data_1U0F
# 
_entry.id   1U0F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1U0F         
RCSB  RCSB023089   
WWPDB D_1000023089 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1U0E . unspecified 
PDB 1U0G . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1U0F 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Solomons, J.T.G.'  1 
'Zimmerly, E.M.'    2 
'Burns, S.'         3 
'Krishnamurthy, N.' 4 
'Swan, M.K.'        5 
'Krings, S.'        6 
'Muirhead, H.'      7 
'Chirgwin, J.'      8 
'Davies, C.'        9 
# 
_citation.id                        primary 
_citation.title                     
;The crystal structure of mouse phosphoglucose isomerase at 1.6A resolution and its complex with glucose 6-phosphate reveals the catalytic mechanism of sugar ring opening.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            342 
_citation.page_first                847 
_citation.page_last                 860 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15342241 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.07.085 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Graham Solomons, J.T.' 1 ? 
primary 'Zimmerly, E.M.'        2 ? 
primary 'Burns, S.'             3 ? 
primary 'Krishnamurthy, N.'     4 ? 
primary 'Swan, M.K.'            5 ? 
primary 'Krings, S.'            6 ? 
primary 'Muirhead, H.'          7 ? 
primary 'Chirgwin, J.'          8 ? 
primary 'Davies, C.'            9 ? 
# 
_cell.entry_id           1U0F 
_cell.length_a           69.400 
_cell.length_b           116.800 
_cell.length_c           73.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.60 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1U0F 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase'     63644.598 2   5.3.1.9 ? ? ? 
2 non-polymer man 6-O-phosphono-alpha-D-glucopyranose 260.136   1   ?       ? ? ? 
3 non-polymer man GLUCOSE-6-PHOSPHATE                 260.136   1   ?       ? ? ? 
4 non-polymer syn 'SULFATE ION'                       96.063    8   ?       ? ? ? 
5 non-polymer syn GLYCEROL                            92.094    12  ?       ? ? ? 
6 non-polymer syn BETA-MERCAPTOETHANOL                78.133    1   ?       ? ? ? 
7 water       nat water                               18.015    858 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI, Neuroleukin, NLK' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAA
RDNMFSGSKINYTEDRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGS
DLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMLEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLL
ALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTKLEHH
HHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAA
RDNMFSGSKINYTEDRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGS
DLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMLEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLL
ALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTKLEHH
HHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   LEU n 
1 5   THR n 
1 6   ARG n 
1 7   ASN n 
1 8   PRO n 
1 9   GLN n 
1 10  PHE n 
1 11  GLN n 
1 12  LYS n 
1 13  LEU n 
1 14  LEU n 
1 15  GLU n 
1 16  TRP n 
1 17  HIS n 
1 18  ARG n 
1 19  ALA n 
1 20  ASN n 
1 21  SER n 
1 22  ALA n 
1 23  ASN n 
1 24  LEU n 
1 25  LYS n 
1 26  LEU n 
1 27  ARG n 
1 28  GLU n 
1 29  LEU n 
1 30  PHE n 
1 31  GLU n 
1 32  ALA n 
1 33  ASP n 
1 34  PRO n 
1 35  GLU n 
1 36  ARG n 
1 37  PHE n 
1 38  ASN n 
1 39  ASN n 
1 40  PHE n 
1 41  SER n 
1 42  LEU n 
1 43  ASN n 
1 44  LEU n 
1 45  ASN n 
1 46  THR n 
1 47  ASN n 
1 48  HIS n 
1 49  GLY n 
1 50  HIS n 
1 51  ILE n 
1 52  LEU n 
1 53  VAL n 
1 54  ASP n 
1 55  TYR n 
1 56  SER n 
1 57  LYS n 
1 58  ASN n 
1 59  LEU n 
1 60  VAL n 
1 61  ASN n 
1 62  LYS n 
1 63  GLU n 
1 64  VAL n 
1 65  MET n 
1 66  GLN n 
1 67  MET n 
1 68  LEU n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  ALA n 
1 73  LYS n 
1 74  SER n 
1 75  ARG n 
1 76  GLY n 
1 77  VAL n 
1 78  GLU n 
1 79  ALA n 
1 80  ALA n 
1 81  ARG n 
1 82  ASP n 
1 83  ASN n 
1 84  MET n 
1 85  PHE n 
1 86  SER n 
1 87  GLY n 
1 88  SER n 
1 89  LYS n 
1 90  ILE n 
1 91  ASN n 
1 92  TYR n 
1 93  THR n 
1 94  GLU n 
1 95  ASP n 
1 96  ARG n 
1 97  ALA n 
1 98  VAL n 
1 99  LEU n 
1 100 HIS n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 ARG n 
1 105 ASN n 
1 106 ARG n 
1 107 SER n 
1 108 ASN n 
1 109 THR n 
1 110 PRO n 
1 111 ILE n 
1 112 LYS n 
1 113 VAL n 
1 114 ASP n 
1 115 GLY n 
1 116 LYS n 
1 117 ASP n 
1 118 VAL n 
1 119 MET n 
1 120 PRO n 
1 121 GLU n 
1 122 VAL n 
1 123 ASN n 
1 124 ARG n 
1 125 VAL n 
1 126 LEU n 
1 127 ASP n 
1 128 LYS n 
1 129 MET n 
1 130 LYS n 
1 131 SER n 
1 132 PHE n 
1 133 CYS n 
1 134 GLN n 
1 135 ARG n 
1 136 VAL n 
1 137 ARG n 
1 138 SER n 
1 139 GLY n 
1 140 ASP n 
1 141 TRP n 
1 142 LYS n 
1 143 GLY n 
1 144 TYR n 
1 145 THR n 
1 146 GLY n 
1 147 LYS n 
1 148 SER n 
1 149 ILE n 
1 150 THR n 
1 151 ASP n 
1 152 ILE n 
1 153 ILE n 
1 154 ASN n 
1 155 ILE n 
1 156 GLY n 
1 157 ILE n 
1 158 GLY n 
1 159 GLY n 
1 160 SER n 
1 161 ASP n 
1 162 LEU n 
1 163 GLY n 
1 164 PRO n 
1 165 LEU n 
1 166 MET n 
1 167 VAL n 
1 168 THR n 
1 169 GLU n 
1 170 ALA n 
1 171 LEU n 
1 172 LYS n 
1 173 PRO n 
1 174 TYR n 
1 175 SER n 
1 176 LYS n 
1 177 GLY n 
1 178 GLY n 
1 179 PRO n 
1 180 ARG n 
1 181 VAL n 
1 182 TRP n 
1 183 PHE n 
1 184 VAL n 
1 185 SER n 
1 186 ASN n 
1 187 ILE n 
1 188 ASP n 
1 189 GLY n 
1 190 THR n 
1 191 HIS n 
1 192 ILE n 
1 193 ALA n 
1 194 LYS n 
1 195 THR n 
1 196 LEU n 
1 197 ALA n 
1 198 SER n 
1 199 LEU n 
1 200 SER n 
1 201 PRO n 
1 202 GLU n 
1 203 THR n 
1 204 SER n 
1 205 LEU n 
1 206 PHE n 
1 207 ILE n 
1 208 ILE n 
1 209 ALA n 
1 210 SER n 
1 211 LYS n 
1 212 THR n 
1 213 PHE n 
1 214 THR n 
1 215 THR n 
1 216 GLN n 
1 217 GLU n 
1 218 THR n 
