805  3.962   13.990  1.00 25.31 ? 525  GLU A CA  1 
ATOM   4179 C C   . GLU A 1 526 ? -9.052  4.479   14.749  1.00 26.12 ? 525  GLU A C   1 
ATOM   4180 O O   . GLU A 1 526 ? -8.897  5.071   15.821  1.00 25.91 ? 525  GLU A O   1 
ATOM   4181 C CB  . GLU A 1 526 ? -7.520  4.793   12.727  1.00 26.00 ? 525  GLU A CB  1 
ATOM   4182 C CG  . GLU A 1 526 ? -6.047  5.103   12.524  1.00 28.34 ? 525  GLU A CG  1 
ATOM   4183 C CD  . GLU A 1 526 ? -5.720  5.668   11.151  1.00 31.63 ? 525  GLU A CD  1 
ATOM   4184 O OE1 . GLU A 1 526 ? -6.413  6.594   10.716  1.00 31.84 ? 525  GLU A OE1 1 
ATOM   4185 O OE2 . GLU A 1 526 ? -4.752  5.181   10.510  1.00 33.96 ? 525  GLU A OE2 1 
ATOM   4186 N N   . PRO A 1 527 ? -10.266 4.260   14.223  1.00 26.73 ? 526  PRO A N   1 
ATOM   4187 C CA  . PRO A 1 527 ? -11.491 4.715   14.911  1.00 27.23 ? 526  PRO A CA  1 
ATOM   4188 C C   . PRO A 1 527 ? -11.813 3.969   16.219  1.00 27.86 ? 526  PRO A C   1 
ATOM   4189 O O   . PRO A 1 527 ? -12.503 4.524   17.074  1.00 27.68 ? 526  PRO A O   1 
ATOM   4190 C CB  . PRO A 1 527 ? -12.595 4.485   13.871  1.00 27.72 ? 526  PRO A CB  1 
ATOM   4191 C CG  . PRO A 1 527 ? -12.063 3.425   12.943  1.00 27.31 ? 526  PRO A CG  1 
ATOM   4192 C CD  . PRO A 1 527 ? -10.570 3.622   12.925  1.00 26.95 ? 526  PRO A CD  1 
ATOM   4193 N N   . GLU A 1 528 ? -11.312 2.744   16.375  1.00 28.00 ? 527  GLU A N   1 
ATOM   4194 C CA  . GLU A 1 528 ? -11.566 1.961   17.580  1.00 29.15 ? 527  GLU A CA  1 
ATOM   4195 C C   . GLU A 1 528 ? -10.845 2.530   18.797  1.00 29.41 ? 527  GLU A C   1 
ATOM   4196 O O   . GLU A 1 528 ? -11.306 2.375   19.923  1.00 29.24 ? 527  GLU A O   1 
ATOM   4197 C CB  . GLU A 1 528 ? -11.174 0.498   17.367  1.00 29.17 ? 527  GLU A CB  1 
ATOM   4198 C CG  . GLU A 1 528 ? -11.954 -0.188  16.256  1.00 30.49 ? 527  GLU A CG  1 
ATOM   4199 C CD  . GLU A 1 528 ? -11.433 -1.579  15.965  1.00 32.72 ? 527  GLU A CD  1 
ATOM   4200 O OE1 . GLU A 1 528 ? -10.230 -1.829  16.199  1.00 32.86 ? 527  GLU A OE1 1 
ATOM   4201 O OE2 . GLU A 1 528 ? -12.232 -2.429  15.522  1.00 35.74 ? 527  GLU A OE2 1 
ATOM   4202 N N   . LEU A 1 529 ? -9.726  3.214   18.557  1.00 29.91 ? 528  LEU A N   1 
ATOM   4203 C CA  . LEU A 1 529 ? -8.955  3.848   19.619  1.00 30.65 ? 528  LEU A CA  1 
ATOM   4204 C C   . LEU A 1 529 ? -9.694  5.016   20.283  1.00 32.11 ? 528  LEU A C   1 
ATOM   4205 O O   . LEU A 1 529 ? -9.439  5.329   21.438  1.00 32.55 ? 528  LEU A O   1 
ATOM   4206 C CB  . LEU A 1 529 ? -7.580  4.299   19.098  1.00 29.79 ? 528  LEU A CB  1 
ATOM   4207 C CG  . LEU A 1 529 ? -6.619  3.158   18.719  1.00 28.53 ? 528  LEU A CG  1 
ATOM   4208 C CD1 . LEU A 1 529 ? -5.331  3.679   18.086  1.00 26.40 ? 528  LEU A CD1 1 
ATOM   4209 C CD2 . LEU A 1 529 ? -6.304  2.280   19.922  1.00 27.80 ? 528  LEU A CD2 1 
ATOM   4210 N N   . GLU A 1 530 ? -10.605 5.649   19.553  1.00 33.90 ? 529  GLU A N   1 
ATOM   4211 C CA  . GLU A 1 530 ? -11.367 6.778   20.094  1.00 35.80 ? 529  GLU A CA  1 
ATOM   4212 C C   . GLU A 1 530 ? -12.415 6.293   21.089  1.00 36.33 ? 529  GLU A C   1 
ATOM   4213 O O   . GLU A 1 530 ? -13.037 5.244   20.892  1.00 36.59 ? 529  GLU A O   1 
ATOM   4214 C CB  . GLU A 1 530 ? -12.062 7.554   18.971  1.00 36.36 ? 529  GLU A CB  1 
ATOM   4215 C CG  . GLU A 1 530 ? -11.143 8.136   17.904  1.00 38.48 ? 529  GLU A CG  1 
ATOM   4216 C CD  . GLU A 1 530 ? -11.859 8.371   16.584  1.00 41.87 ? 529  GLU A CD  1 
ATOM   4217 O OE1 . GLU A 1 530 ? -13.046 7.981   16.462  1.00 44.15 ? 529  GLU A OE1 1 
ATOM   4218 O OE2 . GLU A 1 530 ? -11.234 8.941   15.657  1.00 43.32 ? 529  GLU A OE2 1 
ATOM   4219 N N   . GLY A 1 531 ? -12.605 7.057   22.159  1.00 37.22 ? 530  GLY A N   1 
ATOM   4220 C CA  . GLY A 1 531 ? -13.616 6.736   23.153  1.00 37.78 ? 530  GLY A CA  1 
ATOM   4221 C C   . GLY A 1 531 ? -13.141 5.684   24.133  1.00 38.35 ? 530  GLY A C   1 
ATOM   4222 O O   . GLY A 1 531 ? -12.052 5.120   23.985  1.00 38.35 ? 530  GLY A O   1 
ATOM   4223 N N   . SER A 1 532 ? -13.975 5.400   25.124  1.00 38.67 ? 531  SER A N   1 
ATOM   4224 C CA  . SER A 1 532 ? -13.564 4.584   26.265  1.00 39.23 ? 531  SER A CA  1 
ATOM   4225 C C   . SER A 1 532 ? -14.010 3.117   26.181  1.00 39.06 ? 531  SER A C   1 
ATOM   4226 O O   . SER A 1 532 ? -13.638 2.307   27.031  1.00 39.25 ? 531  SER A O   1 
ATOM   4227 C CB  . SER A 1 532 ? -14.062 5.221   27.570  1.00 39.44 ? 531  SER A CB  1 
ATOM   4228 O OG  . SER A 1 532 ? -14.444 6.576   27.368  1.00 40.82 ? 531  SER A OG  1 
ATOM   4229 N N   . SER A 1 533 ? -14.787 2.776   25.153  1.00 38.96 ? 532  SER A N   1 
ATOM   4230 C CA  . SER A 1 533 ? -15.370 1.433   25.043  1.00 38.57 ? 532  SER A CA  1 
ATOM   4231 C C   . SER A 1 533 ? -14.346 0.335   24.727  1.00 37.76 ? 532  SER A C   1 
ATOM   4232 O O   . SER A 1 533 ? -13.365 0.561   24.003  1.00 37.59 ? 532  SER A O   1 
ATOM   4233 C CB  . SER A 1 533 ? -16.520 1.411   24.030  1.00 38.75 ? 532  SER A CB  1 
ATOM   4234 O OG  . SER A 1 533 ? -16.134 2.008   22.801  1.00 41.05 ? 532  SER A OG  1 
ATOM   4235 N N   . ALA A 1 534 ? -14.581 -0.849  25.293  1.00 36.65 ? 533  ALA A N   1 
ATOM   4236 C CA  . ALA A 1 534 ? -13.738 -2.010  25.058  1.00 35.36 ? 533  ALA A CA  1 
ATOM   4237 C C   . ALA A 1 534 ? -13.857 -2.469  23.611  1.00 34.49 ? 533  ALA A C   1 
ATOM   4238 O O   . ALA A 1 534 ? -14.932 -2.436  23.019  1.00 34.57 ? 533  ALA A O   1 
ATOM   4239 C CB  . ALA A 1 534 ? -14.098 -3.144  26.016  1.00 35.73 ? 533  ALA A CB  1 
ATOM   4240 N N   . VAL A 1 535 ? -12.733 -2.890  23.047  1.00 33.22 ? 534  VAL A N   1 
ATOM   4241 C CA  . VAL A 1 535 ? -12.699 -3.425  21.696  1.00 31.95 ? 534  VAL A CA  1 
ATOM   4242 C C   . VAL A 1 535 ? -12.608 -4.948  21.765  1.00 31.45 ? 534  VAL A C   1 
ATOM   4243 O O   . VAL A 1 535 ? -11.752 -5.494  22.469  1.00 30.96 ? 534  VAL A O   1 
ATOM   4244 C CB  . VAL A 1 535 ? -11.523 -2.809  20.905  1.00 31.96 ? 534  VAL A CB  1 
ATOM   4245 C CG1 . VAL A 1 535 ? -11.308 -3.512  19.579  1.00 31.69 ? 534  VAL A CG1 1 
ATOM   4246 C CG2 . VAL A 1 535 ? -11.757 -1.307  20.703  1.00 30.98 ? 534  VAL A CG2 1 
ATOM   4247 N N   . THR A 1 536 ? -13.501 -5.625  21.044  1.00 30.93 ? 535  THR A N   1 
ATOM   4248 C CA  . THR A 1 536 ? -13.595 -7.085  21.088  1.00 30.73 ? 535  THR A CA  1 
ATOM   4249 C C   . THR A 1 536 ? -13.522 -7.697  19.688  1.00 30.53 ? 535  THR A C   1 
ATOM   4250 O O   . THR A 1 536 ? -13.678 -8.909  19.519  1.00 31.33 ? 535  THR A O   1 
ATOM   4251 C CB  . THR A 1 536 ? -14.914 -7.513  21.788  1.00 31.13 ? 535  THR A CB  1 
ATOM   4252 O OG1 . THR A 1 536 ? -16.026 -6.946  21.090  1.00 30.17 ? 535  THR A OG1 1 
ATOM   4253 C CG2 . THR A 1 536 ? -15.033 -6.896  23.190  1.00 31.60 ? 535  THR A CG2 1 
ATOM   4254 N N   . SER A 1 537 ? -13.263 -6.858  18.690  1.00 30.27 ? 536  SER A N   1 
ATOM   4255 C CA  . SER A 1 537 ? -13.399 -7.256  17.286  1.00 29.72 ? 536  SER A CA  1 
ATOM   4256 C C   . SER A 1 537 ? -12.234 -8.074  16.714  1.00 29.09 ? 536  SER A C   1 
ATOM   4257 O O   . SER A 1 537 ? -12.390 -8.728  15.678  1.00 29.28 ? 536  SER A O   1 
ATOM   4258 C CB  . SER A 1 537 ? -13.664 -6.031  16.410  1.00 30.09 ? 536  SER A CB  1 
ATOM   4259 O OG  . SER A 1 537 ? -12.605 -5.100  16.507  1.00 32.78 ? 536  SER A OG  1 
ATOM   4260 N N   . HIS A 1 538 ? -11.086 -8.042  17.389  1.00 27.08 ? 537  HIS A N   1 
ATOM   4261 C CA  . HIS A 1 538 ? -9.861  -8.694  16.897  1.00 25.97 ? 537  HIS A CA  1 
ATOM   4262 C C   . HIS A 1 538 ? -9.540  -9.967  17.677  1.00 25.60 ? 537  HIS A C   1 
ATOM   4263 O O   . HIS A 1 538 ? -10.348 -10.440 18.475  1.00 26.15 ? 537  HIS A O   1 
ATOM   4264 C CB  . HIS A 1 538 ? -8.672  -7.737  17.031  1.00 25.35 ? 537  HIS A CB  1 
ATOM   4265 C CG  . HIS A 1 538 ? -8.899  -6.396  16.413  1.00 26.01 ? 537  HIS A CG  1 
ATOM   4266 N ND1 . HIS A 1 538 ? -8.522  -6.103  15.121  1.00 25.67 ? 537  HIS A ND1 1 
ATOM   4267 C CD2 . HIS A 1 538 ? -9.454  -5.264  16.912  1.00 27.18 ? 537  HIS A CD2 1 
ATOM   4268 C CE1 . HIS A 1 538 ? -8.845  -4.851  14.846  1.00 27.35 ? 537  HIS A CE1 1 
ATOM   4269 N NE2 . HIS A 1 538 ? -9.411  -4.321  15.915  1.00 27.18 ? 537  HIS A NE2 1 
ATOM   4270 N N   . ASP A 1 539 ? -8.345  -10.513 17.455  1.00 25.04 ? 538  ASP A N   1 
ATOM   4271 C CA  . ASP A 1 539 ? -7.800  -11.547 18.324  1.00 23.90 ? 538  ASP A CA  1 
ATOM   4272 C C   . ASP A 1 539 ? -7.613  -10.957 19.731  1.00 23.61 ? 538  ASP A C   1 
ATOM   4273 O O   . ASP A 1 539 ? -7.581  -9.735  19.904  1.00 23.84 ? 538  ASP A O   1 
ATOM   4274 C CB  . ASP A 1 539 ? -6.455  -11.994 17.769  1.00 23.18 ? 538  ASP A CB  1 
ATOM   4275 C CG  . ASP A 1 539 ? -5.440  -10.875 17.792  1.00 23.46 ? 538  ASP A CG  1 
ATOM   4276 O OD1 . ASP A 1 539 ? -4.649  -10.833 18.752  1.00 21.51 ? 538  ASP A OD1 1 
ATOM   4277 O OD2 . ASP A 1 539 ? -5.381  -9.987  16.912  1.00 22.38 ? 538  ASP A OD2 1 
ATOM   4278 N N   . SER A 1 540 ? -7.483  -11.817 20.734  1.00 23.32 ? 539  SER A N   1 
ATOM   4279 C CA  . SER A 1 540 ? -7.392  -11.360 22.126  1.00 22.57 ? 539  SER A CA  1 
ATOM   4280 C C   . SER A 1 540 ? -6.145  -10.521 22.448  1.00 22.32 ? 539  SER A C   1 
ATOM   4281 O O   . SER A 1 540 ? -6.160  -9.733  23.393  1.00 21.51 ? 539  SER A O   1 
ATOM   4282 C CB  . SER A 1 540 ? -7.533  -12.539 23.105  1.00 22.47 ? 539  SER A CB  1 
ATOM   4283 O OG  . SER A 1 540 ? -6.353  -13.336 23.142  1.00 23.05 ? 539  SER A OG  1 
ATOM   4284 N N   . SER A 1 541 ? -5.084  -10.664 21.659  1.00 22.31 ? 540  SER A N   1 
ATOM   4285 C CA  . SER A 1 541 ? -3.894  -9.853  21.889  1.00 21.66 ? 540  SER A CA  1 
ATOM   4286 C C   . SER A 1 541 ? -4.110  -8.405  21.440  1.00 21.81 ? 540  SER A C   1 
ATOM   4287 O O   . SER A 1 541 ? -3.878  -7.484  22.203  1.00 22.09 ? 540  SER A O   1 
ATOM   4288 C CB  . SER A 1 541 ? -2.670  -10.450 21.184  1.00 21.82 ? 540  SER A CB  1 
ATOM   4289 O OG  . SER A 1 541 ? -1.625  -9.507  21.195  1.00 19.22 ? 540  SER A OG  1 
ATOM   4290 N N   . THR A 1 542 ? -4.550  -8.215  20.198  1.00 21.76 ? 541  THR A N   1 
ATOM   4291 C CA  . THR A 1 542 ? -4.873  -6.887  19.684  1.00 21.49 ? 541  THR A CA  1 
ATOM   4292 C C   . THR A 1 542 ? -5.895  -6.209  20.607  1.00 21.48 ? 541  THR A C   1 
ATOM   4293 O O   . THR A 1 542 ? -5.724  -5.049  20.997  1.00 20.75 ? 541  THR A O   1 
ATOM   4294 C CB  . THR A 1 542 ? -5.397  -7.011  18.240  1.00 20.92 ? 541  THR A CB  1 
ATOM   4295 O OG1 . THR A 1 542 ? -4.371  -7.587  17.417  1.00 20.60 ? 541  THR A OG1 1 
ATOM   4296 C CG2 . THR A 1 542 ? -5.670  -5.652  17.595  1.00 21.43 ? 541  THR A CG2 1 
ATOM   4297 N N   . ASN A 1 543 ? -6.937  -6.957  20.980  1.00 21.49 ? 542  ASN A N   1 
ATOM   4298 C CA  . ASN A 1 543 ? -7.947  -6.475  21.929  1.00 21.84 ? 542  ASN A CA  1 
ATOM   4299 C C   . ASN A 1 543 ? -7.351  -6.057  23.256  1.00 21.32 ? 542  ASN A C   1 
ATOM   4300 O O   . ASN A 1 543 ? -7.721  -5.028  23.817  1.00 21.53 ? 542  ASN A O   1 
ATOM   4301 C CB  . ASN A 1 543 ? -8.993  -7.560  22.218  1.00 21.86 ? 542  ASN A CB  1 
ATOM   4302 C CG  . ASN A 1 543 ? -9.899  -7.835  21.043  1.00 23.07 ? 542  ASN A CG  1 
ATOM   4303 O OD1 . ASN A 1 543 ? -9.960  -7.058  20.080  1.00 22.05 ? 542  ASN A OD1 1 
ATOM   4304 N ND2 . ASN A 1 543 ? -10.618 -8.969  21.113  1.00 21.55 ? 542  ASN A ND2 1 
ATOM   4305 N N   . GLY A 1 544 ? -6.436  -6.877  23.758  1.00 21.15 ? 543  GLY A N   1 
ATOM   4306 C CA  . GLY A 1 544 ? -5.831  -6.664  25.056  1.00 20.54 ? 543  GLY A CA  1 
ATOM   4307 C C   . GLY A 1 544 ? -4.877  -5.478  25.053  1.00 20.37 ? 543  GLY A C   1 
ATOM   4308 O O   . GLY A 1 544 ? -4.807  -4.730  26.011  1.00 20.37 ? 543  GLY A O   1 
ATOM   4309 N N   . LEU A 1 545 ? -4.147  -5.315  23.957  1.00 19.90 ? 544  LEU A N   1 
ATOM   4310 C CA  . LEU A 1 545 ? -3.255  -4.170  23.808  1.00 20.07 ? 544  LEU A CA  1 
ATOM   4311 C C   . LEU A 1 545 ? -4.052  -2.878  23.734  1.00 20.07 ? 544  LEU A C   1 
ATOM   4312 O O   . LEU A 1 545 ? -3.662  -1.876  24.342  1.00 20.24 ? 544  LEU A O   1 
ATOM   4313 C CB  . LEU A 1 545 ? -2.390  -4.324  22.551  1.00 19.44 ? 544  LEU A CB  1 
ATOM   4314 C CG  . LEU A 1 545 ? -1.353  -5.447  22.615  1.00 17.93 ? 544  LEU A CG  1 
ATOM   4315 C CD1 . LEU A 1 545 ? -0.768  -5.789  21.243  1.00 18.21 ? 544  LEU A CD1 1 
ATOM   4316 C CD2 . LEU A 1 545 ? -0.275  -5.058  23.607  1.00 19.85 ? 544  LEU A CD2 1 
ATOM   4317 N N   . ILE A 1 546 ? -5.158  -2.906  22.986  1.00 20.36 ? 545  ILE A N   1 
ATOM   4318 C CA  . ILE A 1 546 ? -6.082  -1.757  22.921  1.00 20.97 ? 545  ILE A CA  1 
ATOM   4319 C C   . ILE A 1 546 ? -6.648  -1.378  24.294  1.00 21.52 ? 545  ILE A C   1 
ATOM   4320 O O   . ILE A 1 546 ? -6.687  -0.197  24.652  1.00 20.61 ? 545  ILE A O   1 
ATOM   4321 C CB  . ILE A 1 546 ? -7.192  -1.973  21.878  1.00 21.04 ? 545  ILE A CB  1 
ATOM   4322 C CG1 . ILE A 1 546 ? -6.584  -1.973  20.461  1.00 22.00 ? 545  ILE A CG1 1 
ATOM   4323 C CG2 . ILE A 1 546 ? -8.233  -0.875  21.985  1.00 21.14 ? 545  ILE A CG2 1 
ATOM   4324 C CD1 . ILE A 1 546 ? -7.505  -2.474  19.372  1.00 22.63 ? 545  ILE A CD1 1 
ATOM   4325 N N   . SER A 1 547 ? -7.064  -2.377  25.069  1.00 22.03 ? 546  SER A N   1 
ATOM   4326 C CA  . SER A 1 547 ? -7.509  -2.127  26.445  1.00 22.49 ? 546  SER A CA  1 
ATOM   4327 C C   . SER A 1 547 ? -6.455  -1.456  27.310  1.00 21.82 ? 546  SER A C   1 
ATOM   4328 O O   . SER A 1 547 ? -6.764  -0.532  28.055  1.00 22.21 ? 546  SER A O   1 
ATOM   4329 C CB  . SER A 1 547 ? -7.936  -3.424  27.115  1.00 22.48 ? 546  SER A CB  1 
ATOM   4330 O OG  . SER A 1 547 ? -9.157  -3.835  26.562  1.00 26.98 ? 546  SER A OG  1 
ATOM   4331 N N   . PHE A 1 548 ? -5.219  -1.942  27.216  1.00 21.63 ? 547  PHE A N   1 
ATOM   4332 C CA  . PHE A 1 548 ? -4.101  -1.359  27.940  1.00 21.62 ? 547  PHE A CA  1 
ATOM   4333 C C   . PHE A 1 548 ? -3.925  0.099   27.539  1.00 21.31 ? 547  PHE A C   1 
ATOM   4334 O O   . PHE A 1 548 ? -3.752  0.977   28.392  1.00 21.47 ? 547  PHE A O   1 
ATOM   4335 C CB  . PHE A 1 548 ? -2.810  -2.148  27.666  1.00 21.60 ? 547  PHE A CB  1 
ATOM   4336 C CG  . PHE A 1 548 ? -1.629  -1.700  28.489  1.00 22.28 ? 547  PHE A CG  1 
ATOM   4337 C CD1 . PHE A 1 548 ? -1.478  -2.114  29.810  1.00 22.96 ? 547  PHE A CD1 1 
ATOM   4338 C CD2 . PHE A 1 548 ? -0.655  -0.866  27.935  1.00 21.97 ? 547  PHE A CD2 1 
ATOM   4339 C CE1 . PHE A 1 548 ? -0.379  -1.693  30.562  1.00 24.88 ? 547  PHE A CE1 1 
ATOM   4340 C CE2 . PHE A 1 548 ? 0.446   -0.450  28.674  1.00 22.97 ? 547  PHE A CE2 1 
ATOM   4341 C CZ  . PHE A 1 548 ? 0.592   -0.862  29.992  1.00 22.83 ? 547  PHE A CZ  1 
ATOM   4342 N N   . ILE A 1 549 ? -3.963  0.354   26.233  1.00 21.14 ? 548  ILE A N   1 
ATOM   4343 C CA  . ILE A 1 549 ? -3.791  1.712   25.718  1.00 21.21 ? 548  ILE A CA  1 
ATOM   4344 C C   . ILE A 1 549 ? -4.877  2.649   26.283  1.00 21.87 ? 548  ILE A C   1 
ATOM   4345 O O   . ILE A 1 549 ? -4.574  3.738   26.795  1.00 21.00 ? 548  ILE A O   1 
ATOM   4346 C CB  . ILE A 1 549 ? -3.764  1.693   24.163  1.00 21.35 ? 548  ILE A CB  1 
ATOM   4347 C CG1 . ILE A 1 549 ? -2.428  1.119   23.664  1.00 21.29 ? 548  ILE A CG1 1 
ATOM   4348 C CG2 . ILE A 1 549 ? -4.028  3.084   23.586  1.00 20.52 ? 548  ILE A CG2 1 
ATOM   4349 C CD1 . ILE A 1 549 ? -2.496  0.435   22.294  1.00 23.53 ? 548  ILE A CD1 1 
ATOM   4350 N N   . LYS A 1 550 ? -6.126  2.206   26.217  1.00 22.65 ? 549  LYS A N   1 
ATOM   4351 C CA  . LYS A 1 550 ? -7.232  2.989   26.769  1.00 24.30 ? 549  LYS A CA  1 
ATOM   4352 C C   . LYS A 1 550 ? -7.105  3.190   28.272  1.00 24.99 ? 549  LYS A C   1 
ATOM   4353 O O   . LYS A 1 550 ? -7.322  4.289   28.761  1.00 25.52 ? 549  LYS A O   1 
ATOM   4354 C CB  . LYS A 1 550 ? -8.586  2.384   26.373  1.00 24.06 ? 549  LYS A CB  1 
ATOM   4355 C CG  . LYS A 1 550 ? -8.790  2.396   24.863  1.00 25.37 ? 549  LYS A CG  1 
ATOM   4356 C CD  . LYS A 1 550 ? -10.179 1.963   24.467  1.00 27.70 ? 549  LYS A CD  1 
ATOM   4357 C CE  . LYS A 1 550 ? -10.422 2.243   23.007  1.00 27.59 ? 549  LYS A CE  1 
ATOM   4358 N NZ  . LYS A 1 550 ? -11.828 2.619   22.750  1.00 27.06 ? 549  LYS A NZ  1 
ATOM   4359 N N   . GLN A 1 551 ? -6.710  2.146   29.001  1.00 25.98 ? 550  GLN A N   1 
ATOM   4360 C CA  . GLN A 1 551 ? -6.550  2.265   30.445  1.00 27.25 ? 550  GLN A CA  1 
ATOM   4361 C C   . GLN A 1 551 ? -5.453  3.247   30.818  1.00 27.48 ? 550  GLN A C   1 
ATOM   4362 O O   . GLN A 1 551 ? -5.625  4.036   31.734  1.00 27.14 ? 550  GLN A O   1 
ATOM   4363 C CB  . GLN A 1 551 ? -6.262  0.905   31.073  1.00 27.93 ? 550  GLN A CB  1 
ATOM   4364 C CG  . GLN A 1 551 ? -6.699  0.794   32.519  1.00 30.26 ? 550  GLN A CG  1 
ATOM   4365 C CD  . GLN A 1 551 ? -5.543  0.861   33.495  1.00 34.06 ? 550  GLN A CD  1 
ATOM   4366 O OE1 . GLN A 1 551 ? -5.696  1.359   34.623  1.00 36.69 ? 550  GLN A OE1 1 
ATOM   4367 N NE2 . GLN A 1 551 ? -4.384  0.346   33.082  1.00 33.04 ? 550  GLN A NE2 1 
ATOM   4368 N N   . GLN A 1 552 ? -4.337  3.215   30.087  1.00 27.93 ? 551  GLN A N   1 
ATOM   4369 C CA  . GLN A 1 552 ? -3.134  3.964   30.463  1.00 28.41 ? 551  GLN A CA  1 
ATOM   4370 C C   . GLN A 1 552 ? -3.034  5.378   29.896  1.00 29.57 ? 551  GLN A C   1 
ATOM   4371 O O   . GLN A 1 552 ? -2.147  6.148   30.291  1.00 29.65 ? 551  GLN A O   1 
ATOM   4372 C CB  . GLN A 1 552 ? -1.876  3.163   30.114  1.00 28.07 ? 551  GLN A CB  1 
ATOM   4373 C CG  . GLN A 1 552 ? -1.692  1.910   30.978  1.00 27.75 ? 551  GLN A CG  1 
ATOM   4374 C CD  . GLN A 1 552 ? -1.587  2.218   32.457  1.00 28.56 ? 551  GLN A CD  1 
ATOM   4375 O OE1 . GLN A 1 552 ? -2.344  1.680   33.263  1.00 32.68 ? 551  GLN A OE1 1 
ATOM   4376 N NE2 . GLN A 1 552 ? -0.666  3.084   32.815  1.00 27.23 ? 551  GLN A NE2 1 
ATOM   4377 N N   . ARG A 1 553 ? -3.945  5.699   28.980  1.00 31.37 ? 552  ARG A N   1 
ATOM   4378 C CA  . ARG A 1 553 ? -4.014  6.974   28.271  1.00 33.88 ? 552  ARG A CA  1 
ATOM   4379 C C   . ARG A 1 553 ? -4.008  8.214   29.173  1.00 35.28 ? 552  ARG A C   1 
ATOM   4380 O O   . ARG A 1 553 ? -3.394  9.235   28.831  1.00 35.35 ? 552  ARG A O   1 
ATOM   4381 C CB  . ARG A 1 553 ? -5.292  6.990   27.433  1.00 33.93 ? 552  ARG A CB  1 
ATOM   4382 C CG  . ARG A 1 553 ? -5.337  8.016   26.333  1.00 35.88 ? 552  ARG A CG  1 
ATOM   4383 C CD  . ARG A 1 553 ? -5.978  7.491   25.067  1.00 36.80 ? 552  ARG A CD  1 
ATOM   4384 N NE  . ARG A 1 553 ? -7.384  7.123   25.260  1.00 36.73 ? 552  ARG A NE  1 
ATOM   4385 C CZ  . ARG A 1 553 ? -8.100  6.424   24.386  1.00 34.81 ? 552  ARG A CZ  1 
ATOM   4386 N NH1 . ARG A 1 553 ? -9.371  6.144   24.639  1.00 34.91 ? 552  ARG A NH1 1 
ATOM   4387 N NH2 . ARG A 1 553 ? -7.545  5.996   23.257  1.00 34.36 ? 552  ARG A NH2 1 
ATOM   4388 N N   . ASP A 1 554 ? -4.708  8.130   30.299  1.00 36.97 ? 553  ASP A N   1 
ATOM   4389 C CA  . ASP A 1 554 ? -4.937  9.302   31.150  1.00 39.43 ? 553  ASP A CA  1 
ATOM   4390 C C   . ASP A 1 554 ? -4.231  9.208   32.509  1.00 40.12 ? 553  ASP A C   1 
ATOM   4391 O O   . ASP A 1 554 ? -4.535  9.971   33.433  1.00 40.69 ? 553  ASP A O   1 
ATOM   4392 C CB  . ASP A 1 554 ? -6.444  9.547   31.345  1.00 39.71 ? 553  ASP A CB  1 
ATOM   4393 C CG  . ASP A 1 554 ? -7.128  10.050  30.083  1.00 41.40 ? 553  ASP A CG  1 
ATOM   4394 O OD1 . ASP A 1 554 ? -6.877  11.209  29.682  1.00 44.43 ? 553  ASP A OD1 1 
ATOM   4395 O OD2 . ASP A 1 554 ? -7.941  9.359   29.425  1.00 43.44 ? 553  ASP A OD2 1 
ATOM   4396 N N   . THR A 1 555 ? -3.286  8.275   32.621  1.00 41.06 ? 554  THR A N   1 
ATOM   4397 C CA  . THR A 1 555 ? -2.459  8.153   33.815  1.00 41.67 ? 554  THR A CA  1 
ATOM   4398 C C   . THR A 1 555 ? -1.560  9.384   33.961  1.00 42.41 ? 554  THR A C   1 
ATOM   4399 O O   . THR A 1 555 ? -0.763  9.697   33.066  1.00 42.42 ? 554  THR A O   1 
ATOM   4400 C CB  . THR A 1 555 ? -1.611  6.871   33.746  1.00 41.59 ? 554  THR A CB  1 
ATOM   4401 O OG1 . THR A 1 555 ? -2.476  5.731   33.746  1.00 41.71 ? 554  THR A OG1 1 
ATOM   4402 C CG2 . THR A 1 555 ? -0.791  6.697   35.024  1.00 41.91 ? 554  THR A CG2 1 
ATOM   4403 N N   . LYS A 1 556 ? -1.696  10.077  35.091  1.00 42.88 ? 555  LYS A N   1 
ATOM   4404 C CA  . LYS A 1 556 ? -0.907  11.278  35.350  1.00 43.38 ? 555  LYS A CA  1 
ATOM   4405 C C   . LYS A 1 556 ? 0.405   10.930  36.062  1.00 43.29 ? 555  LYS A C   1 
ATOM   4406 O O   . LYS A 1 556 ? 0.476   10.953  37.292  1.00 43.53 ? 555  LYS A O   1 
ATOM   4407 C CB  . LYS A 1 556 ? -1.718  12.309  36.155  1.00 43.55 ? 555  LYS A CB  1 
ATOM   4408 C CG  . LYS A 1 556 ? -3.039  12.736  35.501  1.00 44.70 ? 555  LYS A CG  1 
ATOM   4409 C CD  . LYS A 1 556 ? -3.199  14.262  35.483  1.00 46.11 ? 555  LYS A CD  1 
ATOM   4410 C CE  . LYS A 1 556 ? -4.668  14.681  35.569  1.00 46.81 ? 555  LYS A CE  1 
ATOM   4411 N NZ  . LYS A 1 556 ? -4.865  15.857  36.477  1.00 47.31 ? 555  LYS A NZ  1 
ATOM   4412 N N   . LEU A 1 557 ? 1.435   10.600  35.281  1.00 43.12 ? 556  LEU A N   1 
ATOM   4413 C CA  . LEU A 1 557 ? 2.765   10.339  35.827  1.00 42.96 ? 556  LEU A CA  1 
ATOM   4414 C C   . LEU A 1 557 ? 3.473   11.646  36.172  1.00 43.25 ? 556  LEU A C   1 
ATOM   4415 O O   . LEU A 1 557 ? 2.937   12.734  35.942  1.00 43.66 ? 556  LEU A O   1 
ATOM   4416 C CB  . LEU A 1 557 ? 3.624   9.526   34.847  1.00 42.74 ? 556  LEU A CB  1 
ATOM   4417 C CG  . LEU A 1 557 ? 3.198   8.114   34.428  1.00 41.54 ? 556  LEU A CG  1 
ATOM   4418 C CD1 . LEU A 1 557 ? 4.241   7.527   33.486  1.00 40.33 ? 556  LEU A CD1 1 
ATOM   4419 C CD2 . LEU A 1 557 ? 2.965   7.190   35.629  1.00 40.12 ? 556  LEU A CD2 1 
ATOM   4420 N N   . ALA B 1 2   ? 28.867  -29.724 24.179  1.00 25.24 ? 1    ALA B N   1 
ATOM   4421 C CA  . ALA B 1 2   ? 28.411  -28.457 24.815  1.00 24.47 ? 1    ALA B CA  1 
ATOM   4422 C C   . ALA B 1 2   ? 27.269  -28.731 25.773  1.00 24.20 ? 1    ALA B C   1 
ATOM   4423 O O   . ALA B 1 2   ? 26.391  -29.559 25.484  1.00 24.29 ? 1    ALA B O   1 
ATOM   4424 C CB  . ALA B 1 2   ? 27.986  -27.455 23.760  1.00 24.48 ? 1    ALA B CB  1 
ATOM   4425 N N   . ALA B 1 3   ? 27.260  -28.010 26.892  1.00 23.95 ? 2    ALA B N   1 
ATOM   4426 C CA  . ALA B 1 3   ? 26.281  -28.239 27.951  1.00 23.59 ? 2    ALA B CA  1 
ATOM   4427 C C   . ALA B 1 3   ? 24.835  -28.161 27.466  1.00 23.77 ? 2    ALA B C   1 
ATOM   4428 O O   . ALA B 1 3   ? 24.013  -29.001 27.827  1.00 23.46 ? 2    ALA B O   1 
ATOM   4429 C CB  . ALA B 1 3   ? 26.508  -27.278 29.121  1.00 23.77 ? 2    ALA B CB  1 
ATOM   4430 N N   . LEU B 1 4   ? 24.507  -27.154 26.657  1.00 23.17 ? 3    LEU B N   1 
ATOM   4431 C CA  . LEU B 1 4   ? 23.137  -27.030 26.177  1.00 22.70 ? 3    LEU B CA  1 
ATOM   4432 C C   . LEU B 1 4   ? 22.662  -28.245 25.377  1.00 22.70 ? 3    LEU B C   1 
ATOM   4433 O O   . LEU B 1 4   ? 21.567  -28.749 25.611  1.00 22.65 ? 3    LEU B O   1 
ATOM   4434 C CB  . LEU B 1 4   ? 22.930  -25.741 25.372  1.00 22.36 ? 3    LEU B CB  1 
ATOM   4435 C CG  . LEU B 1 4   ? 21.476  -25.519 24.935  1.00 23.05 ? 3    LEU B CG  1 
ATOM   4436 C CD1 . LEU B 1 4   ? 20.551  -25.348 26.152  1.00 21.58 ? 3    LEU B CD1 1 
ATOM   4437 C CD2 . LEU B 1 4   ? 21.371  -24.319 23.991  1.00 23.04 ? 3    LEU B CD2 1 
ATOM   4438 N N   . THR B 1 5   ? 23.494  -28.725 24.457  1.00 22.62 ? 4    THR B N   1 
ATOM   4439 C CA  . THR B 1 5   ? 23.095  -29.835 23.590  1.00 23.39 ? 4    THR B CA  1 
ATOM   4440 C C   . THR B 1 5   ? 22.949  -31.158 24.356  1.00 23.61 ? 4    THR B C   1 
ATOM   4441 O O   . THR B 1 5   ? 22.141  -32.014 23.979  1.00 23.94 ? 4    THR B O   1 
ATOM   4442 C CB  . THR B 1 5   ? 24.051  -29.962 22.391  1.00 23.25 ? 4    THR B CB  1 
ATOM   4443 O OG1 A THR B 1 5   ? 24.274  -28.666 21.821  0.50 22.68 ? 4    THR B OG1 1 
ATOM   4444 O OG1 B THR B 1 5   ? 25.332  -29.426 22.724  0.50 23.28 ? 4    THR B OG1 1 
ATOM   4445 C CG2 A THR B 1 5   ? 23.418  -30.754 21.257  0.50 24.16 ? 4    THR B CG2 1 
ATOM   4446 C CG2 B THR B 1 5   ? 23.574  -29.034 21.270  0.50 23.70 ? 4    THR B CG2 1 
ATOM   4447 N N   . ARG B 1 6   ? 23.694  -31.285 25.449  1.00 24.54 ? 5    ARG B N   1 
ATOM   4448 C CA  . ARG B 1 6   ? 23.673  -32.499 26.276  1.00 25.37 ? 5    ARG B CA  1 
ATOM   4449 C C   . ARG B 1 6   ? 22.545  -32.447 27.305  1.00 25.38 ? 5    ARG B C   1 
ATOM   4450 O O   . ARG B 1 6   ? 22.292  -33.420 28.019  1.00 25.70 ? 5    ARG B O   1 
ATOM   4451 C CB  . ARG B 1 6   ? 25.008  -32.659 27.016  1.00 25.42 ? 5    ARG B CB  1 
ATOM   4452 C CG  . ARG B 1 6   ? 26.249  -32.779 26.147  1.00 28.01 ? 5    ARG B CG  1 
ATOM   4453 C CD  . ARG B 1 6   ? 26.536  -34.194 25.655  1.00 33.39 ? 5    ARG B CD  1 
ATOM   4454 N NE  . ARG B 1 6   ? 27.731  -34.256 24.805  1.00 38.31 ? 5    ARG B NE  1 
ATOM   4455 C CZ  . ARG B 1 6   ? 28.978  -34.425 25.246  1.00 39.84 ? 5    ARG B CZ  1 
ATOM   4456 N NH1 . ARG B 1 6   ? 29.229  -34.551 26.547  1.00 41.02 ? 5    ARG B NH1 1 
ATOM   4457 N NH2 . ARG B 1 6   ? 29.981  -34.469 24.379  1.00 40.49 ? 5    ARG B NH2 1 
ATOM   4458 N N   . ASN B 1 7   ? 21.872  -31.305 27.391  1.00 24.99 ? 6    ASN B N   1 
ATOM   4459 C CA  . ASN B 1 7   ? 20.847  -31.097 28.406  1.00 25.20 ? 6    ASN B CA  1 
ATOM   4460 C C   . ASN B 1 7   ? 19.552  -31.775 27.974  1.00 25.28 ? 6    ASN B C   1 
ATOM   4461 O O   . ASN B 1 7   ? 19.075  -31.534 26.864  1.00 25.37 ? 6    ASN B O   1 
ATOM   4462 C CB  . ASN B 1 7   ? 20.675  -29.592 28.660  1.00 24.63 ? 6    ASN B CB  1 
ATOM   4463 C CG  . ASN B 1 7   ? 19.604  -29.284 29.666  1.00 24.41 ? 6    ASN B CG  1 
ATOM   4464 O OD1 . ASN B 1 7   ? 18.427  -29.440 29.390  1.00 23.55 ? 6    ASN B OD1 1 
ATOM   4465 N ND2 . ASN B 1 7   ? 20.007  -28.848 30.846  1.00 25.23 ? 6    ASN B ND2 1 
ATOM   4466 N N   . PRO B 1 8   ? 19.000  -32.646 28.827  1.00 25.90 ? 7    PRO B N   1 
ATOM   4467 C CA  . PRO B 1 8   ? 17.784  -33.405 28.486  1.00 25.80 ? 7    PRO B CA  1 
ATOM   4468 C C   . PRO B 1 8   ? 16.544  -32.533 28.267  1.00 25.49 ? 7    PRO B C   1 
ATOM   4469 O O   . PRO B 1 8   ? 15.719  -32.905 27.433  1.00 25.69 ? 7    PRO B O   1 
ATOM   4470 C CB  . PRO B 1 8   ? 17.561  -34.322 29.702  1.00 25.94 ? 7    PRO B CB  1 
ATOM   4471 C CG  . PRO B 1 8   ? 18.822  -34.262 30.502  1.00 26.51 ? 7    PRO B CG  1 
ATOM   4472 C CD  . PRO B 1 8   ? 19.501  -32.970 30.174  1.00 25.47 ? 7    PRO B CD  1 
ATOM   4473 N N   . GLN B 1 9   ? 16.417  -31.423 28.996  1.00 25.17 ? 8    GLN B N   1 
ATOM   4474 C CA  . GLN B 1 9   ? 15.292  -30.494 28.825  1.00 25.19 ? 8    GLN B CA  1 
ATOM   4475 C C   . GLN B 1 9   ? 15.367  -29.850 27.433  1.00 25.08 ? 8    GLN B C   1 
ATOM   4476 O O   . GLN B 1 9   ? 14.337  -29.631 26.795  1.00 24.56 ? 8    GLN B O   1 
ATOM   4477 C CB  . GLN B 1 9   ? 15.276  -29.424 29.920  1.00 25.03 ? 8    GLN B CB  1 
ATOM   4478 C CG  . GLN B 1 9   ? 14.707  -29.900 31.279  1.00 25.72 ? 8    GLN B CG  1 
ATOM   4479 C CD  . GLN B 1 9   ? 15.533  -31.029 31.902  1.00 24.47 ? 8    GLN B CD  1 
ATOM   4480 O OE1 . GLN B 1 9   ? 15.011  -32.118 32.172  1.00 27.26 ? 8    GLN B OE1 1 
ATOM   4481 N NE2 . GLN B 1 9   ? 16.810  -30.772 32.133  1.00 22.24 ? 8    GLN B NE2 1 
ATOM   4482 N N   . PHE B 1 10  ? 16.589  -29.574 26.975  1.00 25.04 ? 9    PHE B N   1 
ATOM   4483 C CA  . PHE B 1 10  ? 16.804  -29.046 25.629  1.00 25.18 ? 9    PHE B CA  1 
ATOM   4484 C C   . PHE B 1 10  ? 16.450  -30.069 24.558  1.00 25.40 ? 9    PHE B C   1 
ATOM   4485 O O   . PHE B 1 10  ? 15.722  -29.757 23.612  1.00 24.69 ? 9    PHE B O   1 
ATOM   4486 C CB  . PHE B 1 10  ? 18.237  -28.546 25.401  1.00 25.09 ? 9    PHE B CB  1 
ATOM   4487 C CG  . PHE B 1 10  ? 18.444  -27.999 24.017  1.00 26.58 ? 9    PHE B CG  1 
ATOM   4488 C CD1 . PHE B 1 10  ? 17.846  -26.800 23.641  1.00 27.12 ? 9    PHE B CD1 1 
ATOM   4489 C CD2 . PHE B 1 10  ? 19.184  -28.704 23.079  1.00 27.50 ? 9    PHE B CD2 1 
ATOM   4490 C CE1 . PHE B 1 10  ? 18.002  -26.293 22.350  1.00 28.21 ? 9    PHE B CE1 1 
ATOM   4491 C CE2 . PHE B 1 10  ? 19.349  -28.208 21.782  1.00 29.28 ? 9    PHE B CE2 1 
ATOM   4492 C CZ  . PHE B 1 10  ? 18.747  -26.997 21.422  1.00 29.04 ? 9    PHE B CZ  1 
ATOM   4493 N N   . GLN B 1 11  ? 16.975  -31.287 24.699  1.00 26.01 ? 10   GLN B N   1 
ATOM   4494 C CA  . GLN B 1 11  ? 16.635  -32.371 23.785  1.00 26.49 ? 10   GLN B CA  1 
ATOM   4495 C C   . GLN B 1 11  ? 15.119  -32.618 23.690  1.00 26.23 ? 10   GLN B C   1 
ATOM   4496 O O   . GLN B 1 11  ? 14.594  -32.828 22.596  1.00 25.79 ? 10   GLN B O   1 
ATOM   4497 C CB  . GLN B 1 11  ? 17.397  -33.649 24.157  1.00 26.72 ? 10   GLN B CB  1 
ATOM   4498 C CG  . GLN B 1 11  ? 18.890  -33.558 23.863  1.00 29.05 ? 10   GLN B CG  1 
ATOM   4499 C CD  . GLN B 1 11  ? 19.722  -34.596 24.612  1.00 33.19 ? 10   GLN B CD  1 
ATOM   4500 O OE1 . GLN B 1 11  ? 19.179  -35.554 25.188  1.00 35.75 ? 10   GLN B OE1 1 
ATOM   4501 N NE2 . GLN B 1 11  ? 21.040  -34.408 24.605  1.00 33.52 ? 10   GLN B NE2 1 
ATOM   4502 N N   . LYS B 1 12  ? 14.416  -32.585 24.823  1.00 26.42 ? 11   LYS B N   1 
ATOM   4503 C CA  . LYS B 1 12  ? 12.953  -32.706 24.804  1.00 27.15 ? 11   LYS B CA  1 
ATOM   4504 C C   . LYS B 1 12  ? 12.299  -31.556 24.038  1.00 26.94 ? 11   LYS B C   1 
ATOM   4505 O O   . LYS B 1 12  ? 11.396  -31.768 23.238  1.00 26.84 ? 11   LYS B O   1 
ATOM   4506 C CB  . LYS B 1 12  ? 12.380  -32.798 26.224  1.00 27.81 ? 11   LYS B CB  1 
ATOM   4507 C CG  . LYS B 1 12  ? 10.861  -32.671 26.299  1.00 29.79 ? 11   LYS B CG  1 
ATOM   4508 C CD  . LYS B 1 12  ? 10.198  -33.947 26.788  1.00 34.19 ? 11   LYS B CD  1 
ATOM   4509 C CE  . LYS B 1 12  ? 8.780   -33.667 27.289  1.00 35.84 ? 11   LYS B CE  1 
ATOM   4510 N NZ  . LYS B 1 12  ? 8.763   -32.938 28.603  1.00 36.13 ? 11   LYS B NZ  1 
ATOM   4511 N N   . LEU B 1 13  ? 12.750  -30.335 24.303  1.00 27.25 ? 12   LEU B N   1 
ATOM   4512 C CA  . LEU B 1 13  ? 12.233  -29.163 23.600  1.00 27.25 ? 12   LEU B CA  1 
ATOM   4513 C C   . LEU B 1 13  ? 12.450  -29.302 22.093  1.00 27.56 ? 12   LEU B C   1 
ATOM   4514 O O   . LEU B 1 13  ? 11.545  -29.065 21.299  1.00 27.93 ? 12   LEU B O   1 
ATOM   4515 C CB  . LEU B 1 13  ? 12.921  -27.906 24.131  1.00 27.22 ? 12   LEU B CB  1 
ATOM   4516 C CG  . LEU B 1 13  ? 12.470  -26.541 23.606  1.00 27.87 ? 12   LEU B CG  1 
ATOM   4517 C CD1 . LEU B 1 13  ? 11.184  -26.065 24.310  1.00 26.56 ? 12   LEU B CD1 1 
ATOM   4518 C CD2 . LEU B 1 13  ? 13.613  -25.538 23.778  1.00 28.18 ? 12   LEU B CD2 1 
ATOM   4519 N N   . LEU B 1 14  ? 13.657  -29.714 21.715  1.00 27.91 ? 13   LEU B N   1 
ATOM   4520 C CA  . LEU B 1 14  ? 14.028  -29.935 20.327  1.00 28.42 ? 13   LEU B CA  1 
ATOM   4521 C C   . LEU B 1 14  ? 13.185  -31.017 19.641  1.00 28.58 ? 13   LEU B C   1 
ATOM   4522 O O   . LEU B 1 14  ? 12.713  -30.819 18.518  1.00 28.14 ? 13   LEU B O   1 
ATOM   4523 C CB  . LEU B 1 14  ? 15.524  -30.277 20.257  1.00 28.80 ? 13   LEU B CB  1 
ATOM   4524 C CG  . LEU B 1 14  ? 16.308  -29.973 18.981  1.00 30.01 ? 13   LEU B CG  1 
ATOM   4525 C CD1 . LEU B 1 14  ? 16.196  -28.496 18.573  1.00 30.68 ? 13   LEU B CD1 1 
ATOM   4526 C CD2 . LEU B 1 14  ? 17.771  -30.367 19.172  1.00 30.08 ? 13   LEU B CD2 1 
ATOM   4527 N N   . GLU B 1 15  ? 12.997  -32.157 20.313  1.00 29.06 ? 14   GLU B N   1 
ATOM   4528 C CA  . GLU B 1 15  ? 12.152  -33.229 19.778  1.00 29.32 ? 14   GLU B CA  1 
ATOM   4529 C C   . GLU B 1 15  ? 10.686  -32.803 19.663  1.00 28.40 ? 14   GLU B C   1 
ATOM   4530 O O   . GLU B 1 15  ? 9.996   -33.197 18.725  1.00 28.45 ? 14   GLU B O   1 
ATOM   4531 C CB  . GLU B 1 15  ? 12.292  -34.531 20.602  1.00 30.20 ? 14   GLU B CB  1 
ATOM   4532 C CG  . GLU B 1 15  ? 11.436  -35.709 20.119  1.00 33.84 ? 14   GLU B CG  1 
ATOM   4533 C CD  . GLU B 1 15  ? 11.486  -35.928 18.609  1.00 38.84 ? 14   GLU B CD  1 
ATOM   4534 O OE1 . GLU B 1 15  ? 12.604  -35.975 18.045  1.00 41.04 ? 14   GLU B OE1 1 
ATOM   4535 O OE2 . GLU B 1 15  ? 10.404  -36.048 17.977  1.00 41.05 ? 14   GLU B OE2 1 
ATOM   4536 N N   . TRP B 1 16  ? 10.204  -32.007 20.613  1.00 27.77 ? 15   TRP B N   1 
ATOM   4537 C CA  . TRP B 1 16  ? 8.846   -31.486 20.512  1.00 26.95 ? 15   TRP B CA  1 
ATOM   4538 C C   . TRP B 1 16  ? 8.727   -30.604 19.274  1.00 26.65 ? 15   TRP B C   1 
ATOM   4539 O O   . TRP B 1 16  ? 7.778   -30.738 18.494  1.00 25.80 ? 15   TRP B O   1 
ATOM   4540 C CB  . TRP B 1 16  ? 8.456   -30.710 21.761  1.00 27.16 ? 15   TRP B CB  1 
ATOM   4541 C CG  . TRP B 1 16  ? 6.973   -30.434 21.858  1.00 27.80 ? 15   TRP B CG  1 
ATOM   4542 C CD1 . TRP B 1 16  ? 6.050   -31.157 22.564  1.00 28.51 ? 15   TRP B CD1 1 
ATOM   4543 C CD2 . TRP B 1 16  ? 6.249   -29.357 21.242  1.00 27.23 ? 15   TRP B CD2 1 
ATOM   4544 N NE1 . TRP B 1 16  ? 4.803   -30.602 22.419  1.00 28.94 ? 15   TRP B NE1 1 
ATOM   4545 C CE2 . TRP B 1 16  ? 4.891   -29.496 21.615  1.00 27.95 ? 15   TRP B CE2 1 
ATOM   4546 C CE3 . TRP B 1 16  ? 6.608   -28.280 20.414  1.00 27.59 ? 15   TRP B CE3 1 
ATOM   4547 C CZ2 . TRP B 1 16  ? 3.894   -28.607 21.192  1.00 27.04 ? 15   TRP B CZ2 1 
ATOM   4548 C CZ3 . TRP B 1 16  ? 5.615   -27.395 19.990  1.00 27.78 ? 15   TRP B CZ3 1 
ATOM   4549 C CH2 . TRP B 1 16  ? 4.273   -27.566 20.381  1.00 26.68 ? 15   TRP B CH2 1 
ATOM   4550 N N   . HIS B 1 17  ? 9.704   -29.713 19.092  1.00 26.48 ? 16   HIS B N   1 
ATOM   4551 C CA  . HIS B 1 17  ? 9.735   -28.849 17.922  1.00 26.99 ? 16   HIS B CA  1 
ATOM   4552 C C   . HIS B 1 17  ? 9.679   -29.650 16.620  1.00 27.79 ? 16   HIS B C   1 
ATOM   4553 O O   . HIS B 1 17  ? 8.857   -29.366 15.759  1.00 27.53 ? 16   HIS B O   1 
ATOM   4554 C CB  . HIS B 1 17  ? 10.966  -27.937 17.948  1.00 26.86 ? 16   HIS B CB  1 
ATOM   4555 C CG  . HIS B 1 17  ? 11.070  -27.040 16.758  1.00 26.49 ? 16   HIS B CG  1 
ATOM   4556 N ND1 . HIS B 1 17  ? 10.612  -25.738 16.764  1.00 25.99 ? 16   HIS B ND1 1 
ATOM   4557 C CD2 . HIS B 1 17  ? 11.564  -27.261 15.519  1.00 25.54 ? 16   HIS B CD2 1 
ATOM   4558 C CE1 . HIS B 1 17  ? 10.832  -25.194 15.580  1.00 25.07 ? 16   HIS B CE1 1 
ATOM   4559 N NE2 . HIS B 1 17  ? 11.403  -26.096 14.805  1.00 27.37 ? 16   HIS B NE2 1 
ATOM   4560 N N   . ARG B 1 18  ? 10.546  -30.655 16.497  1.00 29.12 ? 17   ARG B N   1 
ATOM   4561 C CA  . ARG B 1 18  ? 10.612  -31.512 15.315  1.00 30.80 ? 17   ARG B CA  1 
ATOM   4562 C C   . ARG B 1 18  ? 9.254   -32.157 14.995  1.00 30.91 ? 17   ARG B C   1 
ATOM   4563 O O   . ARG B 1 18  ? 8.852   -32.227 13.830  1.00 31.36 ? 17   ARG B O   1 
ATOM   4564 C CB  . ARG B 1 18  ? 11.708  -32.577 15.507  1.00 31.14 ? 17   ARG B CB  1 
ATOM   4565 C CG  . ARG B 1 18  ? 12.254  -33.229 14.230  1.00 34.52 ? 17   ARG B CG  1 
ATOM   4566 C CD  . ARG B 1 18  ? 13.673  -32.772 13.821  1.00 39.87 ? 17   ARG B CD  1 
ATOM   4567 N NE  . ARG B 1 18  ? 14.755  -33.463 14.541  1.00 43.44 ? 17   ARG B NE  1 
ATOM   4568 C CZ  . ARG B 1 18  ? 15.478  -32.925 15.532  1.00 44.67 ? 17   ARG B CZ  1 
ATOM   4569 N NH1 . ARG B 1 18  ? 15.242  -31.682 15.947  1.00 44.66 ? 17   ARG B NH1 1 
ATOM   4570 N NH2 . ARG B 1 18  ? 16.445  -33.631 16.112  1.00 43.98 ? 17   ARG B NH2 1 
ATOM   4571 N N   . ALA B 1 19  ? 8.542   -32.597 16.028  1.00 31.48 ? 18   ALA B N   1 
ATOM   4572 C CA  . ALA B 1 19  ? 7.293   -33.334 15.851  1.00 32.06 ? 18   ALA B CA  1 
ATOM   4573 C C   . ALA B 1 19  ? 6.043   -32.451 15.719  1.00 32.41 ? 18   ALA B C   1 
ATOM   4574 O O   . ALA B 1 19  ? 5.058   -32.860 15.084  1.00 32.77 ? 18   ALA B O   1 
ATOM   4575 C CB  . ALA B 1 19  ? 7.113   -34.359 16.987  1.00 32.23 ? 18   ALA B CB  1 
ATOM   4576 N N   . ASN B 1 20  ? 6.086   -31.252 16.303  1.00 32.41 ? 19   ASN B N   1 
ATOM   4577 C CA  . ASN B 1 20  ? 4.883   -30.432 16.497  1.00 32.56 ? 19   ASN B CA  1 
ATOM   4578 C C   . ASN B 1 20  ? 4.928   -28.999 15.974  1.00 32.68 ? 19   ASN B C   1 
ATOM   4579 O O   . ASN B 1 20  ? 3.885   -28.361 15.855  1.00 32.20 ? 19   ASN B O   1 
ATOM   4580 C CB  . ASN B 1 20  ? 4.527   -30.360 17.992  1.00 32.84 ? 19   ASN B CB  1 
ATOM   4581 C CG  . ASN B 1 20  ? 4.169   -31.710 18.579  1.00 33.53 ? 19   ASN B CG  1 
ATOM   4582 O OD1 . ASN B 1 20  ? 3.244   -32.378 18.115  1.00 35.08 ? 19   ASN B OD1 1 
ATOM   4583 N ND2 . ASN B 1 20  ? 4.904   -32.118 19.602  1.00 33.05 ? 19   ASN B ND2 1 
ATOM   4584 N N   . SER B 1 21  ? 6.121   -28.471 15.704  1.00 32.79 ? 20   SER B N   1 
ATOM   4585 C CA  . SER B 1 21  ? 6.246   -27.044 15.379  1.00 33.58 ? 20   SER B CA  1 
ATOM   4586 C C   . SER B 1 21  ? 5.560   -26.682 14.070  1.00 34.19 ? 20   SER B C   1 
ATOM   4587 O O   . SER B 1 21  ? 4.926   -25.626 13.972  1.00 34.78 ? 20   SER B O   1 
ATOM   4588 C CB  . SER B 1 21  ? 7.713   -26.596 15.342  1.00 32.95 ? 20   SER B CB  1 
ATOM   4589 O OG  . SER B 1 21  ? 8.410   -27.187 14.259  1.00 32.84 ? 20   SER B OG  1 
ATOM   4590 N N   . ALA B 1 22  ? 5.693   -27.555 13.074  1.00 35.07 ? 21   ALA B N   1 
ATOM   4591 C CA  . ALA B 1 22  ? 5.072   -27.338 11.771  1.00 35.80 ? 21   ALA B CA  1 
ATOM   4592 C C   . ALA B 1 22  ? 3.557   -27.190 11.901  1.00 36.23 ? 21   ALA B C   1 
ATOM   4593 O O   . ALA B 1 22  ? 2.917   -26.550 11.060  1.00 36.78 ? 21   ALA B O   1 
ATOM   4594 C CB  . ALA B 1 22  ? 5.421   -28.460 10.808  1.00 35.83 ? 21   ALA B CB  1 
ATOM   4595 N N   . ASN B 1 23  ? 3.005   -27.756 12.976  1.00 36.47 ? 22   ASN B N   1 
ATOM   4596 C CA  . ASN B 1 23  ? 1.571   -27.701 13.268  1.00 36.65 ? 22   ASN B CA  1 
ATOM   4597 C C   . ASN B 1 23  ? 1.118   -26.374 13.860  1.00 35.92 ? 22   ASN B C   1 
ATOM   4598 O O   . ASN B 1 23  ? -0.073  -26.064 13.830  1.00 36.42 ? 22   ASN B O   1 
ATOM   4599 C CB  . ASN B 1 23  ? 1.166   -28.809 14.257  1.00 37.23 ? 22   ASN B CB  1 
ATOM   4600 C CG  . ASN B 1 23  ? 1.167   -30.202 13.637  1.00 38.98 ? 22   ASN B CG  1 
ATOM   4601 O OD1 . ASN B 1 23  ? 1.382   -31.200 14.341  1.00 41.62 ? 22   ASN B OD1 1 
ATOM   4602 N ND2 . ASN B 1 23  ? 0.922   -30.282 12.331  1.00 39.10 ? 22   ASN B ND2 1 
ATOM   4603 N N   . LEU B 1 24  ? 2.054   -25.613 14.425  1.00 34.58 ? 23   LEU B N   1 
ATOM   4604 C CA  . LEU B 1 24  ? 1.703   -24.431 15.197  1.00 33.29 ? 23   LEU B CA  1 
ATOM   4605 C C   . LEU B 1 24  ? 1.336   -23.286 14.278  1.00 32.60 ? 23   LEU B C   1 
ATOM   4606 O O   . LEU B 1 24  ? 2.129   -22.870 13.440  1.00 31.50 ? 23   LEU B O   1 
ATOM   4607 C CB  . LEU B 1 24  ? 2.840   -24.013 16.129  1.00 33.29 ? 23   LEU B CB  1 
ATOM   4608 C CG  . LEU B 1 24  ? 2.984   -24.694 17.490  1.00 32.86 ? 23   LEU B CG  1 
ATOM   4609 C CD1 . LEU B 1 24  ? 4.163   -24.106 18.222  1.00 33.41 ? 23   LEU B CD1 1 
ATOM   4610 C CD2 . LEU B 1 24  ? 1.730   -24.572 18.336  1.00 31.97 ? 23   LEU B CD2 1 
ATOM   4611 N N   . LYS B 1 25  ? 0.107   -22.809 14.440  1.00 31.94 ? 24   LYS B N   1 
ATOM   4612 C CA  . LYS B 1 25  ? -0.416  -21.686 13.686  1.00 31.48 ? 24   LYS B CA  1 
ATOM   4613 C C   . LYS B 1 25  ? -0.929  -20.670 14.691  1.00 30.81 ? 24   LYS B C   1 
ATOM   4614 O O   . LYS B 1 25  ? -1.743  -21.012 15.551  1.00 30.69 ? 24   LYS B O   1 
ATOM   4615 C CB  . LYS B 1 25  ? -1.570  -22.135 12.778  1.00 31.76 ? 24   LYS B CB  1 
ATOM   4616 C CG  . LYS B 1 25  ? -1.218  -23.180 11.716  1.00 32.64 ? 24   LYS B CG  1 
ATOM   4617 C CD  . LYS B 1 25  ? -0.233  -22.635 10.695  1.00 34.37 ? 24   LYS B CD  1 
ATOM   4618 C CE  . LYS B 1 25  ? 0.841   -23.660 10.397  1.00 36.48 ? 24   LYS B CE  1 
ATOM   4619 N NZ  . LYS B 1 25  ? 0.807   -24.074 8.966   1.00 37.68 ? 24   LYS B NZ  1 
ATOM   4620 N N   . LEU B 1 26  ? -0.461  -19.426 14.594  1.00 29.87 ? 25   LEU B N   1 
ATOM   4621 C CA  . LEU B 1 26  ? -0.886  -18.404 15.539  1.00 29.30 ? 25   LEU B CA  1 
ATOM   4622 C C   . LEU B 1 26  ? -2.402  -18.187 15.509  1.00 29.61 ? 25   LEU B C   1 
ATOM   4623 O O   . LEU B 1 26  ? -3.021  -18.078 16.569  1.00 29.28 ? 25   LEU B O   1 
ATOM   4624 C CB  . LEU B 1 26  ? -0.143  -17.084 15.315  1.00 29.08 ? 25   LEU B CB  1 
ATOM   4625 C CG  . LEU B 1 26  ? 1.380   -17.087 15.502  1.00 27.90 ? 25   LEU B CG  1 
ATOM   4626 C CD1 . LEU B 1 26  ? 2.012   -15.806 14.944  1.00 26.72 ? 25   LEU B CD1 1 
ATOM   4627 C CD2 . LEU B 1 26  ? 1.751   -17.268 16.956  1.00 27.98 ? 25   LEU B CD2 1 
ATOM   4628 N N   . ARG B 1 27  ? -2.981  -18.133 14.306  1.00 30.16 ? 26   ARG B N   1 
ATOM   4629 C CA  . ARG B 1 27  ? -4.431  -17.961 14.122  1.00 31.63 ? 26   ARG B CA  1 
ATOM   4630 C C   . ARG B 1 27  ? -5.226  -18.999 14.907  1.00 31.80 ? 26   ARG B C   1 
ATOM   4631 O O   . ARG B 1 27  ? -6.168  -18.653 15.635  1.00 31.31 ? 26   ARG B O   1 
ATOM   4632 C CB  . ARG B 1 27  ? -4.810  -18.099 12.649  1.00 32.50 ? 26   ARG B CB  1 
ATOM   4633 C CG  . ARG B 1 27  ? -4.393  -16.957 11.753  1.00 34.49 ? 26   ARG B CG  1 
ATOM   4634 C CD  . ARG B 1 27  ? -4.852  -17.142 10.313  1.00 37.18 ? 26   ARG B CD  1 
ATOM   4635 N NE  . ARG B 1 27  ? -6.258  -16.762 10.166  1.00 40.02 ? 26   ARG B NE  1 
ATOM   4636 C CZ  . ARG B 1 27  ? -6.704  -15.865 9.299   1.00 40.02 ? 26   ARG B CZ  1 
ATOM   4637 N NH1 . ARG B 1 27  ? -5.866  -15.257 8.472   1.00 40.21 ? 26   ARG B NH1 1 
ATOM   4638 N NH2 . ARG B 1 27  ? -7.995  -15.573 9.252   1.00 40.96 ? 26   ARG B NH2 1 
ATOM   4639 N N   . GLU B 1 28  ? -4.830  -20.263 14.755  1.00 32.13 ? 27   GLU B N   1 
ATOM   4640 C CA  . GLU B 1 28  ? -5.485  -21.394 15.417  1.00 32.45 ? 27   GLU B CA  1 
ATOM   4641 C C   . GLU B 1 28  ? -5.303  -21.335 16.926  1.00 31.94 ? 27   GLU B C   1 
ATOM   4642 O O   . GLU B 1 28  ? -6.224  -21.647 17.684  1.00 32.01 ? 27   GLU B O   1 
ATOM   4643 C CB  . GLU B 1 28  ? -4.954  -22.728 14.889  1.00 32.72 ? 27   GLU B CB  1 
ATOM   4644 C CG  . GLU B 1 28  ? -5.237  -22.967 13.415  1.00 34.28 ? 27   GLU B CG  1 
ATOM   4645 C CD  . GLU B 1 28  ? -4.555  -24.208 12.855  1.00 37.32 ? 27   GLU B CD  1 
ATOM   4646 O OE1 . GLU B 1 28  ? -4.693  -24.434 11.635  1.00 38.57 ? 27   GLU B OE1 1 
ATOM   4647 O OE2 . GLU B 1 28  ? -3.889  -24.956 13.614  1.00 37.86 ? 27   GLU B OE2 1 
ATOM   4648 N N   . LEU B 1 29  ? -4.112  -20.937 17.360  1.00 31.24 ? 28   LEU B N   1 
ATOM   4649 C CA  . LEU B 1 29  ? -3.824  -20.831 18.780  1.00 30.28 ? 28   LEU B CA  1 
ATOM   4650 C C   . LEU B 1 29  ? -4.725  -19.801 19.461  1.00 30.27 ? 28   LEU B C   1 
ATOM   4651 O O   . LEU B 1 29  ? -5.128  -19.982 20.622  1.00 29.98 ? 28   LEU B O   1 
ATOM   4652 C CB  . LEU B 1 29  ? -2.352  -20.477 19.016  1.00 30.13 ? 28   LEU B CB  1 
ATOM   4653 C CG  . LEU B 1 29  ? -1.287  -21.573 18.833  1.00 29.76 ? 28   LEU B CG  1 
ATOM   4654 C CD1 . LEU B 1 29  ? 0.104   -20.949 18.700  1.00 28.80 ? 28   LEU B CD1 1 
ATOM   4655 C CD2 . LEU B 1 29  ? -1.315  -22.600 19.965  1.00 28.54 ? 28   LEU B CD2 1 
ATOM   4656 N N   . PHE B 1 30  ? -5.016  -18.711 18.758  1.00 30.18 ? 29   PHE B N   1 
ATOM   4657 C CA  . PHE B 1 30  ? -5.875  -17.678 19.323  1.00 30.57 ? 29   PHE B CA  1 
ATOM   4658 C C   . PHE B 1 30  ? -7.344  -18.104 19.276  1.00 31.30 ? 29   PHE B C   1 
ATOM   4659 O O   . PHE B 1 30  ? -8.107  -17.805 20.193  1.00 31.10 ? 29   PHE B O   1 
ATOM   4660 C CB  . PHE B 1 30  ? -5.651  -16.330 18.631  1.00 29.83 ? 29   PHE B CB  1 
ATOM   4661 C CG  . PHE B 1 30  ? -4.529  -15.522 19.235  1.00 28.79 ? 29   PHE B CG  1 
ATOM   4662 C CD1 . PHE B 1 30  ? -3.224  -15.659 18.772  1.00 28.26 ? 29   PHE B CD1 1 
ATOM   4663 C CD2 . PHE B 1 30  ? -4.771  -14.641 20.281  1.00 27.03 ? 29   PHE B CD2 1 
ATOM   4664 C CE1 . PHE B 1 30  ? -2.175  -14.911 19.335  1.00 27.37 ? 29   PHE B CE1 1 
ATOM   4665 C CE2 . PHE B 1 30  ? -3.738  -13.897 20.849  1.00 27.67 ? 29   PHE B CE2 1 
ATOM   4666 C CZ  . PHE B 1 30  ? -2.436  -14.029 20.376  1.00 25.94 ? 29   PHE B CZ  1 
ATOM   4667 N N   . GLU B 1 31  ? -7.709  -18.822 18.216  1.00 32.72 ? 30   GLU B N   1 
ATOM   4668 C CA  . GLU B 1 31  ? -9.077  -19.323 18.016  1.00 34.14 ? 30   GLU B CA  1 
ATOM   4669 C C   . GLU B 1 31  ? -9.466  -20.343 19.090  1.00 34.16 ? 30   GLU B C   1 
ATOM   4670 O O   . GLU B 1 31  ? -10.597 -20.337 19.587  1.00 34.59 ? 30   GLU B O   1 
ATOM   4671 C CB  . GLU B 1 31  ? -9.214  -19.950 16.621  1.00 34.45 ? 30   GLU B CB  1 
ATOM   4672 C CG  . GLU B 1 31  ? -9.621  -18.978 15.508  1.00 37.84 ? 30   GLU B CG  1 
ATOM   4673 C CD  . GLU B 1 31  ? -9.098  -19.374 14.121  1.00 41.25 ? 30   GLU B CD  1 
ATOM   4674 O OE1 . GLU B 1 31  ? -9.345  -18.617 13.151  1.00 42.71 ? 30   GLU B OE1 1 
ATOM   4675 O OE2 . GLU B 1 31  ? -8.434  -20.431 13.983  1.00 42.84 ? 30   GLU B OE2 1 
ATOM   4676 N N   . ALA B 1 32  ? -8.523  -21.209 19.449  1.00 33.96 ? 31   ALA B N   1 
ATOM   4677 C CA  . ALA B 1 32  ? -8.760  -22.290 20.399  1.00 34.09 ? 31   ALA B CA  1 
ATOM   4678 C C   . ALA B 1 32  ? -8.799  -21.821 21.852  1.00 34.11 ? 31   ALA B C   1 
ATOM   4679 O O   . ALA B 1 32  ? -9.311  -22.528 22.718  1.00 33.81 ? 31   ALA B O   1 
ATOM   4680 C CB  . ALA B 1 32  ? -7.705  -23.369 20.234  1.00 34.13 ? 31   ALA B CB  1 
ATOM   4681 N N   . ASP B 1 33  ? -8.267  -20.628 22.112  1.00 34.23 ? 32   ASP B N   1 
ATOM   4682 C CA  . ASP B 1 33  ? -8.068  -20.158 23.478  1.00 34.06 ? 32   ASP B CA  1 
ATOM   4683 C C   . ASP B 1 33  ? -8.373  -18.666 23.627  1.00 33.89 ? 32   ASP B C   1 
ATOM   4684 O O   . ASP B 1 33  ? -7.537  -17.829 23.299  1.00 33.14 ? 32   ASP B O   1 
ATOM   4685 C CB  . ASP B 1 33  ? -6.629  -20.481 23.916  1.00 34.56 ? 32   ASP B CB  1 
ATOM   4686 C CG  . ASP B 1 33  ? -6.293  -19.967 25.302  1.00 35.75 ? 32   ASP B CG  1 
ATOM   4687 O OD1 . ASP B 1 33  ? -7.208  -19.830 26.149  1.00 37.28 ? 32   ASP B OD1 1 
ATOM   4688 O OD2 . ASP B 1 33  ? -5.116  -19.698 25.643  1.00 36.28 ? 32   ASP B OD2 1 
ATOM   4689 N N   . PRO B 1 34  ? -9.562  -18.333 24.140  1.00 34.00 ? 33   PRO B N   1 
ATOM   4690 C CA  . PRO B 1 34  ? -9.946  -16.929 24.370  1.00 33.76 ? 33   PRO B CA  1 
ATOM   4691 C C   . PRO B 1 34  ? -9.159  -16.247 25.496  1.00 33.24 ? 33   PRO B C   1 
ATOM   4692 O O   . PRO B 1 34  ? -9.080  -15.024 25.529  1.00 33.50 ? 33   PRO B O   1 
ATOM   4693 C CB  . PRO B 1 34  ? -11.425 -17.029 24.755  1.00 34.05 ? 33   PRO B CB  1 
ATOM   4694 C CG  . PRO B 1 34  ? -11.564 -18.408 25.346  1.00 34.53 ? 33   PRO B CG  1 
ATOM   4695 C CD  . PRO B 1 34  ? -10.640 -19.273 24.516  1.00 34.15 ? 33   PRO B CD  1 
ATOM   4696 N N   . GLU B 1 35  ? -8.586  -17.021 26.407  1.00 32.56 ? 34   GLU B N   1 
ATOM   4697 C CA  . GLU B 1 35  ? -7.754  -16.440 27.452  1.00 32.21 ? 34   GLU B CA  1 
ATOM   4698 C C   . GLU B 1 35  ? -6.289  -16.269 27.014  1.00 31.04 ? 34   GLU B C   1 
ATOM   4699 O O   . GLU B 1 35  ? -5.429  -15.999 27.851  1.00 31.29 ? 34   GLU B O   1 
ATOM   4700 C CB  . GLU B 1 35  ? -7.819  -17.285 28.729  1.00 32.51 ? 34   GLU B CB  1 
ATOM   4701 C CG  . GLU B 1 35  ? -9.193  -17.359 29.382  1.00 34.97 ? 34   GLU B CG  1 
ATOM   4702 C CD  . GLU B 1 35  ? -9.502  -16.178 30.295  1.00 38.50 ? 34   GLU B CD  1 
ATOM   4703 O OE1 . GLU B 1 35  ? -8.559  -15.515 30.800  1.00 38.97 ? 34   GLU B OE1 1 
ATOM   4704 O OE2 . GLU B 1 35  ? -10.710 -15.913 30.513  1.00 40.08 ? 34   GLU B OE2 1 
ATOM   4705 N N   . ARG B 1 36  ? -6.006  -16.423 25.719  1.00 29.75 ? 35   ARG B N   1 
ATOM   4706 C CA  . ARG B 1 36  ? -4.606  -16.469 25.273  1.00 28.54 ? 35   ARG B CA  1 
ATOM   4707 C C   . ARG B 1 36  ? -3.801  -15.232 25.670  1.00 27.82 ? 35   ARG B C   1 
ATOM   4708 O O   . ARG B 1 36  ? -2.707  -15.348 26.222  1.00 27.72 ? 35   ARG B O   1 
ATOM   4709 C CB  . ARG B 1 36  ? -4.462  -16.743 23.774  1.00 28.68 ? 35   ARG B CB  1 
ATOM   4710 C CG  . ARG B 1 36  ? -2.984  -16.984 23.385  1.00 27.94 ? 35   ARG B CG  1 
ATOM   4711 C CD  . ARG B 1 36  ? -2.748  -17.565 22.005  1.00 28.84 ? 35   ARG B CD  1 
ATOM   4712 N NE  . ARG B 1 36  ? -1.319  -17.548 21.672  1.00 27.44 ? 35   ARG B NE  1 
ATOM   4713 C CZ  . ARG B 1 36  ? -0.458  -18.527 21.952  1.00 28.01 ? 35   ARG B CZ  1 
ATOM   4714 N NH1 . ARG B 1 36  ? -0.856  -19.644 22.570  1.00 25.34 ? 35   ARG B NH1 1 
ATOM   4715 N NH2 . ARG B 1 36  ? 0.818   -18.389 21.612  1.00 26.17 ? 35   ARG B NH2 1 
ATOM   4716 N N   . PHE B 1 37  ? -4.341  -14.052 25.395  1.00 27.57 ? 36   PHE B N   1 
ATOM   4717 C CA  . PHE B 1 37  ? -3.665  -12.824 25.800  1.00 26.43 ? 36   PHE B CA  1 
ATOM   4718 C C   . PHE B 1 37  ? -3.476  -12.792 27.316  1.00 26.69 ? 36   PHE B C   1 
ATOM   4719 O O   . PHE B 1 37  ? -2.430  -12.390 27.808  1.00 26.59 ? 36   PHE B O   1 
ATOM   4720 C CB  . PHE B 1 37  ? -4.424  -11.588 25.324  1.00 26.33 ? 36   PHE B CB  1 
ATOM   4721 C CG  . PHE B 1 37  ? -3.967  -10.317 25.974  1.00 25.07 ? 36   PHE B CG  1 
ATOM   4722 C CD1 . PHE B 1 37  ? -2.811  -9.674  25.534  1.00 24.83 ? 36   PHE B CD1 1 
ATOM   4723 C CD2 . PHE B 1 37  ? -4.679  -9.763  27.034  1.00 24.93 ? 36   PHE B CD2 1 
ATOM   4724 C CE1 . PHE B 1 37  ? -2.373  -8.502  26.144  1.00 23.16 ? 36   PHE B CE1 1 
ATOM   4725 C CE2 . PHE B 1 37  ? -4.243  -8.579  27.660  1.00 23.55 ? 36   PHE B CE2 1 
ATOM   4726 C CZ  . PHE B 1 37  ? -3.099  -7.948  27.210  1.00 24.01 ? 36   PHE B CZ  1 
ATOM   4727 N N   . ASN B 1 38  ? -4.494  -13.214 28.061  1.00 27.12 ? 37   ASN B N   1 
ATOM   4728 C CA  . ASN B 1 38  ? -4.409  -13.157 29.518  1.00 27.81 ? 37   ASN B CA  1 
ATOM   4729 C C   . ASN B 1 38  ? -3.286  -14.015 30.089  1.00 27.51 ? 37   ASN B C   1 
ATOM   4730 O O   . ASN B 1 38  ? -2.601  -13.606 31.022  1.00 28.34 ? 37   ASN B O   1 
ATOM   4731 C CB  . ASN B 1 38  ? -5.738  -13.543 30.164  1.00 27.75 ? 37   ASN B CB  1 
ATOM   4732 C CG  . ASN B 1 38  ? -6.777  -12.445 30.058  1.00 29.87 ? 37   ASN B CG  1 
ATOM   4733 O OD1 . ASN B 1 38  ? -6.457  -11.251 30.070  1.00 31.50 ? 37   ASN B OD1 1 
ATOM   4734 N ND2 . ASN B 1 38  ? -8.032  -12.844 29.954  1.00 32.08 ? 37   ASN B ND2 1 
ATOM   4735 N N   . ASN B 1 39  ? -3.103  -15.202 29.532  1.00 27.40 ? 38   ASN B N   1 
ATOM   4736 C CA  . ASN B 1 39  ? -2.150  -16.133 30.108  1.00 27.77 ? 38   ASN B CA  1 
ATOM   4737 C C   . ASN B 1 39  ? -0.754  -16.033 29.514  1.00 27.32 ? 38   ASN B C   1 
ATOM   4738 O O   . ASN B 1 39  ? 0.200   -16.536 30.099  1.00 27.62 ? 38   ASN B O   1 
ATOM   4739 C CB  . ASN B 1 39  ? -2.686  -17.563 30.057  1.00 28.11 ? 38   ASN B CB  1 
ATOM   4740 C CG  . ASN B 1 39  ? -3.984  -17.723 30.831  1.00 29.00 ? 38   ASN B CG  1 
ATOM   4741 O OD1 . ASN B 1 39  ? -4.142  -17.184 31.926  1.00 31.40 ? 38   ASN B OD1 1 
ATOM   4742 N ND2 . ASN B 1 39  ? -4.923  -18.448 30.253  1.00 31.31 ? 38   ASN B ND2 1 
ATOM   4743 N N   . PHE B 1 40  ? -0.634  -15.343 28.380  1.00 26.41 ? 39   PHE B N   1 
ATOM   4744 C CA  . PHE B 1 40  ? 0.669   -15.172 27.733  1.00 25.04 ? 39   PHE B CA  1 
ATOM   4745 C C   . PHE B 1 40  ? 1.080   -13.700 27.670  1.00 24.86 ? 39   PHE B C   1 
ATOM   4746 O O   . PHE B 1 40  ? 1.582   -13.218 26.648  1.00 23.68 ? 39   PHE B O   1 
ATOM   4747 C CB  . PHE B 1 40  ? 0.663   -15.789 26.342  1.00 24.60 ? 39   PHE B CB  1 
ATOM   4748 C CG  . PHE B 1 40  ? 0.521   -17.288 26.336  1.00 24.39 ? 39   PHE B CG  1 
ATOM   4749 C CD1 . PHE B 1 40  ? -0.729  -17.880 26.490  1.00 24.07 ? 39   PHE B CD1 1 
ATOM   4750 C CD2 . PHE B 1 40  ? 1.622   -18.100 26.135  1.00 24.87 ? 39   PHE B CD2 1 
ATOM   4751 C CE1 . PHE B 1 40  ? -0.878  -19.258 26.482  1.00 24.29 ? 39   PHE B CE1 1 
ATOM   4752 C CE2 . PHE B 1 40  ? 1.481   -19.485 26.114  1.00 25.21 ? 39   PHE B CE2 1 
ATOM   4753 C CZ  . PHE B 1 40  ? 0.223   -20.062 26.295  1.00 25.42 ? 39   PHE B CZ  1 
ATOM   4754 N N   . SER B 1 41  ? 0.865   -12.995 28.780  1.00 24.78 ? 40   SER B N   1 
ATOM   4755 C CA  . SER B 1 41  ? 1.303   -11.610 28.918  1.00 25.23 ? 40   SER B CA  1 
ATOM   4756 C C   . SER B 1 41  ? 1.543   -11.261 30.388  1.00 25.38 ? 40   SER B C   1 
ATOM   4757 O O   . SER B 1 41  ? 1.014   -11.932 31.299  1.00 25.84 ? 40   SER B O   1 
ATOM   4758 C CB  . SER B 1 41  ? 0.310   -10.643 28.260  1.00 24.90 ? 40   SER B CB  1 
ATOM   4759 O OG  . SER B 1 41  ? -0.905  -10.547 28.986  1.00 26.62 ? 40   SER B OG  1 
ATOM   4760 N N   . LEU B 1 42  ? 2.340   -10.218 30.610  1.00 24.73 ? 41   LEU B N   1 
ATOM   4761 C CA  . LEU B 1 42  ? 2.701   -9.771  31.939  1.00 25.00 ? 41   LEU B CA  1 
ATOM   4762 C C   . LEU B 1 42  ? 2.444   -8.282  32.009  1.00 25.13 ? 41   LEU B C   1 
ATOM   4763 O O   . LEU B 1 42  ? 3.084   -7.516  31.296  1.00 24.96 ? 41   LEU B O   1 
ATOM   4764 C CB  . LEU B 1 42  ? 4.191   -10.020 32.220  1.00 25.14 ? 41   LEU B CB  1 
ATOM   4765 C CG  . LEU B 1 42  ? 4.712   -11.442 32.355  1.00 25.73 ? 41   LEU B CG  1 
ATOM   4766 C CD1 . LEU B 1 42  ? 6.229   -11.424 32.504  1.00 25.48 ? 41   LEU B CD1 1 
ATOM   4767 C CD2 . LEU B 1 42  ? 4.051   -12.105 33.555  1.00 26.87 ? 41   LEU B CD2 1 
ATOM   4768 N N   . ASN B 1 43  ? 1.493   -7.888  32.847  1.00 24.96 ? 42   ASN B N   1 
ATOM   4769 C CA  . ASN B 1 43  ? 1.230   -6.476  33.082  1.00 25.10 ? 42   ASN B CA  1 
ATOM   4770 C C   . ASN B 1 43  ? 1.955   -6.022  34.339  1.00 25.24 ? 42   ASN B C   1 
ATOM   4771 O O   . ASN B 1 43  ? 1.485   -6.216  35.474  1.00 25.43 ? 42   ASN B O   1 
ATOM   4772 C CB  . ASN B 1 43  ? -0.279  -6.203  33.158  1.00 25.07 ? 42   ASN B CB  1 
ATOM   4773 C CG  . ASN B 1 43  ? -0.611  -4.709  33.157  1.00 25.74 ? 42   ASN B CG  1 
ATOM   4774 O OD1 . ASN B 1 43  ? 0.229   -3.868  33.484  1.00 24.56 ? 42   ASN B OD1 1 
ATOM   4775 N ND2 . ASN B 1 43  ? -1.844  -4.378  32.786  1.00 26.58 ? 42   ASN B ND2 1 
ATOM   4776 N N   . LEU B 1 44  ? 3.111   -5.403  34.140  1.00 25.14 ? 43   LEU B N   1 
ATOM   4777 C CA  . LEU B 1 44  ? 3.935   -4.991  35.266  1.00 25.16 ? 43   LEU B CA  1 
ATOM   4778 C C   . LEU B 1 44  ? 3.570   -3.600  35.755  1.00 25.15 ? 43   LEU B C   1 
ATOM   4779 O O   . LEU B 1 44  ? 3.670   -2.616  35.008  1.00 25.33 ? 43   LEU B O   1 
ATOM   4780 C CB  . LEU B 1 44  ? 5.426   -5.076  34.917  1.00 24.99 ? 43   LEU B CB  1 
ATOM   4781 C CG  . LEU B 1 44  ? 5.924   -6.443  34.443  1.00 26.77 ? 43   LEU B CG  1 
ATOM   4782 C CD1 . LEU B 1 44  ? 7.392   -6.346  34.052  1.00 27.39 ? 43   LEU B CD1 1 
ATOM   4783 C CD2 . LEU B 1 44  ? 5.720   -7.499  35.540  1.00 28.37 ? 43   LEU B CD2 1 
ATOM   4784 N N   . ASN B 1 45  ? 3.125   -3.515  37.008  1.00 24.81 ? 44   ASN B N   1 
ATOM   4785 C CA  . ASN B 1 45  ? 2.935   -2.213  37.627  1.00 25.24 ? 44   ASN B CA  1 
ATOM   4786 C C   . ASN B 1 45  ? 4.169   -1.814  38.439  1.00 24.85 ? 44   ASN B C   1 
ATOM   4787 O O   . ASN B 1 45  ? 4.429   -2.394  39.483  1.00 25.27 ? 44   ASN B O   1 
ATOM   4788 C CB  . ASN B 1 45  ? 1.669   -2.187  38.497  1.00 25.21 ? 44   ASN B CB  1 
ATOM   4789 C CG  . ASN B 1 45  ? 1.368   -0.803  39.026  1.00 26.07 ? 44   ASN B CG  1 
ATOM   4790 O OD1 . ASN B 1 45  ? 2.173   0.112   38.867  1.00 25.45 ? 44   ASN B OD1 1 
ATOM   4791 N ND2 . ASN B 1 45  ? 0.203   -0.634  39.651  1.00 27.77 ? 44   ASN B ND2 1 
ATOM   4792 N N   . THR B 1 46  ? 4.930   -0.833  37.949  1.00 24.80 ? 45   THR B N   1 
ATOM   4793 C CA  . THR B 1 46  ? 6.152   -0.377  38.627  1.00 24.23 ? 45   THR B CA  1 
ATOM   4794 C C   . THR B 1 46  ? 5.898   0.684   39.715  1.00 25.25 ? 45   THR B C   1 
ATOM   4795 O O   . THR B 1 46  ? 6.835   1.072   40.420  1.00 25.54 ? 45   THR B O   1 
ATOM   4796 C CB  . THR B 1 46  ? 7.169   0.233   37.621  1.00 24.31 ? 45   THR B CB  1 
ATOM   4797 O OG1 . THR B 1 46  ? 6.674   1.504   37.156  1.00 22.14 ? 45   THR B OG1 1 
ATOM   4798 C CG2 . THR B 1 46  ? 7.330   -0.616  36.366  1.00 22.88 ? 45   THR B CG2 1 
ATOM   4799 N N   . ASN B 1 47  ? 4.647   1.138   39.823  1.00 25.30 ? 46   ASN B N   1 
ATOM   4800 C CA  . ASN B 1 47  ? 4.222   2.320   40.602  1.00 26.49 ? 46   ASN B CA  1 
ATOM   4801 C C   . ASN B 1 47  ? 4.689   3.662   40.014  1.00 26.42 ? 46   ASN B C   1 
ATOM   4802 O O   . ASN B 1 47  ? 4.389   4.734   40.556  1.00 26.42 ? 46   ASN B O   1 
ATOM   4803 C CB  . ASN B 1 47  ? 4.505   2.187   42.113  1.00 27.07 ? 46   ASN B CB  1 
ATOM   4804 C CG  . ASN B 1 47  ? 3.564   3.063   42.970  1.00 29.80 ? 46   ASN B CG  1 
ATOM   4805 O OD1 . ASN B 1 47  ? 2.423   3.360   42.579  1.00 33.00 ? 46   ASN B OD1 1 
ATOM   4806 N ND2 . ASN B 1 47  ? 4.049   3.487   44.129  1.00 31.68 ? 46   ASN B ND2 1 
ATOM   4807 N N   . HIS B 1 48  ? 5.380   3.587   38.870  1.00 25.78 ? 47   HIS B N   1 
ATOM   4808 C CA  . HIS B 1 48  ? 5.756   4.762   38.088  1.00 26.32 ? 47   HIS B CA  1 
ATOM   4809 C C   . HIS B 1 48  ? 5.376   4.557   36.620  1.00 25.85 ? 47   HIS B C   1 
ATOM   4810 O O   . HIS B 1 48  ? 6.037   5.060   35.708  1.00 25.75 ? 47   HIS B O   1 
ATOM   4811 C CB  . HIS B 1 48  ? 7.245   5.045   38.240  1.00 26.51 ? 47   HIS B CB  1 
ATOM   4812 C CG  . HIS B 1 48  ? 7.663   5.275   39.655  1.00 28.97 ? 47   HIS B CG  1 
ATOM   4813 N ND1 . HIS B 1 48  ? 7.370   6.438   40.336  1.00 32.45 ? 47   HIS B ND1 1 
ATOM   4814 C CD2 . HIS B 1 48  ? 8.320   4.480   40.533  1.00 29.02 ? 47   HIS B CD2 1 
ATOM   4815 C CE1 . HIS B 1 48  ? 7.847   6.358   41.566  1.00 31.18 ? 47   HIS B CE1 1 
ATOM   4816 N NE2 . HIS B 1 48  ? 8.439   5.185   41.706  1.00 32.09 ? 47   HIS B NE2 1 
ATOM   4817 N N   . GLY B 1 49  ? 4.293   3.820   36.419  1.00 25.11 ? 48   GLY B N   1 
ATOM   4818 C CA  . GLY B 1 49  ? 3.822   3.457   35.100  1.00 24.47 ? 48   GLY B CA  1 
ATOM   4819 C C   . GLY B 1 49  ? 3.809   1.955   34.917  1.00 24.20 ? 48   GLY B C   1 
ATOM   4820 O O   . GLY B 1 49  ? 4.463   1.210   35.664  1.00 24.81 ? 48   GLY B O   1 
ATOM   4821 N N   . HIS B 1 50  ? 3.054   1.497   33.926  1.00 23.57 ? 49   HIS B N   1 
ATOM   4822 C CA  . HIS B 1 50  ? 2.966   0.068   33.648  1.00 23.50 ? 49   HIS B CA  1 
ATOM   4823 C C   . HIS B 1 50  ? 3.785   -0.330  32.431  1.00 22.84 ? 49   HIS B C   1 
ATOM   4824 O O   . HIS B 1 50  ? 3.876   0.426   31.465  1.00 22.95 ? 49   HIS B O   1 
ATOM   4825 C CB  . HIS B 1 50  ? 1.511   -0.357  33.422  1.00 23.25 ? 49   HIS B CB  1 
ATOM   4826 C CG  . HIS B 1 50  ? 0.666   -0.311  34.660  1.00 25.20 ? 49   HIS B CG  1 
ATOM   4827 N ND1 . HIS B 1 50  ? 0.047   -1.429  35.180  1.00 27.66 ? 49   HIS B ND1 1 
ATOM   4828 C CD2 . HIS B 1 50  ? 0.342   0.715   35.483  1.00 26.60 ? 49   HIS B CD2 1 
ATOM   4829 C CE1 . HIS B 1 50  ? -0.634  -1.091  36.261  1.00 26.75 ? 49   HIS B CE1 1 
ATOM   4830 N NE2 . HIS B 1 50  ? -0.470  0.204   36.466  1.00 28.36 ? 49   HIS B NE2 1 
ATOM   4831 N N   . ILE B 1 51  ? 4.353   -1.529  32.481  1.00 22.06 ? 50   ILE B N   1 
ATOM   4832 C CA  . ILE B 1 51  ? 4.990   -2.140  31.313  1.00 21.96 ? 50   ILE B CA  1 
ATOM   4833 C C   . ILE B 1 51  ? 4.279   -3.461  30.995  1.00 21.65 ? 50   ILE B C   1 
ATOM   4834 O O   . ILE B 1 51  ? 4.337   -4.406  31.787  1.00 21.93 ? 50   ILE B O   1 
ATOM   4835 C CB  . ILE B 1 51  ? 6.505   -2.372  31.550  1.00 22.02 ? 50   ILE B CB  1 
ATOM   4836 C CG1 . ILE B 1 51  ? 7.223   -1.058  31.853  1.00 23.25 ? 50   ILE B CG1 1 
ATOM   4837 C CG2 . ILE B 1 51  ? 7.145   -3.068  30.335  1.00 21.83 ? 50   ILE B CG2 1 
ATOM   4838 C CD1 . ILE B 1 51  ? 8.644   -1.244  32.440  1.00 22.74 ? 50   ILE B CD1 1 
ATOM   4839 N N   . LEU B 1 52  ? 3.576   -3.504  29.867  1.00 20.90 ? 51   LEU B N   1 
ATOM   4840 C CA  . LEU B 1 52  ? 2.928   -4.724  29.406  1.00 21.44 ? 51   LEU B CA  1 
ATOM   4841 C C   . LEU B 1 52  ? 3.839   -5.456  28.435  1.00 21.71 ? 51   LEU B C   1 
ATOM   4842 O O   . LEU B 1 52  ? 4.197   -4.924  27.374  1.00 21.75 ? 51   LEU B O   1 
ATOM   4843 C CB  . LEU B 1 52  ? 1.597   -4.406  28.716  1.00 20.86 ? 51   LEU B CB  1 
ATOM   4844 C CG  . LEU B 1 52  ? 0.847   -5.547  28.023  1.00 22.26 ? 51   LEU B CG  1 
ATOM   4845 C CD1 . LEU B 1 52  ? 0.536   -6.697  28.989  1.00 20.50 ? 51   LEU B CD1 1 
ATOM   4846 C CD2 . LEU B 1 52  ? -0.418  -4.985  27.409  1.00 23.10 ? 51   LEU B CD2 1 
ATOM   4847 N N   . VAL B 1 53  ? 4.235   -6.664  28.815  1.00 21.55 ? 52   VAL B N   1 
ATOM   4848 C CA  . VAL B 1 53  ? 5.018   -7.509  27.926  1.00 21.62 ? 52   VAL B CA  1 
ATOM   4849 C C   . VAL B 1 53  ? 4.048   -8.556  27.397  1.00 21.48 ? 52   VAL B C   1 
ATOM   4850 O O   . VAL B 1 53  ? 3.717   -9.521  28.101  1.00 20.43 ? 52   VAL B O   1 
ATOM   4851 C CB  . VAL B 1 53  ? 6.222   -8.126  28.662  1.00 21.75 ? 52   VAL B CB  1 
ATOM   4852 C CG1 . VAL B 1 53  ? 6.986   -9.102  27.773  1.00 20.92 ? 52   VAL B CG1 1 
ATOM   4853 C CG2 . VAL B 1 53  ? 7.155   -7.014  29.152  1.00 21.36 ? 52   VAL B CG2 1 
ATOM   4854 N N   . ASP B 1 54  ? 3.557   -8.317  26.180  1.00 20.81 ? 53   ASP B N   1 
ATOM   4855 C CA  . ASP B 1 54  ? 2.593   -9.206  25.549  1.00 21.28 ? 53   ASP B CA  1 
ATOM   4856 C C   . ASP B 1 54  ? 3.323   -10.139 24.592  1.00 20.90 ? 53   ASP B C   1 
ATOM   4857 O O   . ASP B 1 54  ? 3.700   -9.728  23.489  1.00 20.75 ? 53   ASP B O   1 
ATOM   4858 C CB  . ASP B 1 54  ? 1.518   -8.399  24.814  1.00 21.08 ? 53   ASP B CB  1 
ATOM   4859 C CG  . ASP B 1 54  ? 0.548   -9.281  24.023  1.00 22.70 ? 53   ASP B CG  1 
ATOM   4860 O OD1 . ASP B 1 54  ? 0.642   -10.529 24.091  1.00 23.10 ? 53   ASP B OD1 1 
ATOM   4861 O OD2 . ASP B 1 54  ? -0.352  -8.805  23.310  1.00 23.31 ? 53   ASP B OD2 1 
ATOM   4862 N N   . TYR B 1 55  ? 3.523   -11.387 25.025  1.00 20.95 ? 54   TYR B N   1 
ATOM   4863 C CA  . TYR B 1 55  ? 4.215   -12.400 24.224  1.00 20.79 ? 54   TYR B CA  1 
ATOM   4864 C C   . TYR B 1 55  ? 3.238   -13.442 23.663  1.00 20.38 ? 54   TYR B C   1 
ATOM   4865 O O   . TYR B 1 55  ? 3.625   -14.564 23.343  1.00 19.86 ? 54   TYR B O   1 
ATOM   4866 C CB  . TYR B 1 55  ? 5.349   -13.071 25.037  1.00 20.92 ? 54   TYR B CB  1 
ATOM   4867 C CG  . TYR B 1 55  ? 4.913   -13.768 26.317  1.00 21.05 ? 54   TYR B CG  1 
ATOM   4868 C CD1 . TYR B 1 55  ? 4.716   -15.153 26.351  1.00 20.81 ? 54   TYR B CD1 1 
ATOM   4869 C CD2 . TYR B 1 55  ? 4.731   -13.044 27.500  1.00 21.73 ? 54   TYR B CD2 1 
ATOM   4870 C CE1 . TYR B 1 55  ? 4.323   -15.786 27.513  1.00 21.05 ? 54   TYR B CE1 1 
ATOM   4871 C CE2 . TYR B 1 55  ? 4.333   -13.672 28.673  1.00 21.70 ? 54   TYR B CE2 1 
ATOM   4872 C CZ  . TYR B 1 55  ? 4.138   -15.046 28.671  1.00 22.35 ? 54   TYR B CZ  1 
ATOM   4873 O OH  . TYR B 1 55  ? 3.729   -15.654 29.830  1.00 22.97 ? 54   TYR B OH  1 
ATOM   4874 N N   . SER B 1 56  ? 1.971   -13.056 23.537  1.00 20.07 ? 55   SER B N   1 
ATOM   4875 C CA  . SER B 1 56  ? 0.936   -13.994 23.135  1.00 20.71 ? 55   SER B CA  1 
ATOM   4876 C C   . SER B 1 56  ? 0.985   -14.300 21.644  1.00 20.45 ? 55   SER B C   1 
ATOM   4877 O O   . SER B 1 56  ? 0.560   -15.373 21.210  1.00 20.87 ? 55   SER B O   1 
ATOM   4878 C CB  . SER B 1 56  ? -0.449  -13.495 23.556  1.00 20.42 ? 55   SER B CB  1 
ATOM   4879 O OG  . SER B 1 56  ? -0.835  -12.372 22.790  1.00 20.94 ? 55   SER B OG  1 
ATOM   4880 N N   . LYS B 1 57  ? 1.516   -13.366 20.855  1.00 20.83 ? 56   LYS B N   1 
ATOM   4881 C CA  . LYS B 1 57  ? 1.632   -13.581 19.411  1.00 20.31 ? 56   LYS B CA  1 
ATOM   4882 C C   . LYS B 1 57  ? 2.885   -14.391 19.057  1.00 20.86 ? 56   LYS B C   1 
ATOM   4883 O O   . LYS B 1 57  ? 3.467   -14.200 17.993  1.00 20.55 ? 56   LYS B O   1 
ATOM   4884 C CB  . LYS B 1 57  ? 1.597   -12.262 18.617  1.00 20.41 ? 56   LYS B CB  1 
ATOM   4885 C CG  . LYS B 1 57  ? 0.235   -11.544 18.624  1.00 19.77 ? 56   LYS B CG  1 
ATOM   4886 C CD  . LYS B 1 57  ? 0.125   -10.528 17.496  1.00 20.27 ? 56   LYS B CD  1 
ATOM   4887 C CE  . LYS B 1 57  ? -0.960  -9.482  17.747  1.00 20.23 ? 56   LYS B CE  1 
ATOM   4888 N NZ  . LYS B 1 57  ? -0.616  -8.474  18.801  1.00 18.17 ? 56   LYS B NZ  1 
ATOM   4889 N N   . ASN B 1 58  ? 3.266   -15.315 19.940  1.00 20.59 ? 57   ASN B N   1 
ATOM   4890 C CA  . ASN B 1 58  ? 4.420   -16.183 19.716  1.00 20.70 ? 57   ASN B CA  1 
ATOM   4891 C C   . ASN B 1 58  ? 4.007   -17.628 19.446  1.00 21.54 ? 57   ASN B C   1 
ATOM   4892 O O   . ASN B 1 58  ? 2.920   -18.056 19.838  1.00 21.71 ? 57   ASN B O   1 
ATOM   4893 C CB  . ASN B 1 58  ? 5.359   -16.129 20.914  1.00 20.06 ? 57   ASN B CB  1 
ATOM   4894 C CG  . ASN B 1 58  ? 6.252   -14.901 20.893  1.00 20.33 ? 57   ASN B CG  1 
ATOM   4895 O OD1 . ASN B 1 58  ? 7.129   -14.778 20.034  1.00 19.51 ? 57   ASN B OD1 1 
ATOM   4896 N ND2 . ASN B 1 58  ? 6.002   -13.971 21.808  1.00 18.13 ? 57   ASN B ND2 1 
ATOM   4897 N N   . LEU B 1 59  ? 4.867   -18.363 18.745  1.00 21.63 ? 58   LEU B N   1 
ATOM   4898 C CA  . LEU B 1 59  ? 4.573   -19.755 18.383  1.00 22.47 ? 58   LEU B CA  1 
ATOM   4899 C C   . LEU B 1 59  ? 4.832   -20.697 19.545  1.00 22.70 ? 58   LEU B C   1 
ATOM   4900 O O   . LEU B 1 59  ? 5.712   -21.560 19.491  1.00 23.58 ? 58   LEU B O   1 
ATOM   4901 C CB  . LEU B 1 59  ? 5.381   -20.164 17.155  1.00 22.56 ? 58   LEU B CB  1 
ATOM   4902 C CG  . LEU B 1 59  ? 4.841   -19.529 15.870  1.00 22.68 ? 58   LEU B CG  1 
ATOM   4903 C CD1 . LEU B 1 59  ? 5.927   -19.552 14.813  1.00 23.57 ? 58   LEU B CD1 1 
ATOM   4904 C CD2 . LEU B 1 59  ? 3.558   -20.227 15.386  1.00 21.99 ? 58   LEU B CD2 1 
ATOM   4905 N N   . VAL B 1 60  ? 4.067   -20.490 20.611  1.00 23.09 ? 59   VAL B N   1 
ATOM   4906 C CA  . VAL B 1 60  ? 4.198   -21.241 21.850  1.00 23.00 ? 59   VAL B CA  1 
ATOM   4907 C C   . VAL B 1 60  ? 2.829   -21.562 22.422  1.00 23.96 ? 59   VAL B C   1 
ATOM   4908 O O   . VAL B 1 60  ? 1.836   -20.870 22.142  1.00 24.68 ? 59   VAL B O   1 
ATOM   4909 C CB  . VAL B 1 60  ? 4.998   -20.467 22.937  1.00 22.44 ? 59   VAL B CB  1 
ATOM   4910 C CG1 . VAL B 1 60  ? 6.431   -20.172 22.469  1.00 21.85 ? 59   VAL B CG1 1 
ATOM   4911 C CG2 . VAL B 1 60  ? 4.265   -19.187 23.376  1.00 21.97 ? 59   VAL B CG2 1 
ATOM   4912 N N   . ASN B 1 61  ? 2.775   -22.613 23.232  1.00 24.49 ? 60   ASN B N   1 
ATOM   4913 C CA  . ASN B 1 61  ? 1.578   -22.902 23.999  1.00 24.59 ? 60   ASN B CA  1 
ATOM   4914 C C   . ASN B 1 61  ? 1.987   -23.199 25.437  1.00 24.88 ? 60   ASN B C   1 
ATOM   4915 O O   . ASN B 1 61  ? 3.143   -22.990 25.806  1.00 24.70 ? 60   ASN B O   1 
ATOM   4916 C CB  . ASN B 1 61  ? 0.774   -24.051 23.360  1.00 24.54 ? 60   ASN B CB  1 
ATOM   4917 C CG  . ASN B 1 61  ? 1.581   -25.339 23.241  1.00 24.43 ? 60   ASN B CG  1 
ATOM   4918 O OD1 . ASN B 1 61  ? 2.640   -25.468 23.822  1.00 24.24 ? 60   ASN B OD1 1 
ATOM   4919 N ND2 . ASN B 1 61  ? 1.075   -26.293 22.475  1.00 24.92 ? 60   ASN B ND2 1 
ATOM   4920 N N   . LYS B 1 62  ? 1.047   -23.689 26.238  1.00 25.38 ? 61   LYS B N   1 
ATOM   4921 C CA  . LYS B 1 62  ? 1.296   -24.001 27.639  1.00 26.19 ? 61   LYS B CA  1 
ATOM   4922 C C   . LYS B 1 62  ? 2.481   -24.959 27.817  1.00 25.71 ? 61   LYS B C   1 
ATOM   4923 O O   . LYS B 1 62  ? 3.391   -24.669 28.595  1.00 25.41 ? 61   LYS B O   1 
ATOM   4924 C CB  . LYS B 1 62  ? 0.022   -24.545 28.305  1.00 26.77 ? 61   LYS B CB  1 
ATOM   4925 C CG  . LYS B 1 62  ? 0.112   -24.678 29.827  1.00 29.30 ? 61   LYS B CG  1 
ATOM   4926 C CD  . LYS B 1 62  ? -1.246  -25.053 30.428  1.00 33.58 ? 61   LYS B CD  1 
ATOM   4927 C CE  . LYS B 1 62  ? -1.242  -26.479 30.979  1.00 36.27 ? 61   LYS B CE  1 
ATOM   4928 N NZ  . LYS B 1 62  ? -2.626  -27.061 31.026  1.00 39.59 ? 61   LYS B NZ  1 
ATOM   4929 N N   . GLU B 1 63  ? 2.473   -26.071 27.081  1.00 26.67 ? 62   GLU B N   1 
ATOM   4930 C CA  . GLU B 1 63  ? 3.548   -27.057 27.158  1.00 26.94 ? 62   GLU B CA  1 
ATOM   4931 C C   . GLU B 1 63  ? 4.918   -26.462 26.770  1.00 26.43 ? 62   GLU B C   1 
ATOM   4932 O O   . GLU B 1 63  ? 5.910   -26.666 27.479  1.00 26.66 ? 62   GLU B O   1 
ATOM   4933 C CB  . GLU B 1 63  ? 3.223   -28.292 26.306  1.00 27.57 ? 62   GLU B CB  1 
ATOM   4934 C CG  . GLU B 1 63  ? 4.180   -29.464 26.530  1.00 30.56 ? 62   GLU B CG  1 
ATOM   4935 C CD  . GLU B 1 63  ? 3.809   -30.719 25.746  1.00 34.02 ? 62   GLU B CD  1 
ATOM   4936 O OE1 . GLU B 1 63  ? 4.544   -31.728 25.864  1.00 34.83 ? 62   GLU B OE1 1 
ATOM   4937 O OE2 . GLU B 1 63  ? 2.796   -30.708 25.006  1.00 37.09 ? 62   GLU B OE2 1 
ATOM   4938 N N   . VAL B 1 64  ? 4.964   -25.727 25.659  1.00 25.61 ? 63   VAL B N   1 
ATOM   4939 C CA  . VAL B 1 64  ? 6.224   -25.121 25.196  1.00 24.71 ? 63   VAL B CA  1 
ATOM   4940 C C   . VAL B 1 64  ? 6.830   -24.211 26.273  1.00 24.07 ? 63   VAL B C   1 
ATOM   4941 O O   . VAL B 1 64  ? 8.011   -24.325 26.595  1.00 24.31 ? 63   VAL B O   1 
ATOM   4942 C CB  . VAL B 1 64  ? 6.052   -24.342 23.863  1.00 24.70 ? 63   VAL B CB  1 
ATOM   4943 C CG1 . VAL B 1 64  ? 7.364   -23.676 23.456  1.00 24.22 ? 63   VAL B CG1 1 
ATOM   4944 C CG2 . VAL B 1 64  ? 5.588   -25.265 22.751  1.00 24.55 ? 63   VAL B CG2 1 
ATOM   4945 N N   . MET B 1 65  ? 6.015   -23.329 26.851  1.00 23.75 ? 64   MET B N   1 
ATOM   4946 C CA  . MET B 1 65  ? 6.489   -22.434 27.906  1.00 23.99 ? 64   MET B CA  1 
ATOM   4947 C C   . MET B 1 65  ? 6.990   -23.199 29.137  1.00 24.49 ? 64   MET B C   1 
ATOM   4948 O O   . MET B 1 65  ? 7.999   -22.817 29.754  1.00 24.10 ? 64   MET B O   1 
ATOM   4949 C CB  . MET B 1 65  ? 5.413   -21.411 28.281  1.00 23.94 ? 64   MET B CB  1 
ATOM   4950 C CG  . MET B 1 65  ? 5.014   -20.486 27.136  1.00 23.89 ? 64   MET B CG  1 
ATOM   4951 S SD  . MET B 1 65  ? 6.440   -19.592 26.405  1.00 23.96 ? 64   MET B SD  1 
ATOM   4952 C CE  . MET B 1 65  ? 7.112   -18.850 27.800  1.00 21.71 ? 64   MET B CE  1 
ATOM   4953 N N   . GLN B 1 66  ? 6.301   -24.291 29.466  1.00 25.01 ? 65   GLN B N   1 
ATOM   4954 C CA  . GLN B 1 66  ? 6.707   -25.162 30.563  1.00 25.92 ? 65   GLN B CA  1 
ATOM   4955 C C   . GLN B 1 66  ? 8.056   -25.787 30.258  1.00 25.28 ? 65   GLN B C   1 
ATOM   4956 O O   . GLN B 1 66  ? 8.951   -25.791 31.109  1.00 24.90 ? 65   GLN B O   1 
ATOM   4957 C CB  . GLN B 1 66  ? 5.669   -26.267 30.800  1.00 26.28 ? 65   GLN B CB  1 
ATOM   4958 C CG  . GLN B 1 66  ? 4.552   -25.886 31.756  1.00 30.35 ? 65   GLN B CG  1 
ATOM   4959 C CD  . GLN B 1 66  ? 3.393   -26.887 31.757  1.00 34.06 ? 65   GLN B CD  1 
ATOM   4960 O OE1 . GLN B 1 66  ? 2.571   -26.873 32.668  1.00 36.84 ? 65   GLN B OE1 1 
ATOM   4961 N NE2 . GLN B 1 66  ? 3.316   -27.733 30.729  1.00 35.52 ? 65   GLN B NE2 1 
ATOM   4962 N N   . MET B 1 67  ? 8.197   -26.300 29.032  1.00 25.47 ? 66   MET B N   1 
ATOM   4963 C CA  . MET B 1 67  ? 9.445   -26.914 28.596  1.00 24.82 ? 66   MET B CA  1 
ATOM   4964 C C   . MET B 1 67  ? 10.590  -25.905 28.634  1.00 24.39 ? 66   MET B C   1 
ATOM   4965 O O   . MET B 1 67  ? 11.721  -26.256 28.986  1.00 23.79 ? 66   MET B O   1 
ATOM   4966 C CB  . MET B 1 67  ? 9.303   -27.521 27.202  1.00 25.11 ? 66   MET B CB  1 
ATOM   4967 C CG  . MET B 1 67  ? 8.560   -28.871 27.169  1.00 27.37 ? 66   MET B CG  1 
ATOM   4968 S SD  . MET B 1 67  ? 8.669   -29.698 25.579  1.00 31.04 ? 66   MET B SD  1 
ATOM   4969 C CE  . MET B 1 67  ? 8.031   -28.404 24.486  1.00 31.43 ? 66   MET B CE  1 
ATOM   4970 N N   . LEU B 1 68  ? 10.288  -24.658 28.268  1.00 23.05 ? 67   LEU B N   1 
ATOM   4971 C CA  . LEU B 1 68  ? 11.291  -23.589 28.271  1.00 23.32 ? 67   LEU B CA  1 
ATOM   4972 C C   . LEU B 1 68  ? 11.735  -23.160 29.681  1.00 22.55 ? 67   LEU B C   1 
ATOM   4973 O O   . LEU B 1 68  ? 12.933  -23.041 29.948  1.00 23.03 ? 67   LEU B O   1 
ATOM   4974 C CB  . LEU B 1 68  ? 10.801  -22.389 27.445  1.00 22.95 ? 67   LEU B CB  1 
ATOM   4975 C CG  . LEU B 1 68  ? 10.761  -22.562 25.926  1.00 24.11 ? 67   LEU B CG  1 
ATOM   4976 C CD1 . LEU B 1 68  ? 9.902   -21.468 25.311  1.00 23.00 ? 67   LEU B CD1 1 
ATOM   4977 C CD2 . LEU B 1 68  ? 12.166  -22.544 25.335  1.00 22.92 ? 67   LEU B CD2 1 
ATOM   4978 N N   . VAL B 1 69  ? 10.785  -22.943 30.584  1.00 22.58 ? 68   VAL B N   1 
ATOM   4979 C CA  . VAL B 1 69  ? 11.109  -22.653 31.988  1.00 22.82 ? 68   VAL B CA  1 
ATOM   4980 C C   . VAL B 1 69  ? 11.933  -23.779 32.624  1.00 22.95 ? 68   VAL B C   1 
ATOM   4981 O O   . VAL B 1 69  ? 12.864  -23.511 33.371  1.00 21.82 ? 68   VAL B O   1 
ATOM   4982 C CB  . VAL B 1 69  ? 9.850   -22.338 32.823  1.00 22.66 ? 68   VAL B CB  1 
ATOM   4983 C CG1 . VAL B 1 69  ? 10.185  -22.183 34.311  1.00 23.15 ? 68   VAL B CG1 1 
ATOM   4984 C CG2 . VAL B 1 69  ? 9.190   -21.059 32.298  1.00 23.52 ? 68   VAL B CG2 1 
ATOM   4985 N N   . GLU B 1 70  ? 11.589  -25.027 32.311  1.00 23.44 ? 69   GLU B N   1 
ATOM   4986 C CA  . GLU B 1 70  ? 12.325  -26.172 32.845  1.00 24.30 ? 69   GLU B CA  1 
ATOM   4987 C C   . GLU B 1 70  ? 13.768  -26.145 32.365  1.00 23.67 ? 69   GLU B C   1 
ATOM   4988 O O   . GLU B 1 70  ? 14.696  -26.387 33.140  1.00 24.07 ? 69   GLU B O   1 
ATOM   4989 C CB  . GLU B 1 70  ? 11.639  -27.484 32.463  1.00 24.82 ? 69   GLU B CB  1 
ATOM   4990 C CG  . GLU B 1 70  ? 10.539  -27.882 33.433  1.00 28.97 ? 69   GLU B CG  1 
ATOM   4991 C CD  . GLU B 1 70  ? 11.102  -28.408 34.747  1.00 34.58 ? 69   GLU B CD  1 
ATOM   4992 O OE1 . GLU B 1 70  ? 11.021  -27.689 35.771  1.00 36.52 ? 69   GLU B OE1 1 
ATOM   4993 O OE2 . GLU B 1 70  ? 11.655  -29.535 34.747  1.00 37.50 ? 69   GLU B OE2 1 
ATOM   4994 N N   . LEU B 1 71  ? 13.960  -25.813 31.089  1.00 23.19 ? 70   LEU B N   1 
ATOM   4995 C CA  . LEU B 1 71  ? 15.301  -25.647 30.545  1.00 22.45 ? 70   LEU B CA  1 
ATOM   4996 C C   . LEU B 1 71  ? 16.088  -24.556 31.278  1.00 22.47 ? 70   LEU B C   1 
ATOM   4997 O O   . LEU B 1 71  ? 17.258  -24.756 31.597  1.00 21.95 ? 70   LEU B O   1 
ATOM   4998 C CB  . LEU B 1 71  ? 15.256  -25.373 29.037  1.00 22.18 ? 70   LEU B CB  1 
ATOM   4999 C CG  . LEU B 1 71  ? 16.586  -25.191 28.307  1.00 21.64 ? 70   LEU B CG  1 
ATOM   5000 C CD1 . LEU B 1 71  ? 17.549  -26.367 28.555  1.00 22.12 ? 70   LEU B CD1 1 
ATOM   5001 C CD2 . LEU B 1 71  ? 16.324  -24.986 26.793  1.00 21.90 ? 70   LEU B CD2 1 
ATOM   5002 N N   . ALA B 1 72  ? 15.454  -23.411 31.541  1.00 22.35 ? 71   ALA B N   1 
ATOM   5003 C CA  . ALA B 1 72  ? 16.125  -22.324 32.258  1.00 22.43 ? 71   ALA B CA  1 
ATOM   5004 C C   . ALA B 1 72  ? 16.604  -22.792 33.628  1.00 22.43 ? 71   ALA B C   1 
ATOM   5005 O O   . ALA B 1 72  ? 17.732  -22.521 34.041  1.00 21.41 ? 71   ALA B O   1 
ATOM   5006 C CB  . ALA B 1 72  ? 15.187  -21.099 32.392  1.00 22.29 ? 71   ALA B CB  1 
ATOM   5007 N N   . LYS B 1 73  ? 15.738  -23.524 34.317  1.00 22.45 ? 72   LYS B N   1 
ATOM   5008 C CA  . LYS B 1 73  ? 16.071  -24.047 35.632  1.00 22.58 ? 72   LYS B CA  1 
ATOM   5009 C C   . LYS B 1 73  ? 17.249  -25.029 35.576  1.00 21.99 ? 72   LYS B C   1 
ATOM   5010 O O   . LYS B 1 73  ? 18.210  -24.880 36.334  1.00 21.90 ? 72   LYS B O   1 
ATOM   5011 C CB  . LYS B 1 73  ? 14.830  -24.680 36.264  1.00 22.78 ? 72   LYS B CB  1 
ATOM   5012 C CG  . LYS B 1 73  ? 13.882  -23.639 36.824  1.00 23.79 ? 72   LYS B CG  1 
ATOM   5013 C CD  . LYS B 1 73  ? 12.746  -24.277 37.604  1.00 26.69 ? 72   LYS B CD  1 
ATOM   5014 C CE  . LYS B 1 73  ? 11.580  -23.310 37.735  1.00 29.54 ? 72   LYS B CE  1 
ATOM   5015 N NZ  . LYS B 1 73  ? 10.404  -23.986 38.326  1.00 30.49 ? 72   LYS B NZ  1 
ATOM   5016 N N   . SER B 1 74  ? 17.183  -25.996 34.661  1.00 22.45 ? 73   SER B N   1 
ATOM   5017 C CA  . SER B 1 74  ? 18.204  -27.041 34.543  1.00 22.55 ? 73   SER B CA  1 
ATOM   5018 C C   . SER B 1 74  ? 19.508  -26.568 33.879  1.00 22.74 ? 73   SER B C   1 