1 219 ILE n 
1 220 THR n 
1 221 ASN n 
1 222 ALA n 
1 223 GLU n 
1 224 THR n 
1 225 ALA n 
1 226 LYS n 
1 227 GLU n 
1 228 TRP n 
1 229 PHE n 
1 230 LEU n 
1 231 GLU n 
1 232 ALA n 
1 233 ALA n 
1 234 LYS n 
1 235 ASP n 
1 236 PRO n 
1 237 SER n 
1 238 ALA n 
1 239 VAL n 
1 240 ALA n 
1 241 LYS n 
1 242 HIS n 
1 243 PHE n 
1 244 VAL n 
1 245 ALA n 
1 246 LEU n 
1 247 SER n 
1 248 THR n 
1 249 ASN n 
1 250 THR n 
1 251 ALA n 
1 252 LYS n 
1 253 VAL n 
1 254 LYS n 
1 255 GLU n 
1 256 PHE n 
1 257 GLY n 
1 258 ILE n 
1 259 ASP n 
1 260 PRO n 
1 261 GLN n 
1 262 ASN n 
1 263 MET n 
1 264 LEU n 
1 265 GLU n 
1 266 PHE n 
1 267 TRP n 
1 268 ASP n 
1 269 TRP n 
1 270 VAL n 
1 271 GLY n 
1 272 GLY n 
1 273 ARG n 
1 274 TYR n 
1 275 SER n 
1 276 LEU n 
1 277 TRP n 
1 278 SER n 
1 279 ALA n 
1 280 ILE n 
1 281 GLY n 
1 282 LEU n 
1 283 SER n 
1 284 ILE n 
1 285 ALA n 
1 286 LEU n 
1 287 HIS n 
1 288 VAL n 
1 289 GLY n 
1 290 PHE n 
1 291 ASP n 
1 292 HIS n 
1 293 PHE n 
1 294 GLU n 
1 295 GLN n 
1 296 LEU n 
1 297 LEU n 
1 298 SER n 
1 299 GLY n 
1 300 ALA n 
1 301 HIS n 
1 302 TRP n 
1 303 MET n 
1 304 ASP n 
1 305 GLN n 
1 306 HIS n 
1 307 PHE n 
1 308 LEU n 
1 309 LYS n 
1 310 THR n 
1 311 PRO n 
1 312 LEU n 
1 313 GLU n 
1 314 LYS n 
1 315 ASN n 
1 316 ALA n 
1 317 PRO n 
1 318 VAL n 
1 319 LEU n 
1 320 LEU n 
1 321 ALA n 
1 322 LEU n 
1 323 LEU n 
1 324 GLY n 
1 325 ILE n 
1 326 TRP n 
1 327 TYR n 
1 328 ILE n 
1 329 ASN n 
1 330 CYS n 
1 331 TYR n 
1 332 GLY n 
1 333 CYS n 
1 334 GLU n 
1 335 THR n 
1 336 HIS n 
1 337 ALA n 
1 338 LEU n 
1 339 LEU n 
1 340 PRO n 
1 341 TYR n 
1 342 ASP n 
1 343 GLN n 
1 344 TYR n 
1 345 MET n 
1 346 HIS n 
1 347 ARG n 
1 348 PHE n 
1 349 ALA n 
1 350 ALA n 
1 351 TYR n 
1 352 PHE n 
1 353 GLN n 
1 354 GLN n 
1 355 GLY n 
1 356 ASP n 
1 357 MET n 
1 358 GLU n 
1 359 SER n 
1 360 ASN n 
1 361 GLY n 
1 362 LYS n 
1 363 TYR n 
1 364 ILE n 
1 365 THR n 
1 366 LYS n 
1 367 SER n 
1 368 GLY n 
1 369 ALA n 
1 370 ARG n 
1 371 VAL n 
1 372 ASP n 
1 373 HIS n 
1 374 GLN n 
1 375 THR n 
1 376 GLY n 
1 377 PRO n 
1 378 ILE n 
1 379 VAL n 
1 380 TRP n 
1 381 GLY n 
1 382 GLU n 
1 383 PRO n 
1 384 GLY n 
1 385 THR n 
1 386 ASN n 
1 387 GLY n 
1 388 GLN n 
1 389 HIS n 
1 390 ALA n 
1 391 PHE n 
1 392 TYR n 
1 393 GLN n 
1 394 LEU n 
1 395 ILE n 
1 396 HIS n 
1 397 GLN n 
1 398 GLY n 
1 399 THR n 
1 400 LYS n 
1 401 MET n 
1 402 ILE n 
1 403 PRO n 
1 404 CYS n 
1 405 ASP n 
1 406 PHE n 
1 407 LEU n 
1 408 ILE n 
1 409 PRO n 
1 410 VAL n 
1 411 GLN n 
1 412 THR n 
1 413 GLN n 
1 414 HIS n 
1 415 PRO n 
1 416 ILE n 
1 417 ARG n 
1 418 LYS n 
1 419 GLY n 
1 420 LEU n 
1 421 HIS n 
1 422 HIS n 
1 423 LYS n 
1 424 ILE n 
1 425 LEU n 
1 426 LEU n 
1 427 ALA n 
1 428 ASN n 
1 429 PHE n 
1 430 LEU n 
1 431 ALA n 
1 432 GLN n 
1 433 THR n 
1 434 GLU n 
1 435 ALA n 
1 436 LEU n 
1 437 MET n 
1 438 LYS n 
1 439 GLY n 
1 440 LYS n 
1 441 LEU n 
1 442 PRO n 
1 443 GLU n 
1 444 GLU n 
1 445 ALA n 
1 446 ARG n 
1 447 LYS n 
1 448 GLU n 
1 449 LEU n 
1 450 GLN n 
1 451 ALA n 
1 452 ALA n 
1 453 GLY n 
1 454 LYS n 
1 455 SER n 
1 456 PRO n 
1 457 GLU n 
1 458 ASP n 
1 459 LEU n 
1 460 GLU n 
1 461 LYS n 
1 462 LEU n 
1 463 LEU n 
1 464 PRO n 
1 465 HIS n 
1 466 LYS n 
1 467 VAL n 
1 468 PHE n 
1 469 GLU n 
1 470 GLY n 
1 471 ASN n 
1 472 ARG n 
1 473 PRO n 
1 474 THR n 
1 475 ASN n 
1 476 SER n 
1 477 ILE n 
1 478 VAL n 
1 479 PHE n 
1 480 THR n 
1 481 LYS n 
1 482 LEU n 
1 483 THR n 
1 484 PRO n 
1 485 PHE n 
1 486 ILE n 
1 487 LEU n 
1 488 GLY n 
1 489 ALA n 
1 490 LEU n 
1 491 ILE n 
1 492 ALA n 
1 493 MET n 
1 494 TYR n 
1 495 GLU n 
1 496 HIS n 
1 497 LYS n 
1 498 ILE n 
1 499 PHE n 
1 500 VAL n 
1 501 GLN n 
1 502 GLY n 
1 503 ILE n 
1 504 MET n 
1 505 TRP n 
1 506 ASP n 
1 507 ILE n 
1 508 ASN n 
1 509 SER n 
1 510 PHE n 
1 511 ASP n 
1 512 GLN n 
1 513 TRP n 
1 514 GLY n 
1 515 VAL n 
1 516 GLU n 
1 517 LEU n 
1 518 GLY n 
1 519 LYS n 
1 520 GLN n 
1 521 LEU n 
1 522 ALA n 
1 523 LYS n 
1 524 LYS n 
1 525 ILE n 
1 526 GLU n 
1 527 PRO n 
1 528 GLU n 
1 529 LEU n 
1 530 GLU n 
1 531 GLY n 
1 532 SER n 
1 533 SER n 
1 534 ALA n 
1 535 VAL n 
1 536 THR n 
1 537 SER n 
1 538 HIS n 
1 539 ASP n 
1 540 SER n 
1 541 SER n 
1 542 THR n 
1 543 ASN n 
1 544 GLY n 
1 545 LEU n 
1 546 ILE n 
1 547 SER n 
1 548 PHE n 
1 549 ILE n 
1 550 LYS n 
1 551 GLN n 
1 552 GLN n 
1 553 ARG n 
1 554 ASP n 
1 555 THR n 
1 556 LYS n 
1 557 LEU n 
1 558 GLU n 
1 559 HIS n 
1 560 HIS n 
1 561 HIS n 
1 562 HIS n 
1 563 HIS n 
1 564 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 Gpi 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3pLysS 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET5a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_MOUSE 
_struct_ref.pdbx_db_accession          P06745 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAA
RDNMFSGSKINYTEDRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGS
DLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLL
ALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTKLE
;
_struct_ref.pdbx_align_begin           0 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1U0F A 1 ? 558 ? P06745 0 ? 557 ? 0 557 
2 1 1U0F B 1 ? 558 ? P06745 0 ? 557 ? 0 557 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1U0F LEU A 264 ? UNP P06745 PHE 263 'SEE REMARK 999' 263 1  
1 1U0F HIS A 559 ? UNP P06745 ?   ?   'expression tag' 558 2  
1 1U0F HIS A 560 ? UNP P06745 ?   ?   'expression tag' 559 3  
1 1U0F HIS A 561 ? UNP P06745 ?   ?   'expression tag' 560 4  
1 1U0F HIS A 562 ? UNP P06745 ?   ?   'expression tag' 561 5  
1 1U0F HIS A 563 ? UNP P06745 ?   ?   'expression tag' 562 6  
1 1U0F HIS A 564 ? UNP P06745 ?   ?   'expression tag' 563 7  
2 1U0F LEU B 264 ? UNP P06745 PHE 263 'SEE REMARK 999' 263 8  
2 1U0F HIS B 559 ? UNP P06745 ?   ?   'expression tag' 558 9  
2 1U0F HIS B 560 ? UNP P06745 ?   ?   'expression tag' 559 10 
2 1U0F HIS B 561 ? UNP P06745 ?   ?   'expression tag' 560 11 
2 1U0F HIS B 562 ? UNP P06745 ?   ?   'expression tag' 561 12 
2 1U0F HIS B 563 ? UNP P06745 ?   ?   'expression tag' 562 13 
2 1U0F HIS B 564 ? UNP P06745 ?   ?   'expression tag' 563 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                             ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                            ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                          ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                     ?                               'C4 H7 N O4'     133.103 
BME non-polymer                   . BETA-MERCAPTOETHANOL                ?                               'C2 H6 O S'      78.133  
CYS 'L-peptide linking'           y CYSTEINE                            ?                               'C3 H7 N O2 S'   121.158 
G6P 'D-saccharide, alpha linking' n 6-O-phosphono-alpha-D-glucopyranose ?                               'C6 H13 O9 P'    260.136 
G6Q non-polymer                   . GLUCOSE-6-PHOSPHATE                 ?                               'C6 H13 O9 P'    260.136 
GLN 'L-peptide linking'           y GLUTAMINE                           ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                     ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                             ?                               'C2 H5 N O2'     75.067  
GOL non-polymer                   . GLYCEROL                            'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking'           y HISTIDINE                           ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                               ?                               'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                          ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                             ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                              ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                          ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE                       ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                             ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                              ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer                   . 'SULFATE ION'                       ?                               'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE                           ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                          ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                            ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                              ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1U0F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   41.5 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'1.9 M ammonium sulphate, 100 mM Tris-HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2002-08-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1U0F 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.6 
_reflns.d_resolution_low             45.0 
_reflns.number_all                   143578 
_reflns.number_obs                   143578 
_reflns.percent_possible_obs         94.7 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        34.1 
_reflns.B_iso_Wilson_estimate        19.8 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   79.9 
_reflns_shell.Rmerge_I_obs           0.369 
_reflns_shell.pdbx_Rsym_value        0.369 
_reflns_shell.meanI_over_sigI_obs    3.1 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      12096 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1U0F 
_refine.ls_number_reflns_obs                     143578 
_refine.ls_number_reflns_all                     143578 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.00 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    94.6 
_refine.ls_R_factor_obs                          0.18 
_refine.ls_R_factor_all                          0.18 
_refine.ls_R_factor_R_work                       0.178 
_refine.ls_R_factor_R_free                       0.207 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  7210 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.956 
_refine.B_iso_mean                               23.854 
_refine.aniso_B[1][1]                            0.01 
_refine.aniso_B[2][2]                            -1.55 
_refine.aniso_B[3][3]                            1.97 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.09 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'NATIVE STRUCTURE' 
_refine.pdbx_method_to_determine_struct          'REFINEMENT FROM THE NATIVE STRUCTURE' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.095 
_refine.pdbx_overall_ESU_R_Free                  0.092 
_refine.overall_SU_ML                            0.062 
_refine.overall_SU_B                             1.787 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8814 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         148 
_refine_hist.number_atoms_solvent             858 
_refine_hist.number_atoms_total               9820 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        45.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011 0.021 ? 9239  'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.213 1.952 ? 12487 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.578 5.000 ? 1110  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.100 0.200 ? 1360  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005 0.020 ? 6854  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.197 0.200 ? 4340  'X-RAY DIFFRACTION' ? 