ATOM   5019 O O   . SER B 1 74  ? 20.478  -27.327 33.813  1.00 22.84 ? 73   SER B O   1 
ATOM   5020 C CB  . SER B 1 74  ? 17.634  -28.303 33.863  1.00 22.70 ? 73   SER B CB  1 
ATOM   5021 O OG  . SER B 1 74  ? 17.503  -28.162 32.456  1.00 23.43 ? 73   SER B OG  1 
ATOM   5022 N N   . ARG B 1 75  ? 19.534  -25.313 33.417  1.00 22.92 ? 74   ARG B N   1 
ATOM   5023 C CA  . ARG B 1 75  ? 20.773  -24.700 32.932  1.00 22.58 ? 74   ARG B CA  1 
ATOM   5024 C C   . ARG B 1 75  ? 21.401  -23.788 34.002  1.00 22.68 ? 74   ARG B C   1 
ATOM   5025 O O   . ARG B 1 75  ? 22.461  -23.202 33.796  1.00 23.16 ? 74   ARG B O   1 
ATOM   5026 C CB  . ARG B 1 75  ? 20.536  -23.965 31.596  1.00 22.83 ? 74   ARG B CB  1 
ATOM   5027 C CG  . ARG B 1 75  ? 20.271  -24.909 30.393  1.00 22.41 ? 74   ARG B CG  1 
ATOM   5028 C CD  . ARG B 1 75  ? 21.503  -25.687 29.909  1.00 21.45 ? 74   ARG B CD  1 
ATOM   5029 N NE  . ARG B 1 75  ? 22.634  -24.775 29.842  1.00 22.38 ? 74   ARG B NE  1 
ATOM   5030 C CZ  . ARG B 1 75  ? 23.758  -24.866 30.534  1.00 23.45 ? 74   ARG B CZ  1 
ATOM   5031 N NH1 . ARG B 1 75  ? 24.003  -25.900 31.348  1.00 23.74 ? 74   ARG B NH1 1 
ATOM   5032 N NH2 . ARG B 1 75  ? 24.662  -23.907 30.386  1.00 24.18 ? 74   ARG B NH2 1 
ATOM   5033 N N   . GLY B 1 76  ? 20.735  -23.699 35.149  1.00 22.28 ? 75   GLY B N   1 
ATOM   5034 C CA  . GLY B 1 76  ? 21.264  -23.018 36.324  1.00 22.08 ? 75   GLY B CA  1 
ATOM   5035 C C   . GLY B 1 76  ? 21.030  -21.520 36.366  1.00 22.49 ? 75   GLY B C   1 
ATOM   5036 O O   . GLY B 1 76  ? 21.760  -20.798 37.046  1.00 22.17 ? 75   GLY B O   1 
ATOM   5037 N N   . VAL B 1 77  ? 19.996  -21.055 35.666  1.00 22.66 ? 76   VAL B N   1 
ATOM   5038 C CA  . VAL B 1 77  ? 19.726  -19.611 35.544  1.00 23.52 ? 76   VAL B CA  1 
ATOM   5039 C C   . VAL B 1 77  ? 19.484  -18.973 36.908  1.00 24.24 ? 76   VAL B C   1 
ATOM   5040 O O   . VAL B 1 77  ? 19.992  -17.884 37.199  1.00 23.98 ? 76   VAL B O   1 
ATOM   5041 C CB  . VAL B 1 77  ? 18.555  -19.320 34.558  1.00 23.51 ? 76   VAL B CB  1 
ATOM   5042 C CG1 . VAL B 1 77  ? 18.038  -17.890 34.691  1.00 23.78 ? 76   VAL B CG1 1 
ATOM   5043 C CG2 . VAL B 1 77  ? 18.985  -19.593 33.127  1.00 24.75 ? 76   VAL B CG2 1 
ATOM   5044 N N   . GLU B 1 78  ? 18.739  -19.661 37.771  1.00 24.49 ? 77   GLU B N   1 
ATOM   5045 C CA  . GLU B 1 78  ? 18.507  -19.111 39.103  1.00 25.13 ? 77   GLU B CA  1 
ATOM   5046 C C   . GLU B 1 78  ? 19.776  -18.944 39.935  1.00 25.04 ? 77   GLU B C   1 
ATOM   5047 O O   . GLU B 1 78  ? 19.946  -17.904 40.576  1.00 25.39 ? 77   GLU B O   1 
ATOM   5048 C CB  . GLU B 1 78  ? 17.430  -19.886 39.855  1.00 25.95 ? 77   GLU B CB  1 
ATOM   5049 C CG  . GLU B 1 78  ? 16.064  -19.784 39.187  1.00 27.78 ? 77   GLU B CG  1 
ATOM   5050 C CD  . GLU B 1 78  ? 14.947  -20.282 40.076  1.00 32.35 ? 77   GLU B CD  1 
ATOM   5051 O OE1 . GLU B 1 78  ? 14.935  -21.489 40.389  1.00 34.01 ? 77   GLU B OE1 1 
ATOM   5052 O OE2 . GLU B 1 78  ? 14.083  -19.461 40.459  1.00 34.34 ? 77   GLU B OE2 1 
ATOM   5053 N N   . ALA B 1 79  ? 20.658  -19.950 39.920  1.00 24.81 ? 78   ALA B N   1 
ATOM   5054 C CA  . ALA B 1 79  ? 21.912  -19.891 40.674  1.00 24.70 ? 78   ALA B CA  1 
ATOM   5055 C C   . ALA B 1 79  ? 22.846  -18.825 40.112  1.00 24.84 ? 78   ALA B C   1 
ATOM   5056 O O   . ALA B 1 79  ? 23.469  -18.064 40.866  1.00 24.80 ? 78   ALA B O   1 
ATOM   5057 C CB  . ALA B 1 79  ? 22.611  -21.263 40.698  1.00 24.11 ? 78   ALA B CB  1 
ATOM   5058 N N   . ALA B 1 80  ? 22.937  -18.766 38.782  1.00 25.26 ? 79   ALA B N   1 
ATOM   5059 C CA  . ALA B 1 80  ? 23.833  -17.822 38.118  1.00 25.29 ? 79   ALA B CA  1 
ATOM   5060 C C   . ALA B 1 80  ? 23.439  -16.380 38.438  1.00 25.58 ? 79   ALA B C   1 
ATOM   5061 O O   . ALA B 1 80  ? 24.301  -15.522 38.727  1.00 25.62 ? 79   ALA B O   1 
ATOM   5062 C CB  . ALA B 1 80  ? 23.812  -18.065 36.611  1.00 25.32 ? 79   ALA B CB  1 
ATOM   5063 N N   . ARG B 1 81  ? 22.134  -16.121 38.404  1.00 25.48 ? 80   ARG B N   1 
ATOM   5064 C CA  . ARG B 1 81  ? 21.606  -14.800 38.704  1.00 26.19 ? 80   ARG B CA  1 
ATOM   5065 C C   . ARG B 1 81  ? 21.977  -14.372 40.119  1.00 26.84 ? 80   ARG B C   1 
ATOM   5066 O O   . ARG B 1 81  ? 22.428  -13.254 40.332  1.00 26.63 ? 80   ARG B O   1 
ATOM   5067 C CB  . ARG B 1 81  ? 20.094  -14.773 38.513  1.00 26.09 ? 80   ARG B CB  1 
ATOM   5068 C CG  . ARG B 1 81  ? 19.432  -13.487 38.975  1.00 26.43 ? 80   ARG B CG  1 
ATOM   5069 C CD  . ARG B 1 81  ? 17.945  -13.627 39.237  1.00 26.80 ? 80   ARG B CD  1 
ATOM   5070 N NE  . ARG B 1 81  ? 17.689  -14.721 40.170  1.00 27.46 ? 80   ARG B NE  1 
ATOM   5071 C CZ  . ARG B 1 81  ? 16.522  -15.323 40.336  1.00 26.94 ? 80   ARG B CZ  1 
ATOM   5072 N NH1 . ARG B 1 81  ? 15.454  -14.934 39.648  1.00 27.72 ? 80   ARG B NH1 1 
ATOM   5073 N NH2 . ARG B 1 81  ? 16.428  -16.321 41.210  1.00 28.22 ? 80   ARG B NH2 1 
ATOM   5074 N N   . ASP B 1 82  ? 21.781  -15.272 41.080  1.00 26.84 ? 81   ASP B N   1 
ATOM   5075 C CA  . ASP B 1 82  ? 22.111  -14.973 42.468  1.00 27.66 ? 81   ASP B CA  1 
ATOM   5076 C C   . ASP B 1 82  ? 23.592  -14.669 42.614  1.00 27.30 ? 81   ASP B C   1 
ATOM   5077 O O   . ASP B 1 82  ? 23.964  -13.755 43.331  1.00 27.18 ? 81   ASP B O   1 
ATOM   5078 C CB  . ASP B 1 82  ? 21.666  -16.116 43.383  1.00 27.72 ? 81   ASP B CB  1 
ATOM   5079 C CG  . ASP B 1 82  ? 20.139  -16.200 43.514  1.00 29.83 ? 81   ASP B CG  1 
ATOM   5080 O OD1 . ASP B 1 82  ? 19.421  -15.389 42.872  1.00 30.02 ? 81   ASP B OD1 1 
ATOM   5081 O OD2 . ASP B 1 82  ? 19.560  -17.050 44.225  1.00 32.37 ? 81   ASP B OD2 1 
ATOM   5082 N N   . ASN B 1 83  ? 24.410  -15.407 41.870  1.00 27.46 ? 82   ASN B N   1 
ATOM   5083 C CA  . ASN B 1 83  ? 25.847  -15.203 41.828  1.00 27.59 ? 82   ASN B CA  1 
ATOM   5084 C C   . ASN B 1 83  ? 26.230  -13.826 41.280  1.00 27.60 ? 82   ASN B C   1 
ATOM   5085 O O   . ASN B 1 83  ? 27.134  -13.171 41.809  1.00 27.54 ? 82   ASN B O   1 
ATOM   5086 C CB  . ASN B 1 83  ? 26.503  -16.312 40.995  1.00 27.82 ? 82   ASN B CB  1 
ATOM   5087 C CG  . ASN B 1 83  ? 26.575  -17.646 41.738  1.00 29.46 ? 82   ASN B CG  1 
ATOM   5088 O OD1 . ASN B 1 83  ? 26.929  -18.665 41.155  1.00 33.99 ? 82   ASN B OD1 1 
ATOM   5089 N ND2 . ASN B 1 83  ? 26.242  -17.640 43.015  1.00 30.12 ? 82   ASN B ND2 1 
ATOM   5090 N N   . MET B 1 84  ? 25.544  -13.390 40.223  1.00 27.20 ? 83   MET B N   1 
ATOM   5091 C CA  . MET B 1 84  ? 25.753  -12.045 39.702  1.00 26.17 ? 83   MET B CA  1 
ATOM   5092 C C   . MET B 1 84  ? 25.482  -11.008 40.792  1.00 26.04 ? 83   MET B C   1 
ATOM   5093 O O   . MET B 1 84  ? 26.331  -10.166 41.078  1.00 25.31 ? 83   MET B O   1 
ATOM   5094 C CB  . MET B 1 84  ? 24.872  -11.767 38.473  1.00 26.78 ? 83   MET B CB  1 
ATOM   5095 C CG  . MET B 1 84  ? 25.095  -10.365 37.871  1.00 26.80 ? 83   MET B CG  1 
ATOM   5096 S SD  . MET B 1 84  ? 24.425  -10.110 36.185  1.00 30.09 ? 83   MET B SD  1 
ATOM   5097 C CE  . MET B 1 84  ? 22.708  -9.909  36.590  1.00 26.70 ? 83   MET B CE  1 
ATOM   5098 N N   . PHE B 1 85  ? 24.298  -11.088 41.399  1.00 26.04 ? 84   PHE B N   1 
ATOM   5099 C CA  . PHE B 1 85  ? 23.834  -10.079 42.346  1.00 26.40 ? 84   PHE B CA  1 
ATOM   5100 C C   . PHE B 1 85  ? 24.675  -10.032 43.627  1.00 26.53 ? 84   PHE B C   1 
ATOM   5101 O O   . PHE B 1 85  ? 24.712  -9.011  44.318  1.00 26.93 ? 84   PHE B O   1 
ATOM   5102 C CB  . PHE B 1 85  ? 22.348  -10.293 42.690  1.00 26.43 ? 84   PHE B CB  1 
ATOM   5103 C CG  . PHE B 1 85  ? 21.386  -9.719  41.663  1.00 26.16 ? 84   PHE B CG  1 
ATOM   5104 C CD1 . PHE B 1 85  ? 21.182  -10.359 40.438  1.00 26.84 ? 84   PHE B CD1 1 
ATOM   5105 C CD2 . PHE B 1 85  ? 20.681  -8.555  41.930  1.00 26.68 ? 84   PHE B CD2 1 
ATOM   5106 C CE1 . PHE B 1 85  ? 20.285  -9.840  39.485  1.00 25.56 ? 84   PHE B CE1 1 
ATOM   5107 C CE2 . PHE B 1 85  ? 19.786  -8.022  40.992  1.00 25.69 ? 84   PHE B CE2 1 
ATOM   5108 C CZ  . PHE B 1 85  ? 19.584  -8.673  39.768  1.00 25.71 ? 84   PHE B CZ  1 
ATOM   5109 N N   . SER B 1 86  ? 25.363  -11.122 43.934  1.00 26.64 ? 85   SER B N   1 
ATOM   5110 C CA  . SER B 1 86  ? 26.112  -11.188 45.185  1.00 26.89 ? 85   SER B CA  1 
ATOM   5111 C C   . SER B 1 86  ? 27.579  -10.779 45.054  1.00 27.09 ? 85   SER B C   1 
ATOM   5112 O O   . SER B 1 86  ? 28.311  -10.750 46.050  1.00 27.59 ? 85   SER B O   1 
ATOM   5113 C CB  . SER B 1 86  ? 25.984  -12.583 45.801  1.00 27.02 ? 85   SER B CB  1 
ATOM   5114 O OG  . SER B 1 86  ? 26.783  -13.518 45.102  1.00 27.59 ? 85   SER B OG  1 
ATOM   5115 N N   . GLY B 1 87  ? 28.009  -10.449 43.834  1.00 26.27 ? 86   GLY B N   1 
ATOM   5116 C CA  . GLY B 1 87  ? 29.372  -10.016 43.603  1.00 26.04 ? 86   GLY B CA  1 
ATOM   5117 C C   . GLY B 1 87  ? 30.347  -11.140 43.295  1.00 26.27 ? 86   GLY B C   1 
ATOM   5118 O O   . GLY B 1 87  ? 31.550  -10.926 43.300  1.00 26.45 ? 86   GLY B O   1 
ATOM   5119 N N   . SER B 1 88  ? 29.824  -12.335 43.039  1.00 26.20 ? 87   SER B N   1 
ATOM   5120 C CA  . SER B 1 88  ? 30.632  -13.474 42.611  1.00 27.27 ? 87   SER B CA  1 
ATOM   5121 C C   . SER B 1 88  ? 31.315  -13.166 41.272  1.00 27.33 ? 87   SER B C   1 
ATOM   5122 O O   . SER B 1 88  ? 30.805  -12.378 40.464  1.00 26.42 ? 87   SER B O   1 
ATOM   5123 C CB  . SER B 1 88  ? 29.749  -14.722 42.509  1.00 27.41 ? 87   SER B CB  1 
ATOM   5124 O OG  . SER B 1 88  ? 30.502  -15.882 42.196  1.00 31.01 ? 87   SER B OG  1 
ATOM   5125 N N   . LYS B 1 89  ? 32.478  -13.769 41.054  1.00 27.31 ? 88   LYS B N   1 
ATOM   5126 C CA  . LYS B 1 89  ? 33.262  -13.476 39.866  1.00 27.30 ? 88   LYS B CA  1 
ATOM   5127 C C   . LYS B 1 89  ? 32.790  -14.287 38.646  1.00 27.09 ? 88   LYS B C   1 
ATOM   5128 O O   . LYS B 1 89  ? 33.479  -15.182 38.164  1.00 27.49 ? 88   LYS B O   1 
ATOM   5129 C CB  . LYS B 1 89  ? 34.756  -13.643 40.176  1.00 27.33 ? 88   LYS B CB  1 
ATOM   5130 C CG  . LYS B 1 89  ? 35.280  -12.489 41.022  1.00 27.59 ? 88   LYS B CG  1 
ATOM   5131 C CD  . LYS B 1 89  ? 36.628  -12.759 41.670  1.00 30.79 ? 88   LYS B CD  1 
ATOM   5132 C CE  . LYS B 1 89  ? 36.950  -11.633 42.664  1.00 31.75 ? 88   LYS B CE  1 
ATOM   5133 N NZ  . LYS B 1 89  ? 38.416  -11.379 42.812  1.00 34.31 ? 88   LYS B NZ  1 
ATOM   5134 N N   . ILE B 1 90  ? 31.601  -13.956 38.152  1.00 26.64 ? 89   ILE B N   1 
ATOM   5135 C CA  . ILE B 1 90  ? 30.967  -14.751 37.105  1.00 26.50 ? 89   ILE B CA  1 
ATOM   5136 C C   . ILE B 1 90  ? 31.549  -14.489 35.712  1.00 25.98 ? 89   ILE B C   1 
ATOM   5137 O O   . ILE B 1 90  ? 31.299  -15.262 34.793  1.00 26.16 ? 89   ILE B O   1 
ATOM   5138 C CB  . ILE B 1 90  ? 29.419  -14.590 37.108  1.00 26.65 ? 89   ILE B CB  1 
ATOM   5139 C CG1 . ILE B 1 90  ? 29.012  -13.140 36.853  1.00 27.05 ? 89   ILE B CG1 1 
ATOM   5140 C CG2 . ILE B 1 90  ? 28.804  -15.117 38.433  1.00 27.27 ? 89   ILE B CG2 1 
ATOM   5141 C CD1 . ILE B 1 90  ? 27.644  -13.004 36.182  1.00 26.62 ? 89   ILE B CD1 1 
ATOM   5142 N N   . ASN B 1 91  ? 32.298  -13.392 35.573  1.00 25.40 ? 90   ASN B N   1 
ATOM   5143 C CA  . ASN B 1 91  ? 33.110  -13.129 34.377  1.00 25.25 ? 90   ASN B CA  1 
ATOM   5144 C C   . ASN B 1 91  ? 34.381  -13.945 34.533  1.00 25.72 ? 90   ASN B C   1 
ATOM   5145 O O   . ASN B 1 91  ? 35.439  -13.433 34.901  1.00 24.99 ? 90   ASN B O   1 
ATOM   5146 C CB  . ASN B 1 91  ? 33.419  -11.626 34.245  1.00 25.00 ? 90   ASN B CB  1 
ATOM   5147 C CG  . ASN B 1 91  ? 34.223  -11.275 32.979  1.00 24.84 ? 90   ASN B CG  1 
ATOM   5148 O OD1 . ASN B 1 91  ? 34.687  -12.147 32.241  1.00 25.76 ? 90   ASN B OD1 1 
ATOM   5149 N ND2 . ASN B 1 91  ? 34.388  -9.984  32.739  1.00 27.14 ? 90   ASN B ND2 1 
ATOM   5150 N N   . TYR B 1 92  ? 34.259  -15.229 34.231  1.00 26.12 ? 91   TYR B N   1 
ATOM   5151 C CA  . TYR B 1 92  ? 35.263  -16.204 34.633  1.00 26.88 ? 91   TYR B CA  1 
ATOM   5152 C C   . TYR B 1 92  ? 36.545  -16.207 33.806  1.00 27.05 ? 91   TYR B C   1 
ATOM   5153 O O   . TYR B 1 92  ? 37.568  -16.688 34.284  1.00 27.44 ? 91   TYR B O   1 
ATOM   5154 C CB  . TYR B 1 92  ? 34.656  -17.613 34.706  1.00 27.20 ? 91   TYR B CB  1 
ATOM   5155 C CG  . TYR B 1 92  ? 33.843  -18.022 33.495  1.00 27.25 ? 91   TYR B CG  1 
ATOM   5156 C CD1 . TYR B 1 92  ? 34.469  -18.493 32.339  1.00 28.37 ? 91   TYR B CD1 1 
ATOM   5157 C CD2 . TYR B 1 92  ? 32.450  -17.946 33.512  1.00 27.14 ? 91   TYR B CD2 1 
ATOM   5158 C CE1 . TYR B 1 92  ? 33.733  -18.872 31.230  1.00 28.34 ? 91   TYR B CE1 1 
ATOM   5159 C CE2 . TYR B 1 92  ? 31.699  -18.322 32.412  1.00 28.16 ? 91   TYR B CE2 1 
ATOM   5160 C CZ  . TYR B 1 92  ? 32.341  -18.782 31.277  1.00 28.15 ? 91   TYR B CZ  1 
ATOM   5161 O OH  . TYR B 1 92  ? 31.595  -19.154 30.189  1.00 28.59 ? 91   TYR B OH  1 
ATOM   5162 N N   . THR B 1 93  ? 36.519  -15.691 32.576  1.00 26.94 ? 92   THR B N   1 
ATOM   5163 C CA  . THR B 1 93  ? 37.757  -15.694 31.786  1.00 26.35 ? 92   THR B CA  1 
ATOM   5164 C C   . THR B 1 93  ? 38.669  -14.552 32.218  1.00 26.72 ? 92   THR B C   1 
ATOM   5165 O O   . THR B 1 93  ? 39.890  -14.652 32.108  1.00 27.02 ? 92   THR B O   1 
ATOM   5166 C CB  . THR B 1 93  ? 37.516  -15.619 30.260  1.00 26.08 ? 92   THR B CB  1 
ATOM   5167 O OG1 . THR B 1 93  ? 36.874  -14.380 29.953  1.00 25.06 ? 92   THR B OG1 1 
ATOM   5168 C CG2 . THR B 1 93  ? 36.553  -16.731 29.762  1.00 26.51 ? 92   THR B CG2 1 
ATOM   5169 N N   . GLU B 1 94  ? 38.074  -13.464 32.706  1.00 26.79 ? 93   GLU B N   1 
ATOM   5170 C CA  . GLU B 1 94  ? 38.842  -12.329 33.205  1.00 27.27 ? 93   GLU B CA  1 
ATOM   5171 C C   . GLU B 1 94  ? 38.926  -12.333 34.742  1.00 27.52 ? 93   GLU B C   1 
ATOM   5172 O O   . GLU B 1 94  ? 39.600  -11.488 35.337  1.00 27.38 ? 93   GLU B O   1 
ATOM   5173 C CB  . GLU B 1 94  ? 38.243  -11.013 32.696  1.00 27.32 ? 93   GLU B CB  1 
ATOM   5174 C CG  . GLU B 1 94  ? 38.122  -10.936 31.177  1.00 28.93 ? 93   GLU B CG  1 
ATOM   5175 C CD  . GLU B 1 94  ? 37.655  -9.582  30.694  1.00 30.49 ? 93   GLU B CD  1 
ATOM   5176 O OE1 . GLU B 1 94  ? 36.614  -9.102  31.172  1.00 31.64 ? 93   GLU B OE1 1 
ATOM   5177 O OE2 . GLU B 1 94  ? 38.329  -8.994  29.827  1.00 33.96 ? 93   GLU B OE2 1 
ATOM   5178 N N   . ASP B 1 95  ? 38.248  -13.302 35.359  1.00 27.76 ? 94   ASP B N   1 
ATOM   5179 C CA  . ASP B 1 95  ? 38.119  -13.406 36.814  1.00 28.11 ? 94   ASP B CA  1 
ATOM   5180 C C   . ASP B 1 95  ? 37.642  -12.088 37.453  1.00 27.51 ? 94   ASP B C   1 
ATOM   5181 O O   . ASP B 1 95  ? 38.352  -11.445 38.230  1.00 27.37 ? 94   ASP B O   1 
ATOM   5182 C CB  . ASP B 1 95  ? 39.411  -13.949 37.440  1.00 29.10 ? 94   ASP B CB  1 
ATOM   5183 C CG  . ASP B 1 95  ? 39.286  -14.172 38.932  1.00 30.77 ? 94   ASP B CG  1 
ATOM   5184 O OD1 . ASP B 1 95  ? 38.315  -14.836 39.354  1.00 32.64 ? 94   ASP B OD1 1 
ATOM   5185 O OD2 . ASP B 1 95  ? 40.105  -13.705 39.756  1.00 34.17 ? 94   ASP B OD2 1 
ATOM   5186 N N   . ARG B 1 96  ? 36.422  -11.693 37.100  1.00 26.94 ? 95   ARG B N   1 
ATOM   5187 C CA  . ARG B 1 96  ? 35.874  -10.401 37.495  1.00 26.21 ? 95   ARG B CA  1 
ATOM   5188 C C   . ARG B 1 96  ? 34.426  -10.553 37.923  1.00 25.46 ? 95   ARG B C   1 
ATOM   5189 O O   . ARG B 1 96  ? 33.715  -11.417 37.409  1.00 25.13 ? 95   ARG B O   1 
ATOM   5190 C CB  . ARG B 1 96  ? 35.926  -9.436  36.316  1.00 26.34 ? 95   ARG B CB  1 
ATOM   5191 C CG  . ARG B 1 96  ? 37.238  -8.700  36.162  1.00 27.30 ? 95   ARG B CG  1 
ATOM   5192 C CD  . ARG B 1 96  ? 37.297  -7.854  34.901  1.00 30.45 ? 95   ARG B CD  1 
ATOM   5193 N NE  . ARG B 1 96  ? 38.639  -7.326  34.687  1.00 31.48 ? 95   ARG B NE  1 
ATOM   5194 C CZ  . ARG B 1 96  ? 39.002  -6.641  33.615  1.00 32.72 ? 95   ARG B CZ  1 
ATOM   5195 N NH1 . ARG B 1 96  ? 38.124  -6.401  32.640  1.00 32.35 ? 95   ARG B NH1 1 
ATOM   5196 N NH2 . ARG B 1 96  ? 40.247  -6.198  33.517  1.00 33.79 ? 95   ARG B NH2 1 
ATOM   5197 N N   . ALA B 1 97  ? 33.996  -9.713  38.863  1.00 24.58 ? 96   ALA B N   1 
ATOM   5198 C CA  . ALA B 1 97  ? 32.590  -9.613  39.201  1.00 24.46 ? 96   ALA B CA  1 
ATOM   5199 C C   . ALA B 1 97  ? 31.837  -8.918  38.044  1.00 23.76 ? 96   ALA B C   1 
ATOM   5200 O O   . ALA B 1 97  ? 32.457  -8.338  37.146  1.00 24.09 ? 96   ALA B O   1 
ATOM   5201 C CB  . ALA B 1 97  ? 32.406  -8.856  40.526  1.00 24.30 ? 96   ALA B CB  1 
ATOM   5202 N N   . VAL B 1 98  ? 30.514  -9.011  38.050  1.00 23.47 ? 97   VAL B N   1 
ATOM   5203 C CA  . VAL B 1 98  ? 29.680  -8.385  37.019  1.00 23.02 ? 97   VAL B CA  1 
ATOM   5204 C C   . VAL B 1 98  ? 28.591  -7.624  37.743  1.00 23.24 ? 97   VAL B C   1 
ATOM   5205 O O   . VAL B 1 98  ? 27.598  -8.203  38.194  1.00 23.89 ? 97   VAL B O   1 
ATOM   5206 C CB  . VAL B 1 98  ? 29.077  -9.427  36.065  1.00 23.26 ? 97   VAL B CB  1 
ATOM   5207 C CG1 . VAL B 1 98  ? 28.109  -8.772  35.084  1.00 22.24 ? 97   VAL B CG1 1 
ATOM   5208 C CG2 . VAL B 1 98  ? 30.174  -10.164 35.299  1.00 21.06 ? 97   VAL B CG2 1 
ATOM   5209 N N   . LEU B 1 99  ? 28.792  -6.322  37.878  1.00 23.30 ? 98   LEU B N   1 
ATOM   5210 C CA  . LEU B 1 99  ? 28.022  -5.568  38.860  1.00 23.37 ? 98   LEU B CA  1 
ATOM   5211 C C   . LEU B 1 99  ? 27.439  -4.253  38.390  1.00 23.21 ? 98   LEU B C   1 
ATOM   5212 O O   . LEU B 1 99  ? 27.400  -3.281  39.152  1.00 23.16 ? 98   LEU B O   1 
ATOM   5213 C CB  . LEU B 1 99  ? 28.850  -5.373  40.136  1.00 23.73 ? 98   LEU B CB  1 
ATOM   5214 C CG  . LEU B 1 99  ? 28.926  -6.575  41.093  1.00 24.25 ? 98   LEU B CG  1 
ATOM   5215 C CD1 . LEU B 1 99  ? 29.738  -6.176  42.293  1.00 24.37 ? 98   LEU B CD1 1 
ATOM   5216 C CD2 . LEU B 1 99  ? 27.535  -7.076  41.528  1.00 24.19 ? 98   LEU B CD2 1 
ATOM   5217 N N   . HIS B 1 100 ? 26.930  -4.228  37.155  1.00 22.84 ? 99   HIS B N   1 
ATOM   5218 C CA  . HIS B 1 100 ? 26.147  -3.078  36.720  1.00 22.27 ? 99   HIS B CA  1 
ATOM   5219 C C   . HIS B 1 100 ? 24.917  -2.894  37.624  1.00 22.51 ? 99   HIS B C   1 
ATOM   5220 O O   . HIS B 1 100 ? 24.468  -1.777  37.808  1.00 21.90 ? 99   HIS B O   1 
ATOM   5221 C CB  . HIS B 1 100 ? 25.766  -3.143  35.234  1.00 22.41 ? 99   HIS B CB  1 
ATOM   5222 C CG  . HIS B 1 100 ? 25.388  -4.513  34.760  1.00 21.11 ? 99   HIS B CG  1 
ATOM   5223 N ND1 . HIS B 1 100 ? 26.325  -5.461  34.408  1.00 20.31 ? 99   HIS B ND1 1 
ATOM   5224 C CD2 . HIS B 1 100 ? 24.178  -5.106  34.617  1.00 21.01 ? 99   HIS B CD2 1 
ATOM   5225 C CE1 . HIS B 1 100 ? 25.706  -6.573  34.050  1.00 21.33 ? 99   HIS B CE1 1 
ATOM   5226 N NE2 . HIS B 1 100 ? 24.402  -6.385  34.172  1.00 20.21 ? 99   HIS B NE2 1 
ATOM   5227 N N   . VAL B 1 101 ? 24.425  -3.981  38.229  1.00 22.89 ? 100  VAL B N   1 
ATOM   5228 C CA  . VAL B 1 101 ? 23.321  -3.879  39.199  1.00 23.63 ? 100  VAL B CA  1 
ATOM   5229 C C   . VAL B 1 101 ? 23.668  -3.054  40.449  1.00 23.78 ? 100  VAL B C   1 
ATOM   5230 O O   . VAL B 1 101 ? 22.785  -2.403  41.026  1.00 24.66 ? 100  VAL B O   1 
ATOM   5231 C CB  . VAL B 1 101 ? 22.702  -5.253  39.610  1.00 23.50 ? 100  VAL B CB  1 
ATOM   5232 C CG1 . VAL B 1 101 ? 22.103  -5.979  38.404  1.00 23.38 ? 100  VAL B CG1 1 
ATOM   5233 C CG2 . VAL B 1 101 ? 23.706  -6.134  40.362  1.00 23.63 ? 100  VAL B CG2 1 
ATOM   5234 N N   . ALA B 1 102 ? 24.947  -3.057  40.830  1.00 23.63 ? 101  ALA B N   1 
ATOM   5235 C CA  . ALA B 1 102 ? 25.435  -2.289  41.973  1.00 23.62 ? 101  ALA B CA  1 
ATOM   5236 C C   . ALA B 1 102 ? 25.375  -0.796  41.686  1.00 23.26 ? 101  ALA B C   1 
ATOM   5237 O O   . ALA B 1 102 ? 25.063  0.000   42.570  1.00 23.31 ? 101  ALA B O   1 
ATOM   5238 C CB  . ALA B 1 102 ? 26.857  -2.708  42.338  1.00 23.25 ? 101  ALA B CB  1 
ATOM   5239 N N   . LEU B 1 103 ? 25.640  -0.424  40.434  1.00 22.54 ? 102  LEU B N   1 
ATOM   5240 C CA  . LEU B 1 103 ? 25.637  0.973   40.033  1.00 21.98 ? 102  LEU B CA  1 
ATOM   5241 C C   . LEU B 1 103 ? 24.318  1.691   40.287  1.00 22.13 ? 102  LEU B C   1 
ATOM   5242 O O   . LEU B 1 103 ? 24.306  2.884   40.552  1.00 22.32 ? 102  LEU B O   1 
ATOM   5243 C CB  . LEU B 1 103 ? 25.980  1.096   38.549  1.00 21.01 ? 102  LEU B CB  1 
ATOM   5244 C CG  . LEU B 1 103 ? 27.352  0.555   38.162  1.00 20.47 ? 102  LEU B CG  1 
ATOM   5245 C CD1 . LEU B 1 103 ? 27.478  0.632   36.643  1.00 18.21 ? 102  LEU B CD1 1 
ATOM   5246 C CD2 . LEU B 1 103 ? 28.455  1.340   38.831  1.00 19.79 ? 102  LEU B CD2 1 
ATOM   5247 N N   . ARG B 1 104 ? 23.220  0.957   40.171  1.00 22.37 ? 103  ARG B N   1 
ATOM   5248 C CA  . ARG B 1 104 ? 21.885  1.518   40.343  1.00 22.66 ? 103  ARG B CA  1 
ATOM   5249 C C   . ARG B 1 104 ? 21.177  0.905   41.552  1.00 23.33 ? 103  ARG B C   1 
ATOM   5250 O O   . ARG B 1 104 ? 19.953  0.917   41.613  1.00 22.90 ? 103  ARG B O   1 
ATOM   5251 C CB  . ARG B 1 104 ? 21.048  1.278   39.084  1.00 22.12 ? 103  ARG B CB  1 
ATOM   5252 C CG  . ARG B 1 104 ? 20.866  -0.193  38.731  1.00 21.74 ? 103  ARG B CG  1 
ATOM   5253 C CD  . ARG B 1 104 ? 21.465  -0.579  37.378  1.00 21.54 ? 103  ARG B CD  1 
ATOM   5254 N NE  . ARG B 1 104 ? 20.936  -1.855  36.913  1.00 20.32 ? 103  ARG B NE  1 
ATOM   5255 C CZ  . ARG B 1 104 ? 21.215  -2.420  35.742  1.00 21.88 ? 103  ARG B CZ  1 
ATOM   5256 N NH1 . ARG B 1 104 ? 22.058  -1.828  34.897  1.00 22.32 ? 103  ARG B NH1 1 
ATOM   5257 N NH2 . ARG B 1 104 ? 20.646  -3.582  35.414  1.00 20.76 ? 103  ARG B NH2 1 
ATOM   5258 N N   . ASN B 1 105 ? 21.951  0.324   42.461  1.00 24.41 ? 104  ASN B N   1 
ATOM   5259 C CA  . ASN B 1 105 ? 21.425  -0.300  43.687  1.00 26.08 ? 104  ASN B CA  1 
ATOM   5260 C C   . ASN B 1 105 ? 20.937  0.765   44.679  1.00 26.97 ? 104  ASN B C   1 
ATOM   5261 O O   . ASN B 1 105 ? 21.604  1.100   45.665  1.00 27.47 ? 104  ASN B O   1 
ATOM   5262 C CB  . ASN B 1 105 ? 22.462  -1.263  44.287  1.00 26.17 ? 104  ASN B CB  1 
ATOM   5263 C CG  . ASN B 1 105 ? 22.027  -1.876  45.632  1.00 27.83 ? 104  ASN B CG  1 
ATOM   5264 O OD1 . ASN B 1 105 ? 20.845  -2.119  45.883  1.00 30.27 ? 104  ASN B OD1 1 
ATOM   5265 N ND2 . ASN B 1 105 ? 23.002  -2.138  46.487  1.00 26.55 ? 104  ASN B ND2 1 
ATOM   5266 N N   . ARG B 1 106 ? 19.756  1.300   44.387  1.00 28.24 ? 105  ARG B N   1 
ATOM   5267 C CA  . ARG B 1 106 ? 19.168  2.388   45.165  1.00 29.46 ? 105  ARG B CA  1 
ATOM   5268 C C   . ARG B 1 106 ? 18.898  2.008   46.628  1.00 30.23 ? 105  ARG B C   1 
ATOM   5269 O O   . ARG B 1 106 ? 18.857  2.875   47.498  1.00 30.65 ? 105  ARG B O   1 
ATOM   5270 C CB  . ARG B 1 106 ? 17.875  2.882   44.503  1.00 29.39 ? 105  ARG B CB  1 
ATOM   5271 C CG  . ARG B 1 106 ? 18.008  3.257   43.028  1.00 29.93 ? 105  ARG B CG  1 
ATOM   5272 C CD  . ARG B 1 106 ? 19.103  4.265   42.726  1.00 29.10 ? 105  ARG B CD  1 
ATOM   5273 N NE  . ARG B 1 106 ? 18.852  5.558   43.363  1.00 30.21 ? 105  ARG B NE  1 
ATOM   5274 C CZ  . ARG B 1 106 ? 19.764  6.505   43.537  1.00 30.24 ? 105  ARG B CZ  1 
ATOM   5275 N NH1 . ARG B 1 106 ? 21.014  6.317   43.141  1.00 28.59 ? 105  ARG B NH1 1 
ATOM   5276 N NH2 . ARG B 1 106 ? 19.423  7.647   44.129  1.00 31.04 ? 105  ARG B NH2 1 
ATOM   5277 N N   . SER B 1 107 ? 18.721  0.712   46.875  1.00 31.10 ? 106  SER B N   1 
ATOM   5278 C CA  . SER B 1 107 ? 18.411  0.179   48.200  1.00 31.72 ? 106  SER B CA  1 
ATOM   5279 C C   . SER B 1 107 ? 19.629  0.204   49.128  1.00 31.51 ? 106  SER B C   1 
ATOM   5280 O O   . SER B 1 107 ? 19.495  0.158   50.359  1.00 31.35 ? 106  SER B O   1 
ATOM   5281 C CB  . SER B 1 107 ? 17.886  -1.249  48.066  1.00 31.62 ? 106  SER B CB  1 
ATOM   5282 O OG  . SER B 1 107 ? 18.946  -2.170  47.841  1.00 34.16 ? 106  SER B OG  1 
ATOM   5283 N N   . ASN B 1 108 ? 20.812  0.253   48.518  1.00 31.13 ? 107  ASN B N   1 
ATOM   5284 C CA  . ASN B 1 108 ? 22.097  0.318   49.215  1.00 31.06 ? 107  ASN B CA  1 
ATOM   5285 C C   . ASN B 1 108 ? 22.468  -0.900  50.065  1.00 30.89 ? 107  ASN B C   1 
ATOM   5286 O O   . ASN B 1 108 ? 23.440  -0.858  50.820  1.00 30.99 ? 107  ASN B O   1 
ATOM   5287 C CB  . ASN B 1 108 ? 22.245  1.636   50.005  1.00 31.15 ? 107  ASN B CB  1 
ATOM   5288 C CG  . ASN B 1 108 ? 22.607  2.818   49.105  1.00 31.76 ? 107  ASN B CG  1 
ATOM   5289 O OD1 . ASN B 1 108 ? 23.451  2.699   48.209  1.00 31.16 ? 107  ASN B OD1 1 
ATOM   5290 N ND2 . ASN B 1 108 ? 21.960  3.961   49.333  1.00 32.12 ? 107  ASN B ND2 1 
ATOM   5291 N N   . THR B 1 109 ? 21.717  -1.992  49.924  1.00 30.95 ? 108  THR B N   1 
ATOM   5292 C CA  . THR B 1 109 ? 22.130  -3.273  50.496  1.00 30.96 ? 108  THR B CA  1 
ATOM   5293 C C   . THR B 1 109 ? 23.554  -3.578  50.017  1.00 30.84 ? 108  THR B C   1 
ATOM   5294 O O   . THR B 1 109 ? 23.823  -3.545  48.810  1.00 31.16 ? 108  THR B O   1 
ATOM   5295 C CB  . THR B 1 109 ? 21.161  -4.402  50.075  1.00 31.00 ? 108  THR B CB  1 
ATOM   5296 O OG1 . THR B 1 109 ? 19.807  -3.955  50.220  1.00 32.69 ? 108  THR B OG1 1 
ATOM   5297 C CG2 . THR B 1 109 ? 21.253  -5.590  51.032  1.00 30.65 ? 108  THR B CG2 1 
ATOM   5298 N N   . PRO B 1 110 ? 24.473  -3.822  50.952  1.00 30.53 ? 109  PRO B N   1 
ATOM   5299 C CA  . PRO B 1 110 ? 25.875  -4.081  50.604  1.00 30.04 ? 109  PRO B CA  1 
ATOM   5300 C C   . PRO B 1 110 ? 26.045  -5.192  49.567  1.00 29.52 ? 109  PRO B C   1 
ATOM   5301 O O   . PRO B 1 110 ? 25.398  -6.241  49.618  1.00 29.11 ? 109  PRO B O   1 
ATOM   5302 C CB  . PRO B 1 110 ? 26.495  -4.485  51.941  1.00 30.32 ? 109  PRO B CB  1 
ATOM   5303 C CG  . PRO B 1 110 ? 25.666  -3.737  52.940  1.00 31.07 ? 109  PRO B CG  1 
ATOM   5304 C CD  . PRO B 1 110 ? 24.262  -3.819  52.411  1.00 30.84 ? 109  PRO B CD  1 
ATOM   5305 N N   . ILE B 1 111 ? 26.912  -4.925  48.604  1.00 28.96 ? 110  ILE B N   1 
ATOM   5306 C CA  . ILE B 1 111 ? 27.329  -5.917  47.628  1.00 28.68 ? 110  ILE B CA  1 
ATOM   5307 C C   . ILE B 1 111 ? 28.840  -5.969  47.726  1.00 28.52 ? 110  ILE B C   1 
ATOM   5308 O O   . ILE B 1 111 ? 29.505  -4.960  47.530  1.00 28.45 ? 110  ILE B O   1 
ATOM   5309 C CB  . ILE B 1 111 ? 26.883  -5.505  46.199  1.00 28.93 ? 110  ILE B CB  1 
ATOM   5310 C CG1 . ILE B 1 111 ? 25.359  -5.351  46.127  1.00 29.01 ? 110  ILE B CG1 1 
ATOM   5311 C CG2 . ILE B 1 111 ? 27.364  -6.527  45.189  1.00 27.70 ? 110  ILE B CG2 1 
ATOM   5312 C CD1 . ILE B 1 111 ? 24.841  -4.687  44.865  1.00 29.01 ? 110  ILE B CD1 1 
ATOM   5313 N N   . LYS B 1 112 ? 29.378  -7.136  48.050  1.00 29.06 ? 111  LYS B N   1 
ATOM   5314 C CA  . LYS B 1 112 ? 30.808  -7.242  48.316  1.00 29.63 ? 111  LYS B CA  1 
ATOM   5315 C C   . LYS B 1 112 ? 31.595  -7.822  47.163  1.00 29.51 ? 111  LYS B C   1 
ATOM   5316 O O   . LYS B 1 112 ? 31.222  -8.840  46.583  1.00 29.25 ? 111  LYS B O   1 
ATOM   5317 C CB  . LYS B 1 112 ? 31.073  -8.077  49.576  1.00 29.41 ? 111  LYS B CB  1 
ATOM   5318 C CG  . LYS B 1 112 ? 30.638  -7.423  50.869  1.00 31.45 ? 111  LYS B CG  1 
ATOM   5319 C CD  . LYS B 1 112 ? 31.174  -8.207  52.057  1.00 33.83 ? 111  LYS B CD  1 
ATOM   5320 C CE  . LYS B 1 112 ? 30.477  -7.802  53.333  1.00 35.49 ? 111  LYS B CE  1 
ATOM   5321 N NZ  . LYS B 1 112 ? 29.075  -8.320  53.345  1.00 38.90 ? 111  LYS B NZ  1 
ATOM   5322 N N   . VAL B 1 113 ? 32.706  -7.163  46.859  1.00 30.52 ? 112  VAL B N   1 
ATOM   5323 C CA  . VAL B 1 113 ? 33.717  -7.704  45.963  1.00 31.11 ? 112  VAL B CA  1 
ATOM   5324 C C   . VAL B 1 113 ? 35.013  -7.777  46.767  1.00 31.58 ? 112  VAL B C   1 
ATOM   5325 O O   . VAL B 1 113 ? 35.453  -6.775  47.343  1.00 31.55 ? 112  VAL B O   1 
ATOM   5326 C CB  . VAL B 1 113 ? 33.881  -6.833  44.697  1.00 31.41 ? 112  VAL B CB  1 
ATOM   5327 C CG1 . VAL B 1 113 ? 35.097  -7.272  43.869  1.00 32.09 ? 112  VAL B CG1 1 
ATOM   5328 C CG2 . VAL B 1 113 ? 32.626  -6.896  43.850  1.00 30.93 ? 112  VAL B CG2 1 
ATOM   5329 N N   . ASP B 1 114 ? 35.601  -8.973  46.813  1.00 32.52 ? 113  ASP B N   1 
ATOM   5330 C CA  . ASP B 1 114 ? 36.801  -9.261  47.614  1.00 33.06 ? 113  ASP B CA  1 
ATOM   5331 C C   . ASP B 1 114 ? 36.615  -8.821  49.079  1.00 33.38 ? 113  ASP B C   1 
ATOM   5332 O O   . ASP B 1 114 ? 37.492  -8.164  49.661  1.00 33.89 ? 113  ASP B O   1 
ATOM   5333 C CB  . ASP B 1 114 ? 38.054  -8.605  47.010  1.00 33.21 ? 113  ASP B CB  1 
ATOM   5334 C CG  . ASP B 1 114 ? 38.340  -9.068  45.581  1.00 33.87 ? 113  ASP B CG  1 
ATOM   5335 O OD1 . ASP B 1 114 ? 38.324  -10.292 45.320  1.00 33.98 ? 113  ASP B OD1 1 
ATOM   5336 O OD2 . ASP B 1 114 ? 38.608  -8.267  44.662  1.00 35.32 ? 113  ASP B OD2 1 
ATOM   5337 N N   . GLY B 1 115 ? 35.452  -9.148  49.635  1.00 33.16 ? 114  GLY B N   1 
ATOM   5338 C CA  . GLY B 1 115 ? 35.122  -8.861  51.021  1.00 33.14 ? 114  GLY B CA  1 
ATOM   5339 C C   . GLY B 1 115 ? 34.733  -7.432  51.362  1.00 32.84 ? 114  GLY B C   1 
ATOM   5340 O O   . GLY B 1 115 ? 34.464  -7.120  52.532  1.00 33.16 ? 114  GLY B O   1 
ATOM   5341 N N   . LYS B 1 116 ? 34.682  -6.563  50.358  1.00 31.98 ? 115  LYS B N   1 
ATOM   5342 C CA  . LYS B 1 116 ? 34.419  -5.147  50.591  1.00 31.10 ? 115  LYS B CA  1 
ATOM   5343 C C   . LYS B 1 116 ? 33.184  -4.664  49.837  1.00 30.05 ? 115  LYS B C   1 
ATOM   5344 O O   . LYS B 1 116 ? 33.062  -4.880  48.627  1.00 29.73 ? 115  LYS B O   1 
ATOM   5345 C CB  . LYS B 1 116 ? 35.649  -4.325  50.187  1.00 31.78 ? 115  LYS B CB  1 
ATOM   5346 C CG  . LYS B 1 116 ? 35.656  -2.880  50.674  1.00 33.59 ? 115  LYS B CG  1 
ATOM   5347 C CD  . LYS B 1 116 ? 36.940  -2.182  50.228  1.00 35.82 ? 115  LYS B CD  1 
ATOM   5348 C CE  . LYS B 1 116 ? 36.802  -0.671  50.241  1.00 37.87 ? 115  LYS B CE  1 
ATOM   5349 N NZ  . LYS B 1 116 ? 38.080  -0.015  50.644  1.00 39.16 ? 115  LYS B NZ  1 
ATOM   5350 N N   . ASP B 1 117 ? 32.286  -4.003  50.566  1.00 29.01 ? 116  ASP B N   1 
ATOM   5351 C CA  . ASP B 1 117 ? 31.086  -3.384  50.008  1.00 28.17 ? 116  ASP B CA  1 
ATOM   5352 C C   . ASP B 1 117 ? 31.475  -2.335  48.959  1.00 27.29 ? 116  ASP B C   1 
ATOM   5353 O O   . ASP B 1 117 ? 32.273  -1.436  49.229  1.00 27.17 ? 116  ASP B O   1 
ATOM   5354 C CB  . ASP B 1 117 ? 30.248  -2.760  51.139  1.00 28.35 ? 116  ASP B CB  1 
ATOM   5355 C CG  . ASP B 1 117 ? 28.918  -2.182  50.661  1.00 28.86 ? 116  ASP B CG  1 
ATOM   5356 O OD1 . ASP B 1 117 ? 28.570  -2.320  49.464  1.00 28.39 ? 116  ASP B OD1 1 
ATOM   5357 O OD2 . ASP B 1 117 ? 28.144  -1.564  51.433  1.00 29.46 ? 116  ASP B OD2 1 
ATOM   5358 N N   . VAL B 1 118 ? 30.917  -2.468  47.758  1.00 26.77 ? 117  VAL B N   1 
ATOM   5359 C CA  . VAL B 1 118 ? 31.193  -1.520  46.673  1.00 25.95 ? 117  VAL B CA  1 
ATOM   5360 C C   . VAL B 1 118 ? 30.282  -0.277  46.717  1.00 25.61 ? 117  VAL B C   1 
ATOM   5361 O O   . VAL B 1 118 ? 30.552  0.735   46.055  1.00 25.14 ? 117  VAL B O   1 
ATOM   5362 C CB  . VAL B 1 118 ? 31.105  -2.214  45.275  1.00 25.97 ? 117  VAL B CB  1 
ATOM   5363 C CG1 . VAL B 1 118 ? 32.117  -3.365  45.183  1.00 26.56 ? 117  VAL B CG1 1 
ATOM   5364 C CG2 . VAL B 1 118 ? 29.682  -2.709  44.979  1.00 25.65 ? 117  VAL B CG2 1 
ATOM   5365 N N   . MET B 1 119 ? 29.203  -0.353  47.493  1.00 25.36 ? 118  MET B N   1 
ATOM   5366 C CA  . MET B 1 119 ? 28.217  0.723   47.517  1.00 25.86 ? 118  MET B CA  1 
ATOM   5367 C C   . MET B 1 119 ? 28.742  2.115   47.931  1.00 26.11 ? 118  MET B C   1 
ATOM   5368 O O   . MET B 1 119 ? 28.414  3.091   47.268  1.00 26.85 ? 118  MET B O   1 
ATOM   5369 C CB  . MET B 1 119 ? 26.954  0.322   48.293  1.00 25.59 ? 118  MET B CB  1 
ATOM   5370 C CG  . MET B 1 119 ? 26.155  -0.777  47.611  1.00 25.16 ? 118  MET B CG  1 
ATOM   5371 S SD  . MET B 1 119 ? 25.942  -0.554  45.803  1.00 25.67 ? 118  MET B SD  1 
ATOM   5372 C CE  . MET B 1 119 ? 25.175  1.050   45.718  1.00 21.79 ? 118  MET B CE  1 
ATOM   5373 N N   . PRO B 1 120 ? 29.545  2.229   48.997  1.00 26.72 ? 119  PRO B N   1 
ATOM   5374 C CA  . PRO B 1 120 ? 30.134  3.528   49.351  1.00 26.54 ? 119  PRO B CA  1 
ATOM   5375 C C   . PRO B 1 120 ? 30.853  4.238   48.192  1.00 26.85 ? 119  PRO B C   1 
ATOM   5376 O O   . PRO B 1 120 ? 30.656  5.452   48.019  1.00 26.80 ? 119  PRO B O   1 
ATOM   5377 C CB  . PRO B 1 120 ? 31.109  3.161   50.475  1.00 26.86 ? 119  PRO B CB  1 
ATOM   5378 C CG  . PRO B 1 120 ? 30.450  2.018   51.131  1.00 26.72 ? 119  PRO B CG  1 
ATOM   5379 C CD  . PRO B 1 120 ? 29.918  1.190   49.978  1.00 26.56 ? 119  PRO B CD  1 
ATOM   5380 N N   . GLU B 1 121 ? 31.656  3.493   47.428  1.00 26.89 ? 120  GLU B N   1 
ATOM   5381 C CA  . GLU B 1 121 ? 32.378  4.030   46.280  1.00 27.48 ? 120  GLU B CA  1 
ATOM   5382 C C   . GLU B 1 121 ? 31.445  4.400   45.124  1.00 26.31 ? 120  GLU B C   1 
ATOM   5383 O O   . GLU B 1 121 ? 31.596  5.447   44.524  1.00 26.09 ? 120  GLU B O   1 
ATOM   5384 C CB  . GLU B 1 121 ? 33.452  3.051   45.801  1.00 27.93 ? 120  GLU B CB  1 
ATOM   5385 C CG  . GLU B 1 121 ? 34.838  3.321   46.379  1.00 32.01 ? 120  GLU B CG  1 
ATOM   5386 C CD  . GLU B 1 121 ? 35.269  4.777   46.240  1.00 35.22 ? 120  GLU B CD  1 
ATOM   5387 O OE1 . GLU B 1 121 ? 35.115  5.542   47.222  1.00 35.92 ? 120  GLU B OE1 1 
ATOM   5388 O OE2 . GLU B 1 121 ? 35.764  5.162   45.155  1.00 36.97 ? 120  GLU B OE2 1 
ATOM   5389 N N   . VAL B 1 122 ? 30.483  3.532   44.830  1.00 25.16 ? 121  VAL B N   1 
ATOM   5390 C CA  . VAL B 1 122 ? 29.407  3.858   43.885  1.00 24.32 ? 121  VAL B CA  1 
ATOM   5391 C C   . VAL B 1 122 ? 28.752  5.190   44.248  1.00 24.12 ? 121  VAL B C   1 
ATOM   5392 O O   . VAL B 1 122 ? 28.611  6.091   43.409  1.00 23.99 ? 121  VAL B O   1 
ATOM   5393 C CB  . VAL B 1 122 ? 28.332  2.730   43.848  1.00 23.75 ? 121  VAL B CB  1 
ATOM   5394 C CG1 . VAL B 1 122 ? 27.072  3.172   43.098  1.00 22.70 ? 121  VAL B CG1 1 
ATOM   5395 C CG2 . VAL B 1 122 ? 28.909  1.486   43.208  1.00 23.93 ? 121  VAL B CG2 1 
ATOM   5396 N N   . ASN B 1 123 ? 28.378  5.333   45.514  1.00 24.60 ? 122  ASN B N   1 
ATOM   5397 C CA  . ASN B 1 123 ? 27.632  6.512   45.934  1.00 25.10 ? 122  ASN B CA  1 
ATOM   5398 C C   . ASN B 1 123 ? 28.483  7.773   46.003  1.00 24.63 ? 122  ASN B C   1 
ATOM   5399 O O   . ASN B 1 123 ? 27.991  8.879   45.770  1.00 24.21 ? 122  ASN B O   1 
ATOM   5400 C CB  . ASN B 1 123 ? 26.915  6.244   47.253  1.00 25.35 ? 122  ASN B CB  1 
ATOM   5401 C CG  . ASN B 1 123 ? 25.799  5.235   47.097  1.00 26.93 ? 122  ASN B CG  1 
ATOM   5402 O OD1 . ASN B 1 123 ? 25.131  5.198   46.066  1.00 29.49 ? 122  ASN B OD1 1 
ATOM   5403 N ND2 . ASN B 1 123 ? 25.604  4.392   48.106  1.00 27.50 ? 122  ASN B ND2 1 
ATOM   5404 N N   . ARG B 1 124 ? 29.764  7.592   46.296  1.00 24.63 ? 123  ARG B N   1 
ATOM   5405 C CA  . ARG B 1 124 ? 30.700  8.698   46.277  1.00 25.39 ? 123  ARG B CA  1 
ATOM   5406 C C   . ARG B 1 124 ? 30.828  9.292   44.866  1.00 24.59 ? 123  ARG B C   1 
ATOM   5407 O O   . ARG B 1 124 ? 30.791  10.512  44.702  1.00 24.19 ? 123  ARG B O   1 
ATOM   5408 C CB  . ARG B 1 124 ? 32.063  8.263   46.829  1.00 25.37 ? 123  ARG B CB  1 
ATOM   5409 C CG  . ARG B 1 124 ? 33.087  9.396   46.885  1.00 29.43 ? 123  ARG B CG  1 
ATOM   5410 C CD  . ARG B 1 124 ? 34.526  8.947   47.119  1.00 33.61 ? 123  ARG B CD  1 
ATOM   5411 N NE  . ARG B 1 124 ? 35.058  8.175   45.995  1.00 36.46 ? 123  ARG B NE  1 
ATOM   5412 C CZ  . ARG B 1 124 ? 35.576  8.703   44.890  1.00 37.09 ? 123  ARG B CZ  1 
ATOM   5413 N NH1 . ARG B 1 124 ? 35.644  10.023  44.741  1.00 38.69 ? 123  ARG B NH1 1 
ATOM   5414 N NH2 . ARG B 1 124 ? 36.027  7.910   43.930  1.00 37.62 ? 123  ARG B NH2 1 
ATOM   5415 N N   . VAL B 1 125 ? 30.983  8.429   43.857  1.00 24.81 ? 124  VAL B N   1 
ATOM   5416 C CA  . VAL B 1 125 ? 31.047  8.892   42.469  1.00 24.94 ? 124  VAL B CA  1 
ATOM   5417 C C   . VAL B 1 125 ? 29.712  9.503   42.051  1.00 25.20 ? 124  VAL B C   1 
ATOM   5418 O O   . VAL B 1 125 ? 29.684  10.522  41.383  1.00 25.76 ? 124  VAL B O   1 
ATOM   5419 C CB  . VAL B 1 125 ? 31.489  7.781   41.480  1.00 25.21 ? 124  VAL B CB  1 
ATOM   5420 C CG1 . VAL B 1 125 ? 31.347  8.242   40.027  1.00 25.01 ? 124  VAL B CG1 1 
ATOM   5421 C CG2 . VAL B 1 125 ? 32.940  7.356   41.753  1.00 25.86 ? 124  VAL B CG2 1 
ATOM   5422 N N   . LEU B 1 126 ? 28.600  8.897   42.459  1.00 25.64 ? 125  LEU B N   1 
ATOM   5423 C CA  . LEU B 1 126 ? 27.306  9.524   42.182  1.00 25.94 ? 125  LEU B CA  1 
ATOM   5424 C C   . LEU B 1 126 ? 27.204  10.942  42.783  1.00 26.10 ? 125  LEU B C   1 
ATOM   5425 O O   . LEU B 1 126 ? 26.729  11.863  42.119  1.00 25.55 ? 125  LEU B O   1 
ATOM   5426 C CB  . LEU B 1 126 ? 26.143  8.627   42.613  1.00 25.83 ? 125  LEU B CB  1 
ATOM   5427 C CG  . LEU B 1 126 ? 25.912  7.410   41.692  1.00 25.95 ? 125  LEU B CG  1 
ATOM   5428 C CD1 . LEU B 1 126 ? 25.004  6.388   42.343  1.00 25.13 ? 125  LEU B CD1 1 
ATOM   5429 C CD2 . LEU B 1 126 ? 25.385  7.818   40.306  1.00 25.03 ? 125  LEU B CD2 1 
ATOM   5430 N N   . ASP B 1 127 ? 27.669  11.117  44.017  1.00 26.96 ? 126  ASP B N   1 
ATOM   5431 C CA  . ASP B 1 127 ? 27.711  12.454  44.635  1.00 27.42 ? 126  ASP B CA  1 
ATOM   5432 C C   . ASP B 1 127 ? 28.562  13.465  43.863  1.00 27.13 ? 126  ASP B C   1 
ATOM   5433 O O   . ASP B 1 127 ? 28.169  14.626  43.719  1.00 26.78 ? 126  ASP B O   1 
ATOM   5434 C CB  . ASP B 1 127 ? 28.188  12.378  46.086  1.00 28.34 ? 126  ASP B CB  1 
ATOM   5435 C CG  . ASP B 1 127 ? 27.188  11.707  46.994  1.00 29.64 ? 126  ASP B CG  1 
ATOM   5436 O OD1 . ASP B 1 127 ? 27.586  11.318  48.104  1.00 34.29 ? 126  ASP B OD1 1 
ATOM   5437 O OD2 . ASP B 1 127 ? 25.996  11.511  46.690  1.00 32.94 ? 126  ASP B OD2 1 
ATOM   5438 N N   . LYS B 1 128 ? 29.721  13.021  43.376  1.00 26.97 ? 127  LYS B N   1 
ATOM   5439 C CA  . LYS B 1 128 ? 30.574  13.842  42.510  1.00 26.91 ? 127  LYS B CA  1 
ATOM   5440 C C   . LYS B 1 128 ? 29.860  14.245  41.212  1.00 26.09 ? 127  LYS B C   1 
ATOM   5441 O O   . LYS B 1 128 ? 29.987  15.390  40.757  1.00 25.69 ? 127  LYS B O   1 
ATOM   5442 C CB  . LYS B 1 128 ? 31.887  13.110  42.191  1.00 27.14 ? 127  LYS B CB  1 
ATOM   5443 C CG  . LYS B 1 128 ? 33.105  14.016  42.040  1.00 30.36 ? 127  LYS B CG  1 
ATOM   5444 C CD  . LYS B 1 128 ? 33.288  14.553  40.620  1.00 32.75 ? 127  LYS B CD  1 
ATOM   5445 C CE  . LYS B 1 128 ? 34.636  15.270  40.471  1.00 33.46 ? 127  LYS B CE  1 
ATOM   5446 N NZ  . LYS B 1 128 ? 34.579  16.659  39.906  1.00 33.33 ? 127  LYS B NZ  1 
ATOM   5447 N N   . MET B 1 129 ? 29.121  13.303  40.614  1.00 25.50 ? 128  MET B N   1 
ATOM   5448 C CA  . MET B 1 129 ? 28.336  13.585  39.410  1.00 24.94 ? 128  MET B CA  1 
ATOM   5449 C C   . MET B 1 129 ? 27.271  14.668  39.675  1.00 25.05 ? 128  MET B C   1 
ATOM   5450 O O   . MET B 1 129 ? 27.153  15.633  38.922  1.00 25.02 ? 128  MET B O   1 
ATOM   5451 C CB  . MET B 1 129 ? 27.692  12.302  38.867  1.00 24.75 ? 128  MET B CB  1 
ATOM   5452 C CG  . MET B 1 129 ? 28.700  11.250  38.390  1.00 24.59 ? 128  MET B CG  1 
ATOM   5453 S SD  . MET B 1 129 ? 27.932  9.676   37.985  1.00 24.73 ? 128  MET B SD  1 
ATOM   5454 C CE  . MET B 1 129 ? 27.169  10.076  36.472  1.00 24.57 ? 128  MET B CE  1 
ATOM   5455 N N   . LYS B 1 130 ? 26.517  14.515  40.764  1.00 25.42 ? 129  LYS B N   1 
ATOM   5456 C CA  . LYS B 1 130 ? 25.535  15.521  41.185  1.00 25.43 ? 129  LYS B CA  1 
ATOM   5457 C C   . LYS B 1 130 ? 26.140  16.921  41.353  1.00 25.16 ? 129  LYS B C   1 
ATOM   5458 O O   . LYS B 1 130 ? 25.591  17.905  40.860  1.00 24.62 ? 129  LYS B O   1 
ATOM   5459 C CB  . LYS B 1 130 ? 24.893  15.096  42.512  1.00 25.39 ? 129  LYS B CB  1 
ATOM   5460 C CG  . LYS B 1 130 ? 23.631  15.868  42.853  1.00 26.70 ? 129  LYS B CG  1 
ATOM   5461 C CD  . LYS B 1 130 ? 23.042  15.389  44.169  1.00 29.02 ? 129  LYS B CD  1 
ATOM   5462 C CE  . LYS B 1 130 ? 22.122  16.427  44.769  1.00 30.57 ? 129  LYS B CE  1 
ATOM   5463 N NZ  . LYS B 1 130 ? 20.819  15.807  45.130  1.00 33.27 ? 129  LYS B NZ  1 
ATOM   5464 N N   . SER B 1 131 ? 27.269  17.001  42.050  1.00 25.54 ? 130  SER B N   1 
ATOM   5465 C CA  . SER B 1 131 ? 27.957  18.280  42.253  1.00 26.14 ? 130  SER B CA  1 
ATOM   5466 C C   . SER B 1 131 ? 28.415  18.895  40.933  1.00 26.07 ? 130  SER B C   1 
ATOM   5467 O O   . SER B 1 131 ? 28.272  20.108  40.706  1.00 25.79 ? 130  SER B O   1 
ATOM   5468 C CB  . SER B 1 131 ? 29.156  18.088  43.187  1.00 26.73 ? 130  SER B CB  1 
ATOM   5469 O OG  . SER B 1 131 ? 29.992  19.232  43.173  1.00 28.85 ? 130  SER B OG  1 
ATOM   5470 N N   . PHE B 1 132 ? 28.987  18.048  40.078  1.00 26.08 ? 131  PHE B N   1 
ATOM   5471 C CA  . PHE B 1 132 ? 29.412  18.445  38.739  1.00 26.16 ? 131  PHE B CA  1 
ATOM   5472 C C   . PHE B 1 132 ? 28.247  19.021  37.933  1.00 25.93 ? 131  PHE B C   1 
ATOM   5473 O O   . PHE B 1 132 ? 28.361  20.095  37.339  1.00 25.36 ? 131  PHE B O   1 
ATOM   5474 C CB  . PHE B 1 132 ? 30.028  17.250  38.000  1.00 26.40 ? 131  PHE B CB  1 
ATOM   5475 C CG  . PHE B 1 132 ? 30.836  17.636  36.807  1.00 27.50 ? 131  PHE B CG  1 
ATOM   5476 C CD1 . PHE B 1 132 ? 32.204  17.877  36.929  1.00 29.90 ? 131  PHE B CD1 1 
ATOM   5477 C CD2 . PHE B 1 132 ? 30.235  17.770  35.554  1.00 29.17 ? 131  PHE B CD2 1 
ATOM   5478 C CE1 . PHE B 1 132 ? 32.959  18.253  35.811  1.00 30.92 ? 131  PHE B CE1 1 
ATOM   5479 C CE2 . PHE B 1 132 ? 30.980  18.142  34.430  1.00 30.12 ? 131  PHE B CE2 1 
ATOM   5480 C CZ  . PHE B 1 132 ? 32.340  18.386  34.559  1.00 30.34 ? 131  PHE B CZ  1 
ATOM   5481 N N   . CYS B 1 133 ? 27.124  18.312  37.937  1.00 26.02 ? 132  CYS B N   1 
ATOM   5482 C CA  . CYS B 1 133 ? 25.941  18.751  37.220  1.00 25.75 ? 132  CYS B CA  1 
ATOM   5483 C C   . CYS B 1 133 ? 25.419  20.110  37.702  1.00 25.31 ? 132  CYS B C   1 
ATOM   5484 O O   . CYS B 1 133 ? 25.068  20.960  36.879  1.00 25.01 ? 132  CYS B O   1 
ATOM   5485 C CB  . CYS B 1 133 ? 24.852  17.682  37.290  1.00 26.17 ? 132  CYS B CB  1 
ATOM   5486 S SG  . CYS B 1 133 ? 25.224  16.258  36.226  1.00 29.23 ? 132  CYS B SG  1 
ATOM   5487 N N   . GLN B 1 134 ? 25.364  20.309  39.021  1.00 25.12 ? 133  GLN B N   1 
ATOM   5488 C CA  . GLN B 1 134 ? 24.980  21.615  39.584  1.00 24.91 ? 133  GLN B CA  1 
ATOM   5489 C C   . GLN B 1 134 ? 25.883  22.720  39.047  1.00 24.85 ? 133  GLN B C   1 
ATOM   5490 O O   . GLN B 1 134 ? 25.395  23.749  38.582  1.00 25.05 ? 133  GLN B O   1 
ATOM   5491 C CB  . GLN B 1 134 ? 25.005  21.615  41.120  1.00 25.46 ? 133  GLN B CB  1 
ATOM   5492 C CG  . GLN B 1 134 ? 24.548  22.960  41.780  1.00 25.63 ? 133  GLN B CG  1 
ATOM   5493 C CD  . GLN B 1 134 ? 25.584  24.106  41.691  1.00 26.97 ? 133  GLN B CD  1 
ATOM   5494 O OE1 . GLN B 1 134 ? 26.796  23.881  41.813  1.00 27.60 ? 133  GLN B OE1 1 
ATOM   5495 N NE2 . GLN B 1 134 ? 25.096  25.334  41.494  1.00 27.95 ? 133  GLN B NE2 1 
ATOM   5496 N N   . ARG B 1 135 ? 27.191  22.493  39.094  1.00 24.56 ? 134  ARG B N   1 
ATOM   5497 C CA  . ARG B 1 135 ? 28.163  23.494  38.661  1.00 25.24 ? 134  ARG B CA  1 
ATOM   5498 C C   . ARG B 1 135 ? 27.971  23.851  37.184  1.00 24.84 ? 134  ARG B C   1 
ATOM   5499 O O   . ARG B 1 135 ? 27.877  25.023  36.821  1.00 24.77 ? 134  ARG B O   1 
ATOM   5500 C CB  . ARG B 1 135 ? 29.591  22.998  38.933  1.00 25.24 ? 134  ARG B CB  1 
ATOM   5501 C CG  . ARG B 1 135 ? 30.016  23.085  40.393  1.00 27.17 ? 134  ARG B CG  1 
ATOM   5502 C CD  . ARG B 1 135 ? 31.074  24.170  40.675  1.00 26.93 ? 134  ARG B CD  1 
ATOM   5503 N NE  . ARG B 1 135 ? 32.255  24.030  39.815  1.00 28.17 ? 134  ARG B NE  1 
ATOM   5504 C CZ  . ARG B 1 135 ? 32.930  25.040  39.275  1.00 29.36 ? 134  ARG B CZ  1 
ATOM   5505 N NH1 . ARG B 1 135 ? 32.566  26.308  39.501  1.00 26.90 ? 134  ARG B NH1 1 
ATOM   5506 N NH2 . ARG B 1 135 ? 33.984  24.786  38.500  1.00 28.21 ? 134  ARG B NH2 1 
ATOM   5507 N N   . VAL B 1 136 ? 27.878  22.836  36.328  1.00 24.71 ? 135  VAL B N   1 
ATOM   5508 C CA  . VAL B 1 136 ? 27.757  23.097  34.894  1.00 24.89 ? 135  VAL B CA  1 
ATOM   5509 C C   . VAL B 1 136 ? 26.379  23.657  34.488  1.00 25.18 ? 135  VAL B C   1 
ATOM   5510 O O   . VAL B 1 136 ? 26.291  24.652  33.753  1.00 24.87 ? 135  VAL B O   1 
ATOM   5511 C CB  . VAL B 1 136 ? 28.144  21.865  34.043  1.00 24.72 ? 135  VAL B CB  1 
ATOM   5512 C CG1 . VAL B 1 136 ? 27.861  22.126  32.556  1.00 25.59 ? 135  VAL B CG1 1 
ATOM   5513 C CG2 . VAL B 1 136 ? 29.627  21.485  34.272  1.00 24.08 ? 135  VAL B CG2 1 
ATOM   5514 N N   . ARG B 1 137 ? 25.310  23.015  34.954  1.00 25.15 ? 136  ARG B N   1 
ATOM   5515 C CA  . ARG B 1 137 ? 23.966  23.404  34.539  1.00 25.53 ? 136  ARG B CA  1 
ATOM   5516 C C   . ARG B 1 137 ? 23.594  24.811  35.025  1.00 25.98 ? 136  ARG B C   1 
ATOM   5517 O O   . ARG B 1 137 ? 22.914  25.547  34.321  1.00 26.70 ? 136  ARG B O   1 
ATOM   5518 C CB  . ARG B 1 137 ? 22.938  22.365  34.994  1.00 25.62 ? 136  ARG B CB  1 
ATOM   5519 C CG  . ARG B 1 137 ? 23.062  21.026  34.251  1.00 25.47 ? 136  ARG B CG  1 
ATOM   5520 C CD  . ARG B 1 137 ? 22.226  19.898  34.843  1.00 25.22 ? 136  ARG B CD  1 
ATOM   5521 N NE  . ARG B 1 137 ? 20.808  20.250  34.937  1.00 25.24 ? 136  ARG B NE  1 
ATOM   5522 C CZ  . ARG B 1 137 ? 19.928  20.127  33.940  1.00 25.80 ? 136  ARG B CZ  1 
ATOM   5523 N NH1 . ARG B 1 137 ? 20.302  19.649  32.755  1.00 23.57 ? 136  ARG B NH1 1 
ATOM   5524 N NH2 . ARG B 1 137 ? 18.659  20.458  34.139  1.00 26.82 ? 136  ARG B NH2 1 
ATOM   5525 N N   . SER B 1 138 ? 24.067  25.192  36.207  1.00 26.52 ? 137  SER B N   1 
ATOM   5526 C CA  . SER B 1 138 ? 23.733  26.507  36.770  1.00 26.70 ? 137  SER B CA  1 
ATOM   5527 C C   . SER B 1 138 ? 24.438  27.647  36.043  1.00 27.04 ? 137  SER B C   1 
ATOM   5528 O O   . SER B 1 138 ? 24.054  28.822  36.177  1.00 26.94 ? 137  SER B O   1 
ATOM   5529 C CB  . SER B 1 138 ? 24.082  26.557  38.257  1.00 26.59 ? 137  SER B CB  1 
ATOM   5530 O OG  . SER B 1 138 ? 25.472  26.345  38.464  1.00 27.59 ? 137  SER B OG  1 
ATOM   5531 N N   . GLY B 1 139 ? 25.475  27.298  35.287  1.00 26.26 ? 138  GLY B N   1 
ATOM   5532 C CA  . GLY B 1 139 ? 26.319  28.292  34.652  1.00 25.91 ? 138  GLY B CA  1 
ATOM   5533 C C   . GLY B 1 139 ? 27.456  28.731  35.562  1.00 25.50 ? 138  GLY B C   1 
ATOM   5534 O O   . GLY B 1 139 ? 28.264  29.567  35.165  1.00 26.29 ? 138  GLY B O   1 
ATOM   5535 N N   . ASP B 1 140 ? 27.533  28.161  36.763  1.00 24.95 ? 139  ASP B N   1 
ATOM   5536 C CA  . ASP B 1 140 ? 28.602  28.493  37.712  1.00 24.58 ? 139  ASP B CA  1 
ATOM   5537 C C   . ASP B 1 140 ? 29.972  28.050  37.238  1.00 24.16 ? 139  ASP B C   1 
ATOM   5538 O O   . ASP B 1 140 ? 30.962  28.719  37.512  1.00 23.41 ? 139  ASP B O   1 
ATOM   5539 C CB  . ASP B 1 140 ? 28.338  27.878  39.083  1.00 24.57 ? 139  ASP B CB  1 
ATOM   5540 C CG  . ASP B 1 140 ? 27.230  28.576  39.831  1.00 26.09 ? 139  ASP B CG  1 
ATOM   5541 O OD1 . ASP B 1 140 ? 26.810  29.681  39.407  1.00 25.74 ? 139  ASP B OD1 1 
ATOM   5542 O OD2 . ASP B 1 140 ? 26.721  28.094  40.861  1.00 26.85 ? 139  ASP B OD2 1 
ATOM   5543 N N   . TRP B 1 141 ? 30.031  26.913  36.547  1.00 23.98 ? 140  TRP B N   1 
ATOM   5544 C CA  . TRP B 1 141 ? 31.278  26.460  35.937  1.00 24.06 ? 140  TRP B CA  1 
ATOM   5545 C C   . TRP B 1 141 ? 31.594  27.352  34.746  1.00 24.06 ? 140  TRP B C   1 
ATOM   5546 O O   . TRP B 1 141 ? 30.815  27.426  33.787  1.00 24.83 ? 140  TRP B O   1 
ATOM   5547 C CB  . TRP B 1 141 ? 31.173  24.993  35.495  1.00 24.19 ? 140  TRP B CB  1 
ATOM   5548 C CG  . TRP B 1 141 ? 32.441  24.425  34.890  1.00 23.57 ? 140  TRP B CG  1 
ATOM   5549 C CD1 . TRP B 1 141 ? 33.077  24.857  33.750  1.00 24.03 ? 140  TRP B CD1 1 
ATOM   5550 C CD2 . TRP B 1 141 ? 33.205  23.313  35.372  1.00 24.17 ? 140  TRP B CD2 1 
ATOM   5551 N NE1 . TRP B 1 141 ? 34.192  24.092  33.511  1.00 23.01 ? 140  TRP B NE1 1 
ATOM   5552 C CE2 . TRP B 1 141 ? 34.296  23.136  34.488  1.00 24.50 ? 140  TRP B CE2 1 
ATOM   5553 C CE3 . TRP B 1 141 ? 33.082  22.443  36.463  1.00 24.09 ? 140  TRP B CE3 1 
ATOM   5554 C CZ2 . TRP B 1 141 ? 35.251  22.128  34.663  1.00 25.63 ? 140  TRP B CZ2 1 
ATOM   5555 C CZ3 . TRP B 1 141 ? 34.041  21.448  36.642  1.00 25.88 ? 140  TRP B CZ3 1 
ATOM   5556 C CH2 . TRP B 1 141 ? 35.109  21.299  35.744  1.00 25.06 ? 140  TRP B CH2 1 
ATOM   5557 N N   . LYS B 1 142 ? 32.723  28.050  34.818  1.00 23.87 ? 141  LYS B N   1 
ATOM   5558 C CA  . LYS B 1 142 ? 33.088  29.006  33.783  1.00 23.64 ? 141  LYS B CA  1 
ATOM   5559 C C   . LYS B 1 142 ? 34.197  28.481  32.879  1.00 23.54 ? 141  LYS B C   1 
ATOM   5560 O O   . LYS B 1 142 ? 35.102  27.769  33.322  1.00 23.60 ? 141  LYS B O   1 
ATOM   5561 C CB  . LYS B 1 142 ? 33.515  30.352  34.389  1.00 23.42 ? 141  LYS B CB  1 
ATOM   5562 C CG  . LYS B 1 142 ? 32.502  30.979  35.346  1.00 23.18 ? 141  LYS B CG  1 
ATOM   5563 C CD  . LYS B 1 142 ? 31.216  31.389  34.665  1.00 23.71 ? 141  LYS B CD  1 
ATOM   5564 C CE  . LYS B 1 142 ? 30.221  31.922  35.700  1.00 23.46 ? 141  LYS B CE  1 
ATOM   5565 N NZ  . LYS B 1 142 ? 28.893  32.162  35.067  1.00 25.09 ? 141  LYS B NZ  1 
ATOM   5566 N N   . GLY B 1 143 ? 34.109  28.853  31.607  1.00 23.76 ? 142  GLY B N   1 
ATOM   5567 C CA  . GLY B 1 143 ? 35.152  28.566  30.648  1.00 23.54 ? 142  GLY B CA  1 
ATOM   5568 C C   . GLY B 1 143 ? 36.298  29.546  30.817  1.00 23.69 ? 142  GLY B C   1 
ATOM   5569 O O   . GLY B 1 143 ? 36.232  30.432  31.674  1.00 23.56 ? 142  GLY B O   1 
ATOM   5570 N N   . TYR B 1 144 ? 37.342  29.399  29.998  1.00 23.96 ? 143  TYR B N   1 
ATOM   5571 C CA  . TYR B 1 144 ? 38.580  30.181  30.156  1.00 23.89 ? 143  TYR B CA  1 
ATOM   5572 C C   . TYR B 1 144 ? 38.410  31.693  29.962  1.00 24.41 ? 143  TYR B C   1 
ATOM   5573 O O   . TYR B 1 144 ? 39.292  32.467  30.339  1.00 24.56 ? 143  TYR B O   1 
ATOM   5574 C CB  . TYR B 1 144 ? 39.719  29.643  29.251  1.00 24.36 ? 143  TYR B CB  1 
ATOM   5575 C CG  . TYR B 1 144 ? 39.631  30.056  27.788  1.00 24.38 ? 143  TYR B CG  1 
ATOM   5576 C CD1 . TYR B 1 144 ? 40.418  31.097  27.287  1.00 25.93 ? 143  TYR B CD1 1 
ATOM   5577 C CD2 . TYR B 1 144 ? 38.760  29.404  26.903  1.00 26.22 ? 143  TYR B CD2 1 
ATOM   5578 C CE1 . TYR B 1 144 ? 40.335  31.480  25.956  1.00 26.43 ? 143  TYR B CE1 1 
ATOM   5579 C CE2 . TYR B 1 144 ? 38.678  29.779  25.564  1.00 26.37 ? 143  TYR B CE2 1 
ATOM   5580 C CZ  . TYR B 1 144 ? 39.468  30.816  25.101  1.00 27.24 ? 143  TYR B CZ  1 
ATOM   5581 O OH  . TYR B 1 144 ? 39.387  31.197  23.786  1.00 28.29 ? 143  TYR B OH  1 
ATOM   5582 N N   . THR B 1 145 ? 37.301  32.109  29.370  1.00 24.06 ? 144  THR B N   1 
ATOM   5583 C CA  . THR B 1 145 ? 37.035  33.543  29.204  1.00 24.16 ? 144  THR B CA  1 
ATOM   5584 C C   . THR B 1 145 ? 35.995  34.019  30.219  1.00 24.07 ? 144  THR B C   1 
ATOM   5585 O O   . THR B 1 145 ? 35.604  35.187  30.208  1.00 24.08 ? 144  THR B O   1 
ATOM   5586 C CB  . THR B 1 145 ? 36.605  33.909  27.757  1.00 24.08 ? 144  THR B CB  1 
ATOM   5587 O OG1 . THR B 1 145 ? 35.481  33.118  27.345  1.00 25.75 ? 144  THR B OG1 1 
ATOM   5588 C CG2 . THR B 1 145 ? 37.706  33.590  26.734  1.00 24.23 ? 144  THR B CG2 1 
ATOM   5589 N N   . GLY B 1 146 ? 35.558  33.109  31.087  1.00 23.82 ? 145  GLY B N   1 
ATOM   5590 C CA  . GLY B 1 146 ? 34.619  33.431  32.149  1.00 24.26 ? 145  GLY B CA  1 
ATOM   5591 C C   . GLY B 1 146 ? 33.145  33.249  31.819  1.00 24.28 ? 145  GLY B C   1 
ATOM   5592 O O   . GLY B 1 146 ? 32.288  33.736  32.562  1.00 23.91 ? 145  GLY B O   1 
ATOM   5593 N N   . LYS B 1 147 ? 32.848  32.548  30.720  1.00 23.63 ? 146  LYS B N   1 
ATOM   5594 C CA  . LYS B 1 147 ? 31.471  32.352  30.250  1.00 24.34 ? 146  LYS B CA  1 
ATOM   5595 C C   . LYS B 1 147 ? 30.922  30.993  30.672  1.00 23.73 ? 146  LYS B C   1 
ATOM   5596 O O   . LYS B 1 147 ? 31.690  30.052  30.856  1.00 23.76 ? 146  LYS B O   1 
ATOM   5597 C CB  . LYS B 1 147 ? 31.402  32.474  28.721  1.00 24.80 ? 146  LYS B CB  1 
ATOM   5598 C CG  . LYS B 1 147 ? 31.736  33.865  28.199  1.00 26.61 ? 146  LYS B CG  1 
ATOM   5599 C CD  . LYS B 1 147 ? 31.656  33.914  26.674  1.00 29.14 ? 146  LYS B CD  1 
ATOM   5600 C CE  . LYS B 1 147 ? 31.955  35.308  26.133  1.00 30.06 ? 146  LYS B CE  1 
ATOM   5601 N NZ  . LYS B 1 147 ? 32.084  35.344  24.638  1.00 32.47 ? 146  LYS B NZ  1 
ATOM   5602 N N   . SER B 1 148 ? 29.600  30.901  30.820  1.00 23.33 ? 147  SER B N   1 
ATOM   5603 C CA  . SER B 1 148 ? 28.926  29.641  31.108  1.00 23.30 ? 147  SER B CA  1 
ATOM   5604 C C   . SER B 1 148 ? 29.080  28.663  29.944  1.00 23.07 ? 147  SER B C   1 
ATOM   5605 O O   . SER B 1 148 ? 29.180  29.068  28.778  1.00 22.42 ? 147  SER B O   1 
ATOM   5606 C CB  . SER B 1 148 ? 27.438  29.876  31.382  1.00 23.58 ? 147  SER B CB  1 
ATOM   5607 O OG  . SER B 1 148 ? 27.276  30.613  32.584  1.00 24.86 ? 147  SER B OG  1 
ATOM   5608 N N   . ILE B 1 149 ? 29.104  27.381  30.289  1.00 22.96 ? 148  ILE B N   1 
ATOM   5609 C CA  . ILE B 1 149 ? 29.168  26.295  29.321  1.00 23.12 ? 148  ILE B CA  1 
ATOM   5610 C C   . ILE B 1 149 ? 27.814  26.090  28.640  1.00 22.73 ? 148  ILE B C   1 
ATOM   5611 O O   . ILE B 1 149 ? 26.778  26.002  29.313  1.00 22.79 ? 148  ILE B O   1 
ATOM   5612 C CB  . ILE B 1 149 ? 29.620  24.988  30.026  1.00 22.99 ? 148  ILE B CB  1 
ATOM   5613 C CG1 . ILE B 1 149 ? 31.055  25.107  30.598  1.00 22.89 ? 148  ILE B CG1 1 
ATOM   5614 C CG2 . ILE B 1 149 ? 29.456  23.764  29.089  1.00 23.26 ? 148  ILE B CG2 1 
ATOM   5615 C CD1 . ILE B 1 149 ? 32.157  25.534  29.610  1.00 20.57 ? 148  ILE B CD1 1 
ATOM   5616 N N   . THR B 1 150 ? 27.839  26.024  27.303  1.00 22.48 ? 149  THR B N   1 
ATOM   5617 C CA  . THR B 1 150 ? 26.632  25.836  26.489  1.00 22.26 ? 149  THR B CA  1 
ATOM   5618 C C   . THR B 1 150 ? 26.583  24.485  25.772  1.00 21.83 ? 149  THR B C   1 
ATOM   5619 O O   . THR B 1 150 ? 25.516  24.041  25.342  1.00 21.75 ? 149  THR B O   1 
ATOM   5620 C CB  . THR B 1 150 ? 26.481  26.958  25.447  1.00 22.19 ? 149  THR B CB  1 
ATOM   5621 O OG1 . THR B 1 150 ? 27.642  27.020  24.599  1.00 22.39 ? 149  THR B OG1 1 
ATOM   5622 C CG2 . THR B 1 150 ? 26.400  28.341  26.128  1.00 22.64 ? 149  THR B CG2 1 
ATOM   5623 N N   . ASP B 1 151 ? 27.746  23.863  25.621  1.00 21.20 ? 150  ASP B N   1 
ATOM   5624 C CA  . ASP B 1 151 ? 27.847  22.596  24.897  1.00 21.05 ? 150  ASP B CA  1 
ATOM   5625 C C   . ASP B 1 151 ? 28.724  21.606  25.634  1.00 20.27 ? 150  ASP B C   1 
ATOM   5626 O O   . ASP B 1 151 ? 29.823  21.947  26.089  1.00 20.27 ? 150  ASP B O   1 
ATOM   5627 C CB  . ASP B 1 151 ? 28.430  22.829  23.501  1.00 20.29 ? 150  ASP B CB  1 
ATOM   5628 C CG  . ASP B 1 151 ? 27.547  23.699  22.640  1.00 22.12 ? 150  ASP B CG  1 
ATOM   5629 O OD1 . ASP B 1 151 ? 27.679  24.946  22.690  1.00 22.88 ? 150  ASP B OD1 1 
ATOM   5630 O OD2 . ASP B 1 151 ? 26.684  23.222  21.874  1.00 21.84 ? 150  ASP B OD2 1 
ATOM   5631 N N   . ILE B 1 152 ? 28.233  20.373  25.739  1.00 19.44 ? 151  ILE B N   1 
ATOM   5632 C CA  . ILE B 1 152 ? 29.003  19.258  26.277  1.00 19.48 ? 151  ILE B CA  1 
ATOM   5633 C C   . ILE B 1 152 ? 29.329  18.302  25.136  1.00 19.39 ? 151  ILE B C   1 
ATOM   5634 O O   . ILE B 1 152 ? 28.456  18.002  24.315  1.00 18.73 ? 151  ILE B O   1 
ATOM   5635 C CB  . ILE B 1 152 ? 28.184  18.526  27.363  1.00 20.05 ? 151  ILE B CB  1 
ATOM   5636 C CG1 . ILE B 1 152 ? 27.704  19.525  28.427  1.00 21.53 ? 151  ILE B CG1 1 
ATOM   5637 C CG2 . ILE B 1 152 ? 28.979  17.373  27.948  1.00 20.87 ? 151  ILE B CG2 1 
ATOM   5638 C CD1 . ILE B 1 152 ? 28.821  20.210  29.156  1.00 21.17 ? 151  ILE B CD1 1 
ATOM   5639 N N   . ILE B 1 153 ? 30.583  17.848  25.077  1.00 18.56 ? 152  ILE B N   1 
ATOM   5640 C CA  . ILE B 1 153 ? 31.021  16.917  24.021  1.00 19.33 ? 152  ILE B CA  1 
ATOM   5641 C C   . ILE B 1 153 ? 31.592  15.657  24.664  1.00 19.18 ? 152  ILE B C   1 
ATOM   5642 O O   . ILE B 1 153 ? 32.660  15.691  25.288  1.00 19.10 ? 152  ILE B O   1 
ATOM   5643 C CB  . ILE B 1 153 ? 32.059  17.571  23.072  1.00 18.51 ? 152  ILE B CB  1 
ATOM   5644 C CG1 . ILE B 1 153 ? 31.544  18.891  22.510  1.00 19.65 ? 152  ILE B CG1 1 
ATOM   5645 C CG2 . ILE B 1 153 ? 32.406  16.620  21.905  1.00 18.72 ? 152  ILE B CG2 1 
ATOM   5646 C CD1 . ILE B 1 153 ? 31.822  20.134  23.380  1.00 20.39 ? 152  ILE B CD1 1 
ATOM   5647 N N   . ASN B 1 154 ? 30.851  14.561  24.539  1.00 19.19 ? 153  ASN B N   1 
ATOM   5648 C CA  . ASN B 1 154 ? 31.300  13.255  25.003  1.00 20.00 ? 153  ASN B CA  1 
ATOM   5649 C C   . ASN B 1 154 ? 32.155  12.610  23.926  1.00 20.18 ? 153  ASN B C   1 
ATOM   5650 O O   . ASN B 1 154 ? 31.706  12.468  22.782  1.00 19.83 ? 153  ASN B O   1 
ATOM   5651 C CB  . ASN B 1 154 ? 30.108  12.343  25.320  1.00 20.15 ? 153  ASN B CB  1 
ATOM   5652 C CG  . ASN B 1 154 ? 30.524  11.080  26.076  1.00 21.83 ? 153  ASN B CG  1 
ATOM   5653 O OD1 . ASN B 1 154 ? 30.727  11.113  27.294  1.00 23.93 ? 153  ASN B OD1 1 
ATOM   5654 N ND2 . ASN B 1 154 ? 30.624  9.955   25.360  1.00 21.32 ? 153  ASN B ND2 1 
ATOM   5655 N N   . ILE B 1 155 ? 33.375  12.232  24.302  1.00 20.37 ? 154  ILE B N   1 
ATOM   5656 C CA  . ILE B 1 155 ? 34.309  11.564  23.413  1.00 20.56 ? 154  ILE B CA  1 
ATOM   5657 C C   . ILE B 1 155 ? 34.600  10.186  23.988  1.00 20.73 ? 154  ILE B C   1 
ATOM   5658 O O   . ILE B 1 155 ? 35.130  10.045  25.101  1.00 21.25 ? 154  ILE B O   1 
ATOM   5659 C CB  . ILE B 1 155 ? 35.611  12.379  23.226  1.00 19.72 ? 154  ILE B CB  1 
ATOM   5660 C CG1 . ILE B 1 155 ? 35.309  13.837  22.832  1.00 19.89 ? 154  ILE B CG1 1 
ATOM   5661 C CG2 . ILE B 1 155 ? 36.494  11.697  22.177  1.00 21.24 ? 154  ILE B CG2 1 
ATOM   5662 C CD1 . ILE B 1 155 ? 36.572  14.654  22.454  1.00 20.36 ? 154  ILE B CD1 1 
ATOM   5663 N N   . GLY B 1 156 ? 34.213  9.160   23.240  1.00 21.40 ? 155  GLY B N   1 
ATOM   5664 C CA  . GLY B 1 156 ? 34.347  7.782   23.682  1.00 21.99 ? 155  GLY B CA  1 
ATOM   5665 C C   . GLY B 1 156 ? 33.936  6.833   22.578  1.00 22.27 ? 155  GLY B C   1 
ATOM   5666 O O   . GLY B 1 156 ? 33.419  7.268   21.568  1.00 22.44 ? 155  GLY B O   1 
ATOM   5667 N N   . ILE B 1 157 ? 34.194  5.544   22.759  1.00 23.52 ? 156  ILE B N   1 
ATOM   5668 C CA  . ILE B 1 157 ? 33.809  4.525   21.780  1.00 24.56 ? 156  ILE B CA  1 
ATOM   5669 C C   . ILE B 1 157 ? 32.984  3.433   22.448  1.00 24.67 ? 156  ILE B C   1 
ATOM   5670 O O   . ILE B 1 157 ? 33.013  3.278   23.681  1.00 24.42 ? 156  ILE B O   1 
ATOM   5671 C CB  . ILE B 1 157 ? 35.048  3.888   21.071  1.00 25.03 ? 156  ILE B CB  1 
ATOM   5672 C CG1 . ILE B 1 157 ? 35.944  3.150   22.078  1.00 27.19 ? 156  ILE B CG1 1 
ATOM   5673 C CG2 . ILE B 1 157 ? 35.809  4.918   20.237  1.00 25.79 ? 156  ILE B CG2 1 
ATOM   5674 C CD1 . ILE B 1 157 ? 37.011  2.240   21.423  1.00 28.38 ? 156  ILE B CD1 1 
ATOM   5675 N N   . GLY B 1 158 ? 32.238  2.689   21.633  1.00 24.81 ? 157  GLY B N   1 
ATOM   5676 C CA  . GLY B 1 158 ? 31.445  1.568   22.098  1.00 24.26 ? 157  GLY B CA  1 
ATOM   5677 C C   . GLY B 1 158 ? 30.567  1.901   23.278  1.00 24.58 ? 157  GLY B C   1 
ATOM   5678 O O   . GLY B 1 158 ? 29.678  2.751   23.188  1.00 23.47 ? 157  GLY B O   1 
ATOM   5679 N N   . GLY B 1 159 ? 30.832  1.215   24.386  1.00 24.85 ? 158  GLY B N   1 
ATOM   5680 C CA  . GLY B 1 159 ? 30.114  1.408   25.632  1.00 25.36 ? 158  GLY B CA  1 
ATOM   5681 C C   . GLY B 1 159 ? 30.258  2.808   26.213  1.00 25.21 ? 158  GLY B C   1 
ATOM   5682 O O   . GLY B 1 159 ? 29.383  3.254   26.949  1.00 26.36 ? 158  GLY B O   1 
ATOM   5683 N N   . SER B 1 160 ? 31.342  3.509   25.888  1.00 25.41 ? 159  SER B N   1 
ATOM   5684 C CA  . SER B 1 160 ? 31.467  4.911   26.327  1.00 25.07 ? 159  SER B CA  1 
ATOM   5685 C C   . SER B 1 160 ? 30.672  5.914   25.473  1.00 24.66 ? 159  SER B C   1 
ATOM   5686 O O   . SER B 1 160 ? 30.659  7.115   25.774  1.00 25.15 ? 159  SER B O   1 
ATOM   5687 C CB  . SER B 1 160 ? 32.932  5.323   26.388  1.00 25.01 ? 159  SER B CB  1 
ATOM   5688 O OG  . SER B 1 160 ? 33.631  4.468   27.266  1.00 27.37 ? 159  SER B OG  1 
ATOM   5689 N N   . ASP B 1 161 ? 30.028  5.430   24.412  1.00 23.20 ? 160  ASP B N   1 
ATOM   5690 C CA  . ASP B 1 161 ? 29.366  6.301   23.440  1.00 22.61 ? 160  ASP B CA  1 
ATOM   5691 C C   . ASP B 1 161 ? 27.886  5.959   23.242  1.00 21.94 ? 160  ASP B C   1 
ATOM   5692 O O   . ASP B 1 161 ? 27.022  6.823   23.384  1.00 21.55 ? 160  ASP B O   1 
ATOM   5693 C CB  . ASP B 1 161 ? 30.126  6.274   22.101  1.00 22.97 ? 160  ASP B CB  1 
ATOM   5694 C CG  . ASP B 1 161 ? 29.287  6.773   20.924  1.00 23.72 ? 160  ASP B CG  1 
ATOM   5695 O OD1 . ASP B 1 161 ? 29.058  8.001   20.798  1.00 22.02 ? 160  ASP B OD1 1 
ATOM   5696 O OD2 . ASP B 1 161 ? 28.842  6.004   20.048  1.00 25.90 ? 160  ASP B OD2 1 
ATOM   5697 N N   . LEU B 1 162 ? 27.605  4.699   22.920  1.00 21.09 ? 161  LEU B N   1 
ATOM   5698 C CA  . LEU B 1 162 ? 26.251  4.281   22.548  1.00 20.90 ? 161  LEU B CA  1 
ATOM   5699 C C   . LEU B 1 162 ? 25.191  4.509   23.616  1.00 19.80 ? 161  LEU B C   1 
ATOM   5700 O O   . LEU B 1 162 ? 24.076  4.904   23.289  1.00 20.25 ? 161  LEU B O   1 
ATOM   5701 C CB  . LEU B 1 162 ? 26.220  2.813   22.108  1.00 20.81 ? 161  LEU B CB  1 
ATOM   5702 C CG  . LEU B 1 162 ? 27.012  2.400   20.878  1.00 22.24 ? 161  LEU B CG  1 
ATOM   5703 C CD1 . LEU B 1 162 ? 26.868  0.894   20.717  1.00 23.92 ? 161  LEU B CD1 1 
ATOM   5704 C CD2 . LEU B 1 162 ? 26.510  3.104   19.621  1.00 23.11 ? 161  LEU B CD2 1 
ATOM   5705 N N   . GLY B 1 163 ? 25.536  4.238   24.874  1.00 19.39 ? 162  GLY B N   1 
ATOM   5706 C CA  . GLY B 1 163 ? 24.605  4.353   25.990  1.00 19.31 ? 162  GLY B CA  1 
ATOM   5707 C C   . GLY B 1 163 ? 24.191  5.792   26.190  1.00 18.75 ? 162  GLY B C   1 
ATOM   5708 O O   . GLY B 1 163 ? 23.005  6.110   26.077  1.00 18.80 ? 162  GLY B O   1 
ATOM   5709 N N   . PRO B 1 164 ? 25.161  6.661   26.481  1.00 19.09 ? 163  PRO B N   1 
ATOM   5710 C CA  . PRO B 1 164 ? 24.902  8.104   26.622  1.00 18.78 ? 163  PRO B CA  1 
ATOM   5711 C C   . PRO B 1 164 ? 24.189  8.715   25.415  1.00 18.41 ? 163  PRO B C   1 
ATOM   5712 O O   . PRO B 1 164 ? 23.259  9.525   25.599  1.00 17.74 ? 163  PRO B O   1 
ATOM   5713 C CB  . PRO B 1 164 ? 26.309  8.701   26.807  1.00 19.28 ? 163  PRO B CB  1 
ATOM   5714 C CG  . PRO B 1 164 ? 27.117  7.586   27.366  1.00 19.01 ? 163  PRO B CG  1 
ATOM   5715 C CD  . PRO B 1 164 ? 26.568  6.319   26.776  1.00 18.40 ? 163  PRO B CD  1 
ATOM   5716 N N   . LEU B 1 165 ? 24.611  8.339   24.202  1.00 18.34 ? 164  LEU B N   1 
ATOM   5717 C CA  . LEU B 1 165 ? 23.941  8.790   22.984  1.00 18.96 ? 164  LEU B CA  1 
ATOM   5718 C C   . LEU B 1 165 ? 22.474  8.371   22.970  1.00 18.22 ? 164  LEU B C   1 
ATOM   5719 O O   . LEU B 1 165 ? 21.577  9.200   22.788  1.00 17.68 ? 164  LEU B O   1 
ATOM   5720 C CB  . LEU B 1 165 ? 24.640  8.208   21.750  1.00 19.23 ? 164  LEU B CB  1 
ATOM   5721 C CG  . LEU B 1 165 ? 24.583  8.888   20.377  1.00 22.38 ? 164  LEU B CG  1 
ATOM   5722 C CD1 . LEU B 1 165 ? 24.848  7.912   19.240  1.00 26.20 ? 164  LEU B CD1 1 
ATOM   5723 C CD2 . LEU B 1 165 ? 23.323  9.700   20.102  1.00 25.42 ? 164  LEU B CD2 1 
ATOM   5724 N N   . MET B 1 166 ? 22.231  7.072   23.154  1.00 17.93 ? 165  MET B N   1 
ATOM   5725 C CA  . MET B 1 166 ? 20.871  6.542   23.015  1.00 17.62 ? 165  MET B CA  1 
ATOM   5726 C C   . MET B 1 166 ? 19.948  7.140   24.074  1.00 17.62 ? 165  MET B C   1 
ATOM   5727 O O   . MET B 1 166 ? 18.800  7.518   23.784  1.00 18.78 ? 165  MET B O   1 
ATOM   5728 C CB  . MET B 1 166 ? 20.872  5.012   23.106  1.00 18.05 ? 165  MET B CB  1 
ATOM   5729 C CG  . MET B 1 166 ? 19.487  4.342   22.971  1.00 17.68 ? 165  MET B CG  1 
ATOM   5730 S SD  . MET B 1 166 ? 18.624  4.270   24.542  1.00 21.08 ? 165  MET B SD  1 
ATOM   5731 C CE  . MET B 1 166 ? 19.319  2.749   25.151  1.00 21.98 ? 165  MET B CE  1 
ATOM   5732 N N   . VAL B 1 167 ? 20.458  7.252   25.295  1.00 18.03 ? 166  VAL B N   1 
ATOM   5733 C CA  . VAL B 1 167 ? 19.639  7.737   26.393  1.00 16.97 ? 166  VAL B CA  1 
ATOM   5734 C C   . VAL B 1 167 ? 19.329  9.240   26.275  1.00 17.18 ? 166  VAL B C   1 
ATOM   5735 O O   . VAL B 1 167 ? 18.186  9.646   26.502  1.00 16.52 ? 166  VAL B O   1 
ATOM   5736 C CB  . VAL B 1 167 ? 20.267  7.357   27.749  1.00 16.85 ? 166  VAL B CB  1 
ATOM   5737 C CG1 . VAL B 1 167 ? 19.590  8.086   28.882  1.00 17.24 ? 166  VAL B CG1 1 
ATOM   5738 C CG2 . VAL B 1 167 ? 20.156  5.847   27.949  1.00 17.13 ? 166  VAL B CG2 1 
ATOM   5739 N N   . THR B 1 168 ? 20.328  10.057  25.917  1.00 17.22 ? 167  THR B N   1 
ATOM   5740 C CA  . THR B 1 168 ? 20.072  11.487  25.710  1.00 17.35 ? 167  THR B CA  1 
ATOM   5741 C C   . THR B 1 168 ? 19.096  11.744  24.553  1.00 17.40 ? 167  THR B C   1 
ATOM   5742 O O   . THR B 1 168 ? 18.301  12.694  24.619  1.00 17.77 ? 167  THR B O   1 
ATOM   5743 C CB  . THR B 1 168 ? 21.368  12.333  25.540  1.00 17.83 ? 167  THR B CB  1 
ATOM   5744 O OG1 . THR B 1 168 ? 22.194  11.776  24.503  1.00 18.87 ? 167  THR B OG1 1 
ATOM   5745 C CG2 . THR B 1 168 ? 22.231  12.267  26.808  1.00 18.28 ? 167  THR B CG2 1 
ATOM   5746 N N   . GLU B 1 169 ? 19.173  10.914  23.507  1.00 17.23 ? 168  GLU B N   1 
ATOM   5747 C CA  . GLU B 1 169 ? 18.220  10.992  22.397  1.00 17.58 ? 168  GLU B CA  1 
ATOM   5748 C C   . GLU B 1 169 ? 16.826  10.633  22.891  1.00 17.61 ? 168  GLU B C   1 
ATOM   5749 O O   . GLU B 1 169 ? 15.838  11.325  22.579  1.00 17.56 ? 168  GLU B O   1 
ATOM   5750 C CB  . GLU B 1 169 ? 18.627  10.053  21.243  1.00 17.19 ? 168  GLU B CB  1 
ATOM   5751 C CG  . GLU B 1 169 ? 19.756  10.597  20.369  1.00 17.49 ? 168  GLU B CG  1 
ATOM   5752 C CD  . GLU B 1 169 ? 19.439  11.971  19.790  1.00 20.11 ? 168  GLU B CD  1 
ATOM   5753 O OE1 . GLU B 1 169 ? 20.095  12.944  20.198  1.00 21.13 ? 168  GLU B OE1 1 
ATOM   5754 O OE2 . GLU B 1 169 ? 18.554  12.078  18.913  1.00 19.15 ? 168  GLU B OE2 1 
ATOM   5755 N N   . ALA B 1 170 ? 16.745  9.551   23.657  1.00 17.55 ? 169  ALA B N   1 
ATOM   5756 C CA  . ALA B 1 170 ? 15.449  9.062   24.132  1.00 18.21 ? 169  ALA B CA  1 
ATOM   5757 C C   . ALA B 1 170 ? 14.775  9.997   25.143  1.00 18.71 ? 169  ALA B C   1 
ATOM   5758 O O   . ALA B 1 170 ? 13.528  10.062  25.214  1.00 18.63 ? 169  ALA B O   1 
ATOM   5759 C CB  . ALA B 1 170 ? 15.616  7.685   24.728  1.00 18.65 ? 169  ALA B CB  1 
ATOM   5760 N N   . LEU B 1 171 ? 15.596  10.712  25.912  1.00 18.84 ? 170  LEU B N   1 
ATOM   5761 C CA  . LEU B 1 171 ? 15.102  11.543  27.014  1.00 19.82 ? 170  LEU B CA  1 
ATOM   5762 C C   . LEU B 1 171 ? 15.201  13.032  26.721  1.00 20.18 ? 170  LEU B C   1 
ATOM   5763 O O   . LEU B 1 171 ? 15.144  13.854  27.627  1.00 20.30 ? 170  LEU B O   1 
ATOM   5764 C CB  . LEU B 1 171 ? 15.844  11.184  28.309  1.00 20.19 ? 170  LEU B CB  1 
ATOM   5765 C CG  . LEU B 1 171 ? 15.636  9.757   28.830  1.00 19.17 ? 170  LEU B CG  1 
ATOM   5766 C CD1 . LEU B 1 171 ? 16.346  9.581   30.183  1.00 19.61 ? 170  LEU B CD1 1 
ATOM   5767 C CD2 . LEU B 1 171 ? 14.159  9.420   28.942  1.00 19.90 ? 170  LEU B CD2 1 
ATOM   5768 N N   . LYS B 1 172 ? 15.314  13.362  25.436  1.00 20.49 ? 171  LYS B N   1 
ATOM   5769 C CA  . LYS B 1 172 ? 15.430  14.744  24.948  1.00 21.94 ? 171  LYS B CA  1 
ATOM   5770 C C   . LYS B 1 172 ? 14.439  15.760  25.559  1.00 22.27 ? 171  LYS B C   1 
ATOM   5771 O O   . LYS B 1 172 ? 14.838  16.881  25.875  1.00 21.40 ? 171  LYS B O   1 
ATOM   5772 C CB  . LYS B 1 172 ? 15.361  14.754  23.409  1.00 21.97 ? 171  LYS B CB  1 
ATOM   5773 C CG  . LYS B 1 172 ? 15.931  16.011  22.725  1.00 24.40 ? 171  LYS B CG  1 
ATOM   5774 C CD  . LYS B 1 172 ? 17.392  16.305  23.121  1.00 25.84 ? 171  LYS B CD  1 
ATOM   5775 C CE  . LYS B 1 172 ? 18.394  15.352  22.467  1.00 26.24 ? 171  LYS B CE  1 
ATOM   5776 N NZ  . LYS B 1 172 ? 19.806  15.755  22.765  1.00 26.96 ? 171  LYS B NZ  1 
ATOM   5777 N N   . PRO B 1 173 ? 13.161  15.400  25.713  1.00 23.38 ? 172  PRO B N   1 
ATOM   5778 C CA  . PRO B 1 173 ? 12.193  16.313  26.356  1.00 24.31 ? 172  PRO B CA  1 
ATOM   5779 C C   . PRO B 1 173 ? 12.519  16.677  27.800  1.00 24.97 ? 172  PRO B C   1 
ATOM   5780 O O   . PRO B 1 173 ? 11.981  17.670  28.299  1.00 26.32 ? 172  PRO B O   1 
ATOM   5781 C CB  . PRO B 1 173 ? 10.867  15.542  26.325  1.00 24.40 ? 172  PRO B CB  1 
ATOM   5782 C CG  . PRO B 1 173 ? 11.058  14.399  25.438  1.00 23.42 ? 172  PRO B CG  1 
ATOM   5783 C CD  . PRO B 1 173 ? 12.520  14.155  25.242  1.00 22.87 ? 172  PRO B CD  1 
ATOM   5784 N N   . TYR B 1 174 ? 13.376  15.895  28.451  1.00 25.08 ? 173  TYR B N   1 
ATOM   5785 C CA  . TYR B 1 174 ? 13.752  16.123  29.843  1.00 24.60 ? 173  TYR B CA  1 
ATOM   5786 C C   . TYR B 1 174 ? 15.005  17.000  29.966  1.00 25.27 ? 173  TYR B C   1 
ATOM   5787 O O   . TYR B 1 174 ? 15.606  17.099  31.042  1.00 25.29 ? 173  TYR B O   1 
ATOM   5788 C CB  . TYR B 1 174 ? 13.908  14.776  30.571  1.00 24.27 ? 173  TYR B CB  1 
ATOM   5789 C CG  . TYR B 1 174 ? 12.612  13.999  30.571  1.00 22.29 ? 173  TYR B CG  1 
ATOM   5790 C CD1 . TYR B 1 174 ? 12.376  12.998  29.633  1.00 19.15 ? 173  TYR B CD1 1 
ATOM   5791 C CD2 . TYR B 1 174 ? 11.593  14.309  31.471  1.00 18.77 ? 173  TYR B CD2 1 
ATOM   5792 C CE1 . TYR B 1 174 ? 11.163  12.297  29.610  1.00 20.22 ? 173  TYR B CE1 1 
ATOM   5793 C CE2 . TYR B 1 174 ? 10.381  13.618  31.460  1.00 20.75 ? 173  TYR B CE2 1 
ATOM   5794 C CZ  . TYR B 1 174 ? 10.173  12.611  30.523  1.00 18.69 ? 173  TYR B CZ  1 
ATOM   5795 O OH  . TYR B 1 174 ? 8.981   11.939  30.498  1.00 19.59 ? 173  TYR B OH  1 
ATOM   5796 N N   . SER B 1 175 ? 15.379  17.637  28.858  1.00 25.77 ? 174  SER B N   1 
ATOM   5797 C CA  . SER B 1 175 ? 16.634  18.381  28.768  1.00 26.04 ? 174  SER B CA  1 
ATOM   5798 C C   . SER B 1 175 ? 16.468  19.903  28.787  1.00 27.12 ? 174  SER B C   1 
ATOM   5799 O O   . SER B 1 175 ? 17.429  20.632  28.508  1.00 25.92 ? 174  SER B O   1 
ATOM   5800 C CB  . SER B 1 175 ? 17.419  17.967  27.513  1.00 26.26 ? 174  SER B CB  1 
ATOM   5801 O OG  . SER B 1 175 ? 16.750  18.377  26.323  1.00 25.36 ? 174  SER B OG  1 
ATOM   5802 N N   . LYS B 1 176 ? 15.270  20.389  29.115  1.00 28.48 ? 175  LYS B N   1 
ATOM   5803 C CA  . LYS B 1 176 ? 15.076  21.838  29.208  1.00 29.84 ? 175  LYS B CA  1 
ATOM   5804 C C   . LYS B 1 176 ? 16.016  22.396  30.267  1.00 29.64 ? 175  LYS B C   1 
ATOM   5805 O O   . LYS B 1 176 ? 16.131  21.842  31.362  1.00 29.74 ? 175  LYS B O   1 
ATOM   5806 C CB  . LYS B 1 176 ? 13.612  22.197  29.511  1.00 30.63 ? 175  LYS B CB  1 
ATOM   5807 C CG  . LYS B 1 176 ? 13.280  23.684  29.322  1.00 33.38 ? 175  LYS B CG  1 
ATOM   5808 C CD  . LYS B 1 176 ? 11.909  23.888  28.662  1.00 36.72 ? 175  LYS B CD  1 
ATOM   5809 C CE  . LYS B 1 176 ? 11.795  25.264  27.990  1.00 38.42 ? 175  LYS B CE  1 
ATOM   5810 N NZ  . LYS B 1 176 ? 12.631  25.388  26.749  1.00 40.34 ? 175  LYS B NZ  1 
ATOM   5811 N N   . GLY B 1 177 ? 16.715  23.477  29.923  1.00 30.14 ? 176  GLY B N   1 
ATOM   5812 C CA  . GLY B 1 177 ? 17.659  24.116  30.829  1.00 30.08 ? 176  GLY B CA  1 
ATOM   5813 C C   . GLY B 1 177 ? 19.047  23.495  30.866  1.00 29.64 ? 176  GLY B C   1 
ATOM   5814 O O   . GLY B 1 177 ? 19.947  23.995  31.566  1.00 29.89 ? 176  GLY B O   1 
ATOM   5815 N N   . GLY B 1 178 ? 19.223  22.397  30.125  1.00 28.63 ? 177  GLY B N   1 
ATOM   5816 C CA  . GLY B 1 178 ? 20.493  21.701  30.069  1.00 27.00 ? 177  GLY B CA  1 
ATOM   5817 C C   . GLY B 1 178 ? 21.319  22.138  28.876  1.00 25.48 ? 177  GLY B C   1 
ATOM   5818 O O   . GLY B 1 178 ? 20.784  22.694  27.921  1.00 25.75 ? 177  GLY B O   1 
ATOM   5819 N N   . PRO B 1 179 ? 22.628  21.906  28.923  1.00 24.84 ? 178  PRO B N   1 
ATOM   5820 C CA  . PRO B 1 179 ? 23.500  22.242  27.786  1.00 23.90 ? 178  PRO B CA  1 
ATOM   5821 C C   . PRO B 1 179 ? 23.225  21.301  26.617  1.00 23.41 ? 178  PRO B C   1 
ATOM   5822 O O   . PRO B 1 179 ? 22.709  20.193  26.838  1.00 22.68 ? 178  PRO B O   1 
ATOM   5823 C CB  . PRO B 1 179 ? 24.914  22.006  28.341  1.00 23.87 ? 178  PRO B CB  1 
ATOM   5824 C CG  . PRO B 1 179 ? 24.727  21.022  29.489  1.00 24.72 ? 178  PRO B CG  1 
ATOM   5825 C CD  . PRO B 1 179 ? 23.374  21.304  30.044  1.00 24.32 ? 178  PRO B CD  1 
ATOM   5826 N N   . ARG B 1 180 ? 23.531  21.747  25.398  1.00 22.78 ? 179  ARG B N   1 
ATOM   5827 C CA  . ARG B 1 180 ? 23.477  20.875  24.224  1.00 22.83 ? 179  ARG B CA  1 
ATOM   5828 C C   . ARG B 1 180 ? 24.499  19.772  24.426  1.00 22.58 ? 179  ARG B C   1 
ATOM   5829 O O   . ARG B 1 180 ? 25.519  19.985  25.082  1.00 22.38 ? 179  ARG B O   1 
ATOM   5830 C CB  . ARG B 1 180 ? 23.816  21.652  22.952  1.00 23.04 ? 179  ARG B CB  1 
ATOM   5831 C CG  . ARG B 1 180 ? 22.685  22.547  22.430  1.00 24.76 ? 179  ARG B CG  1 
ATOM   5832 C CD  . ARG B 1 180 ? 23.104  23.428  21.246  1.00 28.58 ? 179  ARG B CD  1 
ATOM   5833 N NE  . ARG B 1 180 ? 24.190  24.339  21.623  1.00 30.21 ? 179  ARG B NE  1 
ATOM   5834 C CZ  . ARG B 1 180 ? 24.040  25.641  21.854  1.00 31.33 ? 179  ARG B CZ  1 
ATOM   5835 N NH1 . ARG B 1 180 ? 22.845  26.218  21.733  1.00 31.07 ? 179  ARG B NH1 1 
ATOM   5836 N NH2 . ARG B 1 180 ? 25.096  26.371  22.198  1.00 31.24 ? 179  ARG B NH2 1 
ATOM   5837 N N   . VAL B 1 181 ? 24.214  18.586  23.891  1.00 22.29 ? 180  VAL B N   1 
ATOM   5838 C CA  . VAL B 1 181 ? 25.125  17.452  24.034  1.00 23.33 ? 180  VAL B CA  1 
ATOM   5839 C C   . VAL B 1 181 ? 25.508  16.902  22.651  1.00 21.55 ? 180  VAL B C   1 
ATOM   5840 O O   . VAL B 1 181 ? 24.657  16.750  21.774  1.00 19.93 ? 180  VAL B O   1 
ATOM   5841 C CB  . VAL B 1 181 ? 24.562  16.366  25.024  1.00 22.86 ? 180  VAL B CB  1 
ATOM   5842 C CG1 . VAL B 1 181 ? 23.252  15.749  24.511  1.00 26.58 ? 180  VAL B CG1 1 
ATOM   5843 C CG2 . VAL B 1 181 ? 25.595  15.293  25.311  1.00 27.15 ? 180  VAL B CG2 1 
ATOM   5844 N N   . TRP B 1 182 ? 26.802  16.633  22.477  1.00 20.76 ? 181  TRP B N   1 
ATOM   5845 C CA  . TRP B 1 182 ? 27.352  16.134  21.224  1.00 20.72 ? 181  TRP B CA  1 
ATOM   5846 C C   . TRP B 1 182 ? 28.120  14.860  21.525  1.00 20.26 ? 181  TRP B C   1 
ATOM   5847 O O   . TRP B 1 182 ? 28.698  14.739  22.608  1.00 21.05 ? 181  TRP B O   1 
ATOM   5848 C CB  . TRP B 1 182 ? 28.334  17.146  20.630  1.00 21.42 ? 181  TRP B CB  1 
ATOM   5849 C CG  . TRP B 1 182 ? 27.748  18.498  20.423  1.00 22.22 ? 181  TRP B CG  1 
ATOM   5850 C CD1 . TRP B 1 182 ? 27.421  19.415  21.390  1.00 22.42 ? 181  TRP B CD1 1 
ATOM   5851 C CD2 . TRP B 1 182 ? 27.416  19.102  19.172  1.00 25.14 ? 181  TRP B CD2 1 
ATOM   5852 N NE1 . TRP B 1 182 ? 26.903  20.549  20.814  1.00 21.12 ? 181  TRP B NE1 1 
ATOM   5853 C CE2 . TRP B 1 182 ? 26.887  20.387  19.452  1.00 24.18 ? 181  TRP B CE2 1 
ATOM   5854 C CE3 . TRP B 1 182 ? 27.512  18.693  17.833  1.00 26.30 ? 181  TRP B CE3 1 
ATOM   5855 C CZ2 . TRP B 1 182 ? 26.461  21.262  18.444  1.00 24.73 ? 181  TRP B CZ2 1 
ATOM   5856 C CZ3 . TRP B 1 182 ? 27.095  19.563  16.833  1.00 27.09 ? 181  TRP B CZ3 1 
ATOM   5857 C CH2 . TRP B 1 182 ? 26.571  20.828  17.143  1.00 27.52 ? 181  TRP B CH2 1 
ATOM   5858 N N   . PHE B 1 183 ? 28.131  13.923  20.571  1.00 19.39 ? 182  PHE B N   1 
ATOM   5859 C CA  . PHE B 1 183 ? 28.869  12.680  20.756  1.00 18.92 ? 182  PHE B CA  1 
ATOM   5860 C C   . PHE B 1 183 ? 29.874  12.475  19.635  1.00 18.72 ? 182  PHE B C   1 
ATOM   5861 O O   . PHE B 1 183 ? 29.512  12.497  18.455  1.00 20.17 ? 182  PHE B O   1 
ATOM   5862 C CB  . PHE B 1 183 ? 27.900  11.504  20.883  1.00 18.12 ? 182  PHE B CB  1 
ATOM   5863 C CG  . PHE B 1 183 ? 27.016  11.617  22.082  1.00 18.38 ? 182  PHE B CG  1 
ATOM   5864 C CD1 . PHE B 1 183 ? 25.822  12.334  22.009  1.00 19.68 ? 182  PHE B CD1 1 
ATOM   5865 C CD2 . PHE B 1 183 ? 27.417  11.081  23.295  1.00 20.15 ? 182  PHE B CD2 1 
ATOM   5866 C CE1 . PHE B 1 183 ? 25.017  12.473  23.130  1.00 18.84 ? 182  PHE B CE1 1 
ATOM   5867 C CE2 . PHE B 1 183 ? 26.625  11.221  24.419  1.00 21.79 ? 182  PHE B CE2 1 
ATOM   5868 C CZ  . PHE B 1 183 ? 25.432  11.923  24.337  1.00 21.00 ? 182  PHE B CZ  1 
ATOM   5869 N N   . VAL B 1 184 ? 31.142  12.313  20.006  1.00 18.56 ? 183  VAL B N   1 
ATOM   5870 C CA  . VAL B 1 184 ? 32.193  12.038  19.042  1.00 18.62 ? 183  VAL B CA  1 
ATOM   5871 C C   . VAL B 1 184 ? 32.731  10.647  19.339  1.00 18.69 ? 183  VAL B C   1 
ATOM   5872 O O   . VAL B 1 184 ? 33.135  10.378  20.459  1.00 19.21 ? 183  VAL B O   1 
ATOM   5873 C CB  . VAL B 1 184 ? 33.335  13.056  19.138  1.00 18.35 ? 183  VAL B CB  1 
ATOM   5874 C CG1 . VAL B 1 184 ? 34.450  12.715  18.128  1.00 20.07 ? 183  VAL B CG1 1 
ATOM   5875 C CG2 . VAL B 1 184 ? 32.818  14.456  18.890  1.00 18.97 ? 183  VAL B CG2 1 
ATOM   5876 N N   . SER B 1 185 ? 32.727  9.769   18.351  1.00 18.51 ? 184  SER B N   1 
ATOM   5877 C CA  . SER B 1 185 ? 33.104  8.374   18.592  1.00 19.46 ? 184  SER B CA  1 
ATOM   5878 C C   . SER B 1 185 ? 34.015  7.822   17.518  1.00 19.21 ? 184  SER B C   1 
ATOM   5879 O O   . SER B 1 185 ? 35.000  7.139   17.811  1.00 19.45 ? 184  SER B O   1 
ATOM   5880 C CB  . SER B 1 185 ? 31.852  7.491   18.699  1.00 20.27 ? 184  SER B CB  1 
ATOM   5881 O OG  . SER B 1 185 ? 31.031  7.637   17.556  1.00 23.11 ? 184  SER B OG  1 
ATOM   5882 N N   . ASN B 1 186 ? 33.670  8.095   16.271  1.00 18.53 ? 185  ASN B N   1 
ATOM   5883 C CA  . ASN B 1 186 ? 34.441  7.546   15.167  1.00 17.94 ? 185  ASN B CA  1 
ATOM   5884 C C   . ASN B 1 186 ? 35.844  8.133   15.166  1.00 17.76 ? 185  ASN B C   1 
ATOM   5885 O O   . ASN B 1 186 ? 36.007  9.320   15.423  1.00 17.74 ? 185  ASN B O   1 
ATOM   5886 C CB  . ASN B 1 186 ? 33.734  7.823   13.834  1.00 17.93 ? 185  ASN B CB  1 
ATOM   5887 C CG  . ASN B 1 186 ? 34.049  6.780   12.778  1.00 17.02 ? 185  ASN B CG  1 
ATOM   5888 O OD1 . ASN B 1 186 ? 35.160  6.267   12.716  1.00 16.29 ? 185  ASN B OD1 1 
ATOM   5889 N ND2 . ASN B 1 186 ? 33.087  6.505   11.907  1.00 16.68 ? 185  ASN B ND2 1 
ATOM   5890 N N   . ILE B 1 187 ? 36.850  7.301   14.901  1.00 17.51 ? 186  ILE B N   1 
ATOM   5891 C CA  . ILE B 1 187 ? 38.183  7.827   14.619  1.00 17.54 ? 186  ILE B CA  1 
ATOM   5892 C C   . ILE B 1 187 ? 38.206  8.663   13.328  1.00 17.56 ? 186  ILE B C   1 
ATOM   5893 O O   . ILE B 1 187 ? 38.997  9.616   13.213  1.00 18.40 ? 186  ILE B O   1 
ATOM   5894 C CB  . ILE B 1 187 ? 39.266  6.709   14.588  1.00 17.23 ? 186  ILE B CB  1 
ATOM   5895 C CG1 . ILE B 1 187 ? 40.662  7.347   14.484  1.00 18.39 ? 186  ILE B CG1 1 
ATOM   5896 C CG2 . ILE B 1 187 ? 39.020  5.721   13.444  1.00 18.04 ? 186  ILE B CG2 1 
ATOM   5897 C CD1 . ILE B 1 187 ? 40.995  8.293   15.663  1.00 17.53 ? 186  ILE B CD1 1 
ATOM   5898 N N   . ASP B 1 188 ? 37.331  8.315   12.379  1.00 16.68 ? 187  ASP B N   1 
ATOM   5899 C CA  . ASP B 1 188 ? 37.172  9.085   11.146  1.00 16.26 ? 187  ASP B CA  1 
ATOM   5900 C C   . ASP B 1 188 ? 37.118  10.568  11.517  1.00 16.27 ? 187  ASP B C   1 
ATOM   5901 O O   . ASP B 1 188 ? 36.218  10.990  12.233  1.00 16.64 ? 187  ASP B O   1 
ATOM   5902 C CB  . ASP B 1 188 ? 35.881  8.670   10.428  1.00 16.07 ? 187  ASP B CB  1 
ATOM   5903 C CG  . ASP B 1 188 ? 35.638  9.429   9.136   1.00 16.70 ? 187  ASP B CG  1 
ATOM   5904 O OD1 . ASP B 1 188 ? 34.646  9.082   8.446   1.00 17.01 ? 187  ASP B OD1 1 
ATOM   5905 O OD2 . ASP B 1 188 ? 36.355  10.368  8.721   1.00 15.34 ? 187  ASP B OD2 1 
ATOM   5906 N N   . GLY B 1 189 ? 38.114  11.317  11.057  1.00 15.87 ? 188  GLY B N   1 
ATOM   5907 C CA  . GLY B 1 189 ? 38.270  12.723  11.399  1.00 16.74 ? 188  GLY B CA  1 
ATOM   5908 C C   . GLY B 1 189 ? 37.094  13.611  11.041  1.00 17.39 ? 188  GLY B C   1 
ATOM   5909 O O   . GLY B 1 189 ? 36.929  14.696  11.599  1.00 17.81 ? 188  GLY B O   1 
ATOM   5910 N N   . THR B 1 190 ? 36.264  13.163  10.108  1.00 16.79 ? 189  THR B N   1 
ATOM   5911 C CA  . THR B 1 190 ? 34.964  13.800  9.886   1.00 17.10 ? 189  THR B CA  1 
ATOM   5912 C C   . THR B 1 190 ? 34.191  14.029  11.183  1.00 17.44 ? 189  THR B C   1 
ATOM   5913 O O   . THR B 1 190 ? 33.574  15.089  11.351  1.00 16.34 ? 189  THR B O   1 
ATOM   5914 C CB  . THR B 1 190 ? 34.135  12.920  8.958   1.00 16.59 ? 189  THR B CB  1 
ATOM   5915 O OG1 . THR B 1 190 ? 34.661  13.025  7.631   1.00 16.30 ? 189  THR B OG1 1 
ATOM   5916 C CG2 . THR B 1 190 ? 32.688  13.414  8.850   1.00 16.49 ? 189  THR B CG2 1 
ATOM   5917 N N   . HIS B 1 191 ? 34.199  13.034  12.081  1.00 17.42 ? 190  HIS B N   1 
ATOM   5918 C CA  . HIS B 1 191 ? 33.339  13.093  13.265  1.00 18.39 ? 190  HIS B CA  1 
ATOM   5919 C C   . HIS B 1 191 ? 33.701  14.275  14.177  1.00 18.74 ? 190  HIS B C   1 
ATOM   5920 O O   . HIS B 1 191 ? 32.841  15.109  14.487  1.00 19.05 ? 190  HIS B O   1 
ATOM   5921 C CB  . HIS B 1 191 ? 33.298  11.764  14.033  1.00 18.89 ? 190  HIS B CB  1 
ATOM   5922 C CG  . HIS B 1 191 ? 31.960  11.469  14.646  1.00 19.29 ? 190  HIS B CG  1 
ATOM   5923 N ND1 . HIS B 1 191 ? 31.714  10.346  15.408  1.00 19.88 ? 190  HIS B ND1 1 
ATOM   5924 C CD2 . HIS B 1 191 ? 30.795  12.160  14.615  1.00 19.04 ? 190  HIS B CD2 1 
ATOM   5925 C CE1 . HIS B 1 191 ? 30.458  10.356  15.815  1.00 20.05 ? 190  HIS B CE1 1 
ATOM   5926 N NE2 . HIS B 1 191 ? 29.879  11.448  15.351  1.00 18.76 ? 190  HIS B NE2 1 
ATOM   5927 N N   . ILE B 1 192 ? 34.970  14.369  14.558  1.00 18.49 ? 191  ILE B N   1 
ATOM   5928 C CA  . ILE B 1 192 ? 35.421  15.488  15.386  1.00 19.05 ? 191  ILE B CA  1 
ATOM   5929 C C   . ILE B 1 192 ? 35.423  16.808  14.610  1.00 19.00 ? 191  ILE B C   1 
ATOM   5930 O O   . ILE B 1 192 ? 35.002  17.846  15.154  1.00 18.90 ? 191  ILE B O   1 
ATOM   5931 C CB  . ILE B 1 192 ? 36.791  15.177  16.068  1.00 19.39 ? 191  ILE B CB  1 
ATOM   5932 C CG1 . ILE B 1 192 ? 37.130  16.194  17.171  1.00 19.65 ? 191  ILE B CG1 1 
ATOM   5933 C CG2 . ILE B 1 192 ? 37.930  15.100  15.059  1.00 18.36 ? 191  ILE B CG2 1 
ATOM   5934 C CD1 . ILE B 1 192 ? 36.160  16.219  18.361  1.00 23.53 ? 191  ILE B CD1 1 
ATOM   5935 N N   . ALA B 1 193 ? 35.845  16.780  13.338  1.00 18.87 ? 192  ALA B N   1 
ATOM   5936 C CA  . ALA B 1 193 ? 35.938  18.020  12.558  1.00 19.19 ? 192  ALA B CA  1 
ATOM   5937 C C   . ALA B 1 193 ? 34.561  18.695  12.413  1.00 19.52 ? 192  ALA B C   1 
ATOM   5938 O O   . ALA B 1 193 ? 34.422  19.909  12.623  1.00 20.33 ? 192  ALA B O   1 
ATOM   5939 C CB  . ALA B 1 193 ? 36.585  17.773  11.187  1.00 19.05 ? 192  ALA B CB  1 
ATOM   5940 N N   . LYS B 1 194 ? 33.538  17.908  12.107  1.00 20.07 ? 193  LYS B N   1 
ATOM   5941 C CA  . LYS B 1 194 ? 32.222  18.497  11.898  1.00 21.23 ? 193  LYS B CA  1 
ATOM   5942 C C   . LYS B 1 194 ? 31.568  18.925  13.218  1.00 20.89 ? 193  LYS B C   1 
ATOM   5943 O O   . LYS B 1 194 ? 30.775  19.857  13.227  1.00 21.15 ? 193  LYS B O   1 
ATOM   5944 C CB  . LYS B 1 194 ? 31.316  17.591  11.052  1.00 21.43 ? 193  LYS B CB  1 
ATOM   5945 C CG  . LYS B 1 194 ? 30.756  16.371  11.715  1.00 24.98 ? 193  LYS B CG  1 
ATOM   5946 C CD  . LYS B 1 194 ? 30.018  15.484  10.694  1.00 30.54 ? 193  LYS B CD  1 
ATOM   5947 C CE  . LYS B 1 194 ? 29.450  14.223  11.354  1.00 32.71 ? 193  LYS B CE  1 
ATOM   5948 N NZ  . LYS B 1 194 ? 28.066  14.444  11.859  1.00 35.74 ? 193  LYS B NZ  1 
ATOM   5949 N N   . THR B 1 195 ? 31.920  18.258  14.317  1.00 21.00 ? 194  THR B N   1 
ATOM   5950 C CA  . THR B 1 195 ? 31.472  18.663  15.651  1.00 22.08 ? 194  THR B CA  1 
ATOM   5951 C C   . THR B 1 195 ? 32.102  19.988  16.074  1.00 22.48 ? 194  THR B C   1 
ATOM   5952 O O   . THR B 1 195 ? 31.399  20.905  16.495  1.00 23.78 ? 194  THR B O   1 
ATOM   5953 C CB  . THR B 1 195 ? 31.819  17.578  16.667  1.00 22.12 ? 194  THR B CB  1 
ATOM   5954 O OG1 . THR B 1 195 ? 31.199  16.344  16.276  1.00 20.33 ? 194  THR B OG1 1 
ATOM   5955 C CG2 . THR B 1 195 ? 31.190  17.895  18.036  1.00 21.75 ? 194  THR B CG2 1 
ATOM   5956 N N   . LEU B 1 196 ? 33.424  20.084  15.955  1.00 22.96 ? 195  LEU B N   1 
ATOM   5957 C CA  . LEU B 1 196 ? 34.163  21.283  16.371  1.00 23.37 ? 195  LEU B CA  1 
ATOM   5958 C C   . LEU B 1 196 ? 33.804  22.528  15.555  1.00 24.08 ? 195  LEU B C   1 
ATOM   5959 O O   . LEU B 1 196 ? 33.896  23.654  16.057  1.00 24.08 ? 195  LEU B O   1 
ATOM   5960 C CB  . LEU B 1 196 ? 35.668  21.046  16.289  1.00 23.17 ? 195  LEU B CB  1 
ATOM   5961 C CG  . LEU B 1 196 ? 36.281  20.014  17.246  1.00 22.84 ? 195  LEU B CG  1 
ATOM   5962 C CD1 . LEU B 1 196 ? 37.780  19.900  16.998  1.00 23.01 ? 195  LEU B CD1 1 
ATOM   5963 C CD2 . LEU B 1 196 ? 35.937  20.268  18.724  1.00 22.18 ? 195  LEU B CD2 1 
ATOM   5964 N N   . ALA B 1 197 ? 33.411  22.326  14.298  1.00 24.84 ? 196  ALA B N   1 
ATOM   5965 C CA  . ALA B 1 197 ? 33.015  23.441  13.428  1.00 25.63 ? 196  ALA B CA  1 
ATOM   5966 C C   . ALA B 1 197 ? 31.795  24.185  13.984  1.00 26.15 ? 196  ALA B C   1 
ATOM   5967 O O   . ALA B 1 197 ? 31.590  25.359  13.679  1.00 26.51 ? 196  ALA B O   1 
ATOM   5968 C CB  . ALA B 1 197 ? 32.733  22.940  12.020  1.00 25.87 ? 196  ALA B CB  1 
ATOM   5969 N N   . SER B 1 198 ? 30.999  23.497  14.801  1.00 26.06 ? 197  SER B N   1 
ATOM   5970 C CA  . SER B 1 198 ? 29.752  24.049  15.339  1.00 27.01 ? 197  SER B CA  1 
ATOM   5971 C C   . SER B 1 198 ? 29.896  24.608  16.763  1.00 26.37 ? 197  SER B C   1 
ATOM   5972 O O   . SER B 1 198 ? 28.899  24.993  17.387  1.00 27.04 ? 197  SER B O   1 
ATOM   5973 C CB  . SER B 1 198 ? 28.642  22.982  15.300  1.00 27.32 ? 197  SER B CB  1 
ATOM   5974 O OG  . SER B 1 198 ? 28.918  21.955  14.349  1.00 31.01 ? 197  SER B OG  1 
ATOM   5975 N N   . LEU B 1 199 ? 31.135  24.675  17.251  1.00 25.50 ? 198  LEU B N   1 
ATOM   5976 C CA  . LEU B 1 199 ? 31.421  24.920  18.664  1.00 25.60 ? 198  LEU B CA  1 
ATOM   5977 C C   . LEU B 1 199 ? 32.293  26.158  18.875  1.00 24.97 ? 198  LEU B C   1 
ATOM   5978 O O   . LEU B 1 199 ? 33.075  26.537  18.005  1.00 24.83 ? 198  LEU B O   1 
ATOM   5979 C CB  . LEU B 1 199 ? 32.162  23.724  19.268  1.00 25.55 ? 198  LEU B CB  1 
ATOM   5980 C CG  . LEU B 1 199 ? 31.413  22.611  19.998  1.00 27.95 ? 198  LEU B CG  1 
ATOM   5981 C CD1 . LEU B 1 199 ? 29.922  22.586  19.713  1.00 27.98 ? 198  LEU B CD1 1 
ATOM   5982 C CD2 . LEU B 1 199 ? 32.074  21.284  19.721  1.00 29.36 ? 198  LEU B CD2 1 
ATOM   5983 N N   . SER B 1 200 ? 32.162  26.756  20.053  1.00 24.48 ? 199  SER B N   1 
ATOM   5984 C CA  . SER B 1 200 ? 33.095  27.786  20.506  1.00 24.37 ? 199  SER B CA  1 
ATOM   5985 C C   . SER B 1 200 ? 33.956  27.212  21.624  1.00 23.83 ? 199  SER B C   1 
ATOM   5986 O O   . SER B 1 200 ? 33.427  26.628  22.574  1.00 23.80 ? 199  SER B O   1 
ATOM   5987 C CB  . SER B 1 200 ? 32.355  29.020  21.012  1.00 24.98 ? 199  SER B CB  1 
ATOM   5988 O OG  . SER B 1 200 ? 33.254  29.847  21.753  1.00 24.90 ? 199  SER B OG  1 
ATOM   5989 N N   . PRO B 1 201 ? 35.275  27.378  21.520  1.00 23.59 ? 200  PRO B N   1 
ATOM   5990 C CA  . PRO B 1 201 ? 36.200  26.895  22.548  1.00 23.62 ? 200  PRO B CA  1 
ATOM   5991 C C   . PRO B 1 201 ? 35.881  27.511  23.910  1.00 23.29 ? 200  PRO B C   1 
ATOM   5992 O O   . PRO B 1 201 ? 36.099  26.878  24.948  1.00 23.46 ? 200  PRO B O   1 
ATOM   5993 C CB  . PRO B 1 201 ? 37.567  27.369  22.037  1.00 23.30 ? 200  PRO B CB  1 
ATOM   5994 C CG  . PRO B 1 201 ? 37.390  27.530  20.581  1.00 23.33 ? 200  PRO B CG  1 
ATOM   5995 C CD  . PRO B 1 201 ? 35.991  28.034  20.407  1.00 24.24 ? 200  PRO B CD  1 
ATOM   5996 N N   . GLU B 1 202 ? 35.335  28.724  23.892  1.00 23.39 ? 201  GLU B N   1 
ATOM   5997 C CA  . GLU B 1 202 ? 35.010  29.446  25.122  1.00 23.28 ? 201  GLU B CA  1 
ATOM   5998 C C   . GLU B 1 202 ? 33.873  28.816  25.928  1.00 22.83 ? 201  GLU B C   1 
ATOM   5999 O O   . GLU B 1 202 ? 33.790  29.020  27.135  1.00 22.13 ? 201  GLU B O   1 
ATOM   6000 C CB  . GLU B 1 202 ? 34.654  30.909  24.808  1.00 23.36 ? 201  GLU B CB  1 
ATOM   6001 C CG  . GLU B 1 202 ? 35.713  31.693  24.047  1.00 26.05 ? 201  GLU B CG  1 
ATOM   6002 C CD  . GLU B 1 202 ? 35.265  33.118  23.762  1.00 30.25 ? 201  GLU B CD  1 
ATOM   6003 O OE1 . GLU B 1 202 ? 34.825  33.817  24.708  1.00 30.68 ? 201  GLU B OE1 1 
ATOM   6004 O OE2 . GLU B 1 202 ? 35.327  33.542  22.585  1.00 31.48 ? 201  GLU B OE2 1 
ATOM   6005 N N   . THR B 1 203 ? 33.001  28.044  25.276  1.00 22.78 ? 202  THR B N   1 
ATOM   6006 C CA  . THR B 1 203 ? 31.781  27.592  25.943  1.00 22.09 ? 202  THR B CA  1 
ATOM   6007 C C   . THR B 1 203 ? 31.556  26.091  25.828  1.00 21.45 ? 202  THR B C   1 
ATOM   6008 O O   . THR B 1 203 ? 30.481  25.594  26.153  1.00 21.09 ? 202  THR B O   1 
ATOM   6009 C CB  . THR B 1 203 ? 30.540  28.355  25.411  1.00 22.00 ? 202  THR B CB  1 
ATOM   6010 O OG1 . THR B 1 203 ? 30.457  28.215  23.985  1.00 23.37 ? 202  THR B OG1 1 
ATOM   6011 C CG2 . THR B 1 203 ? 30.683  29.881  25.610  1.00 22.73 ? 202  THR B CG2 1 
ATOM   6012 N N   . SER B 1 204 ? 32.587  25.376  25.400  1.00 21.48 ? 203  SER B N   1 
ATOM   6013 C CA  . SER B 1 204 ? 32.494  23.938  25.178  1.00 22.18 ? 203  SER B CA  1 
ATOM   6014 C C   . SER B 1 204 ? 33.235  23.158  26.251  1.00 22.00 ? 203  SER B C   1 
ATOM   6015 O O   . SER B 1 204 ? 34.391  23.446  26.560  1.00 22.24 ? 203  SER B O   1 
ATOM   6016 C CB  . SER B 1 204 ? 33.050  23.585  23.788  1.00 22.00 ? 203  SER B CB  1 
ATOM   6017 O OG  . SER B 1 204 ? 32.198  24.087  22.775  1.00 22.94 ? 203  SER B OG  1 
ATOM   6018 N N   . LEU B 1 205 ? 32.571  22.148  26.808  1.00 22.27 ? 204  LEU B N   1 
ATOM   6019 C CA  . LEU B 1 205 ? 33.200  21.275  27.791  1.00 21.58 ? 204  LEU B CA  1 
ATOM   6020 C C   . LEU B 1 205 ? 33.277  19.839  27.252  1.00 21.03 ? 204  LEU B C   1 
ATOM   6021 O O   . LEU B 1 205 ? 32.253  19.274  26.856  1.00 20.90 ? 204  LEU B O   1 
ATOM   6022 C CB  . LEU B 1 205 ? 32.422  21.322  29.112  1.00 21.86 ? 204  LEU B CB  1 
ATOM   6023 C CG  . LEU B 1 205 ? 32.856  20.426  30.286  1.00 23.26 ? 204  LEU B CG  1 
ATOM   6024 C CD1 . LEU B 1 205 ? 34.250  20.768  30.788  1.00 24.02 ? 204  LEU B CD1 1 
ATOM   6025 C CD2 . LEU B 1 205 ? 31.842  20.508  31.443  1.00 23.81 ? 204  LEU B CD2 1 
ATOM   6026 N N   . PHE B 1 206 ? 34.483  19.266  27.250  1.00 20.32 ? 205  PHE B N   1 
ATOM   6027 C CA  . PHE B 1 206 ? 34.718  17.915  26.726  1.00 20.45 ? 205  PHE B CA  1 
ATOM   6028 C C   . PHE B 1 206 ? 34.774  16.875  27.841  1.00 20.36 ? 205  PHE B C   1 
ATOM   6029 O O   . PHE B 1 206 ? 35.423  17.078  28.871  1.00 20.84 ? 205  PHE B O   1 
ATOM   6030 C CB  . PHE B 1 206 ? 36.010  17.871  25.888  1.00 20.29 ? 205  PHE B CB  1 
ATOM   6031 C CG  . PHE B 1 206 ? 35.968  18.748  24.663  1.00 21.52 ? 205  PHE B CG  1 
ATOM   6032 C CD1 . PHE B 1 206 ? 36.403  20.068  24.723  1.00 22.16 ? 205  PHE B CD1 1 
ATOM   6033 C CD2 . PHE B 1 206 ? 35.496  18.254  23.454  1.00 22.06 ? 205  PHE B CD2 1 
ATOM   6034 C CE1 . PHE B 1 206 ? 36.372  20.885  23.600  1.00 23.44 ? 205  PHE B CE1 1 
ATOM   6035 C CE2 . PHE B 1 206 ? 35.453  19.065  22.311  1.00 22.90 ? 205  PHE B CE2 1 
ATOM   6036 C CZ  . PHE B 1 206 ? 35.894  20.388  22.388  1.00 23.78 ? 205  PHE B CZ  1 
ATOM   6037 N N   . ILE B 1 207 ? 34.086  15.752  27.635  1.00 20.35 ? 206  ILE B N   1 
ATOM   6038 C CA  . ILE B 1 207 ? 34.159  14.640  28.566  1.00 20.62 ? 206  ILE B CA  1 
ATOM   6039 C C   . ILE B 1 207 ? 34.884  13.517  27.846  1.00 20.77 ? 206  ILE B C   1 
ATOM   6040 O O   . ILE B 1 207 ? 34.397  13.026  26.829  1.00 20.46 ? 206  ILE B O   1 
ATOM   6041 C CB  . ILE B 1 207 ? 32.758  14.159  28.953  1.00 21.02 ? 206  ILE B CB  1 
ATOM   6042 C CG1 . ILE B 1 207 ? 31.935  15.288  29.579  1.00 21.41 ? 206  ILE B CG1 1 
ATOM   6043 C CG2 . ILE B 1 207 ? 32.842  12.949  29.889  1.00 21.51 ? 206  ILE B CG2 1 
ATOM   6044 C CD1 . ILE B 1 207 ? 30.492  14.854  29.856  1.00 23.69 ? 206  ILE B CD1 1 
ATOM   6045 N N   . ILE B 1 208 ? 36.038  13.117  28.363  1.00 20.79 ? 207  ILE B N   1 
ATOM   6046 C CA  . ILE B 1 208 ? 36.829  12.079  27.713  1.00 20.96 ? 207  ILE B CA  1 
ATOM   6047 C C   . ILE B 1 208 ? 36.592  10.785  28.471  1.00 21.83 ? 207  ILE B C   1 
ATOM   6048 O O   . ILE B 1 208 ? 37.037  10.644  29.615  1.00 22.19 ? 207  ILE B O   1 
ATOM   6049 C CB  . ILE B 1 208 ? 38.323  12.451  27.712  1.00 21.36 ? 207  ILE B CB  1 
ATOM   6050 C CG1 . ILE B 1 208 ? 38.546  13.902  27.235  1.00 20.27 ? 207  ILE B CG1 1 
ATOM   6051 C CG2 . ILE B 1 208 ? 39.112  11.444  26.897  1.00 20.07 ? 207  ILE B CG2 1 
ATOM   6052 C CD1 . ILE B 1 208 ? 37.941  14.280  25.875  1.00 21.60 ? 207  ILE B CD1 1 
ATOM   6053 N N   . ALA B 1 209 ? 35.869  9.861   27.845  1.00 22.49 ? 208  ALA B N   1 
ATOM   6054 C CA  . ALA B 1 209 ? 35.383  8.661   28.523  1.00 23.37 ? 208  ALA B CA  1 
ATOM   6055 C C   . ALA B 1 209 ? 36.218  7.471   28.083  1.00 24.33 ? 208  ALA B C   1 
ATOM   6056 O O   . ALA B 1 209 ? 36.144  7.051   26.921  1.00 24.30 ? 208  ALA B O   1 
ATOM   6057 C CB  . ALA B 1 209 ? 33.906  8.426   28.197  1.00 23.33 ? 208  ALA B CB  1 
ATOM   6058 N N   . SER B 1 210 ? 37.040  6.971   29.002  1.00 25.03 ? 209  SER B N   1 
ATOM   6059 C CA  . SER B 1 210 ? 37.953  5.858   28.728  1.00 25.66 ? 209  SER B CA  1 
ATOM   6060 C C   . SER B 1 210 ? 38.606  5.384   30.009  1.00 26.15 ? 209  SER B C   1 
ATOM   6061 O O   . SER B 1 210 ? 39.434  6.097   30.586  1.00 25.44 ? 209  SER B O   1 
ATOM   6062 C CB  . SER B 1 210 ? 39.055  6.269   27.750  1.00 25.36 ? 209  SER B CB  1 
ATOM   6063 O OG  . SER B 1 210 ? 40.110  5.321   27.769  1.00 26.51 ? 209  SER B OG  1 
ATOM   6064 N N   . LYS B 1 211 ? 38.268  4.163   30.417  1.00 26.84 ? 210  LYS B N   1 
ATOM   6065 C CA  . LYS B 1 211 ? 38.796  3.572   31.647  1.00 27.82 ? 210  LYS B CA  1 
ATOM   6066 C C   . LYS B 1 211 ? 40.330  3.627   31.733  1.00 28.23 ? 210  LYS B C   1 
ATOM   6067 O O   . LYS B 1 211 ? 40.873  4.122   32.726  1.00 28.58 ? 210  LYS B O   1 
ATOM   6068 C CB  . LYS B 1 211 ? 38.281  2.131   31.820  1.00 28.16 ? 210  LYS B CB  1 
ATOM   6069 C CG  . LYS B 1 211 ? 38.770  1.424   33.091  1.00 29.55 ? 210  LYS B CG  1 
ATOM   6070 C CD  . LYS B 1 211 ? 37.937  1.754   34.325  1.00 31.38 ? 210  LYS B CD  1 
ATOM   6071 C CE  . LYS B 1 211 ? 38.093  0.680   35.392  1.00 32.11 ? 210  LYS B CE  1 
ATOM   6072 N NZ  . LYS B 1 211 ? 39.510  0.504   35.826  1.00 32.85 ? 210  LYS B NZ  1 
ATOM   6073 N N   . THR B 1 212 ? 41.018  3.143   30.699  1.00 27.96 ? 211  THR B N   1 
ATOM   6074 C CA  . THR B 1 212 ? 42.488  3.130   30.665  1.00 27.99 ? 211  THR B CA  1 
ATOM   6075 C C   . THR B 1 212 ? 43.095  4.503   30.394  1.00 27.98 ? 211  THR B C   1 
ATOM   6076 O O   . THR B 1 212 ? 44.256  4.758   30.735  1.00 28.17 ? 211  THR B O   1 
ATOM   6077 C CB  . THR B 1 212 ? 43.008  2.158   29.577  1.00 28.09 ? 211  THR B CB  1 
ATOM   6078 O OG1 . THR B 1 212 ? 42.551  2.598   28.290  1.00 28.73 ? 211  THR B OG1 1 
ATOM   6079 C CG2 . THR B 1 212 ? 42.397  0.772   29.732  1.00 28.41 ? 211  THR B CG2 1 
ATOM   6080 N N   . PHE B 1 213 ? 42.305  5.372   29.769  1.00 27.41 ? 212  PHE B N   1 
ATOM   6081 C CA  . PHE B 1 213 ? 42.767  6.639   29.212  1.00 27.31 ? 212  PHE B CA  1 
ATOM   6082 C C   . PHE B 1 213 ? 43.898  6.486   28.185  1.00 27.38 ? 212  PHE B C   1 
ATOM   6083 O O   . PHE B 1 213 ? 44.695  7.415   27.972  1.00 27.58 ? 212  PHE B O   1 
ATOM   6084 C CB  . PHE B 1 213 ? 43.135  7.638   30.309  1.00 27.20 ? 212  PHE B CB  1 
ATOM   6085 C CG  . PHE B 1 213 ? 42.654  9.029   30.029  1.00 25.80 ? 212  PHE B CG  1 
ATOM   6086 C CD1 . PHE B 1 213 ? 41.293  9.330   30.086  1.00 24.77 ? 212  PHE B CD1 1 
ATOM   6087 C CD2 . PHE B 1 213 ? 43.554  10.029  29.695  1.00 26.30 ? 212  PHE B CD2 1 
ATOM   6088 C CE1 . PHE B 1 213 ? 40.839  10.598  29.823  1.00 25.13 ? 212  PHE B CE1 1 
ATOM   6089 C CE2 . PHE B 1 213 ? 43.109  11.320  29.431  1.00 25.51 ? 212  PHE B CE2 1 
ATOM   6090 C CZ  . PHE B 1 213 ? 41.747  11.602  29.495  1.00 26.03 ? 212  PHE B CZ  1 
ATOM   6091 N N   . THR B 1 214 ? 43.965  5.310   27.566  1.00 27.01 ? 213  THR B N   1 
ATOM   6092 C CA  . THR B 1 214 ? 44.904  5.065   26.464  1.00 27.13 ? 213  THR B CA  1 
ATOM   6093 C C   . THR B 1 214 ? 44.227  4.504   25.206  1.00 26.74 ? 213  THR B C   1 
ATOM   6094 O O   . THR B 1 214 ? 44.914  4.148   24.245  1.00 27.10 ? 213  THR B O   1 
ATOM   6095 C CB  . THR B 1 214 ? 46.072  4.149   26.898  1.00 27.18 ? 213  THR B CB  1 
ATOM   6096 O OG1 . THR B 1 214 ? 45.557  2.881   27.314  1.00 27.67 ? 213  THR B OG1 1 
ATOM   6097 C CG2 . THR B 1 214 ? 46.773  4.695   28.141  1.00 28.33 ? 213  THR B CG2 1 
ATOM   6098 N N   . THR B 1 215 ? 42.891  4.427   25.220  1.00 26.44 ? 214  THR B N   1 
ATOM   6099 C CA  . THR B 1 215 ? 42.102  3.968   24.074  1.00 25.29 ? 214  THR B CA  1 
ATOM   6100 C C   . THR B 1 215 ? 42.462  4.803   22.847  1.00 25.08 ? 214  THR B C   1 
ATOM   6101 O O   . THR B 1 215 ? 42.274  6.020   22.852  1.00 24.43 ? 214  THR B O   1 
ATOM   6102 C CB  . THR B 1 215 ? 40.608  4.161   24.363  1.00 25.89 ? 214  THR B CB  1 
ATOM   6103 O OG1 . THR B 1 215 ? 40.268  3.533   25.600  1.00 25.56 ? 214  THR B OG1 1 
ATOM   6104 C CG2 . THR B 1 215 ? 39.765  3.425   23.340  1.00 23.86 ? 214  THR B CG2 1 
ATOM   6105 N N   . GLN B 1 216 ? 42.950  4.162   21.788  1.00 24.86 ? 215  GLN B N   1 
ATOM   6106 C CA  . GLN B 1 216 ? 43.490  4.925   20.656  1.00 24.33 ? 215  GLN B CA  1 
ATOM   6107 C C   . GLN B 1 216 ? 42.518  5.922   20.002  1.00 23.82 ? 215  GLN B C   1 
ATOM   6108 O O   . GLN B 1 216 ? 42.872  7.083   19.803  1.00 23.25 ? 215  GLN B O   1 
ATOM   6109 C CB  . GLN B 1 216 ? 44.092  4.015   19.585  1.00 24.98 ? 215  GLN B CB  1 
ATOM   6110 C CG  . GLN B 1 216 ? 44.765  4.809   18.471  1.00 26.02 ? 215  GLN B CG  1 
ATOM   6111 C CD  . GLN B 1 216 ? 45.286  3.952   17.337  1.00 26.94 ? 215  GLN B CD  1 
ATOM   6112 O OE1 . GLN B 1 216 ? 44.679  2.952   16.973  1.00 28.28 ? 215  GLN B OE1 1 
ATOM   6113 N NE2 . GLN B 1 216 ? 46.402  4.363   16.760  1.00 27.10 ? 215  GLN B NE2 1 
ATOM   6114 N N   . GLU B 1 217 ? 41.316  5.470   19.658  1.00 23.07 ? 216  GLU B N   1 
ATOM   6115 C CA  . GLU B 1 217 ? 40.346  6.346   19.000  1.00 23.68 ? 216  GLU B CA  1 
ATOM   6116 C C   . GLU B 1 217 ? 39.944  7.519   19.884  1.00 22.12 ? 216  GLU B C   1 
ATOM   6117 O O   . GLU B 1 217 ? 39.970  8.675   19.454  1.00 21.76 ? 216  GLU B O   1 
ATOM   6118 C CB  . GLU B 1 217 ? 39.098  5.562   18.576  1.00 23.87 ? 216  GLU B CB  1 
ATOM   6119 C CG  . GLU B 1 217 ? 39.403  4.528   17.503  1.00 28.13 ? 216  GLU B CG  1 
ATOM   6120 C CD  . GLU B 1 217 ? 39.479  3.115   18.047  1.00 32.21 ? 216  GLU B CD  1 
ATOM   6121 O OE1 . GLU B 1 217 ? 39.175  2.199   17.254  1.00 35.40 ? 216  GLU B OE1 1 
ATOM   6122 O OE2 . GLU B 1 217 ? 39.861  2.913   19.238  1.00 32.54 ? 216  GLU B OE2 1 
ATOM   6123 N N   . THR B 1 218 ? 39.600  7.207   21.131  1.00 22.08 ? 217  THR B N   1 
ATOM   6124 C CA  . THR B 1 218 ? 39.140  8.204   22.092  1.00 22.38 ? 217  THR B CA  1 
ATOM   6125 C C   . THR B 1 218 ? 40.215  9.224   22.425  1.00 22.09 ? 217  THR B C   1 
ATOM   6126 O O   . THR B 1 218 ? 39.956  10.424  22.447  1.00 23.22 ? 217  THR B O   1 
ATOM   6127 C CB  . THR B 1 218 ? 38.677  7.501   23.361  1.00 22.19 ? 217  THR B CB  1 
ATOM   6128 O OG1 . THR B 1 218 ? 37.638  6.587   23.013  1.00 22.91 ? 217  THR B OG1 1 
ATOM   6129 C CG2 . THR B 1 218 ? 37.993  8.489   24.320  1.00 22.66 ? 217  THR B CG2 1 
ATOM   6130 N N   . ILE B 1 219 ? 41.423  8.743   22.684  1.00 21.67 ? 218  ILE B N   1 
ATOM   6131 C CA  . ILE B 1 219 ? 42.512  9.644   23.027  1.00 21.50 ? 218  ILE B CA  1 
ATOM   6132 C C   . ILE B 1 219 ? 42.952  10.485  21.828  1.00 20.64 ? 218  ILE B C   1 
ATOM   6133 O O   . ILE B 1 219 ? 43.274  11.658  21.994  1.00 20.23 ? 218  ILE B O   1 
ATOM   6134 C CB  . ILE B 1 219 ? 43.690  8.875   23.666  1.00 21.59 ? 218  ILE B CB  1 
ATOM   6135 C CG1 . ILE B 1 219 ? 43.278  8.271   25.020  1.00 21.60 ? 218  ILE B CG1 1 
ATOM   6136 C CG2 . ILE B 1 219 ? 44.912  9.780   23.822  1.00 23.16 ? 218  ILE B CG2 1 
ATOM   6137 C CD1 . ILE B 1 219 ? 42.446  9.182   25.941  1.00 20.46 ? 218  ILE B CD1 1 
ATOM   6138 N N   . THR B 1 220 ? 42.955  9.898   20.623  1.00 19.91 ? 219  THR B N   1 
ATOM   6139 C CA  . THR B 1 220 ? 43.272  10.665  19.417  1.00 19.38 ? 219  THR B CA  1 
ATOM   6140 C C   . THR B 1 220 ? 42.274  11.802  19.219  1.00 18.82 ? 219  THR B C   1 
ATOM   6141 O O   . THR B 1 220 ? 42.662  12.944  19.006  1.00 18.94 ? 219  THR B O   1 
ATOM   6142 C CB  . THR B 1 220 ? 43.317  9.760   18.175  1.00 19.37 ? 219  THR B CB  1 
ATOM   6143 O OG1 . THR B 1 220 ? 44.340  8.779   18.359  1.00 21.36 ? 219  THR B OG1 1 
ATOM   6144 C CG2 . THR B 1 220 ? 43.783  10.569  16.967  1.00 19.46 ? 219  THR B CG2 1 
ATOM   6145 N N   . ASN B 1 221 ? 40.995  11.479  19.335  1.00 18.32 ? 220  ASN B N   1 
ATOM   6146 C CA  . ASN B 1 221 ? 39.932  12.487  19.280  1.00 18.91 ? 220  ASN B CA  1 
ATOM   6147 C C   . ASN B 1 221 ? 40.093  13.567  20.358  1.00 18.99 ? 220  ASN B C   1 
ATOM   6148 O O   . ASN B 1 221 ? 39.981  14.766  20.058  1.00 19.24 ? 220  ASN B O   1 
ATOM   6149 C CB  . ASN B 1 221 ? 38.553  11.823  19.387  1.00 18.40 ? 220  ASN B CB  1 
ATOM   6150 C CG  . ASN B 1 221 ? 38.053  11.273  18.053  1.00 18.50 ? 220  ASN B CG  1 
ATOM   6151 O OD1 . ASN B 1 221 ? 38.304  11.844  16.998  1.00 18.13 ? 220  ASN B OD1 1 
ATOM   6152 N ND2 . ASN B 1 221 ? 37.315  10.161  18.111  1.00 16.48 ? 220  ASN B ND2 1 
ATOM   6153 N N   . ALA B 1 222 ? 40.375  13.128  21.591  1.00 19.07 ? 221  ALA B N   1 
ATOM   6154 C CA  . ALA B 1 222 ? 40.611  14.017  22.731  1.00 19.27 ? 221  ALA B CA  1 
ATOM   6155 C C   . ALA B 1 222 ? 41.791  14.970  22.444  1.00 19.28 ? 221  ALA B C   1 
ATOM   6156 O O   . ALA B 1 222 ? 41.684  16.188  22.649  1.00 19.02 ? 221  ALA B O   1 
ATOM   6157 C CB  . ALA B 1 222 ? 40.858  13.207  24.001  1.00 18.38 ? 221  ALA B CB  1 
ATOM   6158 N N   . GLU B 1 223 ? 42.885  14.423  21.906  1.00 19.83 ? 222  GLU B N   1 
ATOM   6159 C CA  . GLU B 1 223 ? 44.052  15.246  21.582  1.00 20.58 ? 222  GLU B CA  1 
ATOM   6160 C C   . GLU B 1 223 ? 43.769  16.253  20.458  1.00 20.30 ? 222  GLU B C   1 
ATOM   6161 O O   . GLU B 1 223 ? 44.234  17.393  20.499  1.00 19.86 ? 222  GLU B O   1 
ATOM   6162 C CB  . GLU B 1 223 ? 45.282  14.355  21.329  1.00 20.80 ? 222  GLU B CB  1 
ATOM   6163 C CG  . GLU B 1 223 ? 45.799  13.767  22.643  1.00 23.91 ? 222  GLU B CG  1 
ATOM   6164 C CD  . GLU B 1 223 ? 46.916  12.739  22.513  1.00 29.72 ? 222  GLU B CD  1 
ATOM   6165 O OE1 . GLU B 1 223 ? 47.450  12.321  23.572  1.00 32.45 ? 222  GLU B OE1 1 
ATOM   6166 O OE2 . GLU B 1 223 ? 47.270  12.340  21.388  1.00 32.27 ? 222  GLU B OE2 1 
ATOM   6167 N N   . THR B 1 224 ? 42.980  15.841  19.466  1.00 19.69 ? 223  THR B N   1 
ATOM   6168 C CA  . THR B 1 224 ? 42.552  16.754  18.411  1.00 19.65 ? 223  THR B CA  1 
ATOM   6169 C C   . THR B 1 224 ? 41.683  17.895  18.967  1.00 19.91 ? 223  THR B C   1 
ATOM   6170 O O   . THR B 1 224 ? 41.891  19.063  18.622  1.00 19.89 ? 223  THR B O   1 
ATOM   6171 C CB  . THR B 1 224 ? 41.831  15.962  17.295  1.00 19.87 ? 223  THR B CB  1 
ATOM   6172 O OG1 . THR B 1 224 ? 42.786  15.104  16.655  1.00 20.15 ? 223  THR B OG1 1 
ATOM   6173 C CG2 . THR B 1 224 ? 41.344  16.865  16.182  1.00 19.85 ? 223  THR B CG2 1 
ATOM   6174 N N   . ALA B 1 225 ? 40.727  17.556  19.829  1.00 19.58 ? 224  ALA B N   1 
ATOM   6175 C CA  . ALA B 1 225 ? 39.961  18.577  20.562  1.00 20.28 ? 224  ALA B CA  1 
ATOM   6176 C C   . ALA B 1 225 ? 40.836  19.553  21.362  1.00 20.34 ? 224  ALA B C   1 
ATOM   6177 O O   . ALA B 1 225 ? 40.591  20.766  21.341  1.00 20.68 ? 224  ALA B O   1 
ATOM   6178 C CB  . ALA B 1 225 ? 38.933  17.932  21.486  1.00 19.44 ? 224  ALA B CB  1 
ATOM   6179 N N   . LYS B 1 226 ? 41.840  19.021  22.059  1.00 21.03 ? 225  LYS B N   1 
ATOM   6180 C CA  . LYS B 1 226 ? 42.746  19.857  22.868  1.00 21.95 ? 225  LYS B CA  1 
ATOM   6181 C C   . LYS B 1 226 ? 43.543  20.822  21.981  1.00 22.19 ? 225  LYS B C   1 
ATOM   6182 O O   . LYS B 1 226 ? 43.698  22.018  22.304  1.00 21.51 ? 225  LYS B O   1 
ATOM   6183 C CB  . LYS B 1 226 ? 43.663  18.961  23.722  1.00 22.10 ? 225  LYS B CB  1 
ATOM   6184 C CG  . LYS B 1 226 ? 44.657  19.709  24.629  1.00 23.44 ? 225  LYS B CG  1 
ATOM   6185 C CD  . LYS B 1 226 ? 45.069  18.869  25.829  1.00 26.49 ? 225  LYS B CD  1 
ATOM   6186 C CE  . LYS B 1 226 ? 46.012  17.741  25.433  1.00 28.12 ? 225  LYS B CE  1 
ATOM   6187 N NZ  . LYS B 1 226 ? 47.139  17.586  26.400  1.00 30.44 ? 225  LYS B NZ  1 
ATOM   6188 N N   . GLU B 1 227 ? 44.016  20.314  20.848  1.00 22.47 ? 226  GLU B N   1 
ATOM   6189 C CA  . GLU B 1 227 ? 44.736  21.140  19.878  1.00 23.82 ? 226  GLU B CA  1 
ATOM   6190 C C   . GLU B 1 227 ? 43.880  22.303  19.356  1.00 23.48 ? 226  GLU B C   1 
ATOM   6191 O O   . GLU B 1 227 ? 44.347  23.441  19.277  1.00 24.61 ? 226  GLU B O   1 
ATOM   6192 C CB  . GLU B 1 227 ? 45.235  20.258  18.734  1.00 24.41 ? 226  GLU B CB  1 
ATOM   6193 C CG  . GLU B 1 227 ? 46.009  20.973  17.641  1.00 28.16 ? 226  GLU B CG  1 
ATOM   6194 C CD  . GLU B 1 227 ? 46.315  20.050  16.471  1.00 32.58 ? 226  GLU B CD  1 
ATOM   6195 O OE1 . GLU B 1 227 ? 45.639  20.167  15.422  1.00 36.33 ? 226  GLU B OE1 1 
ATOM   6196 O OE2 . GLU B 1 227 ? 47.207  19.191  16.613  1.00 34.73 ? 226  GLU B OE2 1 
ATOM   6197 N N   . TRP B 1 228 ? 42.630  22.011  19.005  1.00 23.21 ? 227  TRP B N   1 
ATOM   6198 C CA  . TRP B 1 228 ? 41.672  23.024  18.559  1.00 22.75 ? 227  TRP B CA  1 
ATOM   6199 C C   . TRP B 1 228 ? 41.414  24.034  19.680  1.00 22.99 ? 227  TRP B C   1 
ATOM   6200 O O   . TRP B 1 228 ? 41.444  25.257  19.459  1.00 22.64 ? 227  TRP B O   1 
ATOM   6201 C CB  . TRP B 1 228 ? 40.384  22.309  18.142  1.00 22.65 ? 227  TRP B CB  1 
ATOM   6202 C CG  . TRP B 1 228 ? 39.159  23.136  17.918  1.00 22.13 ? 227  TRP B CG  1 
ATOM   6203 C CD1 . TRP B 1 228 ? 38.762  23.703  16.745  1.00 21.94 ? 227  TRP B CD1 1 
ATOM   6204 C CD2 . TRP B 1 228 ? 38.111  23.412  18.870  1.00 22.11 ? 227  TRP B CD2 1 
ATOM   6205 N NE1 . TRP B 1 228 ? 37.556  24.343  16.910  1.00 21.92 ? 227  TRP B NE1 1 
ATOM   6206 C CE2 . TRP B 1 228 ? 37.130  24.180  18.200  1.00 20.81 ? 227  TRP B CE2 1 
ATOM   6207 C CE3 . TRP B 1 228 ? 37.913  23.108  20.225  1.00 21.92 ? 227  TRP B CE3 1 
ATOM   6208 C CZ2 . TRP B 1 228 ? 35.960  24.635  18.832  1.00 21.42 ? 227  TRP B CZ2 1 
ATOM   6209 C CZ3 . TRP B 1 228 ? 36.744  23.572  20.862  1.00 21.38 ? 227  TRP B CZ3 1 
ATOM   6210 C CH2 . TRP B 1 228 ? 35.789  24.321  20.162  1.00 20.65 ? 227  TRP B CH2 1 
ATOM   6211 N N   . PHE B 1 229 ? 41.206  23.515  20.886  1.00 22.85 ? 228  PHE B N   1 
ATOM   6212 C CA  . PHE B 1 229 ? 40.955  24.358  22.044  1.00 23.95 ? 228  PHE B CA  1 
ATOM   6213 C C   . PHE B 1 229 ? 42.141  25.283  22.332  1.00 24.15 ? 228  PHE B C   1 
ATOM   6214 O O   . PHE B 1 229 ? 41.967  26.485  22.568  1.00 24.42 ? 228  PHE B O   1 
ATOM   6215 C CB  . PHE B 1 229 ? 40.658  23.506  23.277  1.00 23.79 ? 228  PHE B CB  1 
ATOM   6216 C CG  . PHE B 1 229 ? 40.632  24.294  24.543  1.00 24.72 ? 228  PHE B CG  1 
ATOM   6217 C CD1 . PHE B 1 229 ? 39.560  25.140  24.821  1.00 25.44 ? 228  PHE B CD1 1 
ATOM   6218 C CD2 . PHE B 1 229 ? 41.690  24.220  25.446  1.00 26.28 ? 228  PHE B CD2 1 
ATOM   6219 C CE1 . PHE B 1 229 ? 39.532  25.894  25.992  1.00 25.02 ? 228  PHE B CE1 1 
ATOM   6220 C CE2 . PHE B 1 229 ? 41.668  24.974  26.629  1.00 26.50 ? 228  PHE B CE2 1 
ATOM   6221 C CZ  . PHE B 1 229 ? 40.587  25.807  26.895  1.00 26.58 ? 228  PHE B CZ  1 
ATOM   6222 N N   . LEU B 1 230 ? 43.341  24.721  22.314  1.00 24.29 ? 229  LEU B N   1 
ATOM   6223 C CA  . LEU B 1 230 ? 44.527  25.490  22.680  1.00 25.14 ? 229  LEU B CA  1 
ATOM   6224 C C   . LEU B 1 230 ? 44.898  26.546  21.657  1.00 25.78 ? 229  LEU B C   1 
ATOM   6225 O O   . LEU B 1 230 ? 45.521  27.556  22.021  1.00 25.44 ? 229  LEU B O   1 
ATOM   6226 C CB  . LEU B 1 230 ? 45.715  24.565  22.987  1.00 24.90 ? 229  LEU B CB  1 
ATOM   6227 C CG  . LEU B 1 230 ? 45.649  23.880  24.356  1.00 24.96 ? 229  LEU B CG  1 
ATOM   6228 C CD1 . LEU B 1 230 ? 46.817  22.882  24.533  1.00 25.67 ? 229  LEU B CD1 1 
ATOM   6229 C CD2 . LEU B 1 230 ? 45.604  24.916  25.490  1.00 24.45 ? 229  LEU B CD2 1 
ATOM   6230 N N   . GLU B 1 231 ? 44.507  26.341  20.394  1.00 26.24 ? 230  GLU B N   1 
ATOM   6231 C CA  . GLU B 1 231 ? 44.714  27.350  19.364  1.00 27.60 ? 230  GLU B CA  1 
ATOM   6232 C C   . GLU B 1 231 ? 44.040  28.662  19.767  1.00 27.43 ? 230  GLU B C   1 
ATOM   6233 O O   . GLU B 1 231 ? 44.573  29.734  19.507  1.00 27.04 ? 230  GLU B O   1 
ATOM   6234 C CB  . GLU B 1 231 ? 44.188  26.885  17.999  1.00 28.08 ? 230  GLU B CB  1 
ATOM   6235 C CG  . GLU B 1 231 ? 44.291  27.949  16.915  1.00 31.99 ? 230  GLU B CG  1 
ATOM   6236 C CD  . GLU B 1 231 ? 44.082  27.406  15.514  1.00 37.60 ? 230  GLU B CD  1 
ATOM   6237 O OE1 . GLU B 1 231 ? 45.076  27.336  14.751  1.00 39.06 ? 230  GLU B OE1 1 
ATOM   6238 O OE2 . GLU B 1 231 ? 42.922  27.057  15.173  1.00 40.63 ? 230  GLU B OE2 1 
ATOM   6239 N N   . ALA B 1 232 ? 42.874  28.555  20.401  1.00 27.52 ? 231  ALA B N   1 
ATOM   6240 C CA  . ALA B 1 232 ? 42.123  29.718  20.877  1.00 28.18 ? 231  ALA B CA  1 
ATOM   6241 C C   . ALA B 1 232 ? 42.570  30.177  22.276  1.00 28.91 ? 231  ALA B C   1 
ATOM   6242 O O   . ALA B 1 232 ? 42.779  31.375  22.503  1.00 29.14 ? 231  ALA B O   1 
ATOM   6243 C CB  . ALA B 1 232 ? 40.614  29.412  20.864  1.00 27.70 ? 231  ALA B CB  1 
ATOM   6244 N N   . ALA B 1 233 ? 42.718  29.234  23.207  1.00 29.27 ? 232  ALA B N   1 
ATOM   6245 C CA  . ALA B 1 233 ? 43.009  29.566  24.606  1.00 30.16 ? 232  ALA B CA  1 
ATOM   6246 C C   . ALA B 1 233 ? 44.460  29.961  24.864  1.00 30.93 ? 232  ALA B C   1 
ATOM   6247 O O   . ALA B 1 233 ? 44.721  30.814  25.719  1.00 31.23 ? 232  ALA B O   1 
ATOM   6248 C CB  . ALA B 1 233 ? 42.603  28.434  25.524  1.00 29.61 ? 232  ALA B CB  1 
ATOM   6249 N N   . LYS B 1 234 ? 45.392  29.322  24.152  1.00 31.69 ? 233  LYS B N   1 
ATOM   6250 C CA  . LYS B 1 234 ? 46.823  29.694  24.167  1.00 33.23 ? 233  LYS B CA  1 
ATOM   6251 C C   . LYS B 1 234 ? 47.436  29.606  25.560  1.00 33.73 ? 233  LYS B C   1 
ATOM   6252 O O   . LYS B 1 234 ? 48.367  30.346  25.883  1.00 34.64 ? 233  LYS B O   1 
ATOM   6253 C CB  . LYS B 1 234 ? 47.038  31.106  23.600  1.00 33.08 ? 233  LYS B CB  1 
ATOM   6254 C CG  . LYS B 1 234 ? 46.397  31.370  22.249  1.00 34.55 ? 233  LYS B CG  1 
ATOM   6255 C CD  . LYS B 1 234 ? 46.431  32.863  21.905  1.00 37.23 ? 233  LYS B CD  1 
ATOM   6256 C CE  . LYS B 1 234 ? 45.811  33.140  20.538  1.00 37.92 ? 233  LYS B CE  1 
ATOM   6257 N NZ  . LYS B 1 234 ? 44.312  33.095  20.592  1.00 39.78 ? 233  LYS B NZ  1 
ATOM   6258 N N   . ASP B 1 235 ? 46.908  28.702  26.377  1.00 33.72 ? 234  ASP B N   1 
ATOM   6259 C CA  . ASP B 1 235 ? 47.307  28.570  27.769  1.00 33.76 ? 234  ASP B CA  1 
ATOM   6260 C C   . ASP B 1 235 ? 47.009  27.147  28.246  1.00 33.26 ? 234  ASP B C   1 
ATOM   6261 O O   . ASP B 1 235 ? 45.843  26.812  28.471  1.00 33.22 ? 234  ASP B O   1 
ATOM   6262 C CB  . ASP B 1 235 ? 46.553  29.604  28.625  1.00 34.42 ? 234  ASP B CB  1 
ATOM   6263 C CG  . ASP B 1 235 ? 46.729  29.383  30.121  1.00 35.78 ? 234  ASP B CG  1 
ATOM   6264 O OD1 . ASP B 1 235 ? 45.872  29.880  30.892  1.00 38.85 ? 234  ASP B OD1 1 
ATOM   6265 O OD2 . ASP B 1 235 ? 47.674  28.743  30.628  1.00 35.51 ? 234  ASP B OD2 1 
ATOM   6266 N N   . PRO B 1 236 ? 48.052  26.325  28.407  1.00 32.85 ? 235  PRO B N   1 
ATOM   6267 C CA  . PRO B 1 236 ? 47.901  24.918  28.809  1.00 32.62 ? 235  PRO B CA  1 
ATOM   6268 C C   . PRO B 1 236 ? 47.126  24.728  30.112  1.00 32.00 ? 235  PRO B C   1 
ATOM   6269 O O   . PRO B 1 236 ? 46.486  23.688  30.292  1.00 32.33 ? 235  PRO B O   1 
ATOM   6270 C CB  . PRO B 1 236 ? 49.352  24.440  28.992  1.00 32.68 ? 235  PRO B CB  1 
ATOM   6271 C CG  . PRO B 1 236 ? 50.162  25.350  28.141  1.00 33.33 ? 235  PRO B CG  1 
ATOM   6272 C CD  . PRO B 1 236 ? 49.467  26.684  28.200  1.00 33.02 ? 235  PRO B CD  1 
ATOM   6273 N N   . SER B 1 237 ? 47.163  25.712  31.003  1.00 31.26 ? 236  SER B N   1 
ATOM   6274 C CA  . SER B 1 237 ? 46.406  25.609  32.257  1.00 30.65 ? 236  SER B CA  1 
ATOM   6275 C C   . SER B 1 237 ? 44.890  25.761  32.050  1.00 29.85 ? 236  SER B C   1 
ATOM   6276 O O   . SER B 1 237 ? 44.100  25.405  32.935  1.00 30.14 ? 236  SER B O   1 
ATOM   6277 C CB  . SER B 1 237 ? 46.920  26.618  33.288  1.00 31.03 ? 236  SER B CB  1 
ATOM   6278 O OG  . SER B 1 237 ? 46.788  27.948  32.809  1.00 31.26 ? 236  SER B OG  1 
ATOM   6279 N N   . ALA B 1 238 ? 44.487  26.261  30.882  1.00 28.81 ? 237  ALA B N   1 
ATOM   6280 C CA  . ALA B 1 238 ? 43.064  26.440  30.576  1.00 27.69 ? 237  ALA B CA  1 
ATOM   6281 C C   . ALA B 1 238 ? 42.362  25.118  30.220  1.00 27.09 ? 237  ALA B C   1 
ATOM   6282 O O   . ALA B 1 238 ? 41.138  25.031  30.301  1.00 25.98 ? 237  ALA B O   1 
ATOM   6283 C CB  . ALA B 1 238 ? 42.865  27.471  29.471  1.00 27.95 ? 237  ALA B CB  1 
ATOM   6284 N N   . VAL B 1 239 ? 43.145  24.097  29.862  1.00 26.09 ? 238  VAL B N   1 
ATOM   6285 C CA  . VAL B 1 239 ? 42.608  22.771  29.524  1.00 25.77 ? 238  VAL B CA  1 
ATOM   6286 C C   . VAL B 1 239 ? 41.722  22.218  30.647  1.00 25.63 ? 238  VAL B C   1 
ATOM   6287 O O   . VAL B 1 239 ? 40.651  21.659  30.380  1.00 25.82 ? 238  VAL B O   1 
ATOM   6288 C CB  . VAL B 1 239 ? 43.744  21.771  29.121  1.00 25.79 ? 238  VAL B CB  1 
ATOM   6289 C CG1 . VAL B 1 239 ? 43.248  20.327  29.111  1.00 24.64 ? 238  VAL B CG1 1 
ATOM   6290 C CG2 . VAL B 1 239 ? 44.304  22.132  27.750  1.00 25.55 ? 238  VAL B CG2 1 
ATOM   6291 N N   . ALA B 1 240 ? 42.141  22.432  31.896  1.00 25.70 ? 239  ALA B N   1 
ATOM   6292 C CA  . ALA B 1 240 ? 41.431  21.904  33.059  1.00 25.62 ? 239  ALA B CA  1 
ATOM   6293 C C   . ALA B 1 240 ? 40.028  22.489  33.235  1.00 25.02 ? 239  ALA B C   1 
ATOM   6294 O O   . ALA B 1 240 ? 39.197  21.916  33.928  1.00 25.02 ? 239  ALA B O   1 
ATOM   6295 C CB  . ALA B 1 240 ? 42.266  22.094  34.335  1.00 26.17 ? 239  ALA B CB  1 
ATOM   6296 N N   . LYS B 1 241 ? 39.765  23.633  32.614  1.00 24.65 ? 240  LYS B N   1 
ATOM   6297 C CA  . LYS B 1 241 ? 38.430  24.212  32.669  1.00 24.58 ? 240  LYS B CA  1 
ATOM   6298 C C   . LYS B 1 241 ? 37.484  23.655  31.586  1.00 24.20 ? 240  LYS B C   1 
ATOM   6299 O O   . LYS B 1 241 ? 36.279  23.916  31.619  1.00 23.75 ? 240  LYS B O   1 
ATOM   6300 C CB  . LYS B 1 241 ? 38.520  25.732  32.554  1.00 25.16 ? 240  LYS B CB  1 
ATOM   6301 C CG  . LYS B 1 241 ? 39.336  26.390  33.660  1.00 26.88 ? 240  LYS B CG  1 
ATOM   6302 C CD  . LYS B 1 241 ? 39.299  27.889  33.469  1.00 30.38 ? 240  LYS B CD  1 
ATOM   6303 C CE  . LYS B 1 241 ? 40.349  28.579  34.309  1.00 31.27 ? 240  LYS B CE  1 
ATOM   6304 N NZ  . LYS B 1 241 ? 40.153  30.043  34.185  1.00 29.65 ? 240  LYS B NZ  1 
ATOM   6305 N N   . HIS B 1 242 ? 38.030  22.884  30.646  1.00 23.62 ? 241  HIS B N   1 
ATOM   6306 C CA  . HIS B 1 242 ? 37.272  22.473  29.462  1.00 23.00 ? 241  HIS B CA  1 
ATOM   6307 C C   . HIS B 1 242 ? 37.343  20.976  29.149  1.00 22.77 ? 241  HIS B C   1 
ATOM   6308 O O   . HIS B 1 242 ? 36.720  20.522  28.186  1.00 22.32 ? 241  HIS B O   1 
ATOM   6309 C CB  . HIS B 1 242 ? 37.714  23.282  28.234  1.00 22.98 ? 241  HIS B CB  1 
ATOM   6310 C CG  . HIS B 1 242 ? 37.300  24.720  28.288  1.00 22.61 ? 241  HIS B CG  1 
ATOM   6311 N ND1 . HIS B 1 242 ? 36.136  25.184  27.713  1.00 21.20 ? 241  HIS B ND1 1 
ATOM   6312 C CD2 . HIS B 1 242 ? 37.879  25.790  28.886  1.00 22.85 ? 241  HIS B CD2 1 
ATOM   6313 C CE1 . HIS B 1 242 ? 36.027  26.483  27.939  1.00 22.92 ? 241  HIS B CE1 1 
ATOM   6314 N NE2 . HIS B 1 242 ? 37.072  26.873  28.648  1.00 21.04 ? 241  HIS B NE2 1 
ATOM   6315 N N   . PHE B 1 243 ? 38.103  20.231  29.948  1.00 22.69 ? 242  PHE B N   1 
ATOM   6316 C CA  . PHE B 1 243 ? 38.239  18.780  29.777  1.00 22.56 ? 242  PHE B CA  1 
ATOM   6317 C C   . PHE B 1 243 ? 38.116  18.081  31.120  1.00 22.39 ? 242  PHE B C   1 
ATOM   6318 O O   . PHE B 1 243 ? 38.774  18.459  32.094  1.00 22.52 ? 242  PHE B O   1 
ATOM   6319 C CB  . PHE B 1 243 ? 39.584  18.427  29.114  1.00 22.33 ? 242  PHE B CB  1 
ATOM   6320 C CG  . PHE B 1 243 ? 39.669  18.827  27.672  1.00 23.87 ? 242  PHE B CG  1 
ATOM   6321 C CD1 . PHE B 1 243 ? 39.855  20.167  27.312  1.00 23.07 ? 242  PHE B CD1 1 
ATOM   6322 C CD2 . PHE B 1 243 ? 39.564  17.870  26.665  1.00 22.99 ? 242  PHE B CD2 1 
ATOM   6323 C CE1 . PHE B 1 243 ? 39.924  20.547  25.967  1.00 24.13 ? 242  PHE B CE1 1 
ATOM   6324 C CE2 . PHE B 1 243 ? 39.643  18.233  25.322  1.00 24.52 ? 242  PHE B CE2 1 
ATOM   6325 C CZ  . PHE B 1 243 ? 39.824  19.577  24.965  1.00 24.44 ? 242  PHE B CZ  1 
ATOM   6326 N N   . VAL B 1 244 ? 37.257  17.068  31.172  1.00 21.56 ? 243  VAL B N   1 
ATOM   6327 C CA  . VAL B 1 244 ? 37.158  16.182  32.319  1.00 21.80 ? 243  VAL B CA  1 
ATOM   6328 C C   . VAL B 1 244 ? 37.246  14.748  31.808  1.00 22.13 ? 243  VAL B C   1 
ATOM   6329 O O   . VAL B 1 244 ? 37.090  14.507  30.595  1.00 22.05 ? 243  VAL B O   1 
ATOM   6330 C CB  . VAL B 1 244 ? 35.853  16.416  33.135  1.00 21.76 ? 243  VAL B CB  1 
ATOM   6331 C CG1 . VAL B 1 244 ? 35.669  17.912  33.443  1.00 22.26 ? 243  VAL B CG1 1 
ATOM   6332 C CG2 . VAL B 1 244 ? 34.636  15.873  32.406  1.00 21.21 ? 243  VAL B CG2 1 
ATOM   6333 N N   . ALA B 1 245 ? 37.495  13.813  32.721  1.00 22.15 ? 244  ALA B N   1 
ATOM   6334 C CA  . ALA B 1 245 ? 37.748  12.416  32.364  1.00 22.08 ? 244  ALA B CA  1 
ATOM   6335 C C   . ALA B 1 245 ? 36.838  11.456  33.123  1.00 22.54 ? 244  ALA B C   1 
ATOM   6336 O O   . ALA B 1 245 ? 36.546  11.664  34.305  1.00 22.29 ? 244  ALA B O   1 
ATOM   6337 C CB  . ALA B 1 245 ? 39.207  12.056  32.639  1.00 21.86 ? 244  ALA B CB  1 
ATOM   6338 N N   . LEU B 1 246 ? 36.409  10.397  32.439  1.00 22.55 ? 245  LEU B N   1 
ATOM   6339 C CA  . LEU B 1 246 ? 35.740  9.270   33.086  1.00 22.85 ? 245  LEU B CA  1 
ATOM   6340 C C   . LEU B 1 246 ? 36.715  8.114   32.914  1.00 23.73 ? 245  LEU B C   1 
ATOM   6341 O O   . LEU B 1 246 ? 36.854  7.573   31.811  1.00 23.33 ? 245  LEU B O   1 
ATOM   6342 C CB  . LEU B 1 246 ? 34.380  8.980   32.449  1.00 22.20 ? 245  LEU B CB  1 
ATOM   6343 C CG  . LEU B 1 246 ? 33.489  10.208  32.206  1.00 22.71 ? 245  LEU B CG  1 
ATOM   6344 C CD1 . LEU B 1 246 ? 32.199  9.859   31.474  1.00 21.76 ? 245  LEU B CD1 1 
ATOM   6345 C CD2 . LEU B 1 246 ? 33.179  10.973  33.509  1.00 22.17 ? 245  LEU B CD2 1 
ATOM   6346 N N   . SER B 1 247 ? 37.415  7.784   34.002  1.00 24.76 ? 246  SER B N   1 
ATOM   6347 C CA  . SER B 1 247 ? 38.659  6.997   33.956  1.00 25.82 ? 246  SER B CA  1 
ATOM   6348 C C   . SER B 1 247 ? 39.143  6.629   35.357  1.00 26.60 ? 246  SER B C   1 
ATOM   6349 O O   . SER B 1 247 ? 38.674  7.189   36.353  1.00 27.18 ? 246  SER B O   1 
ATOM   6350 C CB  . SER B 1 247 ? 39.761  7.818   33.284  1.00 25.24 ? 246  SER B CB  1 
ATOM   6351 O OG  . SER B 1 247 ? 40.855  7.012   32.874  1.00 25.54 ? 246  SER B OG  1 
ATOM   6352 N N   . THR B 1 248 ? 40.080  5.684   35.424  1.00 27.63 ? 247  THR B N   1 
ATOM   6353 C CA  . THR B 1 248 ? 40.831  5.427   36.650  1.00 28.06 ? 247  THR B CA  1 
ATOM   6354 C C   . THR B 1 248 ? 42.336  5.712   36.498  1.00 28.47 ? 247  THR B C   1 
ATOM   6355 O O   . THR B 1 248 ? 43.095  5.566   37.450  1.00 28.73 ? 247  THR B O   1 
ATOM   6356 C CB  . THR B 1 248 ? 40.615  3.980   37.166  1.00 28.02 ? 247  THR B CB  1 
ATOM   6357 O OG1 . THR B 1 248 ? 40.899  3.042   36.124  1.00 27.83 ? 247  THR B OG1 1 
ATOM   6358 C CG2 . THR B 1 248 ? 39.158  3.732   37.511  1.00 27.77 ? 247  THR B CG2 1 
ATOM   6359 N N   . ASN B 1 249 ? 42.770  6.128   35.312  1.00 28.90 ? 248  ASN B N   1 
ATOM   6360 C CA  . ASN B 1 249 ? 44.194  6.346   35.083  1.00 29.41 ? 248  ASN B CA  1 
ATOM   6361 C C   . ASN B 1 249 ? 44.640  7.758   35.465  1.00 29.60 ? 248  ASN B C   1 
ATOM   6362 O O   . ASN B 1 249 ? 44.837  8.628   34.607  1.00 29.86 ? 248  ASN B O   1 
ATOM   6363 C CB  . ASN B 1 249 ? 44.575  6.000   33.639  1.00 29.29 ? 248  ASN B CB  1 
ATOM   6364 C CG  . ASN B 1 249 ? 46.070  5.752   33.465  1.00 29.49 ? 248  ASN B CG  1 
ATOM   6365 O OD1 . ASN B 1 249 ? 46.477  4.928   32.642  1.00 31.61 ? 248  ASN B OD1 1 
ATOM   6366 N ND2 . ASN B 1 249 ? 46.890  6.468   34.227  1.00 27.57 ? 248  ASN B ND2 1 
ATOM   6367 N N   . THR B 1 250 ? 44.817  7.971   36.766  1.00 29.86 ? 249  THR B N   1 
ATOM   6368 C CA  . THR B 1 250 ? 45.154  9.293   37.298  1.00 29.96 ? 249  THR B CA  1 
ATOM   6369 C C   . THR B 1 250 ? 46.341  9.947   36.592  1.00 29.93 ? 249  THR B C   1 
ATOM   6370 O O   . THR B 1 250 ? 46.257  11.114  36.180  1.00 30.10 ? 249  THR B O   1 
ATOM   6371 C CB  . THR B 1 250 ? 45.404  9.221   38.827  1.00 29.93 ? 249  THR B CB  1 
ATOM   6372 O OG1 . THR B 1 250 ? 44.254  8.672   39.475  1.00 29.75 ? 249  THR B OG1 1 
ATOM   6373 C CG2 . THR B 1 250 ? 45.506  10.621  39.423  1.00 30.94 ? 249  THR B CG2 1 
ATOM   6374 N N   . ALA B 1 251 ? 47.432  9.195   36.454  1.00 30.18 ? 250  ALA B N   1 
ATOM   6375 C CA  . ALA B 1 251 ? 48.658  9.708   35.847  1.00 30.14 ? 250  ALA B CA  1 
ATOM   6376 C C   . ALA B 1 251 ? 48.434  10.214  34.416  1.00 29.58 ? 250  ALA B C   1 
ATOM   6377 O O   . ALA B 1 251 ? 48.828  11.330  34.081  1.00 29.47 ? 250  ALA B O   1 
ATOM   6378 C CB  . ALA B 1 251 ? 49.786  8.650   35.898  1.00 30.19 ? 250  ALA B CB  1 
ATOM   6379 N N   . LYS B 1 252 ? 47.770  9.411   33.589  1.00 29.34 ? 251  LYS B N   1 
ATOM   6380 C CA  . LYS B 1 252 ? 47.521  9.787   32.192  1.00 29.50 ? 251  LYS B CA  1 
ATOM   6381 C C   . LYS B 1 252 ? 46.554  10.964  32.084  1.00 29.03 ? 251  LYS B C   1 
ATOM   6382 O O   . LYS B 1 252 ? 46.695  11.814  31.205  1.00 28.98 ? 251  LYS B O   1 
ATOM   6383 C CB  . LYS B 1 252 ? 46.990  8.595   31.389  1.00 29.65 ? 251  LYS B CB  1 
ATOM   6384 C CG  . LYS B 1 252 ? 48.013  7.487   31.151  1.00 31.99 ? 251  LYS B CG  1 
ATOM   6385 C CD  . LYS B 1 252 ? 49.221  7.946   30.352  1.00 34.42 ? 251  LYS B CD  1 
ATOM   6386 C CE  . LYS B 1 252 ? 49.593  6.929   29.283  1.00 35.75 ? 251  LYS B CE  1 
ATOM   6387 N NZ  . LYS B 1 252 ? 50.235  5.709   29.850  1.00 37.67 ? 251  LYS B NZ  1 
ATOM   6388 N N   . VAL B 1 253 ? 45.583  11.008  32.992  1.00 28.34 ? 252  VAL B N   1 
ATOM   6389 C CA  . VAL B 1 253 ? 44.607  12.084  33.028  1.00 28.29 ? 252  VAL B CA  1 
ATOM   6390 C C   . VAL B 1 253 ? 45.305  13.399  33.393  1.00 28.75 ? 252  VAL B C   1 
ATOM   6391 O O   . VAL B 1 253 ? 45.113  14.420  32.716  1.00 28.72 ? 252  VAL B O   1 
ATOM   6392 C CB  . VAL B 1 253 ? 43.425  11.735  33.978  1.00 28.26 ? 252  VAL B CB  1 
ATOM   6393 C CG1 . VAL B 1 253 ? 42.503  12.929  34.176  1.00 27.33 ? 252  VAL B CG1 1 
ATOM   6394 C CG2 . VAL B 1 253 ? 42.633  10.560  33.409  1.00 27.99 ? 252  VAL B CG2 1 
ATOM   6395 N N   . LYS B 1 254 ? 46.131  13.357  34.443  1.00 29.05 ? 253  LYS B N   1 
ATOM   6396 C CA  . LYS B 1 254 ? 46.947  14.503  34.849  1.00 30.02 ? 253  LYS B CA  1 
ATOM   6397 C C   . LYS B 1 254 ? 47.817  14.988  33.699  1.00 30.08 ? 253  LYS B C   1 
ATOM   6398 O O   . LYS B 1 254 ? 47.846  16.187  33.414  1.00 30.37 ? 253  LYS B O   1 
ATOM   6399 C CB  . LYS B 1 254 ? 47.826  14.147  36.058  1.00 30.19 ? 253  LYS B CB  1 
ATOM   6400 C CG  . LYS B 1 254 ? 47.187  14.470  37.412  1.00 32.66 ? 253  LYS B CG  1 
ATOM   6401 C CD  . LYS B 1 254 ? 48.254  14.696  38.499  1.00 36.60 ? 253  LYS B CD  1 
ATOM   6402 C CE  . LYS B 1 254 ? 48.840  16.115  38.433  1.00 38.06 ? 253  LYS B CE  1 
ATOM   6403 N NZ  . LYS B 1 254 ? 50.325  16.096  38.248  1.00 40.04 ? 253  LYS B NZ  1 
ATOM   6404 N N   . GLU B 1 255 ? 48.498  14.042  33.039  1.00 30.81 ? 254  GLU B N   1 
ATOM   6405 C CA  . GLU B 1 255 ? 49.378  14.298  31.886  1.00 31.15 ? 254  GLU B CA  1 
ATOM   6406 C C   . GLU B 1 255 ? 48.678  15.042  30.748  1.00 30.50 ? 254  GLU B C   1 
ATOM   6407 O O   . GLU B 1 255 ? 49.277  15.911  30.103  1.00 29.57 ? 254  GLU B O   1 
ATOM   6408 C CB  . GLU B 1 255 ? 49.957  12.979  31.352  1.00 31.63 ? 254  GLU B CB  1 
ATOM   6409 C CG  . GLU B 1 255 ? 51.373  13.087  30.789  1.00 35.31 ? 254  GLU B CG  1 
ATOM   6410 C CD  . GLU B 1 255 ? 51.763  11.914  29.896  1.00 39.24 ? 254  GLU B CD  1 
ATOM   6411 O OE1 . GLU B 1 255 ? 52.580  12.129  28.971  1.00 41.66 ? 254  GLU B OE1 1 
ATOM   6412 O OE2 . GLU B 1 255 ? 51.259  10.781  30.101  1.00 40.92 ? 254  GLU B OE2 1 
ATOM   6413 N N   . PHE B 1 256 ? 47.409  14.698  30.520  1.00 29.80 ? 255  PHE B N   1 
ATOM   6414 C CA  . PHE B 1 256 ? 46.594  15.326  29.483  1.00 29.35 ? 255  PHE B CA  1 
ATOM   6415 C C   . PHE B 1 256 ? 46.338  16.799  29.807  1.00 29.12 ? 255  PHE B C   1 
ATOM   6416 O O   . PHE B 1 256 ? 46.181  17.621  28.900  1.00 29.14 ? 255  PHE B O   1 
ATOM   6417 C CB  . PHE B 1 256 ? 45.266  14.561  29.318  1.00 29.08 ? 255  PHE B CB  1 
ATOM   6418 C CG  . PHE B 1 256 ? 44.446  14.997  28.134  1.00 28.87 ? 255  PHE B CG  1 
ATOM   6419 C CD1 . PHE B 1 256 ? 44.637  14.413  26.874  1.00 28.12 ? 255  PHE B CD1 1 
ATOM   6420 C CD2 . PHE B 1 256 ? 43.458  15.973  28.283  1.00 28.23 ? 255  PHE B CD2 1 
ATOM   6421 C CE1 . PHE B 1 256 ? 43.859  14.814  25.771  1.00 28.12 ? 255  PHE B CE1 1 
ATOM   6422 C CE2 . PHE B 1 256 ? 42.684  16.383  27.198  1.00 27.94 ? 255  PHE B CE2 1 
ATOM   6423 C CZ  . PHE B 1 256 ? 42.889  15.805  25.937  1.00 26.97 ? 255  PHE B CZ  1 
ATOM   6424 N N   . GLY B 1 257 ? 46.298  17.120  31.101  1.00 29.00 ? 256  GLY B N   1 
ATOM   6425 C CA  . GLY B 1 257 ? 46.048  18.478  31.552  1.00 29.14 ? 256  GLY B CA  1 
ATOM   6426 C C   . GLY B 1 257 ? 44.728  18.637  32.282  1.00 28.91 ? 256  GLY B C   1 
ATOM   6427 O O   . GLY B 1 257 ? 44.289  19.756  32.530  1.00 29.25 ? 256  GLY B O   1 
ATOM   6428 N N   . ILE B 1 258 ? 44.108  17.513  32.624  1.00 28.80 ? 257  ILE B N   1 
ATOM   6429 C CA  . ILE B 1 258 ? 42.851  17.495  33.359  1.00 28.81 ? 257  ILE B CA  1 
ATOM   6430 C C   . ILE B 1 258 ? 43.132  17.496  34.861  1.00 29.47 ? 257  ILE B C   1 
ATOM   6431 O O   . ILE B 1 258 ? 43.965  16.733  35.343  1.00 30.21 ? 257  ILE B O   1 
ATOM   6432 C CB  . ILE B 1 258 ? 42.013  16.257  32.935  1.00 28.51 ? 257  ILE B CB  1 
ATOM   6433 C CG1 . ILE B 1 258 ? 41.598  16.383  31.459  1.00 27.32 ? 257  ILE B CG1 1 
ATOM   6434 C CG2 . ILE B 1 258 ? 40.801  16.046  33.863  1.00 27.64 ? 257  ILE B CG2 1 
ATOM   6435 C CD1 . ILE B 1 258 ? 40.994  15.108  30.839  1.00 27.24 ? 257  ILE B CD1 1 
ATOM   6436 N N   . ASP B 1 259 ? 42.442  18.365  35.589  1.00 30.13 ? 258  ASP B N   1 
ATOM   6437 C CA  . ASP B 1 259 ? 42.489  18.365  37.051  1.00 31.05 ? 258  ASP B CA  1 
ATOM   6438 C C   . ASP B 1 259 ? 41.965  17.011  37.566  1.00 31.28 ? 258  ASP B C   1 
ATOM   6439 O O   . ASP B 1 259 ? 40.814  16.661  37.318  1.00 31.42 ? 258  ASP B O   1 
ATOM   6440 C CB  . ASP B 1 259 ? 41.659  19.553  37.587  1.00 31.29 ? 258  ASP B CB  1 
ATOM   6441 C CG  . ASP B 1 259 ? 41.587  19.615  39.120  1.00 32.93 ? 258  ASP B CG  1 
ATOM   6442 O OD1 . ASP B 1 259 ? 42.074  18.708  39.827  1.00 34.64 ? 258  ASP B OD1 1 
ATOM   6443 O OD2 . ASP B 1 259 ? 41.038  20.564  39.714  1.00 34.45 ? 258  ASP B OD2 1 
ATOM   6444 N N   . PRO B 1 260 ? 42.805  16.255  38.277  1.00 31.69 ? 259  PRO B N   1 
ATOM   6445 C CA  . PRO B 1 260 ? 42.437  14.917  38.774  1.00 31.61 ? 259  PRO B CA  1 
ATOM   6446 C C   . PRO B 1 260 ? 41.187  14.898  39.667  1.00 31.65 ? 259  PRO B C   1 
ATOM   6447 O O   . PRO B 1 260 ? 40.617  13.830  39.894  1.00 31.48 ? 259  PRO B O   1 
ATOM   6448 C CB  . PRO B 1 260 ? 43.677  14.487  39.570  1.00 31.83 ? 259  PRO B CB  1 
ATOM   6449 C CG  . PRO B 1 260 ? 44.395  15.781  39.881  1.00 32.14 ? 259  PRO B CG  1 
ATOM   6450 C CD  . PRO B 1 260 ? 44.181  16.625  38.662  1.00 31.71 ? 259  PRO B CD  1 
ATOM   6451 N N   . GLN B 1 261 ? 40.778  16.065  40.163  1.00 31.36 ? 260  GLN B N   1 
ATOM   6452 C CA  . GLN B 1 261 ? 39.497  16.229  40.851  1.00 31.73 ? 260  GLN B CA  1 
ATOM   6453 C C   . GLN B 1 261 ? 38.331  15.916  39.903  1.00 30.92 ? 260  GLN B C   1 
ATOM   6454 O O   . GLN B 1 261 ? 37.306  15.369  40.320  1.00 30.79 ? 260  GLN B O   1 
ATOM   6455 C CB  . GLN B 1 261 ? 39.387  17.667  41.362  1.00 32.42 ? 260  GLN B CB  1 
ATOM   6456 C CG  . GLN B 1 261 ? 38.113  18.017  42.091  1.00 35.31 ? 260  GLN B CG  1 
ATOM   6457 C CD  . GLN B 1 261 ? 38.083  19.481  42.495  1.00 38.62 ? 260  GLN B CD  1 
ATOM   6458 O OE1 . GLN B 1 261 ? 39.135  20.143  42.558  1.00 40.48 ? 260  GLN B OE1 1 
ATOM   6459 N NE2 . GLN B 1 261 ? 36.888  19.993  42.770  1.00 39.09 ? 260  GLN B NE2 1 
ATOM   6460 N N   . ASN B 1 262 ? 38.509  16.256  38.627  1.00 29.87 ? 261  ASN B N   1 
ATOM   6461 C CA  . ASN B 1 262 ? 37.496  15.995  37.608  1.00 29.44 ? 261  ASN B CA  1 
ATOM   6462 C C   . ASN B 1 262 ? 37.702  14.667  36.869  1.00 29.05 ? 261  ASN B C   1 
ATOM   6463 O O   . ASN B 1 262 ? 37.329  14.533  35.701  1.00 28.56 ? 261  ASN B O   1 
ATOM   6464 C CB  . ASN B 1 262 ? 37.410  17.163  36.622  1.00 29.07 ? 261  ASN B CB  1 
ATOM   6465 C CG  . ASN B 1 262 ? 37.226  18.500  37.325  1.00 29.67 ? 261  ASN B CG  1 
ATOM   6466 O OD1 . ASN B 1 262 ? 36.347  18.642  38.173  1.00 29.34 ? 261  ASN B OD1 1 
ATOM   6467 N ND2 . ASN B 1 262 ? 38.068  19.474  36.988  1.00 27.99 ? 261  ASN B ND2 1 
ATOM   6468 N N   . MET B 1 263 ? 38.304  13.701  37.552  1.00 28.58 ? 262  MET B N   1 
ATOM   6469 C CA  . MET B 1 263 ? 38.339  12.331  37.058  1.00 28.69 ? 262  MET B CA  1 
ATOM   6470 C C   . MET B 1 263 ? 37.326  11.521  37.852  1.00 28.79 ? 262  MET B C   1 
ATOM   6471 O O   . MET B 1 263 ? 37.493  11.320  39.061  1.00 28.65 ? 262  MET B O   1 
ATOM   6472 C CB  . MET B 1 263 ? 39.736  11.723  37.179  1.00 28.61 ? 262  MET B CB  1 
ATOM   6473 C CG  . MET B 1 263 ? 39.846  10.347  36.537  1.00 28.35 ? 262  MET B CG  1 
ATOM   6474 S SD  . MET B 1 263 ? 41.408  9.502   36.821  1.00 29.04 ? 262  MET B SD  1 
ATOM   6475 C CE  . MET B 1 263 ? 41.082  8.752   38.391  1.00 27.55 ? 262  MET B CE  1 
ATOM   6476 N N   . LEU B 1 264 ? 36.277  11.065  37.165  1.00 28.39 ? 263  LEU B N   1 
ATOM   6477 C CA  . LEU B 1 264 ? 35.195  10.313  37.795  1.00 28.32 ? 263  LEU B CA  1 
ATOM   6478 C C   . LEU B 1 264 ? 35.433  8.832   37.511  1.00 28.56 ? 263  LEU B C   1 
ATOM   6479 O O   . LEU B 1 264 ? 35.599  8.434   36.352  1.00 28.04 ? 263  LEU B O   1 
ATOM   6480 C CB  . LEU B 1 264 ? 33.839  10.772  37.240  1.00 28.48 ? 263  LEU B CB  1 
ATOM   6481 C CG  . LEU B 1 264 ? 33.245  12.132  37.650  1.00 29.12 ? 263  LEU B CG  1 
ATOM   6482 C CD1 . LEU B 1 264 ? 34.129  13.320  37.299  1.00 30.51 ? 263  LEU B CD1 1 
ATOM   6483 C CD2 . LEU B 1 264 ? 31.888  12.325  36.996  1.00 30.99 ? 263  LEU B CD2 1 
ATOM   6484 N N   . GLU B 1 265 ? 35.483  8.021   38.564  1.00 28.24 ? 264  GLU B N   1 
ATOM   6485 C CA  . GLU B 1 265 ? 35.955  6.648   38.442  1.00 28.53 ? 264  GLU B CA  1 
ATOM   6486 C C   . GLU B 1 265 ? 34.843  5.633   38.212  1.00 28.11 ? 264  GLU B C   1 
ATOM   6487 O O   . GLU B 1 265 ? 33.690  5.856   38.587  1.00 27.96 ? 264  GLU B O   1 
ATOM   6488 C CB  . GLU B 1 265 ? 36.738  6.238   39.698  1.00 29.01 ? 264  GLU B CB  1 
ATOM   6489 C CG  . GLU B 1 265 ? 37.933  7.118   40.014  1.00 31.60 ? 264  GLU B CG  1 
ATOM   6490 C CD  . GLU B 1 265 ? 37.641  8.186   41.062  1.00 35.09 ? 264  GLU B CD  1 
ATOM   6491 O OE1 . GLU B 1 265 ? 38.610  8.632   41.710  1.00 37.79 ? 264  GLU B OE1 1 
ATOM   6492 O OE2 . GLU B 1 265 ? 36.461  8.599   41.241  1.00 36.35 ? 264  GLU B OE2 1 
ATOM   6493 N N   . PHE B 1 266 ? 35.216  4.517   37.586  1.00 27.91 ? 265  PHE B N   1 
ATOM   6494 C CA  . PHE B 1 266 ? 34.404  3.308   37.573  1.00 27.57 ? 265  PHE B CA  1 
ATOM   6495 C C   . PHE B 1 266 ? 35.302  2.074   37.659  1.00 27.16 ? 265  PHE B C   1 
ATOM   6496 O O   . PHE B 1 266 ? 36.523  2.205   37.656  1.00 28.03 ? 265  PHE B O   1 
ATOM   6497 C CB  . PHE B 1 266 ? 33.379  3.261   36.416  1.00 27.44 ? 265  PHE B CB  1 
ATOM   6498 C CG  . PHE B 1 266 ? 33.964  3.407   35.031  1.00 27.16 ? 265  PHE B CG  1 
ATOM   6499 C CD1 . PHE B 1 266 ? 33.982  2.322   34.161  1.00 26.72 ? 265  PHE B CD1 1 
ATOM   6500 C CD2 . PHE B 1 266 ? 34.435  4.640   34.570  1.00 25.67 ? 265  PHE B CD2 1 
ATOM   6501 C CE1 . PHE B 1 266 ? 34.490  2.451   32.855  1.00 26.26 ? 265  PHE B CE1 1 
ATOM   6502 C CE2 . PHE B 1 266 ? 34.945  4.773   33.267  1.00 25.92 ? 265  PHE B CE2 1 
ATOM   6503 C CZ  . PHE B 1 266 ? 34.975  3.677   32.417  1.00 26.03 ? 265  PHE B CZ  1 
ATOM   6504 N N   . TRP B 1 267 ? 34.707  0.886   37.762  1.00 26.51 ? 266  TRP B N   1 
ATOM   6505 C CA  . TRP B 1 267 ? 35.433  -0.291  38.261  1.00 25.68 ? 266  TRP B CA  1 
ATOM   6506 C C   . TRP B 1 267 ? 35.474  -1.430  37.246  1.00 24.86 ? 266  TRP B C   1 
ATOM   6507 O O   . TRP B 1 267 ? 34.721  -1.411  36.281  1.00 22.96 ? 266  TRP B O   1 
ATOM   6508 C CB  . TRP B 1 267 ? 34.825  -0.721  39.614  1.00 25.59 ? 266  TRP B CB  1 
ATOM   6509 C CG  . TRP B 1 267 ? 34.825  0.471   40.534  1.00 25.67 ? 266  TRP B CG  1 
ATOM   6510 C CD1 . TRP B 1 267 ? 35.864  0.900   41.317  1.00 26.27 ? 266  TRP B CD1 1 
ATOM   6511 C CD2 . TRP B 1 267 ? 33.788  1.451   40.678  1.00 25.89 ? 266  TRP B CD2 1 
ATOM   6512 N NE1 . TRP B 1 267 ? 35.520  2.063   41.966  1.00 25.80 ? 266  TRP B NE1 1 
ATOM   6513 C CE2 . TRP B 1 267 ? 34.253  2.427   41.590  1.00 26.24 ? 266  TRP B CE2 1 
ATOM   6514 C CE3 . TRP B 1 267 ? 32.498  1.598   40.143  1.00 26.25 ? 266  TRP B CE3 1 
ATOM   6515 C CZ2 . TRP B 1 267 ? 33.477  3.523   41.982  1.00 26.85 ? 266  TRP B CZ2 1 
ATOM   6516 C CZ3 . TRP B 1 267 ? 31.730  2.690   40.527  1.00 26.26 ? 266  TRP B CZ3 1 
ATOM   6517 C CH2 . TRP B 1 267 ? 32.222  3.641   41.434  1.00 25.34 ? 266  TRP B CH2 1 
ATOM   6518 N N   . ASP B 1 268 ? 36.364  -2.404  37.444  1.00 24.82 ? 267  ASP B N   1 
ATOM   6519 C CA  . ASP B 1 268 ? 36.543  -3.459  36.444  1.00 25.32 ? 267  ASP B CA  1 
ATOM   6520 C C   . ASP B 1 268 ? 35.313  -4.356  36.325  1.00 25.10 ? 267  ASP B C   1 
ATOM   6521 O O   . ASP B 1 268 ? 35.188  -5.120  35.362  1.00 24.35 ? 267  ASP B O   1 
ATOM   6522 C CB  . ASP B 1 268 ? 37.841  -4.297  36.631  1.00 25.93 ? 267  ASP B CB  1 
ATOM   6523 C CG  A ASP B 1 268 ? 39.116  -3.483  36.514  0.40 25.77 ? 267  ASP B CG  1 
ATOM   6524 C CG  B ASP B 1 268 ? 37.883  -5.096  37.919  0.60 26.43 ? 267  ASP B CG  1 
ATOM   6525 O OD1 A ASP B 1 268 ? 40.130  -3.906  37.118  0.40 26.37 ? 267  ASP B OD1 1 
ATOM   6526 O OD1 B ASP B 1 268 ? 36.858  -5.267  38.601  0.60 27.66 ? 267  ASP B OD1 1 
ATOM   6527 O OD2 A ASP B 1 268 ? 39.228  -2.448  35.829  0.40 26.17 ? 267  ASP B OD2 1 
ATOM   6528 O OD2 B ASP B 1 268 ? 38.946  -5.618  38.318  0.60 29.46 ? 267  ASP B OD2 1 
ATOM   6529 N N   . TRP B 1 269 ? 34.412  -4.263  37.308  1.00 24.25 ? 268  TRP B N   1 
ATOM   6530 C CA  . TRP B 1 269 ? 33.177  -5.033  37.275  1.00 24.28 ? 268  TRP B CA  1 
ATOM   6531 C C   . TRP B 1 269 ? 32.056  -4.280  36.552  1.00 23.71 ? 268  TRP B C   1 
ATOM   6532 O O   . TRP B 1 269 ? 30.928  -4.760  36.510  1.00 23.79 ? 268  TRP B O   1 
ATOM   6533 C CB  . TRP B 1 269 ? 32.726  -5.491  38.681  1.00 24.07 ? 268  TRP B CB  1 
ATOM   6534 C CG  . TRP B 1 269 ? 32.921  -4.502  39.802  1.00 25.38 ? 268  TRP B CG  1 
ATOM   6535 C CD1 . TRP B 1 269 ? 33.953  -4.489  40.714  1.00 25.39 ? 268  TRP B CD1 1 
ATOM   6536 C CD2 . TRP B 1 269 ? 32.073  -3.397  40.151  1.00 24.62 ? 268  TRP B CD2 1 
ATOM   6537 N NE1 . TRP B 1 269 ? 33.796  -3.444  41.592  1.00 25.16 ? 268  TRP B NE1 1 
ATOM   6538 C CE2 . TRP B 1 269 ? 32.648  -2.765  41.282  1.00 25.45 ? 268  TRP B CE2 1 
ATOM   6539 C CE3 . TRP B 1 269 ? 30.880  -2.874  39.630  1.00 24.21 ? 268  TRP B CE3 1 
ATOM   6540 C CZ2 . TRP B 1 269 ? 32.080  -1.629  41.888  1.00 25.01 ? 268  TRP B CZ2 1 
ATOM   6541 C CZ3 . TRP B 1 269 ? 30.313  -1.747  40.233  1.00 25.96 ? 268  TRP B CZ3 1 
ATOM   6542 C CH2 . TRP B 1 269 ? 30.914  -1.146  41.365  1.00 24.38 ? 268  TRP B CH2 1 
ATOM   6543 N N   . VAL B 1 270 ? 32.378  -3.102  36.016  1.00 23.34 ? 269  VAL B N   1 
ATOM   6544 C CA  . VAL B 1 270 ? 31.502  -2.402  35.076  1.00 22.97 ? 269  VAL B CA  1 
ATOM   6545 C C   . VAL B 1 270 ? 31.984  -2.611  33.639  1.00 22.58 ? 269  VAL B C   1 
ATOM   6546 O O   . VAL B 1 270 ? 32.956  -1.979  33.209  1.00 23.38 ? 269  VAL B O   1 
ATOM   6547 C CB  . VAL B 1 270 ? 31.430  -0.878  35.324  1.00 22.87 ? 269  VAL B CB  1 
ATOM   6548 C CG1 . VAL B 1 270 ? 30.329  -0.264  34.453  1.00 22.12 ? 269  VAL B CG1 1 
ATOM   6549 C CG2 . VAL B 1 270 ? 31.200  -0.542  36.821  1.00 22.85 ? 269  VAL B CG2 1 
ATOM   6550 N N   . GLY B 1 271 ? 31.308  -3.494  32.912  1.00 22.52 ? 270  GLY B N   1 
ATOM   6551 C CA  . GLY B 1 271 ? 31.564  -3.683  31.489  1.00 22.35 ? 270  GLY B CA  1 
ATOM   6552 C C   . GLY B 1 271 ? 31.155  -2.469  30.673  1.00 22.14 ? 270  GLY B C   1 
ATOM   6553 O O   . GLY B 1 271 ? 30.113  -1.847  30.946  1.00 21.82 ? 270  GLY B O   1 
ATOM   6554 N N   . GLY B 1 272 ? 31.968  -2.136  29.666  1.00 21.54 ? 271  GLY B N   1 
ATOM   6555 C CA  . GLY B 1 272 ? 31.690  -0.993  28.811  1.00 21.31 ? 271  GLY B CA  1 
ATOM   6556 C C   . GLY B 1 272 ? 30.247  -0.978  28.339  1.00 21.29 ? 271  GLY B C   1 
ATOM   6557 O O   . GLY B 1 272 ? 29.541  0.029   28.450  1.00 21.04 ? 271  GLY B O   1 
ATOM   6558 N N   . ARG B 1 273 ? 29.778  -2.123  27.858  1.00 20.71 ? 272  ARG B N   1 
ATOM   6559 C CA  . ARG B 1 273 ? 28.436  -2.189  27.320  1.00 20.29 ? 272  ARG B CA  1 
ATOM   6560 C C   . ARG B 1 273 ? 27.332  -2.242  28.394  1.00 20.14 ? 272  ARG B C   1 
ATOM   6561 O O   . ARG B 1 273 ? 26.147  -2.340  28.057  1.00 20.07 ? 272  ARG B O   1 
ATOM   6562 C CB  . ARG B 1 273 ? 28.325  -3.304  26.265  1.00 21.00 ? 272  ARG B CB  1 
ATOM   6563 C CG  . ARG B 1 273 ? 28.526  -4.716  26.770  1.00 20.24 ? 272  ARG B CG  1 
ATOM   6564 C CD  . ARG B 1 273 ? 28.799  -5.737  25.656  1.00 21.38 ? 272  ARG B CD  1 
ATOM   6565 N NE  . ARG B 1 273 ? 29.181  -7.020  26.235  1.00 20.65 ? 272  ARG B NE  1 
ATOM   6566 C CZ  . ARG B 1 273 ? 30.434  -7.417  26.409  1.00 20.24 ? 272  ARG B CZ  1 
ATOM   6567 N NH1 . ARG B 1 273 ? 31.444  -6.639  26.035  1.00 20.10 ? 272  ARG B NH1 1 
ATOM   6568 N NH2 . ARG B 1 273 ? 30.677  -8.589  26.979  1.00 18.09 ? 272  ARG B NH2 1 
ATOM   6569 N N   . TYR B 1 274 ? 27.733  -2.140  29.667  1.00 19.73 ? 273  TYR B N   1 
ATOM   6570 C CA  . TYR B 1 274 ? 26.792  -2.051  30.792  1.00 20.57 ? 273  TYR B CA  1 
ATOM   6571 C C   . TYR B 1 274 ? 27.128  -0.845  31.666  1.00 20.45 ? 273  TYR B C   1 
ATOM   6572 O O   . TYR B 1 274 ? 26.850  -0.852  32.873  1.00 20.34 ? 273  TYR B O   1 
ATOM   6573 C CB  . TYR B 1 274 ? 26.844  -3.324  31.664  1.00 19.65 ? 273  TYR B CB  1 
ATOM   6574 C CG  . TYR B 1 274 ? 26.472  -4.586  30.938  1.00 20.90 ? 273  TYR B CG  1 
ATOM   6575 C CD1 . TYR B 1 274 ? 27.452  -5.384  30.348  1.00 19.75 ? 273  TYR B CD1 1 
ATOM   6576 C CD2 . TYR B 1 274 ? 25.132  -4.993  30.830  1.00 20.45 ? 273  TYR B CD2 1 
ATOM   6577 C CE1 . TYR B 1 274 ? 27.114  -6.561  29.665  1.00 19.55 ? 273  TYR B CE1 1 
ATOM   6578 C CE2 . TYR B 1 274 ? 24.789  -6.168  30.155  1.00 21.46 ? 273  TYR B CE2 1 
ATOM   6579 C CZ  . TYR B 1 274 ? 25.786  -6.941  29.572  1.00 19.52 ? 273  TYR B CZ  1 
ATOM   6580 O OH  . TYR B 1 274 ? 25.463  -8.092  28.898  1.00 21.96 ? 273  TYR B OH  1 
ATOM   6581 N N   . SER B 1 275 ? 27.727  0.182   31.055  1.00 20.66 ? 274  SER B N   1 
ATOM   6582 C CA  . SER B 1 275 ? 28.354  1.265   31.800  1.00 20.54 ? 274  SER B CA  1 
ATOM   6583 C C   . SER B 1 275 ? 27.591  2.590   31.914  1.00 20.83 ? 274  SER B C   1 
ATOM   6584 O O   . SER B 1 275 ? 28.019  3.457   32.676  1.00 21.25 ? 274  SER B O   1 
ATOM   6585 C CB  . SER B 1 275 ? 29.773  1.551   31.266  1.00 20.73 ? 274  SER B CB  1 
ATOM   6586 O OG  . SER B 1 275 ? 29.733  2.066   29.944  1.00 20.67 ? 274  SER B OG  1 
ATOM   6587 N N   . LEU B 1 276 ? 26.490  2.777   31.182  1.00 20.04 ? 275  LEU B N   1 
ATOM   6588 C CA  . LEU B 1 276 ? 25.831  4.094   31.192  1.00 20.39 ? 275  LEU B CA  1 
ATOM   6589 C C   . LEU B 1 276 ? 25.348  4.489   32.598  1.00 20.47 ? 275  LEU B C   1 
ATOM   6590 O O   . LEU B 1 276 ? 25.189  5.677   32.892  1.00 19.98 ? 275  LEU B O   1 
ATOM   6591 C CB  . LEU B 1 276 ? 24.685  4.168   30.168  1.00 20.25 ? 275  LEU B CB  1 
ATOM   6592 C CG  . LEU B 1 276 ? 23.441  3.305   30.396  1.00 20.56 ? 275  LEU B CG  1 
ATOM   6593 C CD1 . LEU B 1 276 ? 22.412  4.007   31.286  1.00 21.51 ? 275  LEU B CD1 1 
ATOM   6594 C CD2 . LEU B 1 276 ? 22.826  2.980   29.034  1.00 21.05 ? 275  LEU B CD2 1 
ATOM   6595 N N   . TRP B 1 277 ? 25.140  3.473   33.440  1.00 20.18 ? 276  TRP B N   1 
ATOM   6596 C CA  . TRP B 1 277 ? 24.689  3.619   34.828  1.00 20.56 ? 276  TRP B CA  1 
ATOM   6597 C C   . TRP B 1 277 ? 25.757  4.190   35.750  1.00 20.69 ? 276  TRP B C   1 
ATOM   6598 O O   . TRP B 1 277 ? 25.438  4.620   36.858  1.00 20.84 ? 276  TRP B O   1 
ATOM   6599 C CB  . TRP B 1 277 ? 24.234  2.255   35.362  1.00 20.41 ? 276  TRP B CB  1 
ATOM   6600 C CG  . TRP B 1 277 ? 23.444  1.452   34.332  1.00 20.89 ? 276  TRP B CG  1 
ATOM   6601 C CD1 . TRP B 1 277 ? 23.906  0.424   33.555  1.00 21.44 ? 276  TRP B CD1 1 
ATOM   6602 C CD2 . TRP B 1 277 ? 22.066  1.627   33.975  1.00 21.25 ? 276  TRP B CD2 1 
ATOM   6603 N NE1 . TRP B 1 277 ? 22.906  -0.049  32.737  1.00 19.97 ? 276  TRP B NE1 1 
ATOM   6604 C CE2 . TRP B 1 277 ? 21.762  0.666   32.978  1.00 20.54 ? 276  TRP B CE2 1 
ATOM   6605 C CE3 . TRP B 1 277 ? 21.051  2.495   34.401  1.00 20.53 ? 276  TRP B CE3 1 
ATOM   6606 C CZ2 . TRP B 1 277 ? 20.496  0.553   32.396  1.00 21.50 ? 276  TRP B CZ2 1 
ATOM   6607 C CZ3 . TRP B 1 277 ? 19.778  2.375   33.820  1.00 20.17 ? 276  TRP B CZ3 1 
ATOM   6608 C CH2 . TRP B 1 277 ? 19.520  1.411   32.828  1.00 21.13 ? 276  TRP B CH2 1 
ATOM   6609 N N   . SER B 1 278 ? 27.011  4.173   35.292  1.00 20.74 ? 277  SER B N   1 
ATOM   6610 C CA  . SER B 1 278 ? 28.160  4.613   36.071  1.00 20.89 ? 277  SER B CA  1 
ATOM   6611 C C   . SER B 1 278 ? 28.528  6.064   35.756  1.00 20.79 ? 277  SER B C   1 
ATOM   6612 O O   . SER B 1 278 ? 27.739  6.798   35.176  1.00 20.99 ? 277  SER B O   1 
ATOM   6613 C CB  . SER B 1 278 ? 29.360  3.698   35.808  1.00 21.24 ? 277  SER B CB  1 
ATOM   6614 O OG  . SER B 1 278 ? 29.968  3.987   34.551  1.00 21.84 ? 277  SER B OG  1 
ATOM   6615 N N   . ALA B 1 279 ? 29.739  6.452   36.136  1.00 20.69 ? 278  ALA B N   1 
ATOM   6616 C CA  . ALA B 1 279 ? 30.297  7.748   35.775  1.00 20.49 ? 278  ALA B CA  1 
ATOM   6617 C C   . ALA B 1 279 ? 30.166  8.025   34.272  1.00 20.40 ? 278  ALA B C   1 
ATOM   6618 O O   . ALA B 1 279 ? 30.048  9.178   33.873  1.00 20.70 ? 278  ALA B O   1 
ATOM   6619 C CB  . ALA B 1 279 ? 31.749  7.819   36.193  1.00 20.64 ? 278  ALA B CB  1 
ATOM   6620 N N   . ILE B 1 280 ? 30.186  6.962   33.460  1.00 20.24 ? 279  ILE B N   1 
ATOM   6621 C CA  . ILE B 1 280 ? 29.980  7.066   32.009  1.00 20.12 ? 279  ILE B CA  1 
ATOM   6622 C C   . ILE B 1 280 ? 28.667  7.771   31.641  1.00 19.99 ? 279  ILE B C   1 
ATOM   6623 O O   . ILE B 1 280 ? 28.553  8.399   30.577  1.00 20.80 ? 279  ILE B O   1 
ATOM   6624 C CB  . ILE B 1 280 ? 30.078  5.661   31.343  1.00 20.17 ? 279  ILE B CB  1 
ATOM   6625 C CG1 . ILE B 1 280 ? 31.507  5.106   31.480  1.00 20.75 ? 279  ILE B CG1 1 
ATOM   6626 C CG2 . ILE B 1 280 ? 29.581  5.707   29.865  1.00 20.31 ? 279  ILE B CG2 1 
ATOM   6627 C CD1 . ILE B 1 280 ? 32.531  5.805   30.622  1.00 21.55 ? 279  ILE B CD1 1 
ATOM   6628 N N   . GLY B 1 281 ? 27.683  7.703   32.529  1.00 20.32 ? 280  GLY B N   1 
ATOM   6629 C CA  . GLY B 1 281 ? 26.451  8.437   32.330  1.00 20.05 ? 280  GLY B CA  1 
ATOM   6630 C C   . GLY B 1 281 ? 26.517  9.926   32.616  1.00 20.42 ? 280  GLY B C   1 
ATOM   6631 O O   . GLY B 1 281 ? 25.480  10.583  32.610  1.00 20.74 ? 280  GLY B O   1 
ATOM   6632 N N   . LEU B 1 282 ? 27.714  10.471  32.849  1.00 20.19 ? 281  LEU B N   1 
ATOM   6633 C CA  . LEU B 1 282 ? 27.843  11.905  33.142  1.00 20.41 ? 281  LEU B CA  1 
ATOM   6634 C C   . LEU B 1 282 ? 27.149  12.819  32.116  1.00 20.65 ? 281  LEU B C   1 
ATOM   6635 O O   . LEU B 1 282 ? 26.426  13.742  32.501  1.00 20.96 ? 281  LEU B O   1 
ATOM   6636 C CB  . LEU B 1 282 ? 29.305  12.319  33.369  1.00 20.06 ? 281  LEU B CB  1 
ATOM   6637 C CG  . LEU B 1 282 ? 29.511  13.810  33.717  1.00 20.13 ? 281  LEU B CG  1 
ATOM   6638 C CD1 . LEU B 1 282 ? 28.844  14.203  35.048  1.00 20.70 ? 281  LEU B CD1 1 
ATOM   6639 C CD2 . LEU B 1 282 ? 30.987  14.164  33.722  1.00 20.16 ? 281  LEU B CD2 1 
ATOM   6640 N N   . SER B 1 283 ? 27.339  12.554  30.821  1.00 20.53 ? 282  SER B N   1 
ATOM   6641 C CA  . SER B 1 283 ? 26.708  13.377  29.787  1.00 20.56 ? 282  SER B CA  1 
ATOM   6642 C C   . SER B 1 283 ? 25.172  13.306  29.830  1.00 20.18 ? 282  SER B C   1 
ATOM   6643 O O   . SER B 1 283 ? 24.490  14.293  29.524  1.00 19.95 ? 282  SER B O   1 
ATOM   6644 C CB  . SER B 1 283 ? 27.260  13.035  28.393  1.00 21.15 ? 282  SER B CB  1 
ATOM   6645 O OG  . SER B 1 283 ? 26.957  11.691  28.037  1.00 22.53 ? 282  SER B OG  1 
ATOM   6646 N N   . ILE B 1 284 ? 24.625  12.144  30.198  1.00 19.60 ? 283  ILE B N   1 
ATOM   6647 C CA  . ILE B 1 284 ? 23.183  12.049  30.457  1.00 19.87 ? 283  ILE B CA  1 
ATOM   6648 C C   . ILE B 1 284 ? 22.760  12.959  31.621  1.00 19.85 ? 283  ILE B C   1 
ATOM   6649 O O   . ILE B 1 284 ? 21.818  13.751  31.483  1.00 20.23 ? 283  ILE B O   1 
ATOM   6650 C CB  . ILE B 1 284 ? 22.747  10.603  30.762  1.00 19.71 ? 283  ILE B CB  1 
ATOM   6651 C CG1 . ILE B 1 284 ? 23.131  9.658   29.615  1.00 20.18 ? 283  ILE B CG1 1 
ATOM   6652 C CG2 . ILE B 1 284 ? 21.224  10.544  31.078  1.00 20.57 ? 283  ILE B CG2 1 
ATOM   6653 C CD1 . ILE B 1 284 ? 23.078  8.190   30.016  1.00 19.13 ? 283  ILE B CD1 1 
ATOM   6654 N N   . ALA B 1 285 ? 23.448  12.842  32.755  1.00 19.97 ? 284  ALA B N   1 
ATOM   6655 C CA  . ALA B 1 285 ? 23.082  13.631  33.942  1.00 19.90 ? 284  ALA B CA  1 
ATOM   6656 C C   . ALA B 1 285 ? 23.234  15.125  33.654  1.00 20.01 ? 284  ALA B C   1 
ATOM   6657 O O   . ALA B 1 285 ? 22.406  15.923  34.082  1.00 19.21 ? 284  ALA B O   1 
ATOM   6658 C CB  . ALA B 1 285 ? 23.912  13.224  35.148  1.00 19.81 ? 284  ALA B CB  1 
ATOM   6659 N N   . LEU B 1 286 ? 24.269  15.493  32.900  1.00 20.40 ? 285  LEU B N   1 
ATOM   6660 C CA  . LEU B 1 286 ? 24.459  16.902  32.522  1.00 20.91 ? 285  LEU B CA  1 
ATOM   6661 C C   . LEU B 1 286 ? 23.341  17.414  31.631  1.00 21.46 ? 285  LEU B C   1 
ATOM   6662 O O   . LEU B 1 286 ? 22.894  18.560  31.770  1.00 21.24 ? 285  LEU B O   1 
ATOM   6663 C CB  . LEU B 1 286 ? 25.796  17.126  31.822  1.00 21.31 ? 285  LEU B CB  1 
ATOM   6664 C CG  . LEU B 1 286 ? 27.049  17.120  32.687  1.00 21.11 ? 285  LEU B CG  1 
ATOM   6665 C CD1 . LEU B 1 286 ? 28.299  17.012  31.813  1.00 22.99 ? 285  LEU B CD1 1 
ATOM   6666 C CD2 . LEU B 1 286 ? 27.083  18.384  33.532  1.00 21.98 ? 285  LEU B CD2 1 
ATOM   6667 N N   . HIS B 1 287 ? 22.877  16.560  30.719  1.00 21.50 ? 286  HIS B N   1 
ATOM   6668 C CA  . HIS B 1 287 ? 21.874  16.952  29.742  1.00 22.75 ? 286  HIS B CA  1 
ATOM   6669 C C   . HIS B 1 287 ? 20.465  17.085  30.324  1.00 23.08 ? 286  HIS B C   1 
ATOM   6670 O O   . HIS B 1 287 ? 19.785  18.078  30.056  1.00 23.53 ? 286  HIS B O   1 
ATOM   6671 C CB  . HIS B 1 287 ? 21.867  15.965  28.569  1.00 22.75 ? 286  HIS B CB  1 
ATOM   6672 C CG  . HIS B 1 287 ? 21.120  16.453  27.370  1.00 22.75 ? 286  HIS B CG  1 
ATOM   6673 N ND1 . HIS B 1 287 ? 21.312  17.708  26.834  1.00 22.69 ? 286  HIS B ND1 1 
ATOM   6674 C CD2 . HIS B 1 287 ? 20.200  15.844  26.585  1.00 22.95 ? 286  HIS B CD2 1 
ATOM   6675 C CE1 . HIS B 1 287 ? 20.537  17.851  25.773  1.00 23.27 ? 286  HIS B CE1 1 
ATOM   6676 N NE2 . HIS B 1 287 ? 19.850  16.736  25.605  1.00 23.82 ? 286  HIS B NE2 1 
ATOM   6677 N N   . VAL B 1 288 ? 20.042  16.090  31.112  1.00 23.37 ? 287  VAL B N   1 
ATOM   6678 C CA  . VAL B 1 288 ? 18.683  16.043  31.662  1.00 23.72 ? 287  VAL B CA  1 
ATOM   6679 C C   . VAL B 1 288 ? 18.611  16.369  33.170  1.00 24.03 ? 287  VAL B C   1 
ATOM   6680 O O   . VAL B 1 288 ? 17.524  16.450  33.736  1.00 24.33 ? 287  VAL B O   1 
ATOM   6681 C CB  . VAL B 1 288 ? 17.977  14.670  31.381  1.00 23.74 ? 287  VAL B CB  1 
ATOM   6682 C CG1 . VAL B 1 288 ? 17.782  14.451  29.874  1.00 23.79 ? 287  VAL B CG1 1 
ATOM   6683 C CG2 . VAL B 1 288 ? 18.751  13.512  32.017  1.00 22.72 ? 287  VAL B CG2 1 
ATOM   6684 N N   . GLY B 1 289 ? 19.761  16.559  33.811  1.00 24.30 ? 288  GLY B N   1 
ATOM   6685 C CA  . GLY B 1 289 ? 19.785  16.823  35.244  1.00 24.67 ? 288  GLY B CA  1 
ATOM   6686 C C   . GLY B 1 289 ? 19.963  15.560  36.058  1.00 24.99 ? 288  GLY B C   1 
ATOM   6687 O O   . GLY B 1 289 ? 19.558  14.470  35.639  1.00 25.04 ? 288  GLY B O   1 
ATOM   6688 N N   . PHE B 1 290 ? 20.560  15.707  37.234  1.00 24.95 ? 289  PHE B N   1 
ATOM   6689 C CA  . PHE B 1 290 ? 20.878  14.559  38.076  1.00 25.42 ? 289  PHE B CA  1 
ATOM   6690 C C   . PHE B 1 290 ? 19.635  13.847  38.591  1.00 25.32 ? 289  PHE B C   1 
ATOM   6691 O O   . PHE B 1 290 ? 19.649  12.626  38.742  1.00 25.90 ? 289  PHE B O   1 
ATOM   6692 C CB  . PHE B 1 290 ? 21.808  14.943  39.239  1.00 25.45 ? 289  PHE B CB  1 
ATOM   6693 C CG  . PHE B 1 290 ? 22.455  13.763  39.896  1.00 26.48 ? 289  PHE B CG  1 
ATOM   6694 C CD1 . PHE B 1 290 ? 23.507  13.093  39.274  1.00 26.73 ? 289  PHE B CD1 1 
ATOM   6695 C CD2 . PHE B 1 290 ? 21.986  13.292  41.119  1.00 28.42 ? 289  PHE B CD2 1 
ATOM   6696 C CE1 . PHE B 1 290 ? 24.098  11.992  39.873  1.00 27.92 ? 289  PHE B CE1 1 
ATOM   6697 C CE2 . PHE B 1 290 ? 22.578  12.190  41.729  1.00 28.83 ? 289  PHE B CE2 1 
ATOM   6698 C CZ  . PHE B 1 290 ? 23.629  11.538  41.105  1.00 28.36 ? 289  PHE B CZ  1 
ATOM   6699 N N   . ASP B 1 291 ? 18.573  14.613  38.852  1.00 26.03 ? 290  ASP B N   1 
ATOM   6700 C CA  . ASP B 1 291 ? 17.288  14.060  39.294  1.00 26.71 ? 290  ASP B CA  1 