r_nbd_other              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.137 0.200 ? 706   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.170 0.200 ? 52    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.114 0.200 ? 18    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.595 1.500 ? 5534  'X-RAY DIFFRACTION' ? 
r_mcbond_other           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.095 2.000 ? 8946  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.779 3.000 ? 3705  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.917 4.500 ? 3541  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.600 
_refine_ls_shell.d_res_low                        1.642 
_refine_ls_shell.number_reflns_R_work             8373 
_refine_ls_shell.R_factor_R_work                  0.232 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.252 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             437 
_refine_ls_shell.number_reflns_obs                8810 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1U0F 
_struct.title                     'Crystal structure of mouse phosphoglucose isomerase in complex with glucose 6-phosphate' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1U0F 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'aldose-ketose isomerase, dimer, Isomerase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 4 ? 
F  N N 4 ? 
G  N N 5 ? 
H  N N 5 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 6 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 7 ? 
AA N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological unit is a dimer. 
The asymmetric unit is a dimer
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 2   ? ASN A 7   ? ALA A 1   ASN A 6   1 ? 6  
HELX_P HELX_P2  2  ASN A 7   ? SER A 21  ? ASN A 6   SER A 20  1 ? 15 
HELX_P HELX_P3  3  ALA A 22  ? LEU A 24  ? ALA A 21  LEU A 23  5 ? 3  
HELX_P HELX_P4  4  LYS A 25  ? ASP A 33  ? LYS A 24  ASP A 32  1 ? 9  
HELX_P HELX_P5  5  GLU A 35  ? PHE A 40  ? GLU A 34  PHE A 39  1 ? 6  
HELX_P HELX_P6  6  ASN A 61  ? ARG A 75  ? ASN A 60  ARG A 74  1 ? 15 
HELX_P HELX_P7  7  GLY A 76  ? SER A 86  ? GLY A 75  SER A 85  1 ? 11 
HELX_P HELX_P8  8  LEU A 99  ? ARG A 104 ? LEU A 98  ARG A 103 1 ? 6  
HELX_P HELX_P9  9  VAL A 118 ? SER A 138 ? VAL A 117 SER A 137 1 ? 21 
HELX_P HELX_P10 10 ILE A 157 ? SER A 160 ? ILE A 156 SER A 159 5 ? 4  
HELX_P HELX_P11 11 ASP A 161 ? LEU A 171 ? ASP A 160 LEU A 170 1 ? 11 
HELX_P HELX_P12 12 LYS A 172 ? LYS A 176 ? LYS A 171 LYS A 175 5 ? 5  
HELX_P HELX_P13 13 ASP A 188 ? SER A 198 ? ASP A 187 SER A 197 1 ? 11 
HELX_P HELX_P14 14 LEU A 199 ? GLU A 202 ? LEU A 198 GLU A 201 5 ? 4  
HELX_P HELX_P15 15 THR A 215 ? LYS A 234 ? THR A 214 LYS A 233 1 ? 20 
HELX_P HELX_P16 16 ASP A 235 ? SER A 237 ? ASP A 234 SER A 236 5 ? 3  
HELX_P HELX_P17 17 ALA A 238 ? HIS A 242 ? ALA A 237 HIS A 241 1 ? 5  
HELX_P HELX_P18 18 ASN A 249 ? GLY A 257 ? ASN A 248 GLY A 256 1 ? 9  
HELX_P HELX_P19 19 ASP A 259 ? GLN A 261 ? ASP A 258 GLN A 260 5 ? 3  
HELX_P HELX_P20 20 GLY A 271 ? SER A 275 ? GLY A 270 SER A 274 5 ? 5  
HELX_P HELX_P21 21 SER A 278 ? ILE A 280 ? SER A 277 ILE A 279 5 ? 3  
HELX_P HELX_P22 22 GLY A 281 ? GLY A 289 ? GLY A 280 GLY A 288 1 ? 9  
HELX_P HELX_P23 23 GLY A 289 ? THR A 310 ? GLY A 288 THR A 309 1 ? 22 
HELX_P HELX_P24 24 PRO A 311 ? LYS A 314 ? PRO A 310 LYS A 313 5 ? 4  
HELX_P HELX_P25 25 ASN A 315 ? CYS A 330 ? ASN A 314 CYS A 329 1 ? 16 
HELX_P HELX_P26 26 ASP A 342 ? HIS A 346 ? ASP A 341 HIS A 345 5 ? 5  