ATOM   6701 C C   . ASP B 1 291 ? 16.733  13.052  38.287  1.00 25.53 ? 290  ASP B C   1 
ATOM   6702 O O   . ASP B 1 291 ? 16.327  11.940  38.651  1.00 25.71 ? 290  ASP B O   1 
ATOM   6703 C CB  . ASP B 1 291 ? 16.263  15.178  39.574  1.00 27.63 ? 290  ASP B CB  1 
ATOM   6704 C CG  . ASP B 1 291 ? 15.852  15.971  38.314  1.00 31.09 ? 290  ASP B CG  1 
ATOM   6705 O OD1 . ASP B 1 291 ? 14.736  16.545  38.338  1.00 36.42 ? 290  ASP B OD1 1 
ATOM   6706 O OD2 . ASP B 1 291 ? 16.541  16.098  37.257  1.00 34.72 ? 290  ASP B OD2 1 
ATOM   6707 N N   . HIS B 1 292 ? 16.712  13.446  37.022  1.00 24.67 ? 291  HIS B N   1 
ATOM   6708 C CA  . HIS B 1 292 ? 16.281  12.536  35.971  1.00 23.96 ? 291  HIS B CA  1 
ATOM   6709 C C   . HIS B 1 292 ? 17.228  11.341  35.828  1.00 23.64 ? 291  HIS B C   1 
ATOM   6710 O O   . HIS B 1 292 ? 16.769  10.232  35.575  1.00 23.21 ? 291  HIS B O   1 
ATOM   6711 C CB  . HIS B 1 292 ? 16.096  13.266  34.650  1.00 24.14 ? 291  HIS B CB  1 
ATOM   6712 C CG  . HIS B 1 292 ? 14.903  14.172  34.624  1.00 24.30 ? 291  HIS B CG  1 
ATOM   6713 N ND1 . HIS B 1 292 ? 14.950  15.444  34.101  1.00 25.97 ? 291  HIS B ND1 1 
ATOM   6714 C CD2 . HIS B 1 292 ? 13.629  13.987  35.047  1.00 25.22 ? 291  HIS B CD2 1 
ATOM   6715 C CE1 . HIS B 1 292 ? 13.759  16.008  34.205  1.00 25.12 ? 291  HIS B CE1 1 
ATOM   6716 N NE2 . HIS B 1 292 ? 12.941  15.147  34.781  1.00 26.38 ? 291  HIS B NE2 1 
ATOM   6717 N N   . PHE B 1 293 ? 18.533  11.561  36.023  1.00 23.45 ? 292  PHE B N   1 
ATOM   6718 C CA  . PHE B 1 293 ? 19.497  10.454  35.979  1.00 23.27 ? 292  PHE B CA  1 
ATOM   6719 C C   . PHE B 1 293 ? 19.213  9.435   37.084  1.00 23.54 ? 292  PHE B C   1 
ATOM   6720 O O   . PHE B 1 293 ? 19.290  8.218   36.864  1.00 23.03 ? 292  PHE B O   1 
ATOM   6721 C CB  . PHE B 1 293 ? 20.941  10.960  36.088  1.00 22.91 ? 292  PHE B CB  1 
ATOM   6722 C CG  . PHE B 1 293 ? 21.979  9.875   35.892  1.00 23.43 ? 292  PHE B CG  1 
ATOM   6723 C CD1 . PHE B 1 293 ? 22.152  9.280   34.645  1.00 22.70 ? 292  PHE B CD1 1 
ATOM   6724 C CD2 . PHE B 1 293 ? 22.780  9.456   36.947  1.00 23.01 ? 292  PHE B CD2 1 
ATOM   6725 C CE1 . PHE B 1 293 ? 23.108  8.279   34.453  1.00 21.69 ? 292  PHE B CE1 1 
ATOM   6726 C CE2 . PHE B 1 293 ? 23.742  8.457   36.767  1.00 24.19 ? 292  PHE B CE2 1 
ATOM   6727 C CZ  . PHE B 1 293 ? 23.901  7.864   35.510  1.00 22.21 ? 292  PHE B CZ  1 
ATOM   6728 N N   . GLU B 1 294 ? 18.892  9.940   38.276  1.00 24.01 ? 293  GLU B N   1 
ATOM   6729 C CA  . GLU B 1 294 ? 18.563  9.087   39.418  1.00 24.22 ? 293  GLU B CA  1 
ATOM   6730 C C   . GLU B 1 294 ? 17.310  8.257   39.132  1.00 23.80 ? 293  GLU B C   1 
ATOM   6731 O O   . GLU B 1 294 ? 17.225  7.092   39.528  1.00 23.89 ? 293  GLU B O   1 
ATOM   6732 C CB  . GLU B 1 294 ? 18.369  9.924   40.690  1.00 24.93 ? 293  GLU B CB  1 
ATOM   6733 C CG  . GLU B 1 294 ? 19.666  10.373  41.348  1.00 26.08 ? 293  GLU B CG  1 
ATOM   6734 C CD  . GLU B 1 294 ? 19.440  10.955  42.741  1.00 29.94 ? 293  GLU B CD  1 
ATOM   6735 O OE1 . GLU B 1 294 ? 18.494  11.756  42.919  1.00 28.90 ? 293  GLU B OE1 1 
ATOM   6736 O OE2 . GLU B 1 294 ? 20.204  10.602  43.663  1.00 31.77 ? 293  GLU B OE2 1 
ATOM   6737 N N   . GLN B 1 295 ? 16.354  8.862   38.431  1.00 23.40 ? 294  GLN B N   1 
ATOM   6738 C CA  . GLN B 1 295 ? 15.110  8.191   38.054  1.00 23.35 ? 294  GLN B CA  1 
ATOM   6739 C C   . GLN B 1 295 ? 15.397  7.039   37.091  1.00 22.87 ? 294  GLN B C   1 
ATOM   6740 O O   . GLN B 1 295 ? 14.855  5.951   37.251  1.00 22.63 ? 294  GLN B O   1 
ATOM   6741 C CB  . GLN B 1 295 ? 14.120  9.191   37.443  1.00 23.38 ? 294  GLN B CB  1 
ATOM   6742 C CG  . GLN B 1 295 ? 13.494  10.145  38.487  1.00 24.37 ? 294  GLN B CG  1 
ATOM   6743 C CD  . GLN B 1 295 ? 12.851  11.370  37.882  1.00 25.78 ? 294  GLN B CD  1 
ATOM   6744 O OE1 . GLN B 1 295 ? 12.373  11.343  36.741  1.00 28.27 ? 294  GLN B OE1 1 
ATOM   6745 N NE2 . GLN B 1 295 ? 12.839  12.464  38.643  1.00 26.89 ? 294  GLN B NE2 1 
ATOM   6746 N N   . LEU B 1 296 ? 16.284  7.287   36.125  1.00 22.50 ? 295  LEU B N   1 
ATOM   6747 C CA  . LEU B 1 296 ? 16.738  6.261   35.185  1.00 22.46 ? 295  LEU B CA  1 
ATOM   6748 C C   . LEU B 1 296 ? 17.367  5.081   35.932  1.00 22.41 ? 295  LEU B C   1 
ATOM   6749 O O   . LEU B 1 296 ? 17.044  3.916   35.671  1.00 22.31 ? 295  LEU B O   1 
ATOM   6750 C CB  . LEU B 1 296 ? 17.716  6.863   34.173  1.00 21.61 ? 295  LEU B CB  1 
ATOM   6751 C CG  . LEU B 1 296 ? 18.417  5.963   33.152  1.00 22.55 ? 295  LEU B CG  1 
ATOM   6752 C CD1 . LEU B 1 296 ? 17.557  5.740   31.909  1.00 19.78 ? 295  LEU B CD1 1 
ATOM   6753 C CD2 . LEU B 1 296 ? 19.742  6.602   32.772  1.00 24.44 ? 295  LEU B CD2 1 
ATOM   6754 N N   . LEU B 1 297 ? 18.240  5.392   36.886  1.00 22.52 ? 296  LEU B N   1 
ATOM   6755 C CA  . LEU B 1 297 ? 18.840  4.385   37.754  1.00 22.60 ? 296  LEU B CA  1 
ATOM   6756 C C   . LEU B 1 297 ? 17.775  3.639   38.555  1.00 22.55 ? 296  LEU B C   1 
ATOM   6757 O O   . LEU B 1 297 ? 17.837  2.419   38.697  1.00 22.88 ? 296  LEU B O   1 
ATOM   6758 C CB  . LEU B 1 297 ? 19.847  5.021   38.710  1.00 22.88 ? 296  LEU B CB  1 
ATOM   6759 C CG  . LEU B 1 297 ? 21.127  5.695   38.212  1.00 24.31 ? 296  LEU B CG  1 
ATOM   6760 C CD1 . LEU B 1 297 ? 21.889  6.289   39.408  1.00 25.98 ? 296  LEU B CD1 1 
ATOM   6761 C CD2 . LEU B 1 297 ? 21.998  4.707   37.456  1.00 25.87 ? 296  LEU B CD2 1 
ATOM   6762 N N   . SER B 1 298 ? 16.792  4.375   39.058  1.00 22.45 ? 297  SER B N   1 
ATOM   6763 C CA  . SER B 1 298 ? 15.701  3.767   39.821  1.00 22.64 ? 297  SER B CA  1 
ATOM   6764 C C   . SER B 1 298 ? 14.845  2.787   39.013  1.00 21.98 ? 297  SER B C   1 
ATOM   6765 O O   . SER B 1 298 ? 14.415  1.751   39.537  1.00 21.97 ? 297  SER B O   1 
ATOM   6766 C CB  . SER B 1 298 ? 14.842  4.851   40.477  1.00 22.52 ? 297  SER B CB  1 
ATOM   6767 O OG  . SER B 1 298 ? 15.640  5.560   41.422  1.00 26.34 ? 297  SER B OG  1 
ATOM   6768 N N   . GLY B 1 299 ? 14.601  3.109   37.741  1.00 21.18 ? 298  GLY B N   1 
ATOM   6769 C CA  . GLY B 1 299 ? 13.879  2.207   36.854  1.00 20.56 ? 298  GLY B CA  1 
ATOM   6770 C C   . GLY B 1 299 ? 14.598  0.894   36.626  1.00 19.91 ? 298  GLY B C   1 
ATOM   6771 O O   . GLY B 1 299 ? 13.976  -0.187  36.665  1.00 18.54 ? 298  GLY B O   1 
ATOM   6772 N N   . ALA B 1 300 ? 15.913  0.982   36.403  1.00 19.57 ? 299  ALA B N   1 
ATOM   6773 C CA  . ALA B 1 300 ? 16.753  -0.203  36.284  1.00 20.31 ? 299  ALA B CA  1 
ATOM   6774 C C   . ALA B 1 300 ? 16.714  -1.040  37.559  1.00 20.47 ? 299  ALA B C   1 
ATOM   6775 O O   . ALA B 1 300 ? 16.544  -2.260  37.475  1.00 20.36 ? 299  ALA B O   1 
ATOM   6776 C CB  . ALA B 1 300 ? 18.195  0.176   35.941  1.00 20.07 ? 299  ALA B CB  1 
ATOM   6777 N N   . HIS B 1 301 ? 16.839  -0.377  38.716  1.00 20.70 ? 300  HIS B N   1 
ATOM   6778 C CA  . HIS B 1 301 ? 16.776  -1.036  40.033  1.00 21.32 ? 300  HIS B CA  1 
ATOM   6779 C C   . HIS B 1 301 ? 15.462  -1.780  40.219  1.00 21.23 ? 300  HIS B C   1 
ATOM   6780 O O   . HIS B 1 301 ? 15.459  -2.906  40.714  1.00 21.03 ? 300  HIS B O   1 
ATOM   6781 C CB  . HIS B 1 301 ? 16.971  -0.035  41.179  1.00 21.09 ? 300  HIS B CB  1 
ATOM   6782 C CG  . HIS B 1 301 ? 17.077  -0.679  42.529  1.00 23.33 ? 300  HIS B CG  1 
ATOM   6783 N ND1 . HIS B 1 301 ? 18.059  -1.594  42.841  1.00 25.32 ? 300  HIS B ND1 1 
ATOM   6784 C CD2 . HIS B 1 301 ? 16.312  -0.557  43.641  1.00 25.62 ? 300  HIS B CD2 1 
ATOM   6785 C CE1 . HIS B 1 301 ? 17.898  -2.006  44.086  1.00 25.86 ? 300  HIS B CE1 1 
ATOM   6786 N NE2 . HIS B 1 301 ? 16.850  -1.388  44.597  1.00 27.19 ? 300  HIS B NE2 1 
ATOM   6787 N N   . TRP B 1 302 ? 14.359  -1.143  39.821  1.00 21.01 ? 301  TRP B N   1 
ATOM   6788 C CA  . TRP B 1 302 ? 13.056  -1.788  39.844  1.00 21.10 ? 301  TRP B CA  1 
ATOM   6789 C C   . TRP B 1 302 ? 13.086  -3.095  39.036  1.00 20.75 ? 301  TRP B C   1 
ATOM   6790 O O   . TRP B 1 302 ? 12.654  -4.149  39.515  1.00 20.23 ? 301  TRP B O   1 
ATOM   6791 C CB  . TRP B 1 302 ? 11.928  -0.854  39.356  1.00 21.28 ? 301  TRP B CB  1 
ATOM   6792 C CG  . TRP B 1 302 ? 10.585  -1.485  39.577  1.00 21.49 ? 301  TRP B CG  1 
ATOM   6793 C CD1 . TRP B 1 302 ? 9.741   -1.276  40.639  1.00 23.37 ? 301  TRP B CD1 1 
ATOM   6794 C CD2 . TRP B 1 302 ? 9.949   -2.476  38.753  1.00 22.73 ? 301  TRP B CD2 1 
ATOM   6795 N NE1 . TRP B 1 302 ? 8.622   -2.065  40.521  1.00 23.09 ? 301  TRP B NE1 1 
ATOM   6796 C CE2 . TRP B 1 302 ? 8.722   -2.815  39.375  1.00 24.04 ? 301  TRP B CE2 1 
ATOM   6797 C CE3 . TRP B 1 302 ? 10.286  -3.108  37.538  1.00 22.82 ? 301  TRP B CE3 1 
ATOM   6798 C CZ2 . TRP B 1 302 ? 7.833   -3.759  38.829  1.00 24.20 ? 301  TRP B CZ2 1 
ATOM   6799 C CZ3 . TRP B 1 302 ? 9.410   -4.048  37.002  1.00 22.07 ? 301  TRP B CZ3 1 
ATOM   6800 C CH2 . TRP B 1 302 ? 8.193   -4.361  37.647  1.00 23.64 ? 301  TRP B CH2 1 
ATOM   6801 N N   . MET B 1 303 ? 13.628  -3.029  37.817  1.00 20.50 ? 302  MET B N   1 
ATOM   6802 C CA  . MET B 1 303 ? 13.701  -4.206  36.958  1.00 19.93 ? 302  MET B CA  1 
ATOM   6803 C C   . MET B 1 303 ? 14.670  -5.269  37.484  1.00 19.82 ? 302  MET B C   1 
ATOM   6804 O O   . MET B 1 303 ? 14.420  -6.467  37.287  1.00 19.03 ? 302  MET B O   1 
ATOM   6805 C CB  . MET B 1 303 ? 14.074  -3.824  35.510  1.00 19.64 ? 302  MET B CB  1 
ATOM   6806 C CG  . MET B 1 303 ? 13.952  -4.990  34.494  1.00 20.61 ? 302  MET B CG  1 
ATOM   6807 S SD  . MET B 1 303 ? 12.338  -5.829  34.376  1.00 20.32 ? 302  MET B SD  1 
ATOM   6808 C CE  . MET B 1 303 ? 11.288  -4.498  33.760  1.00 19.15 ? 302  MET B CE  1 
ATOM   6809 N N   . ASP B 1 304 ? 15.752  -4.830  38.138  1.00 19.76 ? 303  ASP B N   1 
ATOM   6810 C CA  . ASP B 1 304 ? 16.710  -5.728  38.816  1.00 20.91 ? 303  ASP B CA  1 
ATOM   6811 C C   . ASP B 1 304 ? 16.009  -6.551  39.889  1.00 21.30 ? 303  ASP B C   1 
ATOM   6812 O O   . ASP B 1 304 ? 16.147  -7.775  39.938  1.00 21.02 ? 303  ASP B O   1 
ATOM   6813 C CB  . ASP B 1 304 ? 17.852  -4.942  39.466  1.00 20.60 ? 303  ASP B CB  1 
ATOM   6814 C CG  . ASP B 1 304 ? 18.744  -4.262  38.456  1.00 21.08 ? 303  ASP B CG  1 
ATOM   6815 O OD1 . ASP B 1 304 ? 18.701  -4.659  37.270  1.00 19.43 ? 303  ASP B OD1 1 
ATOM   6816 O OD2 . ASP B 1 304 ? 19.521  -3.332  38.760  1.00 21.43 ? 303  ASP B OD2 1 
ATOM   6817 N N   . GLN B 1 305 ? 15.229  -5.859  40.720  1.00 22.38 ? 304  GLN B N   1 
ATOM   6818 C CA  . GLN B 1 305 ? 14.414  -6.499  41.741  1.00 23.22 ? 304  GLN B CA  1 
ATOM   6819 C C   . GLN B 1 305 ? 13.362  -7.450  41.163  1.00 23.07 ? 304  GLN B C   1 
ATOM   6820 O O   . GLN B 1 305 ? 13.189  -8.566  41.686  1.00 22.66 ? 304  GLN B O   1 
ATOM   6821 C CB  . GLN B 1 305 ? 13.779  -5.438  42.644  1.00 23.72 ? 304  GLN B CB  1 
ATOM   6822 C CG  . GLN B 1 305 ? 14.809  -4.790  43.578  1.00 27.01 ? 304  GLN B CG  1 
ATOM   6823 C CD  . GLN B 1 305 ? 15.580  -5.830  44.376  1.00 29.44 ? 304  GLN B CD  1 
ATOM   6824 O OE1 . GLN B 1 305 ? 14.979  -6.642  45.084  1.00 33.10 ? 304  GLN B OE1 1 
ATOM   6825 N NE2 . GLN B 1 305 ? 16.905  -5.834  44.239  1.00 31.55 ? 304  GLN B NE2 1 
ATOM   6826 N N   . HIS B 1 306 ? 12.679  -7.023  40.089  1.00 22.69 ? 305  HIS B N   1 
ATOM   6827 C CA  . HIS B 1 306 ? 11.735  -7.888  39.385  1.00 22.02 ? 305  HIS B CA  1 
ATOM   6828 C C   . HIS B 1 306 ? 12.424  -9.183  38.953  1.00 22.19 ? 305  HIS B C   1 
ATOM   6829 O O   . HIS B 1 306 ? 11.901  -10.281 39.164  1.00 21.39 ? 305  HIS B O   1 
ATOM   6830 C CB  . HIS B 1 306 ? 11.123  -7.190  38.145  1.00 21.89 ? 305  HIS B CB  1 
ATOM   6831 C CG  . HIS B 1 306 ? 10.316  -8.114  37.287  1.00 21.74 ? 305  HIS B CG  1 
ATOM   6832 N ND1 . HIS B 1 306 ? 9.002   -8.428  37.565  1.00 20.22 ? 305  HIS B ND1 1 
ATOM   6833 C CD2 . HIS B 1 306 ? 10.651  -8.838  36.188  1.00 20.81 ? 305  HIS B CD2 1 
ATOM   6834 C CE1 . HIS B 1 306 ? 8.561   -9.302  36.676  1.00 21.92 ? 305  HIS B CE1 1 
ATOM   6835 N NE2 . HIS B 1 306 ? 9.539   -9.560  35.824  1.00 21.87 ? 305  HIS B NE2 1 
ATOM   6836 N N   . PHE B 1 307 ? 13.600  -9.043  38.346  1.00 21.87 ? 306  PHE B N   1 
ATOM   6837 C CA  . PHE B 1 307 ? 14.360  -10.186 37.845  1.00 22.33 ? 306  PHE B CA  1 
ATOM   6838 C C   . PHE B 1 307 ? 14.867  -11.092 38.979  1.00 22.52 ? 306  PHE B C   1 
ATOM   6839 O O   . PHE B 1 307 ? 14.854  -12.324 38.862  1.00 22.49 ? 306  PHE B O   1 
ATOM   6840 C CB  . PHE B 1 307 ? 15.520  -9.657  36.978  1.00 21.83 ? 306  PHE B CB  1 
ATOM   6841 C CG  . PHE B 1 307 ? 16.486  -10.704 36.520  1.00 22.61 ? 306  PHE B CG  1 
ATOM   6842 C CD1 . PHE B 1 307 ? 16.038  -11.901 35.954  1.00 22.40 ? 306  PHE B CD1 1 
ATOM   6843 C CD2 . PHE B 1 307 ? 17.857  -10.488 36.651  1.00 21.47 ? 306  PHE B CD2 1 
ATOM   6844 C CE1 . PHE B 1 307 ? 16.941  -12.858 35.538  1.00 24.35 ? 306  PHE B CE1 1 
ATOM   6845 C CE2 . PHE B 1 307 ? 18.769  -11.436 36.229  1.00 22.87 ? 306  PHE B CE2 1 
ATOM   6846 C CZ  . PHE B 1 307 ? 18.319  -12.625 35.677  1.00 23.00 ? 306  PHE B CZ  1 
ATOM   6847 N N   . LEU B 1 308 ? 15.302  -10.480 40.071  1.00 22.94 ? 307  LEU B N   1 
ATOM   6848 C CA  . LEU B 1 308 ? 15.840  -11.226 41.207  1.00 23.29 ? 307  LEU B CA  1 
ATOM   6849 C C   . LEU B 1 308 ? 14.756  -12.041 41.915  1.00 24.04 ? 307  LEU B C   1 
ATOM   6850 O O   . LEU B 1 308 ? 14.952  -13.213 42.204  1.00 23.66 ? 307  LEU B O   1 
ATOM   6851 C CB  . LEU B 1 308 ? 16.523  -10.278 42.194  1.00 23.33 ? 307  LEU B CB  1 
ATOM   6852 C CG  . LEU B 1 308 ? 17.198  -10.875 43.433  1.00 23.00 ? 307  LEU B CG  1 
ATOM   6853 C CD1 . LEU B 1 308 ? 18.401  -11.756 43.057  1.00 20.19 ? 307  LEU B CD1 1 
ATOM   6854 C CD2 . LEU B 1 308 ? 17.604  -9.767  44.387  1.00 23.94 ? 307  LEU B CD2 1 
ATOM   6855 N N   . LYS B 1 309 ? 13.606  -11.414 42.152  1.00 24.70 ? 308  LYS B N   1 
ATOM   6856 C CA  . LYS B 1 309 ? 12.590  -11.959 43.058  1.00 25.91 ? 308  LYS B CA  1 
ATOM   6857 C C   . LYS B 1 309 ? 11.463  -12.783 42.422  1.00 26.29 ? 308  LYS B C   1 
ATOM   6858 O O   . LYS B 1 309 ? 10.775  -13.528 43.126  1.00 26.60 ? 308  LYS B O   1 
ATOM   6859 C CB  . LYS B 1 309 ? 11.974  -10.813 43.847  1.00 26.07 ? 308  LYS B CB  1 
ATOM   6860 C CG  . LYS B 1 309 ? 12.970  -10.074 44.716  1.00 27.61 ? 308  LYS B CG  1 
ATOM   6861 C CD  . LYS B 1 309 ? 12.385  -8.772  45.247  1.00 32.30 ? 308  LYS B CD  1 
ATOM   6862 C CE  . LYS B 1 309 ? 10.915  -8.898  45.576  1.00 34.06 ? 308  LYS B CE  1 
ATOM   6863 N NZ  . LYS B 1 309 ? 10.337  -7.557  45.877  1.00 37.49 ? 308  LYS B NZ  1 
ATOM   6864 N N   . THR B 1 310 ? 11.268  -12.652 41.111  1.00 26.09 ? 309  THR B N   1 
ATOM   6865 C CA  . THR B 1 310 ? 10.091  -13.223 40.444  1.00 26.27 ? 309  THR B CA  1 
ATOM   6866 C C   . THR B 1 310 ? 10.311  -14.660 39.986  1.00 26.44 ? 309  THR B C   1 
ATOM   6867 O O   . THR B 1 310 ? 11.353  -14.965 39.393  1.00 26.96 ? 309  THR B O   1 
ATOM   6868 C CB  . THR B 1 310 ? 9.673   -12.327 39.249  1.00 26.31 ? 309  THR B CB  1 
ATOM   6869 O OG1 . THR B 1 310 ? 9.432   -10.999 39.721  1.00 25.60 ? 309  THR B OG1 1 
ATOM   6870 C CG2 . THR B 1 310 ? 8.328   -12.735 38.672  1.00 25.72 ? 309  THR B CG2 1 
ATOM   6871 N N   . PRO B 1 311 ? 9.343   -15.544 40.254  1.00 26.42 ? 310  PRO B N   1 
ATOM   6872 C CA  . PRO B 1 311 ? 9.376   -16.908 39.702  1.00 26.47 ? 310  PRO B CA  1 
ATOM   6873 C C   . PRO B 1 311 ? 9.509   -16.868 38.176  1.00 26.47 ? 310  PRO B C   1 
ATOM   6874 O O   . PRO B 1 311 ? 8.903   -16.003 37.532  1.00 25.83 ? 310  PRO B O   1 
ATOM   6875 C CB  . PRO B 1 311 ? 8.015   -17.483 40.107  1.00 26.68 ? 310  PRO B CB  1 
ATOM   6876 C CG  . PRO B 1 311 ? 7.649   -16.723 41.337  1.00 26.53 ? 310  PRO B CG  1 
ATOM   6877 C CD  . PRO B 1 311 ? 8.152   -15.319 41.100  1.00 26.65 ? 310  PRO B CD  1 
ATOM   6878 N N   . LEU B 1 312 ? 10.274  -17.800 37.613  1.00 26.58 ? 311  LEU B N   1 
ATOM   6879 C CA  . LEU B 1 312 ? 10.670  -17.737 36.200  1.00 26.91 ? 311  LEU B CA  1 
ATOM   6880 C C   . LEU B 1 312 ? 9.505   -17.692 35.212  1.00 27.35 ? 311  LEU B C   1 
ATOM   6881 O O   . LEU B 1 312 ? 9.592   -17.007 34.186  1.00 27.37 ? 311  LEU B O   1 
ATOM   6882 C CB  . LEU B 1 312 ? 11.623  -18.879 35.846  1.00 26.86 ? 311  LEU B CB  1 
ATOM   6883 C CG  . LEU B 1 312 ? 12.981  -19.009 36.542  1.00 27.49 ? 311  LEU B CG  1 
ATOM   6884 C CD1 . LEU B 1 312 ? 13.782  -20.107 35.860  1.00 28.76 ? 311  LEU B CD1 1 
ATOM   6885 C CD2 . LEU B 1 312 ? 13.771  -17.709 36.563  1.00 29.77 ? 311  LEU B CD2 1 
ATOM   6886 N N   . GLU B 1 313 ? 8.418   -18.411 35.522  1.00 27.16 ? 312  GLU B N   1 
ATOM   6887 C CA  . GLU B 1 313 ? 7.252   -18.526 34.625  1.00 27.48 ? 312  GLU B CA  1 
ATOM   6888 C C   . GLU B 1 313 ? 6.576   -17.202 34.354  1.00 26.50 ? 312  GLU B C   1 
ATOM   6889 O O   . GLU B 1 313 ? 5.758   -17.109 33.443  1.00 27.08 ? 312  GLU B O   1 
ATOM   6890 C CB  . GLU B 1 313 ? 6.147   -19.436 35.198  1.00 27.84 ? 312  GLU B CB  1 
ATOM   6891 C CG  . GLU B 1 313 ? 6.581   -20.643 35.982  1.00 31.32 ? 312  GLU B CG  1 
ATOM   6892 C CD  . GLU B 1 313 ? 6.912   -20.301 37.417  1.00 33.86 ? 312  GLU B CD  1 
ATOM   6893 O OE1 . GLU B 1 313 ? 8.117   -20.274 37.732  1.00 33.79 ? 312  GLU B OE1 1 
ATOM   6894 O OE2 . GLU B 1 313 ? 5.975   -20.066 38.221  1.00 37.52 ? 312  GLU B OE2 1 
ATOM   6895 N N   . LYS B 1 314 ? 6.873   -16.200 35.174  1.00 25.90 ? 313  LYS B N   1 
ATOM   6896 C CA  . LYS B 1 314 ? 6.254   -14.884 35.029  1.00 25.55 ? 313  LYS B CA  1 
ATOM   6897 C C   . LYS B 1 314 ? 7.280   -13.755 35.196  1.00 24.48 ? 313  LYS B C   1 
ATOM   6898 O O   . LYS B 1 314 ? 6.941   -12.645 35.624  1.00 24.24 ? 313  LYS B O   1 
ATOM   6899 C CB  . LYS B 1 314 ? 5.069   -14.737 35.998  1.00 25.97 ? 313  LYS B CB  1 
ATOM   6900 C CG  . LYS B 1 314 ? 5.427   -14.739 37.474  1.00 27.41 ? 313  LYS B CG  1 
ATOM   6901 C CD  . LYS B 1 314 ? 4.152   -14.675 38.335  1.00 30.37 ? 313  LYS B CD  1 
ATOM   6902 C CE  . LYS B 1 314 ? 4.410   -15.097 39.778  1.00 30.83 ? 313  LYS B CE  1 
ATOM   6903 N NZ  . LYS B 1 314 ? 3.113   -15.326 40.504  1.00 34.49 ? 313  LYS B NZ  1 
ATOM   6904 N N   . ASN B 1 315 ? 8.525   -14.069 34.831  1.00 23.89 ? 314  ASN B N   1 
ATOM   6905 C CA  . ASN B 1 315 ? 9.694   -13.195 34.973  1.00 22.34 ? 314  ASN B CA  1 
ATOM   6906 C C   . ASN B 1 315 ? 10.020  -12.620 33.593  1.00 22.34 ? 314  ASN B C   1 
ATOM   6907 O O   . ASN B 1 315 ? 10.471  -13.340 32.704  1.00 21.29 ? 314  ASN B O   1 
ATOM   6908 C CB  . ASN B 1 315 ? 10.876  -14.031 35.508  1.00 22.82 ? 314  ASN B CB  1 
ATOM   6909 C CG  . ASN B 1 315 ? 12.065  -13.189 35.964  1.00 22.65 ? 314  ASN B CG  1 
ATOM   6910 O OD1 . ASN B 1 315 ? 12.577  -12.333 35.224  1.00 21.65 ? 314  ASN B OD1 1 
ATOM   6911 N ND2 . ASN B 1 315 ? 12.542  -13.463 37.182  1.00 22.79 ? 314  ASN B ND2 1 
ATOM   6912 N N   . ALA B 1 316 ? 9.783   -11.322 33.425  1.00 22.10 ? 315  ALA B N   1 
ATOM   6913 C CA  . ALA B 1 316 ? 9.815   -10.694 32.101  1.00 21.96 ? 315  ALA B CA  1 
ATOM   6914 C C   . ALA B 1 316 ? 11.098  -10.982 31.294  1.00 21.76 ? 315  ALA B C   1 
ATOM   6915 O O   . ALA B 1 316 ? 11.016  -11.573 30.199  1.00 22.18 ? 315  ALA B O   1 
ATOM   6916 C CB  . ALA B 1 316 ? 9.518   -9.193  32.202  1.00 21.61 ? 315  ALA B CB  1 
ATOM   6917 N N   . PRO B 1 317 ? 12.277  -10.612 31.798  1.00 21.68 ? 316  PRO B N   1 
ATOM   6918 C CA  . PRO B 1 317 ? 13.500  -10.852 31.013  1.00 21.15 ? 316  PRO B CA  1 
ATOM   6919 C C   . PRO B 1 317 ? 13.759  -12.334 30.788  1.00 21.07 ? 316  PRO B C   1 
ATOM   6920 O O   . PRO B 1 317 ? 14.306  -12.700 29.752  1.00 19.76 ? 316  PRO B O   1 
ATOM   6921 C CB  . PRO B 1 317 ? 14.608  -10.206 31.841  1.00 21.41 ? 316  PRO B CB  1 
ATOM   6922 C CG  . PRO B 1 317 ? 14.048  -10.004 33.214  1.00 21.67 ? 316  PRO B CG  1 
ATOM   6923 C CD  . PRO B 1 317 ? 12.565  -9.918  33.071  1.00 21.27 ? 316  PRO B CD  1 
ATOM   6924 N N   . VAL B 1 318 ? 13.333  -13.177 31.730  1.00 20.40 ? 317  VAL B N   1 
ATOM   6925 C CA  . VAL B 1 318 ? 13.511  -14.616 31.567  1.00 21.05 ? 317  VAL B CA  1 
ATOM   6926 C C   . VAL B 1 318 ? 12.673  -15.120 30.406  1.00 20.01 ? 317  VAL B C   1 
ATOM   6927 O O   . VAL B 1 318 ? 13.185  -15.857 29.574  1.00 20.54 ? 317  VAL B O   1 
ATOM   6928 C CB  . VAL B 1 318 ? 13.201  -15.394 32.866  1.00 20.97 ? 317  VAL B CB  1 
ATOM   6929 C CG1 . VAL B 1 318 ? 13.226  -16.898 32.607  1.00 21.58 ? 317  VAL B CG1 1 
ATOM   6930 C CG2 . VAL B 1 318 ? 14.205  -14.999 33.965  1.00 22.49 ? 317  VAL B CG2 1 
ATOM   6931 N N   . LEU B 1 319 ? 11.403  -14.709 30.339  1.00 19.60 ? 318  LEU B N   1 
ATOM   6932 C CA  . LEU B 1 319 ? 10.508  -15.155 29.268  1.00 19.67 ? 318  LEU B CA  1 
ATOM   6933 C C   . LEU B 1 319 ? 10.988  -14.630 27.908  1.00 19.14 ? 318  LEU B C   1 
ATOM   6934 O O   . LEU B 1 319 ? 10.952  -15.341 26.903  1.00 17.89 ? 318  LEU B O   1 
ATOM   6935 C CB  . LEU B 1 319 ? 9.069   -14.692 29.530  1.00 20.00 ? 318  LEU B CB  1 
ATOM   6936 C CG  . LEU B 1 319 ? 8.349   -15.349 30.717  1.00 20.64 ? 318  LEU B CG  1 
ATOM   6937 C CD1 . LEU B 1 319 ? 6.954   -14.814 30.864  1.00 23.94 ? 318  LEU B CD1 1 
ATOM   6938 C CD2 . LEU B 1 319 ? 8.313   -16.868 30.611  1.00 21.09 ? 318  LEU B CD2 1 
ATOM   6939 N N   . LEU B 1 320 ? 11.438  -13.378 27.879  1.00 19.04 ? 319  LEU B N   1 
ATOM   6940 C CA  . LEU B 1 320 ? 12.001  -12.824 26.651  1.00 19.08 ? 319  LEU B CA  1 
ATOM   6941 C C   . LEU B 1 320 ? 13.207  -13.657 26.214  1.00 18.76 ? 319  LEU B C   1 
ATOM   6942 O O   . LEU B 1 320 ? 13.372  -13.957 25.026  1.00 19.11 ? 319  LEU B O   1 
ATOM   6943 C CB  . LEU B 1 320 ? 12.415  -11.372 26.854  1.00 19.44 ? 319  LEU B CB  1 
ATOM   6944 C CG  . LEU B 1 320 ? 11.276  -10.349 26.935  1.00 21.30 ? 319  LEU B CG  1 
ATOM   6945 C CD1 . LEU B 1 320 ? 11.872  -8.938  27.001  1.00 23.09 ? 319  LEU B CD1 1 
ATOM   6946 C CD2 . LEU B 1 320 ? 10.312  -10.490 25.758  1.00 22.47 ? 319  LEU B CD2 1 
ATOM   6947 N N   . ALA B 1 321 ? 14.024  -14.058 27.182  1.00 19.15 ? 320  ALA B N   1 
ATOM   6948 C CA  . ALA B 1 321 ? 15.198  -14.863 26.882  1.00 18.91 ? 320  ALA B CA  1 
ATOM   6949 C C   . ALA B 1 321 ? 14.796  -16.212 26.303  1.00 19.10 ? 320  ALA B C   1 
ATOM   6950 O O   . ALA B 1 321 ? 15.405  -16.707 25.340  1.00 18.55 ? 320  ALA B O   1 
ATOM   6951 C CB  . ALA B 1 321 ? 16.028  -15.053 28.129  1.00 18.79 ? 320  ALA B CB  1 
ATOM   6952 N N   . LEU B 1 322 ? 13.763  -16.802 26.900  1.00 19.82 ? 321  LEU B N   1 
ATOM   6953 C CA  . LEU B 1 322 ? 13.338  -18.154 26.527  1.00 20.39 ? 321  LEU B CA  1 
ATOM   6954 C C   . LEU B 1 322 ? 12.732  -18.197 25.138  1.00 20.66 ? 321  LEU B C   1 
ATOM   6955 O O   . LEU B 1 322 ? 12.990  -19.118 24.378  1.00 20.99 ? 321  LEU B O   1 
ATOM   6956 C CB  . LEU B 1 322 ? 12.350  -18.715 27.558  1.00 20.80 ? 321  LEU B CB  1 
ATOM   6957 C CG  . LEU B 1 322 ? 12.978  -19.023 28.920  1.00 20.84 ? 321  LEU B CG  1 
ATOM   6958 C CD1 . LEU B 1 322 ? 11.911  -19.378 29.977  1.00 23.18 ? 321  LEU B CD1 1 
ATOM   6959 C CD2 . LEU B 1 322 ? 14.011  -20.114 28.777  1.00 20.63 ? 321  LEU B CD2 1 
ATOM   6960 N N   . LEU B 1 323 ? 11.911  -17.200 24.818  1.00 20.02 ? 322  LEU B N   1 
ATOM   6961 C CA  . LEU B 1 323 ? 11.326  -17.110 23.491  1.00 19.93 ? 322  LEU B CA  1 
ATOM   6962 C C   . LEU B 1 323 ? 12.448  -17.000 22.447  1.00 19.76 ? 322  LEU B C   1 
ATOM   6963 O O   . LEU B 1 323 ? 12.393  -17.649 21.404  1.00 19.94 ? 322  LEU B O   1 
ATOM   6964 C CB  . LEU B 1 323 ? 10.353  -15.929 23.408  1.00 19.81 ? 322  LEU B CB  1 
ATOM   6965 C CG  . LEU B 1 323 ? 9.072   -16.134 24.239  1.00 20.70 ? 322  LEU B CG  1 
ATOM   6966 C CD1 . LEU B 1 323 ? 8.336   -14.792 24.477  1.00 20.43 ? 322  LEU B CD1 1 
ATOM   6967 C CD2 . LEU B 1 323 ? 8.162   -17.157 23.582  1.00 21.31 ? 322  LEU B CD2 1 
ATOM   6968 N N   . GLY B 1 324 ? 13.475  -16.215 22.758  1.00 19.83 ? 323  GLY B N   1 
ATOM   6969 C CA  . GLY B 1 324 ? 14.649  -16.115 21.892  1.00 20.55 ? 323  GLY B CA  1 
ATOM   6970 C C   . GLY B 1 324 ? 15.365  -17.454 21.665  1.00 21.19 ? 323  GLY B C   1 
ATOM   6971 O O   . GLY B 1 324 ? 15.754  -17.773 20.538  1.00 21.42 ? 323  GLY B O   1 
ATOM   6972 N N   . ILE B 1 325 ? 15.543  -18.231 22.736  1.00 22.11 ? 324  ILE B N   1 
ATOM   6973 C CA  . ILE B 1 325 ? 16.186  -19.558 22.655  1.00 22.17 ? 324  ILE B CA  1 
ATOM   6974 C C   . ILE B 1 325 ? 15.375  -20.472 21.725  1.00 21.79 ? 324  ILE B C   1 
ATOM   6975 O O   . ILE B 1 325 ? 15.931  -21.229 20.930  1.00 21.33 ? 324  ILE B O   1 
ATOM   6976 C CB  . ILE B 1 325 ? 16.305  -20.209 24.072  1.00 22.99 ? 324  ILE B CB  1 
ATOM   6977 C CG1 . ILE B 1 325 ? 17.165  -19.373 25.041  1.00 23.68 ? 324  ILE B CG1 1 
ATOM   6978 C CG2 . ILE B 1 325 ? 16.788  -21.678 23.983  1.00 21.94 ? 324  ILE B CG2 1 
ATOM   6979 C CD1 . ILE B 1 325 ? 18.642  -19.256 24.672  1.00 23.87 ? 324  ILE B CD1 1 
ATOM   6980 N N   . TRP B 1 326 ? 14.053  -20.386 21.850  1.00 20.75 ? 325  TRP B N   1 
ATOM   6981 C CA  . TRP B 1 326 ? 13.114  -21.152 21.027  1.00 20.17 ? 325  TRP B CA  1 
ATOM   6982 C C   . TRP B 1 326 ? 13.337  -20.805 19.562  1.00 19.65 ? 325  TRP B C   1 
ATOM   6983 O O   . TRP B 1 326 ? 13.546  -21.683 18.741  1.00 18.88 ? 325  TRP B O   1 
ATOM   6984 C CB  . TRP B 1 326 ? 11.701  -20.795 21.477  1.00 20.62 ? 325  TRP B CB  1 
ATOM   6985 C CG  . TRP B 1 326 ? 10.531  -21.438 20.784  1.00 21.41 ? 325  TRP B CG  1 
ATOM   6986 C CD1 . TRP B 1 326 ? 9.500   -20.785 20.169  1.00 22.51 ? 325  TRP B CD1 1 
ATOM   6987 C CD2 . TRP B 1 326 ? 10.208  -22.844 20.713  1.00 23.58 ? 325  TRP B CD2 1 
ATOM   6988 N NE1 . TRP B 1 326 ? 8.569   -21.682 19.703  1.00 23.31 ? 325  TRP B NE1 1 
ATOM   6989 C CE2 . TRP B 1 326 ? 8.976   -22.954 20.018  1.00 22.84 ? 325  TRP B CE2 1 
ATOM   6990 C CE3 . TRP B 1 326 ? 10.843  -24.019 21.147  1.00 24.48 ? 325  TRP B CE3 1 
ATOM   6991 C CZ2 . TRP B 1 326 ? 8.370   -24.187 19.743  1.00 24.93 ? 325  TRP B CZ2 1 
ATOM   6992 C CZ3 . TRP B 1 326 ? 10.231  -25.256 20.882  1.00 24.08 ? 325  TRP B CZ3 1 
ATOM   6993 C CH2 . TRP B 1 326 ? 9.012   -25.324 20.179  1.00 24.02 ? 325  TRP B CH2 1 
ATOM   6994 N N   . TYR B 1 327 ? 13.365  -19.510 19.246  1.00 18.80 ? 326  TYR B N   1 
ATOM   6995 C CA  . TYR B 1 327 ? 13.585  -19.102 17.858  1.00 18.54 ? 326  TYR B CA  1 
ATOM   6996 C C   . TYR B 1 327 ? 14.986  -19.353 17.330  1.00 18.60 ? 326  TYR B C   1 
ATOM   6997 O O   . TYR B 1 327 ? 15.146  -19.678 16.153  1.00 18.66 ? 326  TYR B O   1 
ATOM   6998 C CB  . TYR B 1 327 ? 13.196  -17.638 17.665  1.00 17.77 ? 326  TYR B CB  1 
ATOM   6999 C CG  . TYR B 1 327 ? 11.729  -17.471 17.892  1.00 16.83 ? 326  TYR B CG  1 
ATOM   7000 C CD1 . TYR B 1 327 ? 10.810  -18.308 17.244  1.00 17.36 ? 326  TYR B CD1 1 
ATOM   7001 C CD2 . TYR B 1 327 ? 11.243  -16.527 18.794  1.00 19.36 ? 326  TYR B CD2 1 
ATOM   7002 C CE1 . TYR B 1 327 ? 9.436   -18.173 17.464  1.00 18.55 ? 326  TYR B CE1 1 
ATOM   7003 C CE2 . TYR B 1 327 ? 9.874   -16.399 19.030  1.00 19.11 ? 326  TYR B CE2 1 
ATOM   7004 C CZ  . TYR B 1 327 ? 8.985   -17.212 18.367  1.00 19.38 ? 326  TYR B CZ  1 
ATOM   7005 O OH  . TYR B 1 327 ? 7.641   -17.070 18.619  1.00 19.37 ? 326  TYR B OH  1 
ATOM   7006 N N   . ILE B 1 328 ? 15.981  -19.185 18.191  1.00 18.84 ? 327  ILE B N   1 
ATOM   7007 C CA  . ILE B 1 328 ? 17.380  -19.308 17.772  1.00 19.53 ? 327  ILE B CA  1 
ATOM   7008 C C   . ILE B 1 328 ? 17.786  -20.789 17.640  1.00 20.63 ? 327  ILE B C   1 
ATOM   7009 O O   . ILE B 1 328 ? 18.283  -21.229 16.598  1.00 20.66 ? 327  ILE B O   1 
ATOM   7010 C CB  . ILE B 1 328 ? 18.306  -18.569 18.759  1.00 19.05 ? 327  ILE B CB  1 
ATOM   7011 C CG1 . ILE B 1 328 ? 18.080  -17.044 18.679  1.00 18.76 ? 327  ILE B CG1 1 
ATOM   7012 C CG2 . ILE B 1 328 ? 19.791  -18.934 18.496  1.00 19.84 ? 327  ILE B CG2 1 
ATOM   7013 C CD1 . ILE B 1 328 ? 18.706  -16.257 19.815  1.00 18.10 ? 327  ILE B CD1 1 
ATOM   7014 N N   . ASN B 1 329 ? 17.536  -21.560 18.687  1.00 21.01 ? 328  ASN B N   1 
ATOM   7015 C CA  . ASN B 1 329 ? 18.051  -22.929 18.735  1.00 21.52 ? 328  ASN B CA  1 
ATOM   7016 C C   . ASN B 1 329 ? 17.109  -24.010 18.232  1.00 22.39 ? 328  ASN B C   1 
ATOM   7017 O O   . ASN B 1 329 ? 17.542  -25.143 18.011  1.00 22.73 ? 328  ASN B O   1 
ATOM   7018 C CB  . ASN B 1 329 ? 18.481  -23.266 20.159  1.00 21.20 ? 328  ASN B CB  1 
ATOM   7019 C CG  . ASN B 1 329 ? 19.667  -22.449 20.620  1.00 20.31 ? 328  ASN B CG  1 
ATOM   7020 O OD1 . ASN B 1 329 ? 19.554  -21.690 21.560  1.00 21.19 ? 328  ASN B OD1 1 
ATOM   7021 N ND2 . ASN B 1 329 ? 20.807  -22.600 19.949  1.00 20.26 ? 328  ASN B ND2 1 
ATOM   7022 N N   . CYS B 1 330 ? 15.825  -23.697 18.098  1.00 22.18 ? 329  CYS B N   1 
ATOM   7023 C CA  . CYS B 1 330 ? 14.887  -24.666 17.522  1.00 22.96 ? 329  CYS B CA  1 
ATOM   7024 C C   . CYS B 1 330 ? 14.479  -24.291 16.101  1.00 22.99 ? 329  CYS B C   1 
ATOM   7025 O O   . CYS B 1 330 ? 14.569  -25.124 15.199  1.00 23.87 ? 329  CYS B O   1 
ATOM   7026 C CB  . CYS B 1 330 ? 13.678  -24.901 18.439  1.00 22.79 ? 329  CYS B CB  1 
ATOM   7027 S SG  . CYS B 1 330 ? 14.147  -25.481 20.099  1.00 24.78 ? 329  CYS B SG  1 
ATOM   7028 N N   . TYR B 1 331 ? 14.075  -23.036 15.886  1.00 22.35 ? 330  TYR B N   1 
ATOM   7029 C CA  . TYR B 1 331 ? 13.705  -22.562 14.541  1.00 21.76 ? 330  TYR B CA  1 
ATOM   7030 C C   . TYR B 1 331 ? 14.880  -22.108 13.647  1.00 21.75 ? 330  TYR B C   1 
ATOM   7031 O O   . TYR B 1 331 ? 14.725  -22.001 12.424  1.00 22.45 ? 330  TYR B O   1 
ATOM   7032 C CB  . TYR B 1 331 ? 12.680  -21.424 14.628  1.00 22.00 ? 330  TYR B CB  1 
ATOM   7033 C CG  . TYR B 1 331 ? 11.271  -21.859 14.949  1.00 21.31 ? 330  TYR B CG  1 
ATOM   7034 C CD1 . TYR B 1 331 ? 10.816  -21.847 16.258  1.00 22.44 ? 330  TYR B CD1 1 
ATOM   7035 C CD2 . TYR B 1 331 ? 10.384  -22.242 13.938  1.00 22.38 ? 330  TYR B CD2 1 
ATOM   7036 C CE1 . TYR B 1 331 ? 9.521   -22.219 16.565  1.00 24.04 ? 330  TYR B CE1 1 
ATOM   7037 C CE2 . TYR B 1 331 ? 9.075   -22.606 14.234  1.00 24.26 ? 330  TYR B CE2 1 
ATOM   7038 C CZ  . TYR B 1 331 ? 8.661   -22.591 15.549  1.00 24.42 ? 330  TYR B CZ  1 
ATOM   7039 O OH  . TYR B 1 331 ? 7.378   -22.959 15.856  1.00 28.50 ? 330  TYR B OH  1 
ATOM   7040 N N   . GLY B 1 332 ? 16.029  -21.823 14.261  1.00 21.62 ? 331  GLY B N   1 
ATOM   7041 C CA  . GLY B 1 332 ? 17.233  -21.432 13.544  1.00 21.07 ? 331  GLY B CA  1 
ATOM   7042 C C   . GLY B 1 332 ? 17.238  -20.001 13.028  1.00 21.02 ? 331  GLY B C   1 
ATOM   7043 O O   . GLY B 1 332 ? 17.889  -19.698 12.017  1.00 21.24 ? 331  GLY B O   1 
ATOM   7044 N N   . CYS B 1 333 ? 16.519  -19.118 13.716  1.00 20.03 ? 332  CYS B N   1 
ATOM   7045 C CA  . CYS B 1 333 ? 16.450  -17.707 13.306  1.00 19.08 ? 332  CYS B CA  1 
ATOM   7046 C C   . CYS B 1 333 ? 17.731  -16.978 13.644  1.00 18.28 ? 332  CYS B C   1 
ATOM   7047 O O   . CYS B 1 333 ? 18.122  -16.898 14.817  1.00 19.24 ? 332  CYS B O   1 
ATOM   7048 C CB  . CYS B 1 333 ? 15.255  -16.988 13.949  1.00 19.02 ? 332  CYS B CB  1 
ATOM   7049 S SG  . CYS B 1 333 ? 13.652  -17.713 13.546  1.00 19.32 ? 332  CYS B SG  1 
ATOM   7050 N N   . GLU B 1 334 ? 18.378  -16.432 12.613  1.00 17.74 ? 333  GLU B N   1 
ATOM   7051 C CA  . GLU B 1 334 ? 19.644  -15.717 12.780  1.00 17.60 ? 333  GLU B CA  1 
ATOM   7052 C C   . GLU B 1 334 ? 19.501  -14.371 13.466  1.00 17.55 ? 333  GLU B C   1 
ATOM   7053 O O   . GLU B 1 334 ? 20.439  -13.908 14.092  1.00 16.49 ? 333  GLU B O   1 
ATOM   7054 C CB  . GLU B 1 334 ? 20.334  -15.472 11.432  1.00 17.55 ? 333  GLU B CB  1 
ATOM   7055 C CG  . GLU B 1 334 ? 21.045  -16.687 10.855  1.00 17.69 ? 333  GLU B CG  1 
ATOM   7056 C CD  . GLU B 1 334 ? 21.993  -16.288 9.739   1.00 20.31 ? 333  GLU B CD  1 
ATOM   7057 O OE1 . GLU B 1 334 ? 22.486  -15.151 9.809   1.00 19.76 ? 333  GLU B OE1 1 
ATOM   7058 O OE2 . GLU B 1 334 ? 22.228  -17.074 8.787   1.00 19.40 ? 333  GLU B OE2 1 
ATOM   7059 N N   . THR B 1 335 ? 18.343  -13.744 13.312  1.00 16.84 ? 334  THR B N   1 
ATOM   7060 C CA  . THR B 1 335 ? 18.204  -12.343 13.711  1.00 17.24 ? 334  THR B CA  1 
ATOM   7061 C C   . THR B 1 335 ? 17.074  -12.094 14.676  1.00 17.32 ? 334  THR B C   1 
ATOM   7062 O O   . THR B 1 335 ? 16.204  -12.930 14.873  1.00 17.50 ? 334  THR B O   1 
ATOM   7063 C CB  . THR B 1 335 ? 18.047  -11.378 12.476  1.00 16.87 ? 334  THR B CB  1 
ATOM   7064 O OG1 . THR B 1 335 ? 16.696  -11.396 11.965  1.00 18.10 ? 334  THR B OG1 1 
ATOM   7065 C CG2 . THR B 1 335 ? 18.914  -11.818 11.316  1.00 17.36 ? 334  THR B CG2 1 
ATOM   7066 N N   . HIS B 1 336 ? 17.120  -10.911 15.272  1.00 17.92 ? 335  HIS B N   1 
ATOM   7067 C CA  . HIS B 1 336 ? 16.077  -10.450 16.176  1.00 17.55 ? 335  HIS B CA  1 
ATOM   7068 C C   . HIS B 1 336 ? 15.921  -8.958  15.892  1.00 17.34 ? 335  HIS B C   1 
ATOM   7069 O O   . HIS B 1 336 ? 16.901  -8.220  15.942  1.00 16.87 ? 335  HIS B O   1 
ATOM   7070 C CB  . HIS B 1 336 ? 16.531  -10.671 17.616  1.00 18.03 ? 335  HIS B CB  1 
ATOM   7071 C CG  . HIS B 1 336 ? 15.520  -10.257 18.630  1.00 20.11 ? 335  HIS B CG  1 
ATOM   7072 N ND1 . HIS B 1 336 ? 14.391  -10.999 18.893  1.00 22.16 ? 335  HIS B ND1 1 
ATOM   7073 C CD2 . HIS B 1 336 ? 15.446  -9.159  19.417  1.00 22.13 ? 335  HIS B CD2 1 
ATOM   7074 C CE1 . HIS B 1 336 ? 13.670  -10.382 19.814  1.00 22.75 ? 335  HIS B CE1 1 
ATOM   7075 N NE2 . HIS B 1 336 ? 14.285  -9.260  20.142  1.00 22.47 ? 335  HIS B NE2 1 
ATOM   7076 N N   . ALA B 1 337 ? 14.707  -8.526  15.570  1.00 17.03 ? 336  ALA B N   1 
ATOM   7077 C CA  . ALA B 1 337 ? 14.472  -7.112  15.253  1.00 17.21 ? 336  ALA B CA  1 
ATOM   7078 C C   . ALA B 1 337 ? 13.862  -6.371  16.423  1.00 18.02 ? 336  ALA B C   1 
ATOM   7079 O O   . ALA B 1 337 ? 12.909  -6.857  17.037  1.00 17.10 ? 336  ALA B O   1 
ATOM   7080 C CB  . ALA B 1 337 ? 13.593  -6.974  14.023  1.00 17.96 ? 336  ALA B CB  1 
ATOM   7081 N N   . LEU B 1 338 ? 14.403  -5.177  16.699  1.00 18.07 ? 337  LEU B N   1 
ATOM   7082 C CA  . LEU B 1 338 ? 13.865  -4.273  17.711  1.00 18.06 ? 337  LEU B CA  1 
ATOM   7083 C C   . LEU B 1 338 ? 13.259  -3.092  16.968  1.00 17.77 ? 337  LEU B C   1 
ATOM   7084 O O   . LEU B 1 338 ? 13.962  -2.355  16.266  1.00 16.84 ? 337  LEU B O   1 
ATOM   7085 C CB  . LEU B 1 338 ? 14.946  -3.813  18.713  1.00 18.41 ? 337  LEU B CB  1 
ATOM   7086 C CG  . LEU B 1 338 ? 15.671  -4.895  19.526  1.00 19.07 ? 337  LEU B CG  1 
ATOM   7087 C CD1 . LEU B 1 338 ? 16.849  -4.311  20.315  1.00 19.96 ? 337  LEU B CD1 1 
ATOM   7088 C CD2 . LEU B 1 338 ? 14.702  -5.576  20.484  1.00 20.28 ? 337  LEU B CD2 1 
ATOM   7089 N N   . LEU B 1 339 ? 11.942  -2.936  17.122  1.00 16.94 ? 338  LEU B N   1 
ATOM   7090 C CA  . LEU B 1 339 ? 11.170  -1.988  16.342  1.00 17.27 ? 338  LEU B CA  1 
ATOM   7091 C C   . LEU B 1 339 ? 10.387  -1.048  17.250  1.00 17.04 ? 338  LEU B C   1 
ATOM   7092 O O   . LEU B 1 339 ? 9.180   -1.230  17.456  1.00 16.34 ? 338  LEU B O   1 
ATOM   7093 C CB  . LEU B 1 339 ? 10.230  -2.747  15.369  1.00 16.68 ? 338  LEU B CB  1 
ATOM   7094 C CG  . LEU B 1 339 ? 10.934  -3.710  14.396  1.00 17.67 ? 338  LEU B CG  1 
ATOM   7095 C CD1 . LEU B 1 339 ? 9.942   -4.585  13.612  1.00 15.63 ? 338  LEU B CD1 1 
ATOM   7096 C CD2 . LEU B 1 339 ? 11.934  -2.993  13.450  1.00 15.89 ? 338  LEU B CD2 1 
ATOM   7097 N N   . PRO B 1 340 ? 11.067  -0.045  17.803  1.00 17.54 ? 339  PRO B N   1 
ATOM   7098 C CA  . PRO B 1 340 ? 10.404  0.917   18.689  1.00 17.30 ? 339  PRO B CA  1 
ATOM   7099 C C   . PRO B 1 340 ? 9.610   1.943   17.878  1.00 17.28 ? 339  PRO B C   1 
ATOM   7100 O O   . PRO B 1 340 ? 10.170  2.565   16.981  1.00 17.44 ? 339  PRO B O   1 
ATOM   7101 C CB  . PRO B 1 340 ? 11.568  1.565   19.460  1.00 17.89 ? 339  PRO B CB  1 
ATOM   7102 C CG  . PRO B 1 340 ? 12.781  1.393   18.594  1.00 18.19 ? 339  PRO B CG  1 
ATOM   7103 C CD  . PRO B 1 340 ? 12.515  0.234   17.653  1.00 17.42 ? 339  PRO B CD  1 
ATOM   7104 N N   . TYR B 1 341 ? 8.316   2.082   18.168  1.00 16.12 ? 340  TYR B N   1 
ATOM   7105 C CA  . TYR B 1 341 ? 7.463   3.032   17.467  1.00 15.87 ? 340  TYR B CA  1 
ATOM   7106 C C   . TYR B 1 341 ? 7.580   4.373   18.169  1.00 16.15 ? 340  TYR B C   1 
ATOM   7107 O O   . TYR B 1 341 ? 6.622   4.875   18.758  1.00 16.32 ? 340  TYR B O   1 
ATOM   7108 C CB  . TYR B 1 341 ? 6.015   2.497   17.417  1.00 15.85 ? 340  TYR B CB  1 
ATOM   7109 C CG  . TYR B 1 341 ? 5.834   1.606   16.201  1.00 15.23 ? 340  TYR B CG  1 
ATOM   7110 C CD1 . TYR B 1 341 ? 6.626   0.459   16.027  1.00 13.50 ? 340  TYR B CD1 1 
ATOM   7111 C CD2 . TYR B 1 341 ? 4.931   1.942   15.204  1.00 16.03 ? 340  TYR B CD2 1 
ATOM   7112 C CE1 . TYR B 1 341 ? 6.506   -0.324  14.905  1.00 15.67 ? 340  TYR B CE1 1 
ATOM   7113 C CE2 . TYR B 1 341 ? 4.799   1.158   14.072  1.00 17.77 ? 340  TYR B CE2 1 
ATOM   7114 C CZ  . TYR B 1 341 ? 5.594   0.031   13.927  1.00 17.80 ? 340  TYR B CZ  1 
ATOM   7115 O OH  . TYR B 1 341 ? 5.506   -0.752  12.818  1.00 16.26 ? 340  TYR B OH  1 
ATOM   7116 N N   . ASP B 1 342 ? 8.789   4.922   18.127  1.00 16.29 ? 341  ASP B N   1 
ATOM   7117 C CA  . ASP B 1 342 ? 9.118   6.108   18.888  1.00 16.54 ? 341  ASP B CA  1 
ATOM   7118 C C   . ASP B 1 342 ? 10.383  6.688   18.299  1.00 17.47 ? 341  ASP B C   1 
ATOM   7119 O O   . ASP B 1 342 ? 11.447  6.051   18.311  1.00 16.15 ? 341  ASP B O   1 
ATOM   7120 C CB  . ASP B 1 342 ? 9.352   5.752   20.362  1.00 16.53 ? 341  ASP B CB  1 
ATOM   7121 C CG  . ASP B 1 342 ? 9.576   6.974   21.211  1.00 18.31 ? 341  ASP B CG  1 
ATOM   7122 O OD1 . ASP B 1 342 ? 8.580   7.566   21.690  1.00 17.36 ? 341  ASP B OD1 1 
ATOM   7123 O OD2 . ASP B 1 342 ? 10.718  7.421   21.421  1.00 17.57 ? 341  ASP B OD2 1 
ATOM   7124 N N   . GLN B 1 343 ? 10.259  7.899   17.771  1.00 17.79 ? 342  GLN B N   1 
ATOM   7125 C CA  . GLN B 1 343 ? 11.370  8.571   17.113  1.00 19.12 ? 342  GLN B CA  1 
ATOM   7126 C C   . GLN B 1 343 ? 12.486  8.903   18.095  1.00 18.79 ? 342  GLN B C   1 
ATOM   7127 O O   . GLN B 1 343 ? 13.655  8.851   17.733  1.00 19.68 ? 342  GLN B O   1 
ATOM   7128 C CB  . GLN B 1 343 ? 10.864  9.828   16.373  1.00 19.17 ? 342  GLN B CB  1 
ATOM   7129 C CG  . GLN B 1 343 ? 11.835  10.390  15.333  1.00 21.73 ? 342  GLN B CG  1 
ATOM   7130 C CD  . GLN B 1 343 ? 12.286  9.391   14.282  1.00 23.11 ? 342  GLN B CD  1 
ATOM   7131 O OE1 . GLN B 1 343 ? 11.515  8.549   13.820  1.00 22.24 ? 342  GLN B OE1 1 
ATOM   7132 N NE2 . GLN B 1 343 ? 13.548  9.491   13.896  1.00 25.67 ? 342  GLN B NE2 1 
ATOM   7133 N N   . TYR B 1 344 ? 12.130  9.218   19.342  1.00 18.42 ? 343  TYR B N   1 
ATOM   7134 C CA  . TYR B 1 344 ? 13.130  9.450   20.390  1.00 18.14 ? 343  TYR B CA  1 
ATOM   7135 C C   . TYR B 1 344 ? 14.007  8.217   20.645  1.00 17.39 ? 343  TYR B C   1 
ATOM   7136 O O   . TYR B 1 344 ? 15.189  8.339   20.895  1.00 16.39 ? 343  TYR B O   1 
ATOM   7137 C CB  . TYR B 1 344 ? 12.473  9.918   21.691  1.00 18.14 ? 343  TYR B CB  1 
ATOM   7138 C CG  . TYR B 1 344 ? 12.108  11.395  21.698  1.00 20.04 ? 343  TYR B CG  1 
ATOM   7139 C CD1 . TYR B 1 344 ? 10.868  11.823  22.181  1.00 20.58 ? 343  TYR B CD1 1 
ATOM   7140 C CD2 . TYR B 1 344 ? 13.018  12.366  21.251  1.00 19.72 ? 343  TYR B CD2 1 
ATOM   7141 C CE1 . TYR B 1 344 ? 10.527  13.192  22.188  1.00 19.18 ? 343  TYR B CE1 1 
ATOM   7142 C CE2 . TYR B 1 344 ? 12.697  13.726  21.266  1.00 20.25 ? 343  TYR B CE2 1 
ATOM   7143 C CZ  . TYR B 1 344 ? 11.450  14.132  21.738  1.00 21.19 ? 343  TYR B CZ  1 
ATOM   7144 O OH  . TYR B 1 344 ? 11.137  15.480  21.755  1.00 20.77 ? 343  TYR B OH  1 
ATOM   7145 N N   . MET B 1 345 ? 13.407  7.035   20.538  1.00 17.22 ? 344  MET B N   1 
ATOM   7146 C CA  . MET B 1 345 ? 14.137  5.778   20.701  1.00 16.92 ? 344  MET B CA  1 
ATOM   7147 C C   . MET B 1 345 ? 14.894  5.339   19.424  1.00 17.24 ? 344  MET B C   1 
ATOM   7148 O O   . MET B 1 345 ? 15.190  4.151   19.266  1.00 17.53 ? 344  MET B O   1 
ATOM   7149 C CB  . MET B 1 345 ? 13.173  4.666   21.125  1.00 17.49 ? 344  MET B CB  1 
ATOM   7150 C CG  . MET B 1 345 ? 12.604  4.811   22.527  1.00 17.49 ? 344  MET B CG  1 
ATOM   7151 S SD  . MET B 1 345 ? 11.329  3.578   22.855  1.00 19.45 ? 344  MET B SD  1 
ATOM   7152 C CE  . MET B 1 345 ? 12.369  2.190   23.392  1.00 19.31 ? 344  MET B CE  1 
ATOM   7153 N N   . HIS B 1 346 ? 15.230  6.271   18.530  1.00 17.33 ? 345  HIS B N   1 
ATOM   7154 C CA  . HIS B 1 346 ? 15.792  5.883   17.229  1.00 18.02 ? 345  HIS B CA  1 
ATOM   7155 C C   . HIS B 1 346 ? 17.158  5.185   17.301  1.00 17.94 ? 345  HIS B C   1 
ATOM   7156 O O   . HIS B 1 346 ? 17.574  4.544   16.329  1.00 19.15 ? 345  HIS B O   1 
ATOM   7157 C CB  . HIS B 1 346 ? 15.817  7.060   16.238  1.00 17.93 ? 345  HIS B CB  1 
ATOM   7158 C CG  . HIS B 1 346 ? 16.856  8.095   16.535  1.00 17.66 ? 345  HIS B CG  1 
ATOM   7159 N ND1 . HIS B 1 346 ? 16.793  8.931   17.629  1.00 20.29 ? 345  HIS B ND1 1 
ATOM   7160 C CD2 . HIS B 1 346 ? 17.980  8.436   15.870  1.00 17.56 ? 345  HIS B CD2 1 
ATOM   7161 C CE1 . HIS B 1 346 ? 17.835  9.745   17.622  1.00 16.33 ? 345  HIS B CE1 1 
ATOM   7162 N NE2 . HIS B 1 346 ? 18.576  9.457   16.571  1.00 22.40 ? 345  HIS B NE2 1 
ATOM   7163 N N   . ARG B 1 347 ? 17.841  5.273   18.447  1.00 17.15 ? 346  ARG B N   1 
ATOM   7164 C CA  . ARG B 1 347 ? 19.150  4.608   18.601  1.00 17.77 ? 346  ARG B CA  1 
ATOM   7165 C C   . ARG B 1 347 ? 19.106  3.424   19.584  1.00 17.69 ? 346  ARG B C   1 
ATOM   7166 O O   . ARG B 1 347 ? 20.149  2.880   19.964  1.00 18.38 ? 346  ARG B O   1 
ATOM   7167 C CB  . ARG B 1 347 ? 20.246  5.610   19.001  1.00 17.37 ? 346  ARG B CB  1 
ATOM   7168 C CG  . ARG B 1 347 ? 20.448  6.765   18.004  1.00 17.97 ? 346  ARG B CG  1 
ATOM   7169 C CD  . ARG B 1 347 ? 20.593  6.335   16.528  1.00 22.16 ? 346  ARG B CD  1 
ATOM   7170 N NE  . ARG B 1 347 ? 21.847  5.613   16.319  1.00 22.11 ? 346  ARG B NE  1 
ATOM   7171 C CZ  . ARG B 1 347 ? 22.104  4.776   15.317  1.00 22.71 ? 346  ARG B CZ  1 
ATOM   7172 N NH1 . ARG B 1 347 ? 21.201  4.527   14.373  1.00 24.10 ? 346  ARG B NH1 1 
ATOM   7173 N NH2 . ARG B 1 347 ? 23.288  4.180   15.260  1.00 21.57 ? 346  ARG B NH2 1 
ATOM   7174 N N   . PHE B 1 348 ? 17.891  3.012   19.940  1.00 17.63 ? 347  PHE B N   1 
ATOM   7175 C CA  . PHE B 1 348 ? 17.652  1.903   20.853  1.00 18.74 ? 347  PHE B CA  1 
ATOM   7176 C C   . PHE B 1 348 ? 18.157  0.583   20.272  1.00 18.69 ? 347  PHE B C   1 
ATOM   7177 O O   . PHE B 1 348 ? 18.887  -0.168  20.938  1.00 18.94 ? 347  PHE B O   1 
ATOM   7178 C CB  . PHE B 1 348 ? 16.150  1.833   21.191  1.00 18.29 ? 347  PHE B CB  1 
ATOM   7179 C CG  . PHE B 1 348 ? 15.817  0.916   22.349  1.00 19.75 ? 347  PHE B CG  1 
ATOM   7180 C CD1 . PHE B 1 348 ? 15.962  1.345   23.669  1.00 20.56 ? 347  PHE B CD1 1 
ATOM   7181 C CD2 . PHE B 1 348 ? 15.325  -0.363  22.110  1.00 20.83 ? 347  PHE B CD2 1 
ATOM   7182 C CE1 . PHE B 1 348 ? 15.637  0.492   24.738  1.00 21.41 ? 347  PHE B CE1 1 
ATOM   7183 C CE2 . PHE B 1 348 ? 15.003  -1.214  23.168  1.00 21.30 ? 347  PHE B CE2 1 
ATOM   7184 C CZ  . PHE B 1 348 ? 15.160  -0.781  24.479  1.00 22.15 ? 347  PHE B CZ  1 
ATOM   7185 N N   . ALA B 1 349 ? 17.824  0.328   19.007  1.00 19.32 ? 348  ALA B N   1 
ATOM   7186 C CA  . ALA B 1 349 ? 18.303  -0.872  18.312  1.00 19.27 ? 348  ALA B CA  1 
ATOM   7187 C C   . ALA B 1 349 ? 19.824  -0.931  18.226  1.00 19.39 ? 348  ALA B C   1 
ATOM   7188 O O   . ALA B 1 349 ? 20.433  -1.972  18.498  1.00 19.25 ? 348  ALA B O   1 
ATOM   7189 C CB  . ALA B 1 349 ? 17.680  -0.956  16.910  1.00 20.03 ? 348  ALA B CB  1 
ATOM   7190 N N   . ALA B 1 350 ? 20.444  0.184   17.837  1.00 19.25 ? 349  ALA B N   1 
ATOM   7191 C CA  . ALA B 1 350 ? 21.907  0.246   17.743  1.00 19.19 ? 349  ALA B CA  1 
ATOM   7192 C C   . ALA B 1 350 ? 22.580  -0.017  19.085  1.00 19.10 ? 349  ALA B C   1 
ATOM   7193 O O   . ALA B 1 350 ? 23.637  -0.652  19.127  1.00 19.30 ? 349  ALA B O   1 
ATOM   7194 C CB  . ALA B 1 350 ? 22.371  1.579   17.165  1.00 19.06 ? 349  ALA B CB  1 
ATOM   7195 N N   . TYR B 1 351 ? 21.980  0.478   20.174  1.00 18.85 ? 350  TYR B N   1 
ATOM   7196 C CA  . TYR B 1 351 ? 22.518  0.246   21.504  1.00 18.95 ? 350  TYR B CA  1 
ATOM   7197 C C   . TYR B 1 351 ? 22.581  -1.249  21.814  1.00 18.97 ? 350  TYR B C   1 
ATOM   7198 O O   . TYR B 1 351 ? 23.606  -1.764  22.275  1.00 19.31 ? 350  TYR B O   1 
ATOM   7199 C CB  . TYR B 1 351 ? 21.678  0.929   22.582  1.00 18.37 ? 350  TYR B CB  1 
ATOM   7200 C CG  . TYR B 1 351 ? 22.204  0.667   23.965  1.00 19.76 ? 350  TYR B CG  1 
ATOM   7201 C CD1 . TYR B 1 351 ? 23.305  1.368   24.447  1.00 19.15 ? 350  TYR B CD1 1 
ATOM   7202 C CD2 . TYR B 1 351 ? 21.622  -0.297  24.788  1.00 18.64 ? 350  TYR B CD2 1 
ATOM   7203 C CE1 . TYR B 1 351 ? 23.805  1.119   25.715  1.00 19.18 ? 350  TYR B CE1 1 
ATOM   7204 C CE2 . TYR B 1 351 ? 22.102  -0.541  26.067  1.00 19.13 ? 350  TYR B CE2 1 
ATOM   7205 C CZ  . TYR B 1 351 ? 23.202  0.171   26.513  1.00 20.97 ? 350  TYR B CZ  1 
ATOM   7206 O OH  . TYR B 1 351 ? 23.709  -0.061  27.755  1.00 21.37 ? 350  TYR B OH  1 
ATOM   7207 N N   . PHE B 1 352 ? 21.478  -1.931  21.553  1.00 19.47 ? 351  PHE B N   1 
ATOM   7208 C CA  . PHE B 1 352 ? 21.428  -3.353  21.843  1.00 19.72 ? 351  PHE B CA  1 
ATOM   7209 C C   . PHE B 1 352 ? 22.135  -4.229  20.840  1.00 20.42 ? 351  PHE B C   1 
ATOM   7210 O O   . PHE B 1 352 ? 22.267  -5.438  21.059  1.00 20.42 ? 351  PHE B O   1 
ATOM   7211 C CB  . PHE B 1 352 ? 19.995  -3.773  22.192  1.00 20.22 ? 351  PHE B CB  1 
ATOM   7212 C CG  . PHE B 1 352 ? 19.656  -3.448  23.613  1.00 20.83 ? 351  PHE B CG  1 
ATOM   7213 C CD1 . PHE B 1 352 ? 18.761  -2.430  23.931  1.00 21.94 ? 351  PHE B CD1 1 
ATOM   7214 C CD2 . PHE B 1 352 ? 20.320  -4.106  24.648  1.00 21.94 ? 351  PHE B CD2 1 
ATOM   7215 C CE1 . PHE B 1 352 ? 18.491  -2.121  25.252  1.00 21.05 ? 351  PHE B CE1 1 
ATOM   7216 C CE2 . PHE B 1 352 ? 20.065  -3.793  25.961  1.00 22.62 ? 351  PHE B CE2 1 
ATOM   7217 C CZ  . PHE B 1 352 ? 19.142  -2.799  26.267  1.00 21.05 ? 351  PHE B CZ  1 
ATOM   7218 N N   . GLN B 1 353 ? 22.641  -3.626  19.761  1.00 21.36 ? 352  GLN B N   1 
ATOM   7219 C CA  . GLN B 1 353 ? 23.566  -4.343  18.902  1.00 21.80 ? 352  GLN B CA  1 
ATOM   7220 C C   . GLN B 1 353 ? 24.824  -4.648  19.672  1.00 22.58 ? 352  GLN B C   1 
ATOM   7221 O O   . GLN B 1 353 ? 25.255  -5.798  19.671  1.00 22.75 ? 352  GLN B O   1 
ATOM   7222 C CB  . GLN B 1 353 ? 23.878  -3.594  17.608  1.00 22.18 ? 352  GLN B CB  1 
ATOM   7223 C CG  . GLN B 1 353 ? 22.759  -3.656  16.617  1.00 20.80 ? 352  GLN B CG  1 
ATOM   7224 C CD  . GLN B 1 353 ? 23.197  -3.168  15.248  1.00 19.98 ? 352  GLN B CD  1 
ATOM   7225 O OE1 . GLN B 1 353 ? 23.933  -2.182  15.146  1.00 19.72 ? 352  GLN B OE1 1 
ATOM   7226 N NE2 . GLN B 1 353 ? 22.725  -3.836  14.200  1.00 16.86 ? 352  GLN B NE2 1 
ATOM   7227 N N   . GLN B 1 354 ? 25.396  -3.649  20.363  1.00 22.49 ? 353  GLN B N   1 
ATOM   7228 C CA  . GLN B 1 354 ? 26.524  -3.919  21.257  1.00 22.71 ? 353  GLN B CA  1 
ATOM   7229 C C   . GLN B 1 354 ? 26.109  -4.749  22.462  1.00 22.84 ? 353  GLN B C   1 
ATOM   7230 O O   . GLN B 1 354 ? 26.762  -5.752  22.782  1.00 22.74 ? 353  GLN B O   1 
ATOM   7231 C CB  . GLN B 1 354 ? 27.248  -2.649  21.749  1.00 22.56 ? 353  GLN B CB  1 
ATOM   7232 C CG  . GLN B 1 354 ? 28.595  -2.999  22.437  1.00 24.06 ? 353  GLN B CG  1 
ATOM   7233 C CD  . GLN B 1 354 ? 29.374  -1.810  22.960  1.00 26.08 ? 353  GLN B CD  1 
ATOM   7234 O OE1 . GLN B 1 354 ? 28.879  -0.688  22.965  1.00 26.62 ? 353  GLN B OE1 1 
ATOM   7235 N NE2 . GLN B 1 354 ? 30.604  -2.064  23.422  1.00 26.04 ? 353  GLN B NE2 1 
ATOM   7236 N N   . GLY B 1 355 ? 25.020  -4.348  23.120  1.00 21.43 ? 354  GLY B N   1 
ATOM   7237 C CA  . GLY B 1 355 ? 24.639  -4.963  24.383  1.00 21.16 ? 354  GLY B CA  1 
ATOM   7238 C C   . GLY B 1 355 ? 24.420  -6.460  24.234  1.00 21.00 ? 354  GLY B C   1 
ATOM   7239 O O   . GLY B 1 355 ? 24.883  -7.278  25.054  1.00 21.22 ? 354  GLY B O   1 
ATOM   7240 N N   . ASP B 1 356 ? 23.715  -6.808  23.168  1.00 19.77 ? 355  ASP B N   1 
ATOM   7241 C CA  . ASP B 1 356 ? 23.406  -8.184  22.833  1.00 19.35 ? 355  ASP B CA  1 
ATOM   7242 C C   . ASP B 1 356 ? 24.559  -8.871  22.084  1.00 18.87 ? 355  ASP B C   1 
ATOM   7243 O O   . ASP B 1 356 ? 25.084  -9.903  22.543  1.00 18.14 ? 355  ASP B O   1 
ATOM   7244 C CB  . ASP B 1 356 ? 22.112  -8.220  22.005  1.00 18.95 ? 355  ASP B CB  1 
ATOM   7245 C CG  . ASP B 1 356 ? 21.431  -9.580  22.015  1.00 19.41 ? 355  ASP B CG  1 
ATOM   7246 O OD1 . ASP B 1 356 ? 22.121  -10.630 22.055  1.00 19.71 ? 355  ASP B OD1 1 
ATOM   7247 O OD2 . ASP B 1 356 ? 20.187  -9.686  21.980  1.00 19.39 ? 355  ASP B OD2 1 
ATOM   7248 N N   . MET B 1 357 ? 24.973  -8.314  20.944  1.00 18.84 ? 356  MET B N   1 
ATOM   7249 C CA  . MET B 1 357 ? 25.894  -9.042  20.068  1.00 19.09 ? 356  MET B CA  1 
ATOM   7250 C C   . MET B 1 357 ? 27.307  -9.184  20.620  1.00 18.74 ? 356  MET B C   1 
ATOM   7251 O O   . MET B 1 357 ? 27.939  -10.231 20.456  1.00 18.39 ? 356  MET B O   1 
ATOM   7252 C CB  . MET B 1 357 ? 25.910  -8.470  18.650  1.00 18.55 ? 356  MET B CB  1 
ATOM   7253 C CG  . MET B 1 357 ? 24.529  -8.477  17.977  1.00 18.30 ? 356  MET B CG  1 
ATOM   7254 S SD  . MET B 1 357 ? 24.491  -7.629  16.416  1.00 18.46 ? 356  MET B SD  1 
ATOM   7255 C CE  . MET B 1 357 ? 25.573  -8.711  15.363  1.00 17.91 ? 356  MET B CE  1 
ATOM   7256 N N   . GLU B 1 358 ? 27.813  -8.141  21.270  1.00 18.39 ? 357  GLU B N   1 
ATOM   7257 C CA  . GLU B 1 358 ? 29.142  -8.232  21.855  1.00 19.38 ? 357  GLU B CA  1 
ATOM   7258 C C   . GLU B 1 358 ? 29.120  -9.112  23.113  1.00 19.56 ? 357  GLU B C   1 
ATOM   7259 O O   . GLU B 1 358 ? 30.139  -9.695  23.481  1.00 20.21 ? 357  GLU B O   1 
ATOM   7260 C CB  . GLU B 1 358 ? 29.691  -6.846  22.183  1.00 19.53 ? 357  GLU B CB  1 
ATOM   7261 C CG  . GLU B 1 358 ? 31.146  -6.880  22.609  1.00 20.12 ? 357  GLU B CG  1 
ATOM   7262 C CD  . GLU B 1 358 ? 31.738  -5.503  22.716  1.00 22.42 ? 357  GLU B CD  1 
ATOM   7263 O OE1 . GLU B 1 358 ? 32.427  -5.102  21.765  1.00 26.86 ? 357  GLU B OE1 1 
ATOM   7264 O OE2 . GLU B 1 358 ? 31.504  -4.831  23.740  1.00 21.64 ? 357  GLU B OE2 1 
ATOM   7265 N N   . SER B 1 359 ? 27.958  -9.219  23.753  1.00 18.66 ? 358  SER B N   1 
ATOM   7266 C CA  . SER B 1 359 ? 27.815  -10.077 24.926  1.00 18.73 ? 358  SER B CA  1 
ATOM   7267 C C   . SER B 1 359 ? 27.772  -11.536 24.528  1.00 18.86 ? 358  SER B C   1 
ATOM   7268 O O   . SER B 1 359 ? 28.551  -12.356 25.038  1.00 19.47 ? 358  SER B O   1 
ATOM   7269 C CB  . SER B 1 359 ? 26.541  -9.738  25.711  1.00 18.73 ? 358  SER B CB  1 
ATOM   7270 O OG  . SER B 1 359 ? 26.716  -8.550  26.463  1.00 19.16 ? 358  SER B OG  1 
ATOM   7271 N N   . ASN B 1 360 ? 26.854  -11.863 23.621  1.00 18.22 ? 359  ASN B N   1 
ATOM   7272 C CA  . ASN B 1 360 ? 26.542  -13.256 23.355  1.00 17.64 ? 359  ASN B CA  1 
ATOM   7273 C C   . ASN B 1 360 ? 27.025  -13.787 22.004  1.00 17.48 ? 359  ASN B C   1 
ATOM   7274 O O   . ASN B 1 360 ? 26.772  -14.948 21.663  1.00 17.58 ? 359  ASN B O   1 
ATOM   7275 C CB  . ASN B 1 360 ? 25.060  -13.504 23.611  1.00 16.99 ? 359  ASN B CB  1 
ATOM   7276 C CG  . ASN B 1 360 ? 24.712  -13.402 25.089  1.00 17.94 ? 359  ASN B CG  1 
ATOM   7277 O OD1 . ASN B 1 360 ? 25.601  -13.363 25.934  1.00 20.77 ? 359  ASN B OD1 1 
ATOM   7278 N ND2 . ASN B 1 360 ? 23.420  -13.331 25.407  1.00 18.36 ? 359  ASN B ND2 1 
ATOM   7279 N N   . GLY B 1 361 ? 27.747  -12.948 21.264  1.00 17.47 ? 360  GLY B N   1 
ATOM   7280 C CA  . GLY B 1 361 ? 28.444  -13.389 20.062  1.00 18.34 ? 360  GLY B CA  1 
ATOM   7281 C C   . GLY B 1 361 ? 29.685  -14.204 20.419  1.00 18.77 ? 360  GLY B C   1 
ATOM   7282 O O   . GLY B 1 361 ? 30.830  -13.746 20.238  1.00 18.20 ? 360  GLY B O   1 
ATOM   7283 N N   . LYS B 1 362 ? 29.449  -15.409 20.942  1.00 19.42 ? 361  LYS B N   1 
ATOM   7284 C CA  . LYS B 1 362 ? 30.495  -16.215 21.582  1.00 18.94 ? 361  LYS B CA  1 
ATOM   7285 C C   . LYS B 1 362 ? 30.434  -17.655 21.098  1.00 19.75 ? 361  LYS B C   1 
ATOM   7286 O O   . LYS B 1 362 ? 29.389  -18.123 20.652  1.00 19.35 ? 361  LYS B O   1 
ATOM   7287 C CB  . LYS B 1 362 ? 30.301  -16.191 23.106  1.00 18.26 ? 361  LYS B CB  1 
ATOM   7288 C CG  . LYS B 1 362 ? 30.369  -14.798 23.787  1.00 17.74 ? 361  LYS B CG  1 
ATOM   7289 C CD  . LYS B 1 362 ? 31.789  -14.235 23.790  1.00 16.19 ? 361  LYS B CD  1 
ATOM   7290 C CE  . LYS B 1 362 ? 31.808  -12.722 23.971  1.00 18.27 ? 361  LYS B CE  1 
ATOM   7291 N NZ  . LYS B 1 362 ? 31.321  -12.312 25.354  1.00 16.49 ? 361  LYS B NZ  1 
ATOM   7292 N N   . TYR B 1 363 ? 31.552  -18.368 21.180  1.00 20.16 ? 362  TYR B N   1 
ATOM   7293 C CA  . TYR B 1 363 ? 31.534  -19.774 20.764  1.00 20.93 ? 362  TYR B CA  1 
ATOM   7294 C C   . TYR B 1 363 ? 32.253  -20.755 21.703  1.00 21.82 ? 362  TYR B C   1 
ATOM   7295 O O   . TYR B 1 363 ? 32.288  -21.956 21.422  1.00 21.79 ? 362  TYR B O   1 
ATOM   7296 C CB  . TYR B 1 363 ? 31.997  -19.925 19.304  1.00 20.41 ? 362  TYR B CB  1 
ATOM   7297 C CG  . TYR B 1 363 ? 33.499  -19.931 19.106  1.00 21.01 ? 362  TYR B CG  1 
ATOM   7298 C CD1 . TYR B 1 363 ? 34.127  -21.010 18.484  1.00 22.38 ? 362  TYR B CD1 1 
ATOM   7299 C CD2 . TYR B 1 363 ? 34.291  -18.861 19.529  1.00 20.72 ? 362  TYR B CD2 1 
ATOM   7300 C CE1 . TYR B 1 363 ? 35.509  -21.031 18.293  1.00 21.82 ? 362  TYR B CE1 1 
ATOM   7301 C CE2 . TYR B 1 363 ? 35.669  -18.878 19.352  1.00 20.27 ? 362  TYR B CE2 1 
ATOM   7302 C CZ  . TYR B 1 363 ? 36.268  -19.972 18.727  1.00 21.57 ? 362  TYR B CZ  1 
ATOM   7303 O OH  . TYR B 1 363 ? 37.625  -20.006 18.537  1.00 22.67 ? 362  TYR B OH  1 
ATOM   7304 N N   . ILE B 1 364 ? 32.829  -20.251 22.793  1.00 22.64 ? 363  ILE B N   1 
ATOM   7305 C CA  . ILE B 1 364 ? 33.487  -21.112 23.776  1.00 23.23 ? 363  ILE B CA  1 
ATOM   7306 C C   . ILE B 1 364 ? 32.698  -21.139 25.077  1.00 24.10 ? 363  ILE B C   1 
ATOM   7307 O O   . ILE B 1 364 ? 32.383  -20.096 25.648  1.00 23.96 ? 363  ILE B O   1 
ATOM   7308 C CB  . ILE B 1 364 ? 34.952  -20.667 24.028  1.00 23.60 ? 363  ILE B CB  1 
ATOM   7309 C CG1 . ILE B 1 364 ? 35.726  -20.583 22.699  1.00 22.07 ? 363  ILE B CG1 1 
ATOM   7310 C CG2 . ILE B 1 364 ? 35.653  -21.587 25.072  1.00 22.49 ? 363  ILE B CG2 1 
ATOM   7311 C CD1 . ILE B 1 364 ? 35.834  -21.911 21.918  1.00 24.23 ? 363  ILE B CD1 1 
ATOM   7312 N N   . THR B 1 365 ? 32.390  -22.348 25.544  1.00 25.05 ? 364  THR B N   1 
ATOM   7313 C CA  . THR B 1 365 ? 31.675  -22.525 26.811  1.00 25.22 ? 364  THR B CA  1 
ATOM   7314 C C   . THR B 1 365 ? 32.595  -22.478 28.022  1.00 26.13 ? 364  THR B C   1 
ATOM   7315 O O   . THR B 1 365 ? 33.827  -22.448 27.895  1.00 25.46 ? 364  THR B O   1 
ATOM   7316 C CB  . THR B 1 365 ? 30.891  -23.851 26.853  1.00 25.39 ? 364  THR B CB  1 
ATOM   7317 O OG1 . THR B 1 365 ? 31.809  -24.950 26.823  1.00 24.88 ? 364  THR B OG1 1 
ATOM   7318 C CG2 . THR B 1 365 ? 30.011  -24.040 25.613  1.00 25.57 ? 364  THR B CG2 1 
ATOM   7319 N N   . LYS B 1 366 ? 31.962  -22.519 29.195  1.00 27.14 ? 365  LYS B N   1 
ATOM   7320 C CA  . LYS B 1 366 ? 32.626  -22.493 30.492  1.00 28.68 ? 365  LYS B CA  1 
ATOM   7321 C C   . LYS B 1 366 ? 33.652  -23.633 30.648  1.00 29.38 ? 365  LYS B C   1 
ATOM   7322 O O   . LYS B 1 366 ? 34.689  -23.459 31.288  1.00 29.78 ? 365  LYS B O   1 
ATOM   7323 C CB  . LYS B 1 366 ? 31.552  -22.550 31.592  1.00 28.91 ? 365  LYS B CB  1 
ATOM   7324 C CG  . LYS B 1 366 ? 32.031  -22.299 33.025  1.00 30.92 ? 365  LYS B CG  1 
ATOM   7325 C CD  . LYS B 1 366 ? 30.961  -21.575 33.866  1.00 32.44 ? 365  LYS B CD  1 
ATOM   7326 C CE  . LYS B 1 366 ? 29.705  -22.414 34.077  1.00 33.56 ? 365  LYS B CE  1 
ATOM   7327 N NZ  . LYS B 1 366 ? 28.905  -22.011 35.295  1.00 33.55 ? 365  LYS B NZ  1 
ATOM   7328 N N   . SER B 1 367 ? 33.357  -24.781 30.044  1.00 30.42 ? 366  SER B N   1 
ATOM   7329 C CA  . SER B 1 367 ? 34.241  -25.941 30.074  1.00 31.43 ? 366  SER B CA  1 
ATOM   7330 C C   . SER B 1 367 ? 35.414  -25.833 29.094  1.00 31.85 ? 366  SER B C   1 
ATOM   7331 O O   . SER B 1 367 ? 36.349  -26.641 29.152  1.00 32.50 ? 366  SER B O   1 
ATOM   7332 C CB  . SER B 1 367 ? 33.438  -27.210 29.789  1.00 31.29 ? 366  SER B CB  1 
ATOM   7333 O OG  . SER B 1 367 ? 33.053  -27.265 28.423  1.00 33.64 ? 366  SER B OG  1 
ATOM   7334 N N   . GLY B 1 368 ? 35.369  -24.848 28.192  1.00 31.52 ? 367  GLY B N   1 
ATOM   7335 C CA  . GLY B 1 368 ? 36.425  -24.676 27.204  1.00 30.84 ? 367  GLY B CA  1 
ATOM   7336 C C   . GLY B 1 368 ? 36.093  -25.316 25.869  1.00 30.69 ? 367  GLY B C   1 
ATOM   7337 O O   . GLY B 1 368 ? 36.828  -25.149 24.884  1.00 30.52 ? 367  GLY B O   1 
ATOM   7338 N N   . ALA B 1 369 ? 34.975  -26.039 25.843  1.00 30.10 ? 368  ALA B N   1 
ATOM   7339 C CA  . ALA B 1 369 ? 34.465  -26.693 24.645  1.00 29.37 ? 368  ALA B CA  1 
ATOM   7340 C C   . ALA B 1 369 ? 33.808  -25.714 23.662  1.00 29.03 ? 368  ALA B C   1 
ATOM   7341 O O   . ALA B 1 369 ? 33.163  -24.745 24.071  1.00 28.59 ? 368  ALA B O   1 
ATOM   7342 C CB  . ALA B 1 369 ? 33.473  -27.762 25.034  1.00 29.92 ? 368  ALA B CB  1 
ATOM   7343 N N   . ARG B 1 370 ? 33.955  -25.997 22.372  1.00 27.87 ? 369  ARG B N   1 
ATOM   7344 C CA  . ARG B 1 370 ? 33.303  -25.222 21.321  1.00 27.76 ? 369  ARG B CA  1 
ATOM   7345 C C   . ARG B 1 370 ? 31.813  -25.550 21.306  1.00 27.60 ? 369  ARG B C   1 
ATOM   7346 O O   . ARG B 1 370 ? 31.414  -26.716 21.391  1.00 27.23 ? 369  ARG B O   1 
ATOM   7347 C CB  A ARG B 1 370 ? 33.927  -25.515 19.952  0.35 27.66 ? 369  ARG B CB  1 
ATOM   7348 C CB  B ARG B 1 370 ? 33.934  -25.555 19.966  0.65 27.92 ? 369  ARG B CB  1 
ATOM   7349 C CG  A ARG B 1 370 ? 35.312  -24.896 19.730  0.35 27.23 ? 369  ARG B CG  1 
ATOM   7350 C CG  B ARG B 1 370 ? 33.760  -24.507 18.883  0.65 28.58 ? 369  ARG B CG  1 
ATOM   7351 C CD  A ARG B 1 370 ? 36.114  -25.495 18.561  0.35 27.40 ? 369  ARG B CD  1 
ATOM   7352 C CD  B ARG B 1 370 ? 33.467  -25.102 17.518  0.65 30.22 ? 369  ARG B CD  1 
ATOM   7353 N NE  A ARG B 1 370 ? 35.394  -26.563 17.861  0.35 27.69 ? 369  ARG B NE  1 
ATOM   7354 N NE  B ARG B 1 370 ? 33.345  -24.121 16.439  0.65 29.97 ? 369  ARG B NE  1 
ATOM   7355 C CZ  A ARG B 1 370 ? 35.962  -27.578 17.216  0.35 27.77 ? 369  ARG B CZ  1 
ATOM   7356 C CZ  B ARG B 1 370 ? 32.323  -23.283 16.280  0.65 30.62 ? 369  ARG B CZ  1 
ATOM   7357 N NH1 A ARG B 1 370 ? 37.282  -27.697 17.161  0.35 28.05 ? 369  ARG B NH1 1 
ATOM   7358 N NH1 B ARG B 1 370 ? 31.310  -23.263 17.143  0.65 28.99 ? 369  ARG B NH1 1 
ATOM   7359 N NH2 A ARG B 1 370 ? 35.200  -28.485 16.618  0.35 27.09 ? 369  ARG B NH2 1 
ATOM   7360 N NH2 B ARG B 1 370 ? 32.317  -22.450 15.250  0.65 30.93 ? 369  ARG B NH2 1 
ATOM   7361 N N   . VAL B 1 371 ? 30.985  -24.513 21.214  1.00 26.95 ? 370  VAL B N   1 
ATOM   7362 C CA  . VAL B 1 371 ? 29.550  -24.713 21.051  1.00 26.78 ? 370  VAL B CA  1 
ATOM   7363 C C   . VAL B 1 371 ? 29.248  -25.528 19.778  1.00 25.76 ? 370  VAL B C   1 
ATOM   7364 O O   . VAL B 1 371 ? 29.942  -25.393 18.769  1.00 25.77 ? 370  VAL B O   1 
ATOM   7365 C CB  . VAL B 1 371 ? 28.785  -23.348 21.017  1.00 26.93 ? 370  VAL B CB  1 
ATOM   7366 C CG1 . VAL B 1 371 ? 28.923  -22.610 22.334  1.00 28.33 ? 370  VAL B CG1 1 
ATOM   7367 C CG2 . VAL B 1 371 ? 29.217  -22.473 19.842  1.00 26.52 ? 370  VAL B CG2 1 
ATOM   7368 N N   . ASP B 1 372 ? 28.230  -26.386 19.837  1.00 24.63 ? 371  ASP B N   1 
ATOM   7369 C CA  . ASP B 1 372 ? 27.738  -27.074 18.646  1.00 24.14 ? 371  ASP B CA  1 
ATOM   7370 C C   . ASP B 1 372 ? 26.293  -26.679 18.396  1.00 23.19 ? 371  ASP B C   1 
ATOM   7371 O O   . ASP B 1 372 ? 25.467  -27.482 17.960  1.00 23.37 ? 371  ASP B O   1 
ATOM   7372 C CB  . ASP B 1 372 ? 27.884  -28.602 18.788  1.00 24.52 ? 371  ASP B CB  1 
ATOM   7373 C CG  . ASP B 1 372 ? 27.131  -29.163 19.990  1.00 25.98 ? 371  ASP B CG  1 
ATOM   7374 O OD1 . ASP B 1 372 ? 26.582  -28.384 20.795  1.00 26.56 ? 371  ASP B OD1 1 
ATOM   7375 O OD2 . ASP B 1 372 ? 27.031  -30.392 20.208  1.00 26.91 ? 371  ASP B OD2 1 
ATOM   7376 N N   . HIS B 1 373 ? 25.998  -25.415 18.683  1.00 21.78 ? 372  HIS B N   1 
ATOM   7377 C CA  . HIS B 1 373 ? 24.656  -24.862 18.511  1.00 20.64 ? 372  HIS B CA  1 
ATOM   7378 C C   . HIS B 1 373 ? 24.835  -23.372 18.304  1.00 20.01 ? 372  HIS B C   1 
ATOM   7379 O O   . HIS B 1 373 ? 25.924  -22.841 18.497  1.00 20.00 ? 372  HIS B O   1 
ATOM   7380 C CB  . HIS B 1 373 ? 23.789  -25.087 19.755  1.00 20.20 ? 372  HIS B CB  1 
ATOM   7381 C CG  . HIS B 1 373 ? 24.437  -24.681 21.046  1.00 20.31 ? 372  HIS B CG  1 
ATOM   7382 N ND1 . HIS B 1 373 ? 24.408  -23.386 21.528  1.00 21.42 ? 372  HIS B ND1 1 
ATOM   7383 C CD2 . HIS B 1 373 ? 25.094  -25.412 21.981  1.00 19.73 ? 372  HIS B CD2 1 
ATOM   7384 C CE1 . HIS B 1 373 ? 25.040  -23.333 22.691  1.00 21.77 ? 372  HIS B CE1 1 
ATOM   7385 N NE2 . HIS B 1 373 ? 25.474  -24.548 22.982  1.00 21.08 ? 372  HIS B NE2 1 
ATOM   7386 N N   . GLN B 1 374 ? 23.752  -22.711 17.926  1.00 19.67 ? 373  GLN B N   1 
ATOM   7387 C CA  . GLN B 1 374 ? 23.775  -21.257 17.758  1.00 19.82 ? 373  GLN B CA  1 
ATOM   7388 C C   . GLN B 1 374 ? 23.849  -20.528 19.100  1.00 19.49 ? 373  GLN B C   1 
ATOM   7389 O O   . GLN B 1 374 ? 23.345  -21.017 20.138  1.00 18.92 ? 373  GLN B O   1 
ATOM   7390 C CB  . GLN B 1 374 ? 22.531  -20.816 16.997  1.00 19.57 ? 373  GLN B CB  1 
ATOM   7391 C CG  . GLN B 1 374 ? 22.566  -21.139 15.493  1.00 20.76 ? 373  GLN B CG  1 
ATOM   7392 C CD  . GLN B 1 374 ? 23.727  -20.469 14.789  1.00 23.64 ? 373  GLN B CD  1 
ATOM   7393 O OE1 . GLN B 1 374 ? 23.999  -19.295 15.024  1.00 22.41 ? 373  GLN B OE1 1 
ATOM   7394 N NE2 . GLN B 1 374 ? 24.430  -21.217 13.941  1.00 24.71 ? 373  GLN B NE2 1 
ATOM   7395 N N   . THR B 1 375 ? 24.488  -19.360 19.088  1.00 18.21 ? 374  THR B N   1 
ATOM   7396 C CA  . THR B 1 375 ? 24.416  -18.458 20.237  1.00 18.37 ? 374  THR B CA  1 
ATOM   7397 C C   . THR B 1 375 ? 23.737  -17.155 19.802  1.00 18.22 ? 374  THR B C   1 
ATOM   7398 O O   . THR B 1 375 ? 22.764  -17.190 19.049  1.00 18.25 ? 374  THR B O   1 
ATOM   7399 C CB  . THR B 1 375 ? 25.796  -18.186 20.886  1.00 18.86 ? 374  THR B CB  1 
ATOM   7400 O OG1 . THR B 1 375 ? 26.732  -17.731 19.905  1.00 19.46 ? 374  THR B OG1 1 
ATOM   7401 C CG2 . THR B 1 375 ? 26.416  -19.482 21.473  1.00 16.76 ? 374  THR B CG2 1 
ATOM   7402 N N   . GLY B 1 376 ? 24.263  -16.019 20.256  1.00 18.53 ? 375  GLY B N   1 
ATOM   7403 C CA  . GLY B 1 376 ? 23.579  -14.742 20.088  1.00 18.57 ? 375  GLY B CA  1 
ATOM   7404 C C   . GLY B 1 376 ? 23.185  -14.406 18.654  1.00 18.95 ? 375  GLY B C   1 
ATOM   7405 O O   . GLY B 1 376 ? 23.912  -14.714 17.706  1.00 19.57 ? 375  GLY B O   1 
ATOM   7406 N N   . PRO B 1 377 ? 22.025  -13.762 18.507  1.00 18.84 ? 376  PRO B N   1 
ATOM   7407 C CA  . PRO B 1 377 ? 21.506  -13.393 17.191  1.00 18.08 ? 376  PRO B CA  1 
ATOM   7408 C C   . PRO B 1 377 ? 22.073  -12.064 16.723  1.00 17.55 ? 376  PRO B C   1 
ATOM   7409 O O   . PRO B 1 377 ? 22.630  -11.304 17.525  1.00 17.61 ? 376  PRO B O   1 
ATOM   7410 C CB  . PRO B 1 377 ? 20.008  -13.229 17.452  1.00 18.27 ? 376  PRO B CB  1 
ATOM   7411 C CG  . PRO B 1 377 ? 19.946  -12.722 18.892  1.00 18.74 ? 376  PRO B CG  1 
ATOM   7412 C CD  . PRO B 1 377 ? 21.097  -13.402 19.597  1.00 18.43 ? 376  PRO B CD  1 
ATOM   7413 N N   . ILE B 1 378 ? 21.919  -11.807 15.431  1.00 17.18 ? 377  ILE B N   1 
ATOM   7414 C CA  . ILE B 1 378 ? 22.154  -10.476 14.878  1.00 16.96 ? 377  ILE B CA  1 
ATOM   7415 C C   . ILE B 1 378 ? 20.933  -9.612  15.195  1.00 16.64 ? 377  ILE B C   1 
ATOM   7416 O O   . ILE B 1 378 ? 19.798  -9.943  14.831  1.00 16.89 ? 377  ILE B O   1 
ATOM   7417 C CB  . ILE B 1 378 ? 22.387  -10.578 13.362  1.00 16.96 ? 377  ILE B CB  1 
ATOM   7418 C CG1 . ILE B 1 378 ? 23.668  -11.392 13.083  1.00 17.50 ? 377  ILE B CG1 1 
ATOM   7419 C CG2 . ILE B 1 378 ? 22.426  -9.181  12.698  1.00 18.15 ? 377  ILE B CG2 1 
ATOM   7420 C CD1 . ILE B 1 378 ? 23.657  -12.050 11.692  1.00 17.82 ? 377  ILE B CD1 1 
ATOM   7421 N N   . VAL B 1 379 ? 21.183  -8.500  15.872  1.00 17.00 ? 378  VAL B N   1 
ATOM   7422 C CA  . VAL B 1 379 ? 20.129  -7.594  16.336  1.00 17.10 ? 378  VAL B CA  1 
ATOM   7423 C C   . VAL B 1 379 ? 20.109  -6.409  15.372  1.00 16.46 ? 378  VAL B C   1 
ATOM   7424 O O   . VAL B 1 379 ? 21.161  -5.969  14.909  1.00 17.36 ? 378  VAL B O   1 
ATOM   7425 C CB  . VAL B 1 379 ? 20.378  -7.164  17.802  1.00 17.52 ? 378  VAL B CB  1 
ATOM   7426 C CG1 . VAL B 1 379 ? 19.427  -6.023  18.240  1.00 18.84 ? 378  VAL B CG1 1 
ATOM   7427 C CG2 . VAL B 1 379 ? 20.248  -8.378  18.742  1.00 18.00 ? 378  VAL B CG2 1 
ATOM   7428 N N   . TRP B 1 380 ? 18.914  -5.952  15.013  1.00 15.66 ? 379  TRP B N   1 
ATOM   7429 C CA  . TRP B 1 380 ? 18.776  -4.861  14.047  1.00 16.03 ? 379  TRP B CA  1 
ATOM   7430 C C   . TRP B 1 380 ? 17.406  -4.205  14.199  1.00 15.94 ? 379  TRP B C   1 
ATOM   7431 O O   . TRP B 1 380 ? 16.560  -4.710  14.921  1.00 17.17 ? 379  TRP B O   1 
ATOM   7432 C CB  . TRP B 1 380 ? 18.992  -5.387  12.615  1.00 15.61 ? 379  TRP B CB  1 
ATOM   7433 C CG  . TRP B 1 380 ? 17.966  -6.413  12.162  1.00 15.25 ? 379  TRP B CG  1 
ATOM   7434 C CD1 . TRP B 1 380 ? 17.888  -7.734  12.533  1.00 16.93 ? 379  TRP B CD1 1 
ATOM   7435 C CD2 . TRP B 1 380 ? 16.907  -6.194  11.230  1.00 17.57 ? 379  TRP B CD2 1 
ATOM   7436 N NE1 . TRP B 1 380 ? 16.819  -8.334  11.913  1.00 16.08 ? 379  TRP B NE1 1 
ATOM   7437 C CE2 . TRP B 1 380 ? 16.197  -7.410  11.105  1.00 16.88 ? 379  TRP B CE2 1 
ATOM   7438 C CE3 . TRP B 1 380 ? 16.470  -5.079  10.494  1.00 15.68 ? 379  TRP B CE3 1 
ATOM   7439 C CZ2 . TRP B 1 380 ? 15.098  -7.551  10.259  1.00 15.56 ? 379  TRP B CZ2 1 
ATOM   7440 C CZ3 . TRP B 1 380 ? 15.364  -5.216  9.660   1.00 17.10 ? 379  TRP B CZ3 1 
ATOM   7441 C CH2 . TRP B 1 380 ? 14.689  -6.441  9.554   1.00 16.59 ? 379  TRP B CH2 1 
ATOM   7442 N N   . GLY B 1 381 ? 17.206  -3.064  13.542  1.00 16.64 ? 380  GLY B N   1 
ATOM   7443 C CA  . GLY B 1 381 ? 15.897  -2.438  13.503  1.00 16.34 ? 380  GLY B CA  1 
ATOM   7444 C C   . GLY B 1 381 ? 15.983  -0.954  13.228  1.00 16.28 ? 380  GLY B C   1 
ATOM   7445 O O   . GLY B 1 381 ? 17.066  -0.365  13.286  1.00 15.94 ? 380  GLY B O   1 
ATOM   7446 N N   . GLU B 1 382 ? 14.833  -0.380  12.877  1.00 15.95 ? 381  GLU B N   1 
ATOM   7447 C CA  . GLU B 1 382 ? 14.636  1.069   12.780  1.00 16.14 ? 381  GLU B CA  1 
ATOM   7448 C C   . GLU B 1 382 ? 13.299  1.368   13.471  1.00 16.14 ? 381  GLU B C   1 
ATOM   7449 O O   . GLU B 1 382 ? 12.446  0.496   13.592  1.00 15.68 ? 381  GLU B O   1 
ATOM   7450 C CB  . GLU B 1 382 ? 14.586  1.517   11.305  1.00 16.01 ? 381  GLU B CB  1 
ATOM   7451 C CG  . GLU B 1 382 ? 15.929  1.500   10.565  1.00 18.10 ? 381  GLU B CG  1 
ATOM   7452 C CD  . GLU B 1 382 ? 16.917  2.577   11.047  1.00 21.97 ? 381  GLU B CD  1 
ATOM   7453 O OE1 . GLU B 1 382 ? 16.478  3.603   11.612  1.00 23.46 ? 381  GLU B OE1 1 
ATOM   7454 O OE2 . GLU B 1 382 ? 18.137  2.405   10.863  1.00 23.83 ? 381  GLU B OE2 1 
ATOM   7455 N N   . PRO B 1 383 ? 13.100  2.590   13.931  1.00 16.50 ? 382  PRO B N   1 
ATOM   7456 C CA  . PRO B 1 383 ? 11.801  2.943   14.529  1.00 16.35 ? 382  PRO B CA  1 
ATOM   7457 C C   . PRO B 1 383 ? 10.633  2.823   13.564  1.00 16.31 ? 382  PRO B C   1 
ATOM   7458 O O   . PRO B 1 383 ? 10.791  3.004   12.358  1.00 16.32 ? 382  PRO B O   1 
ATOM   7459 C CB  . PRO B 1 383 ? 11.992  4.400   14.986  1.00 16.50 ? 382  PRO B CB  1 
ATOM   7460 C CG  . PRO B 1 383 ? 13.227  4.889   14.299  1.00 17.23 ? 382  PRO B CG  1 
ATOM   7461 C CD  . PRO B 1 383 ? 14.069  3.696   13.955  1.00 16.03 ? 382  PRO B CD  1 
ATOM   7462 N N   . GLY B 1 384 ? 9.470   2.455   14.092  1.00 16.31 ? 383  GLY B N   1 
ATOM   7463 C CA  . GLY B 1 384 ? 8.236   2.536   13.346  1.00 16.35 ? 383  GLY B CA  1 
ATOM   7464 C C   . GLY B 1 384 ? 7.718   3.963   13.437  1.00 17.21 ? 383  GLY B C   1 
ATOM   7465 O O   . GLY B 1 384 ? 7.994   4.619   14.430  1.00 16.34 ? 383  GLY B O   1 
ATOM   7466 N N   . THR B 1 385 ? 6.970   4.436   12.436  1.00 17.59 ? 384  THR B N   1 
ATOM   7467 C CA  . THR B 1 385 ? 6.542   3.625   11.276  1.00 17.98 ? 384  THR B CA  1 
ATOM   7468 C C   . THR B 1 385 ? 7.548   3.514   10.132  1.00 18.42 ? 384  THR B C   1 
ATOM   7469 O O   . THR B 1 385 ? 7.281   2.819   9.141   1.00 18.53 ? 384  THR B O   1 
ATOM   7470 C CB  . THR B 1 385 ? 5.207   4.139   10.667  1.00 18.90 ? 384  THR B CB  1 
ATOM   7471 O OG1 . THR B 1 385 ? 5.382   5.482   10.184  1.00 17.85 ? 384  THR B OG1 1 
ATOM   7472 C CG2 . THR B 1 385 ? 4.093   4.222   11.709  1.00 19.32 ? 384  THR B CG2 1 
ATOM   7473 N N   . ASN B 1 386 ? 8.703   4.164   10.262  1.00 17.78 ? 385  ASN B N   1 
ATOM   7474 C CA  . ASN B 1 386 ? 9.644   4.235   9.145   1.00 18.71 ? 385  ASN B CA  1 
ATOM   7475 C C   . ASN B 1 386 ? 9.971   2.874   8.548   1.00 18.97 ? 385  ASN B C   1 
ATOM   7476 O O   . ASN B 1 386 ? 9.958   2.716   7.336   1.00 18.85 ? 385  ASN B O   1 
ATOM   7477 C CB  . ASN B 1 386 ? 10.920  4.967   9.540   1.00 18.27 ? 385  ASN B CB  1 
ATOM   7478 C CG  . ASN B 1 386 ? 10.660  6.425   9.847   1.00 22.32 ? 385  ASN B CG  1 
ATOM   7479 O OD1 . ASN B 1 386 ? 10.203  6.758   10.926  1.00 23.29 ? 385  ASN B OD1 1 
ATOM   7480 N ND2 . ASN B 1 386 ? 10.900  7.289   8.876   1.00 22.91 ? 385  ASN B ND2 1 
ATOM   7481 N N   . GLY B 1 387 ? 10.229  1.899   9.413   1.00 19.82 ? 386  GLY B N   1 
ATOM   7482 C CA  . GLY B 1 387 ? 10.581  0.553   8.965   1.00 18.94 ? 386  GLY B CA  1 
ATOM   7483 C C   . GLY B 1 387 ? 9.552   -0.072  8.064   1.00 19.21 ? 386  GLY B C   1 
ATOM   7484 O O   . GLY B 1 387 ? 9.904   -0.863  7.170   1.00 18.80 ? 386  GLY B O   1 
ATOM   7485 N N   . GLN B 1 388 ? 8.275   0.264   8.291   1.00 18.10 ? 387  GLN B N   1 
ATOM   7486 C CA  . GLN B 1 388 ? 7.198   -0.206  7.419   1.00 18.42 ? 387  GLN B CA  1 
ATOM   7487 C C   . GLN B 1 388 ? 7.396   0.147   5.957   1.00 18.85 ? 387  GLN B C   1 
ATOM   7488 O O   . GLN B 1 388 ? 6.939   -0.599  5.092   1.00 18.64 ? 387  GLN B O   1 
ATOM   7489 C CB  . GLN B 1 388 ? 5.841   0.358   7.846   1.00 17.03 ? 387  GLN B CB  1 
ATOM   7490 C CG  . GLN B 1 388 ? 5.438   -0.070  9.215   1.00 17.94 ? 387  GLN B CG  1 
ATOM   7491 C CD  . GLN B 1 388 ? 4.226   0.668   9.745   1.00 17.49 ? 387  GLN B CD  1 
ATOM   7492 O OE1 . GLN B 1 388 ? 3.393   1.214   8.991   1.00 20.28 ? 387  GLN B OE1 1 
ATOM   7493 N NE2 . GLN B 1 388 ? 4.115   0.677   11.034  1.00 15.28 ? 387  GLN B NE2 1 
ATOM   7494 N N   . HIS B 1 389 ? 8.009   1.303   5.686   1.00 19.38 ? 388  HIS B N   1 
ATOM   7495 C CA  . HIS B 1 389 ? 8.233   1.752   4.302   1.00 19.93 ? 388  HIS B CA  1 
ATOM   7496 C C   . HIS B 1 389 ? 9.628   1.442   3.815   1.00 20.21 ? 388  HIS B C   1 
ATOM   7497 O O   . HIS B 1 389 ? 10.055  1.961   2.782   1.00 21.62 ? 388  HIS B O   1 
ATOM   7498 C CB  . HIS B 1 389 ? 7.975   3.255   4.195   1.00 20.69 ? 388  HIS B CB  1 
ATOM   7499 C CG  . HIS B 1 389 ? 6.620   3.645   4.681   1.00 20.12 ? 388  HIS B CG  1 
ATOM   7500 N ND1 . HIS B 1 389 ? 5.552   3.804   3.833   1.00 21.78 ? 388  HIS B ND1 1 
ATOM   7501 C CD2 . HIS B 1 389 ? 6.145   3.851   5.934   1.00 21.85 ? 388  HIS B CD2 1 
ATOM   7502 C CE1 . HIS B 1 389 ? 4.477   4.119   4.537   1.00 21.95 ? 388  HIS B CE1 1 
ATOM   7503 N NE2 . HIS B 1 389 ? 4.811   4.152   5.816   1.00 21.05 ? 388  HIS B NE2 1 
ATOM   7504 N N   . ALA B 1 390 ? 10.348  0.623   4.582   1.00 20.40 ? 389  ALA B N   1 
ATOM   7505 C CA  . ALA B 1 390 ? 11.710  0.265   4.236   1.00 19.50 ? 389  ALA B CA  1 
ATOM   7506 C C   . ALA B 1 390 ? 11.861  -1.235  4.066   1.00 19.15 ? 389  ALA B C   1 
ATOM   7507 O O   . ALA B 1 390 ? 12.154  -1.689  2.971   1.00 19.59 ? 389  ALA B O   1 
ATOM   7508 C CB  . ALA B 1 390 ? 12.704  0.801   5.281   1.00 19.64 ? 389  ALA B CB  1 
ATOM   7509 N N   . PHE B 1 391 ? 11.652  -2.004  5.137   1.00 17.60 ? 390  PHE B N   1 
ATOM   7510 C CA  . PHE B 1 391 ? 11.984  -3.423  5.083   1.00 17.33 ? 390  PHE B CA  1 
ATOM   7511 C C   . PHE B 1 391 ? 10.873  -4.365  5.492   1.00 17.22 ? 390  PHE B C   1 
ATOM   7512 O O   . PHE B 1 391 ? 11.066  -5.571  5.443   1.00 16.45 ? 390  PHE B O   1 
ATOM   7513 C CB  . PHE B 1 391 ? 13.250  -3.723  5.897   1.00 17.14 ? 390  PHE B CB  1 
ATOM   7514 C CG  . PHE B 1 391 ? 13.204  -3.196  7.303   1.00 16.70 ? 390  PHE B CG  1 
ATOM   7515 C CD1 . PHE B 1 391 ? 12.488  -3.859  8.289   1.00 14.23 ? 390  PHE B CD1 1 
ATOM   7516 C CD2 . PHE B 1 391 ? 13.845  -2.006  7.623   1.00 15.10 ? 390  PHE B CD2 1 
ATOM   7517 C CE1 . PHE B 1 391 ? 12.415  -3.352  9.590   1.00 16.65 ? 390  PHE B CE1 1 
ATOM   7518 C CE2 . PHE B 1 391 ? 13.784  -1.485  8.914   1.00 16.87 ? 390  PHE B CE2 1 
ATOM   7519 C CZ  . PHE B 1 391 ? 13.090  -2.153  9.905   1.00 16.09 ? 390  PHE B CZ  1 
ATOM   7520 N N   . TYR B 1 392 ? 9.720   -3.841  5.920   1.00 16.07 ? 391  TYR B N   1 
ATOM   7521 C CA  . TYR B 1 392 ? 8.655   -4.771  6.330   1.00 16.51 ? 391  TYR B CA  1 
ATOM   7522 C C   . TYR B 1 392 ? 8.141   -5.621  5.171   1.00 15.93 ? 391  TYR B C   1 
ATOM   7523 O O   . TYR B 1 392 ? 7.566   -6.672  5.409   1.00 16.33 ? 391  TYR B O   1 
ATOM   7524 C CB  . TYR B 1 392 ? 7.467   -4.066  6.972   1.00 15.66 ? 391  TYR B CB  1 
ATOM   7525 C CG  . TYR B 1 392 ? 7.621   -3.585  8.397   1.00 16.38 ? 391  TYR B CG  1 
ATOM   7526 C CD1 . TYR B 1 392 ? 8.870   -3.199  8.926   1.00 15.72 ? 391  TYR B CD1 1 
ATOM   7527 C CD2 . TYR B 1 392 ? 6.494   -3.438  9.201   1.00 16.75 ? 391  TYR B CD2 1 
ATOM   7528 C CE1 . TYR B 1 392 ? 8.982   -2.685  10.235  1.00 17.14 ? 391  TYR B CE1 1 
ATOM   7529 C CE2 . TYR B 1 392 ? 6.594   -2.945  10.505  1.00 16.83 ? 391  TYR B CE2 1 
ATOM   7530 C CZ  . TYR B 1 392 ? 7.828   -2.555  11.008  1.00 16.81 ? 391  TYR B CZ  1 
ATOM   7531 O OH  . TYR B 1 392 ? 7.909   -2.041  12.285  1.00 17.20 ? 391  TYR B OH  1 
ATOM   7532 N N   . GLN B 1 393 ? 8.324   -5.165  3.930   1.00 16.14 ? 392  GLN B N   1 
ATOM   7533 C CA  . GLN B 1 393 ? 8.025   -5.992  2.769   1.00 16.14 ? 392  GLN B CA  1 
ATOM   7534 C C   . GLN B 1 393 ? 8.605   -7.386  2.976   1.00 15.64 ? 392  GLN B C   1 
ATOM   7535 O O   . GLN B 1 393 ? 7.907   -8.398  2.812   1.00 16.60 ? 392  GLN B O   1 
ATOM   7536 C CB  . GLN B 1 393 ? 8.583   -5.360  1.485   1.00 16.24 ? 392  GLN B CB  1 
ATOM   7537 C CG  . GLN B 1 393 ? 8.634   -6.287  0.249   1.00 14.14 ? 392  GLN B CG  1 
ATOM   7538 C CD  . GLN B 1 393 ? 7.269   -6.820  -0.193  1.00 13.67 ? 392  GLN B CD  1 
ATOM   7539 O OE1 . GLN B 1 393 ? 6.332   -6.048  -0.376  1.00 16.29 ? 392  GLN B OE1 1 
ATOM   7540 N NE2 . GLN B 1 393 ? 7.163   -8.155  -0.358  1.00 13.28 ? 392  GLN B NE2 1 
ATOM   7541 N N   . LEU B 1 394 ? 9.884   -7.439  3.352   1.00 15.68 ? 393  LEU B N   1 
ATOM   7542 C CA  . LEU B 1 394 ? 10.575  -8.712  3.538   1.00 15.86 ? 393  LEU B CA  1 
ATOM   7543 C C   . LEU B 1 394 ? 10.078  -9.476  4.782   1.00 15.97 ? 393  LEU B C   1 
ATOM   7544 O O   . LEU B 1 394 ? 9.954   -10.709 4.753   1.00 16.47 ? 393  LEU B O   1 
ATOM   7545 C CB  . LEU B 1 394 ? 12.092  -8.460  3.640   1.00 16.66 ? 393  LEU B CB  1 
ATOM   7546 C CG  . LEU B 1 394 ? 12.983  -9.702  3.667   1.00 15.47 ? 393  LEU B CG  1 
ATOM   7547 C CD1 . LEU B 1 394 ? 14.305  -9.404  2.942   1.00 18.08 ? 393  LEU B CD1 1 
ATOM   7548 C CD2 . LEU B 1 394 ? 13.244  -10.227 5.099   1.00 16.39 ? 393  LEU B CD2 1 
ATOM   7549 N N   . ILE B 1 395 ? 9.811   -8.764  5.872   1.00 16.07 ? 394  ILE B N   1 
ATOM   7550 C CA  . ILE B 1 395 ? 9.271   -9.406  7.069   1.00 16.24 ? 394  ILE B CA  1 
ATOM   7551 C C   . ILE B 1 395 ? 7.932   -10.094 6.736   1.00 16.94 ? 394  ILE B C   1 
ATOM   7552 O O   . ILE B 1 395 ? 7.679   -11.214 7.201   1.00 17.09 ? 394  ILE B O   1 
ATOM   7553 C CB  . ILE B 1 395 ? 9.108   -8.409  8.256   1.00 16.09 ? 394  ILE B CB  1 
ATOM   7554 C CG1 . ILE B 1 395 ? 10.426  -7.636  8.527   1.00 16.75 ? 394  ILE B CG1 1 
ATOM   7555 C CG2 . ILE B 1 395 ? 8.641   -9.160  9.509   1.00 15.62 ? 394  ILE B CG2 1 
ATOM   7556 C CD1 . ILE B 1 395 ? 10.390  -6.697  9.768   1.00 16.82 ? 394  ILE B CD1 1 
ATOM   7557 N N   . HIS B 1 396 ? 7.079   -9.426  5.956   1.00 17.66 ? 395  HIS B N   1 
ATOM   7558 C CA  . HIS B 1 396 ? 5.756   -9.975  5.611   1.00 18.12 ? 395  HIS B CA  1 
ATOM   7559 C C   . HIS B 1 396 ? 5.778   -11.055 4.536   1.00 18.59 ? 395  HIS B C   1 
ATOM   7560 O O   . HIS B 1 396 ? 4.985   -12.001 4.604   1.00 18.73 ? 395  HIS B O   1 
ATOM   7561 C CB  . HIS B 1 396 ? 4.768   -8.879  5.169   1.00 18.69 ? 395  HIS B CB  1 
ATOM   7562 C CG  . HIS B 1 396 ? 4.262   -8.020  6.279   1.00 19.58 ? 395  HIS B CG  1 
ATOM   7563 N ND1 . HIS B 1 396 ? 3.230   -8.402  7.110   1.00 20.27 ? 395  HIS B ND1 1 
ATOM   7564 C CD2 . HIS B 1 396 ? 4.619   -6.771  6.675   1.00 21.06 ? 395  HIS B CD2 1 
ATOM   7565 C CE1 . HIS B 1 396 ? 2.985   -7.439  7.980   1.00 20.67 ? 395  HIS B CE1 1 
ATOM   7566 N NE2 . HIS B 1 396 ? 3.816   -6.439  7.742   1.00 20.44 ? 395  HIS B NE2 1 
ATOM   7567 N N   . GLN B 1 397 ? 6.647   -10.901 3.530   1.00 17.83 ? 396  GLN B N   1 
ATOM   7568 C CA  . GLN B 1 397 ? 6.558   -11.701 2.305   1.00 18.29 ? 396  GLN B CA  1 
ATOM   7569 C C   . GLN B 1 397 ? 7.899   -12.267 1.797   1.00 18.21 ? 396  GLN B C   1 
ATOM   7570 O O   . GLN B 1 397 ? 7.994   -12.690 0.628   1.00 19.04 ? 396  GLN B O   1 
ATOM   7571 C CB  . GLN B 1 397 ? 5.883   -10.904 1.184   1.00 18.82 ? 396  GLN B CB  1 
ATOM   7572 C CG  . GLN B 1 397 ? 4.367   -10.667 1.395   1.00 18.68 ? 396  GLN B CG  1 
ATOM   7573 C CD  . GLN B 1 397 ? 3.675   -10.251 0.110   1.00 20.48 ? 396  GLN B CD  1 
ATOM   7574 O OE1 . GLN B 1 397 ? 4.224   -9.459  -0.658  1.00 17.91 ? 396  GLN B OE1 1 
ATOM   7575 N NE2 . GLN B 1 397 ? 2.477   -10.802 -0.141  1.00 18.74 ? 396  GLN B NE2 1 
ATOM   7576 N N   . GLY B 1 398 ? 8.922   -12.254 2.643   1.00 17.26 ? 397  GLY B N   1 
ATOM   7577 C CA  . GLY B 1 398 ? 10.215  -12.822 2.277   1.00 17.63 ? 397  GLY B CA  1 
ATOM   7578 C C   . GLY B 1 398 ? 10.287  -14.279 2.673   1.00 18.16 ? 397  GLY B C   1 
ATOM   7579 O O   . GLY B 1 398 ? 9.257   -14.909 2.893   1.00 17.78 ? 397  GLY B O   1 
ATOM   7580 N N   . THR B 1 399 ? 11.505  -14.793 2.822   1.00 18.68 ? 398  THR B N   1 
ATOM   7581 C CA  . THR B 1 399 ? 11.726  -16.213 3.112   1.00 18.80 ? 398  THR B CA  1 
ATOM   7582 C C   . THR B 1 399 ? 12.450  -16.418 4.430   1.00 19.29 ? 398  THR B C   1 
ATOM   7583 O O   . THR B 1 399 ? 12.969  -17.506 4.694   1.00 20.56 ? 398  THR B O   1 
ATOM   7584 C CB  . THR B 1 399 ? 12.536  -16.877 1.989   1.00 18.59 ? 398  THR B CB  1 
ATOM   7585 O OG1 . THR B 1 399 ? 13.724  -16.112 1.739   1.00 19.50 ? 398  THR B OG1 1 
ATOM   7586 C CG2 . THR B 1 399 ? 11.772  -16.811 0.680   1.00 18.74 ? 398  THR B CG2 1 
ATOM   7587 N N   . LYS B 1 400 ? 12.433  -15.386 5.265   1.00 19.55 ? 399  LYS B N   1 
ATOM   7588 C CA  . LYS B 1 400 ? 13.103  -15.393 6.561   1.00 19.80 ? 399  LYS B CA  1 
ATOM   7589 C C   . LYS B 1 400 ? 12.075  -15.336 7.673   1.00 19.48 ? 399  LYS B C   1 
ATOM   7590 O O   . LYS B 1 400 ? 11.106  -14.581 7.593   1.00 20.06 ? 399  LYS B O   1 
ATOM   7591 C CB  . LYS B 1 400 ? 14.031  -14.168 6.685   1.00 20.41 ? 399  LYS B CB  1 
ATOM   7592 C CG  . LYS B 1 400 ? 15.470  -14.402 6.237   1.00 20.47 ? 399  LYS B CG  1 
ATOM   7593 C CD  . LYS B 1 400 ? 15.614  -14.155 4.742   1.00 23.50 ? 399  LYS B CD  1 
ATOM   7594 C CE  . LYS B 1 400 ? 17.030  -14.459 4.304   1.00 23.93 ? 399  LYS B CE  1 
ATOM   7595 N NZ  . LYS B 1 400 ? 17.050  -14.795 2.849   1.00 22.45 ? 399  LYS B NZ  1 
ATOM   7596 N N   . MET B 1 401 ? 12.301  -16.131 8.712   1.00 19.28 ? 400  MET B N   1 
ATOM   7597 C CA  . MET B 1 401 ? 11.586  -15.980 9.972   1.00 19.37 ? 400  MET B CA  1 
ATOM   7598 C C   . MET B 1 401 ? 12.366  -15.028 10.872  1.00 18.63 ? 400  MET B C   1 
ATOM   7599 O O   . MET B 1 401 ? 13.530  -15.272 11.205  1.00 19.19 ? 400  MET B O   1 
ATOM   7600 C CB  . MET B 1 401 ? 11.376  -17.337 10.645  1.00 18.73 ? 400  MET B CB  1 
ATOM   7601 C CG  . MET B 1 401 ? 10.560  -17.275 11.894  1.00 20.02 ? 400  MET B CG  1 
ATOM   7602 S SD  . MET B 1 401 ? 10.493  -18.912 12.652  1.00 22.41 ? 400  MET B SD  1 
ATOM   7603 C CE  . MET B 1 401 ? 9.409   -18.601 13.879  1.00 20.18 ? 400  MET B CE  1 
ATOM   7604 N N   . ILE B 1 402 ? 11.698  -13.949 11.271  1.00 18.01 ? 401  ILE B N   1 
ATOM   7605 C CA  . ILE B 1 402 ? 12.332  -12.856 12.009  1.00 17.67 ? 401  ILE B CA  1 
ATOM   7606 C C   . ILE B 1 402 ? 11.520  -12.506 13.256  1.00 17.61 ? 401  ILE B C   1 
ATOM   7607 O O   . ILE B 1 402 ? 10.508  -11.809 13.135  1.00 18.16 ? 401  ILE B O   1 
ATOM   7608 C CB  . ILE B 1 402 ? 12.435  -11.602 11.087  1.00 16.87 ? 401  ILE B CB  1 
ATOM   7609 C CG1 . ILE B 1 402 ? 13.270  -11.891 9.838   1.00 18.54 ? 401  ILE B CG1 1 
ATOM   7610 C CG2 . ILE B 1 402 ? 13.050  -10.411 11.835  1.00 15.74 ? 401  ILE B CG2 1 
ATOM   7611 C CD1 . ILE B 1 402 ? 13.065  -10.849 8.712   1.00 15.45 ? 401  ILE B CD1 1 
ATOM   7612 N N   . PRO B 1 403 ? 11.926  -12.979 14.444  1.00 17.59 ? 402  PRO B N   1 
ATOM   7613 C CA  . PRO B 1 403 ? 11.249  -12.556 15.679  1.00 17.25 ? 402  PRO B CA  1 
ATOM   7614 C C   . PRO B 1 403 ? 11.443  -11.052 15.845  1.00 17.19 ? 402  PRO B C   1 
ATOM   7615 O O   . PRO B 1 403 ? 12.547  -10.529 15.643  1.00 16.96 ? 402  PRO B O   1 
ATOM   7616 C CB  . PRO B 1 403 ? 11.966  -13.341 16.786  1.00 17.36 ? 402  PRO B CB  1 
ATOM   7617 C CG  . PRO B 1 403 ? 12.604  -14.510 16.070  1.00 18.59 ? 402  PRO B CG  1 
ATOM   7618 C CD  . PRO B 1 403 ? 12.999  -13.962 14.702  1.00 17.14 ? 402  PRO B CD  1 
ATOM   7619 N N   . CYS B 1 404 ? 10.351  -10.367 16.147  1.00 17.05 ? 403  CYS B N   1 
ATOM   7620 C CA  . CYS B 1 404 ? 10.366  -8.910  16.248  1.00 16.82 ? 403  CYS B CA  1 
ATOM   7621 C C   . CYS B 1 404 ? 9.776   -8.468  17.586  1.00 16.52 ? 403  CYS B C   1 
ATOM   7622 O O   . CYS B 1 404 ? 8.705   -8.951  17.982  1.00 16.74 ? 403  CYS B O   1 
ATOM   7623 C CB  . CYS B 1 404 ? 9.488   -8.312  15.159  1.00 16.79 ? 403  CYS B CB  1 
ATOM   7624 S SG  . CYS B 1 404 ? 10.040  -8.426  13.456  1.00 19.20 ? 403  CYS B SG  1 
ATOM   7625 N N   . ASP B 1 405 ? 10.451  -7.544  18.270  1.00 15.93 ? 404  ASP B N   1 
ATOM   7626 C CA  . ASP B 1 405 ? 9.850   -6.889  19.428  1.00 15.89 ? 404  ASP B CA  1 
ATOM   7627 C C   . ASP B 1 405 ? 9.390   -5.514  18.981  1.00 15.93 ? 404  ASP B C   1 
ATOM   7628 O O   . ASP B 1 405 ? 10.191  -4.724  18.502  1.00 15.38 ? 404  ASP B O   1 
ATOM   7629 C CB  . ASP B 1 405 ? 10.854  -6.692  20.554  1.00 15.57 ? 404  ASP B CB  1 
ATOM   7630 C CG  . ASP B 1 405 ? 11.311  -7.980  21.191  1.00 15.49 ? 404  ASP B CG  1 
ATOM   7631 O OD1 . ASP B 1 405 ? 10.750  -9.054  20.919  1.00 16.93 ? 404  ASP B OD1 1 
ATOM   7632 O OD2 . ASP B 1 405 ? 12.274  -7.997  21.975  1.00 18.32 ? 404  ASP B OD2 1 
ATOM   7633 N N   . PHE B 1 406 ? 8.100   -5.247  19.146  1.00 15.59 ? 405  PHE B N   1 
ATOM   7634 C CA  . PHE B 1 406 ? 7.503   -3.948  18.823  1.00 16.48 ? 405  PHE B CA  1 
ATOM   7635 C C   . PHE B 1 406 ? 7.348   -3.218  20.154  1.00 16.47 ? 405  PHE B C   1 
ATOM   7636 O O   . PHE B 1 406 ? 6.781   -3.769  21.088  1.00 17.37 ? 405  PHE B O   1 
ATOM   7637 C CB  . PHE B 1 406 ? 6.125   -4.155  18.164  1.00 16.66 ? 405  PHE B CB  1 
ATOM   7638 C CG  . PHE B 1 406 ? 6.174   -4.477  16.670  1.00 16.93 ? 405  PHE B CG  1 
ATOM   7639 C CD1 . PHE B 1 406 ? 6.656   -5.707  16.208  1.00 17.19 ? 405  PHE B CD1 1 
ATOM   7640 C CD2 . PHE B 1 406 ? 5.674   -3.567  15.735  1.00 15.73 ? 405  PHE B CD2 1 
ATOM   7641 C CE1 . PHE B 1 406 ? 6.682   -5.997  14.812  1.00 17.08 ? 405  PHE B CE1 1 
ATOM   7642 C CE2 . PHE B 1 406 ? 5.690   -3.844  14.368  1.00 17.30 ? 405  PHE B CE2 1 
ATOM   7643 C CZ  . PHE B 1 406 ? 6.199   -5.072  13.911  1.00 16.79 ? 405  PHE B CZ  1 
ATOM   7644 N N   . LEU B 1 407 ? 7.855   -1.989  20.265  1.00 16.48 ? 406  LEU B N   1 
ATOM   7645 C CA  . LEU B 1 407 ? 7.768   -1.256  21.535  1.00 16.08 ? 406  LEU B CA  1 
ATOM   7646 C C   . LEU B 1 407 ? 7.067   0.086   21.299  1.00 16.47 ? 406  LEU B C   1 
ATOM   7647 O O   . LEU B 1 407 ? 7.227   0.685   20.224  1.00 16.80 ? 406  LEU B O   1 
ATOM   7648 C CB  . LEU B 1 407 ? 9.163   -1.018  22.106  1.00 16.70 ? 406  LEU B CB  1 
ATOM   7649 C CG  . LEU B 1 407 ? 10.045  -2.261  22.294  1.00 16.89 ? 406  LEU B CG  1 
ATOM   7650 C CD1 . LEU B 1 407 ? 11.039  -2.400  21.119  1.00 18.90 ? 406  LEU B CD1 1 
ATOM   7651 C CD2 . LEU B 1 407 ? 10.754  -2.181  23.627  1.00 19.17 ? 406  LEU B CD2 1 
ATOM   7652 N N   . ILE B 1 408 ? 6.251   0.525   22.253  1.00 16.32 ? 407  ILE B N   1 
ATOM   7653 C CA  . ILE B 1 408 ? 5.628   1.861   22.152  1.00 16.68 ? 407  ILE B CA  1 
ATOM   7654 C C   . ILE B 1 408 ? 5.202   2.413   23.504  1.00 17.19 ? 407  ILE B C   1 
ATOM   7655 O O   . ILE B 1 408 ? 4.762   1.649   24.359  1.00 17.06 ? 407  ILE B O   1 
ATOM   7656 C CB  . ILE B 1 408 ? 4.407   1.854   21.153  1.00 16.09 ? 407  ILE B CB  1 
ATOM   7657 C CG1 . ILE B 1 408 ? 4.117   3.269   20.610  1.00 16.24 ? 407  ILE B CG1 1 
ATOM   7658 C CG2 . ILE B 1 408 ? 3.135   1.241   21.796  1.00 18.09 ? 407  ILE B CG2 1 
ATOM   7659 C CD1 . ILE B 1 408 ? 3.068   3.309   19.449  1.00 17.26 ? 407  ILE B CD1 1 
ATOM   7660 N N   . PRO B 1 409 ? 5.318   3.731   23.701  1.00 17.73 ? 408  PRO B N   1 
ATOM   7661 C CA  . PRO B 1 409 ? 4.612   4.395   24.809  1.00 17.68 ? 408  PRO B CA  1 
ATOM   7662 C C   . PRO B 1 409 ? 3.152   4.752   24.462  1.00 17.93 ? 408  PRO B C   1 
ATOM   7663 O O   . PRO B 1 409 ? 2.823   5.170   23.338  1.00 17.09 ? 408  PRO B O   1 
ATOM   7664 C CB  . PRO B 1 409 ? 5.439   5.667   25.032  1.00 17.98 ? 408  PRO B CB  1 
ATOM   7665 C CG  . PRO B 1 409 ? 5.970   5.987   23.663  1.00 17.63 ? 408  PRO B CG  1 
ATOM   7666 C CD  . PRO B 1 409 ? 6.163   4.676   22.948  1.00 17.83 ? 408  PRO B CD  1 
ATOM   7667 N N   . VAL B 1 410 ? 2.271   4.564   25.442  1.00 18.19 ? 409  VAL B N   1 
ATOM   7668 C CA  . VAL B 1 410 ? 0.866   4.898   25.281  1.00 19.12 ? 409  VAL B CA  1 
ATOM   7669 C C   . VAL B 1 410 ? 0.732   6.412   25.167  1.00 19.32 ? 409  VAL B C   1 
ATOM   7670 O O   . VAL B 1 410 ? -0.011  6.900   24.320  1.00 19.47 ? 409  VAL B O   1 
ATOM   7671 C CB  . VAL B 1 410 ? 0.021   4.421   26.467  1.00 19.02 ? 409  VAL B CB  1 
ATOM   7672 C CG1 . VAL B 1 410 ? -1.390  4.989   26.388  1.00 18.40 ? 409  VAL B CG1 1 
ATOM   7673 C CG2 . VAL B 1 410 ? -0.016  2.888   26.538  1.00 19.75 ? 409  VAL B CG2 1 
ATOM   7674 N N   . GLN B 1 411 ? 1.462   7.131   26.019  1.00 19.56 ? 410  GLN B N   1 
ATOM   7675 C CA  . GLN B 1 411 ? 1.409   8.591   26.049  1.00 19.71 ? 410  GLN B CA  1 
ATOM   7676 C C   . GLN B 1 411 ? 2.617   9.161   25.329  1.00 20.05 ? 410  GLN B C   1 
ATOM   7677 O O   . GLN B 1 411 ? 3.751   8.761   25.597  1.00 19.62 ? 410  GLN B O   1 
ATOM   7678 C CB  . GLN B 1 411 ? 1.385   9.086   27.492  1.00 20.54 ? 410  GLN B CB  1 
ATOM   7679 C CG  . GLN B 1 411 ? 0.163   8.612   28.282  1.00 19.39 ? 410  GLN B CG  1 
ATOM   7680 C CD  . GLN B 1 411 ? 0.205   9.032   29.754  1.00 21.95 ? 410  GLN B CD  1 
ATOM   7681 O OE1 . GLN B 1 411 ? 0.932   9.951   30.124  1.00 20.90 ? 410  GLN B OE1 1 
ATOM   7682 N NE2 . GLN B 1 411 ? -0.589  8.363   30.586  1.00 22.23 ? 410  GLN B NE2 1 
ATOM   7683 N N   . THR B 1 412 ? 2.365   10.112  24.435  1.00 20.17 ? 411  THR B N   1 
ATOM   7684 C CA  . THR B 1 412 ? 3.429   10.752  23.673  1.00 20.25 ? 411  THR B CA  1 
ATOM   7685 C C   . THR B 1 412 ? 3.950   11.997  24.384  1.00 20.41 ? 411  THR B C   1 
ATOM   7686 O O   . THR B 1 412 ? 3.219   12.655  25.126  1.00 19.92 ? 411  THR B O   1 
ATOM   7687 C CB  . THR B 1 412 ? 2.942   11.062  22.228  1.00 20.11 ? 411  THR B CB  1 
ATOM   7688 O OG1 . THR B 1 412 ? 3.973   11.746  21.497  1.00 20.28 ? 411  THR B OG1 1 
ATOM   7689 C CG2 . THR B 1 412 ? 1.754   12.039  22.227  1.00 20.47 ? 411  THR B CG2 1 
ATOM   7690 N N   . GLN B 1 413 ? 5.227   12.292  24.178  1.00 20.56 ? 412  GLN B N   1 
ATOM   7691 C CA  . GLN B 1 413 ? 5.819   13.537  24.655  1.00 20.88 ? 412  GLN B CA  1 
ATOM   7692 C C   . GLN B 1 413 ? 5.298   14.745  23.884  1.00 21.18 ? 412  GLN B C   1 
ATOM   7693 O O   . GLN B 1 413 ? 5.463   15.885  24.339  1.00 21.42 ? 412  GLN B O   1 
ATOM   7694 C CB  . GLN B 1 413 ? 7.344   13.468  24.584  1.00 21.08 ? 412  GLN B CB  1 
ATOM   7695 C CG  . GLN B 1 413 ? 7.959   12.311  25.390  1.00 21.24 ? 412  GLN B CG  1 
ATOM   7696 C CD  . GLN B 1 413 ? 7.978   12.563  26.897  1.00 22.94 ? 412  GLN B CD  1 
ATOM   7697 O OE1 . GLN B 1 413 ? 7.722   13.678  27.356  1.00 24.84 ? 412  GLN B OE1 1 
ATOM   7698 N NE2 . GLN B 1 413 ? 8.285   11.532  27.658  1.00 22.16 ? 412  GLN B NE2 1 
ATOM   7699 N N   . HIS B 1 414 ? 4.692   14.501  22.717  1.00 20.89 ? 413  HIS B N   1 
ATOM   7700 C CA  . HIS B 1 414 ? 4.211   15.575  21.848  1.00 21.74 ? 413  HIS B CA  1 
ATOM   7701 C C   . HIS B 1 414 ? 2.802   15.315  21.299  1.00 21.21 ? 413  HIS B C   1 
ATOM   7702 O O   . HIS B 1 414 ? 2.639   14.942  20.132  1.00 21.07 ? 413  HIS B O   1 
ATOM   7703 C CB  . HIS B 1 414 ? 5.202   15.820  20.704  1.00 21.50 ? 413  HIS B CB  1 
ATOM   7704 C CG  . HIS B 1 414 ? 6.577   16.147  21.178  1.00 22.97 ? 413  HIS B CG  1 
ATOM   7705 N ND1 . HIS B 1 414 ? 6.952   17.422  21.554  1.00 23.50 ? 413  HIS B ND1 1 
ATOM   7706 C CD2 . HIS B 1 414 ? 7.663   15.363  21.363  1.00 23.56 ? 413  HIS B CD2 1 
ATOM   7707 C CE1 . HIS B 1 414 ? 8.218   17.404  21.937  1.00 25.31 ? 413  HIS B CE1 1 
ATOM   7708 N NE2 . HIS B 1 414 ? 8.670   16.167  21.831  1.00 23.54 ? 413  HIS B NE2 1 
ATOM   7709 N N   . PRO B 1 415 ? 1.784   15.533  22.135  1.00 21.69 ? 414  PRO B N   1 
ATOM   7710 C CA  . PRO B 1 415 ? 0.398   15.229  21.750  1.00 21.64 ? 414  PRO B CA  1 
ATOM   7711 C C   . PRO B 1 415 ? -0.182  16.277  20.798  1.00 21.68 ? 414  PRO B C   1 
ATOM   7712 O O   . PRO B 1 415 ? -1.257  16.831  21.062  1.00 21.73 ? 414  PRO B O   1 
ATOM   7713 C CB  . PRO B 1 415 ? -0.345  15.206  23.102  1.00 21.70 ? 414  PRO B CB  1 
ATOM   7714 C CG  . PRO B 1 415 ? 0.450   16.121  24.000  1.00 22.22 ? 414  PRO B CG  1 
ATOM   7715 C CD  . PRO B 1 415 ? 1.875   16.076  23.500  1.00 21.70 ? 414  PRO B CD  1 
ATOM   7716 N N   . ILE B 1 416 ? 0.533   16.550  19.706  1.00 21.96 ? 415  ILE B N   1 
ATOM   7717 C CA  . ILE B 1 416 ? 0.091   17.541  18.717  1.00 21.35 ? 415  ILE B CA  1 
ATOM   7718 C C   . ILE B 1 416 ? -1.207  17.174  18.022  1.00 21.90 ? 415  ILE B C   1 
ATOM   7719 O O   . ILE B 1 416 ? -1.598  16.004  17.985  1.00 20.64 ? 415  ILE B O   1 
ATOM   7720 C CB  . ILE B 1 416 ? 1.202   17.864  17.676  1.00 21.08 ? 415  ILE B CB  1 
ATOM   7721 C CG1 . ILE B 1 416 ? 1.657   16.604  16.907  1.00 19.45 ? 415  ILE B CG1 1 
ATOM   7722 C CG2 . ILE B 1 416 ? 2.359   18.577  18.366  1.00 20.58 ? 415  ILE B CG2 1 
ATOM   7723 C CD1 . ILE B 1 416 ? 2.532   16.905  15.681  1.00 18.87 ? 415  ILE B CD1 1 
ATOM   7724 N N   . ARG B 1 417 ? -1.874  18.191  17.471  1.00 22.27 ? 416  ARG B N   1 
ATOM   7725 C CA  . ARG B 1 417 ? -3.151  18.021  16.764  1.00 22.93 ? 416  ARG B CA  1 
ATOM   7726 C C   . ARG B 1 417 ? -4.124  17.160  17.566  1.00 22.55 ? 416  ARG B C   1 
ATOM   7727 O O   . ARG B 1 417 ? -4.715  16.232  17.021  1.00 21.78 ? 416  ARG B O   1 
ATOM   7728 C CB  . ARG B 1 417 ? -2.968  17.413  15.356  1.00 23.74 ? 416  ARG B CB  1 
ATOM   7729 C CG  . ARG B 1 417 ? -1.879  18.025  14.466  1.00 26.11 ? 416  ARG B CG  1 
ATOM   7730 C CD  . ARG B 1 417 ? -2.344  18.838  13.234  1.00 26.05 ? 416  ARG B CD  1 
ATOM   7731 N NE  . ARG B 1 417 ? -3.604  18.439  12.592  1.00 28.00 ? 416  ARG B NE  1 
ATOM   7732 C CZ  . ARG B 1 417 ? -3.714  17.778  11.434  1.00 28.65 ? 416  ARG B CZ  1 
ATOM   7733 N NH1 . ARG B 1 417 ? -4.919  17.506  10.952  1.00 28.54 ? 416  ARG B NH1 1 
ATOM   7734 N NH2 . ARG B 1 417 ? -2.640  17.372  10.753  1.00 26.31 ? 416  ARG B NH2 1 
ATOM   7735 N N   . LYS B 1 418 ? -4.245  17.449  18.864  1.00 22.80 ? 417  LYS B N   1 
ATOM   7736 C CA  . LYS B 1 418 ? -5.171  16.747  19.764  1.00 22.96 ? 417  LYS B CA  1 
ATOM   7737 C C   . LYS B 1 418 ? -4.975  15.236  19.719  1.00 22.37 ? 417  LYS B C   1 
ATOM   7738 O O   . LYS B 1 418 ? -5.945  14.470  19.747  1.00 23.15 ? 417  LYS B O   1 
ATOM   7739 C CB  . LYS B 1 418 ? -6.632  17.113  19.454  1.00 23.40 ? 417  LYS B CB  1 
ATOM   7740 C CG  . LYS B 1 418 ? -7.029  18.516  19.919  1.00 25.02 ? 417  LYS B CG  1 
ATOM   7741 C CD  . LYS B 1 418 ? -7.836  19.270  18.847  1.00 27.83 ? 417  LYS B CD  1 
ATOM   7742 C CE  A LYS B 1 418 ? -8.457  20.542  19.420  0.50 26.66 ? 417  LYS B CE  1 
ATOM   7743 C CE  B LYS B 1 418 ? -9.289  18.836  18.787  0.50 28.28 ? 417  LYS B CE  1 
ATOM   7744 N NZ  A LYS B 1 418 ? -9.945  20.553  19.329  0.50 27.53 ? 417  LYS B NZ  1 
ATOM   7745 N NZ  B LYS B 1 418 ? -9.896  19.199  17.476  0.50 28.40 ? 417  LYS B NZ  1 
ATOM   7746 N N   . GLY B 1 419 ? -3.714  14.826  19.625  1.00 21.00 ? 418  GLY B N   1 
ATOM   7747 C CA  . GLY B 1 419 ? -3.343  13.418  19.671  1.00 21.01 ? 418  GLY B CA  1 
ATOM   7748 C C   . GLY B 1 419 ? -3.436  12.648  18.363  1.00 20.25 ? 418  GLY B C   1 
ATOM   7749 O O   . GLY B 1 419 ? -3.282  11.425  18.368  1.00 19.63 ? 418  GLY B O   1 
ATOM   7750 N N   . LEU B 1 420 ? -3.674  13.349  17.252  1.00 19.87 ? 419  LEU B N   1 
ATOM   7751 C CA  . LEU B 1 420 ? -3.909  12.690  15.964  1.00 19.69 ? 419  LEU B CA  1 
ATOM   7752 C C   . LEU B 1 420 ? -2.714  11.851  15.498  1.00 18.52 ? 419  LEU B C   1 
ATOM   7753 O O   . LEU B 1 420 ? -2.886  10.701  15.079  1.00 18.30 ? 419  LEU B O   1 
ATOM   7754 C CB  . LEU B 1 420 ? -4.280  13.689  14.863  1.00 20.54 ? 419  LEU B CB  1 
ATOM   7755 C CG  . LEU B 1 420 ? -4.368  13.176  13.411  1.00 21.91 ? 419  LEU B CG  1 
ATOM   7756 C CD1 . LEU B 1 420 ? -5.504  12.167  13.208  1.00 22.10 ? 419  LEU B CD1 1 
ATOM   7757 C CD2 . LEU B 1 420 ? -4.500  14.337  12.420  1.00 24.39 ? 419  LEU B CD2 1 
ATOM   7758 N N   . HIS B 1 421 ? -1.527  12.442  15.541  1.00 18.17 ? 420  HIS B N   1 
ATOM   7759 C CA  . HIS B 1 421 ? -0.328  11.724  15.148  1.00 18.19 ? 420  HIS B CA  1 
ATOM   7760 C C   . HIS B 1 421 ? -0.131  10.449  15.955  1.00 18.54 ? 420  HIS B C   1 
ATOM   7761 O O   . HIS B 1 421 ? 0.188   9.379   15.392  1.00 19.31 ? 420  HIS B O   1 
ATOM   7762 C CB  . HIS B 1 421 ? 0.912   12.618  15.260  1.00 18.40 ? 420  HIS B CB  1 
ATOM   7763 C CG  . HIS B 1 421 ? 1.035   13.627  14.156  1.00 18.79 ? 420  HIS B CG  1 
ATOM   7764 N ND1 . HIS B 1 421 ? 2.058   13.601  13.231  1.00 18.20 ? 420  HIS B ND1 1 
ATOM   7765 C CD2 . HIS B 1 421 ? 0.286   14.717  13.855  1.00 20.27 ? 420  HIS B CD2 1 
ATOM   7766 C CE1 . HIS B 1 421 ? 1.923   14.618  12.397  1.00 19.02 ? 420  HIS B CE1 1 
ATOM   7767 N NE2 . HIS B 1 421 ? 0.855   15.309  12.752  1.00 19.25 ? 420  HIS B NE2 1 
ATOM   7768 N N   . HIS B 1 422 ? -0.330  10.541  17.269  1.00 17.97 ? 421  HIS B N   1 
ATOM   7769 C CA  . HIS B 1 422 ? -0.083  9.383   18.131  1.00 18.91 ? 421  HIS B CA  1 
ATOM   7770 C C   . HIS B 1 422 ? -1.137  8.288   17.972  1.00 18.91 ? 421  HIS B C   1 
ATOM   7771 O O   . HIS B 1 422 ? -0.835  7.098   18.103  1.00 19.33 ? 421  HIS B O   1 
ATOM   7772 C CB  . HIS B 1 422 ? 0.087   9.790   19.603  1.00 19.07 ? 421  HIS B CB  1 
ATOM   7773 C CG  . HIS B 1 422 ? 0.848   8.787   20.412  1.00 19.87 ? 421  HIS B CG  1 
ATOM   7774 N ND1 . HIS B 1 422 ? 2.122   8.373   20.083  1.00 18.57 ? 421  HIS B ND1 1 
ATOM   7775 C CD2 . HIS B 1 422 ? 0.506   8.099   21.526  1.00 18.89 ? 421  HIS B CD2 1 
ATOM   7776 C CE1 . HIS B 1 422 ? 2.529   7.468   20.953  1.00 19.03 ? 421  HIS B CE1 1 
ATOM   7777 N NE2 . HIS B 1 422 ? 1.568   7.283   21.840  1.00 19.54 ? 421  HIS B NE2 1 
ATOM   7778 N N   . LYS B 1 423 ? -2.373  8.694   17.692  1.00 19.45 ? 422  LYS B N   1 
ATOM   7779 C CA  . LYS B 1 423 ? -3.454  7.765   17.378  1.00 19.69 ? 422  LYS B CA  1 
ATOM   7780 C C   . LYS B 1 423 ? -3.063  6.916   16.155  1.00 19.35 ? 422  LYS B C   1 
ATOM   7781 O O   . LYS B 1 423 ? -3.169  5.685   16.175  1.00 18.97 ? 422  LYS B O   1 
ATOM   7782 C CB  . LYS B 1 423 ? -4.752  8.551   17.110  1.00 19.27 ? 422  LYS B CB  1 
ATOM   7783 C CG  . LYS B 1 423 ? -5.909  7.696   16.613  1.00 21.61 ? 422  LYS B CG  1 
ATOM   7784 C CD  . LYS B 1 423 ? -7.211  8.480   16.560  1.00 25.46 ? 422  LYS B CD  1 
ATOM   7785 C CE  . LYS B 1 423 ? -7.387  9.161   15.223  1.00 27.75 ? 422  LYS B CE  1 
ATOM   7786 N NZ  . LYS B 1 423 ? -8.640  9.989   15.192  1.00 31.13 ? 422  LYS B NZ  1 
ATOM   7787 N N   . ILE B 1 424 ? -2.545  7.579   15.128  1.00 19.01 ? 423  ILE B N   1 
ATOM   7788 C CA  . ILE B 1 424 ? -2.147  6.895   13.905  1.00 18.85 ? 423  ILE B CA  1 
ATOM   7789 C C   . ILE B 1 424 ? -0.965  5.967   14.181  1.00 18.64 ? 423  ILE B C   1 
ATOM   7790 O O   . ILE B 1 424 ? -0.967  4.811   13.731  1.00 18.90 ? 423  ILE B O   1 
ATOM   7791 C CB  . ILE B 1 424 ? -1.840  7.912   12.786  1.00 18.43 ? 423  ILE B CB  1 
ATOM   7792 C CG1 . ILE B 1 424 ? -3.119  8.677   12.425  1.00 20.19 ? 423  ILE B CG1 1 
ATOM   7793 C CG2 . ILE B 1 424 ? -1.278  7.210   11.554  1.00 17.60 ? 423  ILE B CG2 1 
ATOM   7794 C CD1 . ILE B 1 424 ? -2.892  9.893   11.520  1.00 21.55 ? 423  ILE B CD1 1 
ATOM   7795 N N   . LEU B 1 425 ? 0.014   6.474   14.937  1.00 18.55 ? 424  LEU B N   1 
ATOM   7796 C CA  . LEU B 1 425 ? 1.205   5.700   15.314  1.00 18.60 ? 424  LEU B CA  1 
ATOM   7797 C C   . LEU B 1 425 ? 0.806   4.429   16.067  1.00 18.37 ? 424  LEU B C   1 
ATOM   7798 O O   . LEU B 1 425 ? 1.263   3.315   15.743  1.00 17.93 ? 424  LEU B O   1 
ATOM   7799 C CB  . LEU B 1 425 ? 2.148   6.548   16.178  1.00 17.89 ? 424  LEU B CB  1 
ATOM   7800 C CG  . LEU B 1 425 ? 3.499   5.886   16.516  1.00 17.75 ? 424  LEU B CG  1 
ATOM   7801 C CD1 . LEU B 1 425 ? 4.401   5.829   15.285  1.00 16.09 ? 424  LEU B CD1 1 
ATOM   7802 C CD2 . LEU B 1 425 ? 4.172   6.629   17.651  1.00 14.61 ? 424  LEU B CD2 1 
ATOM   7803 N N   . LEU B 1 426 ? -0.065  4.593   17.064  1.00 18.38 ? 425  LEU B N   1 
ATOM   7804 C CA  . LEU B 1 426 ? -0.584  3.440   17.817  1.00 18.96 ? 425  LEU B CA  1 
ATOM   7805 C C   . LEU B 1 426 ? -1.298  2.435   16.922  1.00 18.73 ? 425  LEU B C   1 
ATOM   7806 O O   . LEU B 1 426 ? -1.081  1.222   17.047  1.00 18.64 ? 425  LEU B O   1 
ATOM   7807 C CB  . LEU B 1 426 ? -1.513  3.887   18.958  1.00 19.17 ? 425  LEU B CB  1 
ATOM   7808 C CG  . LEU B 1 426 ? -0.816  4.477   20.191  1.00 18.72 ? 425  LEU B CG  1 
ATOM   7809 C CD1 . LEU B 1 426 ? -1.782  5.400   20.978  1.00 21.15 ? 425  LEU B CD1 1 
ATOM   7810 C CD2 . LEU B 1 426 ? -0.186  3.409   21.102  1.00 19.50 ? 425  LEU B CD2 1 
ATOM   7811 N N   . ALA B 1 427 ? -2.155  2.936   16.037  1.00 18.72 ? 426  ALA B N   1 
ATOM   7812 C CA  . ALA B 1 427 ? -2.911  2.080   15.127  1.00 19.34 ? 426  ALA B CA  1 
ATOM   7813 C C   . ALA B 1 427 ? -1.992  1.257   14.212  1.00 19.01 ? 426  ALA B C   1 
ATOM   7814 O O   . ALA B 1 427 ? -2.255  0.089   13.962  1.00 19.17 ? 426  ALA B O   1 
ATOM   7815 C CB  . ALA B 1 427 ? -3.913  2.902   14.319  1.00 19.21 ? 426  ALA B CB  1 
ATOM   7816 N N   . ASN B 1 428 ? -0.895  1.855   13.745  1.00 19.02 ? 427  ASN B N   1 
ATOM   7817 C CA  . ASN B 1 428 ? 0.112   1.123   12.981  1.00 18.29 ? 427  ASN B CA  1 
ATOM   7818 C C   . ASN B 1 428 ? 0.864   0.065   13.803  1.00 17.74 ? 427  ASN B C   1 
ATOM   7819 O O   . ASN B 1 428 ? 1.078   -1.065  13.341  1.00 17.54 ? 427  ASN B O   1 
ATOM   7820 C CB  . ASN B 1 428 ? 1.102   2.109   12.355  1.00 18.47 ? 427  ASN B CB  1 
ATOM   7821 C CG  . ASN B 1 428 ? 0.566   2.710   11.085  1.00 19.38 ? 427  ASN B CG  1 
ATOM   7822 O OD1 . ASN B 1 428 ? 0.720   2.142   10.026  1.00 21.41 ? 427  ASN B OD1 1 
ATOM   7823 N ND2 . ASN B 1 428 ? -0.105  3.845   11.193  1.00 23.08 ? 427  ASN B ND2 1 
ATOM   7824 N N   . PHE B 1 429 ? 1.259   0.439   15.018  1.00 17.48 ? 428  PHE B N   1 
ATOM   7825 C CA  . PHE B 1 429 ? 1.913   -0.475  15.971  1.00 17.78 ? 428  PHE B CA  1 
ATOM   7826 C C   . PHE B 1 429 ? 1.068   -1.742  16.149  1.00 18.33 ? 428  PHE B C   1 
ATOM   7827 O O   . PHE B 1 429 ? 1.565   -2.877  16.083  1.00 18.11 ? 428  PHE B O   1 
ATOM   7828 C CB  . PHE B 1 429 ? 2.032   0.234   17.322  1.00 17.55 ? 428  PHE B CB  1 
ATOM   7829 C CG  . PHE B 1 429 ? 2.483   -0.652  18.447  1.00 16.99 ? 428  PHE B CG  1 
ATOM   7830 C CD1 . PHE B 1 429 ? 3.841   -0.836  18.693  1.00 18.65 ? 428  PHE B CD1 1 
ATOM   7831 C CD2 . PHE B 1 429 ? 1.556   -1.251  19.296  1.00 18.52 ? 428  PHE B CD2 1 
ATOM   7832 C CE1 . PHE B 1 429 ? 4.271   -1.636  19.752  1.00 20.03 ? 428  PHE B CE1 1 
ATOM   7833 C CE2 . PHE B 1 429 ? 1.978   -2.060  20.351  1.00 19.34 ? 428  PHE B CE2 1 
ATOM   7834 C CZ  . PHE B 1 429 ? 3.345   -2.247  20.576  1.00 19.40 ? 428  PHE B CZ  1 
ATOM   7835 N N   . LEU B 1 430 ? -0.218  -1.521  16.386  1.00 17.51 ? 429  LEU B N   1 
ATOM   7836 C CA  . LEU B 1 430 ? -1.142  -2.615  16.637  1.00 18.45 ? 429  LEU B CA  1 
ATOM   7837 C C   . LEU B 1 430 ? -1.387  -3.422  15.377  1.00 18.32 ? 429  LEU B C   1 
ATOM   7838 O O   . LEU B 1 430 ? -1.342  -4.656  15.401  1.00 18.43 ? 429  LEU B O   1 
ATOM   7839 C CB  . LEU B 1 430 ? -2.468  -2.075  17.185  1.00 18.41 ? 429  LEU B CB  1 
ATOM   7840 C CG  . LEU B 1 430 ? -2.395  -1.439  18.578  1.00 19.51 ? 429  LEU B CG  1 
ATOM   7841 C CD1 . LEU B 1 430 ? -3.624  -0.542  18.843  1.00 17.87 ? 429  LEU B CD1 1 
ATOM   7842 C CD2 . LEU B 1 430 ? -2.181  -2.466  19.726  1.00 19.49 ? 429  LEU B CD2 1 
ATOM   7843 N N   . ALA B 1 431 ? -1.630  -2.714  14.275  1.00 18.11 ? 430  ALA B N   1 
ATOM   7844 C CA  . ALA B 1 431 ? -1.966  -3.352  12.998  1.00 18.93 ? 430  ALA B CA  1 
ATOM   7845 C C   . ALA B 1 431 ? -0.861  -4.237  12.444  1.00 18.92 ? 430  ALA B C   1 
ATOM   7846 O O   . ALA B 1 431 ? -1.147  -5.259  11.818  1.00 18.77 ? 430  ALA B O   1 
ATOM   7847 C CB  . ALA B 1 431 ? -2.336  -2.316  11.972  1.00 19.00 ? 430  ALA B CB  1 
ATOM   7848 N N   . GLN B 1 432 ? 0.397   -3.837  12.648  1.00 18.32 ? 431  GLN B N   1 
ATOM   7849 C CA  . GLN B 1 432 ? 1.499   -4.595  12.069  1.00 18.69 ? 431  GLN B CA  1 
ATOM   7850 C C   . GLN B 1 432 ? 1.638   -5.972  12.707  1.00 18.44 ? 431  GLN B C   1 
ATOM   7851 O O   . GLN B 1 432 ? 1.812   -6.969  11.999  1.00 18.85 ? 431  GLN B O   1 
ATOM   7852 C CB  . GLN B 1 432 ? 2.816   -3.812  12.127  1.00 18.59 ? 431  GLN B CB  1 
ATOM   7853 C CG  . GLN B 1 432 ? 2.864   -2.652  11.131  1.00 18.70 ? 431  GLN B CG  1 
ATOM   7854 C CD  . GLN B 1 432 ? 2.971   -3.114  9.671   1.00 20.24 ? 431  GLN B CD  1 
ATOM   7855 O OE1 . GLN B 1 432 ? 3.488   -4.207  9.375   1.00 19.86 ? 431  GLN B OE1 1 
ATOM   7856 N NE2 . GLN B 1 432 ? 2.514   -2.270  8.760   1.00 17.75 ? 431  GLN B NE2 1 
ATOM   7857 N N   . THR B 1 433 ? 1.534   -6.048  14.031  1.00 18.62 ? 432  THR B N   1 
ATOM   7858 C CA  . THR B 1 433 ? 1.673   -7.362  14.679  1.00 18.20 ? 432  THR B CA  1 
ATOM   7859 C C   . THR B 1 433 ? 0.475   -8.239  14.350  1.00 18.80 ? 432  THR B C   1 
ATOM   7860 O O   . THR B 1 433 ? 0.619   -9.454  14.157  1.00 17.96 ? 432  THR B O   1 
ATOM   7861 C CB  . THR B 1 433 ? 1.923   -7.283  16.220  1.00 18.24 ? 432  THR B CB  1 
ATOM   7862 O OG1 . THR B 1 433 ? 0.834   -6.624  16.880  1.00 18.23 ? 432  THR B OG1 1 
ATOM   7863 C CG2 . THR B 1 433 ? 3.149   -6.434  16.526  1.00 16.41 ? 432  THR B CG2 1 
ATOM   7864 N N   . GLU B 1 434 ? -0.702  -7.617  14.253  1.00 19.07 ? 433  GLU B N   1 
ATOM   7865 C CA  . GLU B 1 434 ? -1.915  -8.346  13.860  1.00 19.46 ? 433  GLU B CA  1 
ATOM   7866 C C   . GLU B 1 434 ? -1.752  -8.902  12.442  1.00 19.34 ? 433  GLU B C   1 
ATOM   7867 O O   . GLU B 1 434 ? -2.046  -10.079 12.191  1.00 19.27 ? 433  GLU B O   1 
ATOM   7868 C CB  . GLU B 1 434 ? -3.143  -7.431  13.956  1.00 19.63 ? 433  GLU B CB  1 
ATOM   7869 C CG  . GLU B 1 434 ? -4.467  -8.125  13.633  1.00 20.35 ? 433  GLU B CG  1 
ATOM   7870 C CD  . GLU B 1 434 ? -5.647  -7.171  13.577  1.00 23.78 ? 433  GLU B CD  1 
ATOM   7871 O OE1 . GLU B 1 434 ? -5.464  -5.972  13.250  1.00 24.17 ? 433  GLU B OE1 1 
ATOM   7872 O OE2 . GLU B 1 434 ? -6.780  -7.613  13.875  1.00 25.11 ? 433  GLU B OE2 1 
ATOM   7873 N N   . ALA B 1 435 ? -1.255  -8.059  11.533  1.00 18.70 ? 434  ALA B N   1 
ATOM   7874 C CA  . ALA B 1 435 ? -1.005  -8.437  10.141  1.00 18.40 ? 434  ALA B CA  1 
ATOM   7875 C C   . ALA B 1 435 ? 0.005   -9.576  10.039  1.00 18.97 ? 434  ALA B C   1 
ATOM   7876 O O   . ALA B 1 435 ? -0.193  -10.542 9.281   1.00 18.90 ? 434  ALA B O   1 
ATOM   7877 C CB  . ALA B 1 435 ? -0.490  -7.252  9.384   1.00 18.31 ? 434  ALA B CB  1 
ATOM   7878 N N   . LEU B 1 436 ? 1.104   -9.440  10.783  1.00 18.83 ? 435  LEU B N   1 
ATOM   7879 C CA  . LEU B 1 436 ? 2.137   -10.468 10.800  1.00 19.17 ? 435  LEU B CA  1 
ATOM   7880 C C   . LEU B 1 436 ? 1.559   -11.794 11.276  1.00 20.07 ? 435  LEU B C   1 
ATOM   7881 O O   . LEU B 1 436 ? 1.893   -12.844 10.718  1.00 19.73 ? 435  LEU B O   1 
ATOM   7882 C CB  . LEU B 1 436 ? 3.307   -10.040 11.680  1.00 19.54 ? 435  LEU B CB  1 
ATOM   7883 C CG  . LEU B 1 436 ? 4.205   -8.994  10.981  1.00 18.86 ? 435  LEU B CG  1 
ATOM   7884 C CD1 . LEU B 1 436 ? 5.107   -8.339  12.003  1.00 20.74 ? 435  LEU B CD1 1 
ATOM   7885 C CD2 . LEU B 1 436 ? 5.018   -9.619  9.809   1.00 20.95 ? 435  LEU B CD2 1 
ATOM   7886 N N   . MET B 1 437 ? 0.700   -11.748 12.299  1.00 19.98 ? 436  MET B N   1 
ATOM   7887 C CA  . MET B 1 437 ? 0.075   -12.982 12.805  1.00 21.28 ? 436  MET B CA  1 
ATOM   7888 C C   . MET B 1 437 ? -0.929  -13.579 11.813  1.00 21.64 ? 436  MET B C   1 
ATOM   7889 O O   . MET B 1 437 ? -0.853  -14.767 11.464  1.00 21.85 ? 436  MET B O   1 
ATOM   7890 C CB  . MET B 1 437 ? -0.619  -12.755 14.159  1.00 21.91 ? 436  MET B CB  1 
ATOM   7891 C CG  . MET B 1 437 ? -1.590  -13.897 14.523  1.00 24.25 ? 436  MET B CG  1 
ATOM   7892 S SD  . MET B 1 437 ? -1.900  -13.961 16.261  1.00 32.03 ? 436  MET B SD  1 
ATOM   7893 C CE  . MET B 1 437 ? -2.941  -12.570 16.447  1.00 30.24 ? 436  MET B CE  1 
ATOM   7894 N N   . LYS B 1 438 ? -1.859  -12.743 11.365  1.00 22.21 ? 437  LYS B N   1 
ATOM   7895 C CA  . LYS B 1 438 ? -3.064  -13.188 10.681  1.00 23.29 ? 437  LYS B CA  1 
ATOM   7896 C C   . LYS B 1 438 ? -2.831  -13.433 9.191   1.00 22.89 ? 437  LYS B C   1 
ATOM   7897 O O   . LYS B 1 438 ? -3.391  -14.369 8.611   1.00 22.33 ? 437  LYS B O   1 
ATOM   7898 C CB  . LYS B 1 438 ? -4.172  -12.150 10.948  1.00 24.41 ? 437  LYS B CB  1 
ATOM   7899 C CG  . LYS B 1 438 ? -5.310  -12.086 9.970   1.00 28.09 ? 437  LYS B CG  1 
ATOM   7900 C CD  . LYS B 1 438 ? -6.321  -11.009 10.392  1.00 32.38 ? 437  LYS B CD  1 
ATOM   7901 C CE  . LYS B 1 438 ? -7.527  -11.631 11.095  1.00 34.03 ? 437  LYS B CE  1 
ATOM   7902 N NZ  . LYS B 1 438 ? -8.809  -10.991 10.684  1.00 36.30 ? 437  LYS B NZ  1 
ATOM   7903 N N   . GLY B 1 439 ? -1.990  -12.600 8.576   1.00 21.91 ? 438  GLY B N   1 
ATOM   7904 C CA  . GLY B 1 439 ? -1.822  -12.634 7.134   1.00 20.95 ? 438  GLY B CA  1 
ATOM   7905 C C   . GLY B 1 439 ? -3.105  -12.287 6.392   1.00 20.58 ? 438  GLY B C   1 
ATOM   7906 O O   . GLY B 1 439 ? -4.015  -11.668 6.941   1.00 21.12 ? 438  GLY B O   1 
ATOM   7907 N N   . LYS B 1 440 ? -3.161  -12.676 5.126   1.00 20.28 ? 439  LYS B N   1 
ATOM   7908 C CA  . LYS B 1 440 ? -4.336  -12.473 4.289   1.00 20.36 ? 439  LYS B CA  1 
ATOM   7909 C C   . LYS B 1 440 ? -4.526  -13.699 3.413   1.00 20.31 ? 439  LYS B C   1 
ATOM   7910 O O   . LYS B 1 440 ? -3.670  -14.023 2.604   1.00 20.29 ? 439  LYS B O   1 
ATOM   7911 C CB  . LYS B 1 440 ? -4.190  -11.203 3.434   1.00 20.19 ? 439  LYS B CB  1 
ATOM   7912 C CG  . LYS B 1 440 ? -5.368  -10.937 2.485   1.00 21.00 ? 439  LYS B CG  1 
ATOM   7913 C CD  . LYS B 1 440 ? -5.089  -9.819  1.495   1.00 21.11 ? 439  LYS B CD  1 
ATOM   7914 C CE  . LYS B 1 440 ? -5.053  -8.470  2.230   1.00 23.37 ? 439  LYS B CE  1 
ATOM   7915 N NZ  . LYS B 1 440 ? -4.908  -7.327  1.297   1.00 21.70 ? 439  LYS B NZ  1 
ATOM   7916 N N   . LEU B 1 441 ? -5.669  -14.362 3.581   1.00 20.08 ? 440  LEU B N   1 
ATOM   7917 C CA  . LEU B 1 441 ? -5.961  -15.615 2.874   1.00 19.63 ? 440  LEU B CA  1 
ATOM   7918 C C   . LEU B 1 441 ? -6.293  -15.398 1.396   1.00 19.09 ? 440  LEU B C   1 
ATOM   7919 O O   . LEU B 1 441 ? -6.751  -14.319 1.021   1.00 18.60 ? 440  LEU B O   1 
ATOM   7920 C CB  . LEU B 1 441 ? -7.112  -16.340 3.579   1.00 20.20 ? 440  LEU B CB  1 
ATOM   7921 C CG  . LEU B 1 441 ? -6.828  -16.731 5.031   1.00 21.43 ? 440  LEU B CG  1 
ATOM   7922 C CD1 . LEU B 1 441 ? -8.117  -16.870 5.814   1.00 21.85 ? 440  LEU B CD1 1 
ATOM   7923 C CD2 . LEU B 1 441 ? -5.992  -18.018 5.075   1.00 24.70 ? 440  LEU B CD2 1 
ATOM   7924 N N   . PRO B 1 442 ? -6.075  -16.413 0.558   1.00 18.65 ? 441  PRO B N   1 
ATOM   7925 C CA  . PRO B 1 442 ? -6.466  -16.331 -0.854  1.00 19.50 ? 441  PRO B CA  1 
ATOM   7926 C C   . PRO B 1 442 ? -7.910  -15.839 -1.032  1.00 19.75 ? 441  PRO B C   1 
ATOM   7927 O O   . PRO B 1 442 ? -8.140  -15.031 -1.931  1.00 20.43 ? 441  PRO B O   1 
ATOM   7928 C CB  . PRO B 1 442 ? -6.342  -17.780 -1.336  1.00 19.45 ? 441  PRO B CB  1 
ATOM   7929 C CG  . PRO B 1 442 ? -5.242  -18.340 -0.472  1.00 18.73 ? 441  PRO B CG  1 
ATOM   7930 C CD  . PRO B 1 442 ? -5.426  -17.703 0.875   1.00 19.21 ? 441  PRO B CD  1 
ATOM   7931 N N   . GLU B 1 443 ? -8.834  -16.291 -0.178  1.00 20.51 ? 442  GLU B N   1 
ATOM   7932 C CA  . GLU B 1 443 ? -10.253 -15.928 -0.301  1.00 21.24 ? 442  GLU B CA  1 
ATOM   7933 C C   . GLU B 1 443 ? -10.468 -14.436 -0.046  1.00 22.13 ? 442  GLU B C   1 
ATOM   7934 O O   . GLU B 1 443 ? -11.310 -13.806 -0.700  1.00 22.72 ? 442  GLU B O   1 
ATOM   7935 C CB  . GLU B 1 443 ? -11.158 -16.804 0.598   1.00 21.26 ? 442  GLU B CB  1 
ATOM   7936 C CG  . GLU B 1 443 ? -10.698 -17.003 2.043   1.00 22.48 ? 442  GLU B CG  1 
ATOM   7937 C CD  . GLU B 1 443 ? -9.830  -18.247 2.254   1.00 22.53 ? 442  GLU B CD  1 
ATOM   7938 O OE1 . GLU B 1 443 ? -9.955  -18.865 3.335   1.00 24.43 ? 442  GLU B OE1 1 
ATOM   7939 O OE2 . GLU B 1 443 ? -9.019  -18.602 1.357   1.00 20.76 ? 442  GLU B OE2 1 
ATOM   7940 N N   . GLU B 1 444 ? -9.666  -13.882 0.864   1.00 21.44 ? 443  GLU B N   1 
ATOM   7941 C CA  . GLU B 1 444 ? -9.737  -12.466 1.204   1.00 22.07 ? 443  GLU B CA  1 
ATOM   7942 C C   . GLU B 1 444 ? -9.135  -11.636 0.074   1.00 21.42 ? 443  GLU B C   1 
ATOM   7943 O O   . GLU B 1 444 ? -9.742  -10.669 -0.401  1.00 21.24 ? 443  GLU B O   1 
ATOM   7944 C CB  . GLU B 1 444 ? -9.024  -12.206 2.543   1.00 21.90 ? 443  GLU B CB  1 
ATOM   7945 C CG  . GLU B 1 444 ? -9.666  -12.925 3.729   1.00 24.33 ? 443  GLU B CG  1 
ATOM   7946 C CD  . GLU B 1 444 ? -8.894  -12.796 5.036   1.00 28.41 ? 443  GLU B CD  1 
ATOM   7947 O OE1 . GLU B 1 444 ? -9.518  -12.423 6.057   1.00 30.85 ? 443  GLU B OE1 1 
ATOM   7948 O OE2 . GLU B 1 444 ? -7.682  -13.091 5.077   1.00 27.05 ? 443  GLU B OE2 1 
ATOM   7949 N N   . ALA B 1 445 ? -7.950  -12.031 -0.386  1.00 20.84 ? 444  ALA B N   1 
ATOM   7950 C CA  . ALA B 1 445 ? -7.307  -11.356 -1.516  1.00 20.41 ? 444  ALA B CA  1 
ATOM   7951 C C   . ALA B 1 445 ? -8.121  -11.444 -2.821  1.00 20.62 ? 444  ALA B C   1 
ATOM   7952 O O   . ALA B 1 445 ? -8.159  -10.487 -3.584  1.00 19.87 ? 444  ALA B O   1 
ATOM   7953 C CB  . ALA B 1 445 ? -5.872  -11.893 -1.719  1.00 20.75 ? 444  ALA B CB  1 
ATOM   7954 N N   . ARG B 1 446 ? -8.768  -12.591 -3.072  1.00 20.64 ? 445  ARG B N   1 
ATOM   7955 C CA  . ARG B 1 446 ? -9.582  -12.779 -4.279  1.00 20.87 ? 445  ARG B CA  1 
ATOM   7956 C C   . ARG B 1 446 ? -10.734 -11.758 -4.367  1.00 20.66 ? 445  ARG B C   1 
ATOM   7957 O O   . ARG B 1 446 ? -10.984 -11.186 -5.429  1.00 21.15 ? 445  ARG B O   1 
ATOM   7958 C CB  . ARG B 1 446 ? -10.144 -14.210 -4.333  1.00 20.73 ? 445  ARG B CB  1 
ATOM   7959 C CG  . ARG B 1 446 ? -10.887 -14.530 -5.625  1.00 22.90 ? 445  ARG B CG  1 
ATOM   7960 C CD  . ARG B 1 446 ? -11.551 -15.931 -5.681  1.00 23.58 ? 445  ARG B CD  1 
ATOM   7961 N NE  . ARG B 1 446 ? -11.881 -16.191 -7.075  1.00 25.84 ? 445  ARG B NE  1 
ATOM   7962 C CZ  . ARG B 1 446 ? -11.031 -16.662 -7.975  1.00 27.23 ? 445  ARG B CZ  1 
ATOM   7963 N NH1 . ARG B 1 446 ? -11.422 -16.802 -9.237  1.00 27.63 ? 445  ARG B NH1 1 
ATOM   7964 N NH2 . ARG B 1 446 ? -9.798  -17.009 -7.622  1.00 26.07 ? 445  ARG B NH2 1 
ATOM   7965 N N   . LYS B 1 447 ? -11.419 -11.533 -3.249  1.00 20.74 ? 446  LYS B N   1 
ATOM   7966 C CA  . LYS B 1 447 ? -12.532 -10.582 -3.193  1.00 21.00 ? 446  LYS B CA  1 
ATOM   7967 C C   . LYS B 1 447 ? -12.061 -9.157  -3.517  1.00 21.57 ? 446  LYS B C   1 
ATOM   7968 O O   . LYS B 1 447 ? -12.778 -8.375  -4.166  1.00 20.71 ? 446  LYS B O   1 
ATOM   7969 C CB  . LYS B 1 447 ? -13.197 -10.620 -1.815  1.00 21.19 ? 446  LYS B CB  1 
ATOM   7970 C CG  . LYS B 1 447 ? -14.017 -11.888 -1.545  1.00 22.26 ? 446  LYS B CG  1 
ATOM   7971 C CD  . LYS B 1 447 ? -14.113 -12.169 -0.038  1.00 26.35 ? 446  LYS B CD  1 
ATOM   7972 C CE  . LYS B 1 447 ? -15.423 -11.690 0.536   1.00 28.46 ? 446  LYS B CE  1 
ATOM   7973 N NZ  . LYS B 1 447 ? -15.464 -11.825 2.032   1.00 28.58 ? 446  LYS B NZ  1 
ATOM   7974 N N   . GLU B 1 448 ? -10.840 -8.842  -3.094  1.00 21.27 ? 447  GLU B N   1 
ATOM   7975 C CA  . GLU B 1 448 ? -10.245 -7.529  -3.368  1.00 22.01 ? 447  GLU B CA  1 
ATOM   7976 C C   . GLU B 1 448 ? -9.966  -7.340  -4.861  1.00 22.10 ? 447  GLU B C   1 
ATOM   7977 O O   . GLU B 1 448 ? -10.222 -6.266  -5.433  1.00 22.36 ? 447  GLU B O   1 
ATOM   7978 C CB  . GLU B 1 448 ? -8.969  -7.339  -2.520  1.00 21.62 ? 447  GLU B CB  1 
ATOM   7979 C CG  . GLU B 1 448 ? -9.252  -7.247  -1.018  1.00 22.48 ? 447  GLU B CG  1 
ATOM   7980 C CD  . GLU B 1 448 ? -8.013  -7.072  -0.150  1.00 23.24 ? 447  GLU B CD  1 
ATOM   7981 O OE1 . GLU B 1 448 ? -8.157  -6.722  1.045   1.00 24.73 ? 447  GLU B OE1 1 
ATOM   7982 O OE2 . GLU B 1 448 ? -6.893  -7.292  -0.641  1.00 25.34 ? 447  GLU B OE2 1 
ATOM   7983 N N   . LEU B 1 449 ? -9.440  -8.381  -5.495  1.00 22.68 ? 448  LEU B N   1 
ATOM   7984 C CA  . LEU B 1 449 ? -9.184  -8.331  -6.929  1.00 23.67 ? 448  LEU B CA  1 
ATOM   7985 C C   . LEU B 1 449 ? -10.496 -8.272  -7.724  1.00 24.83 ? 448  LEU B C   1 
ATOM   7986 O O   . LEU B 1 449 ? -10.588 -7.558  -8.712  1.00 25.08 ? 448  LEU B O   1 
ATOM   7987 C CB  . LEU B 1 449 ? -8.288  -9.495  -7.380  1.00 23.12 ? 448  LEU B CB  1 
ATOM   7988 C CG  . LEU B 1 449 ? -6.900  -9.496  -6.725  1.00 22.80 ? 448  LEU B CG  1 
ATOM   7989 C CD1 . LEU B 1 449 ? -6.225  -10.870 -6.823  1.00 22.97 ? 448  LEU B CD1 1 
ATOM   7990 C CD2 . LEU B 1 449 ? -6.021  -8.415  -7.351  1.00 22.63 ? 448  LEU B CD2 1 
ATOM   7991 N N   . GLN B 1 450 ? -11.514 -9.008  -7.284  1.00 26.04 ? 449  GLN B N   1 
ATOM   7992 C CA  . GLN B 1 450 ? -12.810 -8.933  -7.960  1.00 27.69 ? 449  GLN B CA  1 
ATOM   7993 C C   . GLN B 1 450 ? -13.435 -7.538  -7.854  1.00 27.86 ? 449  GLN B C   1 
ATOM   7994 O O   . GLN B 1 450 ? -13.945 -7.018  -8.847  1.00 28.32 ? 449  GLN B O   1 
ATOM   7995 C CB  . GLN B 1 450 ? -13.780 -10.020 -7.491  1.00 28.21 ? 449  GLN B CB  1 
ATOM   7996 C CG  . GLN B 1 450 ? -13.554 -11.420 -8.148  1.00 32.37 ? 449  GLN B CG  1 
ATOM   7997 C CD  . GLN B 1 450 ? -13.854 -11.517 -9.667  1.00 36.72 ? 449  GLN B CD  1 
ATOM   7998 O OE1 . GLN B 1 450 ? -13.772 -12.613 -10.239 1.00 40.07 ? 449  GLN B OE1 1 
ATOM   7999 N NE2 . GLN B 1 450 ? -14.189 -10.396 -10.309 1.00 38.18 ? 449  GLN B NE2 1 
ATOM   8000 N N   . ALA B 1 451 ? -13.356 -6.925  -6.669  1.00 28.52 ? 450  ALA B N   1 
ATOM   8001 C CA  . ALA B 1 451 ? -13.882 -5.569  -6.462  1.00 29.02 ? 450  ALA B CA  1 
ATOM   8002 C C   . ALA B 1 451 ? -13.103 -4.491  -7.226  1.00 29.85 ? 450  ALA B C   1 
ATOM   8003 O O   . ALA B 1 451 ? -13.664 -3.437  -7.593  1.00 29.66 ? 450  ALA B O   1 
ATOM   8004 C CB  . ALA B 1 451 ? -13.947 -5.230  -4.968  1.00 28.68 ? 450  ALA B CB  1 
ATOM   8005 N N   . ALA B 1 452 ? -11.818 -4.754  -7.458  1.00 30.15 ? 451  ALA B N   1 
ATOM   8006 C CA  . ALA B 1 452 ? -10.958 -3.861  -8.233  1.00 30.97 ? 451  ALA B CA  1 
ATOM   8007 C C   . ALA B 1 452 ? -11.231 -3.979  -9.730  1.00 31.58 ? 451  ALA B C   1 
ATOM   8008 O O   . ALA B 1 452 ? -10.688 -3.210  -10.521 1.00 32.18 ? 451  ALA B O   1 
ATOM   8009 C CB  . ALA B 1 452 ? -9.490  -4.138  -7.940  1.00 30.61 ? 451  ALA B CB  1 
ATOM   8010 N N   . GLY B 1 453 ? -12.068 -4.945  -10.102 1.00 32.18 ? 452  GLY B N   1 
ATOM   8011 C CA  . GLY B 1 453 ? -12.483 -5.139  -11.479 1.00 33.04 ? 452  GLY B CA  1 
ATOM   8012 C C   . GLY B 1 453 ? -11.504 -5.918  -12.336 1.00 33.72 ? 452  GLY B C   1 
ATOM   8013 O O   . GLY B 1 453 ? -11.534 -5.812  -13.565 1.00 33.57 ? 452  GLY B O   1 
ATOM   8014 N N   . LYS B 1 454 ? -10.644 -6.709  -11.697 1.00 34.10 ? 453  LYS B N   1 
ATOM   8015 C CA  . LYS B 1 454 ? -9.642  -7.477  -12.424 1.00 34.64 ? 453  LYS B CA  1 
ATOM   8016 C C   . LYS B 1 454 ? -10.312 -8.547  -13.259 1.00 35.16 ? 453  LYS B C   1 
ATOM   8017 O O   . LYS B 1 454 ? -11.213 -9.239  -12.787 1.00 35.28 ? 453  LYS B O   1 
ATOM   8018 C CB  . LYS B 1 454 ? -8.614  -8.112  -11.476 1.00 34.64 ? 453  LYS B CB  1 
ATOM   8019 C CG  . LYS B 1 454 ? -7.770  -7.110  -10.688 1.00 34.43 ? 453  LYS B CG  1 
ATOM   8020 C CD  . LYS B 1 454 ? -6.754  -6.406  -11.568 1.00 34.96 ? 453  LYS B CD  1 
ATOM   8021 C CE  . LYS B 1 454 ? -5.971  -5.372  -10.779 1.00 34.39 ? 453  LYS B CE  1 
ATOM   8022 N NZ  . LYS B 1 454 ? -5.379  -4.346  -11.670 1.00 32.64 ? 453  LYS B NZ  1 
ATOM   8023 N N   . SER B 1 455 ? -9.871  -8.654  -14.511 1.00 35.86 ? 454  SER B N   1 
ATOM   8024 C CA  . SER B 1 455 ? -10.269 -9.741  -15.404 1.00 36.39 ? 454  SER B CA  1 
ATOM   8025 C C   . SER B 1 455 ? -9.930  -11.105 -14.792 1.00 36.54 ? 454  SER B C   1 
ATOM   8026 O O   . SER B 1 455 ? -9.086  -11.189 -13.892 1.00 36.81 ? 454  SER B O   1 
ATOM   8027 C CB  . SER B 1 455 ? -9.565  -9.587  -16.762 1.00 36.34 ? 454  SER B CB  1 
ATOM   8028 O OG  . SER B 1 455 ? -8.181  -9.877  -16.659 1.00 36.87 ? 454  SER B OG  1 
ATOM   8029 N N   . PRO B 1 456 ? -10.599 -12.165 -15.249 1.00 36.61 ? 455  PRO B N   1 
ATOM   8030 C CA  . PRO B 1 456 ? -10.247 -13.534 -14.851 1.00 36.31 ? 455  PRO B CA  1 
ATOM   8031 C C   . PRO B 1 456 ? -8.747  -13.861 -14.921 1.00 36.04 ? 455  PRO B C   1 
ATOM   8032 O O   . PRO B 1 456 ? -8.217  -14.382 -13.943 1.00 36.06 ? 455  PRO B O   1 
ATOM   8033 C CB  . PRO B 1 456 ? -11.042 -14.391 -15.842 1.00 36.41 ? 455  PRO B CB  1 
ATOM   8034 C CG  . PRO B 1 456 ? -12.245 -13.579 -16.113 1.00 36.70 ? 455  PRO B CG  1 
ATOM   8035 C CD  . PRO B 1 456 ? -11.782 -12.144 -16.132 1.00 36.81 ? 455  PRO B CD  1 
ATOM   8036 N N   . GLU B 1 457 ? -8.074  -13.557 -16.028 1.00 35.94 ? 456  GLU B N   1 
ATOM   8037 C CA  . GLU B 1 457 ? -6.656  -13.921 -16.152 1.00 36.01 ? 456  GLU B CA  1 
ATOM   8038 C C   . GLU B 1 457 ? -5.747  -13.050 -15.281 1.00 34.88 ? 456  GLU B C   1 
ATOM   8039 O O   . GLU B 1 457 ? -4.815  -13.567 -14.654 1.00 35.12 ? 456  GLU B O   1 
ATOM   8040 C CB  . GLU B 1 457 ? -6.171  -13.928 -17.613 1.00 36.47 ? 456  GLU B CB  1 
ATOM   8041 C CG  . GLU B 1 457 ? -7.203  -14.339 -18.660 1.00 39.50 ? 456  GLU B CG  1 
ATOM   8042 C CD  . GLU B 1 457 ? -7.775  -15.739 -18.459 1.00 42.90 ? 456  GLU B CD  1 
ATOM   8043 O OE1 . GLU B 1 457 ? -9.004  -15.847 -18.227 1.00 44.24 ? 456  GLU B OE1 1 
ATOM   8044 O OE2 . GLU B 1 457 ? -7.008  -16.732 -18.545 1.00 44.74 ? 456  GLU B OE2 1 
ATOM   8045 N N   . ASP B 1 458 ? -6.017  -11.745 -15.229 1.00 33.73 ? 457  ASP B N   1 
ATOM   8046 C CA  . ASP B 1 458 ? -5.251  -10.846 -14.354 1.00 32.13 ? 457  ASP B CA  1 
ATOM   8047 C C   . ASP B 1 458 ? -5.437  -11.219 -12.875 1.00 30.92 ? 457  ASP B C   1 
ATOM   8048 O O   . ASP B 1 458 ? -4.476  -11.219 -12.098 1.00 29.78 ? 457  ASP B O   1 
ATOM   8049 C CB  . ASP B 1 458 ? -5.642  -9.384  -14.580 1.00 32.90 ? 457  ASP B CB  1 
ATOM   8050 C CG  . ASP B 1 458 ? -5.068  -8.802  -15.875 1.00 34.23 ? 457  ASP B CG  1 
ATOM   8051 O OD1 . ASP B 1 458 ? -5.411  -7.644  -16.193 1.00 36.09 ? 457  ASP B OD1 1 
ATOM   8052 O OD2 . ASP B 1 458 ? -4.281  -9.406  -16.635 1.00 35.39 ? 457  ASP B OD2 1 
ATOM   8053 N N   . LEU B 1 459 ? -6.671  -11.546 -12.492 1.00 29.38 ? 458  LEU B N   1 
ATOM   8054 C CA  . LEU B 1 459 ? -6.955  -11.983 -11.126 1.00 28.51 ? 458  LEU B CA  1 
ATOM   8055 C C   . LEU B 1 459 ? -6.105  -13.187 -10.730 1.00 28.04 ? 458  LEU B C   1 
ATOM   8056 O O   . LEU B 1 459 ? -5.469  -13.182 -9.686  1.00 27.32 ? 458  LEU B O   1 
ATOM   8057 C CB  . LEU B 1 459 ? -8.440  -12.321 -10.944 1.00 28.43 ? 458  LEU B CB  1 
ATOM   8058 C CG  . LEU B 1 459 ? -8.867  -12.615 -9.499  1.00 28.25 ? 458  LEU B CG  1 
ATOM   8059 C CD1 . LEU B 1 459 ? -10.255 -12.064 -9.236  1.00 28.83 ? 458  LEU B CD1 1 
ATOM   8060 C CD2 . LEU B 1 459 ? -8.819  -14.105 -9.171  1.00 28.30 ? 458  LEU B CD2 1 
ATOM   8061 N N   . GLU B 1 460 ? -6.113  -14.222 -11.564 1.00 27.94 ? 459  GLU B N   1 
ATOM   8062 C CA  . GLU B 1 460 ? -5.409  -15.454 -11.240 1.00 27.60 ? 459  GLU B CA  1 
ATOM   8063 C C   . GLU B 1 460 ? -3.900  -15.226 -11.211 1.00 26.97 ? 459  GLU B C   1 
ATOM   8064 O O   . GLU B 1 460 ? -3.203  -15.826 -10.403 1.00 26.75 ? 459  GLU B O   1 
ATOM   8065 C CB  . GLU B 1 460 ? -5.782  -16.583 -12.215 1.00 28.83 ? 459  GLU B CB  1 
ATOM   8066 C CG  . GLU B 1 460 ? -5.667  -17.976 -11.609 0.70 30.99 ? 459  GLU B CG  1 
ATOM   8067 C CD  . GLU B 1 460 ? -6.848  -18.357 -10.719 0.70 34.29 ? 459  GLU B CD  1 
ATOM   8068 O OE1 . GLU B 1 460 ? -6.966  -17.825 -9.580  0.70 33.65 ? 459  GLU B OE1 1 
ATOM   8069 O OE2 . GLU B 1 460 ? -7.656  -19.212 -11.155 0.70 35.24 ? 459  GLU B OE2 1 
ATOM   8070 N N   . LYS B 1 461 ? -3.412  -14.339 -12.072 1.00 26.63 ? 460  LYS B N   1 
ATOM   8071 C CA  . LYS B 1 461 ? -1.988  -14.020 -12.119 1.00 26.60 ? 460  LYS B CA  1 
ATOM   8072 C C   . LYS B 1 461 ? -1.535  -13.234 -10.882 1.00 25.58 ? 460  LYS B C   1 
ATOM   8073 O O   . LYS B 1 461 ? -0.469  -13.494 -10.336 1.00 25.36 ? 460  LYS B O   1 
ATOM   8074 C CB  . LYS B 1 461 ? -1.647  -13.270 -13.409 1.00 27.73 ? 460  LYS B CB  1 
ATOM   8075 C CG  . LYS B 1 461 ? -1.509  -14.202 -14.592 1.00 29.91 ? 460  LYS B CG  1 
ATOM   8076 C CD  . LYS B 1 461 ? -1.701  -13.477 -15.912 1.00 34.56 ? 460  LYS B CD  1 
ATOM   8077 C CE  . LYS B 1 461 ? -0.915  -14.169 -17.017 1.00 36.49 ? 460  LYS B CE  1 
ATOM   8078 N NZ  . LYS B 1 461 ? -1.705  -15.284 -17.632 1.00 38.09 ? 460  LYS B NZ  1 
ATOM   8079 N N   . LEU B 1 462 ? -2.375  -12.308 -10.423 1.00 24.33 ? 461  LEU B N   1 
ATOM   8080 C CA  . LEU B 1 462 ? -2.023  -11.457 -9.283  1.00 23.43 ? 461  LEU B CA  1 
ATOM   8081 C C   . LEU B 1 462 ? -2.234  -12.118 -7.929  1.00 22.98 ? 461  LEU B C   1 
ATOM   8082 O O   . LEU B 1 462 ? -1.556  -11.786 -6.963  1.00 22.28 ? 461  LEU B O   1 
ATOM   8083 C CB  . LEU B 1 462 ? -2.814  -10.154 -9.317  1.00 23.65 ? 461  LEU B CB  1 
ATOM   8084 C CG  . LEU B 1 462 ? -2.430  -9.200  -10.444 1.00 25.49 ? 461  LEU B CG  1 
ATOM   8085 C CD1 . LEU B 1 462 ? -3.341  -7.970  -10.404 1.00 26.67 ? 461  LEU B CD1 1 
ATOM   8086 C CD2 . LEU B 1 462 ? -0.970  -8.793  -10.286 1.00 26.61 ? 461  LEU B CD2 1 
ATOM   8087 N N   . LEU B 1 463 ? -3.190  -13.042 -7.858  1.00 21.99 ? 462  LEU B N   1 
ATOM   8088 C CA  . LEU B 1 463 ? -3.611  -13.596 -6.572  1.00 20.77 ? 462  LEU B CA  1 
ATOM   8089 C C   . LEU B 1 463 ? -2.491  -14.036 -5.600  1.00 20.56 ? 462  LEU B C   1 
ATOM   8090 O O   . LEU B 1 463 ? -2.493  -13.602 -4.439  1.00 20.38 ? 462  LEU B O   1 
ATOM   8091 C CB  . LEU B 1 463 ? -4.641  -14.719 -6.776  1.00 20.90 ? 462  LEU B CB  1 
ATOM   8092 C CG  . LEU B 1 463 ? -5.316  -15.266 -5.518  1.00 21.33 ? 462  LEU B CG  1 
ATOM   8093 C CD1 . LEU B 1 463 ? -6.095  -14.177 -4.752  1.00 23.73 ? 462  LEU B CD1 1 
ATOM   8094 C CD2 . LEU B 1 463 ? -6.229  -16.407 -5.913  1.00 21.67 ? 462  LEU B CD2 1 
ATOM   8095 N N   . PRO B 1 464 ? -1.551  -14.884 -6.027  1.00 19.93 ? 463  PRO B N   1 
ATOM   8096 C CA  . PRO B 1 464 ? -0.532  -15.388 -5.091  1.00 19.98 ? 463  PRO B CA  1 
ATOM   8097 C C   . PRO B 1 464 ? 0.359   -14.248 -4.548  1.00 19.57 ? 463  PRO B C   1 
ATOM   8098 O O   . PRO B 1 464 ? 0.790   -14.311 -3.397  1.00 19.37 ? 463  PRO B O   1 
ATOM   8099 C CB  . PRO B 1 464 ? 0.289   -16.373 -5.945  1.00 20.18 ? 463  PRO B CB  1 
ATOM   8100 C CG  . PRO B 1 464 ? 0.044   -15.944 -7.371  1.00 20.29 ? 463  PRO B CG  1 
ATOM   8101 C CD  . PRO B 1 464 ? -1.365  -15.418 -7.394  1.00 20.52 ? 463  PRO B CD  1 
ATOM   8102 N N   . HIS B 1 465 ? 0.590   -13.222 -5.363  1.00 19.50 ? 464  HIS B N   1 
ATOM   8103 C CA  . HIS B 1 465 ? 1.363   -12.047 -4.940  1.00 19.92 ? 464  HIS B CA  1 
ATOM   8104 C C   . HIS B 1 465 ? 0.685   -11.269 -3.819  1.00 20.54 ? 464  HIS B C   1 
ATOM   8105 O O   . HIS B 1 465 ? 1.371   -10.607 -3.018  1.00 20.65 ? 464  HIS B O   1 
ATOM   8106 C CB  . HIS B 1 465 ? 1.616   -11.119 -6.137  1.00 20.12 ? 464  HIS B CB  1 
ATOM   8107 C CG  . HIS B 1 465 ? 2.435   -11.750 -7.213  1.00 21.05 ? 464  HIS B CG  1 
ATOM   8108 N ND1 . HIS B 1 465 ? 3.816   -11.766 -7.181  1.00 20.92 ? 464  HIS B ND1 1 
ATOM   8109 C CD2 . HIS B 1 465 ? 2.074   -12.409 -8.340  1.00 20.97 ? 464  HIS B CD2 1 
ATOM   8110 C CE1 . HIS B 1 465 ? 4.269   -12.393 -8.253  1.00 21.23 ? 464  HIS B CE1 1 
ATOM   8111 N NE2 . HIS B 1 465 ? 3.234   -12.797 -8.971  1.00 22.16 ? 464  HIS B NE2 1 
ATOM   8112 N N   . LYS B 1 466 ? -0.649  -11.358 -3.760  1.00 20.31 ? 465  LYS B N   1 
ATOM   8113 C CA  . LYS B 1 466 ? -1.467  -10.578 -2.829  1.00 20.88 ? 465  LYS B CA  1 
ATOM   8114 C C   . LYS B 1 466 ? -1.731  -11.310 -1.510  1.00 20.46 ? 465  LYS B C   1 
ATOM   8115 O O   . LYS B 1 466 ? -2.253  -10.732 -0.549  1.00 19.42 ? 465  LYS B O   1 
ATOM   8116 C CB  . LYS B 1 466 ? -2.814  -10.217 -3.477  1.00 21.12 ? 465  LYS B CB  1 
ATOM   8117 C CG  . LYS B 1 466 ? -2.715  -9.276  -4.668  1.00 24.94 ? 465  LYS B CG  1 
ATOM   8118 C CD  . LYS B 1 466 ? -2.882  -7.817  -4.241  1.00 28.60 ? 465  LYS B CD  1 
ATOM   8119 C CE  . LYS B 1 466 ? -4.335  -7.344  -4.306  1.00 31.93 ? 465  LYS B CE  1 
ATOM   8120 N NZ  . LYS B 1 466 ? -5.239  -8.027  -3.323  1.00 32.92 ? 465  LYS B NZ  1 
ATOM   8121 N N   . VAL B 1 467 ? -1.370  -12.587 -1.469  1.00 19.84 ? 466  VAL B N   1 
ATOM   8122 C CA  . VAL B 1 467 ? -1.534  -13.388 -0.265  1.00 20.07 ? 466  VAL B CA  1 
ATOM   8123 C C   . VAL B 1 467 ? -0.417  -13.173 0.763   1.00 19.78 ? 466  VAL B C   1 
ATOM   8124 O O   . VAL B 1 467 ? 0.764   -13.130 0.429   1.00 19.99 ? 466  VAL B O   1 
ATOM   8125 C CB  . VAL B 1 467 ? -1.672  -14.889 -0.639  1.00 20.41 ? 466  VAL B CB  1 
ATOM   8126 C CG1 . VAL B 1 467 ? -1.620  -15.818 0.614   1.00 20.46 ? 466  VAL B CG1 1 
ATOM   8127 C CG2 . VAL B 1 467 ? -2.973  -15.094 -1.398  1.00 21.31 ? 466  VAL B CG2 1 
ATOM   8128 N N   . PHE B 1 468 ? -0.813  -13.011 2.017   1.00 19.45 ? 467  PHE B N   1 
ATOM   8129 C CA  . PHE B 1 468 ? 0.137   -12.933 3.120   1.00 18.70 ? 467  PHE B CA  1 
ATOM   8130 C C   . PHE B 1 468 ? 0.020   -14.230 3.915   1.00 18.49 ? 467  PHE B C   1 
ATOM   8131 O O   . PHE B 1 468 ? -1.051  -14.536 4.445   1.00 17.58 ? 467  PHE B O   1 
ATOM   8132 C CB  . PHE B 1 468 ? -0.181  -11.729 4.020   1.00 18.51 ? 467  PHE B CB  1 
ATOM   8133 C CG  . PHE B 1 468 ? 0.108   -10.392 3.397   1.00 18.47 ? 467  PHE B CG  1 
ATOM   8134 C CD1 . PHE B 1 468 ? -0.657  -9.909  2.331   1.00 19.62 ? 467  PHE B CD1 1 
ATOM   8135 C CD2 . PHE B 1 468 ? 1.132   -9.582  3.911   1.00 19.92 ? 467  PHE B CD2 1 
ATOM   8136 C CE1 . PHE B 1 468 ? -0.377  -8.645  1.754   1.00 19.82 ? 467  PHE B CE1 1 
ATOM   8137 C CE2 . PHE B 1 468 ? 1.416   -8.341  3.361   1.00 19.48 ? 467  PHE B CE2 1 
ATOM   8138 C CZ  . PHE B 1 468 ? 0.664   -7.862  2.284   1.00 19.92 ? 467  PHE B CZ  1 
ATOM   8139 N N   . GLU B 1 469 ? 1.109   -14.992 4.005   1.00 18.86 ? 468  GLU B N   1 
ATOM   8140 C CA  . GLU B 1 469 ? 1.052   -16.265 4.726   1.00 19.05 ? 468  GLU B CA  1 
ATOM   8141 C C   . GLU B 1 469 ? 0.864   -16.099 6.234   1.00 18.75 ? 468  GLU B C   1 
ATOM   8142 O O   . GLU B 1 469 ? 0.326   -16.977 6.911   1.00 18.99 ? 468  GLU B O   1 
ATOM   8143 C CB  . GLU B 1 469 ? 2.257   -17.151 4.370   1.00 18.89 ? 468  GLU B CB  1 
ATOM   8144 C CG  . GLU B 1 469 ? 2.141   -17.685 2.954   1.00 20.90 ? 468  GLU B CG  1 
ATOM   8145 C CD  . GLU B 1 469 ? 3.322   -18.551 2.546   1.00 25.19 ? 468  GLU B CD  1 
ATOM   8146 O OE1 . GLU B 1 469 ? 4.405   -18.386 3.153   1.00 24.30 ? 468  GLU B OE1 1 
ATOM   8147 O OE2 . GLU B 1 469 ? 3.172   -19.373 1.603   1.00 26.72 ? 468  GLU B OE2 1 
ATOM   8148 N N   . GLY B 1 470 ? 1.263   -14.942 6.756   1.00 18.93 ? 469  GLY B N   1 
ATOM   8149 C CA  . GLY B 1 470 ? 1.165   -14.702 8.187   1.00 18.82 ? 469  GLY B CA  1 
ATOM   8150 C C   . GLY B 1 470 ? 1.970   -15.682 9.014   1.00 18.85 ? 469  GLY B C   1 
ATOM   8151 O O   . GLY B 1 470 ? 3.023   -16.176 8.567   1.00 18.65 ? 469  GLY B O   1 
ATOM   8152 N N   . ASN B 1 471 ? 1.486   -15.953 10.228  1.00 18.87 ? 470  ASN B N   1 
ATOM   8153 C CA  . ASN B 1 471 ? 2.176   -16.821 11.184  1.00 19.58 ? 470  ASN B CA  1 
ATOM   8154 C C   . ASN B 1 471 ? 3.590   -16.350 11.540  1.00 20.21 ? 470  ASN B C   1 
ATOM   8155 O O   . ASN B 1 471 ? 4.483   -17.158 11.796  1.00 20.92 ? 470  ASN B O   1 
ATOM   8156 C CB  . ASN B 1 471 ? 2.212   -18.263 10.668  1.00 20.71 ? 470  ASN B CB  1 
ATOM   8157 C CG  . ASN B 1 471 ? 2.141   -19.275 11.784  1.00 21.65 ? 470  ASN B CG  1 
ATOM   8158 O OD1 . ASN B 1 471 ? 1.537   -19.024 12.821  1.00 22.54 ? 470  ASN B OD1 1 
ATOM   8159 N ND2 . ASN B 1 471 ? 2.774   -20.432 11.580  1.00 24.04 ? 470  ASN B ND2 1 
ATOM   8160 N N   . ARG B 1 472 ? 3.780   -15.031 11.530  1.00 19.30 ? 471  ARG B N   1 
ATOM   8161 C CA  . ARG B 1 472 ? 5.046   -14.414 11.914  1.00 19.45 ? 471  ARG B CA  1 
ATOM   8162 C C   . ARG B 1 472 ? 4.927   -13.863 13.326  1.00 19.08 ? 471  ARG B C   1 
ATOM   8163 O O   . ARG B 1 472 ? 4.093   -12.977 13.573  1.00 18.49 ? 471  ARG B O   1 
ATOM   8164 C CB  . ARG B 1 472 ? 5.402   -13.326 10.916  1.00 19.36 ? 471  ARG B CB  1 
ATOM   8165 C CG  . ARG B 1 472 ? 5.898   -13.895 9.613   1.00 20.85 ? 471  ARG B CG  1 
ATOM   8166 C CD  . ARG B 1 472 ? 5.277   -13.314 8.388   1.00 19.82 ? 471  ARG B CD  1 
ATOM   8167 N NE  . ARG B 1 472 ? 6.153   -13.530 7.233   1.00 19.03 ? 471  ARG B NE  1 
ATOM   8168 C CZ  . ARG B 1 472 ? 6.034   -14.540 6.384   1.00 19.38 ? 471  ARG B CZ  1 
ATOM   8169 N NH1 . ARG B 1 472 ? 5.066   -15.438 6.531   1.00 20.82 ? 471  ARG B NH1 1 
ATOM   8170 N NH2 . ARG B 1 472 ? 6.887   -14.664 5.383   1.00 20.76 ? 471  ARG B NH2 1 
ATOM   8171 N N   . PRO B 1 473 ? 5.724   -14.409 14.263  1.00 18.39 ? 472  PRO B N   1 
ATOM   8172 C CA  . PRO B 1 473 ? 5.597   -14.101 15.692  1.00 18.56 ? 472  PRO B CA  1 
ATOM   8173 C C   . PRO B 1 473 ? 6.234   -12.786 16.131  1.00 18.53 ? 472  PRO B C   1 
ATOM   8174 O O   . PRO B 1 473 ? 7.275   -12.366 15.614  1.00 18.34 ? 472  PRO B O   1 
ATOM   8175 C CB  . PRO B 1 473 ? 6.317   -15.277 16.357  1.00 18.94 ? 472  PRO B CB  1 
ATOM   8176 C CG  . PRO B 1 473 ? 7.382   -15.632 15.389  1.00 17.50 ? 472  PRO B CG  1 
ATOM   8177 C CD  . PRO B 1 473 ? 6.775   -15.421 14.023  1.00 18.78 ? 472  PRO B CD  1 
ATOM   8178 N N   . THR B 1 474 ? 5.584   -12.130 17.086  1.00 18.35 ? 473  THR B N   1 
ATOM   8179 C CA  . THR B 1 474 ? 6.104   -10.882 17.628  1.00 17.53 ? 473  THR B CA  1 
ATOM   8180 C C   . THR B 1 474 ? 5.876   -10.819 19.135  1.00 18.01 ? 473  THR B C   1 
ATOM   8181 O O   . THR B 1 474 ? 5.005   -11.516 19.680  1.00 16.89 ? 473  THR B O   1 
ATOM   8182 C CB  . THR B 1 474 ? 5.395   -9.673  16.997  1.00 17.99 ? 473  THR B CB  1 
ATOM   8183 O OG1 . THR B 1 474 ? 3.989   -9.812  17.197  1.00 19.37 ? 473  THR B OG1 1 
ATOM   8184 C CG2 . THR B 1 474 ? 5.553   -9.620  15.462  1.00 18.70 ? 473  THR B CG2 1 
ATOM   8185 N N   . ASN B 1 475 ? 6.658   -9.966  19.789  1.00 17.30 ? 474  ASN B N   1 
ATOM   8186 C CA  . ASN B 1 475 ? 6.315   -9.446  21.107  1.00 18.02 ? 474  ASN B CA  1 
ATOM   8187 C C   . ASN B 1 475 ? 5.881   -7.998  20.953  1.00 18.20 ? 474  ASN B C   1 
ATOM   8188 O O   . ASN B 1 475 ? 6.433   -7.284  20.105  1.00 18.01 ? 474  ASN B O   1 
ATOM   8189 C CB  . ASN B 1 475 ? 7.542   -9.452  22.014  1.00 17.73 ? 474  ASN B CB  1 
ATOM   8190 C CG  . ASN B 1 475 ? 8.011   -10.859 22.369  1.00 19.55 ? 474  ASN B CG  1 
ATOM   8191 O OD1 . ASN B 1 475 ? 7.210   -11.739 22.703  1.00 20.29 ? 474  ASN B OD1 1 
ATOM   8192 N ND2 . ASN B 1 475 ? 9.320   -11.067 22.314  1.00 19.31 ? 474  ASN B ND2 1 
ATOM   8193 N N   . SER B 1 476 ? 4.894   -7.587  21.752  1.00 17.84 ? 475  SER B N   1 
ATOM   8194 C CA  . SER B 1 476 ? 4.524   -6.176  21.857  1.00 17.72 ? 475  SER B CA  1 
ATOM   8195 C C   . SER B 1 476 ? 4.782   -5.732  23.290  1.00 18.13 ? 475  SER B C   1 
ATOM   8196 O O   . SER B 1 476 ? 4.261   -6.321  24.230  1.00 18.99 ? 475  SER B O   1 
ATOM   8197 C CB  . SER B 1 476 ? 3.048   -5.967  21.471  1.00 17.27 ? 475  SER B CB  1 
ATOM   8198 O OG  . SER B 1 476 ? 2.830   -6.204  20.087  1.00 18.22 ? 475  SER B OG  1 
ATOM   8199 N N   . ILE B 1 477 ? 5.607   -4.694  23.455  1.00 18.69 ? 476  ILE B N   1 
ATOM   8200 C CA  . ILE B 1 477 ? 5.991   -4.186  24.756  1.00 18.55 ? 476  ILE B CA  1 
ATOM   8201 C C   . ILE B 1 477 ? 5.486   -2.749  24.803  1.00 18.63 ? 476  ILE B C   1 
ATOM   8202 O O   . ILE B 1 477 ? 5.983   -1.886  24.082  1.00 18.62 ? 476  ILE B O   1 
ATOM   8203 C CB  . ILE B 1 477 ? 7.550   -4.288  24.935  1.00 19.20 ? 476  ILE B CB  1 
ATOM   8204 C CG1 . ILE B 1 477 ? 7.966   -5.762  25.018  1.00 19.60 ? 476  ILE B CG1 1 
ATOM   8205 C CG2 . ILE B 1 477 ? 8.045   -3.510  26.186  1.00 19.22 ? 476  ILE B CG2 1 
ATOM   8206 C CD1 . ILE B 1 477 ? 9.433   -6.029  24.692  1.00 19.23 ? 476  ILE B CD1 1 
ATOM   8207 N N   . VAL B 1 478 ? 4.455   -2.529  25.610  1.00 18.53 ? 477  VAL B N   1 
ATOM   8208 C CA  . VAL B 1 478 ? 3.752   -1.253  25.667  1.00 19.37 ? 477  VAL B CA  1 
ATOM   8209 C C   . VAL B 1 478 ? 3.903   -0.714  27.070  1.00 19.87 ? 477  VAL B C   1 
ATOM   8210 O O   . VAL B 1 478 ? 3.724   -1.446  28.051  1.00 20.20 ? 477  VAL B O   1 
ATOM   8211 C CB  . VAL B 1 478 ? 2.245   -1.403  25.316  1.00 19.48 ? 477  VAL B CB  1 
ATOM   8212 C CG1 . VAL B 1 478 ? 1.559   -0.051  25.254  1.00 19.69 ? 477  VAL B CG1 1 
ATOM   8213 C CG2 . VAL B 1 478 ? 2.062   -2.114  23.998  1.00 19.93 ? 477  VAL B CG2 1 
ATOM   8214 N N   . PHE B 1 479 ? 4.220   0.572   27.176  1.00 19.83 ? 478  PHE B N   1 
ATOM   8215 C CA  . PHE B 1 479 ? 4.444   1.163   28.485  1.00 19.56 ? 478  PHE B CA  1 
ATOM   8216 C C   . PHE B 1 479 ? 3.754   2.515   28.579  1.00 19.84 ? 478  PHE B C   1 
ATOM   8217 O O   . PHE B 1 479 ? 3.553   3.178   27.575  1.00 18.59 ? 478  PHE B O   1 
ATOM   8218 C CB  . PHE B 1 479 ? 5.942   1.286   28.764  1.00 20.56 ? 478  PHE B CB  1 
ATOM   8219 C CG  . PHE B 1 479 ? 6.760   1.526   27.526  1.00 19.91 ? 478  PHE B CG  1 
ATOM   8220 C CD1 . PHE B 1 479 ? 7.103   2.819   27.152  1.00 19.29 ? 478  PHE B CD1 1 
ATOM   8221 C CD2 . PHE B 1 479 ? 7.161   0.465   26.725  1.00 19.47 ? 478  PHE B CD2 1 
ATOM   8222 C CE1 . PHE B 1 479 ? 7.849   3.046   25.982  1.00 18.98 ? 478  PHE B CE1 1 
ATOM   8223 C CE2 . PHE B 1 479 ? 7.904   0.689   25.554  1.00 20.13 ? 478  PHE B CE2 1 
ATOM   8224 C CZ  . PHE B 1 479 ? 8.242   1.974   25.192  1.00 19.27 ? 478  PHE B CZ  1 
ATOM   8225 N N   . THR B 1 480 ? 3.387   2.912   29.796  1.00 19.06 ? 479  THR B N   1 
ATOM   8226 C CA  . THR B 1 480 ? 2.614   4.141   30.002  1.00 19.05 ? 479  THR B CA  1 
ATOM   8227 C C   . THR B 1 480 ? 3.169   5.366   29.256  1.00 19.05 ? 479  THR B C   1 
ATOM   8228 O O   . THR B 1 480 ? 2.437   6.069   28.542  1.00 18.98 ? 479  THR B O   1 
ATOM   8229 C CB  . THR B 1 480 ? 2.498   4.419   31.512  1.00 19.28 ? 479  THR B CB  1 
ATOM   8230 O OG1 . THR B 1 480 ? 1.884   3.279   32.142  1.00 20.23 ? 479  THR B OG1 1 
ATOM   8231 C CG2 . THR B 1 480 ? 1.513   5.562   31.773  1.00 19.48 ? 479  THR B CG2 1 
ATOM   8232 N N   . LYS B 1 481 ? 4.461   5.612   29.451  1.00 19.05 ? 480  LYS B N   1 
ATOM   8233 C CA  . LYS B 1 481 ? 5.145   6.776   28.896  1.00 19.27 ? 480  LYS B CA  1 
ATOM   8234 C C   . LYS B 1 481 ? 6.639   6.502   28.958  1.00 18.77 ? 480  LYS B C   1 
ATOM   8235 O O   . LYS B 1 481 ? 7.117   5.840   29.890  1.00 19.69 ? 480  LYS B O   1 
ATOM   8236 C CB  . LYS B 1 481 ? 4.827   8.031   29.731  1.00 18.65 ? 480  LYS B CB  1 
ATOM   8237 C CG  . LYS B 1 481 ? 5.171   9.357   29.041  1.00 19.44 ? 480  LYS B CG  1 
ATOM   8238 C CD  . LYS B 1 481 ? 4.565   10.565  29.774  1.00 22.39 ? 480  LYS B CD  1 
ATOM   8239 C CE  . LYS B 1 481 ? 4.777   11.836  28.967  1.00 23.67 ? 480  LYS B CE  1 
ATOM   8240 N NZ  . LYS B 1 481 ? 4.164   13.022  29.633  1.00 25.74 ? 480  LYS B NZ  1 
ATOM   8241 N N   . LEU B 1 482 ? 7.380   6.996   27.973  1.00 19.04 ? 481  LEU B N   1 
ATOM   8242 C CA  . LEU B 1 482 ? 8.833   6.862   28.011  1.00 18.69 ? 481  LEU B CA  1 
ATOM   8243 C C   . LEU B 1 482 ? 9.475   7.958   28.870  1.00 19.28 ? 481  LEU B C   1 
ATOM   8244 O O   . LEU B 1 482 ? 10.010  8.939   28.362  1.00 18.90 ? 481  LEU B O   1 
ATOM   8245 C CB  . LEU B 1 482 ? 9.427   6.828   26.592  1.00 18.12 ? 481  LEU B CB  1 
ATOM   8246 C CG  . LEU B 1 482 ? 10.881  6.336   26.578  1.00 17.98 ? 481  LEU B CG  1 
ATOM   8247 C CD1 . LEU B 1 482 ? 10.995  4.848   27.014  1.00 18.06 ? 481  LEU B CD1 1 
ATOM   8248 C CD2 . LEU B 1 482 ? 11.503  6.541   25.219  1.00 20.16 ? 481  LEU B CD2 1 
ATOM   8249 N N   . THR B 1 483 ? 9.393   7.767   30.187  1.00 19.09 ? 482  THR B N   1 
ATOM   8250 C CA  . THR B 1 483 ? 10.035  8.632   31.174  1.00 19.58 ? 482  THR B CA  1 
ATOM   8251 C C   . THR B 1 483 ? 11.438  8.077   31.424  1.00 19.75 ? 482  THR B C   1 
ATOM   8252 O O   . THR B 1 483 ? 11.727  6.945   31.005  1.00 19.59 ? 482  THR B O   1 
ATOM   8253 C CB  . THR B 1 483 ? 9.270   8.564   32.504  1.00 19.22 ? 482  THR B CB  1 
ATOM   8254 O OG1 . THR B 1 483 ? 9.254   7.199   32.949  1.00 20.20 ? 482  THR B OG1 1 
ATOM   8255 C CG2 . THR B 1 483 ? 7.794   8.921   32.332  1.00 20.14 ? 482  THR B CG2 1 
ATOM   8256 N N   . PRO B 1 484 ? 12.304  8.819   32.123  1.00 20.02 ? 483  PRO B N   1 
ATOM   8257 C CA  . PRO B 1 484 ? 13.599  8.261   32.552  1.00 20.06 ? 483  PRO B CA  1 
ATOM   8258 C C   . PRO B 1 484 ? 13.479  6.950   33.341  1.00 20.32 ? 483  PRO B C   1 
ATOM   8259 O O   . PRO B 1 484 ? 14.200  5.981   33.036  1.00 20.20 ? 483  PRO B O   1 
ATOM   8260 C CB  . PRO B 1 484 ? 14.185  9.374   33.429  1.00 19.90 ? 483  PRO B CB  1 
ATOM   8261 C CG  . PRO B 1 484 ? 13.594  10.607  32.877  1.00 19.63 ? 483  PRO B CG  1 
ATOM   8262 C CD  . PRO B 1 484 ? 12.174  10.244  32.501  1.00 20.45 ? 483  PRO B CD  1 
ATOM   8263 N N   . PHE B 1 485 ? 12.562  6.901   34.313  1.00 19.83 ? 484  PHE B N   1 
ATOM   8264 C CA  . PHE B 1 485 ? 12.331  5.680   35.083  1.00 20.28 ? 484  PHE B CA  1 
ATOM   8265 C C   . PHE B 1 485 ? 11.985  4.489   34.175  1.00 20.41 ? 484  PHE B C   1 
ATOM   8266 O O   . PHE B 1 485 ? 12.598  3.416   34.286  1.00 20.58 ? 484  PHE B O   1 
ATOM   8267 C CB  . PHE B 1 485 ? 11.219  5.886   36.119  1.00 20.30 ? 484  PHE B CB  1 
ATOM   8268 C CG  . PHE B 1 485 ? 10.919  4.657   36.928  1.00 20.08 ? 484  PHE B CG  1 
ATOM   8269 C CD1 . PHE B 1 485 ? 11.461  4.503   38.203  1.00 20.73 ? 484  PHE B CD1 1 
ATOM   8270 C CD2 . PHE B 1 485 ? 10.105  3.639   36.414  1.00 21.76 ? 484  PHE B CD2 1 
ATOM   8271 C CE1 . PHE B 1 485 ? 11.198  3.359   38.954  1.00 21.31 ? 484  PHE B CE1 1 
ATOM   8272 C CE2 . PHE B 1 485 ? 9.839   2.490   37.170  1.00 22.52 ? 484  PHE B CE2 1 
ATOM   8273 C CZ  . PHE B 1 485 ? 10.393  2.359   38.438  1.00 21.74 ? 484  PHE B CZ  1 
ATOM   8274 N N   . ILE B 1 486 ? 11.003  4.676   33.290  1.00 19.58 ? 485  ILE B N   1 
ATOM   8275 C CA  . ILE B 1 486 ? 10.535  3.581   32.416  1.00 19.92 ? 485  ILE B CA  1 
ATOM   8276 C C   . ILE B 1 486 ? 11.642  3.158   31.441  1.00 19.35 ? 485  ILE B C   1 
ATOM   8277 O O   . ILE B 1 486 ? 11.874  1.952   31.247  1.00 18.73 ? 485  ILE B O   1 
ATOM   8278 C CB  . ILE B 1 486 ? 9.183   3.940   31.678  1.00 19.77 ? 485  ILE B CB  1 
ATOM   8279 C CG1 . ILE B 1 486 ? 8.013   4.060   32.683  1.00 21.01 ? 485  ILE B CG1 1 
ATOM   8280 C CG2 . ILE B 1 486 ? 8.822   2.917   30.576  1.00 19.83 ? 485  ILE B CG2 1 
ATOM   8281 C CD1 . ILE B 1 486 ? 7.680   2.763   33.425  1.00 23.97 ? 485  ILE B CD1 1 
ATOM   8282 N N   . LEU B 1 487 ? 12.342  4.128   30.853  1.00 19.60 ? 486  LEU B N   1 
ATOM   8283 C CA  . LEU B 1 487 ? 13.485  3.784   30.000  1.00 19.85 ? 486  LEU B CA  1 
ATOM   8284 C C   . LEU B 1 487 ? 14.524  2.953   30.769  1.00 20.22 ? 486  LEU B C   1 
ATOM   8285 O O   . LEU B 1 487 ? 15.066  1.979   30.232  1.00 20.97 ? 486  LEU B O   1 
ATOM   8286 C CB  . LEU B 1 487 ? 14.133  5.039   29.389  1.00 20.13 ? 486  LEU B CB  1 
ATOM   8287 C CG  . LEU B 1 487 ? 15.335  4.808   28.453  1.00 19.89 ? 486  LEU B CG  1 
ATOM   8288 C CD1 . LEU B 1 487 ? 14.978  3.988   27.209  1.00 20.59 ? 486  LEU B CD1 1 
ATOM   8289 C CD2 . LEU B 1 487 ? 15.941  6.142   28.044  1.00 18.60 ? 486  LEU B CD2 1 
ATOM   8290 N N   . GLY B 1 488 ? 14.793  3.321   32.024  1.00 19.79 ? 487  GLY B N   1 
ATOM   8291 C CA  . GLY B 1 488 ? 15.753  2.582   32.828  1.00 19.28 ? 487  GLY B CA  1 
ATOM   8292 C C   . GLY B 1 488 ? 15.346  1.133   32.995  1.00 18.95 ? 487  GLY B C   1 
ATOM   8293 O O   . GLY B 1 488 ? 16.170  0.213   32.852  1.00 18.79 ? 487  GLY B O   1 
ATOM   8294 N N   . ALA B 1 489 ? 14.067  0.938   33.296  1.00 18.40 ? 488  ALA B N   1 
ATOM   8295 C CA  . ALA B 1 489 ? 13.487  -0.395  33.413  1.00 18.40 ? 488  ALA B CA  1 
ATOM   8296 C C   . ALA B 1 489 ? 13.631  -1.203  32.123  1.00 18.43 ? 488  ALA B C   1 
ATOM   8297 O O   . ALA B 1 489 ? 14.001  -2.379  32.157  1.00 17.97 ? 488  ALA B O   1 
ATOM   8298 C CB  . ALA B 1 489 ? 12.019  -0.285  33.816  1.00 18.74 ? 488  ALA B CB  1 
ATOM   8299 N N   . LEU B 1 490 ? 13.322  -0.563  30.997  1.00 17.69 ? 489  LEU B N   1 
ATOM   8300 C CA  . LEU B 1 490 ? 13.379  -1.217  29.685  1.00 18.32 ? 489  LEU B CA  1 
ATOM   8301 C C   . LEU B 1 490 ? 14.788  -1.701  29.326  1.00 18.05 ? 489  LEU B C   1 
ATOM   8302 O O   . LEU B 1 490 ? 14.964  -2.825  28.829  1.00 17.50 ? 489  LEU B O   1 
ATOM   8303 C CB  . LEU B 1 490 ? 12.817  -0.315  28.575  1.00 18.36 ? 489  LEU B CB  1 
ATOM   8304 C CG  . LEU B 1 490 ? 11.301  -0.072  28.589  1.00 18.21 ? 489  LEU B CG  1 
ATOM   8305 C CD1 . LEU B 1 490 ? 10.880  0.988   27.548  1.00 18.69 ? 489  LEU B CD1 1 
ATOM   8306 C CD2 . LEU B 1 490 ? 10.522  -1.380  28.407  1.00 19.28 ? 489  LEU B CD2 1 
ATOM   8307 N N   . ILE B 1 491 ? 15.784  -0.853  29.564  1.00 17.94 ? 490  ILE B N   1 
ATOM   8308 C CA  . ILE B 1 491 ? 17.169  -1.223  29.261  1.00 18.03 ? 490  ILE B CA  1 
ATOM   8309 C C   . ILE B 1 491 ? 17.596  -2.377  30.152  1.00 18.37 ? 490  ILE B C   1 
ATOM   8310 O O   . ILE B 1 491 ? 18.140  -3.353  29.661  1.00 18.45 ? 490  ILE B O   1 
ATOM   8311 C CB  . ILE B 1 491 ? 18.151  -0.023  29.421  1.00 17.62 ? 490  ILE B CB  1 
ATOM   8312 C CG1 . ILE B 1 491 ? 17.754  1.110   28.489  1.00 17.74 ? 490  ILE B CG1 1 
ATOM   8313 C CG2 . ILE B 1 491 ? 19.585  -0.455  29.092  1.00 18.16 ? 490  ILE B CG2 1 
ATOM   8314 C CD1 . ILE B 1 491 ? 18.294  2.445   28.895  1.00 17.98 ? 490  ILE B CD1 1 
ATOM   8315 N N   . ALA B 1 492 ? 17.311  -2.278  31.452  1.00 18.75 ? 491  ALA B N   1 
ATOM   8316 C CA  . ALA B 1 492 ? 17.690  -3.342  32.387  1.00 18.79 ? 491  ALA B CA  1 
ATOM   8317 C C   . ALA B 1 492 ? 17.042  -4.669  32.018  1.00 18.92 ? 491  ALA B C   1 
ATOM   8318 O O   . ALA B 1 492 ? 17.666  -5.727  32.162  1.00 19.43 ? 491  ALA B O   1 
ATOM   8319 C CB  . ALA B 1 492 ? 17.353  -2.954  33.830  1.00 18.38 ? 491  ALA B CB  1 
ATOM   8320 N N   . MET B 1 493 ? 15.795  -4.603  31.545  1.00 19.48 ? 492  MET B N   1 
ATOM   8321 C CA  . MET B 1 493 ? 15.055  -5.793  31.117  1.00 19.64 ? 492  MET B CA  1 
ATOM   8322 C C   . MET B 1 493 ? 15.795  -6.535  30.002  1.00 19.50 ? 492  MET B C   1 
ATOM   8323 O O   . MET B 1 493 ? 15.924  -7.756  30.033  1.00 19.98 ? 492  MET B O   1 
ATOM   8324 C CB  . MET B 1 493 ? 13.660  -5.398  30.629  1.00 19.81 ? 492  MET B CB  1 
ATOM   8325 C CG  . MET B 1 493 ? 12.735  -6.606  30.348  1.00 20.41 ? 492  MET B CG  1 
ATOM   8326 S SD  . MET B 1 493 ? 11.041  -6.137  29.796  1.00 23.12 ? 492  MET B SD  1 
ATOM   8327 C CE  . MET B 1 493 ? 11.430  -5.230  28.341  1.00 23.40 ? 492  MET B CE  1 
ATOM   8328 N N   . TYR B 1 494 ? 16.289  -5.787  29.023  1.00 19.08 ? 493  TYR B N   1 
ATOM   8329 C CA  . TYR B 1 494 ? 17.051  -6.400  27.945  1.00 18.57 ? 493  TYR B CA  1 
ATOM   8330 C C   . TYR B 1 494 ? 18.435  -6.864  28.409  1.00 18.33 ? 493  TYR B C   1 
ATOM   8331 O O   . TYR B 1 494 ? 18.880  -7.934  28.010  1.00 18.08 ? 493  TYR B O   1 
ATOM   8332 C CB  . TYR B 1 494 ? 17.119  -5.465  26.745  1.00 18.29 ? 493  TYR B CB  1 
ATOM   8333 C CG  . TYR B 1 494 ? 15.905  -5.526  25.864  1.00 19.25 ? 493  TYR B CG  1 
ATOM   8334 C CD1 . TYR B 1 494 ? 14.919  -4.541  25.933  1.00 19.72 ? 493  TYR B CD1 1 
ATOM   8335 C CD2 . TYR B 1 494 ? 15.737  -6.565  24.948  1.00 20.61 ? 493  TYR B CD2 1 
ATOM   8336 C CE1 . TYR B 1 494 ? 13.790  -4.587  25.116  1.00 20.91 ? 493  TYR B CE1 1 
ATOM   8337 C CE2 . TYR B 1 494 ? 14.621  -6.615  24.124  1.00 21.14 ? 493  TYR B CE2 1 
ATOM   8338 C CZ  . TYR B 1 494 ? 13.657  -5.615  24.210  1.00 20.60 ? 493  TYR B CZ  1 
ATOM   8339 O OH  . TYR B 1 494 ? 12.553  -5.675  23.396  1.00 19.81 ? 493  TYR B OH  1 
ATOM   8340 N N   . GLU B 1 495 ? 19.083  -6.102  29.290  1.00 18.39 ? 494  GLU B N   1 
ATOM   8341 C CA  . GLU B 1 495 ? 20.355  -6.548  29.892  1.00 18.97 ? 494  GLU B CA  1 
ATOM   8342 C C   . GLU B 1 495 ? 20.162  -7.933  30.528  1.00 19.53 ? 494  GLU B C   1 
ATOM   8343 O O   . GLU B 1 495 ? 20.978  -8.840  30.349  1.00 19.11 ? 494  GLU B O   1 
ATOM   8344 C CB  . GLU B 1 495 ? 20.875  -5.565  30.948  1.00 19.38 ? 494  GLU B CB  1 
ATOM   8345 C CG  . GLU B 1 495 ? 21.281  -4.197  30.408  1.00 20.04 ? 494  GLU B CG  1 
ATOM   8346 C CD  . GLU B 1 495 ? 21.810  -3.262  31.488  1.00 21.70 ? 494  GLU B CD  1 
ATOM   8347 O OE1 . GLU B 1 495 ? 21.375  -3.372  32.665  1.00 23.02 ? 494  GLU B OE1 1 
ATOM   8348 O OE2 . GLU B 1 495 ? 22.663  -2.405  31.161  1.00 21.36 ? 494  GLU B OE2 1 
ATOM   8349 N N   . HIS B 1 496 ? 19.051  -8.105  31.233  1.00 19.37 ? 495  HIS B N   1 
ATOM   8350 C CA  . HIS B 1 496 ? 18.827  -9.362  31.941  1.00 19.59 ? 495  HIS B CA  1 
ATOM   8351 C C   . HIS B 1 496 ? 18.372  -10.488 31.018  1.00 19.61 ? 495  HIS B C   1 
ATOM   8352 O O   . HIS B 1 496 ? 18.693  -11.645 31.271  1.00 20.62 ? 495  HIS B O   1 
ATOM   8353 C CB  . HIS B 1 496 ? 17.900  -9.158  33.134  1.00 19.21 ? 495  HIS B CB  1 
ATOM   8354 C CG  . HIS B 1 496 ? 18.518  -8.344  34.232  1.00 19.25 ? 495  HIS B CG  1 
ATOM   8355 N ND1 . HIS B 1 496 ? 19.866  -8.390  34.530  1.00 19.47 ? 495  HIS B ND1 1 
ATOM   8356 C CD2 . HIS B 1 496 ? 17.975  -7.440  35.083  1.00 19.51 ? 495  HIS B CD2 1 
ATOM   8357 C CE1 . HIS B 1 496 ? 20.122  -7.552  35.520  1.00 21.22 ? 495  HIS B CE1 1 
ATOM   8358 N NE2 . HIS B 1 496 ? 18.988  -6.979  35.885  1.00 19.93 ? 495  HIS B NE2 1 
ATOM   8359 N N   . LYS B 1 497 ? 17.668  -10.149 29.933  1.00 19.41 ? 496  LYS B N   1 
ATOM   8360 C CA  . LYS B 1 497 ? 17.385  -11.109 28.855  1.00 19.16 ? 496  LYS B CA  1 
ATOM   8361 C C   . LYS B 1 497 ? 18.694  -11.699 28.323  1.00 19.33 ? 496  LYS B C   1 
ATOM   8362 O O   . LYS B 1 497 ? 18.841  -12.926 28.209  1.00 18.92 ? 496  LYS B O   1 
ATOM   8363 C CB  . LYS B 1 497 ? 16.633  -10.427 27.702  1.00 18.69 ? 496  LYS B CB  1 
ATOM   8364 C CG  . LYS B 1 497 ? 16.392  -11.338 26.506  1.00 18.78 ? 496  LYS B CG  1 
ATOM   8365 C CD  . LYS B 1 497 ? 15.967  -10.584 25.225  1.00 16.88 ? 496  LYS B CD  1 
ATOM   8366 C CE  . LYS B 1 497 ? 16.142  -11.499 23.996  1.00 18.90 ? 496  LYS B CE  1 
ATOM   8367 N NZ  . LYS B 1 497 ? 15.795  -10.868 22.681  1.00 18.99 ? 496  LYS B NZ  1 
ATOM   8368 N N   . ILE B 1 498 ? 19.629  -10.816 27.965  1.00 18.89 ? 497  ILE B N   1 
ATOM   8369 C CA  . ILE B 1 498 ? 20.936  -11.218 27.437  1.00 19.39 ? 497  ILE B CA  1 
ATOM   8370 C C   . ILE B 1 498 ? 21.690  -12.112 28.435  1.00 19.34 ? 497  ILE B C   1 
ATOM   8371 O O   . ILE B 1 498 ? 22.311  -13.126 28.056  1.00 19.20 ? 497  ILE B O   1 
ATOM   8372 C CB  . ILE B 1 498 ? 21.758  -9.937  27.093  1.00 19.71 ? 497  ILE B CB  1 
ATOM   8373 C CG1 . ILE B 1 498 ? 21.218  -9.290  25.804  1.00 19.44 ? 497  ILE B CG1 1 
ATOM   8374 C CG2 . ILE B 1 498 ? 23.256  -10.233 26.965  1.00 19.26 ? 497  ILE B CG2 1 
ATOM   8375 C CD1 . ILE B 1 498 ? 21.343  -7.753  25.773  1.00 19.86 ? 497  ILE B CD1 1 
ATOM   8376 N N   . PHE B 1 499 ? 21.631  -11.741 29.711  1.00 19.85 ? 498  PHE B N   1 
ATOM   8377 C CA  . PHE B 1 499 ? 22.269  -12.532 30.758  1.00 20.73 ? 498  PHE B CA  1 
ATOM   8378 C C   . PHE B 1 499 ? 21.717  -13.960 30.776  1.00 20.11 ? 498  PHE B C   1 
ATOM   8379 O O   . PHE B 1 499 ? 22.493  -14.931 30.699  1.00 20.66 ? 498  PHE B O   1 
ATOM   8380 C CB  . PHE B 1 499 ? 22.105  -11.862 32.131  1.00 21.06 ? 498  PHE B CB  1 
ATOM   8381 C CG  . PHE B 1 499 ? 22.489  -12.749 33.289  1.00 22.78 ? 498  PHE B CG  1 
ATOM   8382 C CD1 . PHE B 1 499 ? 23.819  -12.901 33.651  1.00 24.12 ? 498  PHE B CD1 1 