HELX_P HELX_P27 27 ARG A 347 ? GLY A 361 ? ARG A 346 GLY A 360 1 ? 15 
HELX_P HELX_P28 28 THR A 385 ? ALA A 390 ? THR A 384 ALA A 389 5 ? 6  
HELX_P HELX_P29 29 PHE A 391 ? GLY A 398 ? PHE A 390 GLY A 397 1 ? 8  
HELX_P HELX_P30 30 ILE A 416 ? LYS A 418 ? ILE A 415 LYS A 417 5 ? 3  
HELX_P HELX_P31 31 GLY A 419 ? GLY A 439 ? GLY A 418 GLY A 438 1 ? 21 
HELX_P HELX_P32 32 LEU A 441 ? ALA A 452 ? LEU A 440 ALA A 451 1 ? 12 
HELX_P HELX_P33 33 SER A 455 ? LEU A 463 ? SER A 454 LEU A 462 1 ? 9  
HELX_P HELX_P34 34 PRO A 464 ? VAL A 467 ? PRO A 463 VAL A 466 5 ? 4  
HELX_P HELX_P35 35 THR A 483 ? ASP A 506 ? THR A 482 ASP A 505 1 ? 24 
HELX_P HELX_P36 36 GLN A 512 ? GLY A 514 ? GLN A 511 GLY A 513 5 ? 3  
HELX_P HELX_P37 37 VAL A 515 ? GLU A 530 ? VAL A 514 GLU A 529 1 ? 16 
HELX_P HELX_P38 38 ASP A 539 ? ARG A 553 ? ASP A 538 ARG A 552 1 ? 15 
HELX_P HELX_P39 39 ALA B 2   ? ASN B 7   ? ALA B 1   ASN B 6   1 ? 6  
HELX_P HELX_P40 40 ASN B 7   ? SER B 21  ? ASN B 6   SER B 20  1 ? 15 
HELX_P HELX_P41 41 ALA B 22  ? LEU B 24  ? ALA B 21  LEU B 23  5 ? 3  
HELX_P HELX_P42 42 LYS B 25  ? ASP B 33  ? LYS B 24  ASP B 32  1 ? 9  
HELX_P HELX_P43 43 GLU B 35  ? PHE B 40  ? GLU B 34  PHE B 39  1 ? 6  
HELX_P HELX_P44 44 ASN B 61  ? ARG B 75  ? ASN B 60  ARG B 74  1 ? 15 
HELX_P HELX_P45 45 GLY B 76  ? GLY B 87  ? GLY B 75  GLY B 86  1 ? 12 
HELX_P HELX_P46 46 LEU B 99  ? ARG B 104 ? LEU B 98  ARG B 103 1 ? 6  
HELX_P HELX_P47 47 VAL B 118 ? GLY B 139 ? VAL B 117 GLY B 138 1 ? 22 
HELX_P HELX_P48 48 ILE B 157 ? SER B 160 ? ILE B 156 SER B 159 5 ? 4  
HELX_P HELX_P49 49 ASP B 161 ? LEU B 171 ? ASP B 160 LEU B 170 1 ? 11 
HELX_P HELX_P50 50 LYS B 172 ? SER B 175 ? LYS B 171 SER B 174 5 ? 4  
HELX_P HELX_P51 51 ASP B 188 ? ALA B 197 ? ASP B 187 ALA B 196 1 ? 10 
HELX_P HELX_P52 52 THR B 215 ? LYS B 234 ? THR B 214 LYS B 233 1 ? 20 
HELX_P HELX_P53 53 ASP B 235 ? LYS B 241 ? ASP B 234 LYS B 240 5 ? 7  
HELX_P HELX_P54 54 ASN B 249 ? GLY B 257 ? ASN B 248 GLY B 256 1 ? 9  
HELX_P HELX_P55 55 ASP B 259 ? GLN B 261 ? ASP B 258 GLN B 260 5 ? 3  
HELX_P HELX_P56 56 GLY B 271 ? SER B 275 ? GLY B 270 SER B 274 5 ? 5  
HELX_P HELX_P57 57 SER B 278 ? ILE B 280 ? SER B 277 ILE B 279 5 ? 3  
HELX_P HELX_P58 58 GLY B 281 ? GLY B 289 ? GLY B 280 GLY B 288 1 ? 9  
HELX_P HELX_P59 59 GLY B 289 ? THR B 310 ? GLY B 288 THR B 309 1 ? 22 
HELX_P HELX_P60 60 PRO B 311 ? LYS B 314 ? PRO B 310 LYS B 313 5 ? 4  
HELX_P HELX_P61 61 ASN B 315 ? CYS B 330 ? ASN B 314 CYS B 329 1 ? 16 
HELX_P HELX_P62 62 ASP B 342 ? HIS B 346 ? ASP B 341 HIS B 345 5 ? 5  
HELX_P HELX_P63 63 ARG B 347 ? GLY B 361 ? ARG B 346 GLY B 360 1 ? 15 
HELX_P HELX_P64 64 THR B 385 ? ALA B 390 ? THR B 384 ALA B 389 5 ? 6  
HELX_P HELX_P65 65 PHE B 391 ? GLY B 398 ? PHE B 390 GLY B 397 1 ? 8  
HELX_P HELX_P66 66 ILE B 416 ? LYS B 418 ? ILE B 415 LYS B 417 5 ? 3  
HELX_P HELX_P67 67 GLY B 419 ? GLY B 439 ? GLY B 418 GLY B 438 1 ? 21 
HELX_P HELX_P68 68 LEU B 441 ? ALA B 452 ? LEU B 440 ALA B 451 1 ? 12 
HELX_P HELX_P69 69 SER B 455 ? VAL B 467 ? SER B 454 VAL B 466 1 ? 13 
HELX_P HELX_P70 70 THR B 483 ? ASP B 506 ? THR B 482 ASP B 505 1 ? 24 
HELX_P HELX_P71 71 GLN B 512 ? GLY B 514 ? GLN B 511 GLY B 513 5 ? 3  
HELX_P HELX_P72 72 VAL B 515 ? GLU B 530 ? VAL B 514 GLU B 529 1 ? 16 
HELX_P HELX_P73 73 ASP B 539 ? ARG B 553 ? ASP B 538 ARG B 552 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 384 A . ? GLY 383 A THR 385 A ? THR 384 A 1 4.52 
2 GLY 384 B . ? GLY 383 B THR 385 B ? THR 384 B 1 4.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 5 ? 
D ? 6 ? 