ATOM   8383 C CD2 . PHE B 1 499 ? 21.518  -13.463 33.986  1.00 27.41 ? 498  PHE B CD2 1 
ATOM   8384 C CE1 . PHE B 1 499 ? 24.184  -13.744 34.720  1.00 25.38 ? 498  PHE B CE1 1 
ATOM   8385 C CE2 . PHE B 1 499 ? 21.865  -14.304 35.044  1.00 26.80 ? 498  PHE B CE2 1 
ATOM   8386 C CZ  . PHE B 1 499 ? 23.210  -14.432 35.414  1.00 26.97 ? 498  PHE B CZ  1 
ATOM   8387 N N   . VAL B 1 500 ? 20.386  -14.083 30.852  1.00 20.06 ? 499  VAL B N   1 
ATOM   8388 C CA  . VAL B 1 500 ? 19.732  -15.396 30.887  1.00 19.72 ? 499  VAL B CA  1 
ATOM   8389 C C   . VAL B 1 500 ? 20.142  -16.247 29.688  1.00 20.07 ? 499  VAL B C   1 
ATOM   8390 O O   . VAL B 1 500 ? 20.504  -17.416 29.858  1.00 20.14 ? 499  VAL B O   1 
ATOM   8391 C CB  . VAL B 1 500 ? 18.188  -15.292 31.006  1.00 19.79 ? 499  VAL B CB  1 
ATOM   8392 C CG1 . VAL B 1 500 ? 17.514  -16.673 30.832  1.00 18.36 ? 499  VAL B CG1 1 
ATOM   8393 C CG2 . VAL B 1 500 ? 17.798  -14.654 32.348  1.00 20.63 ? 499  VAL B CG2 1 
ATOM   8394 N N   . GLN B 1 501 ? 20.130  -15.657 28.491  1.00 19.55 ? 500  GLN B N   1 
ATOM   8395 C CA  . GLN B 1 501 ? 20.504  -16.390 27.282  1.00 19.72 ? 500  GLN B CA  1 
ATOM   8396 C C   . GLN B 1 501 ? 21.942  -16.928 27.329  1.00 19.12 ? 500  GLN B C   1 
ATOM   8397 O O   . GLN B 1 501 ? 22.192  -18.095 26.970  1.00 18.94 ? 500  GLN B O   1 
ATOM   8398 C CB  . GLN B 1 501 ? 20.249  -15.560 26.007  1.00 19.59 ? 500  GLN B CB  1 
ATOM   8399 C CG  . GLN B 1 501 ? 18.753  -15.349 25.717  1.00 19.21 ? 500  GLN B CG  1 
ATOM   8400 C CD  . GLN B 1 501 ? 18.477  -14.608 24.414  1.00 20.20 ? 500  GLN B CD  1 
ATOM   8401 O OE1 . GLN B 1 501 ? 19.231  -13.724 24.024  1.00 19.92 ? 500  GLN B OE1 1 
ATOM   8402 N NE2 . GLN B 1 501 ? 17.386  -14.954 23.763  1.00 20.98 ? 500  GLN B NE2 1 
ATOM   8403 N N   . GLY B 1 502 ? 22.865  -16.089 27.798  1.00 19.56 ? 501  GLY B N   1 
ATOM   8404 C CA  . GLY B 1 502 ? 24.268  -16.465 27.931  1.00 19.88 ? 501  GLY B CA  1 
ATOM   8405 C C   . GLY B 1 502 ? 24.488  -17.633 28.884  1.00 19.79 ? 501  GLY B C   1 
ATOM   8406 O O   . GLY B 1 502 ? 25.296  -18.518 28.602  1.00 19.27 ? 501  GLY B O   1 
ATOM   8407 N N   . ILE B 1 503 ? 23.774  -17.639 30.008  1.00 20.32 ? 502  ILE B N   1 
ATOM   8408 C CA  . ILE B 1 503 ? 23.857  -18.753 30.963  1.00 21.07 ? 502  ILE B CA  1 
ATOM   8409 C C   . ILE B 1 503 ? 23.377  -20.043 30.308  1.00 21.21 ? 502  ILE B C   1 
ATOM   8410 O O   . ILE B 1 503 ? 24.020  -21.092 30.431  1.00 22.31 ? 502  ILE B O   1 
ATOM   8411 C CB  . ILE B 1 503 ? 23.064  -18.442 32.293  1.00 21.32 ? 502  ILE B CB  1 
ATOM   8412 C CG1 . ILE B 1 503 ? 23.622  -17.199 33.006  1.00 21.65 ? 502  ILE B CG1 1 
ATOM   8413 C CG2 . ILE B 1 503 ? 23.012  -19.688 33.249  1.00 21.04 ? 502  ILE B CG2 1 
ATOM   8414 C CD1 . ILE B 1 503 ? 25.114  -17.266 33.402  1.00 24.88 ? 502  ILE B CD1 1 
ATOM   8415 N N   . MET B 1 504 ? 22.262  -19.962 29.590  1.00 21.36 ? 503  MET B N   1 
ATOM   8416 C CA  . MET B 1 504 ? 21.667  -21.122 28.948  1.00 21.58 ? 503  MET B CA  1 
ATOM   8417 C C   . MET B 1 504 ? 22.581  -21.711 27.863  1.00 21.81 ? 503  MET B C   1 
ATOM   8418 O O   . MET B 1 504 ? 22.683  -22.942 27.720  1.00 21.42 ? 503  MET B O   1 
ATOM   8419 C CB  . MET B 1 504 ? 20.253  -20.787 28.451  1.00 21.70 ? 503  MET B CB  1 
ATOM   8420 C CG  . MET B 1 504 ? 19.255  -20.650 29.606  1.00 23.09 ? 503  MET B CG  1 
ATOM   8421 S SD  . MET B 1 504 ? 17.627  -20.138 29.093  1.00 25.40 ? 503  MET B SD  1 
ATOM   8422 C CE  . MET B 1 504 ? 17.001  -21.652 28.509  1.00 26.45 ? 503  MET B CE  1 
ATOM   8423 N N   . TRP B 1 505 ? 23.307  -20.832 27.171  1.00 21.53 ? 504  TRP B N   1 
ATOM   8424 C CA  . TRP B 1 505 ? 24.306  -21.249 26.180  1.00 21.87 ? 504  TRP B CA  1 
ATOM   8425 C C   . TRP B 1 505 ? 25.645  -21.694 26.786  1.00 22.20 ? 504  TRP B C   1 
ATOM   8426 O O   . TRP B 1 505 ? 26.510  -22.205 26.079  1.00 22.15 ? 504  TRP B O   1 
ATOM   8427 C CB  . TRP B 1 505 ? 24.531  -20.135 25.140  1.00 21.67 ? 504  TRP B CB  1 
ATOM   8428 C CG  . TRP B 1 505 ? 23.361  -19.936 24.196  1.00 21.14 ? 504  TRP B CG  1 
ATOM   8429 C CD1 . TRP B 1 505 ? 22.562  -20.906 23.647  1.00 20.99 ? 504  TRP B CD1 1 
ATOM   8430 C CD2 . TRP B 1 505 ? 22.863  -18.687 23.696  1.00 20.57 ? 504  TRP B CD2 1 
ATOM   8431 N NE1 . TRP B 1 505 ? 21.596  -20.338 22.851  1.00 20.66 ? 504  TRP B NE1 1 
ATOM   8432 C CE2 . TRP B 1 505 ? 21.752  -18.975 22.864  1.00 20.03 ? 504  TRP B CE2 1 
ATOM   8433 C CE3 . TRP B 1 505 ? 23.240  -17.344 23.875  1.00 19.76 ? 504  TRP B CE3 1 
ATOM   8434 C CZ2 . TRP B 1 505 ? 21.014  -17.970 22.204  1.00 19.47 ? 504  TRP B CZ2 1 
ATOM   8435 C CZ3 . TRP B 1 505 ? 22.504  -16.352 23.233  1.00 18.04 ? 504  TRP B CZ3 1 
ATOM   8436 C CH2 . TRP B 1 505 ? 21.419  -16.666 22.397  1.00 19.25 ? 504  TRP B CH2 1 
ATOM   8437 N N   . ASP B 1 506 ? 25.806  -21.505 28.094  1.00 22.73 ? 505  ASP B N   1 
ATOM   8438 C CA  . ASP B 1 506 ? 27.049  -21.839 28.797  1.00 23.61 ? 505  ASP B CA  1 
ATOM   8439 C C   . ASP B 1 506 ? 28.216  -20.947 28.378  1.00 23.70 ? 505  ASP B C   1 
ATOM   8440 O O   . ASP B 1 506 ? 29.379  -21.342 28.482  1.00 24.37 ? 505  ASP B O   1 
ATOM   8441 C CB  . ASP B 1 506 ? 27.411  -23.313 28.577  1.00 23.85 ? 505  ASP B CB  1 
ATOM   8442 C CG  . ASP B 1 506 ? 28.074  -23.946 29.793  1.00 26.27 ? 505  ASP B CG  1 
ATOM   8443 O OD1 . ASP B 1 506 ? 27.615  -23.699 30.928  1.00 26.31 ? 505  ASP B OD1 1 
ATOM   8444 O OD2 . ASP B 1 506 ? 29.050  -24.719 29.691  1.00 27.68 ? 505  ASP B OD2 1 
ATOM   8445 N N   . ILE B 1 507 ? 27.913  -19.742 27.904  1.00 22.95 ? 506  ILE B N   1 
ATOM   8446 C CA  . ILE B 1 507 ? 28.971  -18.837 27.469  1.00 22.82 ? 506  ILE B CA  1 
ATOM   8447 C C   . ILE B 1 507 ? 29.165  -17.703 28.467  1.00 22.17 ? 506  ILE B C   1 
ATOM   8448 O O   . ILE B 1 507 ? 28.350  -17.520 29.382  1.00 21.85 ? 506  ILE B O   1 
ATOM   8449 C CB  . ILE B 1 507 ? 28.698  -18.293 26.037  1.00 22.75 ? 506  ILE B CB  1 
ATOM   8450 C CG1 . ILE B 1 507 ? 27.326  -17.603 25.986  1.00 22.77 ? 506  ILE B CG1 1 
ATOM   8451 C CG2 . ILE B 1 507 ? 28.834  -19.422 25.024  1.00 23.29 ? 506  ILE B CG2 1 
ATOM   8452 C CD1 . ILE B 1 507 ? 27.099  -16.732 24.762  1.00 25.11 ? 506  ILE B CD1 1 
ATOM   8453 N N   . ASN B 1 508 ? 30.262  -16.971 28.301  1.00 21.56 ? 507  ASN B N   1 
ATOM   8454 C CA  . ASN B 1 508 ? 30.533  -15.764 29.069  1.00 21.36 ? 507  ASN B CA  1 
ATOM   8455 C C   . ASN B 1 508 ? 29.989  -14.493 28.398  1.00 21.07 ? 507  ASN B C   1 
ATOM   8456 O O   . ASN B 1 508 ? 30.600  -13.968 27.461  1.00 20.79 ? 507  ASN B O   1 
ATOM   8457 C CB  . ASN B 1 508 ? 32.046  -15.610 29.300  1.00 21.39 ? 507  ASN B CB  1 
ATOM   8458 C CG  . ASN B 1 508 ? 32.377  -14.567 30.363  1.00 22.21 ? 507  ASN B CG  1 
ATOM   8459 O OD1 . ASN B 1 508 ? 31.482  -13.916 30.930  1.00 24.81 ? 507  ASN B OD1 1 
ATOM   8460 N ND2 . ASN B 1 508 ? 33.667  -14.388 30.625  1.00 23.28 ? 507  ASN B ND2 1 
ATOM   8461 N N   . SER B 1 509 ? 28.863  -13.991 28.894  1.00 20.80 ? 508  SER B N   1 
ATOM   8462 C CA  . SER B 1 509 ? 28.265  -12.760 28.367  1.00 20.49 ? 508  SER B CA  1 
ATOM   8463 C C   . SER B 1 509 ? 29.096  -11.497 28.609  1.00 20.36 ? 508  SER B C   1 
ATOM   8464 O O   . SER B 1 509 ? 28.797  -10.421 28.051  1.00 20.07 ? 508  SER B O   1 
ATOM   8465 C CB  . SER B 1 509 ? 26.862  -12.580 28.950  1.00 20.77 ? 508  SER B CB  1 
ATOM   8466 O OG  . SER B 1 509 ? 25.999  -13.620 28.529  1.00 19.57 ? 508  SER B OG  1 
ATOM   8467 N N   . PHE B 1 510 ? 30.138  -11.602 29.432  1.00 20.19 ? 509  PHE B N   1 
ATOM   8468 C CA  . PHE B 1 510 ? 30.781  -10.401 29.974  1.00 20.41 ? 509  PHE B CA  1 
ATOM   8469 C C   . PHE B 1 510 ? 32.217  -10.131 29.552  1.00 19.86 ? 509  PHE B C   1 
ATOM   8470 O O   . PHE B 1 510 ? 32.799  -9.124  29.941  1.00 19.62 ? 509  PHE B O   1 
ATOM   8471 C CB  . PHE B 1 510 ? 30.587  -10.353 31.488  1.00 20.57 ? 509  PHE B CB  1 
ATOM   8472 C CG  . PHE B 1 510 ? 29.148  -10.481 31.870  1.00 20.61 ? 509  PHE B CG  1 
ATOM   8473 C CD1 . PHE B 1 510 ? 28.644  -11.682 32.336  1.00 20.53 ? 509  PHE B CD1 1 
ATOM   8474 C CD2 . PHE B 1 510 ? 28.271  -9.431  31.626  1.00 19.76 ? 509  PHE B CD2 1 
ATOM   8475 C CE1 . PHE B 1 510 ? 27.306  -11.812 32.633  1.00 21.29 ? 509  PHE B CE1 1 
ATOM   8476 C CE2 . PHE B 1 510 ? 26.928  -9.556  31.922  1.00 22.39 ? 509  PHE B CE2 1 
ATOM   8477 C CZ  . PHE B 1 510 ? 26.443  -10.744 32.426  1.00 22.83 ? 509  PHE B CZ  1 
ATOM   8478 N N   . ASP B 1 511 ? 32.773  -11.010 28.730  1.00 20.01 ? 510  ASP B N   1 
ATOM   8479 C CA  . ASP B 1 511 ? 34.092  -10.757 28.168  1.00 20.20 ? 510  ASP B CA  1 
ATOM   8480 C C   . ASP B 1 511 ? 33.954  -10.354 26.694  1.00 20.24 ? 510  ASP B C   1 
ATOM   8481 O O   . ASP B 1 511 ? 32.841  -10.303 26.163  1.00 20.71 ? 510  ASP B O   1 
ATOM   8482 C CB  . ASP B 1 511 ? 35.034  -11.968 28.376  1.00 20.72 ? 510  ASP B CB  1 
ATOM   8483 C CG  . ASP B 1 511 ? 34.581  -13.218 27.636  1.00 21.07 ? 510  ASP B CG  1 
ATOM   8484 O OD1 . ASP B 1 511 ? 33.675  -13.133 26.786  1.00 21.92 ? 510  ASP B OD1 1 
ATOM   8485 O OD2 . ASP B 1 511 ? 35.086  -14.352 27.821  1.00 22.31 ? 510  ASP B OD2 1 
ATOM   8486 N N   . GLN B 1 512 ? 35.072  -10.048 26.051  1.00 19.66 ? 511  GLN B N   1 
ATOM   8487 C CA  . GLN B 1 512 ? 35.083  -9.646  24.638  1.00 20.11 ? 511  GLN B CA  1 
ATOM   8488 C C   . GLN B 1 512 ? 36.428  -9.923  23.985  1.00 20.55 ? 511  GLN B C   1 
ATOM   8489 O O   . GLN B 1 512 ? 37.078  -9.011  23.440  1.00 20.04 ? 511  GLN B O   1 
ATOM   8490 C CB  . GLN B 1 512 ? 34.680  -8.171  24.461  1.00 20.44 ? 511  GLN B CB  1 
ATOM   8491 C CG  . GLN B 1 512 ? 35.492  -7.174  25.262  1.00 21.11 ? 511  GLN B CG  1 
ATOM   8492 C CD  . GLN B 1 512 ? 35.099  -7.106  26.737  1.00 23.52 ? 511  GLN B CD  1 
ATOM   8493 O OE1 . GLN B 1 512 ? 33.938  -7.301  27.100  1.00 22.40 ? 511  GLN B OE1 1 
ATOM   8494 N NE2 . GLN B 1 512 ? 36.078  -6.844  27.583  1.00 22.50 ? 511  GLN B NE2 1 
ATOM   8495 N N   . TRP B 1 513 ? 36.846  -11.187 24.046  1.00 20.48 ? 512  TRP B N   1 
ATOM   8496 C CA  . TRP B 1 513 ? 38.153  -11.598 23.525  1.00 21.80 ? 512  TRP B CA  1 
ATOM   8497 C C   . TRP B 1 513 ? 38.218  -11.455 22.010  1.00 21.81 ? 512  TRP B C   1 
ATOM   8498 O O   . TRP B 1 513 ? 39.298  -11.389 21.428  1.00 22.23 ? 512  TRP B O   1 
ATOM   8499 C CB  . TRP B 1 513 ? 38.474  -13.041 23.971  1.00 21.70 ? 512  TRP B CB  1 
ATOM   8500 C CG  . TRP B 1 513 ? 38.724  -13.108 25.466  1.00 22.72 ? 512  TRP B CG  1 
ATOM   8501 C CD1 . TRP B 1 513 ? 37.940  -13.709 26.418  1.00 24.50 ? 512  TRP B CD1 1 
ATOM   8502 C CD2 . TRP B 1 513 ? 39.826  -12.521 26.174  1.00 24.06 ? 512  TRP B CD2 1 
ATOM   8503 N NE1 . TRP B 1 513 ? 38.490  -13.532 27.666  1.00 22.64 ? 512  TRP B NE1 1 
ATOM   8504 C CE2 . TRP B 1 513 ? 39.645  -12.807 27.547  1.00 25.15 ? 512  TRP B CE2 1 
ATOM   8505 C CE3 . TRP B 1 513 ? 40.951  -11.773 25.786  1.00 24.51 ? 512  TRP B CE3 1 
ATOM   8506 C CZ2 . TRP B 1 513 ? 40.554  -12.381 28.535  1.00 26.61 ? 512  TRP B CZ2 1 
ATOM   8507 C CZ3 . TRP B 1 513 ? 41.858  -11.352 26.765  1.00 26.18 ? 512  TRP B CZ3 1 
ATOM   8508 C CH2 . TRP B 1 513 ? 41.651  -11.663 28.125  1.00 26.01 ? 512  TRP B CH2 1 
ATOM   8509 N N   . GLY B 1 514 ? 37.054  -11.368 21.379  1.00 22.40 ? 513  GLY B N   1 
ATOM   8510 C CA  . GLY B 1 514 ? 36.962  -11.321 19.924  1.00 22.87 ? 513  GLY B CA  1 
ATOM   8511 C C   . GLY B 1 514 ? 37.325  -9.998  19.271  1.00 23.60 ? 513  GLY B C   1 
ATOM   8512 O O   . GLY B 1 514 ? 37.371  -9.901  18.044  1.00 24.43 ? 513  GLY B O   1 
ATOM   8513 N N   . VAL B 1 515 ? 37.595  -8.972  20.066  1.00 24.57 ? 514  VAL B N   1 
ATOM   8514 C CA  . VAL B 1 515 ? 37.992  -7.698  19.472  1.00 25.26 ? 514  VAL B CA  1 
ATOM   8515 C C   . VAL B 1 515 ? 39.517  -7.583  19.334  1.00 25.21 ? 514  VAL B C   1 
ATOM   8516 O O   . VAL B 1 515 ? 40.017  -6.692  18.647  1.00 25.36 ? 514  VAL B O   1 
ATOM   8517 C CB  . VAL B 1 515 ? 37.388  -6.474  20.228  1.00 25.86 ? 514  VAL B CB  1 
ATOM   8518 C CG1 . VAL B 1 515 ? 35.858  -6.611  20.369  1.00 26.89 ? 514  VAL B CG1 1 
ATOM   8519 C CG2 . VAL B 1 515 ? 38.051  -6.279  21.570  1.00 25.84 ? 514  VAL B CG2 1 
ATOM   8520 N N   . GLU B 1 516 ? 40.241  -8.519  19.948  1.00 24.59 ? 515  GLU B N   1 
ATOM   8521 C CA  . GLU B 1 516 ? 41.697  -8.434  20.076  1.00 25.17 ? 515  GLU B CA  1 
ATOM   8522 C C   . GLU B 1 516 ? 42.448  -8.526  18.742  1.00 24.16 ? 515  GLU B C   1 
ATOM   8523 O O   . GLU B 1 516 ? 43.353  -7.720  18.482  1.00 23.70 ? 515  GLU B O   1 
ATOM   8524 C CB  . GLU B 1 516 ? 42.206  -9.499  21.059  1.00 24.83 ? 515  GLU B CB  1 
ATOM   8525 C CG  . GLU B 1 516 ? 43.683  -9.383  21.410  1.00 28.73 ? 515  GLU B CG  1 
ATOM   8526 C CD  . GLU B 1 516 ? 44.066  -10.102 22.701  1.00 32.78 ? 515  GLU B CD  1 
ATOM   8527 O OE1 . GLU B 1 516 ? 45.177  -9.831  23.211  1.00 35.29 ? 515  GLU B OE1 1 
ATOM   8528 O OE2 . GLU B 1 516 ? 43.280  -10.934 23.209  1.00 33.70 ? 515  GLU B OE2 1 
ATOM   8529 N N   . LEU B 1 517 ? 42.087  -9.499  17.904  1.00 23.61 ? 516  LEU B N   1 
ATOM   8530 C CA  . LEU B 1 517 ? 42.841  -9.754  16.674  1.00 22.95 ? 516  LEU B CA  1 
ATOM   8531 C C   . LEU B 1 517 ? 42.847  -8.558  15.711  1.00 22.79 ? 516  LEU B C   1 
ATOM   8532 O O   . LEU B 1 517 ? 43.889  -8.202  15.161  1.00 21.90 ? 516  LEU B O   1 
ATOM   8533 C CB  . LEU B 1 517 ? 42.346  -11.018 15.966  1.00 23.09 ? 516  LEU B CB  1 
ATOM   8534 C CG  . LEU B 1 517 ? 43.054  -11.440 14.671  1.00 21.43 ? 516  LEU B CG  1 
ATOM   8535 C CD1 . LEU B 1 517 ? 44.555  -11.667 14.877  1.00 23.35 ? 516  LEU B CD1 1 
ATOM   8536 C CD2 . LEU B 1 517 ? 42.394  -12.706 14.135  1.00 21.10 ? 516  LEU B CD2 1 
ATOM   8537 N N   . GLY B 1 518 ? 41.695  -7.922  15.530  1.00 22.35 ? 517  GLY B N   1 
ATOM   8538 C CA  . GLY B 1 518 ? 41.620  -6.778  14.634  1.00 23.28 ? 517  GLY B CA  1 
ATOM   8539 C C   . GLY B 1 518 ? 42.454  -5.619  15.154  1.00 23.31 ? 517  GLY B C   1 
ATOM   8540 O O   . GLY B 1 518 ? 43.043  -4.865  14.364  1.00 23.86 ? 517  GLY B O   1 
ATOM   8541 N N   . LYS B 1 519 ? 42.505  -5.467  16.477  1.00 23.60 ? 518  LYS B N   1 
ATOM   8542 C CA  . LYS B 1 519 ? 43.323  -4.421  17.098  1.00 24.59 ? 518  LYS B CA  1 
ATOM   8543 C C   . LYS B 1 519 ? 44.814  -4.678  16.869  1.00 24.56 ? 518  LYS B C   1 
ATOM   8544 O O   . LYS B 1 519 ? 45.576  -3.759  16.549  1.00 24.53 ? 518  LYS B O   1 
ATOM   8545 C CB  . LYS B 1 519 ? 43.047  -4.331  18.603  1.00 24.70 ? 518  LYS B CB  1 
ATOM   8546 C CG  . LYS B 1 519 ? 41.669  -3.810  18.958  1.00 26.40 ? 518  LYS B CG  1 
ATOM   8547 C CD  . LYS B 1 519 ? 41.531  -3.654  20.472  1.00 28.90 ? 518  LYS B CD  1 
ATOM   8548 C CE  . LYS B 1 519 ? 40.131  -3.232  20.834  1.00 31.86 ? 518  LYS B CE  1 
ATOM   8549 N NZ  . LYS B 1 519 ? 39.847  -3.444  22.289  1.00 32.89 ? 518  LYS B NZ  1 
ATOM   8550 N N   . GLN B 1 520 ? 45.221  -5.934  17.033  1.00 24.74 ? 519  GLN B N   1 
ATOM   8551 C CA  . GLN B 1 520 ? 46.611  -6.323  16.826  1.00 24.48 ? 519  GLN B CA  1 
ATOM   8552 C C   . GLN B 1 520 ? 47.053  -6.055  15.380  1.00 23.97 ? 519  GLN B C   1 
ATOM   8553 O O   . GLN B 1 520 ? 48.126  -5.481  15.145  1.00 24.30 ? 519  GLN B O   1 
ATOM   8554 C CB  . GLN B 1 520 ? 46.815  -7.802  17.175  1.00 25.32 ? 519  GLN B CB  1 
ATOM   8555 C CG  . GLN B 1 520 ? 46.656  -8.143  18.647  1.00 27.69 ? 519  GLN B CG  1 
ATOM   8556 C CD  . GLN B 1 520 ? 46.740  -9.644  18.904  1.00 30.80 ? 519  GLN B CD  1 
ATOM   8557 O OE1 . GLN B 1 520 ? 45.977  -10.426 18.328  1.00 30.41 ? 519  GLN B OE1 1 
ATOM   8558 N NE2 . GLN B 1 520 ? 47.674  -10.045 19.760  1.00 33.90 ? 519  GLN B NE2 1 
ATOM   8559 N N   . LEU B 1 521 ? 46.212  -6.446  14.420  1.00 23.38 ? 520  LEU B N   1 
ATOM   8560 C CA  . LEU B 1 521 ? 46.558  -6.314  13.009  1.00 22.43 ? 520  LEU B CA  1 
ATOM   8561 C C   . LEU B 1 521 ? 46.564  -4.857  12.560  1.00 22.04 ? 520  LEU B C   1 
ATOM   8562 O O   . LEU B 1 521 ? 47.346  -4.484  11.687  1.00 21.18 ? 520  LEU B O   1 
ATOM   8563 C CB  . LEU B 1 521 ? 45.629  -7.153  12.121  1.00 22.81 ? 520  LEU B CB  1 
ATOM   8564 C CG  . LEU B 1 521 ? 45.625  -8.675  12.328  1.00 23.64 ? 520  LEU B CG  1 
ATOM   8565 C CD1 . LEU B 1 521 ? 45.016  -9.416  11.119  1.00 23.58 ? 520  LEU B CD1 1 
ATOM   8566 C CD2 . LEU B 1 521 ? 47.005  -9.229  12.671  1.00 25.01 ? 520  LEU B CD2 1 
ATOM   8567 N N   . ALA B 1 522 ? 45.688  -4.040  13.153  1.00 21.82 ? 521  ALA B N   1 
ATOM   8568 C CA  . ALA B 1 522 ? 45.614  -2.608  12.808  1.00 22.05 ? 521  ALA B CA  1 
ATOM   8569 C C   . ALA B 1 522 ? 46.887  -1.867  13.231  1.00 22.96 ? 521  ALA B C   1 
ATOM   8570 O O   . ALA B 1 522 ? 47.430  -1.032  12.482  1.00 22.97 ? 521  ALA B O   1 
ATOM   8571 C CB  . ALA B 1 522 ? 44.357  -1.952  13.438  1.00 21.77 ? 521  ALA B CB  1 
ATOM   8572 N N   . LYS B 1 523 ? 47.363  -2.180  14.433  1.00 23.72 ? 522  LYS B N   1 
ATOM   8573 C CA  . LYS B 1 523 ? 48.612  -1.617  14.928  1.00 24.73 ? 522  LYS B CA  1 
ATOM   8574 C C   . LYS B 1 523 ? 49.805  -1.936  14.020  1.00 24.75 ? 522  LYS B C   1 
ATOM   8575 O O   . LYS B 1 523 ? 50.708  -1.125  13.870  1.00 24.93 ? 522  LYS B O   1 
ATOM   8576 C CB  . LYS B 1 523 ? 48.869  -2.081  16.358  1.00 25.23 ? 522  LYS B CB  1 
ATOM   8577 C CG  . LYS B 1 523 ? 48.228  -1.179  17.413  1.00 28.57 ? 522  LYS B CG  1 
ATOM   8578 C CD  . LYS B 1 523 ? 49.025  0.121   17.586  1.00 32.86 ? 522  LYS B CD  1 
ATOM   8579 C CE  . LYS B 1 523 ? 48.213  1.355   17.213  1.00 35.08 ? 522  LYS B CE  1 
ATOM   8580 N NZ  . LYS B 1 523 ? 49.084  2.525   16.866  1.00 35.55 ? 522  LYS B NZ  1 
ATOM   8581 N N   . LYS B 1 524 ? 49.789  -3.104  13.397  1.00 25.07 ? 523  LYS B N   1 
ATOM   8582 C CA  . LYS B 1 524 ? 50.836  -3.480  12.451  1.00 25.56 ? 523  LYS B CA  1 
ATOM   8583 C C   . LYS B 1 524 ? 50.757  -2.730  11.113  1.00 25.08 ? 523  LYS B C   1 
ATOM   8584 O O   . LYS B 1 524 ? 51.790  -2.380  10.520  1.00 25.62 ? 523  LYS B O   1 
ATOM   8585 C CB  . LYS B 1 524 ? 50.804  -4.992  12.227  1.00 25.95 ? 523  LYS B CB  1 
ATOM   8586 C CG  . LYS B 1 524 ? 51.482  -5.763  13.338  1.00 29.41 ? 523  LYS B CG  1 
ATOM   8587 C CD  . LYS B 1 524 ? 50.953  -7.182  13.425  1.00 33.07 ? 523  LYS B CD  1 
ATOM   8588 C CE  . LYS B 1 524 ? 52.025  -8.130  13.945  1.00 35.88 ? 523  LYS B CE  1 
ATOM   8589 N NZ  . LYS B 1 524 ? 51.517  -8.935  15.090  1.00 37.97 ? 523  LYS B NZ  1 
ATOM   8590 N N   . ILE B 1 525 ? 49.539  -2.486  10.633  1.00 23.52 ? 524  ILE B N   1 
ATOM   8591 C CA  . ILE B 1 525 ? 49.344  -1.819  9.339   1.00 22.61 ? 524  ILE B CA  1 
ATOM   8592 C C   . ILE B 1 525 ? 49.553  -0.304  9.414   1.00 22.54 ? 524  ILE B C   1 
ATOM   8593 O O   . ILE B 1 525 ? 50.060  0.302   8.473   1.00 22.35 ? 524  ILE B O   1 
ATOM   8594 C CB  . ILE B 1 525 ? 47.934  -2.136  8.761   1.00 22.55 ? 524  ILE B CB  1 
ATOM   8595 C CG1 . ILE B 1 525 ? 47.871  -3.591  8.273   1.00 21.35 ? 524  ILE B CG1 1 
ATOM   8596 C CG2 . ILE B 1 525 ? 47.571  -1.167  7.631   1.00 19.75 ? 524  ILE B CG2 1 
ATOM   8597 C CD1 . ILE B 1 525 ? 46.436  -4.107  7.999   1.00 21.32 ? 524  ILE B CD1 1 
ATOM   8598 N N   . GLU B 1 526 ? 49.143  0.305   10.524  1.00 22.72 ? 525  GLU B N   1 
ATOM   8599 C CA  . GLU B 1 526 ? 49.228  1.759   10.676  1.00 23.93 ? 525  GLU B CA  1 
ATOM   8600 C C   . GLU B 1 526 ? 50.552  2.394   10.168  1.00 23.77 ? 525  GLU B C   1 
ATOM   8601 O O   . GLU B 1 526 ? 50.510  3.297   9.321   1.00 23.85 ? 525  GLU B O   1 
ATOM   8602 C CB  . GLU B 1 526 ? 48.910  2.169   12.127  1.00 24.25 ? 525  GLU B CB  1 
ATOM   8603 C CG  . GLU B 1 526 ? 48.618  3.651   12.305  1.00 27.56 ? 525  GLU B CG  1 
ATOM   8604 C CD  . GLU B 1 526 ? 48.405  4.039   13.757  1.00 30.53 ? 525  GLU B CD  1 
ATOM   8605 O OE1 . GLU B 1 526 ? 47.768  3.255   14.495  1.00 30.94 ? 525  GLU B OE1 1 
ATOM   8606 O OE2 . GLU B 1 526 ? 48.879  5.129   14.157  1.00 33.31 ? 525  GLU B OE2 1 
ATOM   8607 N N   . PRO B 1 527 ? 51.717  1.970   10.674  1.00 23.86 ? 526  PRO B N   1 
ATOM   8608 C CA  . PRO B 1 527 ? 52.990  2.553   10.210  1.00 24.04 ? 526  PRO B CA  1 
ATOM   8609 C C   . PRO B 1 527 ? 53.373  2.205   8.771   1.00 24.20 ? 526  PRO B C   1 
ATOM   8610 O O   . PRO B 1 527 ? 54.141  2.938   8.150   1.00 24.68 ? 526  PRO B O   1 
ATOM   8611 C CB  . PRO B 1 527 ? 54.021  2.005   11.200  1.00 23.71 ? 526  PRO B CB  1 
ATOM   8612 C CG  . PRO B 1 527 ? 53.416  0.752   11.726  1.00 24.52 ? 526  PRO B CG  1 
ATOM   8613 C CD  . PRO B 1 527 ? 51.935  1.004   11.765  1.00 23.50 ? 526  PRO B CD  1 
ATOM   8614 N N   . GLU B 1 528 ? 52.817  1.123   8.238   1.00 24.14 ? 527  GLU B N   1 
ATOM   8615 C CA  . GLU B 1 528 ? 53.079  0.729   6.860   1.00 23.97 ? 527  GLU B CA  1 
ATOM   8616 C C   . GLU B 1 528 ? 52.460  1.684   5.846   1.00 24.33 ? 527  GLU B C   1 
ATOM   8617 O O   . GLU B 1 528 ? 52.901  1.743   4.703   1.00 23.61 ? 527  GLU B O   1 
ATOM   8618 C CB  . GLU B 1 528 ? 52.578  -0.686  6.621   1.00 23.66 ? 527  GLU B CB  1 
ATOM   8619 C CG  . GLU B 1 528 ? 53.224  -1.716  7.534   1.00 24.99 ? 527  GLU B CG  1 
ATOM   8620 C CD  . GLU B 1 528 ? 52.735  -3.121  7.234   1.00 25.85 ? 527  GLU B CD  1 
ATOM   8621 O OE1 . GLU B 1 528 ? 51.529  -3.282  6.921   1.00 25.74 ? 527  GLU B OE1 1 
ATOM   8622 O OE2 . GLU B 1 528 ? 53.565  -4.050  7.278   1.00 28.28 ? 527  GLU B OE2 1 
ATOM   8623 N N   . LEU B 1 529 ? 51.441  2.437   6.270   1.00 24.69 ? 528  LEU B N   1 
ATOM   8624 C CA  . LEU B 1 529 ? 50.737  3.320   5.349   1.00 26.19 ? 528  LEU B CA  1 
ATOM   8625 C C   . LEU B 1 529 ? 51.516  4.600   5.041   1.00 27.95 ? 528  LEU B C   1 
ATOM   8626 O O   . LEU B 1 529 ? 51.406  5.117   3.939   1.00 28.55 ? 528  LEU B O   1 
ATOM   8627 C CB  . LEU B 1 529 ? 49.330  3.654   5.864   1.00 25.41 ? 528  LEU B CB  1 
ATOM   8628 C CG  . LEU B 1 529 ? 48.393  2.459   6.074   1.00 24.93 ? 528  LEU B CG  1 
ATOM   8629 C CD1 . LEU B 1 529 ? 47.079  2.914   6.704   1.00 22.48 ? 528  LEU B CD1 1 
ATOM   8630 C CD2 . LEU B 1 529 ? 48.132  1.776   4.729   1.00 23.17 ? 528  LEU B CD2 1 
ATOM   8631 N N   . GLU B 1 530 ? 52.293  5.077   6.019   1.00 30.31 ? 529  GLU B N   1 
ATOM   8632 C CA  . GLU B 1 530 ? 53.116  6.301   5.926   1.00 32.68 ? 529  GLU B CA  1 
ATOM   8633 C C   . GLU B 1 530 ? 53.848  6.468   4.584   1.00 33.22 ? 529  GLU B C   1 
ATOM   8634 O O   . GLU B 1 530 ? 53.481  7.314   3.754   1.00 34.95 ? 529  GLU B O   1 
ATOM   8635 C CB  . GLU B 1 530 ? 54.149  6.349   7.078   1.00 33.03 ? 529  GLU B CB  1 
ATOM   8636 C CG  . GLU B 1 530 ? 53.594  6.522   8.499   1.00 36.42 ? 529  GLU B CG  1 
ATOM   8637 C CD  . GLU B 1 530 ? 54.532  6.005   9.606   1.00 40.01 ? 529  GLU B CD  1 
ATOM   8638 O OE1 . GLU B 1 530 ? 54.319  6.372   10.791  1.00 40.28 ? 529  GLU B OE1 1 
ATOM   8639 O OE2 . GLU B 1 530 ? 55.477  5.217   9.316   1.00 41.61 ? 529  GLU B OE2 1 
ATOM   8640 N N   . GLY B 1 531 ? 54.867  5.645   4.360   1.00 33.42 ? 530  GLY B N   1 
ATOM   8641 C CA  . GLY B 1 531 ? 55.807  5.893   3.281   1.00 33.20 ? 530  GLY B CA  1 
ATOM   8642 C C   . GLY B 1 531 ? 55.288  5.613   1.885   1.00 32.88 ? 530  GLY B C   1 
ATOM   8643 O O   . GLY B 1 531 ? 54.110  5.298   1.696   1.00 33.05 ? 530  GLY B O   1 
ATOM   8644 N N   . SER B 1 532 ? 56.177  5.737   0.905   1.00 32.15 ? 531  SER B N   1 
ATOM   8645 C CA  . SER B 1 532 ? 55.842  5.448   -0.480  1.00 31.99 ? 531  SER B CA  1 
ATOM   8646 C C   . SER B 1 532 ? 56.151  3.996   -0.858  1.00 31.40 ? 531  SER B C   1 
ATOM   8647 O O   . SER B 1 532 ? 55.730  3.530   -1.914  1.00 31.77 ? 531  SER B O   1 
ATOM   8648 C CB  . SER B 1 532 ? 56.572  6.400   -1.435  1.00 32.34 ? 531  SER B CB  1 
ATOM   8649 O OG  . SER B 1 532 ? 57.972  6.209   -1.349  1.00 33.68 ? 531  SER B OG  1 
ATOM   8650 N N   . SER B 1 533 ? 56.871  3.279   -0.003  1.00 30.83 ? 532  SER B N   1 
ATOM   8651 C CA  . SER B 1 533 ? 57.314  1.931   -0.373  1.00 29.77 ? 532  SER B CA  1 
ATOM   8652 C C   . SER B 1 533 ? 56.150  0.936   -0.446  1.00 28.35 ? 532  SER B C   1 
ATOM   8653 O O   . SER B 1 533 ? 55.139  1.071   0.260   1.00 27.47 ? 532  SER B O   1 
ATOM   8654 C CB  . SER B 1 533 ? 58.407  1.431   0.565   1.00 30.19 ? 532  SER B CB  1 
ATOM   8655 O OG  . SER B 1 533 ? 57.925  1.274   1.886   1.00 33.46 ? 532  SER B OG  1 
ATOM   8656 N N   . ALA B 1 534 ? 56.301  -0.049  -1.320  1.00 26.95 ? 533  ALA B N   1 
ATOM   8657 C CA  . ALA B 1 534 ? 55.297  -1.092  -1.478  1.00 25.81 ? 533  ALA B CA  1 
ATOM   8658 C C   . ALA B 1 534 ? 55.254  -1.972  -0.229  1.00 25.00 ? 533  ALA B C   1 
ATOM   8659 O O   . ALA B 1 534 ? 56.296  -2.317  0.342   1.00 25.28 ? 533  ALA B O   1 
ATOM   8660 C CB  . ALA B 1 534 ? 55.589  -1.919  -2.729  1.00 26.04 ? 533  ALA B CB  1 
ATOM   8661 N N   . VAL B 1 535 ? 54.046  -2.308  0.213   1.00 23.83 ? 534  VAL B N   1 
ATOM   8662 C CA  . VAL B 1 535 ? 53.861  -3.195  1.362   1.00 23.32 ? 534  VAL B CA  1 
ATOM   8663 C C   . VAL B 1 535 ? 53.590  -4.601  0.827   1.00 23.40 ? 534  VAL B C   1 
ATOM   8664 O O   . VAL B 1 535 ? 52.692  -4.787  -0.013  1.00 23.08 ? 534  VAL B O   1 
ATOM   8665 C CB  . VAL B 1 535 ? 52.710  -2.709  2.280   1.00 23.12 ? 534  VAL B CB  1 
ATOM   8666 C CG1 . VAL B 1 535 ? 52.450  -3.705  3.423   1.00 22.22 ? 534  VAL B CG1 1 
ATOM   8667 C CG2 . VAL B 1 535 ? 53.052  -1.325  2.850   1.00 23.69 ? 534  VAL B CG2 1 
ATOM   8668 N N   . THR B 1 536 ? 54.407  -5.559  1.279   1.00 23.09 ? 535  THR B N   1 
ATOM   8669 C CA  . THR B 1 536 ? 54.315  -6.950  0.838   1.00 23.72 ? 535  THR B CA  1 
ATOM   8670 C C   . THR B 1 536 ? 54.172  -7.921  2.003   1.00 23.78 ? 535  THR B C   1 
ATOM   8671 O O   . THR B 1 536 ? 54.173  -9.141  1.795   1.00 23.85 ? 535  THR B O   1 
ATOM   8672 C CB  . THR B 1 536 ? 55.565  -7.351  0.012   1.00 24.19 ? 535  THR B CB  1 
ATOM   8673 O OG1 . THR B 1 536 ? 56.732  -7.093  0.792   1.00 24.66 ? 535  THR B OG1 1 
ATOM   8674 C CG2 . THR B 1 536 ? 55.731  -6.462  -1.220  1.00 23.79 ? 535  THR B CG2 1 
ATOM   8675 N N   . SER B 1 537 ? 54.034  -7.398  3.220   1.00 23.99 ? 536  SER B N   1 
ATOM   8676 C CA  . SER B 1 537 ? 54.078  -8.223  4.434   1.00 24.79 ? 536  SER B CA  1 
ATOM   8677 C C   . SER B 1 537 ? 52.780  -8.927  4.796   1.00 24.58 ? 536  SER B C   1 
ATOM   8678 O O   . SER B 1 537 ? 52.705  -9.590  5.836   1.00 25.22 ? 536  SER B O   1 
ATOM   8679 C CB  . SER B 1 537 ? 54.524  -7.383  5.638   1.00 24.86 ? 536  SER B CB  1 
ATOM   8680 O OG  . SER B 1 537 ? 53.589  -6.357  5.897   1.00 27.70 ? 536  SER B OG  1 
ATOM   8681 N N   . HIS B 1 538 ? 51.754  -8.785  3.967   1.00 23.13 ? 537  HIS B N   1 
ATOM   8682 C CA  . HIS B 1 538 ? 50.479  -9.432  4.268   1.00 22.47 ? 537  HIS B CA  1 
ATOM   8683 C C   . HIS B 1 538 ? 50.067  -10.372 3.156   1.00 21.61 ? 537  HIS B C   1 
ATOM   8684 O O   . HIS B 1 538 ? 50.823  -10.594 2.226   1.00 21.76 ? 537  HIS B O   1 
ATOM   8685 C CB  . HIS B 1 538 ? 49.395  -8.374  4.513   1.00 22.40 ? 537  HIS B CB  1 
ATOM   8686 C CG  . HIS B 1 538 ? 49.782  -7.328  5.508   1.00 22.28 ? 537  HIS B CG  1 
ATOM   8687 N ND1 . HIS B 1 538 ? 49.433  -7.398  6.841   1.00 23.69 ? 537  HIS B ND1 1 
ATOM   8688 C CD2 . HIS B 1 538 ? 50.493  -6.185  5.364   1.00 23.14 ? 537  HIS B CD2 1 
ATOM   8689 C CE1 . HIS B 1 538 ? 49.926  -6.349  7.477   1.00 24.00 ? 537  HIS B CE1 1 
ATOM   8690 N NE2 . HIS B 1 538 ? 50.580  -5.602  6.605   1.00 22.86 ? 537  HIS B NE2 1 
ATOM   8691 N N   . ASP B 1 539 ? 48.853  -10.914 3.243   1.00 20.52 ? 538  ASP B N   1 
ATOM   8692 C CA  . ASP B 1 539 ? 48.250  -11.639 2.131   1.00 19.70 ? 538  ASP B CA  1 
ATOM   8693 C C   . ASP B 1 539 ? 48.102  -10.702 0.911   1.00 19.09 ? 538  ASP B C   1 
ATOM   8694 O O   . ASP B 1 539 ? 48.162  -9.473  1.056   1.00 18.52 ? 538  ASP B O   1 
ATOM   8695 C CB  . ASP B 1 539 ? 46.880  -12.145 2.554   1.00 19.02 ? 538  ASP B CB  1 
ATOM   8696 C CG  . ASP B 1 539 ? 45.928  -11.002 2.855   1.00 17.64 ? 538  ASP B CG  1 
ATOM   8697 O OD1 . ASP B 1 539 ? 45.238  -10.543 1.934   1.00 16.73 ? 538  ASP B OD1 1 
ATOM   8698 O OD2 . ASP B 1 539 ? 45.845  -10.472 3.969   1.00 19.67 ? 538  ASP B OD2 1 
ATOM   8699 N N   . SER B 1 540 ? 47.891  -11.260 -0.279  1.00 18.67 ? 539  SER B N   1 
ATOM   8700 C CA  . SER B 1 540 ? 47.865  -10.436 -1.499  1.00 18.40 ? 539  SER B CA  1 
ATOM   8701 C C   . SER B 1 540 ? 46.719  -9.419  -1.580  1.00 18.41 ? 539  SER B C   1 
ATOM   8702 O O   . SER B 1 540 ? 46.856  -8.370  -2.224  1.00 17.98 ? 539  SER B O   1 
ATOM   8703 C CB  . SER B 1 540 ? 47.917  -11.283 -2.767  1.00 19.43 ? 539  SER B CB  1 
ATOM   8704 O OG  . SER B 1 540 ? 46.699  -11.983 -2.988  1.00 18.46 ? 539  SER B OG  1 
ATOM   8705 N N   . SER B 1 541 ? 45.597  -9.717  -0.934  1.00 17.76 ? 540  SER B N   1 
ATOM   8706 C CA  . SER B 1 541 ? 44.502  -8.746  -0.885  1.00 17.90 ? 540  SER B CA  1 
ATOM   8707 C C   . SER B 1 541 ? 44.854  -7.527  -0.023  1.00 17.95 ? 540  SER B C   1 
ATOM   8708 O O   . SER B 1 541 ? 44.774  -6.374  -0.497  1.00 18.19 ? 540  SER B O   1 
ATOM   8709 C CB  . SER B 1 541 ? 43.198  -9.417  -0.429  1.00 17.41 ? 540  SER B CB  1 
ATOM   8710 O OG  . SER B 1 541 ? 42.211  -8.456  -0.097  1.00 16.44 ? 540  SER B OG  1 
ATOM   8711 N N   . THR B 1 542 ? 45.247  -7.761  1.231   1.00 18.12 ? 541  THR B N   1 
ATOM   8712 C CA  . THR B 1 542 ? 45.681  -6.647  2.096   1.00 18.31 ? 541  THR B CA  1 
ATOM   8713 C C   . THR B 1 542 ? 46.784  -5.815  1.408   1.00 18.39 ? 541  THR B C   1 
ATOM   8714 O O   . THR B 1 542 ? 46.731  -4.576  1.390   1.00 17.46 ? 541  THR B O   1 
ATOM   8715 C CB  . THR B 1 542 ? 46.140  -7.176  3.469   1.00 18.43 ? 541  THR B CB  1 
ATOM   8716 O OG1 . THR B 1 542 ? 45.091  -7.947  4.064   1.00 18.67 ? 541  THR B OG1 1 
ATOM   8717 C CG2 . THR B 1 542 ? 46.361  -6.033  4.466   1.00 18.11 ? 541  THR B CG2 1 
ATOM   8718 N N   . ASN B 1 543 ? 47.758  -6.498  0.806   1.00 18.50 ? 542  ASN B N   1 
ATOM   8719 C CA  . ASN B 1 543 ? 48.798  -5.806  0.027   1.00 18.96 ? 542  ASN B CA  1 
ATOM   8720 C C   . ASN B 1 543 ? 48.225  -5.008  -1.150  1.00 18.54 ? 542  ASN B C   1 
ATOM   8721 O O   . ASN B 1 543 ? 48.628  -3.850  -1.396  1.00 18.64 ? 542  ASN B O   1 
ATOM   8722 C CB  . ASN B 1 543 ? 49.850  -6.788  -0.517  1.00 18.92 ? 542  ASN B CB  1 
ATOM   8723 C CG  . ASN B 1 543 ? 50.652  -7.504  0.567   1.00 20.42 ? 542  ASN B CG  1 
ATOM   8724 O OD1 . ASN B 1 543 ? 50.681  -7.115  1.746   1.00 20.32 ? 542  ASN B OD1 1 
ATOM   8725 N ND2 . ASN B 1 543 ? 51.340  -8.574  0.150   1.00 19.08 ? 542  ASN B ND2 1 
ATOM   8726 N N   . GLY B 1 544 ? 47.307  -5.626  -1.894  1.00 17.93 ? 543  GLY B N   1 
ATOM   8727 C CA  . GLY B 1 544 ? 46.705  -4.984  -3.051  1.00 17.94 ? 543  GLY B CA  1 
ATOM   8728 C C   . GLY B 1 544 ? 45.887  -3.756  -2.683  1.00 17.61 ? 543  GLY B C   1 
ATOM   8729 O O   . GLY B 1 544 ? 45.948  -2.698  -3.349  1.00 17.97 ? 543  GLY B O   1 
ATOM   8730 N N   . LEU B 1 545 ? 45.156  -3.869  -1.583  1.00 17.25 ? 544  LEU B N   1 
ATOM   8731 C CA  . LEU B 1 545 ? 44.378  -2.739  -1.095  1.00 17.60 ? 544  LEU B CA  1 
ATOM   8732 C C   . LEU B 1 545 ? 45.295  -1.596  -0.661  1.00 17.65 ? 544  LEU B C   1 
ATOM   8733 O O   . LEU B 1 545 ? 45.007  -0.432  -0.962  1.00 18.26 ? 544  LEU B O   1 
ATOM   8734 C CB  . LEU B 1 545 ? 43.462  -3.162  0.052   1.00 18.19 ? 544  LEU B CB  1 
ATOM   8735 C CG  . LEU B 1 545 ? 42.356  -4.157  -0.285  1.00 16.71 ? 544  LEU B CG  1 
ATOM   8736 C CD1 . LEU B 1 545 ? 41.869  -4.822  0.995   1.00 17.25 ? 544  LEU B CD1 1 
ATOM   8737 C CD2 . LEU B 1 545 ? 41.204  -3.494  -1.087  1.00 18.75 ? 544  LEU B CD2 1 
ATOM   8738 N N   . ILE B 1 546 ? 46.410  -1.926  -0.003  1.00 17.85 ? 545  ILE B N   1 
ATOM   8739 C CA  . ILE B 1 546 ? 47.380  -0.895  0.422   1.00 18.20 ? 545  ILE B CA  1 
ATOM   8740 C C   . ILE B 1 546 ? 48.021  -0.206  -0.789  1.00 18.26 ? 545  ILE B C   1 
ATOM   8741 O O   . ILE B 1 546 ? 48.165  1.025   -0.821  1.00 18.46 ? 545  ILE B O   1 
ATOM   8742 C CB  . ILE B 1 546 ? 48.446  -1.464  1.420   1.00 18.14 ? 545  ILE B CB  1 
ATOM   8743 C CG1 . ILE B 1 546 ? 47.809  -1.809  2.783   1.00 18.18 ? 545  ILE B CG1 1 
ATOM   8744 C CG2 . ILE B 1 546 ? 49.605  -0.479  1.639   1.00 17.66 ? 545  ILE B CG2 1 
ATOM   8745 C CD1 . ILE B 1 546 ? 48.685  -2.651  3.746   1.00 19.33 ? 545  ILE B CD1 1 
ATOM   8746 N N   . SER B 1 547 ? 48.398  -1.000  -1.789  1.00 18.38 ? 546  SER B N   1 
ATOM   8747 C CA  . SER B 1 547 ? 48.917  -0.472  -3.056  1.00 18.60 ? 546  SER B CA  1 
ATOM   8748 C C   . SER B 1 547 ? 47.953  0.538   -3.693  1.00 18.64 ? 546  SER B C   1 
ATOM   8749 O O   . SER B 1 547 ? 48.368  1.590   -4.187  1.00 19.41 ? 546  SER B O   1 
ATOM   8750 C CB  . SER B 1 547 ? 49.133  -1.624  -4.029  1.00 18.24 ? 546  SER B CB  1 
ATOM   8751 O OG  A SER B 1 547 ? 50.228  -2.431  -3.646  0.30 18.20 ? 546  SER B OG  1 
ATOM   8752 O OG  B SER B 1 547 ? 49.786  -1.205  -5.214  0.70 19.00 ? 546  SER B OG  1 
ATOM   8753 N N   . PHE B 1 548 ? 46.666  0.210   -3.688  1.00 18.11 ? 547  PHE B N   1 
ATOM   8754 C CA  . PHE B 1 548 ? 45.653  1.077   -4.278  1.00 18.38 ? 547  PHE B CA  1 
ATOM   8755 C C   . PHE B 1 548 ? 45.548  2.401   -3.513  1.00 18.00 ? 547  PHE B C   1 
ATOM   8756 O O   . PHE B 1 548 ? 45.524  3.474   -4.116  1.00 18.18 ? 547  PHE B O   1 
ATOM   8757 C CB  . PHE B 1 548 ? 44.305  0.352   -4.279  1.00 18.10 ? 547  PHE B CB  1 
ATOM   8758 C CG  . PHE B 1 548 ? 43.186  1.146   -4.878  1.00 17.74 ? 547  PHE B CG  1 
ATOM   8759 C CD1 . PHE B 1 548 ? 43.020  1.213   -6.269  1.00 18.89 ? 547  PHE B CD1 1 
ATOM   8760 C CD2 . PHE B 1 548 ? 42.270  1.797   -4.052  1.00 16.72 ? 547  PHE B CD2 1 
ATOM   8761 C CE1 . PHE B 1 548 ? 41.957  1.940   -6.819  1.00 18.99 ? 547  PHE B CE1 1 
ATOM   8762 C CE2 . PHE B 1 548 ? 41.216  2.527   -4.591  1.00 17.64 ? 547  PHE B CE2 1 
ATOM   8763 C CZ  . PHE B 1 548 ? 41.064  2.598   -5.982  1.00 19.45 ? 547  PHE B CZ  1 
ATOM   8764 N N   . ILE B 1 549 ? 45.475  2.302   -2.188  1.00 17.68 ? 548  ILE B N   1 
ATOM   8765 C CA  . ILE B 1 549 ? 45.519  3.473   -1.307  1.00 18.02 ? 548  ILE B CA  1 
ATOM   8766 C C   . ILE B 1 549 ? 46.752  4.363   -1.569  1.00 18.68 ? 548  ILE B C   1 
ATOM   8767 O O   . ILE B 1 549 ? 46.628  5.583   -1.722  1.00 17.81 ? 548  ILE B O   1 
ATOM   8768 C CB  . ILE B 1 549 ? 45.468  3.019   0.160   1.00 18.40 ? 548  ILE B CB  1 
ATOM   8769 C CG1 . ILE B 1 549 ? 44.112  2.380   0.486   1.00 17.66 ? 548  ILE B CG1 1 
ATOM   8770 C CG2 . ILE B 1 549 ? 45.792  4.169   1.145   1.00 18.17 ? 548  ILE B CG2 1 
ATOM   8771 C CD1 . ILE B 1 549 ? 44.168  1.448   1.723   1.00 18.78 ? 548  ILE B CD1 1 
ATOM   8772 N N   . LYS B 1 550 ? 47.936  3.765   -1.642  1.00 19.56 ? 549  LYS B N   1 
ATOM   8773 C CA  . LYS B 1 550 ? 49.133  4.569   -1.862  1.00 20.55 ? 549  LYS B CA  1 
ATOM   8774 C C   . LYS B 1 550 ? 49.098  5.246   -3.224  1.00 21.65 ? 549  LYS B C   1 
ATOM   8775 O O   . LYS B 1 550 ? 49.544  6.386   -3.363  1.00 22.81 ? 549  LYS B O   1 
ATOM   8776 C CB  . LYS B 1 550 ? 50.424  3.748   -1.650  1.00 20.10 ? 549  LYS B CB  1 
ATOM   8777 C CG  . LYS B 1 550 ? 50.579  3.231   -0.228  1.00 20.53 ? 549  LYS B CG  1 
ATOM   8778 C CD  . LYS B 1 550 ? 51.993  2.764   0.027   1.00 22.23 ? 549  LYS B CD  1 
ATOM   8779 C CE  . LYS B 1 550 ? 52.177  2.420   1.491   1.00 22.73 ? 549  LYS B CE  1 
ATOM   8780 N NZ  . LYS B 1 550 ? 53.566  2.703   1.961   1.00 23.15 ? 549  LYS B NZ  1 
ATOM   8781 N N   . GLN B 1 551 ? 48.523  4.569   -4.210  1.00 21.76 ? 550  GLN B N   1 
ATOM   8782 C CA  . GLN B 1 551 ? 48.467  5.082   -5.567  1.00 22.59 ? 550  GLN B CA  1 
ATOM   8783 C C   . GLN B 1 551 ? 47.433  6.199   -5.694  1.00 22.87 ? 550  GLN B C   1 
ATOM   8784 O O   . GLN B 1 551 ? 47.704  7.226   -6.325  1.00 22.65 ? 550  GLN B O   1 
ATOM   8785 C CB  . GLN B 1 551 ? 48.165  3.956   -6.558  1.00 22.96 ? 550  GLN B CB  1 
ATOM   8786 C CG  . GLN B 1 551 ? 48.367  4.358   -8.015  1.00 26.51 ? 550  GLN B CG  1 
ATOM   8787 C CD  . GLN B 1 551 ? 47.393  3.665   -8.931  1.00 29.66 ? 550  GLN B CD  1 
ATOM   8788 O OE1 . GLN B 1 551 ? 46.185  3.666   -8.679  1.00 31.01 ? 550  GLN B OE1 1 
ATOM   8789 N NE2 . GLN B 1 551 ? 47.908  3.046   -9.988  1.00 31.70 ? 550  GLN B NE2 1 
ATOM   8790 N N   . GLN B 1 552 ? 46.277  6.011   -5.056  1.00 21.85 ? 551  GLN B N   1 
ATOM   8791 C CA  . GLN B 1 552 ? 45.146  6.920   -5.225  1.00 22.53 ? 551  GLN B CA  1 
ATOM   8792 C C   . GLN B 1 552 ? 45.131  8.133   -4.298  1.00 23.83 ? 551  GLN B C   1 
ATOM   8793 O O   . GLN B 1 552 ? 44.318  9.042   -4.483  1.00 24.47 ? 551  GLN B O   1 
ATOM   8794 C CB  . GLN B 1 552 ? 43.821  6.148   -5.121  1.00 22.33 ? 551  GLN B CB  1 
ATOM   8795 C CG  . GLN B 1 552 ? 43.541  5.260   -6.331  1.00 21.78 ? 551  GLN B CG  1 
ATOM   8796 C CD  . GLN B 1 552 ? 43.400  6.049   -7.618  1.00 23.74 ? 551  GLN B CD  1 
ATOM   8797 O OE1 . GLN B 1 552 ? 42.654  7.030   -7.674  1.00 23.15 ? 551  GLN B OE1 1 
ATOM   8798 N NE2 . GLN B 1 552 ? 44.127  5.633   -8.648  1.00 24.41 ? 551  GLN B NE2 1 
ATOM   8799 N N   . ARG B 1 553 ? 46.010  8.167   -3.303  1.00 24.82 ? 552  ARG B N   1 
ATOM   8800 C CA  . ARG B 1 553 ? 45.943  9.264   -2.343  1.00 27.65 ? 552  ARG B CA  1 
ATOM   8801 C C   . ARG B 1 553 ? 46.494  10.579  -2.877  1.00 29.69 ? 552  ARG B C   1 
ATOM   8802 O O   . ARG B 1 553 ? 46.217  11.634  -2.316  1.00 29.55 ? 552  ARG B O   1 
ATOM   8803 C CB  . ARG B 1 553 ? 46.588  8.893   -1.010  1.00 26.92 ? 552  ARG B CB  1 
ATOM   8804 C CG  . ARG B 1 553 ? 48.058  8.569   -1.070  1.00 28.11 ? 552  ARG B CG  1 
ATOM   8805 C CD  . ARG B 1 553 ? 48.549  8.027   0.257   1.00 28.49 ? 552  ARG B CD  1 
ATOM   8806 N NE  . ARG B 1 553 ? 49.955  7.648   0.229   1.00 27.93 ? 552  ARG B NE  1 
ATOM   8807 C CZ  . ARG B 1 553 ? 50.544  6.943   1.173   1.00 27.49 ? 552  ARG B CZ  1 
ATOM   8808 N NH1 . ARG B 1 553 ? 51.826  6.652   1.063   1.00 28.23 ? 552  ARG B NH1 1 
ATOM   8809 N NH2 . ARG B 1 553 ? 49.853  6.527   2.232   1.00 28.30 ? 552  ARG B NH2 1 
ATOM   8810 N N   . ASP B 1 554 ? 47.233  10.486  -3.979  1.00 32.71 ? 553  ASP B N   1 
ATOM   8811 C CA  . ASP B 1 554 ? 47.868  11.628  -4.639  1.00 36.21 ? 553  ASP B CA  1 
ATOM   8812 C C   . ASP B 1 554 ? 47.069  12.110  -5.854  1.00 37.44 ? 553  ASP B C   1 
ATOM   8813 O O   . ASP B 1 554 ? 47.404  13.146  -6.455  1.00 38.13 ? 553  ASP B O   1 
ATOM   8814 C CB  . ASP B 1 554 ? 49.279  11.246  -5.099  1.00 36.68 ? 553  ASP B CB  1 
ATOM   8815 C CG  . ASP B 1 554 ? 50.257  11.085  -3.950  1.00 38.34 ? 553  ASP B CG  1 
ATOM   8816 O OD1 . ASP B 1 554 ? 50.158  11.840  -2.953  1.00 41.49 ? 553  ASP B OD1 1 
ATOM   8817 O OD2 . ASP B 1 554 ? 51.176  10.234  -3.971  1.00 40.42 ? 553  ASP B OD2 1 
ATOM   8818 N N   . THR B 1 555 ? 46.033  11.356  -6.226  1.00 38.48 ? 554  THR B N   1 
ATOM   8819 C CA  . THR B 1 555 ? 45.221  11.685  -7.396  1.00 39.63 ? 554  THR B CA  1 
ATOM   8820 C C   . THR B 1 555 ? 44.442  12.974  -7.165  1.00 40.43 ? 554  THR B C   1 
ATOM   8821 O O   . THR B 1 555 ? 43.764  13.120  -6.147  1.00 40.18 ? 554  THR B O   1 
ATOM   8822 C CB  . THR B 1 555 ? 44.236  10.543  -7.724  1.00 39.39 ? 554  THR B CB  1 
ATOM   8823 O OG1 . THR B 1 555 ? 44.959  9.324   -7.927  1.00 40.62 ? 554  THR B OG1 1 
ATOM   8824 C CG2 . THR B 1 555 ? 43.571  10.784  -9.075  1.00 39.84 ? 554  THR B CG2 1 
ATOM   8825 N N   . LYS B 1 556 ? 44.535  13.894  -8.123  1.00 41.36 ? 555  LYS B N   1 
ATOM   8826 C CA  . LYS B 1 556 ? 43.824  15.162  -8.042  1.00 42.36 ? 555  LYS B CA  1 
ATOM   8827 C C   . LYS B 1 556 ? 42.532  15.136  -8.865  1.00 42.72 ? 555  LYS B C   1 
ATOM   8828 O O   . LYS B 1 556 ? 42.569  15.036  -10.095 1.00 43.18 ? 555  LYS B O   1 
ATOM   8829 C CB  . LYS B 1 556 ? 44.733  16.322  -8.475  1.00 42.40 ? 555  LYS B CB  1 
ATOM   8830 C CG  . LYS B 1 556 ? 45.175  17.232  -7.326  1.00 43.68 ? 555  LYS B CG  1 
ATOM   8831 C CD  . LYS B 1 556 ? 43.994  17.984  -6.708  1.00 43.96 ? 555  LYS B CD  1 
ATOM   8832 C CE  . LYS B 1 556 ? 44.096  19.488  -6.930  1.00 44.99 ? 555  LYS B CE  1 
ATOM   8833 N NZ  . LYS B 1 556 ? 43.111  20.224  -6.081  1.00 44.35 ? 555  LYS B NZ  1 
ATOM   8834 N N   . LEU B 1 557 ? 41.398  15.216  -8.170  1.00 42.95 ? 556  LEU B N   1 
ATOM   8835 C CA  . LEU B 1 557 ? 40.080  15.194  -8.803  1.00 43.08 ? 556  LEU B CA  1 
ATOM   8836 C C   . LEU B 1 557 ? 39.532  16.614  -8.977  1.00 43.50 ? 556  LEU B C   1 
ATOM   8837 O O   . LEU B 1 557 ? 39.334  17.345  -7.995  1.00 43.91 ? 556  LEU B O   1 
ATOM   8838 C CB  . LEU B 1 557 ? 39.106  14.338  -7.978  1.00 42.77 ? 556  LEU B CB  1 
ATOM   8839 C CG  . LEU B 1 557 ? 38.844  12.859  -8.316  1.00 42.39 ? 556  LEU B CG  1 
ATOM   8840 C CD1 . LEU B 1 557 ? 40.003  12.166  -9.046  1.00 42.19 ? 556  LEU B CD1 1 
ATOM   8841 C CD2 . LEU B 1 557 ? 38.466  12.080  -7.064  1.00 39.97 ? 556  LEU B CD2 1 
HETATM 8842 S S   . SO4 C 2 .   ? 5.110   7.386   -1.291  1.00 35.09 ? 1201 SO4 A S   1 
HETATM 8843 O O1  . SO4 C 2 .   ? 4.031   7.127   -2.241  1.00 34.30 ? 1201 SO4 A O1  1 
HETATM 8844 O O2  . SO4 C 2 .   ? 4.648   8.338   -0.278  1.00 34.20 ? 1201 SO4 A O2  1 
HETATM 8845 O O3  . SO4 C 2 .   ? 6.291   7.944   -1.942  1.00 33.60 ? 1201 SO4 A O3  1 
HETATM 8846 O O4  . SO4 C 2 .   ? 5.423   6.112   -0.638  1.00 35.02 ? 1201 SO4 A O4  1 
HETATM 8847 S S   . SO4 D 2 .   ? 8.443   -23.007 -12.440 1.00 39.52 ? 1202 SO4 A S   1 
HETATM 8848 O O1  . SO4 D 2 .   ? 7.097   -22.652 -11.971 1.00 38.35 ? 1202 SO4 A O1  1 
HETATM 8849 O O2  . SO4 D 2 .   ? 9.184   -21.800 -12.802 1.00 37.12 ? 1202 SO4 A O2  1 
HETATM 8850 O O3  . SO4 D 2 .   ? 8.325   -23.802 -13.665 1.00 39.68 ? 1202 SO4 A O3  1 
HETATM 8851 O O4  . SO4 D 2 .   ? 9.100   -23.765 -11.382 1.00 37.28 ? 1202 SO4 A O4  1 
HETATM 8852 S S   . SO4 E 2 .   ? 34.127  11.925  -18.947 0.90 51.82 ? 1206 SO4 A S   1 
HETATM 8853 O O1  . SO4 E 2 .   ? 33.385  11.465  -17.781 0.90 51.03 ? 1206 SO4 A O1  1 
HETATM 8854 O O2  . SO4 E 2 .   ? 34.222  13.385  -18.891 0.90 51.57 ? 1206 SO4 A O2  1 
HETATM 8855 O O3  . SO4 E 2 .   ? 33.433  11.531  -20.172 0.90 51.30 ? 1206 SO4 A O3  1 
HETATM 8856 O O4  . SO4 E 2 .   ? 35.454  11.315  -18.942 0.90 51.01 ? 1206 SO4 A O4  1 
HETATM 8857 S S   . SO4 F 2 .   ? 26.583  16.045  -18.799 0.80 46.66 ? 1207 SO4 A S   1 
HETATM 8858 O O1  . SO4 F 2 .   ? 26.633  14.851  -17.953 0.80 45.70 ? 1207 SO4 A O1  1 
HETATM 8859 O O2  . SO4 F 2 .   ? 25.615  17.022  -18.299 0.80 46.24 ? 1207 SO4 A O2  1 
HETATM 8860 O O3  . SO4 F 2 .   ? 26.199  15.642  -20.152 0.80 46.12 ? 1207 SO4 A O3  1 
HETATM 8861 O O4  . SO4 F 2 .   ? 27.897  16.690  -18.810 0.80 46.49 ? 1207 SO4 A O4  1 
HETATM 8862 C C1  . BME G 3 .   ? 46.990  7.519   4.766   1.00 42.58 ? 1211 BME A C1  1 
HETATM 8863 C C2  . BME G 3 .   ? 47.357  8.964   5.075   1.00 42.96 ? 1211 BME A C2  1 
HETATM 8864 O O1  . BME G 3 .   ? 47.078  7.306   3.372   1.00 40.68 ? 1211 BME A O1  1 
HETATM 8865 S S2  . BME G 3 .   ? 45.896  9.961   5.460   1.00 47.40 ? 1211 BME A S2  1 
HETATM 8866 C C1  . BME H 3 .   ? 18.674  8.953   11.262  1.00 52.54 ? 1212 BME A C1  1 
HETATM 8867 C C2  . BME H 3 .   ? 17.279  8.882   10.667  1.00 53.61 ? 1212 BME A C2  1 
HETATM 8868 O O1  . BME H 3 .   ? 19.541  9.601   10.362  1.00 51.44 ? 1212 BME A O1  1 
HETATM 8869 S S2  . BME H 3 .   ? 16.150  9.965   11.569  1.00 57.24 ? 1212 BME A S2  1 
HETATM 8870 C C1  . BME I 3 .   ? 45.986  6.686   -11.392 1.00 49.24 ? 1213 BME A C1  1 
HETATM 8871 C C2  . BME I 3 .   ? 44.692  7.502   -11.327 1.00 48.92 ? 1213 BME A C2  1 
HETATM 8872 O O1  . BME I 3 .   ? 45.777  5.412   -11.978 1.00 48.47 ? 1213 BME A O1  1 
HETATM 8873 S S2  . BME I 3 .   ? 43.819  7.660   -12.910 1.00 52.92 ? 1213 BME A S2  1 
HETATM 8874 C C1  . BME J 3 .   ? 21.216  31.013  8.358   1.00 47.59 ? 1214 BME A C1  1 
HETATM 8875 C C2  . BME J 3 .   ? 20.789  32.215  9.187   1.00 48.36 ? 1214 BME A C2  1 
HETATM 8876 O O1  . BME J 3 .   ? 21.176  31.350  6.992   1.00 47.78 ? 1214 BME A O1  1 
HETATM 8877 S S2  . BME J 3 .   ? 20.229  31.689  10.820  1.00 50.98 ? 1214 BME A S2  1 
HETATM 8878 C C1  . BME K 3 .   ? 7.347   27.063  16.336  1.00 42.63 ? 1215 BME A C1  1 
HETATM 8879 C C2  . BME K 3 .   ? 6.955   25.592  16.362  1.00 43.42 ? 1215 BME A C2  1 
HETATM 8880 O O1  . BME K 3 .   ? 8.573   27.229  15.657  1.00 40.53 ? 1215 BME A O1  1 
HETATM 8881 S S2  . BME K 3 .   ? 6.866   24.918  18.035  1.00 48.32 ? 1215 BME A S2  1 
HETATM 8882 C C1  . GOL L 4 .   ? 9.515   34.321  -5.331  1.00 31.71 ? 1221 GOL A C1  1 
HETATM 8883 O O1  . GOL L 4 .   ? 10.411  35.207  -4.681  1.00 31.78 ? 1221 GOL A O1  1 
HETATM 8884 C C2  . GOL L 4 .   ? 8.721   33.552  -4.277  1.00 31.75 ? 1221 GOL A C2  1 
HETATM 8885 O O2  . GOL L 4 .   ? 8.293   34.427  -3.256  1.00 30.79 ? 1221 GOL A O2  1 
HETATM 8886 C C3  . GOL L 4 .   ? 7.566   32.799  -4.941  1.00 33.08 ? 1221 GOL A C3  1 
HETATM 8887 O O3  . GOL L 4 .   ? 6.526   33.654  -5.392  1.00 34.35 ? 1221 GOL A O3  1 
HETATM 8888 C C1  . GOL M 4 .   ? 31.256  -20.291 10.363  1.00 45.60 ? 1223 GOL A C1  1 
HETATM 8889 O O1  . GOL M 4 .   ? 30.366  -19.568 11.193  1.00 44.52 ? 1223 GOL A O1  1 
HETATM 8890 C C2  . GOL M 4 .   ? 31.681  -19.452 9.158   1.00 45.60 ? 1223 GOL A C2  1 
HETATM 8891 O O2  . GOL M 4 .   ? 31.859  -18.099 9.520   1.00 46.68 ? 1223 GOL A O2  1 
HETATM 8892 C C3  . GOL M 4 .   ? 32.989  -19.984 8.572   1.00 45.44 ? 1223 GOL A C3  1 
HETATM 8893 O O3  . GOL M 4 .   ? 33.175  -19.449 7.276   1.00 44.67 ? 1223 GOL A O3  1 
HETATM 8894 C C1  . GOL N 4 .   ? 18.885  14.113  9.842   1.00 48.66 ? 1225 GOL A C1  1 
HETATM 8895 O O1  . GOL N 4 .   ? 19.047  14.667  8.559   1.00 49.08 ? 1225 GOL A O1  1 
HETATM 8896 C C2  . GOL N 4 .   ? 20.256  13.932  10.477  1.00 48.27 ? 1225 GOL A C2  1 
HETATM 8897 O O2  . GOL N 4 .   ? 20.114  13.967  11.884  1.00 48.88 ? 1225 GOL A O2  1 
HETATM 8898 C C3  . GOL N 4 .   ? 20.835  12.598  10.009  1.00 47.70 ? 1225 GOL A C3  1 
HETATM 8899 O O3  . GOL N 4 .   ? 20.682  11.604  10.998  1.00 48.13 ? 1225 GOL A O3  1 
HETATM 8900 C C1  . GOL O 4 .   ? 8.233   25.561  -7.140  1.00 39.37 ? 1226 GOL A C1  1 
HETATM 8901 O O1  . GOL O 4 .   ? 6.961   25.880  -6.621  1.00 40.20 ? 1226 GOL A O1  1 
HETATM 8902 C C2  . GOL O 4 .   ? 8.059   25.431  -8.640  1.00 39.51 ? 1226 GOL A C2  1 
HETATM 8903 O O2  . GOL O 4 .   ? 7.356   26.567  -9.087  1.00 39.28 ? 1226 GOL A O2  1 
HETATM 8904 C C3  . GOL O 4 .   ? 9.414   25.352  -9.320  1.00 39.26 ? 1226 GOL A C3  1 
HETATM 8905 O O3  . GOL O 4 .   ? 9.308   24.475  -10.417 1.00 39.75 ? 1226 GOL A O3  1 
HETATM 8906 C C1  . GOL P 4 .   ? 23.264  22.626  7.610   1.00 40.74 ? 1227 GOL A C1  1 
HETATM 8907 O O1  . GOL P 4 .   ? 23.666  22.587  6.264   1.00 40.93 ? 1227 GOL A O1  1 
HETATM 8908 C C2  . GOL P 4 .   ? 22.655  21.301  8.035   1.00 40.79 ? 1227 GOL A C2  1 
HETATM 8909 O O2  . GOL P 4 .   ? 21.897  21.503  9.209   1.00 43.58 ? 1227 GOL A O2  1 
HETATM 8910 C C3  . GOL P 4 .   ? 21.747  20.758  6.949   1.00 38.42 ? 1227 GOL A C3  1 
HETATM 8911 O O3  . GOL P 4 .   ? 20.932  19.767  7.515   1.00 42.54 ? 1227 GOL A O3  1 
HETATM 8912 S S   . SO4 Q 2 .   ? 18.560  20.917  37.630  0.90 45.19 ? 1203 SO4 B S   1 
HETATM 8913 O O1  . SO4 Q 2 .   ? 18.149  19.520  37.467  0.90 44.52 ? 1203 SO4 B O1  1 
HETATM 8914 O O2  . SO4 Q 2 .   ? 18.212  21.371  38.980  0.90 44.47 ? 1203 SO4 B O2  1 
HETATM 8915 O O3  . SO4 Q 2 .   ? 17.858  21.737  36.646  0.90 44.42 ? 1203 SO4 B O3  1 
HETATM 8916 O O4  . SO4 Q 2 .   ? 20.008  21.035  37.452  0.90 43.11 ? 1203 SO4 B O4  1 
HETATM 8917 S S   . SO4 R 2 .   ? 36.193  -28.830 21.236  0.80 42.96 ? 1204 SO4 B S   1 
HETATM 8918 O O1  . SO4 R 2 .   ? 37.032  -29.535 22.207  0.80 43.61 ? 1204 SO4 B O1  1 
HETATM 8919 O O2  . SO4 R 2 .   ? 34.841  -28.662 21.756  0.80 41.23 ? 1204 SO4 B O2  1 
HETATM 8920 O O3  . SO4 R 2 .   ? 36.148  -29.588 19.980  0.80 42.60 ? 1204 SO4 B O3  1 
HETATM 8921 O O4  . SO4 R 2 .   ? 36.800  -27.519 21.024  0.80 43.04 ? 1204 SO4 B O4  1 
HETATM 8922 S S   . SO4 S 2 .   ? 33.581  -1.041  25.427  1.00 47.79 ? 1205 SO4 B S   1 
HETATM 8923 O O1  . SO4 S 2 .   ? 32.139  -0.845  25.405  1.00 47.36 ? 1205 SO4 B O1  1 
HETATM 8924 O O2  . SO4 S 2 .   ? 34.167  -0.224  26.495  1.00 48.32 ? 1205 SO4 B O2  1 
HETATM 8925 O O3  . SO4 S 2 .   ? 34.128  -0.656  24.128  1.00 48.83 ? 1205 SO4 B O3  1 
HETATM 8926 O O4  . SO4 S 2 .   ? 33.886  -2.455  25.682  1.00 48.28 ? 1205 SO4 B O4  1 
HETATM 8927 S S   . SO4 T 2 .   ? 27.785  34.108  30.117  0.90 46.68 ? 1208 SO4 B S   1 
HETATM 8928 O O1  . SO4 T 2 .   ? 28.296  33.127  31.065  0.90 46.00 ? 1208 SO4 B O1  1 
HETATM 8929 O O2  . SO4 T 2 .   ? 26.371  34.372  30.407  0.90 46.85 ? 1208 SO4 B O2  1 
HETATM 8930 O O3  . SO4 T 2 .   ? 27.907  33.577  28.765  0.90 46.41 ? 1208 SO4 B O3  1 
HETATM 8931 O O4  . SO4 T 2 .   ? 28.566  35.347  30.214  0.90 45.85 ? 1208 SO4 B O4  1 
HETATM 8932 S S   . SO4 U 2 .   ? 42.141  0.186   25.636  0.80 36.57 ? 1209 SO4 B S   1 
HETATM 8933 O O1  . SO4 U 2 .   ? 42.071  -1.213  26.063  0.80 37.34 ? 1209 SO4 B O1  1 
HETATM 8934 O O2  . SO4 U 2 .   ? 42.467  0.227   24.211  0.80 37.14 ? 1209 SO4 B O2  1 
HETATM 8935 O O3  . SO4 U 2 .   ? 43.203  0.881   26.355  0.80 35.35 ? 1209 SO4 B O3  1 
HETATM 8936 O O4  . SO4 U 2 .   ? 40.854  0.831   25.907  0.80 33.87 ? 1209 SO4 B O4  1 
HETATM 8937 S S   . SO4 V 2 .   ? 59.181  3.598   3.599   0.80 46.65 ? 1210 SO4 B S   1 
HETATM 8938 O O1  . SO4 V 2 .   ? 59.216  3.009   4.939   0.80 45.51 ? 1210 SO4 B O1  1 
HETATM 8939 O O2  . SO4 V 2 .   ? 57.821  3.513   3.064   0.80 45.87 ? 1210 SO4 B O2  1 
HETATM 8940 O O3  . SO4 V 2 .   ? 60.119  2.888   2.726   0.80 45.90 ? 1210 SO4 B O3  1 
HETATM 8941 O O4  . SO4 V 2 .   ? 59.564  5.009   3.682   0.80 45.82 ? 1210 SO4 B O4  1 
HETATM 8942 C C1  . GOL W 4 .   ? 18.741  -32.136 36.021  1.00 25.16 ? 1222 GOL B C1  1 
HETATM 8943 O O1  . GOL W 4 .   ? 18.784  -30.732 36.106  1.00 27.26 ? 1222 GOL B O1  1 
HETATM 8944 C C2  . GOL W 4 .   ? 17.794  -32.479 34.894  1.00 26.33 ? 1222 GOL B C2  1 
HETATM 8945 O O2  . GOL W 4 .   ? 18.431  -32.097 33.705  1.00 24.15 ? 1222 GOL B O2  1 
HETATM 8946 C C3  . GOL W 4 .   ? 17.520  -33.974 34.845  1.00 25.73 ? 1222 GOL B C3  1 
HETATM 8947 O O3  . GOL W 4 .   ? 16.388  -34.164 34.021  1.00 28.90 ? 1222 GOL B O3  1 
HETATM 8948 C C1  . GOL X 4 .   ? 2.313   -18.578 29.798  1.00 37.08 ? 1224 GOL B C1  1 
HETATM 8949 O O1  . GOL X 4 .   ? 3.717   -18.538 29.695  1.00 35.03 ? 1224 GOL B O1  1 
HETATM 8950 C C2  . GOL X 4 .   ? 1.829   -20.016 29.897  1.00 38.87 ? 1224 GOL B C2  1 
HETATM 8951 O O2  . GOL X 4 .   ? 2.628   -20.721 30.820  1.00 39.78 ? 1224 GOL B O2  1 
HETATM 8952 C C3  . GOL X 4 .   ? 0.388   -20.022 30.386  1.00 39.50 ? 1224 GOL B C3  1 
HETATM 8953 O O3  . GOL X 4 .   ? -0.170  -21.277 30.066  1.00 41.42 ? 1224 GOL B O3  1 
HETATM 8954 O O   . HOH Y 5 .   ? 11.823  6.673   6.220   1.00 21.99 ? 1228 HOH A O   1 
HETATM 8955 O O   . HOH Y 5 .   ? 17.452  -3.122  -9.022  1.00 17.89 ? 1229 HOH A O   1 
HETATM 8956 O O   . HOH Y 5 .   ? 5.802   13.920  12.837  1.00 17.10 ? 1230 HOH A O   1 
HETATM 8957 O O   . HOH Y 5 .   ? 16.018  1.329   6.753   1.00 16.30 ? 1231 HOH A O   1 
HETATM 8958 O O   . HOH Y 5 .   ? 11.932  13.139  4.790   1.00 19.88 ? 1232 HOH A O   1 
HETATM 8959 O O   . HOH Y 5 .   ? 22.865  3.073   8.177   1.00 16.27 ? 1233 HOH A O   1 
HETATM 8960 O O   . HOH Y 5 .   ? 24.771  8.715   4.832   1.00 14.39 ? 1234 HOH A O   1 
HETATM 8961 O O   . HOH Y 5 .   ? 19.275  -1.870  11.469  1.00 18.82 ? 1235 HOH A O   1 
HETATM 8962 O O   . HOH Y 5 .   ? 27.617  -7.139  -2.253  1.00 13.58 ? 1236 HOH A O   1 
HETATM 8963 O O   . HOH Y 5 .   ? 9.133   9.947   19.931  1.00 16.77 ? 1237 HOH A O   1 
HETATM 8964 O O   . HOH Y 5 .   ? 32.381  -12.558 7.061   1.00 17.18 ? 1238 HOH A O   1 
HETATM 8965 O O   . HOH Y 5 .   ? 31.415  -0.838  11.427  1.00 17.69 ? 1239 HOH A O   1 
HETATM 8966 O O   . HOH Y 5 .   ? 35.879  11.206  0.640   1.00 18.88 ? 1240 HOH A O   1 
HETATM 8967 O O   . HOH Y 5 .   ? 36.182  7.925   5.280   1.00 16.46 ? 1241 HOH A O   1 
HETATM 8968 O O   . HOH Y 5 .   ? 8.678   -2.338  3.321   1.00 17.10 ? 1242 HOH A O   1 
HETATM 8969 O O   . HOH Y 5 .   ? 1.825   -5.115  5.321   1.00 19.94 ? 1243 HOH A O   1 
HETATM 8970 O O   . HOH Y 5 .   ? 18.620  -1.638  -11.124 1.00 19.40 ? 1244 HOH A O   1 
HETATM 8971 O O   . HOH Y 5 .   ? 23.874  -13.428 2.709   1.00 19.33 ? 1245 HOH A O   1 
HETATM 8972 O O   . HOH Y 5 .   ? 19.955  12.645  -16.574 1.00 23.22 ? 1246 HOH A O   1 
HETATM 8973 O O   . HOH Y 5 .   ? 48.286  -6.623  10.017  1.00 22.88 ? 1247 HOH A O   1 
HETATM 8974 O O   . HOH Y 5 .   ? 28.560  -9.671  -2.646  1.00 16.61 ? 1248 HOH A O   1 
HETATM 8975 O O   . HOH Y 5 .   ? 13.530  15.929  -1.675  1.00 19.46 ? 1249 HOH A O   1 
HETATM 8976 O O   . HOH Y 5 .   ? 5.669   9.936   20.511  1.00 17.94 ? 1250 HOH A O   1 
HETATM 8977 O O   . HOH Y 5 .   ? 18.667  -9.184  -2.780  1.00 19.45 ? 1251 HOH A O   1 
HETATM 8978 O O   . HOH Y 5 .   ? 18.089  2.635   -4.946  1.00 15.70 ? 1252 HOH A O   1 
HETATM 8979 O O   . HOH Y 5 .   ? 3.245   10.332  18.263  1.00 17.13 ? 1253 HOH A O   1 
HETATM 8980 O O   . HOH Y 5 .   ? 40.343  12.380  8.851   1.00 20.08 ? 1254 HOH A O   1 
HETATM 8981 O O   . HOH Y 5 .   ? 37.714  -9.305  -0.505  1.00 17.00 ? 1255 HOH A O   1 
HETATM 8982 O O   . HOH Y 5 .   ? 43.094  12.620  9.241   1.00 19.04 ? 1256 HOH A O   1 
HETATM 8983 O O   . HOH Y 5 .   ? 14.937  6.950   -1.508  1.00 18.88 ? 1257 HOH A O   1 
HETATM 8984 O O   . HOH Y 5 .   ? 38.265  -7.864  1.966   1.00 16.53 ? 1258 HOH A O   1 
HETATM 8985 O O   . HOH Y 5 .   ? 6.139   9.932   1.345   1.00 19.29 ? 1259 HOH A O   1 
HETATM 8986 O O   . HOH Y 5 .   ? 22.140  -2.206  11.562  1.00 18.54 ? 1260 HOH A O   1 
HETATM 8987 O O   . HOH Y 5 .   ? 16.327  2.388   -1.419  1.00 21.26 ? 1261 HOH A O   1 
HETATM 8988 O O   . HOH Y 5 .   ? 9.501   1.819   -3.029  1.00 19.57 ? 1262 HOH A O   1 
HETATM 8989 O O   . HOH Y 5 .   ? 13.585  -12.855 1.523   1.00 18.81 ? 1263 HOH A O   1 
HETATM 8990 O O   . HOH Y 5 .   ? 10.402  0.385   -10.404 1.00 19.31 ? 1264 HOH A O   1 
HETATM 8991 O O   . HOH Y 5 .   ? 31.816  12.702  1.228   1.00 17.38 ? 1265 HOH A O   1 
HETATM 8992 O O   . HOH Y 5 .   ? 16.652  -8.461  0.541   1.00 21.44 ? 1266 HOH A O   1 
HETATM 8993 O O   . HOH Y 5 .   ? 15.329  -7.908  -10.650 1.00 17.76 ? 1267 HOH A O   1 
HETATM 8994 O O   . HOH Y 5 .   ? 38.699  -13.369 12.880  1.00 21.67 ? 1268 HOH A O   1 
HETATM 8995 O O   . HOH Y 5 .   ? 35.579  12.148  4.448   1.00 17.72 ? 1269 HOH A O   1 
HETATM 8996 O O   . HOH Y 5 .   ? 12.320  2.244   -11.079 1.00 18.00 ? 1270 HOH A O   1 
HETATM 8997 O O   . HOH Y 5 .   ? 39.887  -4.315  4.008   1.00 18.60 ? 1271 HOH A O   1 
HETATM 8998 O O   . HOH Y 5 .   ? 7.992   0.024   -11.777 1.00 21.37 ? 1272 HOH A O   1 
HETATM 8999 O O   . HOH Y 5 .   ? 15.919  1.241   -14.633 1.00 17.09 ? 1273 HOH A O   1 
HETATM 9000 O O   . HOH Y 5 .   ? 21.790  -8.802  -1.427  1.00 19.71 ? 1274 HOH A O   1 
HETATM 9001 O O   . HOH Y 5 .   ? 27.585  1.180   16.374  1.00 21.94 ? 1275 HOH A O   1 
HETATM 9002 O O   . HOH Y 5 .   ? 46.503  18.816  8.984   1.00 28.90 ? 1276 HOH A O   1 
HETATM 9003 O O   . HOH Y 5 .   ? 11.927  -0.784  -18.175 1.00 20.43 ? 1277 HOH A O   1 
HETATM 9004 O O   . HOH Y 5 .   ? 37.813  -11.454 5.115   1.00 19.02 ? 1278 HOH A O   1 
HETATM 9005 O O   . HOH Y 5 .   ? 7.558   -23.483 -1.721  1.00 28.39 ? 1279 HOH A O   1 
HETATM 9006 O O   . HOH Y 5 .   ? 37.258  -15.609 13.328  1.00 17.96 ? 1280 HOH A O   1 
HETATM 9007 O O   . HOH Y 5 .   ? 22.998  -21.791 7.567   1.00 38.63 ? 1281 HOH A O   1 
HETATM 9008 O O   . HOH Y 5 .   ? 30.625  -14.010 10.784  1.00 17.97 ? 1282 HOH A O   1 
HETATM 9009 O O   . HOH Y 5 .   ? 23.655  4.818   11.395  1.00 23.59 ? 1283 HOH A O   1 
HETATM 9010 O O   . HOH Y 5 .   ? 23.949  -10.392 -1.300  1.00 20.22 ? 1284 HOH A O   1 
HETATM 9011 O O   . HOH Y 5 .   ? 31.298  -14.632 8.269   1.00 20.03 ? 1285 HOH A O   1 
HETATM 9012 O O   . HOH Y 5 .   ? 39.237  10.069  8.415   1.00 15.36 ? 1286 HOH A O   1 
HETATM 9013 O O   . HOH Y 5 .   ? 21.377  15.966  5.785   1.00 18.42 ? 1287 HOH A O   1 
HETATM 9014 O O   . HOH Y 5 .   ? 26.765  -23.619 -12.808 1.00 26.74 ? 1288 HOH A O   1 
HETATM 9015 O O   . HOH Y 5 .   ? 12.735  -8.584  -10.974 1.00 18.72 ? 1289 HOH A O   1 
HETATM 9016 O O   . HOH Y 5 .   ? 36.203  -17.652 15.867  1.00 23.18 ? 1290 HOH A O   1 
HETATM 9017 O O   . HOH Y 5 .   ? 6.287   -0.425  -7.599  1.00 24.48 ? 1291 HOH A O   1 
HETATM 9018 O O   . HOH Y 5 .   ? 39.962  8.396   -12.682 1.00 22.23 ? 1292 HOH A O   1 
HETATM 9019 O O   . HOH Y 5 .   ? 43.103  12.247  2.376   1.00 20.25 ? 1293 HOH A O   1 
HETATM 9020 O O   . HOH Y 5 .   ? 15.994  12.832  -13.368 1.00 21.94 ? 1294 HOH A O   1 
HETATM 9021 O O   . HOH Y 5 .   ? 15.835  32.178  -0.865  1.00 19.35 ? 1295 HOH A O   1 
HETATM 9022 O O   . HOH Y 5 .   ? 33.800  11.031  2.643   1.00 19.11 ? 1296 HOH A O   1 
HETATM 9023 O O   . HOH Y 5 .   ? 44.535  -20.660 -4.269  1.00 31.88 ? 1297 HOH A O   1 
HETATM 9024 O O   . HOH Y 5 .   ? 19.421  -16.221 3.035   1.00 27.24 ? 1298 HOH A O   1 
HETATM 9025 O O   . HOH Y 5 .   ? 23.196  -5.644  -1.056  1.00 28.83 ? 1299 HOH A O   1 
HETATM 9026 O O   . HOH Y 5 .   ? 3.154   -3.470  -5.450  1.00 21.00 ? 1300 HOH A O   1 
HETATM 9027 O O   . HOH Y 5 .   ? -2.958  2.914   7.095   1.00 23.71 ? 1301 HOH A O   1 
HETATM 9028 O O   . HOH Y 5 .   ? 10.269  -0.382  -7.642  1.00 20.93 ? 1302 HOH A O   1 
HETATM 9029 O O   . HOH Y 5 .   ? 29.765  -9.702  1.225   1.00 23.50 ? 1303 HOH A O   1 
HETATM 9030 O O   . HOH Y 5 .   ? 2.843   36.472  0.838   1.00 29.32 ? 1304 HOH A O   1 
HETATM 9031 O O   . HOH Y 5 .   ? 13.557  28.793  9.453   1.00 26.05 ? 1305 HOH A O   1 
HETATM 9032 O O   . HOH Y 5 .   ? 31.731  -11.586 1.588   1.00 20.95 ? 1306 HOH A O   1 
HETATM 9033 O O   . HOH Y 5 .   ? 31.537  14.680  -8.360  1.00 19.25 ? 1307 HOH A O   1 
HETATM 9034 O O   . HOH Y 5 .   ? 21.593  5.694   -17.370 1.00 19.26 ? 1308 HOH A O   1 
HETATM 9035 O O   . HOH Y 5 .   ? 41.100  -18.853 6.539   1.00 22.09 ? 1309 HOH A O   1 
HETATM 9036 O O   . HOH Y 5 .   ? 5.328   2.195   -16.893 1.00 23.08 ? 1310 HOH A O   1 
HETATM 9037 O O   . HOH Y 5 .   ? 23.874  -5.027  -23.383 1.00 32.49 ? 1311 HOH A O   1 
HETATM 9038 O O   . HOH Y 5 .   ? -2.052  -6.296  17.776  1.00 19.10 ? 1312 HOH A O   1 
HETATM 9039 O O   . HOH Y 5 .   ? -4.517  12.956  8.513   1.00 34.07 ? 1313 HOH A O   1 
HETATM 9040 O O   . HOH Y 5 .   ? 17.992  -21.369 -0.620  1.00 23.25 ? 1314 HOH A O   1 
HETATM 9041 O O   . HOH Y 5 .   ? 43.574  -13.839 20.670  1.00 26.13 ? 1315 HOH A O   1 
HETATM 9042 O O   . HOH Y 5 .   ? 9.457   8.196   -3.683  1.00 21.66 ? 1316 HOH A O   1 
HETATM 9043 O O   . HOH Y 5 .   ? 33.910  -19.326 15.657  1.00 34.78 ? 1317 HOH A O   1 
HETATM 9044 O O   . HOH Y 5 .   ? 1.398   3.959   5.741   1.00 25.60 ? 1318 HOH A O   1 
HETATM 9045 O O   . HOH Y 5 .   ? 19.409  13.502  -19.101 1.00 26.45 ? 1319 HOH A O   1 
HETATM 9046 O O   . HOH Y 5 .   ? 25.290  -11.666 0.657   1.00 21.73 ? 1320 HOH A O   1 
HETATM 9047 O O   . HOH Y 5 .   ? 5.947   -10.098 -6.231  1.00 21.26 ? 1321 HOH A O   1 
HETATM 9048 O O   . HOH Y 5 .   ? 16.014  -14.005 11.336  1.00 15.31 ? 1322 HOH A O   1 
HETATM 9049 O O   . HOH Y 5 .   ? -0.360  4.967   3.802   1.00 25.66 ? 1323 HOH A O   1 
HETATM 9050 O O   . HOH Y 5 .   ? 14.702  4.463   -0.446  1.00 21.76 ? 1324 HOH A O   1 
HETATM 9051 O O   . HOH Y 5 .   ? 15.106  8.161   8.000   1.00 23.12 ? 1325 HOH A O   1 
HETATM 9052 O O   . HOH Y 5 .   ? 6.073   11.572  6.364   1.00 18.32 ? 1326 HOH A O   1 
HETATM 9053 O O   . HOH Y 5 .   ? 22.066  1.204   9.980   1.00 20.80 ? 1327 HOH A O   1 
HETATM 9054 O O   . HOH Y 5 .   ? 18.134  -27.496 -7.082  1.00 36.95 ? 1328 HOH A O   1 
HETATM 9055 O O   . HOH Y 5 .   ? 44.325  19.471  12.076  1.00 30.39 ? 1329 HOH A O   1 
HETATM 9056 O O   . HOH Y 5 .   ? 21.896  25.001  -7.745  1.00 23.77 ? 1330 HOH A O   1 
HETATM 9057 O O   . HOH Y 5 .   ? 22.946  -13.612 -19.354 1.00 36.87 ? 1331 HOH A O   1 
HETATM 9058 O O   . HOH Y 5 .   ? 5.419   -7.877  -3.782  1.00 18.59 ? 1332 HOH A O   1 
HETATM 9059 O O   . HOH Y 5 .   ? 28.781  9.560   -16.852 1.00 24.95 ? 1333 HOH A O   1 
HETATM 9060 O O   . HOH Y 5 .   ? 41.046  -3.053  13.399  1.00 23.48 ? 1334 HOH A O   1 
HETATM 9061 O O   . HOH Y 5 .   ? 47.671  -14.345 -2.641  1.00 24.59 ? 1335 HOH A O   1 
HETATM 9062 O O   . HOH Y 5 .   ? 36.808  10.371  6.028   1.00 15.87 ? 1336 HOH A O   1 
HETATM 9063 O O   . HOH Y 5 .   ? 42.753  -6.768  -11.167 1.00 40.89 ? 1337 HOH A O   1 
HETATM 9064 O O   . HOH Y 5 .   ? 6.030   7.655   -19.565 1.00 32.43 ? 1338 HOH A O   1 
HETATM 9065 O O   . HOH Y 5 .   ? -2.925  4.286   4.623   1.00 29.45 ? 1339 HOH A O   1 
HETATM 9066 O O   . HOH Y 5 .   ? 23.584  7.313   12.426  1.00 26.44 ? 1340 HOH A O   1 
HETATM 9067 O O   . HOH Y 5 .   ? 18.411  -19.435 9.118   1.00 24.93 ? 1341 HOH A O   1 
HETATM 9068 O O   . HOH Y 5 .   ? 16.376  16.283  10.043  1.00 26.83 ? 1342 HOH A O   1 
HETATM 9069 O O   . HOH Y 5 .   ? 12.815  18.646  -22.387 1.00 35.40 ? 1343 HOH A O   1 
HETATM 9070 O O   . HOH Y 5 .   ? 18.637  6.464   4.927   1.00 31.17 ? 1344 HOH A O   1 
HETATM 9071 O O   . HOH Y 5 .   ? 3.662   39.906  3.936   1.00 21.43 ? 1345 HOH A O   1 
HETATM 9072 O O   . HOH Y 5 .   ? 8.942   12.424  -22.713 1.00 31.21 ? 1346 HOH A O   1 
HETATM 9073 O O   . HOH Y 5 .   ? 13.700  10.788  8.335   1.00 20.14 ? 1347 HOH A O   1 
HETATM 9074 O O   . HOH Y 5 .   ? -1.082  -6.493  -1.492  1.00 23.19 ? 1348 HOH A O   1 
HETATM 9075 O O   . HOH Y 5 .   ? 22.372  -0.424  13.770  1.00 21.11 ? 1349 HOH A O   1 
HETATM 9076 O O   . HOH Y 5 .   ? 27.868  -11.320 -0.536  1.00 22.25 ? 1350 HOH A O   1 
HETATM 9077 O O   . HOH Y 5 .   ? -10.235 -10.540 23.821  1.00 28.64 ? 1351 HOH A O   1 
HETATM 9078 O O   . HOH Y 5 .   ? 25.865  3.070   6.774   1.00 19.68 ? 1352 HOH A O   1 
HETATM 9079 O O   . HOH Y 5 .   ? 44.901  8.484   1.999   1.00 21.69 ? 1353 HOH A O   1 
HETATM 9080 O O   . HOH Y 5 .   ? 18.905  -18.371 4.924   1.00 30.05 ? 1354 HOH A O   1 
HETATM 9081 O O   . HOH Y 5 .   ? -5.110  -5.253  28.841  1.00 27.54 ? 1355 HOH A O   1 
HETATM 9082 O O   . HOH Y 5 .   ? 31.976  -29.895 1.623   1.00 30.57 ? 1356 HOH A O   1 
HETATM 9083 O O   . HOH Y 5 .   ? 13.539  1.947   -25.734 1.00 29.66 ? 1357 HOH A O   1 
HETATM 9084 O O   . HOH Y 5 .   ? 0.146   -1.072  -7.588  1.00 38.02 ? 1358 HOH A O   1 
HETATM 9085 O O   . HOH Y 5 .   ? 2.426   -1.446  5.944   1.00 25.01 ? 1359 HOH A O   1 
HETATM 9086 O O   . HOH Y 5 .   ? 6.386   -11.957 -3.734  1.00 18.25 ? 1360 HOH A O   1 
HETATM 9087 O O   . HOH Y 5 .   ? 29.691  1.651   18.539  1.00 28.98 ? 1361 HOH A O   1 
HETATM 9088 O O   . HOH Y 5 .   ? 15.120  -5.167  -24.959 1.00 39.00 ? 1362 HOH A O   1 
HETATM 9089 O O   . HOH Y 5 .   ? -8.138  -9.379  25.325  1.00 24.06 ? 1363 HOH A O   1 
HETATM 9090 O O   . HOH Y 5 .   ? 9.674   -19.727 -11.143 1.00 22.30 ? 1364 HOH A O   1 
HETATM 9091 O O   . HOH Y 5 .   ? 1.163   37.006  3.027   1.00 31.08 ? 1365 HOH A O   1 
HETATM 9092 O O   . HOH Y 5 .   ? 51.137  -11.962 -3.905  1.00 24.57 ? 1366 HOH A O   1 
HETATM 9093 O O   . HOH Y 5 .   ? 0.047   22.121  13.267  1.00 30.00 ? 1367 HOH A O   1 
HETATM 9094 O O   . HOH Y 5 .   ? 0.753   37.322  5.881   1.00 27.97 ? 1368 HOH A O   1 
HETATM 9095 O O   . HOH Y 5 .   ? -15.196 -4.037  19.313  1.00 36.16 ? 1369 HOH A O   1 
HETATM 9096 O O   . HOH Y 5 .   ? 34.774  12.249  -8.648  1.00 21.70 ? 1370 HOH A O   1 
HETATM 9097 O O   . HOH Y 5 .   ? -2.640  9.772   26.017  1.00 29.70 ? 1371 HOH A O   1 
HETATM 9098 O O   . HOH Y 5 .   ? 14.709  -23.131 -14.501 1.00 28.15 ? 1372 HOH A O   1 
HETATM 9099 O O   . HOH Y 5 .   ? 7.339   1.281   0.775   1.00 24.47 ? 1373 HOH A O   1 
HETATM 9100 O O   . HOH Y 5 .   ? 13.133  -19.346 -8.639  1.00 20.58 ? 1374 HOH A O   1 
HETATM 9101 O O   . HOH Y 5 .   ? 7.073   -0.048  -23.019 1.00 41.07 ? 1375 HOH A O   1 
HETATM 9102 O O   . HOH Y 5 .   ? 31.054  2.824   -17.912 1.00 28.39 ? 1376 HOH A O   1 
HETATM 9103 O O   . HOH Y 5 .   ? 11.610  -25.816 -7.740  1.00 29.95 ? 1377 HOH A O   1 
HETATM 9104 O O   . HOH Y 5 .   ? 17.883  7.167   7.541   1.00 30.48 ? 1378 HOH A O   1 
HETATM 9105 O O   . HOH Y 5 .   ? 41.190  -19.445 9.082   1.00 46.19 ? 1379 HOH A O   1 
HETATM 9106 O O   . HOH Y 5 .   ? 14.957  -17.381 9.816   1.00 25.75 ? 1380 HOH A O   1 
HETATM 9107 O O   . HOH Y 5 .   ? 35.742  -4.716  -15.755 1.00 28.87 ? 1381 HOH A O   1 
HETATM 9108 O O   . HOH Y 5 .   ? 36.041  -15.708 23.033  1.00 23.42 ? 1382 HOH A O   1 
HETATM 9109 O O   . HOH Y 5 .   ? 47.148  -16.381 3.907   1.00 26.97 ? 1383 HOH A O   1 
HETATM 9110 O O   . HOH Y 5 .   ? 11.652  28.058  -10.772 1.00 38.02 ? 1384 HOH A O   1 
HETATM 9111 O O   . HOH Y 5 .   ? 8.959   11.870  -26.508 1.00 35.20 ? 1385 HOH A O   1 
HETATM 9112 O O   . HOH Y 5 .   ? 8.958   9.699   -29.040 1.00 37.67 ? 1386 HOH A O   1 
HETATM 9113 O O   . HOH Y 5 .   ? 38.810  -5.126  16.712  1.00 32.88 ? 1387 HOH A O   1 
HETATM 9114 O O   . HOH Y 5 .   ? 41.382  -24.104 0.544   1.00 29.34 ? 1388 HOH A O   1 
HETATM 9115 O O   . HOH Y 5 .   ? 26.691  3.884   16.214  1.00 39.98 ? 1389 HOH A O   1 
HETATM 9116 O O   . HOH Y 5 .   ? 28.888  -30.334 -9.077  1.00 37.22 ? 1390 HOH A O   1 
HETATM 9117 O O   . HOH Y 5 .   ? 18.652  -2.230  -23.974 1.00 35.23 ? 1391 HOH A O   1 
HETATM 9118 O O   . HOH Y 5 .   ? -9.189  -0.430  29.059  1.00 31.23 ? 1392 HOH A O   1 
HETATM 9119 O O   . HOH Y 5 .   ? 36.442  -14.065 -11.012 1.00 27.16 ? 1393 HOH A O   1 
HETATM 9120 O O   . HOH Y 5 .   ? 41.342  -23.430 -8.617  1.00 38.77 ? 1394 HOH A O   1 
HETATM 9121 O O   . HOH Y 5 .   ? 42.080  14.559  1.482   1.00 27.43 ? 1395 HOH A O   1 
HETATM 9122 O O   . HOH Y 5 .   ? 20.340  -13.576 -21.421 1.00 25.04 ? 1396 HOH A O   1 
HETATM 9123 O O   . HOH Y 5 .   ? 41.477  -20.246 -5.797  1.00 32.43 ? 1397 HOH A O   1 
HETATM 9124 O O   . HOH Y 5 .   ? 33.328  -23.182 3.398   1.00 36.74 ? 1398 HOH A O   1 
HETATM 9125 O O   . HOH Y 5 .   ? 25.115  -20.290 11.183  1.00 40.46 ? 1399 HOH A O   1 
HETATM 9126 O O   . HOH Y 5 .   ? 19.479  20.225  10.173  1.00 43.22 ? 1400 HOH A O   1 
HETATM 9127 O O   . HOH Y 5 .   ? 1.121   20.918  15.409  1.00 25.05 ? 1401 HOH A O   1 
HETATM 9128 O O   . HOH Y 5 .   ? 18.950  4.219   -24.529 1.00 43.98 ? 1402 HOH A O   1 
HETATM 9129 O O   . HOH Y 5 .   ? 6.945   3.435   -4.801  1.00 44.75 ? 1403 HOH A O   1 
HETATM 9130 O O   . HOH Y 5 .   ? 7.791   3.796   -2.026  1.00 29.95 ? 1404 HOH A O   1 
HETATM 9131 O O   . HOH Y 5 .   ? 41.130  14.496  -5.228  1.00 29.30 ? 1405 HOH A O   1 
HETATM 9132 O O   . HOH Y 5 .   ? 21.078  29.335  1.269   1.00 38.29 ? 1406 HOH A O   1 
HETATM 9133 O O   . HOH Y 5 .   ? 11.449  13.485  -12.142 1.00 20.58 ? 1407 HOH A O   1 
HETATM 9134 O O   . HOH Y 5 .   ? 8.102   -11.488 -6.671  1.00 26.89 ? 1408 HOH A O   1 
HETATM 9135 O O   . HOH Y 5 .   ? 13.528  13.938  -14.065 1.00 22.49 ? 1409 HOH A O   1 
HETATM 9136 O O   . HOH Y 5 .   ? 43.097  -5.098  -9.037  1.00 29.32 ? 1410 HOH A O   1 
HETATM 9137 O O   . HOH Y 5 .   ? 31.068  -25.798 4.108   1.00 38.84 ? 1411 HOH A O   1 
HETATM 9138 O O   . HOH Y 5 .   ? 21.173  3.791   -21.752 1.00 37.09 ? 1412 HOH A O   1 
HETATM 9139 O O   . HOH Y 5 .   ? 27.337  -6.820  -22.144 1.00 41.56 ? 1413 HOH A O   1 
HETATM 9140 O O   . HOH Y 5 .   ? 38.645  -2.732  17.265  1.00 27.82 ? 1414 HOH A O   1 
HETATM 9141 O O   . HOH Y 5 .   ? 15.078  12.585  10.186  1.00 35.76 ? 1415 HOH A O   1 
HETATM 9142 O O   . HOH Y 5 .   ? 3.156   28.853  13.919  1.00 28.44 ? 1416 HOH A O   1 
HETATM 9143 O O   . HOH Y 5 .   ? 48.450  -4.020  -6.868  1.00 28.86 ? 1417 HOH A O   1 
HETATM 9144 O O   . HOH Y 5 .   ? 11.628  -12.141 -12.684 1.00 35.10 ? 1418 HOH A O   1 
HETATM 9145 O O   . HOH Y 5 .   ? 41.934  -0.919  16.417  1.00 28.22 ? 1419 HOH A O   1 
HETATM 9146 O O   . HOH Y 5 .   ? 8.638   0.935   -5.645  1.00 24.10 ? 1420 HOH A O   1 
HETATM 9147 O O   . HOH Y 5 .   ? 11.544  -7.918  -13.593 1.00 34.30 ? 1421 HOH A O   1 
HETATM 9148 O O   . HOH Y 5 .   ? 3.564   7.895   -15.100 1.00 28.31 ? 1422 HOH A O   1 
HETATM 9149 O O   . HOH Y 5 .   ? 6.642   1.413   -9.568  1.00 20.56 ? 1423 HOH A O   1 
HETATM 9150 O O   . HOH Y 5 .   ? 20.786  25.559  -10.406 1.00 23.07 ? 1424 HOH A O   1 
HETATM 9151 O O   . HOH Y 5 .   ? 21.182  8.318   13.178  1.00 29.72 ? 1425 HOH A O   1 
HETATM 9152 O O   . HOH Y 5 .   ? 30.694  19.054  6.148   1.00 31.41 ? 1426 HOH A O   1 
HETATM 9153 O O   . HOH Y 5 .   ? -9.065  -1.009  5.906   1.00 33.65 ? 1427 HOH A O   1 
HETATM 9154 O O   . HOH Y 5 .   ? 15.865  6.493   -3.899  1.00 18.20 ? 1428 HOH A O   1 
HETATM 9155 O O   . HOH Y 5 .   ? 47.518  -11.324 5.980   1.00 22.85 ? 1429 HOH A O   1 
HETATM 9156 O O   . HOH Y 5 .   ? 26.443  22.238  -7.094  1.00 22.63 ? 1430 HOH A O   1 
HETATM 9157 O O   . HOH Y 5 .   ? 26.468  23.967  -1.747  1.00 28.29 ? 1431 HOH A O   1 
HETATM 9158 O O   . HOH Y 5 .   ? 28.808  -11.723 -20.798 1.00 26.80 ? 1432 HOH A O   1 
HETATM 9159 O O   . HOH Y 5 .   ? 25.023  -20.058 7.109   1.00 22.81 ? 1433 HOH A O   1 
HETATM 9160 O O   . HOH Y 5 .   ? 15.701  -13.186 -19.040 1.00 27.30 ? 1434 HOH A O   1 
HETATM 9161 O O   . HOH Y 5 .   ? 35.583  5.417   -17.668 1.00 25.00 ? 1435 HOH A O   1 
HETATM 9162 O O   . HOH Y 5 .   ? -2.167  38.883  2.966   1.00 27.51 ? 1436 HOH A O   1 
HETATM 9163 O O   . HOH Y 5 .   ? 38.132  0.587   -16.188 1.00 29.22 ? 1437 HOH A O   1 
HETATM 9164 O O   . HOH Y 5 .   ? 44.446  12.403  4.720   1.00 27.17 ? 1438 HOH A O   1 
HETATM 9165 O O   . HOH Y 5 .   ? 43.293  -18.575 -5.426  1.00 29.01 ? 1439 HOH A O   1 
HETATM 9166 O O   . HOH Y 5 .   ? 24.941  24.218  -9.008  1.00 36.31 ? 1440 HOH A O   1 
HETATM 9167 O O   . HOH Y 5 .   ? -5.574  -2.951  30.606  1.00 30.52 ? 1441 HOH A O   1 
HETATM 9168 O O   . HOH Y 5 .   ? 5.967   -24.686 -10.398 1.00 32.20 ? 1442 HOH A O   1 
HETATM 9169 O O   . HOH Y 5 .   ? 11.475  25.684  -11.761 1.00 26.43 ? 1443 HOH A O   1 
HETATM 9170 O O   . HOH Y 5 .   ? 26.641  13.974  7.456   1.00 25.34 ? 1444 HOH A O   1 
HETATM 9171 O O   . HOH Y 5 .   ? 40.685  -4.953  -12.809 1.00 29.30 ? 1445 HOH A O   1 
HETATM 9172 O O   . HOH Y 5 .   ? 19.550  16.923  7.713   1.00 29.97 ? 1446 HOH A O   1 
HETATM 9173 O O   . HOH Y 5 .   ? 41.922  0.886   -13.620 1.00 26.08 ? 1447 HOH A O   1 
HETATM 9174 O O   . HOH Y 5 .   ? 3.700   37.435  10.023  1.00 33.13 ? 1448 HOH A O   1 
HETATM 9175 O O   . HOH Y 5 .   ? 39.505  -2.330  -15.295 1.00 29.32 ? 1449 HOH A O   1 
HETATM 9176 O O   . HOH Y 5 .   ? 16.224  -21.274 -15.432 1.00 24.49 ? 1450 HOH A O   1 
HETATM 9177 O O   . HOH Y 5 .   ? 6.890   22.288  17.398  1.00 32.45 ? 1451 HOH A O   1 
HETATM 9178 O O   . HOH Y 5 .   ? -8.668  -14.417 19.881  1.00 26.93 ? 1452 HOH A O   1 
HETATM 9179 O O   . HOH Y 5 .   ? 19.793  -21.512 1.648   1.00 25.80 ? 1453 HOH A O   1 
HETATM 9180 O O   . HOH Y 5 .   ? 48.985  -10.739 9.198   1.00 32.51 ? 1454 HOH A O   1 
HETATM 9181 O O   . HOH Y 5 .   ? 16.159  31.932  9.477   1.00 34.60 ? 1455 HOH A O   1 
HETATM 9182 O O   . HOH Y 5 .   ? 26.980  4.689   13.813  1.00 26.42 ? 1456 HOH A O   1 
HETATM 9183 O O   . HOH Y 5 .   ? -5.850  20.096  13.933  1.00 38.16 ? 1457 HOH A O   1 
HETATM 9184 O O   . HOH Y 5 .   ? 41.391  15.075  -1.453  1.00 27.04 ? 1458 HOH A O   1 
HETATM 9185 O O   . HOH Y 5 .   ? 44.248  -2.849  -8.498  1.00 25.77 ? 1459 HOH A O   1 
HETATM 9186 O O   . HOH Y 5 .   ? 23.129  3.287   -23.413 1.00 33.26 ? 1460 HOH A O   1 
HETATM 9187 O O   . HOH Y 5 .   ? -4.614  23.455  -5.020  1.00 38.93 ? 1461 HOH A O   1 
HETATM 9188 O O   . HOH Y 5 .   ? 46.862  13.869  4.648   1.00 34.07 ? 1462 HOH A O   1 
HETATM 9189 O O   . HOH Y 5 .   ? 21.188  29.900  3.891   1.00 35.79 ? 1463 HOH A O   1 
HETATM 9190 O O   . HOH Y 5 .   ? 3.737   37.162  -4.482  1.00 33.80 ? 1464 HOH A O   1 
HETATM 9191 O O   . HOH Y 5 .   ? 18.600  2.413   -22.693 1.00 33.14 ? 1465 HOH A O   1 
HETATM 9192 O O   . HOH Y 5 .   ? 6.089   7.293   -22.611 1.00 40.16 ? 1466 HOH A O   1 
HETATM 9193 O O   . HOH Y 5 .   ? -4.835  7.016   21.820  1.00 38.86 ? 1467 HOH A O   1 
HETATM 9194 O O   . HOH Y 5 .   ? 9.893   0.208   -24.987 1.00 30.61 ? 1468 HOH A O   1 
HETATM 9195 O O   . HOH Y 5 .   ? 33.862  -20.554 12.403  1.00 30.95 ? 1469 HOH A O   1 
HETATM 9196 O O   . HOH Y 5 .   ? 32.968  20.371  -6.203  1.00 33.49 ? 1470 HOH A O   1 
HETATM 9197 O O   . HOH Y 5 .   ? 23.362  27.180  6.787   1.00 35.49 ? 1471 HOH A O   1 
HETATM 9198 O O   . HOH Y 5 .   ? 20.759  2.462   12.258  1.00 30.99 ? 1472 HOH A O   1 
HETATM 9199 O O   . HOH Y 5 .   ? 38.214  -15.692 -11.484 1.00 43.85 ? 1473 HOH A O   1 
HETATM 9200 O O   . HOH Y 5 .   ? 38.555  -22.855 29.341  1.00 32.88 ? 1474 HOH A O   1 
HETATM 9201 O O   . HOH Y 5 .   ? 26.627  7.251   13.572  1.00 32.23 ? 1475 HOH A O   1 
HETATM 9202 O O   . HOH Y 5 .   ? 22.797  21.480  -16.603 1.00 37.42 ? 1476 HOH A O   1 
HETATM 9203 O O   . HOH Y 5 .   ? 44.487  -28.540 4.345   1.00 40.33 ? 1477 HOH A O   1 
HETATM 9204 O O   . HOH Y 5 .   ? 4.289   21.535  16.866  1.00 34.78 ? 1478 HOH A O   1 
HETATM 9205 O O   . HOH Y 5 .   ? 6.423   5.225   1.297   1.00 25.78 ? 1479 HOH A O   1 
HETATM 9206 O O   . HOH Y 5 .   ? 8.375   3.960   0.478   1.00 31.80 ? 1480 HOH A O   1 
HETATM 9207 O O   . HOH Y 5 .   ? -7.693  -6.575  28.680  1.00 35.37 ? 1481 HOH A O   1 
HETATM 9208 O O   . HOH Y 5 .   ? 18.864  -23.248 -2.215  1.00 45.02 ? 1482 HOH A O   1 
HETATM 9209 O O   . HOH Y 5 .   ? 4.181   -6.263  -17.740 1.00 32.44 ? 1483 HOH A O   1 
HETATM 9210 O O   . HOH Y 5 .   ? -0.965  29.050  -2.226  1.00 28.99 ? 1484 HOH A O   1 
HETATM 9211 O O   . HOH Y 5 .   ? 36.399  -2.980  19.786  1.00 28.61 ? 1485 HOH A O   1 
HETATM 9212 O O   . HOH Y 5 .   ? 42.211  -20.610 13.579  1.00 33.39 ? 1486 HOH A O   1 
HETATM 9213 O O   . HOH Y 5 .   ? 18.777  19.707  -19.376 1.00 39.72 ? 1487 HOH A O   1 
HETATM 9214 O O   . HOH Y 5 .   ? 34.676  -14.137 -12.823 1.00 31.53 ? 1488 HOH A O   1 
HETATM 9215 O O   . HOH Y 5 .   ? 7.719   -25.623 -8.561  1.00 36.85 ? 1489 HOH A O   1 
HETATM 9216 O O   . HOH Y 5 .   ? 34.371  -16.494 -13.949 1.00 36.32 ? 1490 HOH A O   1 
HETATM 9217 O O   . HOH Y 5 .   ? -3.306  22.010  16.290  1.00 37.70 ? 1491 HOH A O   1 
HETATM 9218 O O   . HOH Y 5 .   ? 33.108  20.719  5.066   1.00 33.49 ? 1492 HOH A O   1 
HETATM 9219 O O   . HOH Y 5 .   ? 21.389  -23.635 2.162   1.00 38.60 ? 1493 HOH A O   1 
HETATM 9220 O O   . HOH Y 5 .   ? 47.777  -10.778 -6.344  1.00 18.59 ? 1494 HOH A O   1 
HETATM 9221 O O   . HOH Y 5 .   ? 9.706   35.701  4.484   1.00 18.05 ? 1495 HOH A O   1 
HETATM 9222 O O   . HOH Y 5 .   ? 3.120   0.698   -6.811  1.00 27.33 ? 1496 HOH A O   1 
HETATM 9223 O O   . HOH Y 5 .   ? 45.244  11.257  1.050   1.00 30.35 ? 1497 HOH A O   1 
HETATM 9224 O O   . HOH Y 5 .   ? 49.121  -8.643  -6.406  1.00 28.39 ? 1498 HOH A O   1 
HETATM 9225 O O   . HOH Y 5 .   ? 8.337   -23.768 -6.407  1.00 32.01 ? 1499 HOH A O   1 
HETATM 9226 O O   . HOH Y 5 .   ? 17.331  -27.350 -4.063  1.00 34.38 ? 1500 HOH A O   1 
HETATM 9227 O O   . HOH Y 5 .   ? -4.228  24.170  7.081   1.00 32.57 ? 1501 HOH A O   1 
HETATM 9228 O O   . HOH Y 5 .   ? 27.974  -24.669 -14.828 1.00 32.73 ? 1502 HOH A O   1 
HETATM 9229 O O   . HOH Y 5 .   ? 38.507  19.715  8.106   1.00 31.94 ? 1503 HOH A O   1 
HETATM 9230 O O   . HOH Y 5 .   ? 50.136  14.872  15.732  1.00 40.64 ? 1504 HOH A O   1 
HETATM 9231 O O   . HOH Y 5 .   ? 27.907  11.962  9.728   1.00 33.66 ? 1505 HOH A O   1 
HETATM 9232 O O   . HOH Y 5 .   ? 0.315   -0.469  -0.327  1.00 31.43 ? 1506 HOH A O   1 
HETATM 9233 O O   . HOH Y 5 .   ? 15.115  -14.729 -16.370 1.00 37.87 ? 1507 HOH A O   1 
HETATM 9234 O O   . HOH Y 5 .   ? 20.955  15.636  -19.963 1.00 36.91 ? 1508 HOH A O   1 
HETATM 9235 O O   . HOH Y 5 .   ? 53.541  -14.553 19.701  1.00 39.98 ? 1509 HOH A O   1 
HETATM 9236 O O   . HOH Y 5 .   ? -5.218  25.765  8.955   1.00 40.49 ? 1510 HOH A O   1 
HETATM 9237 O O   . HOH Y 5 .   ? -3.419  21.794  7.061   1.00 35.73 ? 1511 HOH A O   1 
HETATM 9238 O O   . HOH Y 5 .   ? 16.491  34.597  8.649   1.00 33.75 ? 1512 HOH A O   1 
HETATM 9239 O O   . HOH Y 5 .   ? 25.143  -21.338 -19.022 1.00 32.74 ? 1513 HOH A O   1 
HETATM 9240 O O   . HOH Y 5 .   ? 20.468  1.025   -24.003 1.00 47.99 ? 1514 HOH A O   1 
HETATM 9241 O O   . HOH Y 5 .   ? 51.723  -16.343 17.958  1.00 39.50 ? 1515 HOH A O   1 
HETATM 9242 O O   . HOH Y 5 .   ? 29.439  -34.051 -6.772  1.00 37.04 ? 1516 HOH A O   1 
HETATM 9243 O O   . HOH Y 5 .   ? -6.499  27.144  3.125   1.00 40.58 ? 1517 HOH A O   1 
HETATM 9244 O O   . HOH Y 5 .   ? 24.305  22.349  -14.269 1.00 40.07 ? 1518 HOH A O   1 
HETATM 9245 O O   . HOH Y 5 .   ? 30.412  13.750  -15.341 1.00 41.91 ? 1519 HOH A O   1 
HETATM 9246 O O   . HOH Y 5 .   ? 16.419  34.976  5.647   1.00 17.95 ? 1520 HOH A O   1 
HETATM 9247 O O   . HOH Y 5 .   ? 50.051  -23.390 -5.269  1.00 23.55 ? 1521 HOH A O   1 
HETATM 9248 O O   . HOH Y 5 .   ? 16.401  37.642  5.913   1.00 30.23 ? 1522 HOH A O   1 
HETATM 9249 O O   . HOH Y 5 .   ? 15.624  15.993  -23.998 1.00 34.07 ? 1523 HOH A O   1 
HETATM 9250 O O   . HOH Y 5 .   ? 5.712   2.179   -6.824  1.00 28.27 ? 1524 HOH A O   1 
HETATM 9251 O O   . HOH Y 5 .   ? -3.197  -1.950  33.080  1.00 38.14 ? 1525 HOH A O   1 
HETATM 9252 O O   . HOH Y 5 .   ? 23.532  15.491  -20.543 1.00 37.23 ? 1526 HOH A O   1 
HETATM 9253 O O   . HOH Y 5 .   ? 31.201  10.517  -16.954 1.00 35.32 ? 1527 HOH A O   1 
HETATM 9254 O O   . HOH Y 5 .   ? 47.494  16.148  5.425   1.00 37.71 ? 1528 HOH A O   1 
HETATM 9255 O O   . HOH Y 5 .   ? 25.772  22.515  5.494   1.00 31.49 ? 1529 HOH A O   1 
HETATM 9256 O O   . HOH Y 5 .   ? 16.597  37.883  3.361   1.00 25.78 ? 1530 HOH A O   1 
HETATM 9257 O O   . HOH Y 5 .   ? 50.997  -16.319 -1.587  1.00 27.23 ? 1531 HOH A O   1 
HETATM 9258 O O   . HOH Y 5 .   ? 1.841   -19.743 -5.626  1.00 32.01 ? 1532 HOH A O   1 
HETATM 9259 O O   . HOH Y 5 .   ? -8.473  -1.653  1.598   1.00 31.22 ? 1533 HOH A O   1 
HETATM 9260 O O   . HOH Y 5 .   ? -10.323 -2.943  24.504  1.00 40.99 ? 1534 HOH A O   1 
HETATM 9261 O O   . HOH Y 5 .   ? -1.307  30.956  -4.223  1.00 32.78 ? 1535 HOH A O   1 
HETATM 9262 O O   . HOH Y 5 .   ? 21.176  10.848  13.750  1.00 45.55 ? 1536 HOH A O   1 
HETATM 9263 O O   . HOH Y 5 .   ? -9.644  -6.979  8.564   1.00 40.38 ? 1537 HOH A O   1 
HETATM 9264 O O   . HOH Y 5 .   ? -3.507  27.402  -0.166  1.00 41.38 ? 1538 HOH A O   1 
HETATM 9265 O O   . HOH Y 5 .   ? 27.222  26.996  4.414   1.00 40.77 ? 1539 HOH A O   1 
HETATM 9266 O O   . HOH Y 5 .   ? 13.137  -17.651 -15.710 1.00 40.94 ? 1540 HOH A O   1 
HETATM 9267 O O   . HOH Y 5 .   ? -5.070  20.483  2.913   1.00 40.04 ? 1541 HOH A O   1 
HETATM 9268 O O   . HOH Y 5 .   ? 27.130  -8.555  -19.720 1.00 35.74 ? 1542 HOH A O   1 
HETATM 9269 O O   . HOH Y 5 .   ? 2.688   6.034   -21.847 1.00 42.30 ? 1543 HOH A O   1 
HETATM 9270 O O   . HOH Y 5 .   ? 36.134  16.987  -4.125  1.00 31.18 ? 1544 HOH A O   1 
HETATM 9271 O O   . HOH Y 5 .   ? 20.771  28.421  6.189   1.00 29.05 ? 1545 HOH A O   1 
HETATM 9272 O O   . HOH Y 5 .   ? 40.386  -24.337 -4.631  1.00 33.92 ? 1546 HOH A O   1 
HETATM 9273 O O   . HOH Y 5 .   ? 30.713  -15.530 13.869  1.00 27.61 ? 1547 HOH A O   1 
HETATM 9274 O O   . HOH Y 5 .   ? 30.541  22.938  -0.356  1.00 34.24 ? 1548 HOH A O   1 
HETATM 9275 O O   . HOH Y 5 .   ? 0.021   -19.286 -9.311  1.00 34.81 ? 1549 HOH A O   1 
HETATM 9276 O O   . HOH Y 5 .   ? 42.775  3.072   -16.981 1.00 34.85 ? 1550 HOH A O   1 
HETATM 9277 O O   . HOH Y 5 .   ? -1.535  -4.670  -10.474 1.00 27.08 ? 1551 HOH A O   1 
HETATM 9278 O O   . HOH Y 5 .   ? 27.926  12.024  -18.126 1.00 38.16 ? 1552 HOH A O   1 
HETATM 9279 O O   . HOH Y 5 .   ? 37.167  14.485  -11.985 1.00 40.57 ? 1553 HOH A O   1 
HETATM 9280 O O   . HOH Y 5 .   ? 13.843  38.531  -5.103  1.00 30.01 ? 1554 HOH A O   1 
HETATM 9281 O O   . HOH Y 5 .   ? 36.586  -18.153 -12.944 1.00 26.95 ? 1555 HOH A O   1 
HETATM 9282 O O   . HOH Y 5 .   ? 18.827  31.196  0.592   1.00 36.60 ? 1556 HOH A O   1 
HETATM 9283 O O   . HOH Y 5 .   ? -8.791  -7.010  26.404  1.00 36.43 ? 1557 HOH A O   1 
HETATM 9284 O O   . HOH Y 5 .   ? 41.684  -25.794 -6.530  1.00 40.45 ? 1558 HOH A O   1 
HETATM 9285 O O   . HOH Y 5 .   ? 21.943  3.059   -27.176 1.00 32.57 ? 1559 HOH A O   1 
HETATM 9286 O O   . HOH Y 5 .   ? 13.940  16.604  11.211  1.00 32.08 ? 1560 HOH A O   1 
HETATM 9287 O O   . HOH Y 5 .   ? -7.672  17.551  -7.997  1.00 38.43 ? 1561 HOH A O   1 
HETATM 9288 O O   . HOH Y 5 .   ? 22.447  4.092   -19.415 1.00 29.30 ? 1562 HOH A O   1 
HETATM 9289 O O   . HOH Y 5 .   ? 13.441  -13.855 -14.296 1.00 37.96 ? 1563 HOH A O   1 
HETATM 9290 O O   . HOH Y 5 .   ? 37.651  -12.447 -14.681 1.00 45.23 ? 1564 HOH A O   1 
HETATM 9291 O O   . HOH Y 5 .   ? 15.094  39.930  1.805   1.00 31.79 ? 1565 HOH A O   1 
HETATM 9292 O O   . HOH Y 5 .   ? 0.870   25.979  -4.929  1.00 31.66 ? 1566 HOH A O   1 
HETATM 9293 O O   . HOH Y 5 .   ? -4.164  2.657   2.841   1.00 36.23 ? 1567 HOH A O   1 
HETATM 9294 O O   . HOH Y 5 .   ? 20.605  17.680  -15.957 1.00 32.92 ? 1568 HOH A O   1 
HETATM 9295 O O   . HOH Y 5 .   ? 4.319   32.389  -5.364  1.00 35.43 ? 1569 HOH A O   1 
HETATM 9296 O O   . HOH Y 5 .   ? 5.122   30.073  -7.123  1.00 41.32 ? 1570 HOH A O   1 
HETATM 9297 O O   . HOH Y 5 .   ? 19.649  -29.345 -6.972  1.00 32.05 ? 1571 HOH A O   1 
HETATM 9298 O O   . HOH Y 5 .   ? 6.810   18.783  -13.429 1.00 28.23 ? 1572 HOH A O   1 
HETATM 9299 O O   . HOH Y 5 .   ? 51.627  -8.383  -9.920  1.00 44.94 ? 1573 HOH A O   1 
HETATM 9300 O O   . HOH Y 5 .   ? 17.542  -24.563 -17.988 1.00 40.17 ? 1574 HOH A O   1 
HETATM 9301 O O   . HOH Y 5 .   ? 14.565  -22.204 1.663   1.00 33.32 ? 1575 HOH A O   1 
HETATM 9302 O O   . HOH Y 5 .   ? 20.154  -24.604 -18.675 1.00 33.21 ? 1576 HOH A O   1 
HETATM 9303 O O   . HOH Y 5 .   ? 2.289   -0.747  -3.171  1.00 41.83 ? 1577 HOH A O   1 
HETATM 9304 O O   . HOH Y 5 .   ? 11.788  -20.794 1.311   1.00 38.71 ? 1578 HOH A O   1 
HETATM 9305 O O   . HOH Y 5 .   ? 23.380  16.366  9.575   1.00 39.31 ? 1579 HOH A O   1 
HETATM 9306 O O   . HOH Y 5 .   ? 34.137  22.150  7.528   1.00 46.15 ? 1580 HOH A O   1 
HETATM 9307 O O   . HOH Y 5 .   ? 23.821  18.974  9.220   1.00 44.56 ? 1581 HOH A O   1 
HETATM 9308 O O   . HOH Y 5 .   ? 32.387  -4.726  -23.776 1.00 37.39 ? 1582 HOH A O   1 
HETATM 9309 O O   . HOH Y 5 .   ? 16.767  27.233  15.746  1.00 40.01 ? 1583 HOH A O   1 
HETATM 9310 O O   . HOH Y 5 .   ? 5.111   -23.248 -14.305 1.00 36.15 ? 1584 HOH A O   1 
HETATM 9311 O O   . HOH Y 5 .   ? 27.027  -29.074 2.667   1.00 40.77 ? 1585 HOH A O   1 
HETATM 9312 O O   . HOH Y 5 .   ? 25.663  -27.851 0.738   1.00 38.20 ? 1586 HOH A O   1 
HETATM 9313 O O   . HOH Y 5 .   ? 0.983   2.061   -13.806 1.00 41.75 ? 1587 HOH A O   1 
HETATM 9314 O O   . HOH Y 5 .   ? 26.568  0.980   7.915   1.00 32.92 ? 1588 HOH A O   1 
HETATM 9315 O O   . HOH Y 5 .   ? 21.724  36.460  -5.338  1.00 30.09 ? 1589 HOH A O   1 
HETATM 9316 O O   . HOH Y 5 .   ? 0.533   3.993   34.767  1.00 41.43 ? 1590 HOH A O   1 
HETATM 9317 O O   . HOH Y 5 .   ? 2.383   -5.079  -20.937 1.00 34.82 ? 1591 HOH A O   1 
HETATM 9318 O O   . HOH Y 5 .   ? 43.168  -19.740 10.748  1.00 39.61 ? 1592 HOH A O   1 
HETATM 9319 O O   . HOH Y 5 .   ? -5.191  -1.114  0.194   1.00 37.45 ? 1593 HOH A O   1 
HETATM 9320 O O   . HOH Y 5 .   ? 29.985  -10.701 -23.652 1.00 35.76 ? 1594 HOH A O   1 
HETATM 9321 O O   . HOH Y 5 .   ? -7.850  0.413   3.422   1.00 41.60 ? 1595 HOH A O   1 
HETATM 9322 O O   . HOH Y 5 .   ? 46.035  -2.574  -10.367 1.00 39.80 ? 1596 HOH A O   1 
HETATM 9323 O O   . HOH Y 5 .   ? 33.384  -17.253 -16.663 1.00 30.55 ? 1597 HOH A O   1 
HETATM 9324 O O   . HOH Y 5 .   ? -4.190  15.829  8.756   1.00 30.62 ? 1598 HOH A O   1 
HETATM 9325 O O   . HOH Y 5 .   ? 7.276   21.749  20.645  1.00 55.12 ? 1599 HOH A O   1 
HETATM 9326 O O   . HOH Y 5 .   ? 46.485  -22.007 -6.412  1.00 43.36 ? 1600 HOH A O   1 
HETATM 9327 O O   . HOH Y 5 .   ? -16.641 -4.662  16.982  1.00 45.40 ? 1601 HOH A O   1 
HETATM 9328 O O   . HOH Y 5 .   ? 47.662  -23.443 0.501   1.00 34.96 ? 1602 HOH A O   1 
HETATM 9329 O O   . HOH Y 5 .   ? 2.620   6.488   -10.102 1.00 36.34 ? 1603 HOH A O   1 
HETATM 9330 O O   . HOH Y 5 .   ? 19.750  -26.854 -19.943 1.00 38.51 ? 1604 HOH A O   1 
HETATM 9331 O O   . HOH Y 5 .   ? 44.788  5.003   -17.858 1.00 34.92 ? 1605 HOH A O   1 
HETATM 9332 O O   . HOH Y 5 .   ? -4.706  7.597   4.721   1.00 44.69 ? 1606 HOH A O   1 
HETATM 9333 O O   . HOH Y 5 .   ? 13.976  -11.273 -20.029 1.00 42.74 ? 1607 HOH A O   1 
HETATM 9334 O O   . HOH Y 5 .   ? 24.506  24.314  9.576   1.00 39.67 ? 1608 HOH A O   1 
HETATM 9335 O O   . HOH Y 5 .   ? 8.768   -25.242 -0.213  1.00 35.89 ? 1609 HOH A O   1 
HETATM 9336 O O   . HOH Y 5 .   ? -10.337 7.726   13.613  1.00 39.06 ? 1610 HOH A O   1 
HETATM 9337 O O   . HOH Y 5 .   ? 7.776   37.337  -6.940  1.00 43.38 ? 1611 HOH A O   1 
HETATM 9338 O O   . HOH Y 5 .   ? 22.056  -30.213 -6.791  1.00 37.72 ? 1612 HOH A O   1 
HETATM 9339 O O   . HOH Y 5 .   ? 13.525  21.412  18.984  1.00 43.07 ? 1613 HOH A O   1 
HETATM 9340 O O   . HOH Y 5 .   ? 19.574  17.773  -18.122 1.00 40.32 ? 1614 HOH A O   1 
HETATM 9341 O O   . HOH Y 5 .   ? 29.343  -3.185  -25.188 1.00 36.36 ? 1615 HOH A O   1 
HETATM 9342 O O   . HOH Y 5 .   ? 6.867   34.652  -7.924  1.00 40.52 ? 1616 HOH A O   1 
HETATM 9343 O O   . HOH Y 5 .   ? 11.562  -10.156 -14.719 1.00 40.33 ? 1617 HOH A O   1 
HETATM 9344 O O   . HOH Y 5 .   ? 30.674  -30.250 -11.141 1.00 34.36 ? 1618 HOH A O   1 
HETATM 9345 O O   . HOH Y 5 .   ? 17.062  25.338  -15.916 1.00 33.49 ? 1619 HOH A O   1 
HETATM 9346 O O   . HOH Y 5 .   ? 44.209  -0.668  -13.110 1.00 40.17 ? 1620 HOH A O   1 
HETATM 9347 O O   . HOH Y 5 .   ? -2.989  24.784  0.509   1.00 40.87 ? 1621 HOH A O   1 
HETATM 9348 O O   . HOH Y 5 .   ? 37.561  -29.375 -2.894  1.00 40.40 ? 1622 HOH A O   1 
HETATM 9349 O O   . HOH Y 5 .   ? 26.098  -26.951 -16.223 1.00 44.99 ? 1623 HOH A O   1 
HETATM 9350 O O   . HOH Y 5 .   ? 6.037   26.563  -4.189  1.00 45.01 ? 1624 HOH A O   1 
HETATM 9351 O O   . HOH Y 5 .   ? 11.608  36.556  -6.786  1.00 39.43 ? 1625 HOH A O   1 
HETATM 9352 O O   . HOH Y 5 .   ? 5.636   30.035  14.784  1.00 40.10 ? 1626 HOH A O   1 
HETATM 9353 O O   . HOH Y 5 .   ? 19.253  -8.831  -25.166 1.00 40.67 ? 1627 HOH A O   1 
HETATM 9354 O O   . HOH Y 5 .   ? -0.879  26.641  -3.004  1.00 40.30 ? 1628 HOH A O   1 
HETATM 9355 O O   . HOH Y 5 .   ? 7.283   10.255  -19.488 1.00 35.96 ? 1629 HOH A O   1 
HETATM 9356 O O   . HOH Y 5 .   ? 51.618  -15.091 10.002  1.00 42.89 ? 1630 HOH A O   1 
HETATM 9357 O O   . HOH Y 5 .   ? 27.199  -13.645 -21.792 1.00 42.74 ? 1631 HOH A O   1 
HETATM 9358 O O   . HOH Y 5 .   ? -4.552  15.475  -0.773  1.00 41.66 ? 1632 HOH A O   1 
HETATM 9359 O O   . HOH Y 5 .   ? 42.250  -18.669 -10.018 1.00 36.65 ? 1633 HOH A O   1 
HETATM 9360 O O   . HOH Y 5 .   ? 49.392  -13.378 6.055   1.00 38.17 ? 1634 HOH A O   1 
HETATM 9361 O O   . HOH Y 5 .   ? 1.419   7.863   -13.218 1.00 36.39 ? 1635 HOH A O   1 
HETATM 9362 O O   . HOH Y 5 .   ? -7.121  8.533   12.003  1.00 44.68 ? 1636 HOH A O   1 
HETATM 9363 O O   . HOH Y 5 .   ? 24.068  24.414  4.650   1.00 43.82 ? 1637 HOH A O   1 
HETATM 9364 O O   . HOH Y 5 .   ? 8.475   6.152   -1.920  1.00 34.95 ? 1638 HOH A O   1 
HETATM 9365 O O   . HOH Y 5 .   ? 22.277  15.891  12.370  1.00 42.83 ? 1639 HOH A O   1 
HETATM 9366 O O   . HOH Y 5 .   ? 17.797  11.507  13.612  1.00 39.87 ? 1640 HOH A O   1 
HETATM 9367 O O   . HOH Y 5 .   ? -1.885  -2.510  -17.212 1.00 37.32 ? 1641 HOH A O   1 
HETATM 9368 O O   . HOH Y 5 .   ? 15.200  19.660  -21.741 1.00 39.23 ? 1642 HOH A O   1 
HETATM 9369 O O   . HOH Y 5 .   ? 2.232   23.008  16.273  1.00 44.75 ? 1643 HOH A O   1 
HETATM 9370 O O   . HOH Y 5 .   ? 17.211  -4.569  -26.281 1.00 40.68 ? 1644 HOH A O   1 
HETATM 9371 O O   . HOH Y 5 .   ? 17.812  26.355  11.979  1.00 45.69 ? 1645 HOH A O   1 
HETATM 9372 O O   . HOH Y 5 .   ? 12.856  11.925  -28.443 1.00 47.01 ? 1646 HOH A O   1 
HETATM 9373 O O   . HOH Y 5 .   ? 36.654  -10.519 -12.886 1.00 38.64 ? 1647 HOH A O   1 
HETATM 9374 O O   . HOH Y 5 .   ? 16.273  11.373  -26.490 1.00 40.10 ? 1648 HOH A O   1 
HETATM 9375 O O   . HOH Y 5 .   ? 48.151  -5.881  -8.403  1.00 37.56 ? 1649 HOH A O   1 
HETATM 9376 O O   . HOH Y 5 .   ? -6.668  7.181   6.409   1.00 39.02 ? 1650 HOH A O   1 
HETATM 9377 O O   . HOH Y 5 .   ? 2.182   4.302   -7.627  1.00 41.53 ? 1651 HOH A O   1 
HETATM 9378 O O   . HOH Y 5 .   ? 11.979  34.782  10.720  1.00 44.04 ? 1652 HOH A O   1 
HETATM 9379 O O   . HOH Y 5 .   ? 27.303  -24.781 4.550   1.00 35.00 ? 1653 HOH A O   1 
HETATM 9380 O O   . HOH Y 5 .   ? -17.457 -10.011 19.826  1.00 44.82 ? 1654 HOH A O   1 
HETATM 9381 O O   . HOH Y 5 .   ? 14.323  16.927  14.581  1.00 36.37 ? 1655 HOH A O   1 
HETATM 9382 O O   . HOH Y 5 .   ? 26.771  7.760   -22.159 1.00 48.97 ? 1656 HOH A O   1 
HETATM 9383 O O   . HOH Y 5 .   ? 11.438  -2.599  -24.976 1.00 33.66 ? 1657 HOH A O   1 
HETATM 9384 O O   . HOH Y 5 .   ? 13.377  22.680  -20.306 1.00 36.29 ? 1658 HOH A O   1 
HETATM 9385 O O   . HOH Y 5 .   ? 35.690  -24.221 5.045   1.00 31.91 ? 1659 HOH A O   1 
HETATM 9386 O O   . HOH Y 5 .   ? 1.549   27.281  15.644  1.00 40.80 ? 1660 HOH A O   1 
HETATM 9387 O O   . HOH Y 5 .   ? 13.751  14.403  -28.287 1.00 38.27 ? 1661 HOH A O   1 
HETATM 9388 O O   . HOH Y 5 .   ? 20.852  -22.409 -20.699 1.00 37.52 ? 1662 HOH A O   1 
HETATM 9389 O O   . HOH Y 5 .   ? 40.395  -17.171 -11.520 1.00 40.00 ? 1663 HOH A O   1 
HETATM 9390 O O   . HOH Y 5 .   ? 24.692  -25.029 4.377   1.00 44.06 ? 1664 HOH A O   1 
HETATM 9391 O O   . HOH Y 5 .   ? 16.030  1.591   -25.875 1.00 36.60 ? 1665 HOH A O   1 
HETATM 9392 O O   . HOH Y 5 .   ? -8.505  -2.703  30.686  1.00 45.14 ? 1666 HOH A O   1 
HETATM 9393 O O   . HOH Y 5 .   ? 0.276   0.106   -15.392 1.00 38.52 ? 1667 HOH A O   1 
HETATM 9394 O O   . HOH Y 5 .   ? 41.226  -22.704 14.803  1.00 41.52 ? 1668 HOH A O   1 
HETATM 9395 O O   . HOH Y 5 .   ? 47.786  11.756  1.679   1.00 40.66 ? 1669 HOH A O   1 
HETATM 9396 O O   . HOH Y 5 .   ? 40.690  -12.817 -14.143 1.00 42.47 ? 1670 HOH A O   1 
HETATM 9397 O O   . HOH Y 5 .   ? 50.130  -8.564  10.172  1.00 37.17 ? 1671 HOH A O   1 
HETATM 9398 O O   . HOH Y 5 .   ? -14.820 -2.659  17.040  1.00 41.26 ? 1672 HOH A O   1 
HETATM 9399 O O   . HOH Y 5 .   ? 12.548  8.611   -29.899 1.00 49.11 ? 1673 HOH A O   1 
HETATM 9400 O O   . HOH Y 5 .   ? 30.536  -31.673 -7.617  1.00 34.12 ? 1674 HOH A O   1 
HETATM 9401 O O   . HOH Y 5 .   ? 15.743  -20.770 -18.413 1.00 41.32 ? 1675 HOH A O   1 
HETATM 9402 O O   . HOH Y 5 .   ? -3.942  13.028  -0.603  1.00 39.74 ? 1676 HOH A O   1 
HETATM 9403 O O   . HOH Y 5 .   ? 1.136   34.867  -1.358  1.00 36.22 ? 1677 HOH A O   1 
HETATM 9404 O O   . HOH Y 5 .   ? 22.435  29.737  -7.074  1.00 37.06 ? 1678 HOH A O   1 
HETATM 9405 O O   . HOH Y 5 .   ? 23.613  27.042  -6.733  1.00 40.26 ? 1679 HOH A O   1 
HETATM 9406 O O   . HOH Y 5 .   ? 7.328   27.944  6.277   1.00 35.38 ? 1680 HOH A O   1 
HETATM 9407 O O   . HOH Y 5 .   ? 27.880  10.665  -21.414 1.00 45.12 ? 1681 HOH A O   1 
HETATM 9408 O O   . HOH Y 5 .   ? 49.224  -16.601 35.126  1.00 44.24 ? 1682 HOH A O   1 
HETATM 9409 O O   . HOH Y 5 .   ? 29.052  23.044  -7.564  1.00 41.77 ? 1683 HOH A O   1 
HETATM 9410 O O   . HOH Y 5 .   ? 25.004  25.669  -13.388 1.00 44.59 ? 1684 HOH A O   1 
HETATM 9411 O O   . HOH Y 5 .   ? 49.292  -18.449 -8.330  1.00 42.44 ? 1685 HOH A O   1 
HETATM 9412 O O   . HOH Y 5 .   ? 27.837  16.402  -14.258 1.00 38.23 ? 1686 HOH A O   1 
HETATM 9413 O O   . HOH Y 5 .   ? 44.498  -23.364 -3.521  1.00 39.75 ? 1687 HOH A O   1 
HETATM 9414 O O   . HOH Y 5 .   ? 31.705  -18.996 -17.179 1.00 43.46 ? 1688 HOH A O   1 
HETATM 9415 O O   . HOH Y 5 .   ? 11.752  22.861  -17.815 1.00 40.94 ? 1689 HOH A O   1 
HETATM 9416 O O   . HOH Y 5 .   ? 29.654  1.466   -25.065 1.00 42.36 ? 1690 HOH A O   1 
HETATM 9417 O O   . HOH Y 5 .   ? 22.591  9.198   16.055  1.00 43.64 ? 1691 HOH A O   1 
HETATM 9418 O O   . HOH Y 5 .   ? 7.700   1.098   -26.377 1.00 41.81 ? 1692 HOH A O   1 
HETATM 9419 O O   . HOH Y 5 .   ? 0.328   5.665   -12.060 1.00 45.66 ? 1693 HOH A O   1 
HETATM 9420 O O   . HOH Y 5 .   ? 23.964  14.418  -24.262 1.00 43.25 ? 1694 HOH A O   1 
HETATM 9421 O O   . HOH Y 5 .   ? 4.196   21.332  19.400  1.00 39.18 ? 1695 HOH A O   1 
HETATM 9422 O O   . HOH Y 5 .   ? 36.014  18.681  1.984   1.00 38.87 ? 1696 HOH A O   1 
HETATM 9423 O O   . HOH Y 5 .   ? 16.177  -17.906 -18.924 1.00 40.04 ? 1697 HOH A O   1 
HETATM 9424 O O   . HOH Y 5 .   ? 39.697  -6.632  -14.726 1.00 44.53 ? 1698 HOH A O   1 
HETATM 9425 O O   . HOH Y 5 .   ? 16.007  -25.076 -0.481  1.00 38.40 ? 1699 HOH A O   1 
HETATM 9426 O O   . HOH Y 5 .   ? 33.934  -0.595  -17.091 1.00 43.02 ? 1700 HOH A O   1 
HETATM 9427 O O   . HOH Y 5 .   ? 12.279  -9.436  -19.471 1.00 43.97 ? 1701 HOH A O   1 
HETATM 9428 O O   . HOH Y 5 .   ? -15.463 -0.474  21.190  1.00 44.89 ? 1702 HOH A O   1 
HETATM 9429 O O   . HOH Y 5 .   ? -11.881 -6.573  24.861  1.00 40.79 ? 1703 HOH A O   1 
HETATM 9430 O O   . HOH Y 5 .   ? 38.594  19.997  5.024   1.00 44.43 ? 1704 HOH A O   1 
HETATM 9431 O O   . HOH Y 5 .   ? 15.816  -25.043 -16.071 1.00 37.03 ? 1705 HOH A O   1 
HETATM 9432 O O   . HOH Y 5 .   ? 30.335  23.723  -2.703  1.00 48.74 ? 1706 HOH A O   1 
HETATM 9433 O O   . HOH Y 5 .   ? 22.454  -20.616 10.932  1.00 41.45 ? 1707 HOH A O   1 
HETATM 9434 O O   . HOH Y 5 .   ? 23.769  14.039  11.091  1.00 44.88 ? 1708 HOH A O   1 
HETATM 9435 O O   . HOH Y 5 .   ? 52.457  -8.127  9.018   1.00 42.26 ? 1709 HOH A O   1 
HETATM 9436 O O   . HOH Y 5 .   ? 19.463  35.849  -9.821  1.00 45.68 ? 1710 HOH A O   1 
HETATM 9437 O O   . HOH Y 5 .   ? 23.985  12.214  12.940  1.00 42.57 ? 1711 HOH A O   1 
HETATM 9438 O O   . HOH Y 5 .   ? 25.762  26.167  -10.563 1.00 44.65 ? 1712 HOH A O   1 
HETATM 9439 O O   . HOH Y 5 .   ? -1.473  12.555  -12.001 1.00 44.00 ? 1713 HOH A O   1 
HETATM 9440 O O   . HOH Y 5 .   ? 1.323   0.036   -18.518 1.00 37.98 ? 1714 HOH A O   1 
HETATM 9441 O O   . HOH Y 5 .   ? 16.571  -8.647  -24.447 1.00 36.82 ? 1715 HOH A O   1 
HETATM 9442 O O   . HOH Y 5 .   ? 20.978  32.846  4.734   1.00 42.65 ? 1716 HOH A O   1 
HETATM 9443 O O   . HOH Y 5 .   ? 37.683  5.845   -19.218 1.00 46.41 ? 1717 HOH A O   1 
HETATM 9444 O O   . HOH Y 5 .   ? 36.716  -14.527 -15.754 1.00 43.70 ? 1718 HOH A O   1 
HETATM 9445 O O   . HOH Y 5 .   ? 9.779   -27.549 -4.087  1.00 40.06 ? 1719 HOH A O   1 
HETATM 9446 O O   . HOH Y 5 .   ? 3.573   5.126   -17.882 1.00 42.13 ? 1720 HOH A O   1 
HETATM 9447 O O   . HOH Y 5 .   ? 35.512  1.200   -17.771 1.00 40.54 ? 1721 HOH A O   1 
HETATM 9448 O O   . HOH Y 5 .   ? -5.543  20.496  16.477  1.00 47.83 ? 1722 HOH A O   1 
HETATM 9449 O O   . HOH Y 5 .   ? 46.795  -15.217 13.563  1.00 39.79 ? 1723 HOH A O   1 
HETATM 9450 O O   . HOH Y 5 .   ? 43.296  -25.682 1.159   1.00 43.92 ? 1724 HOH A O   1 
HETATM 9451 O O   . HOH Y 5 .   ? -14.068 2.091   21.083  1.00 45.05 ? 1725 HOH A O   1 
HETATM 9452 O O   . HOH Y 5 .   ? 32.299  14.672  -12.058 1.00 44.56 ? 1726 HOH A O   1 
HETATM 9453 O O   . HOH Y 5 .   ? -4.289  31.383  10.795  1.00 41.99 ? 1727 HOH A O   1 
HETATM 9454 O O   . HOH Y 5 .   ? 7.236   -17.513 -16.002 1.00 39.61 ? 1728 HOH A O   1 
HETATM 9455 O O   . HOH Y 5 .   ? 27.268  -21.602 7.337   1.00 43.77 ? 1729 HOH A O   1 
HETATM 9456 O O   . HOH Y 5 .   ? -5.395  11.396  0.816   1.00 44.12 ? 1730 HOH A O   1 
HETATM 9457 O O   . HOH Y 5 .   ? 39.670  -25.673 -2.286  1.00 43.37 ? 1731 HOH A O   1 
HETATM 9458 O O   . HOH Y 5 .   ? 30.622  -13.868 -20.890 1.00 45.96 ? 1732 HOH A O   1 
HETATM 9459 O O   . HOH Y 5 .   ? 50.157  -6.310  -9.849  1.00 42.56 ? 1733 HOH A O   1 
HETATM 9460 O O   . HOH Y 5 .   ? 29.175  2.981   -22.910 1.00 45.73 ? 1734 HOH A O   1 
HETATM 9461 O O   . HOH Y 5 .   ? 12.763  -11.769 -16.483 1.00 44.09 ? 1735 HOH A O   1 
HETATM 9462 O O   . HOH Y 5 .   ? 38.645  -23.882 16.623  1.00 44.85 ? 1736 HOH A O   1 
HETATM 9463 O O   . HOH Y 5 .   ? 44.514  6.934   -16.118 1.00 41.85 ? 1737 HOH A O   1 
HETATM 9464 O O   . HOH Y 5 .   ? -5.277  29.243  9.786   1.00 42.61 ? 1738 HOH A O   1 
HETATM 9465 O O   . HOH Y 5 .   ? 4.332   4.664   -3.423  1.00 45.60 ? 1739 HOH A O   1 
HETATM 9466 O O   . HOH Y 5 .   ? 15.537  13.651  12.517  1.00 42.39 ? 1740 HOH A O   1 
HETATM 9467 O O   . HOH Y 5 .   ? -1.685  -0.148  -18.469 1.00 46.85 ? 1741 HOH A O   1 
HETATM 9468 O O   . HOH Y 5 .   ? 5.102   14.065  -17.729 1.00 49.00 ? 1742 HOH A O   1 
HETATM 9469 O O   . HOH Y 5 .   ? 49.586  14.258  13.288  1.00 43.10 ? 1743 HOH A O   1 
HETATM 9470 O O   . HOH Y 5 .   ? 19.299  32.455  2.852   1.00 36.58 ? 1744 HOH A O   1 
HETATM 9471 O O   . HOH Y 5 .   ? 33.652  9.071   -17.326 1.00 32.26 ? 1745 HOH A O   1 
HETATM 9472 O O   . HOH Y 5 .   ? -5.900  24.903  4.611   1.00 39.06 ? 1746 HOH A O   1 
HETATM 9473 O O   . HOH Y 5 .   ? -0.053  5.561   8.896   1.00 37.04 ? 1747 HOH A O   1 
HETATM 9474 O O   . HOH Y 5 .   ? 44.742  1.646   -12.308 1.00 45.65 ? 1748 HOH A O   1 
HETATM 9475 O O   . HOH Y 5 .   ? 42.084  -22.878 -5.765  1.00 42.71 ? 1749 HOH A O   1 
HETATM 9476 O O   . HOH Y 5 .   ? -3.416  32.562  13.728  1.00 46.62 ? 1750 HOH A O   1 
HETATM 9477 O O   . HOH Y 5 .   ? 41.274  -20.258 -8.181  1.00 30.01 ? 1751 HOH A O   1 
HETATM 9478 O O   . HOH Y 5 .   ? 20.163  38.134  -6.479  1.00 47.59 ? 1752 HOH A O   1 
HETATM 9479 O O   . HOH Z 5 .   ? 29.131  -5.073  34.304  1.00 22.81 ? 1225 HOH B O   1 
HETATM 9480 O O   . HOH Z 5 .   ? 17.502  6.739   21.217  1.00 16.14 ? 1226 HOH B O   1 
HETATM 9481 O O   . HOH Z 5 .   ? 2.743   -12.748 6.002   1.00 18.84 ? 1227 HOH B O   1 
HETATM 9482 O O   . HOH Z 5 .   ? 25.450  -0.498  17.003  1.00 22.66 ? 1228 HOH B O   1 
HETATM 9483 O O   . HOH Z 5 .   ? 20.436  -18.162 15.210  1.00 29.40 ? 1229 HOH B O   1 
HETATM 9484 O O   . HOH Z 5 .   ? 6.044   7.159   20.567  1.00 18.69 ? 1230 HOH B O   1 
HETATM 9485 O O   . HOH Z 5 .   ? 36.386  8.299   20.182  1.00 22.65 ? 1231 HOH B O   1 
HETATM 9486 O O   . HOH Z 5 .   ? 9.937   0.031   11.904  1.00 21.22 ? 1232 HOH B O   1 
HETATM 9487 O O   . HOH Z 5 .   ? 25.264  -6.831  37.398  1.00 21.46 ? 1233 HOH B O   1 
HETATM 9488 O O   . HOH Z 5 .   ? 26.259  -24.963 25.690  1.00 21.78 ? 1234 HOH B O   1 
HETATM 9489 O O   . HOH Z 5 .   ? 16.316  -14.933 16.701  1.00 21.05 ? 1235 HOH B O   1 
HETATM 9490 O O   . HOH Z 5 .   ? 37.786  -9.933  27.126  1.00 24.34 ? 1236 HOH B O   1 
HETATM 9491 O O   . HOH Z 5 .   ? -7.443  -20.764 0.902   1.00 21.27 ? 1237 HOH B O   1 
HETATM 9492 O O   . HOH Z 5 .   ? 16.469  -13.362 21.455  1.00 17.54 ? 1238 HOH B O   1 
HETATM 9493 O O   . HOH Z 5 .   ? -0.514  10.987  24.813  1.00 21.16 ? 1239 HOH B O   1 
HETATM 9494 O O   . HOH Z 5 .   ? 9.489   -12.563 8.783   1.00 18.07 ? 1240 HOH B O   1 
HETATM 9495 O O   . HOH Z 5 .   ? 1.667   -10.708 7.184   1.00 17.00 ? 1241 HOH B O   1 
HETATM 9496 O O   . HOH Z 5 .   ? 13.835  2.914   7.867   1.00 20.77 ? 1242 HOH B O   1 
HETATM 9497 O O   . HOH Z 5 .   ? 30.579  9.554   22.402  1.00 22.10 ? 1243 HOH B O   1 
HETATM 9498 O O   . HOH Z 5 .   ? 29.004  -10.262 40.168  1.00 23.89 ? 1244 HOH B O   1 
HETATM 9499 O O   . HOH Z 5 .   ? 50.136  -5.358  17.069  1.00 35.39 ? 1245 HOH B O   1 
HETATM 9500 O O   . HOH Z 5 .   ? 36.868  12.173  14.599  1.00 19.44 ? 1246 HOH B O   1 
HETATM 9501 O O   . HOH Z 5 .   ? 15.070  -13.926 19.000  1.00 25.38 ? 1247 HOH B O   1 
HETATM 9502 O O   . HOH Z 5 .   ? 20.127  -2.794  41.324  1.00 20.97 ? 1248 HOH B O   1 
HETATM 9503 O O   . HOH Z 5 .   ? 2.118   2.827   38.139  1.00 25.30 ? 1249 HOH B O   1 
HETATM 9504 O O   . HOH Z 5 .   ? 42.867  -6.328  4.049   1.00 19.40 ? 1250 HOH B O   1 
HETATM 9505 O O   . HOH Z 5 .   ? 11.045  9.164   35.532  1.00 21.15 ? 1251 HOH B O   1 
HETATM 9506 O O   . HOH Z 5 .   ? 39.743  19.387  34.622  1.00 26.49 ? 1252 HOH B O   1 
HETATM 9507 O O   . HOH Z 5 .   ? 24.048  -13.997 8.081   1.00 17.53 ? 1253 HOH B O   1 
HETATM 9508 O O   . HOH Z 5 .   ? 29.260  10.697  29.383  1.00 20.23 ? 1254 HOH B O   1 
HETATM 9509 O O   . HOH Z 5 .   ? 15.931  1.931   17.464  1.00 18.18 ? 1255 HOH B O   1 
HETATM 9510 O O   . HOH Z 5 .   ? 26.650  -15.800 17.849  1.00 19.06 ? 1256 HOH B O   1 
HETATM 9511 O O   . HOH Z 5 .   ? 12.095  4.190   6.139   1.00 21.48 ? 1257 HOH B O   1 
HETATM 9512 O O   . HOH Z 5 .   ? 10.869  -11.488 19.385  1.00 20.80 ? 1258 HOH B O   1 
HETATM 9513 O O   . HOH Z 5 .   ? 21.585  13.547  22.447  1.00 24.73 ? 1259 HOH B O   1 
HETATM 9514 O O   . HOH Z 5 .   ? 19.393  0.891   13.933  1.00 24.90 ? 1260 HOH B O   1 
HETATM 9515 O O   . HOH Z 5 .   ? 30.882  -7.056  32.981  1.00 22.07 ? 1261 HOH B O   1 
HETATM 9516 O O   . HOH Z 5 .   ? 35.093  -13.537 24.282  1.00 20.20 ? 1262 HOH B O   1 
HETATM 9517 O O   . HOH Z 5 .   ? -0.347  13.444  18.449  1.00 18.34 ? 1263 HOH B O   1 
HETATM 9518 O O   . HOH Z 5 .   ? 30.835  5.287   38.426  1.00 23.91 ? 1264 HOH B O   1 
HETATM 9519 O O   . HOH Z 5 .   ? 1.236   -4.562  18.408  1.00 21.60 ? 1265 HOH B O   1 
HETATM 9520 O O   . HOH Z 5 .   ? 7.903   -12.333 12.885  1.00 24.19 ? 1266 HOH B O   1 
HETATM 9521 O O   . HOH Z 5 .   ? 32.341  -5.804  19.246  1.00 22.58 ? 1267 HOH B O   1 
HETATM 9522 O O   . HOH Z 5 .   ? 10.706  10.095  25.717  1.00 16.23 ? 1268 HOH B O   1 
HETATM 9523 O O   . HOH Z 5 .   ? 2.401   -8.657  19.416  1.00 18.56 ? 1269 HOH B O   1 
HETATM 9524 O O   . HOH Z 5 .   ? 17.687  -8.673  22.537  1.00 32.25 ? 1270 HOH B O   1 
HETATM 9525 O O   . HOH Z 5 .   ? 2.210   12.742  18.631  1.00 18.60 ? 1271 HOH B O   1 
HETATM 9526 O O   . HOH Z 5 .   ? 19.099  0.393   9.833   1.00 23.35 ? 1272 HOH B O   1 
HETATM 9527 O O   . HOH Z 5 .   ? -0.236  2.924   7.409   1.00 22.92 ? 1273 HOH B O   1 
HETATM 9528 O O   . HOH Z 5 .   ? 8.886   -14.015 11.053  1.00 18.72 ? 1274 HOH B O   1 
HETATM 9529 O O   . HOH Z 5 .   ? 2.842   1.305   6.086   1.00 28.97 ? 1275 HOH B O   1 
HETATM 9530 O O   . HOH Z 5 .   ? 2.635   -11.282 15.287  1.00 18.80 ? 1276 HOH B O   1 
HETATM 9531 O O   . HOH Z 5 .   ? 8.711   -12.825 18.584  1.00 24.75 ? 1277 HOH B O   1 
HETATM 9532 O O   . HOH Z 5 .   ? 2.813   -10.815 21.171  1.00 17.35 ? 1278 HOH B O   1 
HETATM 9533 O O   . HOH Z 5 .   ? 21.470  18.429  37.954  1.00 24.44 ? 1279 HOH B O   1 
HETATM 9534 O O   . HOH Z 5 .   ? 28.963  5.223   40.489  1.00 24.20 ? 1280 HOH B O   1 
HETATM 9535 O O   . HOH Z 5 .   ? 18.228  -22.598 37.996  1.00 24.09 ? 1281 HOH B O   1 
HETATM 9536 O O   . HOH Z 5 .   ? 13.080  -10.149 23.184  1.00 17.54 ? 1282 HOH B O   1 
HETATM 9537 O O   . HOH Z 5 .   ? 27.721  31.158  27.892  1.00 25.99 ? 1283 HOH B O   1 
HETATM 9538 O O   . HOH Z 5 .   ? 25.998  1.201   28.724  1.00 20.21 ? 1284 HOH B O   1 
HETATM 9539 O O   . HOH Z 5 .   ? 25.257  -14.538 30.886  1.00 19.64 ? 1285 HOH B O   1 
HETATM 9540 O O   . HOH Z 5 .   ? 46.188  -2.542  -6.097  1.00 21.71 ? 1286 HOH B O   1 
HETATM 9541 O O   . HOH Z 5 .   ? 18.838  -11.919 21.966  1.00 20.44 ? 1287 HOH B O   1 
HETATM 9542 O O   . HOH Z 5 .   ? 9.608   -13.355 5.630   1.00 20.95 ? 1288 HOH B O   1 
HETATM 9543 O O   . HOH Z 5 .   ? 39.093  -8.854  16.200  1.00 25.46 ? 1289 HOH B O   1 
HETATM 9544 O O   . HOH Z 5 .   ? 33.347  10.743  6.650   1.00 13.54 ? 1290 HOH B O   1 
HETATM 9545 O O   . HOH Z 5 .   ? 22.977  3.879   45.315  1.00 28.57 ? 1291 HOH B O   1 
HETATM 9546 O O   . HOH Z 5 .   ? 11.884  -12.634 22.958  1.00 18.82 ? 1292 HOH B O   1 
HETATM 9547 O O   . HOH Z 5 .   ? 5.827   -23.314 13.614  1.00 33.56 ? 1293 HOH B O   1 
HETATM 9548 O O   . HOH Z 5 .   ? 31.123  -6.892  30.265  1.00 24.51 ? 1294 HOH B O   1 
HETATM 9549 O O   . HOH Z 5 .   ? 34.485  31.189  28.696  1.00 23.42 ? 1295 HOH B O   1 
HETATM 9550 O O   . HOH Z 5 .   ? 27.862  -9.870  48.333  1.00 26.08 ? 1296 HOH B O   1 
HETATM 9551 O O   . HOH Z 5 .   ? 4.175   -10.204 -3.249  1.00 23.73 ? 1297 HOH B O   1 
HETATM 9552 O O   . HOH Z 5 .   ? 28.835  -15.572 33.747  1.00 28.82 ? 1298 HOH B O   1 
HETATM 9553 O O   . HOH Z 5 .   ? 49.213  -15.158 2.222   1.00 23.74 ? 1299 HOH B O   1 
HETATM 9554 O O   . HOH Z 5 .   ? 36.047  -7.716  39.869  1.00 31.23 ? 1300 HOH B O   1 
HETATM 9555 O O   . HOH Z 5 .   ? 21.290  -19.515 8.746   1.00 26.81 ? 1301 HOH B O   1 
HETATM 9556 O O   . HOH Z 5 .   ? 24.045  -11.609 20.165  1.00 18.13 ? 1302 HOH B O   1 
HETATM 9557 O O   . HOH Z 5 .   ? -1.303  -17.863 11.972  1.00 31.66 ? 1303 HOH B O   1 
HETATM 9558 O O   . HOH Z 5 .   ? 21.752  -13.009 22.922  1.00 21.83 ? 1304 HOH B O   1 
HETATM 9559 O O   . HOH Z 5 .   ? 28.608  8.671   18.290  1.00 26.80 ? 1305 HOH B O   1 
HETATM 9560 O O   . HOH Z 5 .   ? -3.098  -20.685 24.117  1.00 31.44 ? 1306 HOH B O   1 
HETATM 9561 O O   . HOH Z 5 .   ? 4.562   15.372  27.931  1.00 37.14 ? 1307 HOH B O   1 
HETATM 9562 O O   . HOH Z 5 .   ? 21.665  18.396  22.319  1.00 25.17 ? 1308 HOH B O   1 
HETATM 9563 O O   . HOH Z 5 .   ? 23.505  -9.164  30.679  1.00 22.19 ? 1309 HOH B O   1 
HETATM 9564 O O   . HOH Z 5 .   ? 4.709   0.572   4.026   1.00 27.29 ? 1310 HOH B O   1 
HETATM 9565 O O   . HOH Z 5 .   ? 0.425   -0.504  9.825   1.00 21.40 ? 1311 HOH B O   1 
HETATM 9566 O O   . HOH Z 5 .   ? 22.340  4.021   42.648  1.00 25.10 ? 1312 HOH B O   1 
HETATM 9567 O O   . HOH Z 5 .   ? 36.453  5.234   24.911  1.00 24.65 ? 1313 HOH B O   1 
HETATM 9568 O O   . HOH Z 5 .   ? 35.688  -3.556  32.433  1.00 41.33 ? 1314 HOH B O   1 
HETATM 9569 O O   . HOH Z 5 .   ? 56.183  -4.830  3.533   1.00 28.50 ? 1315 HOH B O   1 
HETATM 9570 O O   . HOH Z 5 .   ? -7.256  -13.107 26.833  1.00 28.38 ? 1316 HOH B O   1 
HETATM 9571 O O   . HOH Z 5 .   ? -6.991  -10.057 14.615  1.00 31.52 ? 1317 HOH B O   1 
HETATM 9572 O O   . HOH Z 5 .   ? 30.226  26.117  22.234  1.00 32.32 ? 1318 HOH B O   1 
HETATM 9573 O O   . HOH Z 5 .   ? -1.984  11.926  22.428  1.00 27.15 ? 1319 HOH B O   1 
HETATM 9574 O O   . HOH Z 5 .   ? 23.450  -2.426  28.659  1.00 24.99 ? 1320 HOH B O   1 
HETATM 9575 O O   . HOH Z 5 .   ? 3.257   -22.919 30.868  1.00 29.57 ? 1321 HOH B O   1 
HETATM 9576 O O   . HOH Z 5 .   ? 49.104  -13.969 -0.179  1.00 28.24 ? 1322 HOH B O   1 
HETATM 9577 O O   . HOH Z 5 .   ? 29.695  -26.784 27.814  1.00 27.89 ? 1323 HOH B O   1 
HETATM 9578 O O   . HOH Z 5 .   ? 11.508  -19.819 39.668  1.00 32.65 ? 1324 HOH B O   1 
HETATM 9579 O O   . HOH Z 5 .   ? 48.885  -7.878  -3.970  1.00 23.29 ? 1325 HOH B O   1 
HETATM 9580 O O   . HOH Z 5 .   ? -2.786  -16.718 4.307   1.00 23.60 ? 1326 HOH B O   1 
HETATM 9581 O O   . HOH Z 5 .   ? 12.218  -28.963 28.554  1.00 26.64 ? 1327 HOH B O   1 
HETATM 9582 O O   . HOH Z 5 .   ? 6.622   8.850   25.896  1.00 19.42 ? 1328 HOH B O   1 
HETATM 9583 O O   . HOH Z 5 .   ? -2.581  -18.913 3.146   1.00 31.71 ? 1329 HOH B O   1 
HETATM 9584 O O   . HOH Z 5 .   ? 14.518  -19.896 10.515  1.00 24.12 ? 1330 HOH B O   1 
HETATM 9585 O O   . HOH Z 5 .   ? 23.344  4.010   20.439  1.00 31.22 ? 1331 HOH B O   1 
HETATM 9586 O O   . HOH Z 5 .   ? 31.934  29.483  40.046  1.00 25.56 ? 1332 HOH B O   1 
HETATM 9587 O O   . HOH Z 5 .   ? 25.889  -0.290  51.548  1.00 31.82 ? 1333 HOH B O   1 
HETATM 9588 O O   . HOH Z 5 .   ? 27.701  -15.477 31.073  1.00 18.98 ? 1334 HOH B O   1 
HETATM 9589 O O   . HOH Z 5 .   ? 0.842   -16.935 -2.265  1.00 21.19 ? 1335 HOH B O   1 
HETATM 9590 O O   . HOH Z 5 .   ? 24.141  -30.497 29.871  1.00 24.01 ? 1336 HOH B O   1 
HETATM 9591 O O   . HOH Z 5 .   ? 24.873  -17.651 8.640   1.00 23.63 ? 1337 HOH B O   1 
HETATM 9592 O O   . HOH Z 5 .   ? 10.505  -4.595  41.693  1.00 30.80 ? 1338 HOH B O   1 
HETATM 9593 O O   . HOH Z 5 .   ? -2.856  -8.109  -0.475  1.00 19.56 ? 1339 HOH B O   1 
HETATM 9594 O O   . HOH Z 5 .   ? -2.095  -8.705  30.715  1.00 27.37 ? 1340 HOH B O   1 
HETATM 9595 O O   . HOH Z 5 .   ? 22.547  -8.347  33.292  1.00 23.05 ? 1341 HOH B O   1 
HETATM 9596 O O   . HOH Z 5 .   ? 41.614  -12.620 22.159  1.00 26.51 ? 1342 HOH B O   1 
HETATM 9597 O O   . HOH Z 5 .   ? -10.517 -3.828  -4.124  1.00 27.42 ? 1343 HOH B O   1 
HETATM 9598 O O   . HOH Z 5 .   ? 33.056  -7.854  34.349  1.00 26.42 ? 1344 HOH B O   1 
HETATM 9599 O O   . HOH Z 5 .   ? 32.870  -5.287  28.828  1.00 33.32 ? 1345 HOH B O   1 
HETATM 9600 O O   . HOH Z 5 .   ? 57.715  -9.593  1.737   1.00 26.10 ? 1346 HOH B O   1 
HETATM 9601 O O   . HOH Z 5 .   ? 16.459  -20.473 43.582  1.00 43.36 ? 1347 HOH B O   1 
HETATM 9602 O O   . HOH Z 5 .   ? 35.911  -16.334 38.150  1.00 33.84 ? 1348 HOH B O   1 
HETATM 9603 O O   . HOH Z 5 .   ? 34.424  -16.208 26.069  1.00 32.79 ? 1349 HOH B O   1 
HETATM 9604 O O   . HOH Z 5 .   ? 18.140  4.556   13.654  1.00 29.86 ? 1350 HOH B O   1 
HETATM 9605 O O   . HOH Z 5 .   ? 5.462   -21.606 32.243  1.00 27.92 ? 1351 HOH B O   1 
HETATM 9606 O O   . HOH Z 5 .   ? 18.904  7.066   13.636  1.00 33.20 ? 1352 HOH B O   1 
HETATM 9607 O O   . HOH Z 5 .   ? 27.099  -31.245 22.771  1.00 35.88 ? 1353 HOH B O   1 
HETATM 9608 O O   . HOH Z 5 .   ? 33.674  -17.169 22.937  1.00 23.09 ? 1354 HOH B O   1 
HETATM 9609 O O   . HOH Z 5 .   ? -0.694  -4.884  36.689  1.00 36.26 ? 1355 HOH B O   1 
HETATM 9610 O O   . HOH Z 5 .   ? 30.065  -30.804 26.839  1.00 28.17 ? 1356 HOH B O   1 
HETATM 9611 O O   . HOH Z 5 .   ? 26.741  25.025  19.399  1.00 38.93 ? 1357 HOH B O   1 
HETATM 9612 O O   . HOH Z 5 .   ? 6.963   -30.503 12.610  1.00 39.35 ? 1358 HOH B O   1 
HETATM 9613 O O   . HOH Z 5 .   ? 6.019   -2.330  41.806  1.00 32.45 ? 1359 HOH B O   1 
HETATM 9614 O O   . HOH Z 5 .   ? 12.313  -13.607 20.178  1.00 22.12 ? 1360 HOH B O   1 
HETATM 9615 O O   . HOH Z 5 .   ? 26.436  4.518   39.495  1.00 19.81 ? 1361 HOH B O   1 
HETATM 9616 O O   . HOH Z 5 .   ? 3.811   -15.516 32.389  1.00 40.26 ? 1362 HOH B O   1 
HETATM 9617 O O   . HOH Z 5 .   ? 9.895   13.043  35.526  1.00 44.45 ? 1363 HOH B O   1 
HETATM 9618 O O   . HOH Z 5 .   ? 28.487  26.532  32.915  1.00 21.58 ? 1364 HOH B O   1 
HETATM 9619 O O   . HOH Z 5 .   ? 32.440  -3.738  53.472  1.00 40.87 ? 1365 HOH B O   1 
HETATM 9620 O O   . HOH Z 5 .   ? 33.984  -2.834  22.094  1.00 29.72 ? 1366 HOH B O   1 
HETATM 9621 O O   . HOH Z 5 .   ? 33.170  0.961   48.299  1.00 34.39 ? 1367 HOH B O   1 
HETATM 9622 O O   . HOH Z 5 .   ? 0.772   12.788  26.218  1.00 32.38 ? 1368 HOH B O   1 
HETATM 9623 O O   . HOH Z 5 .   ? 12.739  19.317  30.267  1.00 30.30 ? 1369 HOH B O   1 
HETATM 9624 O O   . HOH Z 5 .   ? 3.504   -14.179 -11.257 1.00 28.44 ? 1370 HOH B O   1 
HETATM 9625 O O   . HOH Z 5 .   ? -0.844  20.880  17.593  1.00 28.87 ? 1371 HOH B O   1 
HETATM 9626 O O   . HOH Z 5 .   ? 26.230  2.404   51.606  1.00 46.80 ? 1372 HOH B O   1 
HETATM 9627 O O   . HOH Z 5 .   ? 6.450   -18.499 10.845  1.00 42.82 ? 1373 HOH B O   1 
HETATM 9628 O O   . HOH Z 5 .   ? 35.527  37.278  28.501  1.00 40.07 ? 1374 HOH B O   1 
HETATM 9629 O O   . HOH Z 5 .   ? 29.567  34.323  33.023  1.00 29.16 ? 1375 HOH B O   1 
HETATM 9630 O O   . HOH Z 5 .   ? 25.310  -1.959  25.342  1.00 23.74 ? 1376 HOH B O   1 
HETATM 9631 O O   . HOH Z 5 .   ? 34.331  -11.556 47.817  1.00 47.53 ? 1377 HOH B O   1 
HETATM 9632 O O   . HOH Z 5 .   ? 21.251  -24.147 17.505  1.00 24.50 ? 1378 HOH B O   1 
HETATM 9633 O O   . HOH Z 5 .   ? 25.034  28.816  42.640  1.00 33.79 ? 1379 HOH B O   1 
HETATM 9634 O O   . HOH Z 5 .   ? 28.109  -19.480 31.430  1.00 34.86 ? 1380 HOH B O   1 
HETATM 9635 O O   . HOH Z 5 .   ? -12.942 -11.445 3.111   1.00 45.05 ? 1381 HOH B O   1 
HETATM 9636 O O   . HOH Z 5 .   ? 32.452  2.500   28.999  1.00 25.91 ? 1382 HOH B O   1 
HETATM 9637 O O   . HOH Z 5 .   ? 34.207  4.454   16.904  1.00 35.23 ? 1383 HOH B O   1 
HETATM 9638 O O   . HOH Z 5 .   ? 25.076  -22.532 34.471  1.00 36.03 ? 1384 HOH B O   1 
HETATM 9639 O O   . HOH Z 5 .   ? 41.688  19.524  13.682  1.00 32.90 ? 1385 HOH B O   1 
HETATM 9640 O O   . HOH Z 5 .   ? 17.064  19.416  31.880  1.00 29.78 ? 1386 HOH B O   1 
HETATM 9641 O O   . HOH Z 5 .   ? 8.407   -17.326 4.083   1.00 36.77 ? 1387 HOH B O   1 
HETATM 9642 O O   . HOH Z 5 .   ? 26.972  0.147   24.741  1.00 30.43 ? 1388 HOH B O   1 
HETATM 9643 O O   . HOH Z 5 .   ? 19.127  -2.297  52.191  1.00 36.98 ? 1389 HOH B O   1 
HETATM 9644 O O   . HOH Z 5 .   ? 23.696  -19.121 43.945  1.00 38.87 ? 1390 HOH B O   1 
HETATM 9645 O O   . HOH Z 5 .   ? 4.590   -2.896  5.895   1.00 34.56 ? 1391 HOH B O   1 
HETATM 9646 O O   . HOH Z 5 .   ? 28.476  -18.476 34.758  1.00 41.85 ? 1392 HOH B O   1 
HETATM 9647 O O   . HOH Z 5 .   ? 30.650  -29.147 22.118  1.00 33.50 ? 1393 HOH B O   1 
HETATM 9648 O O   . HOH Z 5 .   ? 1.393   12.507  28.964  1.00 28.56 ? 1394 HOH B O   1 
HETATM 9649 O O   . HOH Z 5 .   ? -7.720  -15.446 22.058  1.00 32.95 ? 1395 HOH B O   1 
HETATM 9650 O O   . HOH Z 5 .   ? 21.462  5.736   46.766  1.00 37.91 ? 1396 HOH B O   1 
HETATM 9651 O O   . HOH Z 5 .   ? 8.096   0.972   42.709  1.00 35.19 ? 1397 HOH B O   1 
HETATM 9652 O O   . HOH Z 5 .   ? -8.501  -8.258  11.411  1.00 44.16 ? 1398 HOH B O   1 
HETATM 9653 O O   . HOH Z 5 .   ? 42.863  20.274  16.018  1.00 44.32 ? 1399 HOH B O   1 
HETATM 9654 O O   . HOH Z 5 .   ? 35.170  -6.128  32.729  1.00 35.74 ? 1400 HOH B O   1 
HETATM 9655 O O   . HOH Z 5 .   ? 22.130  -12.866 45.263  1.00 33.71 ? 1401 HOH B O   1 
HETATM 9656 O O   . HOH Z 5 .   ? 18.813  2.077   16.282  1.00 24.24 ? 1402 HOH B O   1 
HETATM 9657 O O   . HOH Z 5 .   ? 7.012   10.948  22.594  1.00 20.95 ? 1403 HOH B O   1 
HETATM 9658 O O   . HOH Z 5 .   ? 5.440   -18.048 5.404   1.00 28.02 ? 1404 HOH B O   1 
HETATM 9659 O O   . HOH Z 5 .   ? -1.934  -22.954 25.474  1.00 29.37 ? 1405 HOH B O   1 
HETATM 9660 O O   . HOH Z 5 .   ? 46.981  -0.018  -7.171  1.00 27.04 ? 1406 HOH B O   1 
HETATM 9661 O O   . HOH Z 5 .   ? -7.270  -4.236  12.181  1.00 21.95 ? 1407 HOH B O   1 
HETATM 9662 O O   . HOH Z 5 .   ? 16.235  -23.410 39.436  1.00 28.99 ? 1408 HOH B O   1 
HETATM 9663 O O   . HOH Z 5 .   ? 8.736   9.088   23.978  1.00 22.38 ? 1409 HOH B O   1 
HETATM 9664 O O   . HOH Z 5 .   ? 3.668   -14.088 2.943   1.00 20.38 ? 1410 HOH B O   1 
HETATM 9665 O O   . HOH Z 5 .   ? 50.927  1.984   -4.916  1.00 25.71 ? 1411 HOH B O   1 
HETATM 9666 O O   . HOH Z 5 .   ? -1.565  -18.260 -2.371  1.00 30.11 ? 1412 HOH B O   1 
HETATM 9667 O O   . HOH Z 5 .   ? 27.065  2.367   26.548  1.00 25.70 ? 1413 HOH B O   1 
HETATM 9668 O O   . HOH Z 5 .   ? 4.818   2.011   1.547   1.00 25.28 ? 1414 HOH B O   1 
HETATM 9669 O O   . HOH Z 5 .   ? 3.389   -18.907 7.387   1.00 27.97 ? 1415 HOH B O   1 
HETATM 9670 O O   . HOH Z 5 .   ? 35.025  -7.191  30.195  1.00 28.89 ? 1416 HOH B O   1 
HETATM 9671 O O   . HOH Z 5 .   ? 51.910  -0.750  -1.137  1.00 24.06 ? 1417 HOH B O   1 
HETATM 9672 O O   . HOH Z 5 .   ? 19.365  -5.029  42.903  1.00 29.32 ? 1418 HOH B O   1 
HETATM 9673 O O   . HOH Z 5 .   ? 1.256   -15.452 -11.046 1.00 29.23 ? 1419 HOH B O   1 
HETATM 9674 O O   . HOH Z 5 .   ? 5.662   -15.728 2.755   1.00 25.87 ? 1420 HOH B O   1 
HETATM 9675 O O   . HOH Z 5 .   ? 46.907  8.711   18.277  1.00 35.47 ? 1421 HOH B O   1 
HETATM 9676 O O   . HOH Z 5 .   ? 52.719  0.458   -3.399  1.00 29.87 ? 1422 HOH B O   1 
HETATM 9677 O O   . HOH Z 5 .   ? 19.588  -23.447 15.495  1.00 27.60 ? 1423 HOH B O   1 
HETATM 9678 O O   . HOH Z 5 .   ? 20.610  -19.651 12.932  1.00 29.04 ? 1424 HOH B O   1 
HETATM 9679 O O   . HOH Z 5 .   ? 16.164  12.637  20.049  1.00 24.35 ? 1425 HOH B O   1 
HETATM 9680 O O   . HOH Z 5 .   ? 33.723  -15.801 42.892  1.00 35.48 ? 1426 HOH B O   1 
HETATM 9681 O O   . HOH Z 5 .   ? 49.830  -5.276  -4.606  1.00 28.64 ? 1427 HOH B O   1 
HETATM 9682 O O   . HOH Z 5 .   ? -4.368  -22.080 22.283  1.00 31.88 ? 1428 HOH B O   1 
HETATM 9683 O O   . HOH Z 5 .   ? 45.236  22.413  32.376  1.00 33.89 ? 1429 HOH B O   1 
HETATM 9684 O O   . HOH Z 5 .   ? 47.719  11.291  28.884  1.00 36.11 ? 1430 HOH B O   1 
HETATM 9685 O O   . HOH Z 5 .   ? -3.407  9.972   21.029  1.00 31.15 ? 1431 HOH B O   1 
HETATM 9686 O O   . HOH Z 5 .   ? 47.546  20.147  22.073  1.00 30.72 ? 1432 HOH B O   1 
HETATM 9687 O O   . HOH Z 5 .   ? 22.735  -7.809  45.619  1.00 37.14 ? 1433 HOH B O   1 
HETATM 9688 O O   . HOH Z 5 .   ? -4.077  -17.915 -8.813  1.00 28.08 ? 1434 HOH B O   1 
HETATM 9689 O O   . HOH Z 5 .   ? 13.760  13.800  16.991  1.00 40.24 ? 1435 HOH B O   1 
HETATM 9690 O O   . HOH Z 5 .   ? 20.766  -5.838  45.057  1.00 38.79 ? 1436 HOH B O   1 
HETATM 9691 O O   . HOH Z 5 .   ? -2.682  -18.777 -6.645  1.00 29.05 ? 1437 HOH B O   1 
HETATM 9692 O O   . HOH Z 5 .   ? -1.983  -25.861 21.541  1.00 33.61 ? 1438 HOH B O   1 
HETATM 9693 O O   . HOH Z 5 .   ? 34.128  -12.663 45.210  1.00 43.88 ? 1439 HOH B O   1 
HETATM 9694 O O   . HOH Z 5 .   ? -2.585  7.539   24.087  1.00 27.73 ? 1440 HOH B O   1 
HETATM 9695 O O   . HOH Z 5 .   ? 21.564  -31.127 18.885  1.00 31.15 ? 1441 HOH B O   1 
HETATM 9696 O O   . HOH Z 5 .   ? 3.527   -5.882  38.975  1.00 36.75 ? 1442 HOH B O   1 
HETATM 9697 O O   . HOH Z 5 .   ? 27.446  10.786  17.268  1.00 33.59 ? 1443 HOH B O   1 
HETATM 9698 O O   . HOH Z 5 .   ? 13.450  1.383   42.206  1.00 31.15 ? 1444 HOH B O   1 
HETATM 9699 O O   . HOH Z 5 .   ? 18.866  -33.722 20.771  1.00 34.06 ? 1445 HOH B O   1 
HETATM 9700 O O   . HOH Z 5 .   ? -10.597 -5.198  1.413   1.00 34.48 ? 1446 HOH B O   1 
HETATM 9701 O O   . HOH Z 5 .   ? -1.771  -19.587 0.658   1.00 30.01 ? 1447 HOH B O   1 
HETATM 9702 O O   . HOH Z 5 .   ? 39.465  1.698   28.536  1.00 30.35 ? 1448 HOH B O   1 
HETATM 9703 O O   . HOH Z 5 .   ? 37.379  2.944   26.195  1.00 32.65 ? 1449 HOH B O   1 
HETATM 9704 O O   . HOH Z 5 .   ? 46.645  12.206  18.978  1.00 34.21 ? 1450 HOH B O   1 
HETATM 9705 O O   . HOH Z 5 .   ? 0.978   -20.092 0.335   1.00 32.64 ? 1451 HOH B O   1 
HETATM 9706 O O   . HOH Z 5 .   ? 40.256  33.766  23.291  1.00 34.26 ? 1452 HOH B O   1 
HETATM 9707 O O   . HOH Z 5 .   ? 15.313  14.937  18.859  1.00 38.50 ? 1453 HOH B O   1 
HETATM 9708 O O   . HOH Z 5 .   ? 36.544  21.764  12.450  1.00 32.80 ? 1454 HOH B O   1 
HETATM 9709 O O   . HOH Z 5 .   ? 0.227   -9.750  34.321  1.00 36.06 ? 1455 HOH B O   1 
HETATM 9710 O O   . HOH Z 5 .   ? 20.842  -22.570 12.773  1.00 37.66 ? 1456 HOH B O   1 
HETATM 9711 O O   . HOH Z 5 .   ? 29.021  15.021  17.022  1.00 30.87 ? 1457 HOH B O   1 
HETATM 9712 O O   . HOH Z 5 .   ? 7.272   -7.688  39.447  1.00 37.54 ? 1458 HOH B O   1 
HETATM 9713 O O   . HOH Z 5 .   ? 21.080  -19.121 44.522  1.00 35.70 ? 1459 HOH B O   1 
HETATM 9714 O O   . HOH Z 5 .   ? 47.961  14.969  25.620  1.00 34.72 ? 1460 HOH B O   1 
HETATM 9715 O O   . HOH Z 5 .   ? 6.260   -23.496 34.321  1.00 30.86 ? 1461 HOH B O   1 
HETATM 9716 O O   . HOH Z 5 .   ? 0.023   -27.035 25.692  1.00 34.27 ? 1462 HOH B O   1 
HETATM 9717 O O   . HOH Z 5 .   ? 48.496  22.093  20.665  1.00 32.96 ? 1463 HOH B O   1 
HETATM 9718 O O   . HOH Z 5 .   ? 28.757  -1.270  53.940  1.00 31.70 ? 1464 HOH B O   1 
HETATM 9719 O O   . HOH Z 5 .   ? 29.428  -13.843 46.156  1.00 37.57 ? 1465 HOH B O   1 
HETATM 9720 O O   . HOH Z 5 .   ? 38.208  -6.410  29.500  1.00 34.64 ? 1466 HOH B O   1 
HETATM 9721 O O   . HOH Z 5 .   ? -9.366  -5.814  11.544  1.00 36.71 ? 1467 HOH B O   1 
HETATM 9722 O O   . HOH Z 5 .   ? -15.508 -8.568  -4.342  1.00 39.91 ? 1468 HOH B O   1 
HETATM 9723 O O   . HOH Z 5 .   ? -3.229  19.599  20.124  1.00 36.41 ? 1469 HOH B O   1 
HETATM 9724 O O   . HOH Z 5 .   ? 32.096  -17.458 26.001  1.00 28.07 ? 1470 HOH B O   1 
HETATM 9725 O O   . HOH Z 5 .   ? 10.122  15.636  34.833  1.00 35.96 ? 1471 HOH B O   1 
HETATM 9726 O O   . HOH Z 5 .   ? -3.153  -6.318  30.805  1.00 29.97 ? 1472 HOH B O   1 
HETATM 9727 O O   . HOH Z 5 .   ? 27.286  12.984  14.790  1.00 38.86 ? 1473 HOH B O   1 
HETATM 9728 O O   . HOH Z 5 .   ? 46.872  8.984   27.179  1.00 38.14 ? 1474 HOH B O   1 
HETATM 9729 O O   . HOH Z 5 .   ? 23.500  14.710  20.651  1.00 31.36 ? 1475 HOH B O   1 
HETATM 9730 O O   . HOH Z 5 .   ? 20.365  3.519   52.511  1.00 43.12 ? 1476 HOH B O   1 
HETATM 9731 O O   . HOH Z 5 .   ? 20.349  -31.907 21.704  1.00 33.26 ? 1477 HOH B O   1 
HETATM 9732 O O   . HOH Z 5 .   ? 33.143  -0.727  51.809  1.00 35.55 ? 1478 HOH B O   1 
HETATM 9733 O O   . HOH Z 5 .   ? 24.224  5.071   17.973  1.00 37.26 ? 1479 HOH B O   1 
HETATM 9734 O O   . HOH Z 5 .   ? 38.271  -1.928  39.524  1.00 32.74 ? 1480 HOH B O   1 
HETATM 9735 O O   . HOH Z 5 .   ? -8.444  -20.833 4.154   1.00 28.16 ? 1481 HOH B O   1 
HETATM 9736 O O   . HOH Z 5 .   ? 4.881   19.417  20.989  1.00 39.82 ? 1482 HOH B O   1 
HETATM 9737 O O   . HOH Z 5 .   ? 47.139  21.214  29.702  1.00 32.30 ? 1483 HOH B O   1 
HETATM 9738 O O   . HOH Z 5 .   ? 1.939   11.005  32.533  1.00 43.43 ? 1484 HOH B O   1 
HETATM 9739 O O   . HOH Z 5 .   ? 30.130  4.047   19.043  1.00 40.41 ? 1485 HOH B O   1 
HETATM 9740 O O   . HOH Z 5 .   ? 0.125   14.146  30.555  1.00 36.21 ? 1486 HOH B O   1 
HETATM 9741 O O   . HOH Z 5 .   ? 12.069  -32.329 31.867  1.00 37.47 ? 1487 HOH B O   1 
HETATM 9742 O O   . HOH Z 5 .   ? -11.512 -18.255 5.301   1.00 27.92 ? 1488 HOH B O   1 
HETATM 9743 O O   . HOH Z 5 .   ? 26.530  14.505  18.213  1.00 35.17 ? 1489 HOH B O   1 
HETATM 9744 O O   . HOH Z 5 .   ? 43.379  1.077   22.149  1.00 43.08 ? 1490 HOH B O   1 
HETATM 9745 O O   . HOH Z 5 .   ? 58.726  0.097   -2.935  1.00 36.81 ? 1491 HOH B O   1 
HETATM 9746 O O   . HOH Z 5 .   ? 28.227  32.031  39.257  1.00 28.64 ? 1492 HOH B O   1 
HETATM 9747 O O   . HOH Z 5 .   ? 51.141  -13.657 -1.754  1.00 36.73 ? 1493 HOH B O   1 
HETATM 9748 O O   . HOH Z 5 .   ? 2.962   6.816   39.966  1.00 40.12 ? 1494 HOH B O   1 
HETATM 9749 O O   . HOH Z 5 .   ? 28.099  21.804  43.356  1.00 35.47 ? 1495 HOH B O   1 
HETATM 9750 O O   . HOH Z 5 .   ? -3.839  13.564  23.330  1.00 41.80 ? 1496 HOH B O   1 
HETATM 9751 O O   . HOH Z 5 .   ? 20.457  -9.877  47.051  1.00 44.69 ? 1497 HOH B O   1 
HETATM 9752 O O   . HOH Z 5 .   ? 5.525   -19.042 31.647  1.00 30.95 ? 1498 HOH B O   1 
HETATM 9753 O O   . HOH Z 5 .   ? 35.020  2.354   50.164  1.00 38.67 ? 1499 HOH B O   1 
HETATM 9754 O O   . HOH Z 5 .   ? 31.030  -11.407 46.938  1.00 35.05 ? 1500 HOH B O   1 
HETATM 9755 O O   . HOH Z 5 .   ? 19.872  20.068  22.972  1.00 39.68 ? 1501 HOH B O   1 
HETATM 9756 O O   . HOH Z 5 .   ? 35.571  36.902  24.951  1.00 42.79 ? 1502 HOH B O   1 
HETATM 9757 O O   . HOH Z 5 .   ? 6.525   -21.507 11.235  1.00 40.64 ? 1503 HOH B O   1 
HETATM 9758 O O   . HOH Z 5 .   ? 28.282  26.173  41.777  1.00 26.27 ? 1504 HOH B O   1 
HETATM 9759 O O   . HOH Z 5 .   ? 20.829  -30.014 34.114  1.00 22.24 ? 1505 HOH B O   1 
HETATM 9760 O O   . HOH Z 5 .   ? 46.715  17.799  21.629  1.00 32.93 ? 1506 HOH B O   1 
HETATM 9761 O O   . HOH Z 5 .   ? 39.082  11.749  41.492  1.00 39.90 ? 1507 HOH B O   1 
HETATM 9762 O O   . HOH Z 5 .   ? 24.099  -4.749  55.948  1.00 34.09 ? 1508 HOH B O   1 
HETATM 9763 O O   . HOH Z 5 .   ? 18.729  -7.355  46.500  1.00 42.50 ? 1509 HOH B O   1 
HETATM 9764 O O   . HOH Z 5 .   ? 10.743  -30.498 30.167  1.00 33.97 ? 1510 HOH B O   1 
HETATM 9765 O O   . HOH Z 5 .   ? 15.287  7.655   12.860  1.00 37.51 ? 1511 HOH B O   1 
HETATM 9766 O O   . HOH Z 5 .   ? 40.187  -0.601  18.283  1.00 43.89 ? 1512 HOH B O   1 
HETATM 9767 O O   . HOH Z 5 .   ? 21.760  22.953  38.551  1.00 43.57 ? 1513 HOH B O   1 
HETATM 9768 O O   . HOH Z 5 .   ? 41.529  -0.946  33.935  1.00 40.93 ? 1514 HOH B O   1 
HETATM 9769 O O   . HOH Z 5 .   ? -8.462  -10.998 27.395  1.00 33.01 ? 1515 HOH B O   1 
HETATM 9770 O O   . HOH Z 5 .   ? 16.431  -14.419 44.093  1.00 34.57 ? 1516 HOH B O   1 
HETATM 9771 O O   . HOH Z 5 .   ? 12.369  17.375  23.130  1.00 32.49 ? 1517 HOH B O   1 
HETATM 9772 O O   . HOH Z 5 .   ? 35.507  -1.110  33.342  1.00 40.77 ? 1518 HOH B O   1 
HETATM 9773 O O   . HOH Z 5 .   ? 23.104  19.228  19.832  1.00 41.58 ? 1519 HOH B O   1 
HETATM 9774 O O   . HOH Z 5 .   ? 51.030  -9.313  -2.693  1.00 26.87 ? 1520 HOH B O   1 
HETATM 9775 O O   . HOH Z 5 .   ? -1.825  -24.456 16.141  1.00 35.90 ? 1521 HOH B O   1 
HETATM 9776 O O   . HOH Z 5 .   ? 7.803   7.124   35.133  1.00 24.47 ? 1522 HOH B O   1 
HETATM 9777 O O   . HOH Z 5 .   ? -1.474  -3.206  40.020  1.00 39.78 ? 1523 HOH B O   1 
HETATM 9778 O O   . HOH Z 5 .   ? 13.917  -28.284 34.831  1.00 38.46 ? 1524 HOH B O   1 
HETATM 9779 O O   . HOH Z 5 .   ? 14.814  5.046   9.190   1.00 39.09 ? 1525 HOH B O   1 
HETATM 9780 O O   . HOH Z 5 .   ? 41.314  29.389  17.181  1.00 33.53 ? 1526 HOH B O   1 
HETATM 9781 O O   . HOH Z 5 .   ? 40.078  27.001  17.574  1.00 34.82 ? 1527 HOH B O   1 
HETATM 9782 O O   . HOH Z 5 .   ? 11.098  2.616   42.504  1.00 42.20 ? 1528 HOH B O   1 
HETATM 9783 O O   . HOH Z 5 .   ? 35.315  25.861  15.497  1.00 33.02 ? 1529 HOH B O   1 
HETATM 9784 O O   . HOH Z 5 .   ? 37.782  28.085  16.982  1.00 46.32 ? 1530 HOH B O   1 
HETATM 9785 O O   . HOH Z 5 .   ? 29.816  7.253   49.896  1.00 40.61 ? 1531 HOH B O   1 
HETATM 9786 O O   . HOH Z 5 .   ? 27.679  8.998   49.355  1.00 32.89 ? 1532 HOH B O   1 
HETATM 9787 O O   . HOH Z 5 .   ? 22.733  18.469  40.439  1.00 32.02 ? 1533 HOH B O   1 
HETATM 9788 O O   . HOH Z 5 .   ? 13.789  -33.785 34.594  1.00 41.50 ? 1534 HOH B O   1 
HETATM 9789 O O   . HOH Z 5 .   ? 33.457  21.543  40.045  1.00 32.65 ? 1535 HOH B O   1 
HETATM 9790 O O   . HOH Z 5 .   ? 16.702  -36.454 32.680  1.00 38.55 ? 1536 HOH B O   1 
HETATM 9791 O O   . HOH Z 5 .   ? 36.016  20.492  39.971  1.00 37.22 ? 1537 HOH B O   1 
HETATM 9792 O O   . HOH Z 5 .   ? 49.292  -5.628  19.860  1.00 37.14 ? 1538 HOH B O   1 
HETATM 9793 O O   . HOH Z 5 .   ? 1.833   -11.683 -12.323 1.00 38.15 ? 1539 HOH B O   1 
HETATM 9794 O O   . HOH Z 5 .   ? 17.162  2.898   50.174  1.00 37.98 ? 1540 HOH B O   1 
HETATM 9795 O O   . HOH Z 5 .   ? 54.283  -3.094  10.890  1.00 31.93 ? 1541 HOH B O   1 
HETATM 9796 O O   . HOH Z 5 .   ? -15.784 -11.476 -5.196  1.00 35.36 ? 1542 HOH B O   1 
HETATM 9797 O O   . HOH Z 5 .   ? 41.753  8.407   -9.686  1.00 33.80 ? 1543 HOH B O   1 
HETATM 9798 O O   . HOH Z 5 .   ? 34.576  0.991   29.049  1.00 37.67 ? 1544 HOH B O   1 
HETATM 9799 O O   . HOH Z 5 .   ? -13.331 -14.926 -2.493  1.00 35.04 ? 1545 HOH B O   1 
HETATM 9800 O O   . HOH Z 5 .   ? 47.592  23.828  16.761  1.00 38.85 ? 1546 HOH B O   1 
HETATM 9801 O O   . HOH Z 5 .   ? 44.697  24.044  15.507  1.00 40.69 ? 1547 HOH B O   1 
HETATM 9802 O O   . HOH Z 5 .   ? -14.344 -13.772 -4.843  1.00 44.18 ? 1548 HOH B O   1 
HETATM 9803 O O   . HOH Z 5 .   ? 34.690  -3.390  29.590  1.00 40.14 ? 1549 HOH B O   1 
HETATM 9804 O O   . HOH Z 5 .   ? 25.069  30.887  28.262  1.00 34.53 ? 1550 HOH B O   1 
HETATM 9805 O O   . HOH Z 5 .   ? 55.539  3.594   5.998   1.00 33.96 ? 1551 HOH B O   1 
HETATM 9806 O O   . HOH Z 5 .   ? 55.873  2.045   3.787   1.00 37.36 ? 1552 HOH B O   1 
HETATM 9807 O O   . HOH Z 5 .   ? 46.994  30.328  18.763  1.00 35.97 ? 1553 HOH B O   1 
HETATM 9808 O O   . HOH Z 5 .   ? 56.206  -0.630  4.696   1.00 38.87 ? 1554 HOH B O   1 
HETATM 9809 O O   . HOH Z 5 .   ? 34.484  -2.206  47.549  1.00 50.63 ? 1555 HOH B O   1 
HETATM 9810 O O   . HOH Z 5 .   ? 12.923  -29.336 13.915  1.00 40.21 ? 1556 HOH B O   1 
HETATM 9811 O O   . HOH Z 5 .   ? 52.153  4.930   12.629  1.00 41.42 ? 1557 HOH B O   1 
HETATM 9812 O O   . HOH Z 5 .   ? 14.278  4.855   44.237  1.00 35.48 ? 1558 HOH B O   1 
HETATM 9813 O O   . HOH Z 5 .   ? 27.131  6.035   17.915  1.00 33.92 ? 1559 HOH B O   1 
HETATM 9814 O O   . HOH Z 5 .   ? 9.370   -21.396 39.594  1.00 39.67 ? 1560 HOH B O   1 
HETATM 9815 O O   . HOH Z 5 .   ? 9.548   -33.836 23.480  1.00 38.09 ? 1561 HOH B O   1 
HETATM 9816 O O   . HOH Z 5 .   ? 30.167  -26.274 31.539  1.00 30.32 ? 1562 HOH B O   1 
HETATM 9817 O O   . HOH Z 5 .   ? -14.318 -15.102 -7.402  1.00 35.37 ? 1563 HOH B O   1 
HETATM 9818 O O   . HOH Z 5 .   ? -4.278  -24.587 21.014  1.00 36.89 ? 1564 HOH B O   1 
HETATM 9819 O O   . HOH Z 5 .   ? -3.149  -16.669 6.881   1.00 37.22 ? 1565 HOH B O   1 
HETATM 9820 O O   . HOH Z 5 .   ? 35.627  -19.272 37.570  1.00 38.33 ? 1566 HOH B O   1 
HETATM 9821 O O   . HOH Z 5 .   ? 46.934  -4.573  20.100  1.00 33.57 ? 1567 HOH B O   1 
HETATM 9822 O O   . HOH Z 5 .   ? -13.388 -8.174  -11.501 1.00 48.29 ? 1568 HOH B O   1 
HETATM 9823 O O   . HOH Z 5 .   ? 50.895  1.183   15.297  1.00 40.58 ? 1569 HOH B O   1 
HETATM 9824 O O   . HOH Z 5 .   ? 27.369  -24.101 35.056  1.00 36.43 ? 1570 HOH B O   1 
HETATM 9825 O O   . HOH Z 5 .   ? 4.402   -20.715 9.271   1.00 34.98 ? 1571 HOH B O   1 
HETATM 9826 O O   . HOH Z 5 .   ? 7.963   -23.099 36.905  1.00 46.79 ? 1572 HOH B O   1 
HETATM 9827 O O   . HOH Z 5 .   ? 5.172   -11.009 37.108  1.00 34.96 ? 1573 HOH B O   1 
HETATM 9828 O O   . HOH Z 5 .   ? 52.077  4.401   -5.080  1.00 32.62 ? 1574 HOH B O   1 
HETATM 9829 O O   . HOH Z 5 .   ? 36.818  2.442   28.832  1.00 39.67 ? 1575 HOH B O   1 
HETATM 9830 O O   . HOH Z 5 .   ? 32.888  -18.906 28.123  1.00 41.54 ? 1576 HOH B O   1 
HETATM 9831 O O   . HOH Z 5 .   ? 37.596  30.973  33.839  1.00 39.78 ? 1577 HOH B O   1 
HETATM 9832 O O   . HOH Z 5 .   ? 48.294  26.138  20.456  1.00 39.09 ? 1578 HOH B O   1 
HETATM 9833 O O   . HOH Z 5 .   ? -6.747  -13.119 7.566   1.00 43.20 ? 1579 HOH B O   1 
HETATM 9834 O O   . HOH Z 5 .   ? -12.478 -11.531 -12.725 1.00 44.02 ? 1580 HOH B O   1 
HETATM 9835 O O   . HOH Z 5 .   ? 12.502  -0.958  43.330  1.00 37.51 ? 1581 HOH B O   1 
HETATM 9836 O O   . HOH Z 5 .   ? 13.223  -16.757 40.225  1.00 38.43 ? 1582 HOH B O   1 
HETATM 9837 O O   . HOH Z 5 .   ? 2.541   18.901  22.049  1.00 37.84 ? 1583 HOH B O   1 
HETATM 9838 O O   . HOH Z 5 .   ? 28.651  16.450  14.130  1.00 47.56 ? 1584 HOH B O   1 
HETATM 9839 O O   . HOH Z 5 .   ? 48.525  28.188  18.097  1.00 36.10 ? 1585 HOH B O   1 
HETATM 9840 O O   . HOH Z 5 .   ? 14.816  11.437  17.320  1.00 32.17 ? 1586 HOH B O   1 
HETATM 9841 O O   . HOH Z 5 .   ? 44.917  -0.999  16.735  1.00 41.31 ? 1587 HOH B O   1 
HETATM 9842 O O   . HOH Z 5 .   ? 56.133  -3.148  5.629   1.00 41.85 ? 1588 HOH B O   1 
HETATM 9843 O O   . HOH Z 5 .   ? 27.503  31.784  24.969  1.00 37.93 ? 1589 HOH B O   1 
HETATM 9844 O O   . HOH Z 5 .   ? 0.128   -29.062 19.921  1.00 40.14 ? 1590 HOH B O   1 
HETATM 9845 O O   . HOH Z 5 .   ? -17.252 -7.201  -6.356  1.00 45.09 ? 1591 HOH B O   1 
HETATM 9846 O O   . HOH Z 5 .   ? 24.387  -7.519  51.593  1.00 41.92 ? 1592 HOH B O   1 
HETATM 9847 O O   . HOH Z 5 .   ? 42.916  9.167   41.741  1.00 39.25 ? 1593 HOH B O   1 
HETATM 9848 O O   . HOH Z 5 .   ? 33.548  -25.391 14.103  1.00 52.63 ? 1594 HOH B O   1 
HETATM 9849 O O   . HOH Z 5 .   ? -6.834  -10.161 6.830   1.00 33.53 ? 1595 HOH B O   1 
HETATM 9850 O O   . HOH Z 5 .   ? 37.287  -2.411  22.315  1.00 41.08 ? 1596 HOH B O   1 
HETATM 9851 O O   . HOH Z 5 .   ? 8.502   -36.928 19.464  1.00 38.83 ? 1597 HOH B O   1 
HETATM 9852 O O   . HOH Z 5 .   ? 1.444   -12.153 35.677  1.00 45.88 ? 1598 HOH B O   1 
HETATM 9853 O O   . HOH Z 5 .   ? 7.896   -25.564 33.971  1.00 37.30 ? 1599 HOH B O   1 
HETATM 9854 O O   . HOH Z 5 .   ? -8.066  -6.771  -15.495 1.00 41.92 ? 1600 HOH B O   1 
HETATM 9855 O O   . HOH Z 5 .   ? 31.392  -1.197  54.067  1.00 41.22 ? 1601 HOH B O   1 
HETATM 9856 O O   . HOH Z 5 .   ? 0.569   -4.585  40.954  1.00 44.45 ? 1602 HOH B O   1 
HETATM 9857 O O   . HOH Z 5 .   ? -12.756 -14.390 2.965   1.00 33.86 ? 1603 HOH B O   1 
HETATM 9858 O O   . HOH Z 5 .   ? 31.106  -20.471 15.837  1.00 42.70 ? 1604 HOH B O   1 
HETATM 9859 O O   . HOH Z 5 .   ? 39.947  -0.407  38.575  1.00 42.09 ? 1605 HOH B O   1 
HETATM 9860 O O   . HOH Z 5 .   ? 52.470  9.833   2.552   1.00 40.28 ? 1606 HOH B O   1 
HETATM 9861 O O   . HOH Z 5 .   ? 30.073  11.390  49.119  1.00 38.76 ? 1607 HOH B O   1 
HETATM 9862 O O   . HOH Z 5 .   ? -4.585  -19.654 28.052  1.00 45.39 ? 1608 HOH B O   1 
HETATM 9863 O O   . HOH Z 5 .   ? 22.755  24.706  31.045  1.00 38.74 ? 1609 HOH B O   1 
HETATM 9864 O O   . HOH Z 5 .   ? 38.558  -22.766 19.102  1.00 41.56 ? 1610 HOH B O   1 
HETATM 9865 O O   . HOH Z 5 .   ? 11.208  -8.431  48.613  1.00 38.42 ? 1611 HOH B O   1 
HETATM 9866 O O   . HOH Z 5 .   ? 18.488  17.573  39.103  1.00 41.79 ? 1612 HOH B O   1 
HETATM 9867 O O   . HOH Z 5 .   ? 38.451  -26.153 22.832  1.00 44.31 ? 1613 HOH B O   1 
HETATM 9868 O O   . HOH Z 5 .   ? 45.885  22.648  35.353  1.00 39.38 ? 1614 HOH B O   1 
HETATM 9869 O O   . HOH Z 5 .   ? 20.050  24.903  21.047  1.00 40.96 ? 1615 HOH B O   1 
HETATM 9870 O O   . HOH Z 5 .   ? 35.867  -0.812  30.403  1.00 42.37 ? 1616 HOH B O   1 
HETATM 9871 O O   . HOH Z 5 .   ? -3.490  16.738  22.702  1.00 43.51 ? 1617 HOH B O   1 
HETATM 9872 O O   . HOH Z 5 .   ? 40.879  7.641   41.585  1.00 46.10 ? 1618 HOH B O   1 
HETATM 9873 O O   . HOH Z 5 .   ? -10.554 -13.126 24.870  1.00 37.88 ? 1619 HOH B O   1 
HETATM 9874 O O   . HOH Z 5 .   ? -7.704  -8.970  29.817  1.00 38.96 ? 1620 HOH B O   1 
HETATM 9875 O O   . HOH Z 5 .   ? -8.933  -8.438  3.132   1.00 41.81 ? 1621 HOH B O   1 
HETATM 9876 O O   . HOH Z 5 .   ? 49.288  19.522  24.650  1.00 41.40 ? 1622 HOH B O   1 
HETATM 9877 O O   . HOH Z 5 .   ? 26.438  -21.608 32.302  1.00 39.02 ? 1623 HOH B O   1 
HETATM 9878 O O   . HOH Z 5 .   ? 57.792  3.965   7.013   1.00 45.45 ? 1624 HOH B O   1 
HETATM 9879 O O   . HOH Z 5 .   ? 58.662  -3.049  -0.127  1.00 38.06 ? 1625 HOH B O   1 
HETATM 9880 O O   . HOH Z 5 .   ? 26.725  5.202   50.520  1.00 44.52 ? 1626 HOH B O   1 
HETATM 9881 O O   . HOH Z 5 .   ? 47.889  6.337   37.908  1.00 36.21 ? 1627 HOH B O   1 
HETATM 9882 O O   . HOH Z 5 .   ? 46.975  23.989  19.556  1.00 36.44 ? 1628 HOH B O   1 
HETATM 9883 O O   . HOH Z 5 .   ? -9.618  15.986  17.062  1.00 41.26 ? 1629 HOH B O   1 
HETATM 9884 O O   . HOH Z 5 .   ? 22.209  9.169   43.540  1.00 38.42 ? 1630 HOH B O   1 
HETATM 9885 O O   . HOH Z 5 .   ? 1.665   -2.981  42.957  1.00 45.15 ? 1631 HOH B O   1 
HETATM 9886 O O   . HOH Z 5 .   ? 41.333  31.088  31.919  1.00 39.44 ? 1632 HOH B O   1 
HETATM 9887 O O   . HOH Z 5 .   ? 28.197  27.477  19.962  1.00 44.18 ? 1633 HOH B O   1 
HETATM 9888 O O   . HOH Z 5 .   ? 55.101  1.908   -3.696  1.00 37.88 ? 1634 HOH B O   1 
HETATM 9889 O O   . HOH Z 5 .   ? 39.706  -24.347 20.788  1.00 34.69 ? 1635 HOH B O   1 
HETATM 9890 O O   . HOH Z 5 .   ? 40.914  0.545   20.802  1.00 43.52 ? 1636 HOH B O   1 
HETATM 9891 O O   . HOH Z 5 .   ? -12.213 -13.982 -11.892 1.00 43.25 ? 1637 HOH B O   1 
HETATM 9892 O O   . HOH Z 5 .   ? 38.175  -2.960  33.422  1.00 42.59 ? 1638 HOH B O   1 
HETATM 9893 O O   . HOH Z 5 .   ? 12.837  -22.971 10.920  1.00 45.93 ? 1639 HOH B O   1 
HETATM 9894 O O   . HOH Z 5 .   ? 10.649  -29.028 38.300  1.00 49.90 ? 1640 HOH B O   1 
HETATM 9895 O O   . HOH Z 5 .   ? 58.715  6.563   1.907   1.00 42.52 ? 1641 HOH B O   1 
HETATM 9896 O O   . HOH Z 5 .   ? 58.513  -1.506  -5.072  1.00 36.71 ? 1642 HOH B O   1 
HETATM 9897 O O   . HOH Z 5 .   ? -7.455  12.609  16.887  1.00 47.54 ? 1643 HOH B O   1 
HETATM 9898 O O   . HOH Z 5 .   ? 0.977   -29.283 23.414  1.00 40.63 ? 1644 HOH B O   1 
HETATM 9899 O O   . HOH Z 5 .   ? 42.780  -2.230  23.318  1.00 47.49 ? 1645 HOH B O   1 
HETATM 9900 O O   . HOH Z 5 .   ? 20.708  12.873  45.118  1.00 39.32 ? 1646 HOH B O   1 
HETATM 9901 O O   . HOH Z 5 .   ? 24.831  31.403  24.969  1.00 42.66 ? 1647 HOH B O   1 
HETATM 9902 O O   . HOH Z 5 .   ? 38.686  20.314  12.964  1.00 43.36 ? 1648 HOH B O   1 
HETATM 9903 O O   . HOH Z 5 .   ? 10.635  18.974  24.131  1.00 39.89 ? 1649 HOH B O   1 
HETATM 9904 O O   . HOH Z 5 .   ? 16.082  -21.819 9.534   1.00 40.27 ? 1650 HOH B O   1 
HETATM 9905 O O   . HOH Z 5 .   ? 23.756  -24.422 14.009  1.00 43.76 ? 1651 HOH B O   1 
HETATM 9906 O O   . HOH Z 5 .   ? 53.707  5.185   -2.870  1.00 43.46 ? 1652 HOH B O   1 
HETATM 9907 O O   . HOH Z 5 .   ? 7.380   14.973  29.730  1.00 38.49 ? 1653 HOH B O   1 
HETATM 9908 O O   . HOH Z 5 .   ? 41.260  -6.220  22.834  1.00 46.41 ? 1654 HOH B O   1 
HETATM 9909 O O   . HOH Z 5 .   ? 27.621  29.360  23.073  1.00 41.71 ? 1655 HOH B O   1 
HETATM 9910 O O   . HOH Z 5 .   ? 42.049  2.461   16.011  1.00 39.69 ? 1656 HOH B O   1 
HETATM 9911 O O   . HOH Z 5 .   ? 21.058  -27.207 18.000  1.00 46.26 ? 1657 HOH B O   1 
HETATM 9912 O O   . HOH Z 5 .   ? -2.635  -21.949 27.800  1.00 42.86 ? 1658 HOH B O   1 
HETATM 9913 O O   . HOH Z 5 .   ? 10.923  -36.321 23.560  1.00 39.58 ? 1659 HOH B O   1 
HETATM 9914 O O   . HOH Z 5 .   ? 17.680  15.549  42.363  1.00 45.67 ? 1660 HOH B O   1 
HETATM 9915 O O   . HOH Z 5 .   ? 39.220  22.012  45.034  1.00 38.72 ? 1661 HOH B O   1 
HETATM 9916 O O   . HOH Z 5 .   ? 33.415  38.378  24.524  1.00 44.20 ? 1662 HOH B O   1 
HETATM 9917 O O   . HOH Z 5 .   ? 23.830  8.626   45.530  1.00 46.47 ? 1663 HOH B O   1 
HETATM 9918 O O   . HOH Z 5 .   ? 14.625  -17.739 42.881  1.00 38.53 ? 1664 HOH B O   1 
HETATM 9919 O O   . HOH Z 5 .   ? -6.893  16.745  14.813  1.00 39.20 ? 1665 HOH B O   1 
HETATM 9920 O O   . HOH Z 5 .   ? 48.790  15.658  21.924  1.00 38.98 ? 1666 HOH B O   1 
HETATM 9921 O O   . HOH Z 5 .   ? 5.670   -14.373 43.382  1.00 44.40 ? 1667 HOH B O   1 
HETATM 9922 O O   . HOH Z 5 .   ? 10.009  4.176   44.310  1.00 45.83 ? 1668 HOH B O   1 
HETATM 9923 O O   . HOH Z 5 .   ? 16.247  6.471   44.214  1.00 48.05 ? 1669 HOH B O   1 
HETATM 9924 O O   . HOH Z 5 .   ? 23.009  26.127  28.220  1.00 40.60 ? 1670 HOH B O   1 
HETATM 9925 O O   . HOH Z 5 .   ? 42.116  5.621   39.904  1.00 40.51 ? 1671 HOH B O   1 
HETATM 9926 O O   . HOH Z 5 .   ? 8.219   -10.267 41.886  1.00 44.60 ? 1672 HOH B O   1 
HETATM 9927 O O   . HOH Z 5 .   ? 6.784   -12.218 42.660  1.00 41.87 ? 1673 HOH B O   1 
HETATM 9928 O O   . HOH Z 5 .   ? 25.127  31.136  36.943  1.00 42.54 ? 1674 HOH B O   1 
HETATM 9929 O O   . HOH Z 5 .   ? 29.246  -4.722  54.596  1.00 39.18 ? 1675 HOH B O   1 
HETATM 9930 O O   . HOH Z 5 .   ? 25.143  -21.584 37.016  1.00 47.89 ? 1676 HOH B O   1 
HETATM 9931 O O   . HOH Z 5 .   ? 15.331  -18.338 6.926   1.00 39.13 ? 1677 HOH B O   1 
HETATM 9932 O O   . HOH Z 5 .   ? 46.953  18.242  35.295  1.00 43.03 ? 1678 HOH B O   1 
HETATM 9933 O O   . HOH Z 5 .   ? 9.157   -8.163  43.073  1.00 48.56 ? 1679 HOH B O   1 
HETATM 9934 O O   . HOH Z 5 .   ? -0.893  -18.583 9.296   1.00 42.71 ? 1680 HOH B O   1 
HETATM 9935 O O   . HOH Z 5 .   ? 19.613  24.641  35.165  1.00 45.77 ? 1681 HOH B O   1 
HETATM 9936 O O   . HOH Z 5 .   ? 26.687  16.202  45.657  1.00 32.66 ? 1682 HOH B O   1 
HETATM 9937 O O   . HOH Z 5 .   ? 42.275  22.954  15.113  1.00 47.53 ? 1683 HOH B O   1 
HETATM 9938 O O   . HOH Z 5 .   ? 16.318  -33.869 20.640  1.00 43.22 ? 1684 HOH B O   1 
HETATM 9939 O O   . HOH Z 5 .   ? 14.852  -34.686 17.990  1.00 47.59 ? 1685 HOH B O   1 
HETATM 9940 O O   . HOH Z 5 .   ? 16.984  24.094  34.497  1.00 44.36 ? 1686 HOH B O   1 
HETATM 9941 O O   . HOH Z 5 .   ? 16.138  -36.482 21.297  1.00 41.45 ? 1687 HOH B O   1 
HETATM 9942 O O   . HOH Z 5 .   ? 16.714  0.343   51.568  1.00 41.53 ? 1688 HOH B O   1 
HETATM 9943 O O   . HOH Z 5 .   ? 30.420  -18.612 36.546  1.00 44.99 ? 1689 HOH B O   1 
HETATM 9944 O O   . HOH Z 5 .   ? 8.108   -34.657 21.520  1.00 42.97 ? 1690 HOH B O   1 
HETATM 9945 O O   . HOH Z 5 .   ? 13.615  -35.867 23.579  1.00 45.63 ? 1691 HOH B O   1 
HETATM 9946 O O   . HOH Z 5 .   ? 23.295  -27.780 16.769  1.00 42.65 ? 1692 HOH B O   1 
HETATM 9947 O O   . HOH Z 5 .   ? 0.314   -13.992 33.473  1.00 48.34 ? 1693 HOH B O   1 
HETATM 9948 O O   . HOH Z 5 .   ? 36.639  24.085  13.249  1.00 40.77 ? 1694 HOH B O   1 
HETATM 9949 O O   . HOH Z 5 .   ? 20.155  -1.566  14.533  1.00 37.91 ? 1695 HOH B O   1 
HETATM 9950 O O   . HOH Z 5 .   ? -3.177  -25.007 24.695  1.00 37.95 ? 1696 HOH B O   1 
HETATM 9951 O O   . HOH Z 5 .   ? 50.707  17.082  23.202  1.00 41.74 ? 1697 HOH B O   1 
HETATM 9952 O O   . HOH Z 5 .   ? -4.207  -24.507 17.908  1.00 42.82 ? 1698 HOH B O   1 
HETATM 9953 O O   . HOH Z 5 .   ? 17.478  -25.166 14.018  1.00 44.81 ? 1699 HOH B O   1 
HETATM 9954 O O   . HOH Z 5 .   ? 42.439  -24.468 21.886  1.00 43.34 ? 1700 HOH B O   1 
HETATM 9955 O O   . HOH Z 5 .   ? 60.224  5.592   -0.250  1.00 42.32 ? 1701 HOH B O   1 
HETATM 9956 O O   . HOH Z 5 .   ? 8.178   -17.228 8.468   1.00 40.07 ? 1702 HOH B O   1 
HETATM 9957 O O   . HOH Z 5 .   ? 39.388  -0.693  22.643  1.00 46.10 ? 1703 HOH B O   1 
HETATM 9958 O O   . HOH Z 5 .   ? 31.927  -3.747  26.743  1.00 32.16 ? 1704 HOH B O   1 
HETATM 9959 O O   . HOH Z 5 .   ? 8.662   -8.562  47.751  1.00 40.77 ? 1705 HOH B O   1 
HETATM 9960 O O   . HOH Z 5 .   ? 44.626  2.071   -9.498  1.00 33.39 ? 1706 HOH B O   1 
HETATM 9961 O O   . HOH Z 5 .   ? 44.271  1.091   15.138  1.00 39.46 ? 1707 HOH B O   1 
HETATM 9962 O O   . HOH Z 5 .   ? 52.746  -2.121  -4.782  1.00 39.94 ? 1708 HOH B O   1 
HETATM 9963 O O   . HOH Z 5 .   ? 30.054  34.149  23.561  1.00 44.88 ? 1709 HOH B O   1 
HETATM 9964 O O   . HOH Z 5 .   ? 20.480  24.415  24.859  1.00 36.64 ? 1710 HOH B O   1 
HETATM 9965 O O   . HOH Z 5 .   ? 51.189  -2.947  -1.459  1.00 29.75 ? 1711 HOH B O   1 
HETATM 9966 O O   . HOH Z 5 .   ? 12.027  -21.092 9.612   1.00 40.10 ? 1712 HOH B O   1 
HETATM 9967 O O   . HOH Z 5 .   ? 46.593  6.226   23.424  1.00 40.78 ? 1713 HOH B O   1 
HETATM 9968 O O   . HOH Z 5 .   ? 24.161  13.501  18.443  1.00 42.89 ? 1714 HOH B O   1 
HETATM 9969 O O   . HOH Z 5 .   ? 51.466  3.615   14.769  1.00 46.96 ? 1715 HOH B O   1 
HETATM 9970 O O   . HOH Z 5 .   ? 14.485  2.608   44.419  1.00 39.95 ? 1716 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   ALA 2   1   1   ALA ALA A . n 
A 1 3   ALA 3   2   2   ALA ALA A . n 
A 1 4   LEU 4   3   3   LEU LEU A . n 
A 1 5   THR 5   4   4   THR THR A . n 
A 1 6   ARG 6   5   5   ARG ARG A . n 
A 1 7   ASN 7   6   6   ASN ASN A . n 
A 1 8   PRO 8   7   7   PRO PRO A . n 
A 1 9   GLN 9   8   8   GLN GLN A . n 
A 1 10  PHE 10  9   9   PHE PHE A . n 
A 1 11  GLN 11  10  10  GLN GLN A . n 
A 1 12  LYS 12  11  11  LYS LYS A . n 
A 1 13  LEU 13  12  12  LEU LEU A . n 
A 1 14  LEU 14  13  13  LEU LEU A . n 
A 1 15  GLU 15  14  14  GLU GLU A . n 
A 1 16  TRP 16  15  15  TRP TRP A . n 
A 1 17  HIS 17  16  16  HIS HIS A . n 
A 1 18  ARG 18  17  17  ARG ARG A . n 
A 1 19  ALA 19  18  18  ALA ALA A . n 
A 1 20  ASN 20  19  19  ASN ASN A . n 
A 1 21  SER 21  20  20  SER SER A . n 
A 1 22  ALA 22  21  21  ALA ALA A . n 
A 1 23  ASN 23  22  22  ASN ASN A . n 
A 1 24  LEU 24  23  23  LEU LEU A . n 
A 1 25  LYS 25  24  24  LYS LYS A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  ARG 27  26  26  ARG ARG A . n 
A 1 28  GLU 28  27  27  GLU GLU A . n 
A 1 29  LEU 29  28  28  LEU LEU A . n 
A 1 30  PHE 30  29  29  PHE PHE A . n 
A 1 31  GLU 31  30  30  GLU GLU A . n 
A 1 32  ALA 32  31  31  ALA ALA A . n 
A 1 33  ASP 33  32  32  ASP ASP A . n 
A 1 34  PRO 34  33  33  PRO PRO A . n 
A 1 35  GLU 35  34  34  GLU GLU A . n 
A 1 36  ARG 36  35  35  ARG ARG A . n 
A 1 37  PHE 37  36  36  PHE PHE A . n 
A 1 38  ASN 38  37  37  ASN ASN A . n 
A 1 39  ASN 39  38  38  ASN ASN A . n 
A 1 40  PHE 40  39  39  PHE PHE A . n 
A 1 41  SER 41  40  40  SER SER A . n 
A 1 42  LEU 42  41  41  LEU LEU A . n 
A 1 43  ASN 43  42  42  ASN ASN A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  ASN 45  44  44  ASN ASN A . n 
A 1 46  THR 46  45  45  THR THR A . n 
A 1 47  ASN 47  46  46  ASN ASN A . n 
A 1 48  HIS 48  47  47  HIS HIS A . n 
A 1 49  GLY 49  48  48  GLY GLY A . n 
A 1 50  HIS 50  49  49  HIS HIS A . n 
A 1 51  ILE 51  50  50  ILE ILE A . n 
A 1 52  LEU 52  51  51  LEU LEU A . n 
A 1 53  VAL 53  52  52  VAL VAL A . n 
A 1 54  ASP 54  53  53  ASP ASP A . n 
A 1 55  TYR 55  54  54  TYR TYR A . n 
A 1 56  SER 56  55  55  SER SER A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  ASN 58  57  57  ASN ASN A . n 
A 1 59  LEU 59  58  58  LEU LEU A . n 
A 1 60  VAL 60  59  59  VAL VAL A . n 
A 1 61  ASN 61  60  60  ASN ASN A . n 
A 1 62  LYS 62  61  61  LYS LYS A . n 
A 1 63  GLU 63  62  62  GLU GLU A . n 
A 1 64  VAL 64  63  63  VAL VAL A . n 
A 1 65  MET 65  64  64  MET MET A . n 
A 1 66  GLN 66  65  65  GLN GLN A . n 
A 1 67  MET 67  66  66  MET MET A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  VAL 69  68  68  VAL VAL A . n 
A 1 70  GLU 70  69  69  GLU GLU A . n 
A 1 71  LEU 71  70  70  LEU LEU A . n 
A 1 72  ALA 72  71  71  ALA ALA A . n 
A 1 73  LYS 73  72  72  LYS LYS A . n 
A 1 74  SER 74  73  73  SER SER A . n 
A 1 75  ARG 75  74  74  ARG ARG A . n 
A 1 76  GLY 76  75  75  GLY GLY A . n 
A 1 77  VAL 77  76  76  VAL VAL A . n 
A 1 78  GLU 78  77  77  GLU GLU A . n 
A 1 79  ALA 79  78  78  ALA ALA A . n 
A 1 80  ALA 80  79  79  ALA ALA A . n 
A 1 81  ARG 81  80  80  ARG ARG A . n 
A 1 82  ASP 82  81  81  ASP ASP A . n 
A 1 83  ASN 83  82  82  ASN ASN A . n 
A 1 84  MET 84  83  83  MET MET A . n 
A 1 85  PHE 85  84  84  PHE PHE A . n 
A 1 86  SER 86  85  85  SER SER A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  SER 88  87  87  SER SER A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  ILE 90  89  89  ILE ILE A . n 
A 1 91  ASN 91  90  90  ASN ASN A . n 
A 1 92  TYR 92  91  91  TYR TYR A . n 
A 1 93  THR 93  92  92  THR THR A . n 
A 1 94  GLU 94  93  93  GLU GLU A . n 
A 1 95  ASP 95  94  94  ASP ASP A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  VAL 98  97  97  VAL VAL A . n 
A 1 99  LEU 99  98  98  LEU LEU A . n 
A 1 100 HIS 100 99  99  HIS HIS A . n 
A 1 101 VAL 101 100 100 VAL VAL A . n 
A 1 102 ALA 102 101 101 ALA ALA A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 ARG 104 103 103 ARG ARG A . n 
A 1 105 ASN 105 104 104 ASN ASN A . n 
A 1 106 ARG 106 105 105 ARG ARG A . n 
A 1 107 SER 107 106 106 SER SER A . n 
A 1 108 ASN 108 107 107 ASN ASN A . n 
A 1 109 THR 109 108 108 THR THR A . n 
A 1 110 PRO 110 109 109 PRO PRO A . n 
A 1 111 ILE 111 110 110 ILE ILE A . n 
A 1 112 LYS 112 111 111 LYS LYS A . n 
A 1 113 VAL 113 112 112 VAL VAL A . n 
A 1 114 ASP 114 113 113 ASP ASP A . n 
A 1 115 GLY 115 114 114 GLY GLY A . n 
A 1 116 LYS 116 115 115 LYS LYS A . n 
A 1 117 ASP 117 116 116 ASP ASP A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 MET 119 118 118 MET MET A . n 
A 1 120 PRO 120 119 119 PRO PRO A . n 
A 1 121 GLU 121 120 120 GLU GLU A . n 
A 1 122 VAL 122 121 121 VAL VAL A . n 
A 1 123 ASN 123 122 122 ASN ASN A . n 
A 1 124 ARG 124 123 123 ARG ARG A . n 
A 1 125 VAL 125 124 124 VAL VAL A . n 
A 1 126 LEU 126 125 125 LEU LEU A . n 
A 1 127 ASP 127 126 126 ASP ASP A . n 
A 1 128 LYS 128 127 127 LYS LYS A . n 
A 1 129 MET 129 128 128 MET MET A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 SER 131 130 130 SER SER A . n 
A 1 132 PHE 132 131 131 PHE PHE A . n 
A 1 133 CYS 133 132 132 CYS CYS A . n 
A 1 134 GLN 134 133 133 GLN GLN A . n 
A 1 135 ARG 135 134 134 ARG ARG A . n 
A 1 136 VAL 136 135 135 VAL VAL A . n 
A 1 137 ARG 137 136 136 ARG ARG A . n 
A 1 138 SER 138 137 137 SER SER A . n 
A 1 139 GLY 139 138 138 GLY GLY A . n 
A 1 140 ASP 140 139 139 ASP ASP A . n 
A 1 141 TRP 141 140 140 TRP TRP A . n 
A 1 142 LYS 142 141 141 LYS LYS A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 TYR 144 143 143 TYR TYR A . n 
A 1 145 THR 145 144 144 THR THR A . n 
A 1 146 GLY 146 145 145 GLY GLY A . n 
A 1 147 LYS 147 146 146 LYS LYS A . n 
A 1 148 SER 148 147 147 SER SER A . n 
A 1 149 ILE 149 148 148 ILE ILE A . n 
A 1 150 THR 150 149 149 THR THR A . n 
A 1 151 ASP 151 150 150 ASP ASP A . n 
A 1 152 ILE 152 151 151 ILE ILE A . n 
A 1 153 ILE 153 152 152 ILE ILE A . n 
A 1 154 ASN 154 153 153 ASN ASN A . n 
A 1 155 ILE 155 154 154 ILE ILE A . n 
A 1 156 GLY 156 155 155 GLY GLY A . n 
A 1 157 ILE 157 156 156 ILE ILE A . n 
A 1 158 GLY 158 157 157 GLY GLY A . n 
A 1 159 GLY 159 158 158 GLY GLY A . n 
A 1 160 SER 160 159 159 SER SER A . n 
A 1 161 ASP 161 160 160 ASP ASP A . n 
A 1 162 LEU 162 161 161 LEU LEU A . n 
A 1 163 GLY 163 162 162 GLY GLY A . n 
A 1 164 PRO 164 163 163 PRO PRO A . n 
A 1 165 LEU 165 164 164 LEU LEU A . n 
A 1 166 MET 166 165 165 MET MET A . n 
A 1 167 VAL 167 166 166 VAL VAL A . n 
A 1 168 THR 168 167 167 THR THR A . n 
A 1 169 GLU 169 168 168 GLU GLU A . n 
A 1 170 ALA 170 169 169 ALA ALA A . n 
A 1 171 LEU 171 170 170 LEU LEU A . n 
A 1 172 LYS 172 171 171 LYS LYS A . n 
A 1 173 PRO 173 172 172 PRO PRO A . n 
A 1 174 TYR 174 173 173 TYR TYR A . n 
A 1 175 SER 175 174 174 SER SER A . n 
A 1 176 LYS 176 175 175 LYS LYS A . n 
A 1 177 GLY 177 176 176 GLY GLY A . n 
A 1 178 GLY 178 177 177 GLY GLY A . n 
A 1 179 PRO 179 178 178 PRO PRO A . n 
A 1 180 ARG 180 179 179 ARG ARG A . n 
A 1 181 VAL 181 180 180 VAL VAL A . n 
A 1 182 TRP 182 181 181 TRP TRP A . n 
A 1 183 PHE 183 182 182 PHE PHE A . n 
A 1 184 VAL 184 183 183 VAL VAL A . n 
A 1 185 SER 185 184 184 SER SER A . n 
A 1 186 ASN 186 185 185 ASN ASN A . n 
A 1 187 ILE 187 186 186 ILE ILE A . n 
A 1 188 ASP 188 187 187 ASP ASP A . n 
A 1 189 GLY 189 188 188 GLY GLY A . n 
A 1 190 THR 190 189 189 THR THR A . n 
A 1 191 HIS 191 190 190 HIS HIS A . n 
A 1 192 ILE 192 191 191 ILE ILE A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 LYS 194 193 193 LYS LYS A . n 
A 1 195 THR 195 194 194 THR THR A . n 
A 1 196 LEU 196 195 195 LEU LEU A . n 
A 1 197 ALA 197 196 196 ALA ALA A . n 
A 1 198 SER 198 197 197 SER SER A . n 
A 1 199 LEU 199 198 198 LEU LEU A . n 
A 1 200 SER 200 199 199 SER SER A . n 
A 1 201 PRO 201 200 200 PRO PRO A . n 
A 1 202 GLU 202 201 201 GLU GLU A . n 
A 1 203 THR 203 202 202 THR THR A . n 
A 1 204 SER 204 203 203 SER SER A . n 
A 1 205 LEU 205 204 204 LEU LEU A . n 
A 1 206 PHE 206 205 205 PHE PHE A . n 
A 1 207 ILE 207 206 206 ILE ILE A . n 
A 1 208 ILE 208 207 207 ILE ILE A . n 
A 1 209 ALA 209 208 208 ALA ALA A . n 
A 1 210 SER 210 209 209 SER SER A . n 
A 1 211 LYS 211 210 210 LYS LYS A . n 
A 1 212 THR 212 211 211 THR THR A . n 
A 1 213 PHE 213 212 212 PHE PHE A . n 
A 1 214 THR 214 213 213 THR THR A . n 