E ? 2 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 41  ? ASN A 45  ? SER A 40  ASN A 44  
A 2 HIS A 50  ? ASP A 54  ? HIS A 49  ASP A 53  
A 3 THR A 474 ? LYS A 481 ? THR A 473 LYS A 480 
A 4 CYS A 404 ? GLN A 411 ? CYS A 403 GLN A 410 
A 5 THR A 335 ? PRO A 340 ? THR A 334 PRO A 339 
A 6 ILE A 378 ? TRP A 380 ? ILE A 377 TRP A 379 
B 1 LYS A 112 ? VAL A 113 ? LYS A 111 VAL A 112 
B 2 LYS A 116 ? ASP A 117 ? LYS A 115 ASP A 116 
C 1 ARG A 180 ? VAL A 184 ? ARG A 179 VAL A 183 
C 2 ASP A 151 ? ILE A 155 ? ASP A 150 ILE A 154 
C 3 SER A 204 ? ALA A 209 ? SER A 203 ALA A 208 
C 4 PHE A 243 ? SER A 247 ? PHE A 242 SER A 246 
C 5 MET A 263 ? GLU A 265 ? MET A 262 GLU A 264 
D 1 SER B 41  ? ASN B 45  ? SER B 40  ASN B 44  
D 2 HIS B 50  ? ASP B 54  ? HIS B 49  ASP B 53  
D 3 THR B 474 ? LYS B 481 ? THR B 473 LYS B 480 
D 4 CYS B 404 ? GLN B 411 ? CYS B 403 GLN B 410 
D 5 THR B 335 ? PRO B 340 ? THR B 334 PRO B 339 
D 6 ILE B 378 ? TRP B 380 ? ILE B 377 TRP B 379 
E 1 LYS B 112 ? VAL B 113 ? LYS B 111 VAL B 112 
E 2 LYS B 116 ? ASP B 117 ? LYS B 115 ASP B 116 
F 1 ARG B 180 ? VAL B 184 ? ARG B 179 VAL B 183 
F 2 ASP B 151 ? ILE B 155 ? ASP B 150 ILE B 154 
F 3 SER B 204 ? ALA B 209 ? SER B 203 ALA B 208 
F 4 PHE B 243 ? LEU B 246 ? PHE B 242 LEU B 245 
F 5 MET B 263 ? LEU B 264 ? MET B 262 LEU B 263 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 44  ? N LEU A 43  O ILE A 51  ? O ILE A 50  
A 2 3 N LEU A 52  ? N LEU A 51  O VAL A 478 ? O VAL A 477 
A 3 4 O ILE A 477 ? O ILE A 476 N PHE A 406 ? N PHE A 405 
A 4 5 O ASP A 405 ? O ASP A 404 N LEU A 339 ? N LEU A 338 
A 5 6 N LEU A 338 ? N LEU A 337 O TRP A 380 ? O TRP A 379 
B 1 2 N VAL A 113 ? N VAL A 112 O LYS A 116 ? O LYS A 115 
C 1 2 O VAL A 184 ? O VAL A 183 N ASN A 154 ? N ASN A 153 
C 2 3 N ILE A 153 ? N ILE A 152 O ILE A 207 ? O ILE A 206 
C 3 4 N ILE A 208 ? N ILE A 207 O VAL A 244 ? O VAL A 243 
C 4 5 N ALA A 245 ? N ALA A 244 O LEU A 264 ? O LEU A 263 
D 1 2 N LEU B 42  ? N LEU B 41  O VAL B 53  ? O VAL B 52  
D 2 3 N LEU B 52  ? N LEU B 51  O VAL B 478 ? O VAL B 477 
D 3 4 O ILE B 477 ? O ILE B 476 N PHE B 406 ? N PHE B 405 
D 4 5 O ASP B 405 ? O ASP B 404 N LEU B 339 ? N LEU B 338 
D 5 6 N LEU B 338 ? N LEU B 337 O TRP B 380 ? O TRP B 379 
E 1 2 N VAL B 113 ? N VAL B 112 O LYS B 116 ? O LYS B 115 
F 1 2 O VAL B 184 ? O VAL B 183 N ASN B 154 ? N ASN B 153 
F 2 3 N ILE B 153 ? N ILE B 152 O ILE B 207 ? O ILE B 206 
F 3 4 N ILE B 208 ? N ILE B 207 O VAL B 244 ? O VAL B 243 
F 4 5 N ALA B 245 ? N ALA B 244 O LEU B 264 ? O LEU B 263 
# 
_database_PDB_matrix.entry_id          1U0F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1U0F 
_atom_sites.fract_transf_matrix[1][1]   0.014409 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002958 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008562 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013814 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A  1 2   ? 9.922   -23.704 -8.806  1.00 23.05 ? 1    ALA A N   1 
ATOM   2    C CA  . ALA A  1 2   ? 10.670  -22.410 -8.879  1.00 22.77 ? 1    ALA A CA  1 
ATOM   3    C C   . ALA A  1 2   ? 11.843  -22.550 -9.842  1.00 22.90 ? 1    ALA A C   1 
ATOM   4    O O   . ALA A  1 2   ? 12.572  -23.544 -9.805  1.00 23.52 ? 1    ALA A O   1 
ATOM   5    C CB  . ALA A  1 2   ? 11.162  -22.008 -7.494  1.00 22.26 ? 1    ALA A CB  1 
ATOM   6    N N   . ALA A  1 3   ? 12.028  -21.536 -10.679 1.00 23.13 ? 2    ALA A N   1 
ATOM   7    C CA  . ALA A  1 3   ? 12.986  -21.590 -11.782 1.00 23.30 ? 2    ALA A CA  1 
ATOM   8    C C   . ALA A  1 3   ? 14.438  -21.835 -11.364 1.00 23.57 ? 2    ALA A C   1 
ATOM   9    O O   . ALA A  1 3   ? 15.162  -22.560 -12.063 1.00 23.57 ? 2    ALA A O   1 
ATOM   10   C CB  . ALA A  1 3   ? 12.872  -20.335 -12.654 1.00 22.71 ? 2    ALA A CB  1 
ATOM   11   N N   . LEU A  1 4   ? 14.874  -21.249 -10.238 1.00 23.68 ? 3    LEU A N   1 
ATOM   12   C CA  . LEU A  1 4   ? 16.257  -21.407 -9.802  1.00 23.65 ? 3    LEU A CA  1 
ATOM   13   C C   . LEU A  1 4   ? 16.607  -22.847 -9.427  1.00 23.98 ? 3    LEU A C   1 