A 1 215 THR 215 214 214 THR THR A . n 
A 1 216 GLN 216 215 215 GLN GLN A . n 
A 1 217 GLU 217 216 216 GLU GLU A . n 
A 1 218 THR 218 217 217 THR THR A . n 
A 1 219 ILE 219 218 218 ILE ILE A . n 
A 1 220 THR 220 219 219 THR THR A . n 
A 1 221 ASN 221 220 220 ASN ASN A . n 
A 1 222 ALA 222 221 221 ALA ALA A . n 
A 1 223 GLU 223 222 222 GLU GLU A . n 
A 1 224 THR 224 223 223 THR THR A . n 
A 1 225 ALA 225 224 224 ALA ALA A . n 
A 1 226 LYS 226 225 225 LYS LYS A . n 
A 1 227 GLU 227 226 226 GLU GLU A . n 
A 1 228 TRP 228 227 227 TRP TRP A . n 
A 1 229 PHE 229 228 228 PHE PHE A . n 
A 1 230 LEU 230 229 229 LEU LEU A . n 
A 1 231 GLU 231 230 230 GLU GLU A . n 
A 1 232 ALA 232 231 231 ALA ALA A . n 
A 1 233 ALA 233 232 232 ALA ALA A . n 
A 1 234 LYS 234 233 233 LYS LYS A . n 
A 1 235 ASP 235 234 234 ASP ASP A . n 
A 1 236 PRO 236 235 235 PRO PRO A . n 
A 1 237 SER 237 236 236 SER SER A . n 
A 1 238 ALA 238 237 237 ALA ALA A . n 
A 1 239 VAL 239 238 238 VAL VAL A . n 
A 1 240 ALA 240 239 239 ALA ALA A . n 
A 1 241 LYS 241 240 240 LYS LYS A . n 
A 1 242 HIS 242 241 241 HIS HIS A . n 
A 1 243 PHE 243 242 242 PHE PHE A . n 
A 1 244 VAL 244 243 243 VAL VAL A . n 
A 1 245 ALA 245 244 244 ALA ALA A . n 
A 1 246 LEU 246 245 245 LEU LEU A . n 
A 1 247 SER 247 246 246 SER SER A . n 
A 1 248 THR 248 247 247 THR THR A . n 
A 1 249 ASN 249 248 248 ASN ASN A . n 
A 1 250 THR 250 249 249 THR THR A . n 
A 1 251 ALA 251 250 250 ALA ALA A . n 
A 1 252 LYS 252 251 251 LYS LYS A . n 
A 1 253 VAL 253 252 252 VAL VAL A . n 
A 1 254 LYS 254 253 253 LYS LYS A . n 
A 1 255 GLU 255 254 254 GLU GLU A . n 
A 1 256 PHE 256 255 255 PHE PHE A . n 
A 1 257 GLY 257 256 256 GLY GLY A . n 
A 1 258 ILE 258 257 257 ILE ILE A . n 
A 1 259 ASP 259 258 258 ASP ASP A . n 
A 1 260 PRO 260 259 259 PRO PRO A . n 
A 1 261 GLN 261 260 260 GLN GLN A . n 
A 1 262 ASN 262 261 261 ASN ASN A . n 
A 1 263 MET 263 262 262 MET MET A . n 
A 1 264 LEU 264 263 263 LEU LEU A . n 
A 1 265 GLU 265 264 264 GLU GLU A . n 
A 1 266 PHE 266 265 265 PHE PHE A . n 
A 1 267 TRP 267 266 266 TRP TRP A . n 
A 1 268 ASP 268 267 267 ASP ASP A . n 
A 1 269 TRP 269 268 268 TRP TRP A . n 
A 1 270 VAL 270 269 269 VAL VAL A . n 
A 1 271 GLY 271 270 270 GLY GLY A . n 
A 1 272 GLY 272 271 271 GLY GLY A . n 
A 1 273 ARG 273 272 272 ARG ARG A . n 
A 1 274 TYR 274 273 273 TYR TYR A . n 
A 1 275 SER 275 274 274 SER SER A . n 
A 1 276 LEU 276 275 275 LEU LEU A . n 
A 1 277 TRP 277 276 276 TRP TRP A . n 
A 1 278 SER 278 277 277 SER SER A . n 
A 1 279 ALA 279 278 278 ALA ALA A . n 
A 1 280 ILE 280 279 279 ILE ILE A . n 
A 1 281 GLY 281 280 280 GLY GLY A . n 
A 1 282 LEU 282 281 281 LEU LEU A . n 
A 1 283 SER 283 282 282 SER SER A . n 
A 1 284 ILE 284 283 283 ILE ILE A . n 
A 1 285 ALA 285 284 284 ALA ALA A . n 
A 1 286 LEU 286 285 285 LEU LEU A . n 
A 1 287 HIS 287 286 286 HIS HIS A . n 
A 1 288 VAL 288 287 287 VAL VAL A . n 
A 1 289 GLY 289 288 288 GLY GLY A . n 
A 1 290 PHE 290 289 289 PHE PHE A . n 
A 1 291 ASP 291 290 290 ASP ASP A . n 
A 1 292 HIS 292 291 291 HIS HIS A . n 
A 1 293 PHE 293 292 292 PHE PHE A . n 
A 1 294 GLU 294 293 293 GLU GLU A . n 
A 1 295 GLN 295 294 294 GLN GLN A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 LEU 297 296 296 LEU LEU A . n 
A 1 298 SER 298 297 297 SER SER A . n 
A 1 299 GLY 299 298 298 GLY GLY A . n 
A 1 300 ALA 300 299 299 ALA ALA A . n 
A 1 301 HIS 301 300 300 HIS HIS A . n 
A 1 302 TRP 302 301 301 TRP TRP A . n 
A 1 303 MET 303 302 302 MET MET A . n 
A 1 304 ASP 304 303 303 ASP ASP A . n 
A 1 305 GLN 305 304 304 GLN GLN A . n 
A 1 306 HIS 306 305 305 HIS HIS A . n 
A 1 307 PHE 307 306 306 PHE PHE A . n 
A 1 308 LEU 308 307 307 LEU LEU A . n 
A 1 309 LYS 309 308 308 LYS LYS A . n 
A 1 310 THR 310 309 309 THR THR A . n 
A 1 311 PRO 311 310 310 PRO PRO A . n 
A 1 312 LEU 312 311 311 LEU LEU A . n 
A 1 313 GLU 313 312 312 GLU GLU A . n 
A 1 314 LYS 314 313 313 LYS LYS A . n 
A 1 315 ASN 315 314 314 ASN ASN A . n 
A 1 316 ALA 316 315 315 ALA ALA A . n 
A 1 317 PRO 317 316 316 PRO PRO A . n 
A 1 318 VAL 318 317 317 VAL VAL A . n 
A 1 319 LEU 319 318 318 LEU LEU A . n 
A 1 320 LEU 320 319 319 LEU LEU A . n 
A 1 321 ALA 321 320 320 ALA ALA A . n 
A 1 322 LEU 322 321 321 LEU LEU A . n 
A 1 323 LEU 323 322 322 LEU LEU A . n 
A 1 324 GLY 324 323 323 GLY GLY A . n 
A 1 325 ILE 325 324 324 ILE ILE A . n 
A 1 326 TRP 326 325 325 TRP TRP A . n 
A 1 327 TYR 327 326 326 TYR TYR A . n 
A 1 328 ILE 328 327 327 ILE ILE A . n 
A 1 329 ASN 329 328 328 ASN ASN A . n 
A 1 330 CYS 330 329 329 CYS CYS A . n 
A 1 331 TYR 331 330 330 TYR TYR A . n 
A 1 332 GLY 332 331 331 GLY GLY A . n 
A 1 333 CYS 333 332 332 CYS CYS A . n 
A 1 334 GLU 334 333 333 GLU GLU A . n 
A 1 335 THR 335 334 334 THR THR A . n 
A 1 336 HIS 336 335 335 HIS HIS A . n 
A 1 337 ALA 337 336 336 ALA ALA A . n 
A 1 338 LEU 338 337 337 LEU LEU A . n 
A 1 339 LEU 339 338 338 LEU LEU A . n 
A 1 340 PRO 340 339 339 PRO PRO A . n 
A 1 341 TYR 341 340 340 TYR TYR A . n 
A 1 342 ASP 342 341 341 ASP ASP A . n 
A 1 343 GLN 343 342 342 GLN GLN A . n 
A 1 344 TYR 344 343 343 TYR TYR A . n 
A 1 345 MET 345 344 344 MET MET A . n 
A 1 346 HIS 346 345 345 HIS HIS A . n 
A 1 347 ARG 347 346 346 ARG ARG A . n 
A 1 348 PHE 348 347 347 PHE PHE A . n 
A 1 349 ALA 349 348 348 ALA ALA A . n 
A 1 350 ALA 350 349 349 ALA ALA A . n 
A 1 351 TYR 351 350 350 TYR TYR A . n 
A 1 352 PHE 352 351 351 PHE PHE A . n 
A 1 353 GLN 353 352 352 GLN GLN A . n 
A 1 354 GLN 354 353 353 GLN GLN A . n 
A 1 355 GLY 355 354 354 GLY GLY A . n 
A 1 356 ASP 356 355 355 ASP ASP A . n 
A 1 357 MET 357 356 356 MET MET A . n 
A 1 358 GLU 358 357 357 GLU GLU A . n 
A 1 359 SER 359 358 358 SER SER A . n 
A 1 360 ASN 360 359 359 ASN ASN A . n 
A 1 361 GLY 361 360 360 GLY GLY A . n 
A 1 362 LYS 362 361 361 LYS LYS A . n 
A 1 363 TYR 363 362 362 TYR TYR A . n 
A 1 364 ILE 364 363 363 ILE ILE A . n 
A 1 365 THR 365 364 364 THR THR A . n 
A 1 366 LYS 366 365 365 LYS LYS A . n 
A 1 367 SER 367 366 366 SER SER A . n 
A 1 368 GLY 368 367 367 GLY GLY A . n 
A 1 369 ALA 369 368 368 ALA ALA A . n 
A 1 370 ARG 370 369 369 ARG ARG A . n 
A 1 371 VAL 371 370 370 VAL VAL A . n 
A 1 372 ASP 372 371 371 ASP ASP A . n 
A 1 373 HIS 373 372 372 HIS HIS A . n 
A 1 374 GLN 374 373 373 GLN GLN A . n 
A 1 375 THR 375 374 374 THR THR A . n 
A 1 376 GLY 376 375 375 GLY GLY A . n 
A 1 377 PRO 377 376 376 PRO PRO A . n 
A 1 378 ILE 378 377 377 ILE ILE A . n 
A 1 379 VAL 379 378 378 VAL VAL A . n 
A 1 380 TRP 380 379 379 TRP TRP A . n 
A 1 381 GLY 381 380 380 GLY GLY A . n 
A 1 382 GLU 382 381 381 GLU GLU A . n 
A 1 383 PRO 383 382 382 PRO PRO A . n 
A 1 384 GLY 384 383 383 GLY GLY A . n 
A 1 385 THR 385 384 384 THR THR A . n 
A 1 386 ASN 386 385 385 ASN ASN A . n 
A 1 387 GLY 387 386 386 GLY GLY A . n 
A 1 388 GLN 388 387 387 GLN GLN A . n 
A 1 389 HIS 389 388 388 HIS HIS A . n 
A 1 390 ALA 390 389 389 ALA ALA A . n 
A 1 391 PHE 391 390 390 PHE PHE A . n 
A 1 392 TYR 392 391 391 TYR TYR A . n 
A 1 393 GLN 393 392 392 GLN GLN A . n 
A 1 394 LEU 394 393 393 LEU LEU A . n 
A 1 395 ILE 395 394 394 ILE ILE A . n 
A 1 396 HIS 396 395 395 HIS HIS A . n 
A 1 397 GLN 397 396 396 GLN GLN A . n 
A 1 398 GLY 398 397 397 GLY GLY A . n 
A 1 399 THR 399 398 398 THR THR A . n 
A 1 400 LYS 400 399 399 LYS LYS A . n 
A 1 401 MET 401 400 400 MET MET A . n 
A 1 402 ILE 402 401 401 ILE ILE A . n 
A 1 403 PRO 403 402 402 PRO PRO A . n 
A 1 404 CYS 404 403 403 CYS CYS A . n 
A 1 405 ASP 405 404 404 ASP ASP A . n 
A 1 406 PHE 406 405 405 PHE PHE A . n 
A 1 407 LEU 407 406 406 LEU LEU A . n 
A 1 408 ILE 408 407 407 ILE ILE A . n 
A 1 409 PRO 409 408 408 PRO PRO A . n 
A 1 410 VAL 410 409 409 VAL VAL A . n 
A 1 411 GLN 411 410 410 GLN GLN A . n 
A 1 412 THR 412 411 411 THR THR A . n 
A 1 413 GLN 413 412 412 GLN GLN A . n 
A 1 414 HIS 414 413 413 HIS HIS A . n 
A 1 415 PRO 415 414 414 PRO PRO A . n 
A 1 416 ILE 416 415 415 ILE ILE A . n 
A 1 417 ARG 417 416 416 ARG ARG A . n 
A 1 418 LYS 418 417 417 LYS LYS A . n 
A 1 419 GLY 419 418 418 GLY GLY A . n 
A 1 420 LEU 420 419 419 LEU LEU A . n 
A 1 421 HIS 421 420 420 HIS HIS A . n 
A 1 422 HIS 422 421 421 HIS HIS A . n 
A 1 423 LYS 423 422 422 LYS LYS A . n 
A 1 424 ILE 424 423 423 ILE ILE A . n 
A 1 425 LEU 425 424 424 LEU LEU A . n 
A 1 426 LEU 426 425 425 LEU LEU A . n 
A 1 427 ALA 427 426 426 ALA ALA A . n 
A 1 428 ASN 428 427 427 ASN ASN A . n 
A 1 429 PHE 429 428 428 PHE PHE A . n 
A 1 430 LEU 430 429 429 LEU LEU A . n 
A 1 431 ALA 431 430 430 ALA ALA A . n 
A 1 432 GLN 432 431 431 GLN GLN A . n 
A 1 433 THR 433 432 432 THR THR A . n 
A 1 434 GLU 434 433 433 GLU GLU A . n 
A 1 435 ALA 435 434 434 ALA ALA A . n 
A 1 436 LEU 436 435 435 LEU LEU A . n 
A 1 437 MET 437 436 436 MET MET A . n 
A 1 438 LYS 438 437 437 LYS LYS A . n 
A 1 439 GLY 439 438 438 GLY GLY A . n 
A 1 440 LYS 440 439 439 LYS LYS A . n 
A 1 441 LEU 441 440 440 LEU LEU A . n 
A 1 442 PRO 442 441 441 PRO PRO A . n 
A 1 443 GLU 443 442 442 GLU GLU A . n 
A 1 444 GLU 444 443 443 GLU GLU A . n 
A 1 445 ALA 445 444 444 ALA ALA A . n 
A 1 446 ARG 446 445 445 ARG ARG A . n 
A 1 447 LYS 447 446 446 LYS LYS A . n 
A 1 448 GLU 448 447 447 GLU GLU A . n 
A 1 449 LEU 449 448 448 LEU LEU A . n 
A 1 450 GLN 450 449 449 GLN GLN A . n 
A 1 451 ALA 451 450 450 ALA ALA A . n 
A 1 452 ALA 452 451 451 ALA ALA A . n 
A 1 453 GLY 453 452 452 GLY GLY A . n 
A 1 454 LYS 454 453 453 LYS LYS A . n 
A 1 455 SER 455 454 454 SER SER A . n 
A 1 456 PRO 456 455 455 PRO PRO A . n 
A 1 457 GLU 457 456 456 GLU GLU A . n 
A 1 458 ASP 458 457 457 ASP ASP A . n 
A 1 459 LEU 459 458 458 LEU LEU A . n 
A 1 460 GLU 460 459 459 GLU GLU A . n 
A 1 461 LYS 461 460 460 LYS LYS A . n 
A 1 462 LEU 462 461 461 LEU LEU A . n 
A 1 463 LEU 463 462 462 LEU LEU A . n 
A 1 464 PRO 464 463 463 PRO PRO A . n 
A 1 465 HIS 465 464 464 HIS HIS A . n 
A 1 466 LYS 466 465 465 LYS LYS A . n 
A 1 467 VAL 467 466 466 VAL VAL A . n 
A 1 468 PHE 468 467 467 PHE PHE A . n 
A 1 469 GLU 469 468 468 GLU GLU A . n 
A 1 470 GLY 470 469 469 GLY GLY A . n 
A 1 471 ASN 471 470 470 ASN ASN A . n 
A 1 472 ARG 472 471 471 ARG ARG A . n 
A 1 473 PRO 473 472 472 PRO PRO A . n 
A 1 474 THR 474 473 473 THR THR A . n 
A 1 475 ASN 475 474 474 ASN ASN A . n 
A 1 476 SER 476 475 475 SER SER A . n 
A 1 477 ILE 477 476 476 ILE ILE A . n 
A 1 478 VAL 478 477 477 VAL VAL A . n 
A 1 479 PHE 479 478 478 PHE PHE A . n 
A 1 480 THR 480 479 479 THR THR A . n 
A 1 481 LYS 481 480 480 LYS LYS A . n 
A 1 482 LEU 482 481 481 LEU LEU A . n 
A 1 483 THR 483 482 482 THR THR A . n 
A 1 484 PRO 484 483 483 PRO PRO A . n 
A 1 485 PHE 485 484 484 PHE PHE A . n 
A 1 486 ILE 486 485 485 ILE ILE A . n 
A 1 487 LEU 487 486 486 LEU LEU A . n 
A 1 488 GLY 488 487 487 GLY GLY A . n 
A 1 489 ALA 489 488 488 ALA ALA A . n 
A 1 490 LEU 490 489 489 LEU LEU A . n 
A 1 491 ILE 491 490 490 ILE ILE A . n 
A 1 492 ALA 492 491 491 ALA ALA A . n 
A 1 493 MET 493 492 492 MET MET A . n 
A 1 494 TYR 494 493 493 TYR TYR A . n 
A 1 495 GLU 495 494 494 GLU GLU A . n 
A 1 496 HIS 496 495 495 HIS HIS A . n 
A 1 497 LYS 497 496 496 LYS LYS A . n 
A 1 498 ILE 498 497 497 ILE ILE A . n 
A 1 499 PHE 499 498 498 PHE PHE A . n 
A 1 500 VAL 500 499 499 VAL VAL A . n 
A 1 501 GLN 501 500 500 GLN GLN A . n 
A 1 502 GLY 502 501 501 GLY GLY A . n 
A 1 503 ILE 503 502 502 ILE ILE A . n 
A 1 504 MET 504 503 503 MET MET A . n 
A 1 505 TRP 505 504 504 TRP TRP A . n 
A 1 506 ASP 506 505 505 ASP ASP A . n 
A 1 507 ILE 507 506 506 ILE ILE A . n 
A 1 508 ASN 508 507 507 ASN ASN A . n 
A 1 509 SER 509 508 508 SER SER A . n 
A 1 510 PHE 510 509 509 PHE PHE A . n 
A 1 511 ASP 511 510 510 ASP ASP A . n 
A 1 512 GLN 512 511 511 GLN GLN A . n 
A 1 513 TRP 513 512 512 TRP TRP A . n 
A 1 514 GLY 514 513 513 GLY GLY A . n 
A 1 515 VAL 515 514 514 VAL VAL A . n 
A 1 516 GLU 516 515 515 GLU GLU A . n 
A 1 517 LEU 517 516 516 LEU LEU A . n 
A 1 518 GLY 518 517 517 GLY GLY A . n 
A 1 519 LYS 519 518 518 LYS LYS A . n 
A 1 520 GLN 520 519 519 GLN GLN A . n 
A 1 521 LEU 521 520 520 LEU LEU A . n 
A 1 522 ALA 522 521 521 ALA ALA A . n 
A 1 523 LYS 523 522 522 LYS LYS A . n 
A 1 524 LYS 524 523 523 LYS LYS A . n 
A 1 525 ILE 525 524 524 ILE ILE A . n 
A 1 526 GLU 526 525 525 GLU GLU A . n 
A 1 527 PRO 527 526 526 PRO PRO A . n 
A 1 528 GLU 528 527 527 GLU GLU A . n 
A 1 529 LEU 529 528 528 LEU LEU A . n 
A 1 530 GLU 530 529 529 GLU GLU A . n 
A 1 531 GLY 531 530 530 GLY GLY A . n 
A 1 532 SER 532 531 531 SER SER A . n 
A 1 533 SER 533 532 532 SER SER A . n 
A 1 534 ALA 534 533 533 ALA ALA A . n 
A 1 535 VAL 535 534 534 VAL VAL A . n 
A 1 536 THR 536 535 535 THR THR A . n 
A 1 537 SER 537 536 536 SER SER A . n 
A 1 538 HIS 538 537 537 HIS HIS A . n 
A 1 539 ASP 539 538 538 ASP ASP A . n 
A 1 540 SER 540 539 539 SER SER A . n 
A 1 541 SER 541 540 540 SER SER A . n 
A 1 542 THR 542 541 541 THR THR A . n 
A 1 543 ASN 543 542 542 ASN ASN A . n 
A 1 544 GLY 544 543 543 GLY GLY A . n 
A 1 545 LEU 545 544 544 LEU LEU A . n 
A 1 546 ILE 546 545 545 ILE ILE A . n 
A 1 547 SER 547 546 546 SER SER A . n 
A 1 548 PHE 548 547 547 PHE PHE A . n 
A 1 549 ILE 549 548 548 ILE ILE A . n 
A 1 550 LYS 550 549 549 LYS LYS A . n 
A 1 551 GLN 551 550 550 GLN GLN A . n 
A 1 552 GLN 552 551 551 GLN GLN A . n 
A 1 553 ARG 553 552 552 ARG ARG A . n 
A 1 554 ASP 554 553 553 ASP ASP A . n 
A 1 555 THR 555 554 554 THR THR A . n 
A 1 556 LYS 556 555 555 LYS LYS A . n 
A 1 557 LEU 557 556 556 LEU LEU A . n 
A 1 558 GLU 558 557 ?   ?   ?   A . n 
A 1 559 HIS 559 558 ?   ?   ?   A . n 
A 1 560 HIS 560 559 ?   ?   ?   A . n 
A 1 561 HIS 561 560 ?   ?   ?   A . n 
A 1 562 HIS 562 561 ?   ?   ?   A . n 
A 1 563 HIS 563 562 ?   ?   ?   A . n 
A 1 564 HIS 564 563 ?   ?   ?   A . n 
B 1 1   MET 1   0   ?   ?   ?   B . n 
B 1 2   ALA 2   1   1   ALA ALA B . n 
B 1 3   ALA 3   2   2   ALA ALA B . n 
B 1 4   LEU 4   3   3   LEU LEU B . n 
B 1 5   THR 5   4   4   THR THR B . n 
B 1 6   ARG 6   5   5   ARG ARG B . n 
B 1 7   ASN 7   6   6   ASN ASN B . n 
B 1 8   PRO 8   7   7   PRO PRO B . n 
B 1 9   GLN 9   8   8   GLN GLN B . n 
B 1 10  PHE 10  9   9   PHE PHE B . n 
B 1 11  GLN 11  10  10  GLN GLN B . n 
B 1 12  LYS 12  11  11  LYS LYS B . n 
B 1 13  LEU 13  12  12  LEU LEU B . n 
B 1 14  LEU 14  13  13  LEU LEU B . n 
B 1 15  GLU 15  14  14  GLU GLU B . n 
B 1 16  TRP 16  15  15  TRP TRP B . n 
B 1 17  HIS 17  16  16  HIS HIS B . n 
B 1 18  ARG 18  17  17  ARG ARG B . n 
B 1 19  ALA 19  18  18  ALA ALA B . n 
B 1 20  ASN 20  19  19  ASN ASN B . n 
B 1 21  SER 21  20  20  SER SER B . n 
B 1 22  ALA 22  21  21  ALA ALA B . n 
B 1 23  ASN 23  22  22  ASN ASN B . n 
B 1 24  LEU 24  23  23  LEU LEU B . n 
B 1 25  LYS 25  24  24  LYS LYS B . n 
B 1 26  LEU 26  25  25  LEU LEU B . n 
B 1 27  ARG 27  26  26  ARG ARG B . n 
B 1 28  GLU 28  27  27  GLU GLU B . n 
B 1 29  LEU 29  28  28  LEU LEU B . n 
B 1 30  PHE 30  29  29  PHE PHE B . n 
B 1 31  GLU 31  30  30  GLU GLU B . n 
B 1 32  ALA 32  31  31  ALA ALA B . n 
B 1 33  ASP 33  32  32  ASP ASP B . n 
B 1 34  PRO 34  33  33  PRO PRO B . n 
B 1 35  GLU 35  34  34  GLU GLU B . n 
B 1 36  ARG 36  35  35  ARG ARG B . n 
B 1 37  PHE 37  36  36  PHE PHE B . n 
B 1 38  ASN 38  37  37  ASN ASN B . n 
B 1 39  ASN 39  38  38  ASN ASN B . n 
B 1 40  PHE 40  39  39  PHE PHE B . n 
B 1 41  SER 41  40  40  SER SER B . n 
B 1 42  LEU 42  41  41  LEU LEU B . n 
B 1 43  ASN 43  42  42  ASN ASN B . n 
B 1 44  LEU 44  43  43  LEU LEU B . n 
B 1 45  ASN 45  44  44  ASN ASN B . n 
B 1 46  THR 46  45  45  THR THR B . n 
B 1 47  ASN 47  46  46  ASN ASN B . n 
B 1 48  HIS 48  47  47  HIS HIS B . n 
B 1 49  GLY 49  48  48  GLY GLY B . n 
B 1 50  HIS 50  49  49  HIS HIS B . n 
B 1 51  ILE 51  50  50  ILE ILE B . n 
B 1 52  LEU 52  51  51  LEU LEU B . n 
B 1 53  VAL 53  52  52  VAL VAL B . n 
B 1 54  ASP 54  53  53  ASP ASP B . n 
B 1 55  TYR 55  54  54  TYR TYR B . n 
B 1 56  SER 56  55  55  SER SER B . n 
B 1 57  LYS 57  56  56  LYS LYS B . n 
B 1 58  ASN 58  57  57  ASN ASN B . n 
B 1 59  LEU 59  58  58  LEU LEU B . n 
B 1 60  VAL 60  59  59  VAL VAL B . n 
B 1 61  ASN 61  60  60  ASN ASN B . n 
B 1 62  LYS 62  61  61  LYS LYS B . n 
B 1 63  GLU 63  62  62  GLU GLU B . n 
B 1 64  VAL 64  63  63  VAL VAL B . n 
B 1 65  MET 65  64  64  MET MET B . n 
B 1 66  GLN 66  65  65  GLN GLN B . n 
B 1 67  MET 67  66  66  MET MET B . n 
B 1 68  LEU 68  67  67  LEU LEU B . n 
B 1 69  VAL 69  68  68  VAL VAL B . n 
B 1 70  GLU 70  69  69  GLU GLU B . n 
B 1 71  LEU 71  70  70  LEU LEU B . n 
B 1 72  ALA 72  71  71  ALA ALA B . n 
B 1 73  LYS 73  72  72  LYS LYS B . n 
B 1 74  SER 74  73  73  SER SER B . n 
B 1 75  ARG 75  74  74  ARG ARG B . n 
B 1 76  GLY 76  75  75  GLY GLY B . n 
B 1 77  VAL 77  76  76  VAL VAL B . n 
B 1 78  GLU 78  77  77  GLU GLU B . n 
B 1 79  ALA 79  78  78  ALA ALA B . n 
B 1 80  ALA 80  79  79  ALA ALA B . n 
B 1 81  ARG 81  80  80  ARG ARG B . n 
B 1 82  ASP 82  81  81  ASP ASP B . n 
B 1 83  ASN 83  82  82  ASN ASN B . n 
B 1 84  MET 84  83  83  MET MET B . n 
B 1 85  PHE 85  84  84  PHE PHE B . n 
B 1 86  SER 86  85  85  SER SER B . n 
B 1 87  GLY 87  86  86  GLY GLY B . n 
B 1 88  SER 88  87  87  SER SER B . n 
B 1 89  LYS 89  88  88  LYS LYS B . n 
B 1 90  ILE 90  89  89  ILE ILE B . n 
B 1 91  ASN 91  90  90  ASN ASN B . n 
B 1 92  TYR 92  91  91  TYR TYR B . n 
B 1 93  THR 93  92  92  THR THR B . n 
B 1 94  GLU 94  93  93  GLU GLU B . n 
B 1 95  ASP 95  94  94  ASP ASP B . n 
B 1 96  ARG 96  95  95  ARG ARG B . n 
B 1 97  ALA 97  96  96  ALA ALA B . n 
B 1 98  VAL 98  97  97  VAL VAL B . n 
B 1 99  LEU 99  98  98  LEU LEU B . n 
B 1 100 HIS 100 99  99  HIS HIS B . n 
B 1 101 VAL 101 100 100 VAL VAL B . n 
B 1 102 ALA 102 101 101 ALA ALA B . n 
B 1 103 LEU 103 102 102 LEU LEU B . n 
B 1 104 ARG 104 103 103 ARG ARG B . n 
B 1 105 ASN 105 104 104 ASN ASN B . n 
B 1 106 ARG 106 105 105 ARG ARG B . n 
B 1 107 SER 107 106 106 SER SER B . n 
B 1 108 ASN 108 107 107 ASN ASN B . n 
B 1 109 THR 109 108 108 THR THR B . n 
B 1 110 PRO 110 109 109 PRO PRO B . n 
B 1 111 ILE 111 110 110 ILE ILE B . n 
B 1 112 LYS 112 111 111 LYS LYS B . n 
B 1 113 VAL 113 112 112 VAL VAL B . n 
B 1 114 ASP 114 113 113 ASP ASP B . n 
B 1 115 GLY 115 114 114 GLY GLY B . n 
B 1 116 LYS 116 115 115 LYS LYS B . n 
B 1 117 ASP 117 116 116 ASP ASP B . n 
B 1 118 VAL 118 117 117 VAL VAL B . n 
B 1 119 MET 119 118 118 MET MET B . n 
B 1 120 PRO 120 119 119 PRO PRO B . n 
B 1 121 GLU 121 120 120 GLU GLU B . n 
B 1 122 VAL 122 121 121 VAL VAL B . n 
B 1 123 ASN 123 122 122 ASN ASN B . n 
B 1 124 ARG 124 123 123 ARG ARG B . n 
B 1 125 VAL 125 124 124 VAL VAL B . n 
B 1 126 LEU 126 125 125 LEU LEU B . n 
B 1 127 ASP 127 126 126 ASP ASP B . n 
B 1 128 LYS 128 127 127 LYS LYS B . n 
B 1 129 MET 129 128 128 MET MET B . n 
B 1 130 LYS 130 129 129 LYS LYS B . n 
B 1 131 SER 131 130 130 SER SER B . n 
B 1 132 PHE 132 131 131 PHE PHE B . n 
B 1 133 CYS 133 132 132 CYS CYS B . n 
B 1 134 GLN 134 133 133 GLN GLN B . n 
B 1 135 ARG 135 134 134 ARG ARG B . n 
B 1 136 VAL 136 135 135 VAL VAL B . n 
B 1 137 ARG 137 136 136 ARG ARG B . n 
B 1 138 SER 138 137 137 SER SER B . n 
B 1 139 GLY 139 138 138 GLY GLY B . n 
B 1 140 ASP 140 139 139 ASP ASP B . n 
B 1 141 TRP 141 140 140 TRP TRP B . n 
B 1 142 LYS 142 141 141 LYS LYS B . n 
B 1 143 GLY 143 142 142 GLY GLY B . n 
B 1 144 TYR 144 143 143 TYR TYR B . n 
B 1 145 THR 145 144 144 THR THR B . n 
B 1 146 GLY 146 145 145 GLY GLY B . n 
B 1 147 LYS 147 146 146 LYS LYS B . n 
B 1 148 SER 148 147 147 SER SER B . n 
B 1 149 ILE 149 148 148 ILE ILE B . n 
B 1 150 THR 150 149 149 THR THR B . n 
B 1 151 ASP 151 150 150 ASP ASP B . n 
B 1 152 ILE 152 151 151 ILE ILE B . n 
B 1 153 ILE 153 152 152 ILE ILE B . n 
B 1 154 ASN 154 153 153 ASN ASN B . n 
B 1 155 ILE 155 154 154 ILE ILE B . n 
B 1 156 GLY 156 155 155 GLY GLY B . n 
B 1 157 ILE 157 156 156 ILE ILE B . n 
B 1 158 GLY 158 157 157 GLY GLY B . n 
B 1 159 GLY 159 158 158 GLY GLY B . n 
B 1 160 SER 160 159 159 SER SER B . n 
B 1 161 ASP 161 160 160 ASP ASP B . n 
B 1 162 LEU 162 161 161 LEU LEU B . n 
B 1 163 GLY 163 162 162 GLY GLY B . n 
B 1 164 PRO 164 163 163 PRO PRO B . n 
B 1 165 LEU 165 164 164 LEU LEU B . n 
B 1 166 MET 166 165 165 MET MET B . n 
B 1 167 VAL 167 166 166 VAL VAL B . n 
B 1 168 THR 168 167 167 THR THR B . n 
B 1 169 GLU 169 168 168 GLU GLU B . n 
B 1 170 ALA 170 169 169 ALA ALA B . n 
B 1 171 LEU 171 170 170 LEU LEU B . n 
B 1 172 LYS 172 171 171 LYS LYS B . n 
B 1 173 PRO 173 172 172 PRO PRO B . n 
B 1 174 TYR 174 173 173 TYR TYR B . n 
B 1 175 SER 175 174 174 SER SER B . n 
B 1 176 LYS 176 175 175 LYS LYS B . n 
B 1 177 GLY 177 176 176 GLY GLY B . n 
B 1 178 GLY 178 177 177 GLY GLY B . n 
B 1 179 PRO 179 178 178 PRO PRO B . n 
B 1 180 ARG 180 179 179 ARG ARG B . n 
B 1 181 VAL 181 180 180 VAL VAL B . n 
B 1 182 TRP 182 181 181 TRP TRP B . n 
B 1 183 PHE 183 182 182 PHE PHE B . n 
B 1 184 VAL 184 183 183 VAL VAL B . n 
B 1 185 SER 185 184 184 SER SER B . n 
B 1 186 ASN 186 185 185 ASN ASN B . n 
B 1 187 ILE 187 186 186 ILE ILE B . n 
B 1 188 ASP 188 187 187 ASP ASP B . n 
B 1 189 GLY 189 188 188 GLY GLY B . n 
B 1 190 THR 190 189 189 THR THR B . n 
B 1 191 HIS 191 190 190 HIS HIS B . n 
B 1 192 ILE 192 191 191 ILE ILE B . n 
B 1 193 ALA 193 192 192 ALA ALA B . n 
B 1 194 LYS 194 193 193 LYS LYS B . n 
B 1 195 THR 195 194 194 THR THR B . n 
B 1 196 LEU 196 195 195 LEU LEU B . n 
B 1 197 ALA 197 196 196 ALA ALA B . n 
B 1 198 SER 198 197 197 SER SER B . n 
B 1 199 LEU 199 198 198 LEU LEU B . n 
B 1 200 SER 200 199 199 SER SER B . n 
B 1 201 PRO 201 200 200 PRO PRO B . n 
B 1 202 GLU 202 201 201 GLU GLU B . n 
B 1 203 THR 203 202 202 THR THR B . n 
B 1 204 SER 204 203 203 SER SER B . n 
B 1 205 LEU 205 204 204 LEU LEU B . n 
B 1 206 PHE 206 205 205 PHE PHE B . n 
B 1 207 ILE 207 206 206 ILE ILE B . n 
B 1 208 ILE 208 207 207 ILE ILE B . n 
B 1 209 ALA 209 208 208 ALA ALA B . n 
B 1 210 SER 210 209 209 SER SER B . n 
B 1 211 LYS 211 210 210 LYS LYS B . n 
B 1 212 THR 212 211 211 THR THR B . n 
B 1 213 PHE 213 212 212 PHE PHE B . n 
B 1 214 THR 214 213 213 THR THR B . n 
B 1 215 THR 215 214 214 THR THR B . n 
B 1 216 GLN 216 215 215 GLN GLN B . n 
B 1 217 GLU 217 216 216 GLU GLU B . n 
B 1 218 THR 218 217 217 THR THR B . n 
B 1 219 ILE 219 218 218 ILE ILE B . n 
B 1 220 THR 220 219 219 THR THR B . n 
B 1 221 ASN 221 220 220 ASN ASN B . n 
B 1 222 ALA 222 221 221 ALA ALA B . n 
B 1 223 GLU 223 222 222 GLU GLU B . n 
B 1 224 THR 224 223 223 THR THR B . n 
B 1 225 ALA 225 224 224 ALA ALA B . n 
B 1 226 LYS 226 225 225 LYS LYS B . n 
B 1 227 GLU 227 226 226 GLU GLU B . n 
B 1 228 TRP 228 227 227 TRP TRP B . n 
B 1 229 PHE 229 228 228 PHE PHE B . n 
B 1 230 LEU 230 229 229 LEU LEU B . n 
B 1 231 GLU 231 230 230 GLU GLU B . n 
B 1 232 ALA 232 231 231 ALA ALA B . n 
B 1 233 ALA 233 232 232 ALA ALA B . n 
B 1 234 LYS 234 233 233 LYS LYS B . n 
B 1 235 ASP 235 234 234 ASP ASP B . n 
B 1 236 PRO 236 235 235 PRO PRO B . n 
B 1 237 SER 237 236 236 SER SER B . n 
B 1 238 ALA 238 237 237 ALA ALA B . n 
B 1 239 VAL 239 238 238 VAL VAL B . n 
B 1 240 ALA 240 239 239 ALA ALA B . n 
B 1 241 LYS 241 240 240 LYS LYS B . n 
B 1 242 HIS 242 241 241 HIS HIS B . n 
B 1 243 PHE 243 242 242 PHE PHE B . n 
B 1 244 VAL 244 243 243 VAL VAL B . n 
B 1 245 ALA 245 244 244 ALA ALA B . n 
B 1 246 LEU 246 245 245 LEU LEU B . n 
B 1 247 SER 247 246 246 SER SER B . n 
B 1 248 THR 248 247 247 THR THR B . n 
B 1 249 ASN 249 248 248 ASN ASN B . n 
B 1 250 THR 250 249 249 THR THR B . n 
B 1 251 ALA 251 250 250 ALA ALA B . n 
B 1 252 LYS 252 251 251 LYS LYS B . n 
B 1 253 VAL 253 252 252 VAL VAL B . n 
B 1 254 LYS 254 253 253 LYS LYS B . n 
B 1 255 GLU 255 254 254 GLU GLU B . n 
B 1 256 PHE 256 255 255 PHE PHE B . n 
B 1 257 GLY 257 256 256 GLY GLY B . n 
B 1 258 ILE 258 257 257 ILE ILE B . n 
B 1 259 ASP 259 258 258 ASP ASP B . n 
B 1 260 PRO 260 259 259 PRO PRO B . n 
B 1 261 GLN 261 260 260 GLN GLN B . n 
B 1 262 ASN 262 261 261 ASN ASN B . n 
B 1 263 MET 263 262 262 MET MET B . n 
B 1 264 LEU 264 263 263 LEU LEU B . n 
B 1 265 GLU 265 264 264 GLU GLU B . n 
B 1 266 PHE 266 265 265 PHE PHE B . n 
B 1 267 TRP 267 266 266 TRP TRP B . n 
B 1 268 ASP 268 267 267 ASP ASP B . n 
B 1 269 TRP 269 268 268 TRP TRP B . n 
B 1 270 VAL 270 269 269 VAL VAL B . n 
B 1 271 GLY 271 270 270 GLY GLY B . n 
B 1 272 GLY 272 271 271 GLY GLY B . n 
B 1 273 ARG 273 272 272 ARG ARG B . n 
B 1 274 TYR 274 273 273 TYR TYR B . n 
B 1 275 SER 275 274 274 SER SER B . n 
B 1 276 LEU 276 275 275 LEU LEU B . n 
B 1 277 TRP 277 276 276 TRP TRP B . n 
B 1 278 SER 278 277 277 SER SER B . n 
B 1 279 ALA 279 278 278 ALA ALA B . n 
B 1 280 ILE 280 279 279 ILE ILE B . n 
B 1 281 GLY 281 280 280 GLY GLY B . n 
B 1 282 LEU 282 281 281 LEU LEU B . n 
B 1 283 SER 283 282 282 SER SER B . n 
B 1 284 ILE 284 283 283 ILE ILE B . n 
B 1 285 ALA 285 284 284 ALA ALA B . n 
B 1 286 LEU 286 285 285 LEU LEU B . n 
B 1 287 HIS 287 286 286 HIS HIS B . n 
B 1 288 VAL 288 287 287 VAL VAL B . n 
B 1 289 GLY 289 288 288 GLY GLY B . n 
B 1 290 PHE 290 289 289 PHE PHE B . n 
B 1 291 ASP 291 290 290 ASP ASP B . n 
B 1 292 HIS 292 291 291 HIS HIS B . n 
B 1 293 PHE 293 292 292 PHE PHE B . n 
B 1 294 GLU 294 293 293 GLU GLU B . n 
B 1 295 GLN 295 294 294 GLN GLN B . n 
B 1 296 LEU 296 295 295 LEU LEU B . n 
B 1 297 LEU 297 296 296 LEU LEU B . n 
B 1 298 SER 298 297 297 SER SER B . n 
B 1 299 GLY 299 298 298 GLY GLY B . n 
B 1 300 ALA 300 299 299 ALA ALA B . n 
B 1 301 HIS 301 300 300 HIS HIS B . n 
B 1 302 TRP 302 301 301 TRP TRP B . n 
B 1 303 MET 303 302 302 MET MET B . n 
B 1 304 ASP 304 303 303 ASP ASP B . n 
B 1 305 GLN 305 304 304 GLN GLN B . n 
B 1 306 HIS 306 305 305 HIS HIS B . n 
B 1 307 PHE 307 306 306 PHE PHE B . n 
B 1 308 LEU 308 307 307 LEU LEU B . n 
B 1 309 LYS 309 308 308 LYS LYS B . n 
B 1 310 THR 310 309 309 THR THR B . n 
B 1 311 PRO 311 310 310 PRO PRO B . n 
B 1 312 LEU 312 311 311 LEU LEU B . n 
B 1 313 GLU 313 312 312 GLU GLU B . n 
B 1 314 LYS 314 313 313 LYS LYS B . n 
B 1 315 ASN 315 314 314 ASN ASN B . n 
B 1 316 ALA 316 315 315 ALA ALA B . n 
B 1 317 PRO 317 316 316 PRO PRO B . n 
B 1 318 VAL 318 317 317 VAL VAL B . n 
B 1 319 LEU 319 318 318 LEU LEU B . n 
B 1 320 LEU 320 319 319 LEU LEU B . n 
B 1 321 ALA 321 320 320 ALA ALA B . n 
B 1 322 LEU 322 321 321 LEU LEU B . n 
B 1 323 LEU 323 322 322 LEU LEU B . n 
B 1 324 GLY 324 323 323 GLY GLY B . n 
B 1 325 ILE 325 324 324 ILE ILE B . n 
B 1 326 TRP 326 325 325 TRP TRP B . n 
B 1 327 TYR 327 326 326 TYR TYR B . n 
B 1 328 ILE 328 327 327 ILE ILE B . n 
B 1 329 ASN 329 328 328 ASN ASN B . n 
B 1 330 CYS 330 329 329 CYS CYS B . n 
B 1 331 TYR 331 330 330 TYR TYR B . n 
B 1 332 GLY 332 331 331 GLY GLY B . n 
B 1 333 CYS 333 332 332 CYS CYS B . n 
B 1 334 GLU 334 333 333 GLU GLU B . n 
B 1 335 THR 335 334 334 THR THR B . n 
B 1 336 HIS 336 335 335 HIS HIS B . n 
B 1 337 ALA 337 336 336 ALA ALA B . n 
B 1 338 LEU 338 337 337 LEU LEU B . n 
B 1 339 LEU 339 338 338 LEU LEU B . n 
B 1 340 PRO 340 339 339 PRO PRO B . n 
B 1 341 TYR 341 340 340 TYR TYR B . n 
B 1 342 ASP 342 341 341 ASP ASP B . n 
B 1 343 GLN 343 342 342 GLN GLN B . n 
B 1 344 TYR 344 343 343 TYR TYR B . n 
B 1 345 MET 345 344 344 MET MET B . n 
B 1 346 HIS 346 345 345 HIS HIS B . n 
B 1 347 ARG 347 346 346 ARG ARG B . n 
B 1 348 PHE 348 347 347 PHE PHE B . n 
B 1 349 ALA 349 348 348 ALA ALA B . n 
B 1 350 ALA 350 349 349 ALA ALA B . n 
B 1 351 TYR 351 350 350 TYR TYR B . n 
B 1 352 PHE 352 351 351 PHE PHE B . n 
B 1 353 GLN 353 352 352 GLN GLN B . n 
B 1 354 GLN 354 353 353 GLN GLN B . n 
B 1 355 GLY 355 354 354 GLY GLY B . n 
B 1 356 ASP 356 355 355 ASP ASP B . n 
B 1 357 MET 357 356 356 MET MET B . n 
B 1 358 GLU 358 357 357 GLU GLU B . n 
B 1 359 SER 359 358 358 SER SER B . n 
B 1 360 ASN 360 359 359 ASN ASN B . n 
B 1 361 GLY 361 360 360 GLY GLY B . n 
B 1 362 LYS 362 361 361 LYS LYS B . n 
B 1 363 TYR 363 362 362 TYR TYR B . n 
B 1 364 ILE 364 363 363 ILE ILE B . n 
B 1 365 THR 365 364 364 THR THR B . n 
B 1 366 LYS 366 365 365 LYS LYS B . n 
B 1 367 SER 367 366 366 SER SER B . n 
B 1 368 GLY 368 367 367 GLY GLY B . n 
B 1 369 ALA 369 368 368 ALA ALA B . n 
B 1 370 ARG 370 369 369 ARG ARG B . n 
B 1 371 VAL 371 370 370 VAL VAL B . n 
B 1 372 ASP 372 371 371 ASP ASP B . n 
B 1 373 HIS 373 372 372 HIS HIS B . n 
B 1 374 GLN 374 373 373 GLN GLN B . n 
B 1 375 THR 375 374 374 THR THR B . n 
B 1 376 GLY 376 375 375 GLY GLY B . n 
B 1 377 PRO 377 376 376 PRO PRO B . n 
B 1 378 ILE 378 377 377 ILE ILE B . n 
B 1 379 VAL 379 378 378 VAL VAL B . n 
B 1 380 TRP 380 379 379 TRP TRP B . n 
B 1 381 GLY 381 380 380 GLY GLY B . n 
B 1 382 GLU 382 381 381 GLU GLU B . n 
B 1 383 PRO 383 382 382 PRO PRO B . n 
B 1 384 GLY 384 383 383 GLY GLY B . n 
B 1 385 THR 385 384 384 THR THR B . n 
B 1 386 ASN 386 385 385 ASN ASN B . n 
B 1 387 GLY 387 386 386 GLY GLY B . n 
B 1 388 GLN 388 387 387 GLN GLN B . n 
B 1 389 HIS 389 388 388 HIS HIS B . n 
B 1 390 ALA 390 389 389 ALA ALA B . n 
B 1 391 PHE 391 390 390 PHE PHE B . n 
B 1 392 TYR 392 391 391 TYR TYR B . n 
B 1 393 GLN 393 392 392 GLN GLN B . n 
B 1 394 LEU 394 393 393 LEU LEU B . n 
B 1 395 ILE 395 394 394 ILE ILE B . n 
B 1 396 HIS 396 395 395 HIS HIS B . n 
B 1 397 GLN 397 396 396 GLN GLN B . n 
B 1 398 GLY 398 397 397 GLY GLY B . n 
B 1 399 THR 399 398 398 THR THR B . n 
B 1 400 LYS 400 399 399 LYS LYS B . n 
B 1 401 MET 401 400 400 MET MET B . n 
B 1 402 ILE 402 401 401 ILE ILE B . n 
B 1 403 PRO 403 402 402 PRO PRO B . n 
B 1 404 CYS 404 403 403 CYS CYS B . n 
B 1 405 ASP 405 404 404 ASP ASP B . n 
B 1 406 PHE 406 405 405 PHE PHE B . n 
B 1 407 LEU 407 406 406 LEU LEU B . n 
B 1 408 ILE 408 407 407 ILE ILE B . n 
B 1 409 PRO 409 408 408 PRO PRO B . n 
B 1 410 VAL 410 409 409 VAL VAL B . n 
B 1 411 GLN 411 410 410 GLN GLN B . n 
B 1 412 THR 412 411 411 THR THR B . n 
B 1 413 GLN 413 412 412 GLN GLN B . n 
B 1 414 HIS 414 413 413 HIS HIS B . n 
B 1 415 PRO 415 414 414 PRO PRO B . n 
B 1 416 ILE 416 415 415 ILE ILE B . n 
B 1 417 ARG 417 416 416 ARG ARG B . n 
B 1 418 LYS 418 417 417 LYS LYS B . n 
B 1 419 GLY 419 418 418 GLY GLY B . n 
B 1 420 LEU 420 419 419 LEU LEU B . n 
B 1 421 HIS 421 420 420 HIS HIS B . n 
B 1 422 HIS 422 421 421 HIS HIS B . n 
B 1 423 LYS 423 422 422 LYS LYS B . n 
B 1 424 ILE 424 423 423 ILE ILE B . n 
B 1 425 LEU 425 424 424 LEU LEU B . n 
B 1 426 LEU 426 425 425 LEU LEU B . n 
B 1 427 ALA 427 426 426 ALA ALA B . n 
B 1 428 ASN 428 427 427 ASN ASN B . n 
B 1 429 PHE 429 428 428 PHE PHE B . n 
B 1 430 LEU 430 429 429 LEU LEU B . n 
B 1 431 ALA 431 430 430 ALA ALA B . n 
B 1 432 GLN 432 431 431 GLN GLN B . n 
B 1 433 THR 433 432 432 THR THR B . n 
B 1 434 GLU 434 433 433 GLU GLU B . n 
B 1 435 ALA 435 434 434 ALA ALA B . n 
B 1 436 LEU 436 435 435 LEU LEU B . n 
B 1 437 MET 437 436 436 MET MET B . n 
B 1 438 LYS 438 437 437 LYS LYS B . n 
B 1 439 GLY 439 438 438 GLY GLY B . n 
B 1 440 LYS 440 439 439 LYS LYS B . n 
B 1 441 LEU 441 440 440 LEU LEU B . n 
B 1 442 PRO 442 441 441 PRO PRO B . n 
B 1 443 GLU 443 442 442 GLU GLU B . n 
B 1 444 GLU 444 443 443 GLU GLU B . n 
B 1 445 ALA 445 444 444 ALA ALA B . n 
B 1 446 ARG 446 445 445 ARG ARG B . n 
B 1 447 LYS 447 446 446 LYS LYS B . n 
B 1 448 GLU 448 447 447 GLU GLU B . n 
B 1 449 LEU 449 448 448 LEU LEU B . n 
B 1 450 GLN 450 449 449 GLN GLN B . n 
B 1 451 ALA 451 450 450 ALA ALA B . n 
B 1 452 ALA 452 451 451 ALA ALA B . n 
B 1 453 GLY 453 452 452 GLY GLY B . n 
B 1 454 LYS 454 453 453 LYS LYS B . n 
B 1 455 SER 455 454 454 SER SER B . n 
B 1 456 PRO 456 455 455 PRO PRO B . n 
B 1 457 GLU 457 456 456 GLU GLU B . n 
B 1 458 ASP 458 457 457 ASP ASP B . n 
B 1 459 LEU 459 458 458 LEU LEU B . n 
B 1 460 GLU 460 459 459 GLU GLU B . n 
B 1 461 LYS 461 460 460 LYS LYS B . n 
B 1 462 LEU 462 461 461 LEU LEU B . n 
B 1 463 LEU 463 462 462 LEU LEU B . n 
B 1 464 PRO 464 463 463 PRO PRO B . n 
B 1 465 HIS 465 464 464 HIS HIS B . n 
B 1 466 LYS 466 465 465 LYS LYS B . n 
B 1 467 VAL 467 466 466 VAL VAL B . n 
B 1 468 PHE 468 467 467 PHE PHE B . n 
B 1 469 GLU 469 468 468 GLU GLU B . n 
B 1 470 GLY 470 469 469 GLY GLY B . n 
B 1 471 ASN 471 470 470 ASN ASN B . n 
B 1 472 ARG 472 471 471 ARG ARG B . n 
B 1 473 PRO 473 472 472 PRO PRO B . n 
B 1 474 THR 474 473 473 THR THR B . n 
B 1 475 ASN 475 474 474 ASN ASN B . n 
B 1 476 SER 476 475 475 SER SER B . n 
B 1 477 ILE 477 476 476 ILE ILE B . n 
B 1 478 VAL 478 477 477 VAL VAL B . n 
B 1 479 PHE 479 478 478 PHE PHE B . n 
B 1 480 THR 480 479 479 THR THR B . n 
B 1 481 LYS 481 480 480 LYS LYS B . n 
B 1 482 LEU 482 481 481 LEU LEU B . n 
B 1 483 THR 483 482 482 THR THR B . n 
B 1 484 PRO 484 483 483 PRO PRO B . n 
B 1 485 PHE 485 484 484 PHE PHE B . n 
B 1 486 ILE 486 485 485 ILE ILE B . n 
B 1 487 LEU 487 486 486 LEU LEU B . n 
B 1 488 GLY 488 487 487 GLY GLY B . n 
B 1 489 ALA 489 488 488 ALA ALA B . n 
B 1 490 LEU 490 489 489 LEU LEU B . n 
B 1 491 ILE 491 490 490 ILE ILE B . n 
B 1 492 ALA 492 491 491 ALA ALA B . n 
B 1 493 MET 493 492 492 MET MET B . n 
B 1 494 TYR 494 493 493 TYR TYR B . n 
B 1 495 GLU 495 494 494 GLU GLU B . n 
B 1 496 HIS 496 495 495 HIS HIS B . n 
B 1 497 LYS 497 496 496 LYS LYS B . n 
B 1 498 ILE 498 497 497 ILE ILE B . n 
B 1 499 PHE 499 498 498 PHE PHE B . n 
B 1 500 VAL 500 499 499 VAL VAL B . n 
B 1 501 GLN 501 500 500 GLN GLN B . n 
B 1 502 GLY 502 501 501 GLY GLY B . n 
B 1 503 ILE 503 502 502 ILE ILE B . n 
B 1 504 MET 504 503 503 MET MET B . n 
B 1 505 TRP 505 504 504 TRP TRP B . n 
B 1 506 ASP 506 505 505 ASP ASP B . n 
B 1 507 ILE 507 506 506 ILE ILE B . n 
B 1 508 ASN 508 507 507 ASN ASN B . n 
B 1 509 SER 509 508 508 SER SER B . n 
B 1 510 PHE 510 509 509 PHE PHE B . n 
B 1 511 ASP 511 510 510 ASP ASP B . n 
B 1 512 GLN 512 511 511 GLN GLN B . n 
B 1 513 TRP 513 512 512 TRP TRP B . n 
B 1 514 GLY 514 513 513 GLY GLY B . n 
B 1 515 VAL 515 514 514 VAL VAL B . n 
B 1 516 GLU 516 515 515 GLU GLU B . n 
B 1 517 LEU 517 516 516 LEU LEU B . n 
B 1 518 GLY 518 517 517 GLY GLY B . n 
B 1 519 LYS 519 518 518 LYS LYS B . n 
B 1 520 GLN 520 519 519 GLN GLN B . n 
B 1 521 LEU 521 520 520 LEU LEU B . n 
B 1 522 ALA 522 521 521 ALA ALA B . n 
B 1 523 LYS 523 522 522 LYS LYS B . n 
B 1 524 LYS 524 523 523 LYS LYS B . n 
B 1 525 ILE 525 524 524 ILE ILE B . n 
B 1 526 GLU 526 525 525 GLU GLU B . n 
B 1 527 PRO 527 526 526 PRO PRO B . n 
B 1 528 GLU 528 527 527 GLU GLU B . n 
B 1 529 LEU 529 528 528 LEU LEU B . n 
B 1 530 GLU 530 529 529 GLU GLU B . n 
B 1 531 GLY 531 530 530 GLY GLY B . n 
B 1 532 SER 532 531 531 SER SER B . n 
B 1 533 SER 533 532 532 SER SER B . n 
B 1 534 ALA 534 533 533 ALA ALA B . n 
B 1 535 VAL 535 534 534 VAL VAL B . n 
B 1 536 THR 536 535 535 THR THR B . n 
B 1 537 SER 537 536 536 SER SER B . n 
B 1 538 HIS 538 537 537 HIS HIS B . n 
B 1 539 ASP 539 538 538 ASP ASP B . n 
B 1 540 SER 540 539 539 SER SER B . n 
B 1 541 SER 541 540 540 SER SER B . n 
B 1 542 THR 542 541 541 THR THR B . n 
B 1 543 ASN 543 542 542 ASN ASN B . n 
B 1 544 GLY 544 543 543 GLY GLY B . n 
B 1 545 LEU 545 544 544 LEU LEU B . n 
B 1 546 ILE 546 545 545 ILE ILE B . n 
B 1 547 SER 547 546 546 SER SER B . n 
B 1 548 PHE 548 547 547 PHE PHE B . n 
B 1 549 ILE 549 548 548 ILE ILE B . n 
B 1 550 LYS 550 549 549 LYS LYS B . n 
B 1 551 GLN 551 550 550 GLN GLN B . n 
B 1 552 GLN 552 551 551 GLN GLN B . n 
B 1 553 ARG 553 552 552 ARG ARG B . n 
B 1 554 ASP 554 553 553 ASP ASP B . n 
B 1 555 THR 555 554 554 THR THR B . n 
B 1 556 LYS 556 555 555 LYS LYS B . n 
B 1 557 LEU 557 556 556 LEU LEU B . n 
B 1 558 GLU 558 557 ?   ?   ?   B . n 
B 1 559 HIS 559 558 ?   ?   ?   B . n 
B 1 560 HIS 560 559 ?   ?   ?   B . n 
B 1 561 HIS 561 560 ?   ?   ?   B . n 
B 1 562 HIS 562 561 ?   ?   ?   B . n 
B 1 563 HIS 563 562 ?   ?   ?   B . n 
B 1 564 HIS 564 563 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   1201 1    SO4 SO4 A . 
D 2 SO4 1   1202 2    SO4 SO4 A . 
E 2 SO4 1   1206 6    SO4 SO4 A . 
F 2 SO4 1   1207 7    SO4 SO4 A . 
G 3 BME 1   1211 1    BME BME A . 
H 3 BME 1   1212 2    BME BME A . 
I 3 BME 1   1213 3    BME BME A . 
J 3 BME 1   1214 4    BME BME A . 
K 3 BME 1   1215 5    BME BME A . 
L 4 GOL 1   1221 1    GOL GOL A . 
M 4 GOL 1   1223 3    GOL GOL A . 
N 4 GOL 1   1225 5    GOL GOL A . 
O 4 GOL 1   1226 6    GOL GOL A . 
P 4 GOL 1   1227 7    GOL GOL A . 
Q 2 SO4 1   1203 3    SO4 SO4 B . 
R 2 SO4 1   1204 4    SO4 SO4 B . 
S 2 SO4 1   1205 5    SO4 SO4 B . 
T 2 SO4 1   1208 8    SO4 SO4 B . 
U 2 SO4 1   1209 9    SO4 SO4 B . 
V 2 SO4 1   1210 10   SO4 SO4 B . 
W 4 GOL 1   1222 2    GOL GOL B . 
X 4 GOL 1   1224 4    GOL GOL B . 
Y 5 HOH 1   1228 1    HOH HOH A . 
Y 5 HOH 2   1229 2    HOH HOH A . 
Y 5 HOH 3   1230 3    HOH HOH A . 
Y 5 HOH 4   1231 4    HOH HOH A . 
Y 5 HOH 5   1232 6    HOH HOH A . 
Y 5 HOH 6   1233 7    HOH HOH A . 
Y 5 HOH 7   1234 8    HOH HOH A . 
Y 5 HOH 8   1235 9    HOH HOH A . 
Y 5 HOH 9   1236 10   HOH HOH A . 
Y 5 HOH 10  1237 11   HOH HOH A . 
Y 5 HOH 11  1238 12   HOH HOH A . 
Y 5 HOH 12  1239 13   HOH HOH A . 
Y 5 HOH 13  1240 14   HOH HOH A . 
Y 5 HOH 14  1241 15   HOH HOH A . 
Y 5 HOH 15  1242 16   HOH HOH A . 
Y 5 HOH 16  1243 17   HOH HOH A . 
Y 5 HOH 17  1244 19   HOH HOH A . 
Y 5 HOH 18  1245 20   HOH HOH A . 
Y 5 HOH 19  1246 22   HOH HOH A . 
Y 5 HOH 20  1247 25   HOH HOH A . 
Y 5 HOH 21  1248 29   HOH HOH A . 
Y 5 HOH 22  1249 30   HOH HOH A . 
Y 5 HOH 23  1250 31   HOH HOH A . 
Y 5 HOH 24  1251 32   HOH HOH A . 
Y 5 HOH 25  1252 33   HOH HOH A . 
Y 5 HOH 26  1253 36   HOH HOH A . 
Y 5 HOH 27  1254 37   HOH HOH A . 
Y 5 HOH 28  1255 38   HOH HOH A . 
Y 5 HOH 29  1256 39   HOH HOH A . 
Y 5 HOH 30  1257 40   HOH HOH A . 
Y 5 HOH 31  1258 41   HOH HOH A . 
Y 5 HOH 32  1259 45   HOH HOH A . 
Y 5 HOH 33  1260 48   HOH HOH A . 
Y 5 HOH 34  1261 49   HOH HOH A . 
Y 5 HOH 35  1262 53   HOH HOH A . 
Y 5 HOH 36  1263 54   HOH HOH A . 
Y 5 HOH 37  1264 55   HOH HOH A . 
Y 5 HOH 38  1265 60   HOH HOH A . 
Y 5 HOH 39  1266 61   HOH HOH A . 
Y 5 HOH 40  1267 62   HOH HOH A . 
Y 5 HOH 41  1268 66   HOH HOH A . 
Y 5 HOH 42  1269 67   HOH HOH A . 
Y 5 HOH 43  1270 69   HOH HOH A . 
Y 5 HOH 44  1271 70   HOH HOH A . 
Y 5 HOH 45  1272 71   HOH HOH A . 
Y 5 HOH 46  1273 72   HOH HOH A . 
Y 5 HOH 47  1274 74   HOH HOH A . 
Y 5 HOH 48  1275 75   HOH HOH A . 
Y 5 HOH 49  1276 79   HOH HOH A . 
Y 5 HOH 50  1277 81   HOH HOH A . 
Y 5 HOH 51  1278 84   HOH HOH A . 
Y 5 HOH 52  1279 86   HOH HOH A . 
Y 5 HOH 53  1280 89   HOH HOH A . 
Y 5 HOH 54  1281 91   HOH HOH A . 
Y 5 HOH 55  1282 93   HOH HOH A . 
Y 5 HOH 56  1283 96   HOH HOH A . 
Y 5 HOH 57  1284 98   HOH HOH A . 
Y 5 HOH 58  1285 101  HOH HOH A . 
Y 5 HOH 59  1286 103  HOH HOH A . 
Y 5 HOH 60  1287 105  HOH HOH A . 
Y 5 HOH 61  1288 106  HOH HOH A . 
Y 5 HOH 62  1289 109  HOH HOH A . 
Y 5 HOH 63  1290 113  HOH HOH A . 
Y 5 HOH 64  1291 117  HOH HOH A . 
Y 5 HOH 65  1292 118  HOH HOH A . 
Y 5 HOH 66  1293 122  HOH HOH A . 
Y 5 HOH 67  1294 123  HOH HOH A . 
Y 5 HOH 68  1295 124  HOH HOH A . 
Y 5 HOH 69  1296 126  HOH HOH A . 
Y 5 HOH 70  1297 127  HOH HOH A . 
Y 5 HOH 71  1298 129  HOH HOH A . 
Y 5 HOH 72  1299 130  HOH HOH A . 
Y 5 HOH 73  1300 132  HOH HOH A . 
Y 5 HOH 74  1301 133  HOH HOH A . 
Y 5 HOH 75  1302 134  HOH HOH A . 
Y 5 HOH 76  1303 135  HOH HOH A . 
Y 5 HOH 77  1304 137  HOH HOH A . 
Y 5 HOH 78  1305 138  HOH HOH A . 
Y 5 HOH 79  1306 139  HOH HOH A . 
Y 5 HOH 80  1307 142  HOH HOH A . 
Y 5 HOH 81  1308 145  HOH HOH A . 
Y 5 HOH 82  1309 146  HOH HOH A . 
Y 5 HOH 83  1310 148  HOH HOH A . 
Y 5 HOH 84  1311 149  HOH HOH A . 
Y 5 HOH 85  1312 150  HOH HOH A . 
Y 5 HOH 86  1313 152  HOH HOH A . 
Y 5 HOH 87  1314 153  HOH HOH A . 
Y 5 HOH 88  1315 154  HOH HOH A . 
Y 5 HOH 89  1316 157  HOH HOH A . 
Y 5 HOH 90  1317 158  HOH HOH A . 
Y 5 HOH 91  1318 159  HOH HOH A . 
Y 5 HOH 92  1319 164  HOH HOH A . 
Y 5 HOH 93  1320 166  HOH HOH A . 
Y 5 HOH 94  1321 167  HOH HOH A . 
Y 5 HOH 95  1322 169  HOH HOH A . 
Y 5 HOH 96  1323 170  HOH HOH A . 
Y 5 HOH 97  1324 174  HOH HOH A . 
Y 5 HOH 98  1325 176  HOH HOH A . 
Y 5 HOH 99  1326 179  HOH HOH A . 
Y 5 HOH 100 1327 180  HOH HOH A . 
Y 5 HOH 101 1328 181  HOH HOH A . 
Y 5 HOH 102 1329 184  HOH HOH A . 
Y 5 HOH 103 1330 187  HOH HOH A . 
Y 5 HOH 104 1331 188  HOH HOH A . 
Y 5 HOH 105 1332 189  HOH HOH A . 
Y 5 HOH 106 1333 190  HOH HOH A . 
Y 5 HOH 107 1334 192  HOH HOH A . 
Y 5 HOH 108 1335 193  HOH HOH A . 
Y 5 HOH 109 1336 195  HOH HOH A . 
Y 5 HOH 110 1337 196  HOH HOH A . 
Y 5 HOH 111 1338 197  HOH HOH A . 
Y 5 HOH 112 1339 198  HOH HOH A . 
Y 5 HOH 113 1340 202  HOH HOH A . 
Y 5 HOH 114 1341 204  HOH HOH A . 
Y 5 HOH 115 1342 205  HOH HOH A . 
Y 5 HOH 116 1343 208  HOH HOH A . 
Y 5 HOH 117 1344 210  HOH HOH A . 
Y 5 HOH 118 1345 211  HOH HOH A . 
Y 5 HOH 119 1346 212  HOH HOH A . 
Y 5 HOH 120 1347 213  HOH HOH A . 
Y 5 HOH 121 1348 214  HOH HOH A . 
Y 5 HOH 122 1349 216  HOH HOH A . 
Y 5 HOH 123 1350 217  HOH HOH A . 
Y 5 HOH 124 1351 218  HOH HOH A . 
Y 5 HOH 125 1352 221  HOH HOH A . 
Y 5 HOH 126 1353 224  HOH HOH A . 
Y 5 HOH 127 1354 228  HOH HOH A . 
Y 5 HOH 128 1355 229  HOH HOH A . 
Y 5 HOH 129 1356 233  HOH HOH A . 
Y 5 HOH 130 1357 236  HOH HOH A . 
Y 5 HOH 131 1358 237  HOH HOH A . 
Y 5 HOH 132 1359 238  HOH HOH A . 
Y 5 HOH 133 1360 242  HOH HOH A . 
Y 5 HOH 134 1361 244  HOH HOH A . 
Y 5 HOH 135 1362 245  HOH HOH A . 
Y 5 HOH 136 1363 246  HOH HOH A . 
Y 5 HOH 137 1364 247  HOH HOH A . 
Y 5 HOH 138 1365 252  HOH HOH A . 
Y 5 HOH 139 1366 253  HOH HOH A . 
Y 5 HOH 140 1367 256  HOH HOH A . 
Y 5 HOH 141 1368 257  HOH HOH A . 
Y 5 HOH 142 1369 261  HOH HOH A . 
Y 5 HOH 143 1370 262  HOH HOH A . 
Y 5 HOH 144 1371 265  HOH HOH A . 
Y 5 HOH 145 1372 266  HOH HOH A . 
Y 5 HOH 146 1373 267  HOH HOH A . 
Y 5 HOH 147 1374 271  HOH HOH A . 
Y 5 HOH 148 1375 272  HOH HOH A . 
Y 5 HOH 149 1376 275  HOH HOH A . 
Y 5 HOH 150 1377 276  HOH HOH A . 
Y 5 HOH 151 1378 277  HOH HOH A . 
Y 5 HOH 152 1379 278  HOH HOH A . 
Y 5 HOH 153 1380 279  HOH HOH A . 
Y 5 HOH 154 1381 280  HOH HOH A . 
Y 5 HOH 155 1382 285  HOH HOH A . 
Y 5 HOH 156 1383 286  HOH HOH A . 
Y 5 HOH 157 1384 299  HOH HOH A . 
Y 5 HOH 158 1385 301  HOH HOH A . 
Y 5 HOH 159 1386 302  HOH HOH A . 
Y 5 HOH 160 1387 303  HOH HOH A . 
Y 5 HOH 161 1388 304  HOH HOH A . 
Y 5 HOH 162 1389 307  HOH HOH A . 
Y 5 HOH 163 1390 308  HOH HOH A . 
Y 5 HOH 164 1391 309  HOH HOH A . 
Y 5 HOH 165 1392 311  HOH HOH A . 
Y 5 HOH 166 1393 313  HOH HOH A . 
Y 5 HOH 167 1394 315  HOH HOH A . 
Y 5 HOH 168 1395 316  HOH HOH A . 
Y 5 HOH 169 1396 317  HOH HOH A . 
Y 5 HOH 170 1397 318  HOH HOH A . 
Y 5 HOH 171 1398 322  HOH HOH A . 
Y 5 HOH 172 1399 323  HOH HOH A . 
Y 5 HOH 173 1400 325  HOH HOH A . 
Y 5 HOH 174 1401 327  HOH HOH A . 
Y 5 HOH 175 1402 328  HOH HOH A . 
Y 5 HOH 176 1403 329  HOH HOH A . 
Y 5 HOH 177 1404 330  HOH HOH A . 
Y 5 HOH 178 1405 331  HOH HOH A . 
Y 5 HOH 179 1406 332  HOH HOH A . 
Y 5 HOH 180 1407 333  HOH HOH A . 
Y 5 HOH 181 1408 334  HOH HOH A . 
Y 5 HOH 182 1409 336  HOH HOH A . 
Y 5 HOH 183 1410 339  HOH HOH A . 
Y 5 HOH 184 1411 342  HOH HOH A . 
Y 5 HOH 185 1412 343  HOH HOH A . 
Y 5 HOH 186 1413 344  HOH HOH A . 
Y 5 HOH 187 1414 350  HOH HOH A . 
Y 5 HOH 188 1415 352  HOH HOH A . 
Y 5 HOH 189 1416 353  HOH HOH A . 
Y 5 HOH 190 1417 354  HOH HOH A . 
Y 5 HOH 191 1418 356  HOH HOH A . 
Y 5 HOH 192 1419 358  HOH HOH A . 
Y 5 HOH 193 1420 359  HOH HOH A . 
Y 5 HOH 194 1421 363  HOH HOH A . 
Y 5 HOH 195 1422 364  HOH HOH A . 
Y 5 HOH 196 1423 368  HOH HOH A . 
Y 5 HOH 197 1424 370  HOH HOH A . 
Y 5 HOH 198 1425 373  HOH HOH A . 
Y 5 HOH 199 1426 376  HOH HOH A . 
Y 5 HOH 200 1427 377  HOH HOH A . 
Y 5 HOH 201 1428 379  HOH HOH A . 
Y 5 HOH 202 1429 380  HOH HOH A . 
Y 5 HOH 203 1430 386  HOH HOH A . 
Y 5 HOH 204 1431 390  HOH HOH A . 
Y 5 HOH 205 1432 393  HOH HOH A . 
Y 5 HOH 206 1433 394  HOH HOH A . 
Y 5 HOH 207 1434 395  HOH HOH A . 
Y 5 HOH 208 1435 396  HOH HOH A . 
Y 5 HOH 209 1436 397  HOH HOH A . 
Y 5 HOH 210 1437 398  HOH HOH A . 
Y 5 HOH 211 1438 399  HOH HOH A . 
Y 5 HOH 212 1439 400  HOH HOH A . 
Y 5 HOH 213 1440 401  HOH HOH A . 
Y 5 HOH 214 1441 402  HOH HOH A . 
Y 5 HOH 215 1442 403  HOH HOH A . 
Y 5 HOH 216 1443 405  HOH HOH A . 
Y 5 HOH 217 1444 408  HOH HOH A . 
Y 5 HOH 218 1445 413  HOH HOH A . 
Y 5 HOH 219 1446 414  HOH HOH A . 
Y 5 HOH 220 1447 415  HOH HOH A . 
Y 5 HOH 221 1448 417  HOH HOH A . 
Y 5 HOH 222 1449 419  HOH HOH A . 
Y 5 HOH 223 1450 421  HOH HOH A . 
Y 5 HOH 224 1451 425  HOH HOH A . 
Y 5 HOH 225 1452 427  HOH HOH A . 
Y 5 HOH 226 1453 431  HOH HOH A . 
Y 5 HOH 227 1454 432  HOH HOH A . 
Y 5 HOH 228 1455 436  HOH HOH A . 
Y 5 HOH 229 1456 437  HOH HOH A . 
Y 5 HOH 230 1457 438  HOH HOH A . 
Y 5 HOH 231 1458 441  HOH HOH A . 
Y 5 HOH 232 1459 444  HOH HOH A . 
Y 5 HOH 233 1460 446  HOH HOH A . 
Y 5 HOH 234 1461 447  HOH HOH A . 
Y 5 HOH 235 1462 451  HOH HOH A . 
Y 5 HOH 236 1463 452  HOH HOH A . 
Y 5 HOH 237 1464 453  HOH HOH A . 
Y 5 HOH 238 1465 454  HOH HOH A . 
Y 5 HOH 239 1466 456  HOH HOH A . 
Y 5 HOH 240 1467 457  HOH HOH A . 
Y 5 HOH 241 1468 464  HOH HOH A . 
Y 5 HOH 242 1469 465  HOH HOH A . 
Y 5 HOH 243 1470 469  HOH HOH A . 
Y 5 HOH 244 1471 474  HOH HOH A . 
Y 5 HOH 245 1472 475  HOH HOH A . 
Y 5 HOH 246 1473 476  HOH HOH A . 
Y 5 HOH 247 1474 477  HOH HOH A . 
Y 5 HOH 248 1475 480  HOH HOH A . 
Y 5 HOH 249 1476 482  HOH HOH A . 
Y 5 HOH 250 1477 483  HOH HOH A . 
Y 5 HOH 251 1478 485  HOH HOH A . 
Y 5 HOH 252 1479 487  HOH HOH A . 
Y 5 HOH 253 1480 490  HOH HOH A . 
Y 5 HOH 254 1481 492  HOH HOH A . 
Y 5 HOH 255 1482 497  HOH HOH A . 
Y 5 HOH 256 1483 498  HOH HOH A . 
Y 5 HOH 257 1484 499  HOH HOH A . 
Y 5 HOH 258 1485 504  HOH HOH A . 
Y 5 HOH 259 1486 507  HOH HOH A . 
Y 5 HOH 260 1487 510  HOH HOH A . 
Y 5 HOH 261 1488 511  HOH HOH A . 
Y 5 HOH 262 1489 512  HOH HOH A . 
Y 5 HOH 263 1490 513  HOH HOH A . 
Y 5 HOH 264 1491 514  HOH HOH A . 
Y 5 HOH 265 1492 516  HOH HOH A . 
Y 5 HOH 266 1493 518  HOH HOH A . 
Y 5 HOH 267 1494 522  HOH HOH A . 
Y 5 HOH 268 1495 523  HOH HOH A . 
Y 5 HOH 269 1496 524  HOH HOH A . 
Y 5 HOH 270 1497 525  HOH HOH A . 
Y 5 HOH 271 1498 526  HOH HOH A . 
Y 5 HOH 272 1499 527  HOH HOH A . 
Y 5 HOH 273 1500 530  HOH HOH A . 
Y 5 HOH 274 1501 531  HOH HOH A . 
Y 5 HOH 275 1502 532  HOH HOH A . 
Y 5 HOH 276 1503 534  HOH HOH A . 
Y 5 HOH 277 1504 536  HOH HOH A . 
Y 5 HOH 278 1505 542  HOH HOH A . 
Y 5 HOH 279 1506 548  HOH HOH A . 
Y 5 HOH 280 1507 551  HOH HOH A . 
Y 5 HOH 281 1508 552  HOH HOH A . 
Y 5 HOH 282 1509 554  HOH HOH A . 
Y 5 HOH 283 1510 557  HOH HOH A . 
Y 5 HOH 284 1511 559  HOH HOH A . 
Y 5 HOH 285 1512 560  HOH HOH A . 
Y 5 HOH 286 1513 561  HOH HOH A . 
Y 5 HOH 287 1514 562  HOH HOH A . 
Y 5 HOH 288 1515 565  HOH HOH A . 
Y 5 HOH 289 1516 566  HOH HOH A . 
Y 5 HOH 290 1517 567  HOH HOH A . 
Y 5 HOH 291 1518 570  HOH HOH A . 
Y 5 HOH 292 1519 571  HOH HOH A . 
Y 5 HOH 293 1520 572  HOH HOH A . 
Y 5 HOH 294 1521 575  HOH HOH A . 
Y 5 HOH 295 1522 576  HOH HOH A . 
Y 5 HOH 296 1523 577  HOH HOH A . 
Y 5 HOH 297 1524 578  HOH HOH A . 
Y 5 HOH 298 1525 593  HOH HOH A . 
Y 5 HOH 299 1526 594  HOH HOH A . 
Y 5 HOH 300 1527 595  HOH HOH A . 
Y 5 HOH 301 1528 596  HOH HOH A . 
Y 5 HOH 302 1529 597  HOH HOH A . 
Y 5 HOH 303 1530 599  HOH HOH A . 
Y 5 HOH 304 1531 600  HOH HOH A . 
Y 5 HOH 305 1532 601  HOH HOH A . 
Y 5 HOH 306 1533 602  HOH HOH A . 
Y 5 HOH 307 1534 603  HOH HOH A . 
Y 5 HOH 308 1535 604  HOH HOH A . 
Y 5 HOH 309 1536 605  HOH HOH A . 
Y 5 HOH 310 1537 607  HOH HOH A . 
Y 5 HOH 311 1538 608  HOH HOH A . 
Y 5 HOH 312 1539 609  HOH HOH A . 
Y 5 HOH 313 1540 610  HOH HOH A . 
Y 5 HOH 314 1541 611  HOH HOH A . 
Y 5 HOH 315 1542 612  HOH HOH A . 
Y 5 HOH 316 1543 613  HOH HOH A . 
Y 5 HOH 317 1544 615  HOH HOH A . 
Y 5 HOH 318 1545 616  HOH HOH A . 
Y 5 HOH 319 1546 619  HOH HOH A . 
Y 5 HOH 320 1547 620  HOH HOH A . 
Y 5 HOH 321 1548 621  HOH HOH A . 
Y 5 HOH 322 1549 623  HOH HOH A . 
Y 5 HOH 323 1550 624  HOH HOH A . 
Y 5 HOH 324 1551 625  HOH HOH A . 
Y 5 HOH 325 1552 626  HOH HOH A . 
Y 5 HOH 326 1553 628  HOH HOH A . 
Y 5 HOH 327 1554 631  HOH HOH A . 
Y 5 HOH 328 1555 632  HOH HOH A . 
Y 5 HOH 329 1556 633  HOH HOH A . 
Y 5 HOH 330 1557 635  HOH HOH A . 
Y 5 HOH 331 1558 637  HOH HOH A . 
Y 5 HOH 332 1559 638  HOH HOH A . 
Y 5 HOH 333 1560 639  HOH HOH A . 
Y 5 HOH 334 1561 641  HOH HOH A . 
Y 5 HOH 335 1562 643  HOH HOH A . 
Y 5 HOH 336 1563 645  HOH HOH A . 
Y 5 HOH 337 1564 646  HOH HOH A . 
Y 5 HOH 338 1565 651  HOH HOH A . 
Y 5 HOH 339 1566 652  HOH HOH A . 
Y 5 HOH 340 1567 653  HOH HOH A . 
Y 5 HOH 341 1568 654  HOH HOH A . 
Y 5 HOH 342 1569 656  HOH HOH A . 
Y 5 HOH 343 1570 658  HOH HOH A . 
Y 5 HOH 344 1571 661  HOH HOH A . 
Y 5 HOH 345 1572 662  HOH HOH A . 
Y 5 HOH 346 1573 666  HOH HOH A . 
Y 5 HOH 347 1574 667  HOH HOH A . 
Y 5 HOH 348 1575 669  HOH HOH A . 
Y 5 HOH 349 1576 670  HOH HOH A . 
Y 5 HOH 350 1577 672  HOH HOH A . 
Y 5 HOH 351 1578 673  HOH HOH A . 
Y 5 HOH 352 1579 676  HOH HOH A . 
Y 5 HOH 353 1580 678  HOH HOH A . 
Y 5 HOH 354 1581 679  HOH HOH A . 
Y 5 HOH 355 1582 680  HOH HOH A . 
Y 5 HOH 356 1583 681  HOH HOH A . 
Y 5 HOH 357 1584 684  HOH HOH A . 
Y 5 HOH 358 1585 686  HOH HOH A . 
Y 5 HOH 359 1586 691  HOH HOH A . 
Y 5 HOH 360 1587 692  HOH HOH A . 
Y 5 HOH 361 1588 693  HOH HOH A . 
Y 5 HOH 362 1589 694  HOH HOH A . 
Y 5 HOH 363 1590 697  HOH HOH A . 
Y 5 HOH 364 1591 698  HOH HOH A . 
Y 5 HOH 365 1592 700  HOH HOH A . 
Y 5 HOH 366 1593 701  HOH HOH A . 
Y 5 HOH 367 1594 702  HOH HOH A . 
Y 5 HOH 368 1595 703  HOH HOH A . 
Y 5 HOH 369 1596 704  HOH HOH A . 
Y 5 HOH 370 1597 706  HOH HOH A . 
Y 5 HOH 371 1598 707  HOH HOH A . 
Y 5 HOH 372 1599 710  HOH HOH A . 
Y 5 HOH 373 1600 716  HOH HOH A . 
Y 5 HOH 374 1601 718  HOH HOH A . 
Y 5 HOH 375 1602 726  HOH HOH A . 
Y 5 HOH 376 1603 728  HOH HOH A . 
Y 5 HOH 377 1604 730  HOH HOH A . 
Y 5 HOH 378 1605 734  HOH HOH A . 
Y 5 HOH 379 1606 740  HOH HOH A . 
Y 5 HOH 380 1607 743  HOH HOH A . 
Y 5 HOH 381 1608 748  HOH HOH A . 
Y 5 HOH 382 1609 755  HOH HOH A . 
Y 5 HOH 383 1610 757  HOH HOH A . 
Y 5 HOH 384 1611 759  HOH HOH A . 
Y 5 HOH 385 1612 760  HOH HOH A . 
Y 5 HOH 386 1613 761  HOH HOH A . 
Y 5 HOH 387 1614 762  HOH HOH A . 
Y 5 HOH 388 1615 764  HOH HOH A . 
Y 5 HOH 389 1616 766  HOH HOH A . 
Y 5 HOH 390 1617 767  HOH HOH A . 
Y 5 HOH 391 1618 768  HOH HOH A . 
Y 5 HOH 392 1619 769  HOH HOH A . 
Y 5 HOH 393 1620 770  HOH HOH A . 
Y 5 HOH 394 1621 771  HOH HOH A . 
Y 5 HOH 395 1622 772  HOH HOH A . 
Y 5 HOH 396 1623 773  HOH HOH A . 
Y 5 HOH 397 1624 774  HOH HOH A . 
Y 5 HOH 398 1625 775  HOH HOH A . 
Y 5 HOH 399 1626 776  HOH HOH A . 
Y 5 HOH 400 1627 777  HOH HOH A . 
Y 5 HOH 401 1628 778  HOH HOH A . 
Y 5 HOH 402 1629 779  HOH HOH A . 
Y 5 HOH 403 1630 780  HOH HOH A . 
Y 5 HOH 404 1631 781  HOH HOH A . 
Y 5 HOH 405 1632 783  HOH HOH A . 
Y 5 HOH 406 1633 788  HOH HOH A . 
Y 5 HOH 407 1634 792  HOH HOH A . 
Y 5 HOH 408 1635 794  HOH HOH A . 
Y 5 HOH 409 1636 797  HOH HOH A . 
Y 5 HOH 410 1637 799  HOH HOH A . 
Y 5 HOH 411 1638 803  HOH HOH A . 
Y 5 HOH 412 1639 806  HOH HOH A . 
Y 5 HOH 413 1640 807  HOH HOH A . 
Y 5 HOH 414 1641 809  HOH HOH A . 
Y 5 HOH 415 1642 812  HOH HOH A . 
Y 5 HOH 416 1643 814  HOH HOH A . 
Y 5 HOH 417 1644 817  HOH HOH A . 
Y 5 HOH 418 1645 819  HOH HOH A . 
Y 5 HOH 419 1646 820  HOH HOH A . 
Y 5 HOH 420 1647 821  HOH HOH A . 
Y 5 HOH 421 1648 825  HOH HOH A . 
Y 5 HOH 422 1649 826  HOH HOH A . 
Y 5 HOH 423 1650 827  HOH HOH A . 
Y 5 HOH 424 1651 828  HOH HOH A . 
Y 5 HOH 425 1652 831  HOH HOH A . 
Y 5 HOH 426 1653 833  HOH HOH A . 
Y 5 HOH 427 1654 837  HOH HOH A . 
Y 5 HOH 428 1655 841  HOH HOH A . 
Y 5 HOH 429 1656 843  HOH HOH A . 
Y 5 HOH 430 1657 848  HOH HOH A . 
Y 5 HOH 431 1658 849  HOH HOH A . 
Y 5 HOH 432 1659 850  HOH HOH A . 
Y 5 HOH 433 1660 852  HOH HOH A . 
Y 5 HOH 434 1661 853  HOH HOH A . 
Y 5 HOH 435 1662 854  HOH HOH A . 
Y 5 HOH 436 1663 856  HOH HOH A . 
Y 5 HOH 437 1664 857  HOH HOH A . 
Y 5 HOH 438 1665 859  HOH HOH A . 
Y 5 HOH 439 1666 860  HOH HOH A . 
Y 5 HOH 440 1667 861  HOH HOH A . 
Y 5 HOH 441 1668 862  HOH HOH A . 
Y 5 HOH 442 1669 864  HOH HOH A . 
Y 5 HOH 443 1670 867  HOH HOH A . 
Y 5 HOH 444 1671 869  HOH HOH A . 
Y 5 HOH 445 1672 871  HOH HOH A . 
Y 5 HOH 446 1673 872  HOH HOH A . 
Y 5 HOH 447 1674 875  HOH HOH A . 
Y 5 HOH 448 1675 879  HOH HOH A . 
Y 5 HOH 449 1676 880  HOH HOH A . 
Y 5 HOH 450 1677 884  HOH HOH A . 
Y 5 HOH 451 1678 886  HOH HOH A . 
Y 5 HOH 452 1679 887  HOH HOH A . 
Y 5 HOH 453 1680 888  HOH HOH A . 
Y 5 HOH 454 1681 890  HOH HOH A . 
Y 5 HOH 455 1682 891  HOH HOH A . 
Y 5 HOH 456 1683 894  HOH HOH A . 
Y 5 HOH 457 1684 897  HOH HOH A . 
Y 5 HOH 458 1685 898  HOH HOH A . 
Y 5 HOH 459 1686 900  HOH HOH A . 
Y 5 HOH 460 1687 901  HOH HOH A . 
Y 5 HOH 461 1688 902  HOH HOH A . 
Y 5 HOH 462 1689 903  HOH HOH A . 
Y 5 HOH 463 1690 904  HOH HOH A . 
Y 5 HOH 464 1691 905  HOH HOH A . 
Y 5 HOH 465 1692 906  HOH HOH A . 
Y 5 HOH 466 1693 908  HOH HOH A . 
Y 5 HOH 467 1694 910  HOH HOH A . 
Y 5 HOH 468 1695 911  HOH HOH A . 
Y 5 HOH 469 1696 912  HOH HOH A . 
Y 5 HOH 470 1697 913  HOH HOH A . 
Y 5 HOH 471 1698 914  HOH HOH A . 
Y 5 HOH 472 1699 917  HOH HOH A . 
Y 5 HOH 473 1700 919  HOH HOH A . 
Y 5 HOH 474 1701 920  HOH HOH A . 
Y 5 HOH 475 1702 921  HOH HOH A . 
Y 5 HOH 476 1703 930  HOH HOH A . 
Y 5 HOH 477 1704 932  HOH HOH A . 
Y 5 HOH 478 1705 935  HOH HOH A . 
Y 5 HOH 479 1706 937  HOH HOH A . 
Y 5 HOH 480 1707 938  HOH HOH A . 
Y 5 HOH 481 1708 939  HOH HOH A . 
Y 5 HOH 482 1709 940  HOH HOH A . 
Y 5 HOH 483 1710 941  HOH HOH A . 
Y 5 HOH 484 1711 946  HOH HOH A . 
Y 5 HOH 485 1712 950  HOH HOH A . 
Y 5 HOH 486 1713 951  HOH HOH A . 
Y 5 HOH 487 1714 952  HOH HOH A . 
Y 5 HOH 488 1715 953  HOH HOH A . 
Y 5 HOH 489 1716 954  HOH HOH A . 
Y 5 HOH 490 1717 955  HOH HOH A . 
Y 5 HOH 491 1718 956  HOH HOH A . 
Y 5 HOH 492 1719 957  HOH HOH A . 
Y 5 HOH 493 1720 958  HOH HOH A . 
Y 5 HOH 494 1721 963  HOH HOH A . 
Y 5 HOH 495 1722 966  HOH HOH A . 
Y 5 HOH 496 1723 968  HOH HOH A . 
Y 5 HOH 497 1724 970  HOH HOH A . 
Y 5 HOH 498 1725 971  HOH HOH A . 
Y 5 HOH 499 1726 972  HOH HOH A . 
Y 5 HOH 500 1727 973  HOH HOH A . 
Y 5 HOH 501 1728 974  HOH HOH A . 
Y 5 HOH 502 1729 975  HOH HOH A . 
Y 5 HOH 503 1730 976  HOH HOH A . 
Y 5 HOH 504 1731 977  HOH HOH A . 
Y 5 HOH 505 1732 978  HOH HOH A . 
Y 5 HOH 506 1733 980  HOH HOH A . 
Y 5 HOH 507 1734 982  HOH HOH A . 
Y 5 HOH 508 1735 983  HOH HOH A . 
Y 5 HOH 509 1736 988  HOH HOH A . 
Y 5 HOH 510 1737 989  HOH HOH A . 
Y 5 HOH 511 1738 990  HOH HOH A . 
Y 5 HOH 512 1739 993  HOH HOH A . 
Y 5 HOH 513 1740 994  HOH HOH A . 
Y 5 HOH 514 1741 995  HOH HOH A . 
Y 5 HOH 515 1742 999  HOH HOH A . 
Y 5 HOH 516 1743 1000 HOH HOH A . 
Y 5 HOH 517 1744 1001 HOH HOH A . 
Y 5 HOH 518 1745 1004 HOH HOH A . 
Y 5 HOH 519 1746 1006 HOH HOH A . 
Y 5 HOH 520 1747 1007 HOH HOH A . 
Y 5 HOH 521 1748 1011 HOH HOH A . 
Y 5 HOH 522 1749 1012 HOH HOH A . 
Y 5 HOH 523 1750 1013 HOH HOH A . 
Y 5 HOH 524 1751 1015 HOH HOH A . 
Y 5 HOH 525 1752 1017 HOH HOH A . 
Z 5 HOH 1   1225 5    HOH HOH B . 
Z 5 HOH 2   1226 18   HOH HOH B . 
Z 5 HOH 3   1227 21   HOH HOH B . 
Z 5 HOH 4   1228 23   HOH HOH B . 
Z 5 HOH 5   1229 24   HOH HOH B . 
Z 5 HOH 6   1230 26   HOH HOH B . 
Z 5 HOH 7   1231 27   HOH HOH B . 
Z 5 HOH 8   1232 28   HOH HOH B . 
Z 5 HOH 9   1233 34   HOH HOH B . 
Z 5 HOH 10  1234 35   HOH HOH B . 
Z 5 HOH 11  1235 42   HOH HOH B . 
Z 5 HOH 12  1236 43   HOH HOH B . 
Z 5 HOH 13  1237 44   HOH HOH B . 
Z 5 HOH 14  1238 46   HOH HOH B . 
Z 5 HOH 15  1239 47   HOH HOH B . 
Z 5 HOH 16  1240 50   HOH HOH B . 
Z 5 HOH 17  1241 51   HOH HOH B . 
Z 5 HOH 18  1242 52   HOH HOH B . 
Z 5 HOH 19  1243 56   HOH HOH B . 
Z 5 HOH 20  1244 57   HOH HOH B . 
Z 5 HOH 21  1245 58   HOH HOH B . 
Z 5 HOH 22  1246 59   HOH HOH B . 
Z 5 HOH 23  1247 63   HOH HOH B . 
Z 5 HOH 24  1248 64   HOH HOH B . 
Z 5 HOH 25  1249 65   HOH HOH B . 
Z 5 HOH 26  1250 68   HOH HOH B . 
Z 5 HOH 27  1251 73   HOH HOH B . 
Z 5 HOH 28  1252 76   HOH HOH B . 
Z 5 HOH 29  1253 77   HOH HOH B . 
Z 5 HOH 30  1254 78   HOH HOH B . 
Z 5 HOH 31  1255 80   HOH HOH B . 
Z 5 HOH 32  1256 82   HOH HOH B . 
Z 5 HOH 33  1257 83   HOH HOH B . 
Z 5 HOH 34  1258 85   HOH HOH B . 
Z 5 HOH 35  1259 87   HOH HOH B . 
Z 5 HOH 36  1260 88   HOH HOH B . 
Z 5 HOH 37  1261 90   HOH HOH B . 
Z 5 HOH 38  1262 92   HOH HOH B . 
Z 5 HOH 39  1263 94   HOH HOH B . 
Z 5 HOH 40  1264 95   HOH HOH B . 
Z 5 HOH 41  1265 97   HOH HOH B . 
Z 5 HOH 42  1266 99   HOH HOH B . 
Z 5 HOH 43  1267 100  HOH HOH B . 
Z 5 HOH 44  1268 102  HOH HOH B . 
Z 5 HOH 45  1269 104  HOH HOH B . 
Z 5 HOH 46  1270 107  HOH HOH B . 
Z 5 HOH 47  1271 108  HOH HOH B . 
Z 5 HOH 48  1272 110  HOH HOH B . 
Z 5 HOH 49  1273 111  HOH HOH B . 
Z 5 HOH 50  1274 112  HOH HOH B . 
Z 5 HOH 51  1275 114  HOH HOH B . 
Z 5 HOH 52  1276 115  HOH HOH B . 
Z 5 HOH 53  1277 116  HOH HOH B . 
Z 5 HOH 54  1278 119  HOH HOH B . 
Z 5 HOH 55  1279 120  HOH HOH B . 
Z 5 HOH 56  1280 121  HOH HOH B . 
Z 5 HOH 57  1281 125  HOH HOH B . 
Z 5 HOH 58  1282 128  HOH HOH B . 
Z 5 HOH 59  1283 131  HOH HOH B . 
Z 5 HOH 60  1284 136  HOH HOH B . 
Z 5 HOH 61  1285 140  HOH HOH B . 
Z 5 HOH 62  1286 141  HOH HOH B . 
Z 5 HOH 63  1287 143  HOH HOH B . 
Z 5 HOH 64  1288 144  HOH HOH B . 
Z 5 HOH 65  1289 147  HOH HOH B . 
Z 5 HOH 66  1290 151  HOH HOH B . 
Z 5 HOH 67  1291 155  HOH HOH B . 
Z 5 HOH 68  1292 156  HOH HOH B . 
Z 5 HOH 69  1293 160  HOH HOH B . 
Z 5 HOH 70  1294 161  HOH HOH B . 
Z 5 HOH 71  1295 162  HOH HOH B . 
Z 5 HOH 72  1296 163  HOH HOH B . 
Z 5 HOH 73  1297 165  HOH HOH B . 
Z 5 HOH 74  1298 168  HOH HOH B . 
Z 5 HOH 75  1299 171  HOH HOH B . 
Z 5 HOH 76  1300 172  HOH HOH B . 
Z 5 HOH 77  1301 173  HOH HOH B . 
Z 5 HOH 78  1302 175  HOH HOH B . 
Z 5 HOH 79  1303 177  HOH HOH B . 
Z 5 HOH 80  1304 178  HOH HOH B . 
Z 5 HOH 81  1305 182  HOH HOH B . 
Z 5 HOH 82  1306 183  HOH HOH B . 
Z 5 HOH 83  1307 185  HOH HOH B . 
Z 5 HOH 84  1308 186  HOH HOH B . 
Z 5 HOH 85  1309 191  HOH HOH B . 
Z 5 HOH 86  1310 194  HOH HOH B . 
Z 5 HOH 87  1311 199  HOH HOH B . 
Z 5 HOH 88  1312 200  HOH HOH B . 
Z 5 HOH 89  1313 201  HOH HOH B . 
Z 5 HOH 90  1314 203  HOH HOH B . 
Z 5 HOH 91  1315 206  HOH HOH B . 
Z 5 HOH 92  1316 207  HOH HOH B . 
Z 5 HOH 93  1317 209  HOH HOH B . 
Z 5 HOH 94  1318 215  HOH HOH B . 
Z 5 HOH 95  1319 219  HOH HOH B . 
Z 5 HOH 96  1320 220  HOH HOH B . 
Z 5 HOH 97  1321 222  HOH HOH B . 
Z 5 HOH 98  1322 223  HOH HOH B . 
Z 5 HOH 99  1323 225  HOH HOH B . 
Z 5 HOH 100 1324 226  HOH HOH B . 
Z 5 HOH 101 1325 227  HOH HOH B . 
Z 5 HOH 102 1326 230  HOH HOH B . 
Z 5 HOH 103 1327 231  HOH HOH B . 
Z 5 HOH 104 1328 232  HOH HOH B . 
Z 5 HOH 105 1329 234  HOH HOH B . 
Z 5 HOH 106 1330 235  HOH HOH B . 
Z 5 HOH 107 1331 239  HOH HOH B . 
Z 5 HOH 108 1332 240  HOH HOH B . 
Z 5 HOH 109 1333 241  HOH HOH B . 
Z 5 HOH 110 1334 243  HOH HOH B . 
Z 5 HOH 111 1335 248  HOH HOH B . 
Z 5 HOH 112 1336 249  HOH HOH B . 
Z 5 HOH 113 1337 250  HOH HOH B . 
Z 5 HOH 114 1338 251  HOH HOH B . 
Z 5 HOH 115 1339 254  HOH HOH B . 
Z 5 HOH 116 1340 255  HOH HOH B . 
Z 5 HOH 117 1341 258  HOH HOH B . 
Z 5 HOH 118 1342 259  HOH HOH B . 
Z 5 HOH 119 1343 260  HOH HOH B . 
Z 5 HOH 120 1344 263  HOH HOH B . 
Z 5 HOH 121 1345 264  HOH HOH B . 
Z 5 HOH 122 1346 268  HOH HOH B . 
Z 5 HOH 123 1347 269  HOH HOH B . 
Z 5 HOH 124 1348 270  HOH HOH B . 
Z 5 HOH 125 1349 273  HOH HOH B . 
Z 5 HOH 126 1350 274  HOH HOH B . 
Z 5 HOH 127 1351 281  HOH HOH B . 
Z 5 HOH 128 1352 282  HOH HOH B . 
Z 5 HOH 129 1353 283  HOH HOH B . 
Z 5 HOH 130 1354 284  HOH HOH B . 
Z 5 HOH 131 1355 287  HOH HOH B . 
Z 5 HOH 132 1356 288  HOH HOH B . 
Z 5 HOH 133 1357 289  HOH HOH B . 
Z 5 HOH 134 1358 290  HOH HOH B . 
Z 5 HOH 135 1359 291  HOH HOH B . 
Z 5 HOH 136 1360 292  HOH HOH B . 
Z 5 HOH 137 1361 293  HOH HOH B . 
Z 5 HOH 138 1362 294  HOH HOH B . 
Z 5 HOH 139 1363 295  HOH HOH B . 
Z 5 HOH 140 1364 296  HOH HOH B . 
Z 5 HOH 141 1365 297  HOH HOH B . 
Z 5 HOH 142 1366 298  HOH HOH B . 
Z 5 HOH 143 1367 300  HOH HOH B . 
Z 5 HOH 144 1368 305  HOH HOH B . 
Z 5 HOH 145 1369 306  HOH HOH B . 
Z 5 HOH 146 1370 310  HOH HOH B . 
Z 5 HOH 147 1371 312  HOH HOH B . 
Z 5 HOH 148 1372 314  HOH HOH B . 
Z 5 HOH 149 1373 319  HOH HOH B . 
Z 5 HOH 150 1374 320  HOH HOH B . 
Z 5 HOH 151 1375 321  HOH HOH B . 
Z 5 HOH 152 1376 324  HOH HOH B . 
Z 5 HOH 153 1377 326  HOH HOH B . 
Z 5 HOH 154 1378 335  HOH HOH B . 
Z 5 HOH 155 1379 337  HOH HOH B . 
Z 5 HOH 156 1380 338  HOH HOH B . 
Z 5 HOH 157 1381 340  HOH HOH B . 
Z 5 HOH 158 1382 341  HOH HOH B . 
Z 5 HOH 159 1383 345  HOH HOH B . 
Z 5 HOH 160 1384 346  HOH HOH B . 
Z 5 HOH 161 1385 347  HOH HOH B . 
Z 5 HOH 162 1386 348  HOH HOH B . 
Z 5 HOH 163 1387 349  HOH HOH B . 
Z 5 HOH 164 1388 351  HOH HOH B . 
Z 5 HOH 165 1389 355  HOH HOH B . 
Z 5 HOH 166 1390 357  HOH HOH B . 
Z 5 HOH 167 1391 360  HOH HOH B . 
Z 5 HOH 168 1392 361  HOH HOH B . 
Z 5 HOH 169 1393 362  HOH HOH B . 
Z 5 HOH 170 1394 365  HOH HOH B . 
Z 5 HOH 171 1395 366  HOH HOH B . 
Z 5 HOH 172 1396 367  HOH HOH B . 
Z 5 HOH 173 1397 369  HOH HOH B . 
Z 5 HOH 174 1398 371  HOH HOH B . 
Z 5 HOH 175 1399 372  HOH HOH B . 
Z 5 HOH 176 1400 374  HOH HOH B . 
Z 5 HOH 177 1401 375  HOH HOH B . 
Z 5 HOH 178 1402 378  HOH HOH B . 
Z 5 HOH 179 1403 381  HOH HOH B . 
Z 5 HOH 180 1404 382  HOH HOH B . 
Z 5 HOH 181 1405 383  HOH HOH B . 
Z 5 HOH 182 1406 384  HOH HOH B . 
Z 5 HOH 183 1407 385  HOH HOH B . 
Z 5 HOH 184 1408 387  HOH HOH B . 
Z 5 HOH 185 1409 388  HOH HOH B . 
Z 5 HOH 186 1410 389  HOH HOH B . 
Z 5 HOH 187 1411 391  HOH HOH B . 
Z 5 HOH 188 1412 392  HOH HOH B . 
Z 5 HOH 189 1413 404  HOH HOH B . 
Z 5 HOH 190 1414 406  HOH HOH B . 
Z 5 HOH 191 1415 407  HOH HOH B . 
Z 5 HOH 192 1416 409  HOH HOH B . 
Z 5 HOH 193 1417 410  HOH HOH B . 
Z 5 HOH 194 1418 411  HOH HOH B . 
Z 5 HOH 195 1419 412  HOH HOH B . 
Z 5 HOH 196 1420 416  HOH HOH B . 
Z 5 HOH 197 1421 418  HOH HOH B . 
Z 5 HOH 198 1422 420  HOH HOH B . 
Z 5 HOH 199 1423 422  HOH HOH B . 
Z 5 HOH 200 1424 423  HOH HOH B . 
Z 5 HOH 201 1425 424  HOH HOH B . 
Z 5 HOH 202 1426 426  HOH HOH B . 
Z 5 HOH 203 1427 428  HOH HOH B . 
Z 5 HOH 204 1428 429  HOH HOH B . 
Z 5 HOH 205 1429 430  HOH HOH B . 
Z 5 HOH 206 1430 433  HOH HOH B . 
Z 5 HOH 207 1431 434  HOH HOH B . 
Z 5 HOH 208 1432 435  HOH HOH B . 
Z 5 HOH 209 1433 439  HOH HOH B . 
Z 5 HOH 210 1434 440  HOH HOH B . 
Z 5 HOH 211 1435 442  HOH HOH B . 
Z 5 HOH 212 1436 443  HOH HOH B . 
Z 5 HOH 213 1437 445  HOH HOH B . 
Z 5 HOH 214 1438 448  HOH HOH B . 
Z 5 HOH 215 1439 449  HOH HOH B . 
Z 5 HOH 216 1440 450  HOH HOH B . 
Z 5 HOH 217 1441 455  HOH HOH B . 
Z 5 HOH 218 1442 458  HOH HOH B . 
Z 5 HOH 219 1443 459  HOH HOH B . 
Z 5 HOH 220 1444 460  HOH HOH B . 
Z 5 HOH 221 1445 461  HOH HOH B . 
Z 5 HOH 222 1446 462  HOH HOH B . 
Z 5 HOH 223 1447 463  HOH HOH B . 
Z 5 HOH 224 1448 466  HOH HOH B . 
Z 5 HOH 225 1449 467  HOH HOH B . 
Z 5 HOH 226 1450 468  HOH HOH B . 
Z 5 HOH 227 1451 470  HOH HOH B . 
Z 5 HOH 228 1452 471  HOH HOH B . 
Z 5 HOH 229 1453 472  HOH HOH B . 
Z 5 HOH 230 1454 473  HOH HOH B . 
Z 5 HOH 231 1455 478  HOH HOH B . 
Z 5 HOH 232 1456 479  HOH HOH B . 
Z 5 HOH 233 1457 481  HOH HOH B . 
Z 5 HOH 234 1458 484  HOH HOH B . 
Z 5 HOH 235 1459 486  HOH HOH B . 
Z 5 HOH 236 1460 488  HOH HOH B . 
Z 5 HOH 237 1461 489  HOH HOH B . 
Z 5 HOH 238 1462 491  HOH HOH B . 
Z 5 HOH 239 1463 493  HOH HOH B . 
Z 5 HOH 240 1464 494  HOH HOH B . 
Z 5 HOH 241 1465 495  HOH HOH B . 
Z 5 HOH 242 1466 496  HOH HOH B . 
Z 5 HOH 243 1467 500  HOH HOH B . 
Z 5 HOH 244 1468 501  HOH HOH B . 
Z 5 HOH 245 1469 502  HOH HOH B . 
Z 5 HOH 246 1470 503  HOH HOH B . 
Z 5 HOH 247 1471 505  HOH HOH B . 
Z 5 HOH 248 1472 506  HOH HOH B . 
Z 5 HOH 249 1473 508  HOH HOH B . 
Z 5 HOH 250 1474 509  HOH HOH B . 
Z 5 HOH 251 1475 515  HOH HOH B . 
Z 5 HOH 252 1476 517  HOH HOH B . 
Z 5 HOH 253 1477 519  HOH HOH B . 
Z 5 HOH 254 1478 520  HOH HOH B . 
Z 5 HOH 255 1479 521  HOH HOH B . 
Z 5 HOH 256 1480 528  HOH HOH B . 
Z 5 HOH 257 1481 529  HOH HOH B . 
Z 5 HOH 258 1482 533  HOH HOH B . 
Z 5 HOH 259 1483 535  HOH HOH B . 
Z 5 HOH 260 1484 537  HOH HOH B . 
Z 5 HOH 261 1485 538  HOH HOH B . 
Z 5 HOH 262 1486 539  HOH HOH B . 
Z 5 HOH 263 1487 540  HOH HOH B . 
Z 5 HOH 264 1488 541  HOH HOH B . 
Z 5 HOH 265 1489 543  HOH HOH B . 
Z 5 HOH 266 1490 544  HOH HOH B . 
Z 5 HOH 267 1491 545  HOH HOH B . 
Z 5 HOH 268 1492 546  HOH HOH B . 
Z 5 HOH 269 1493 547  HOH HOH B . 
Z 5 HOH 270 1494 549  HOH HOH B . 
Z 5 HOH 271 1495 550  HOH HOH B . 
Z 5 HOH 272 1496 553  HOH HOH B . 
Z 5 HOH 273 1497 555  HOH HOH B . 
Z 5 HOH 274 1498 556  HOH HOH B . 
Z 5 HOH 275 1499 558  HOH HOH B . 
Z 5 HOH 276 1500 563  HOH HOH B . 
Z 5 HOH 277 1501 564  HOH HOH B . 
Z 5 HOH 278 1502 568  HOH HOH B . 
Z 5 HOH 279 1503 569  HOH HOH B . 
Z 5 HOH 280 1504 573  HOH HOH B . 
Z 5 HOH 281 1505 574  HOH HOH B . 
Z 5 HOH 282 1506 579  HOH HOH B . 
Z 5 HOH 283 1507 580  HOH HOH B . 
Z 5 HOH 284 1508 581  HOH HOH B . 
Z 5 HOH 285 1509 582  HOH HOH B . 
Z 5 HOH 286 1510 583  HOH HOH B . 
Z 5 HOH 287 1511 584  HOH HOH B . 
Z 5 HOH 288 1512 585  HOH HOH B . 
Z 5 HOH 289 1513 586  HOH HOH B . 
Z 5 HOH 290 1514 587  HOH HOH B . 
Z 5 HOH 291 1515 588  HOH HOH B . 
Z 5 HOH 292 1516 589  HOH HOH B . 
Z 5 HOH 293 1517 590  HOH HOH B . 
Z 5 HOH 294 1518 591  HOH HOH B . 
Z 5 HOH 295 1519 592  HOH HOH B . 
Z 5 HOH 296 1520 598  HOH HOH B . 
Z 5 HOH 297 1521 606  HOH HOH B . 
Z 5 HOH 298 1522 614  HOH HOH B . 
Z 5 HOH 299 1523 617  HOH HOH B . 
Z 5 HOH 300 1524 618  HOH HOH B . 
Z 5 HOH 301 1525 622  HOH HOH B . 
Z 5 HOH 302 1526 627  HOH HOH B . 
Z 5 HOH 303 1527 629  HOH HOH B . 
Z 5 HOH 304 1528 630  HOH HOH B . 
Z 5 HOH 305 1529 634  HOH HOH B . 
Z 5 HOH 306 1530 636  HOH HOH B . 
Z 5 HOH 307 1531 640  HOH HOH B . 
Z 5 HOH 308 1532 642  HOH HOH B . 
Z 5 HOH 309 1533 644  HOH HOH B . 
Z 5 HOH 310 1534 647  HOH HOH B . 
Z 5 HOH 311 1535 648  HOH HOH B . 
Z 5 HOH 312 1536 649  HOH HOH B . 
Z 5 HOH 313 1537 650  HOH HOH B . 
Z 5 HOH 314 1538 655  HOH HOH B . 
Z 5 HOH 315 1539 657  HOH HOH B . 
Z 5 HOH 316 1540 659  HOH HOH B . 
Z 5 HOH 317 1541 660  HOH HOH B . 
Z 5 HOH 318 1542 663  HOH HOH B . 
Z 5 HOH 319 1543 664  HOH HOH B . 
Z 5 HOH 320 1544 665  HOH HOH B . 
Z 5 HOH 321 1545 668  HOH HOH B . 
Z 5 HOH 322 1546 671  HOH HOH B . 
Z 5 HOH 323 1547 674  HOH HOH B . 
Z 5 HOH 324 1548 675  HOH HOH B . 
Z 5 HOH 325 1549 677  HOH HOH B . 
Z 5 HOH 326 1550 682  HOH HOH B . 
Z 5 HOH 327 1551 683  HOH HOH B . 
Z 5 HOH 328 1552 685  HOH HOH B . 
Z 5 HOH 329 1553 687  HOH HOH B . 
Z 5 HOH 330 1554 688  HOH HOH B . 
Z 5 HOH 331 1555 689  HOH HOH B . 
Z 5 HOH 332 1556 690  HOH HOH B . 
Z 5 HOH 333 1557 695  HOH HOH B . 
Z 5 HOH 334 1558 696  HOH HOH B . 
Z 5 HOH 335 1559 699  HOH HOH B . 
Z 5 HOH 336 1560 705  HOH HOH B . 
Z 5 HOH 337 1561 708  HOH HOH B . 
Z 5 HOH 338 1562 709  HOH HOH B . 
Z 5 HOH 339 1563 711  HOH HOH B . 
Z 5 HOH 340 1564 712  HOH HOH B . 
Z 5 HOH 341 1565 713  HOH HOH B . 
Z 5 HOH 342 1566 714  HOH HOH B . 
Z 5 HOH 343 1567 715  HOH HOH B . 
Z 5 HOH 344 1568 717  HOH HOH B . 
Z 5 HOH 345 1569 719  HOH HOH B . 
Z 5 HOH 346 1570 720  HOH HOH B . 
Z 5 HOH 347 1571 721  HOH HOH B . 
Z 5 HOH 348 1572 722  HOH HOH B . 
Z 5 HOH 349 1573 723  HOH HOH B . 
Z 5 HOH 350 1574 724  HOH HOH B . 
Z 5 HOH 351 1575 725  HOH HOH B . 
Z 5 HOH 352 1576 727  HOH HOH B . 
Z 5 HOH 353 1577 729  HOH HOH B . 
Z 5 HOH 354 1578 731  HOH HOH B . 
Z 5 HOH 355 1579 732  HOH HOH B . 
Z 5 HOH 356 1580 733  HOH HOH B . 
Z 5 HOH 357 1581 735  HOH HOH B . 
Z 5 HOH 358 1582 736  HOH HOH B . 
Z 5 HOH 359 1583 737  HOH HOH B . 
Z 5 HOH 360 1584 738  HOH HOH B . 
Z 5 HOH 361 1585 739  HOH HOH B . 
Z 5 HOH 362 1586 741  HOH HOH B . 
Z 5 HOH 363 1587 742  HOH HOH B . 
Z 5 HOH 364 1588 744  HOH HOH B . 
Z 5 HOH 365 1589 745  HOH HOH B . 
Z 5 HOH 366 1590 746  HOH HOH B . 
Z 5 HOH 367 1591 747  HOH HOH B . 
Z 5 HOH 368 1592 749  HOH HOH B . 
Z 5 HOH 369 1593 750  HOH HOH B . 
Z 5 HOH 370 1594 751  HOH HOH B . 
Z 5 HOH 371 1595 752  HOH HOH B . 
Z 5 HOH 372 1596 753  HOH HOH B . 
Z 5 HOH 373 1597 754  HOH HOH B . 
Z 5 HOH 374 1598 756  HOH HOH B . 
Z 5 HOH 375 1599 758  HOH HOH B . 
Z 5 HOH 376 1600 763  HOH HOH B . 
Z 5 HOH 377 1601 765  HOH HOH B . 
Z 5 HOH 378 1602 782  HOH HOH B . 
Z 5 HOH 379 1603 784  HOH HOH B . 
Z 5 HOH 380 1604 785  HOH HOH B . 
Z 5 HOH 381 1605 786  HOH HOH B . 
Z 5 HOH 382 1606 787  HOH HOH B . 
Z 5 HOH 383 1607 789  HOH HOH B . 
Z 5 HOH 384 1608 790  HOH HOH B . 
Z 5 HOH 385 1609 791  HOH HOH B . 
Z 5 HOH 386 1610 793  HOH HOH B . 
Z 5 HOH 387 1611 795  HOH HOH B . 
Z 5 HOH 388 1612 796  HOH HOH B . 
Z 5 HOH 389 1613 798  HOH HOH B . 
Z 5 HOH 390 1614 800  HOH HOH B . 
Z 5 HOH 391 1615 801  HOH HOH B . 
Z 5 HOH 392 1616 802  HOH HOH B . 
Z 5 HOH 393 1617 804  HOH HOH B . 
Z 5 HOH 394 1618 805  HOH HOH B . 
Z 5 HOH 395 1619 808  HOH HOH B . 
Z 5 HOH 396 1620 810  HOH HOH B . 
Z 5 HOH 397 1621 811  HOH HOH B . 
Z 5 HOH 398 1622 813  HOH HOH B . 
Z 5 HOH 399 1623 815  HOH HOH B . 
Z 5 HOH 400 1624 816  HOH HOH B . 
Z 5 HOH 401 1625 818  HOH HOH B . 
Z 5 HOH 402 1626 822  HOH HOH B . 
Z 5 HOH 403 1627 823  HOH HOH B . 
Z 5 HOH 404 1628 824  HOH HOH B . 
Z 5 HOH 405 1629 829  HOH HOH B . 
Z 5 HOH 406 1630 830  HOH HOH B . 
Z 5 HOH 407 1631 832  HOH HOH B . 
Z 5 HOH 408 1632 834  HOH HOH B . 
Z 5 HOH 409 1633 835  HOH HOH B . 
Z 5 HOH 410 1634 836  HOH HOH B . 
Z 5 HOH 411 1635 838  HOH HOH B . 
Z 5 HOH 412 1636 839  HOH HOH B . 
Z 5 HOH 413 1637 840  HOH HOH B . 
Z 5 HOH 414 1638 842  HOH HOH B . 
Z 5 HOH 415 1639 844  HOH HOH B . 
Z 5 HOH 416 1640 845  HOH HOH B . 
Z 5 HOH 417 1641 846  HOH HOH B . 
Z 5 HOH 418 1642 847  HOH HOH B . 
Z 5 HOH 419 1643 851  HOH HOH B . 
Z 5 HOH 420 1644 855  HOH HOH B . 
Z 5 HOH 421 1645 858  HOH HOH B . 
Z 5 HOH 422 1646 863  HOH HOH B . 
Z 5 HOH 423 1647 865  HOH HOH B . 
Z 5 HOH 424 1648 866  HOH HOH B . 
Z 5 HOH 425 1649 868  HOH HOH B . 
Z 5 HOH 426 1650 870  HOH HOH B . 
Z 5 HOH 427 1651 873  HOH HOH B . 
Z 5 HOH 428 1652 874  HOH HOH B . 
Z 5 HOH 429 1653 876  HOH HOH B . 
Z 5 HOH 430 1654 877  HOH HOH B . 
Z 5 HOH 431 1655 878  HOH HOH B . 
Z 5 HOH 432 1656 881  HOH HOH B . 
Z 5 HOH 433 1657 882  HOH HOH B . 
Z 5 HOH 434 1658 883  HOH HOH B . 
Z 5 HOH 435 1659 885  HOH HOH B . 
Z 5 HOH 436 1660 889  HOH HOH B . 
Z 5 HOH 437 1661 892  HOH HOH B . 
Z 5 HOH 438 1662 893  HOH HOH B . 
Z 5 HOH 439 1663 895  HOH HOH B . 
Z 5 HOH 440 1664 896  HOH HOH B . 
Z 5 HOH 441 1665 899  HOH HOH B . 
Z 5 HOH 442 1666 907  HOH HOH B . 
Z 5 HOH 443 1667 909  HOH HOH B . 
Z 5 HOH 444 1668 915  HOH HOH B . 
Z 5 HOH 445 1669 916  HOH HOH B . 
Z 5 HOH 446 1670 918  HOH HOH B . 
Z 5 HOH 447 1671 922  HOH HOH B . 
Z 5 HOH 448 1672 923  HOH HOH B . 
Z 5 HOH 449 1673 924  HOH HOH B . 
Z 5 HOH 450 1674 925  HOH HOH B . 
Z 5 HOH 451 1675 926  HOH HOH B . 
Z 5 HOH 452 1676 927  HOH HOH B . 
Z 5 HOH 453 1677 928  HOH HOH B . 
Z 5 HOH 454 1678 929  HOH HOH B . 
Z 5 HOH 455 1679 931  HOH HOH B . 
Z 5 HOH 456 1680 933  HOH HOH B . 
Z 5 HOH 457 1681 934  HOH HOH B . 
Z 5 HOH 458 1682 936  HOH HOH B . 
Z 5 HOH 459 1683 942  HOH HOH B . 
Z 5 HOH 460 1684 943  HOH HOH B . 
Z 5 HOH 461 1685 944  HOH HOH B . 
Z 5 HOH 462 1686 945  HOH HOH B . 
Z 5 HOH 463 1687 947  HOH HOH B . 
Z 5 HOH 464 1688 948  HOH HOH B . 
Z 5 HOH 465 1689 949  HOH HOH B . 
Z 5 HOH 466 1690 959  HOH HOH B . 
Z 5 HOH 467 1691 960  HOH HOH B . 
Z 5 HOH 468 1692 961  HOH HOH B . 
Z 5 HOH 469 1693 962  HOH HOH B . 
Z 5 HOH 470 1694 964  HOH HOH B . 
Z 5 HOH 471 1695 965  HOH HOH B . 
Z 5 HOH 472 1696 967  HOH HOH B . 
Z 5 HOH 473 1697 969  HOH HOH B . 
Z 5 HOH 474 1698 979  HOH HOH B . 
Z 5 HOH 475 1699 981  HOH HOH B . 
Z 5 HOH 476 1700 984  HOH HOH B . 
Z 5 HOH 477 1701 985  HOH HOH B . 
Z 5 HOH 478 1702 986  HOH HOH B . 
Z 5 HOH 479 1703 987  HOH HOH B . 
Z 5 HOH 480 1704 991  HOH HOH B . 
Z 5 HOH 481 1705 992  HOH HOH B . 
Z 5 HOH 482 1706 996  HOH HOH B . 
Z 5 HOH 483 1707 997  HOH HOH B . 
Z 5 HOH 484 1708 998  HOH HOH B . 
Z 5 HOH 485 1709 1002 HOH HOH B . 
Z 5 HOH 486 1710 1003 HOH HOH B . 
Z 5 HOH 487 1711 1005 HOH HOH B . 
Z 5 HOH 488 1712 1008 HOH HOH B . 
Z 5 HOH 489 1713 1009 HOH HOH B . 
Z 5 HOH 490 1714 1010 HOH HOH B . 
Z 5 HOH 491 1715 1014 HOH HOH B . 
Z 5 HOH 492 1716 1016 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 17460 ? 
1 MORE         -190  ? 
1 'SSA (A^2)'  36950 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-11-02 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC       refinement       5.1.24         ? 1 
CrystalClear 'data reduction' '(MSC/RIGAKU)' ? 2 
d*TREK       'data scaling'   .              ? 3 
MOLREP       phasing          .              ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
RESIDUE 263 IS A LEU NOT A PHE AS SHOWN BY THE SEQUENCE OF THE CONSTRUCT AS WELL AS THE ELECTRON DENSITY MAP. IT APPEARS TO EMANATE FROM THE ORIGINAL EXPRESSED SEQUENCE TAG AND IS NOT A PCR ERROR. HENCE THIS IS A POLYMORPHISM IN
THE MAMMARY CELL LINE USED TO MAKE THE CDNA.
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 187 ? ? CG A ASP 187 ? ? OD2 A ASP 187 ? ? 123.92 118.30 5.62 0.90 N 
2 1 CB A ASP 457 ? ? CG A ASP 457 ? ? OD2 A ASP 457 ? ? 124.25 118.30 5.95 0.90 N 
3 1 CB B ASP 126 ? ? CG B ASP 126 ? ? OD2 B ASP 126 ? ? 123.89 118.30 5.59 0.90 N 
4 1 CB B ASP 187 ? ? CG B ASP 187 ? ? OD2 B ASP 187 ? ? 124.43 118.30 6.13 0.90 N 
5 1 CB B ASP 234 ? ? CG B ASP 234 ? ? OD2 B ASP 234 ? ? 124.11 118.30 5.81 0.90 N 
6 1 CB B ASP 267 ? ? CG B ASP 267 ? A OD2 B ASP 267 ? A 124.30 118.30 6.00 0.90 N 
7 1 CB B ASP 290 ? ? CG B ASP 290 ? ? OD2 B ASP 290 ? ? 125.93 118.30 7.63 0.90 N 
8 1 CB B ASP 457 ? ? CG B ASP 457 ? ? OD2 B ASP 457 ? ? 124.51 118.30 6.21 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 46  ? ? 74.73   -1.85   
2  1 LYS A 56  ? ? -80.54  31.80   
3  1 ASP A 160 ? ? -134.18 -52.77  
4  1 SER A 184 ? ? -142.05 -49.18  
5  1 SER A 277 ? ? -100.58 -161.93 
6  1 ASP A 341 ? ? -163.40 115.72  
7  1 THR A 374 ? ? -113.09 -137.95 
8  1 GLN A 511 ? ? -161.10 61.49   
9  1 HIS A 537 ? ? -106.28 -169.62 
10 1 LYS B 56  ? ? -82.98  33.44   
11 1 ASP B 160 ? ? -124.68 -54.23  
12 1 SER B 184 ? ? -136.39 -44.94  
13 1 SER B 209 ? ? -171.74 112.97  
14 1 ASP B 341 ? ? -162.98 116.84  
15 1 THR B 374 ? ? -117.11 -138.12 
16 1 ALA B 389 ? ? -120.78 -63.71  
17 1 GLN B 511 ? ? -155.56 56.70   
18 1 GLU B 529 ? ? -41.72  -71.61  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 0   ? A MET 1   
2  1 Y 1 A GLU 557 ? A GLU 558 
3  1 Y 1 A HIS 558 ? A HIS 559 
4  1 Y 1 A HIS 559 ? A HIS 560 
5  1 Y 1 A HIS 560 ? A HIS 561 
6  1 Y 1 A HIS 561 ? A HIS 562 
7  1 Y 1 A HIS 562 ? A HIS 563 
8  1 Y 1 A HIS 563 ? A HIS 564 
9  1 Y 1 B MET 0   ? B MET 1   
10 1 Y 1 B GLU 557 ? B GLU 558 
11 1 Y 1 B HIS 558 ? B HIS 559 
12 1 Y 1 B HIS 559 ? B HIS 560 
13 1 Y 1 B HIS 560 ? B HIS 561 
14 1 Y 1 B HIS 561 ? B HIS 562 
15 1 Y 1 B HIS 562 ? B HIS 563 
16 1 Y 1 B HIS 563 ? B HIS 564 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'        SO4 
3 BETA-MERCAPTOETHANOL BME 
4 GLYCEROL             GOL 
5 water                HOH 
#