ATOM   14   O O   . LEU A  1 4   ? 17.625  -23.374 -9.874  1.00 23.66 ? 3    LEU A O   1 
ATOM   15   C CB  . LEU A  1 4   ? 16.612  -20.453 -8.642  1.00 23.73 ? 3    LEU A CB  1 
ATOM   16   C CG  . LEU A  1 4   ? 18.068  -20.575 -8.163  1.00 23.29 ? 3    LEU A CG  1 
ATOM   17   C CD1 . LEU A  1 4   ? 19.067  -20.123 -9.246  1.00 24.48 ? 3    LEU A CD1 1 
ATOM   18   C CD2 . LEU A  1 4   ? 18.283  -19.808 -6.848  1.00 24.37 ? 3    LEU A CD2 1 
ATOM   19   N N   . THR A  1 5   ? 15.767  -23.487 -8.621  1.00 24.27 ? 4    THR A N   1 
ATOM   20   C CA  . THR A  1 5   ? 16.116  -24.809 -8.102  1.00 24.79 ? 4    THR A CA  1 
ATOM   21   C C   . THR A  1 5   ? 15.964  -25.883 -9.170  1.00 24.78 ? 4    THR A C   1 
ATOM   22   O O   . THR A  1 5   ? 16.565  -26.943 -9.050  1.00 24.79 ? 4    THR A O   1 
ATOM   23   C CB  . THR A  1 5   ? 15.307  -25.155 -6.847  1.00 25.18 ? 4    THR A CB  1 
ATOM   24   O OG1 . THR A  1 5   ? 14.005  -24.586 -6.962  1.00 25.99 ? 4    THR A OG1 1 
ATOM   25   C CG2 . THR A  1 5   ? 15.886  -24.428 -5.630  1.00 25.77 ? 4    THR A CG2 1 
ATOM   26   N N   . ARG A  1 6   ? 15.183  -25.579 -10.211 1.00 24.91 ? 5    ARG A N   1 
ATOM   27   C CA  . ARG A  1 6   ? 15.015  -26.468 -11.379 1.00 25.54 ? 5    ARG A CA  1 
ATOM   28   C C   . ARG A  1 6   ? 16.149  -26.318 -12.397 1.00 25.56 ? 5    ARG A C   1 
ATOM   29   O O   . ARG A  1 6   ? 16.302  -27.149 -13.306 1.00 26.20 ? 5    ARG A O   1 
ATOM   30   C CB  . ARG A  1 6   ? 13.679  -26.197 -12.084 1.00 25.88 ? 5    ARG A CB  1 
ATOM   31   C CG  . ARG A  1 6   ? 12.452  -26.697 -11.337 1.00 28.68 ? 5    ARG A CG  1 
ATOM   32   C CD  . ARG A  1 6   ? 11.175  -26.703 -12.175 1.00 34.69 ? 5    ARG A CD  1 
ATOM   33   N NE  . ARG A  1 6   ? 10.647  -28.060 -12.357 1.00 39.71 ? 5    ARG A NE  1 
ATOM   34   C CZ  . ARG A  1 6   ? 10.188  -28.547 -13.511 1.00 41.97 ? 5    ARG A CZ  1 
ATOM   35   N NH1 . ARG A  1 6   ? 10.181  -27.795 -14.609 1.00 43.89 ? 5    ARG A NH1 1 
ATOM   36   N NH2 . ARG A  1 6   ? 9.730   -29.792 -13.569 1.00 42.77 ? 5    ARG A NH2 1 
ATOM   37   N N   . ASN A  1 7   ? 16.936  -25.259 -12.252 1.00 24.60 ? 6    ASN A N   1 
ATOM   38   C CA  . ASN A  1 7   ? 18.028  -24.964 -13.172 1.00 24.58 ? 6    ASN A CA  1 
ATOM   39   C C   . ASN A  1 7   ? 19.235  -25.902 -12.983 1.00 24.46 ? 6    ASN A C   1 
ATOM   40   O O   . ASN A  1 7   ? 19.750  -26.043 -11.875 1.00 23.78 ? 6    ASN A O   1 
ATOM   41   C CB  . ASN A  1 7   ? 18.408  -23.482 -13.035 1.00 24.20 ? 6    ASN A CB  1 
ATOM   42   C CG  . ASN A  1 7   ? 19.519  -23.075 -13.964 1.00 24.19 ? 6    ASN A CG  1 
ATOM   43   O OD1 . ASN A  1 7   ? 20.672  -23.443 -13.751 1.00 25.26 ? 6    ASN A OD1 1 
ATOM   44   N ND2 . ASN A  1 7   ? 19.187  -22.304 -14.993 1.00 24.39 ? 6    ASN A ND2 1 
ATOM   45   N N   . PRO A  1 8   ? 19.690  -26.556 -14.056 1.00 24.49 ? 7    PRO A N   1 
ATOM   46   C CA  . PRO A  1 8   ? 20.752  -27.559 -13.937 1.00 25.12 ? 7    PRO A CA  1 
ATOM   47   C C   . PRO A  1 8   ? 22.098  -26.974 -13.507 1.00 25.23 ? 7    PRO A C   1 
ATOM   48   O O   . PRO A  1 8   ? 22.855  -27.660 -12.815 1.00 25.49 ? 7    PRO A O   1 
ATOM   49   C CB  . PRO A  1 8   ? 20.843  -28.150 -15.351 1.00 24.68 ? 7    PRO A CB  1 
ATOM   50   C CG  . PRO A  1 8   ? 20.318  -27.104 -16.235 1.00 25.83 ? 7    PRO A CG  1 
ATOM   51   C CD  . PRO A  1 8   ? 19.235  -26.396 -15.450 1.00 24.86 ? 7    PRO A CD  1 
ATOM   52   N N   . GLN A  1 9   ? 22.383  -25.733 -13.907 1.00 25.60 ? 8    GLN A N   1 
ATOM   53   C CA  . GLN A  1 9   ? 23.615  -25.054 -13.492 1.00 25.59 ? 8    GLN A CA  1 
ATOM   54   C C   . GLN A  1 9   ? 23.612  -24.777 -11.999 1.00 24.95 ? 8    GLN A C   1 
ATOM   55   O O   . GLN A  1 9   ? 24.657  -24.827 -11.368 1.00 24.84 ? 8    GLN A O   1 
ATOM   56   C CB  . GLN A  1 9   ? 23.833  -23.748 -14.261 1.00 26.05 ? 8    GLN A CB  1 
ATOM   57   C CG  . GLN A  1 9   ? 24.410  -23.935 -15.672 1.00 28.29 ? 8    GLN A CG  1 
ATOM   58   C CD  . GLN A  1 9   ? 23.574  -24.876 -16.535 1.00 30.58 ? 8    GLN A CD  1 
ATOM   59   O OE1 . GLN A  1 9   ? 24.010  -25.987 -16.851 1.00 33.56 ? 8    GLN A OE1 1 
ATOM   60   N NE2 . GLN A  1 9   ? 22.370  -24.445 -16.897 1.00 29.92 ? 8    GLN A NE2 1 
ATOM   61   N N   . PHE A  1 10  ? 22.437  -24.482 -11.445 1.00 24.47 ? 9    PHE A N   1 
ATOM   62   C CA  . PHE A  1 10  ? 22.306  -24.288 -10.003 1.00 24.24 ? 9    PHE A CA  1 
ATOM   63   C C   . PHE A  1 10  ? 22.519  -25.592 -9.231  1.00 24.15 ? 9    PHE A C   1 
ATOM   64   O O   . PHE A  1 10  ? 23.232  -25.614 -8.227  1.00 23.57 ? 9    PHE A O   1 
ATOM   65   C CB  . PHE A  1 10  ? 20.953  -23.653 -9.633  1.00 24.07 ? 9    PHE A CB  1 
ATOM   66   C CG  . PHE A  1 10  ? 20.748  -23.533 -8.158  1.00 24.76 ? 9    PHE A CG  1 
ATOM   67   C CD1 . PHE A  1 10  ? 21.422  -22.550 -7.428  1.00 25.43 ? 9    PHE A CD1 1 
ATOM   68   C CD2 . PHE A  1 10  ? 19.935  -24.441 -7.480  1.00 24.45 ? 9    PHE A CD2 1 
ATOM   69   C CE1 . PHE A  1 10  ? 21.269  -22.453 -6.049  1.00 25.21 ? 9    PHE A CE1 1 
ATOM   70   C CE2 . PHE A  1 10  ? 19.774  -24.359 -6.085  1.00 26.14 ? 9    PHE A CE2 1 
ATOM   71   C CZ  . PHE A  1 10  ? 20.443  -23.357 -5.373  1.00 26.21 ? 9    PHE A CZ  1 
ATOM   72   N N   . GLN A  1 11  ? 21.909  -26.678 -9.711  1.00 24.22 ? 10   GLN A N   1 
ATOM   73   C CA  . GLN A  1 11  ? 22.068  -27.981 -9.059  1.00 24.68 ? 10   GLN A CA  1 
ATOM   74   C C   . GLN A  1 11  ? 23.539  -28.431 -9.021  1.00 24.60 ? 10   GLN A C   1 
ATOM   75   O O   . GLN A  1 11  ? 23.999  -28.978 -8.004  1.00 24.79 ? 10   GLN A O   1 
ATOM   76   C CB  . GLN A  1 11  ? 21.150  -29.047 -9.683  1.00 24.90 ? 10   GLN A CB  1 
ATOM   77   C CG  A GLN A  1 11  ? 19.655  -28.960 -9.251  0.35 24.31 ? 10   GLN A CG  1 
ATOM   78   C CG  B GLN A  1 11  ? 19.790  -28.496 -10.131 0.65 26.19 ? 10   GLN A CG  1 
ATOM   79   C CD  A GLN A  1 11  ? 19.410  -28.927 -7.734  0.35 24.20 ? 10   GLN A CD  1 
ATOM   80   C CD  B GLN A  1 11  ? 18.826  -29.564 -10.608 0.65 28.76 ? 10   GLN A CD  1 
ATOM   81   O OE1 A GLN A  1 11  ? 18.664  -28.072 -7.241  0.35 24.14 ? 10   GLN A OE1 1 
ATOM   82   O OE1 B GLN A  1 11  ? 17.641  -29.535 -10.260 0.65 29.53 ? 10   GLN A OE1 1 
ATOM   83   N NE2 A GLN A  1 11  ? 19.999  -29.870 -7.006  0.35 24.48 ? 10   GLN A NE2 1 
ATOM   84   N NE2 B GLN A  1 11  ? 19.319  -30.496 -11.419 0.65 30.20 ? 10   GLN A NE2 1 
ATOM   85   N N   . LYS A  1 12  ? 24.268  -28.146 -10.100 1.00 24.93 ? 11   LYS A N   1 
ATOM   86   C CA  . LYS A  1 12  ? 25.706  -28.403 -10.186 1.00 25.45 ? 11   LYS A CA  1 
ATOM   87   C C   . LYS A  1 12  ? 26.463  -27.630 -9.110  1.00 25.30 ? 11   LYS A C   1 
ATOM   88   O O   . LYS A  1 12  ? 27.286  -28.195 -8.388  1.00 25.52 ? 11   LYS A O   1 
ATOM   89   C CB  . LYS A  1 12  ? 26.237  -28.032 -11.579 1.00 25.78 ? 11   LYS A CB  1 
ATOM   90   C CG  . LYS A  1 12  ? 27.690  -28.446 -11.835 1.00 28.06 ? 11   LYS A CG  1 
ATOM   91   C CD  . LYS A  1 12  ? 28.127  -28.100 -13.267 1.00 32.31 ? 11   LYS A CD  1 
ATOM   92   C CE  . LYS A  1 12  ? 29.572  -28.517 -13.523 1.00 33.69 ? 11   LYS A CE  1 
ATOM   93   N NZ  . LYS A  1 12  ? 30.228  -27.645 -14.545 1.00 36.34 ? 11   LYS A NZ  1 
ATOM   94   N N   . LEU A  1 13  ? 26.159  -26.337 -8.999  1.00 24.85 ? 12   LEU A N   1 
ATOM   95   C CA  . LEU A  1 13  ? 26.787  -25.481 -7.995  1.00 24.01 ? 12   LEU A CA  1 
ATOM   96   C C   . LEU A  1 13  ? 26.525  -26.015 -6.585  1.00 23.98 ? 12   LEU A C   1 
ATOM   97   O O   . LEU A  1 13  ? 27.438  -26.108 -5.768  1.00 22.88 ? 12   LEU A O   1 
ATOM   98   C CB  . LEU A  1 13  ? 26.278  -24.036 -8.139  1.00 24.41 ? 12   LEU A CB  1 
ATOM   99   C CG  . LEU A  1 13  ? 26.887  -22.963 -7.236  1.00 24.43 ? 12   LEU A CG  1 
ATOM   100  C CD1 . LEU A  1 13  ? 28.227  -22.443 -7.801  1.00 23.60 ? 12   LEU A CD1 1 
ATOM   101  C CD2 . LEU A  1 13  ? 25.891  -21.826 -7.050  1.00 24.58 ? 12   LEU A CD2 1 
ATOM   102  N N   . LEU A  1 14  ? 25.271  -26.363 -6.314  1.00 23.96 ? 13   LEU A N   1 
ATOM   103  C CA  . LEU A  1 14  ? 24.888  -26.884 -5.006  1.00 24.59 ? 13   LEU A CA  1 
ATOM   104  C C   . LEU A  1 14  ? 25.607  -28.200 -4.694  1.00 24.91 ? 13   LEU A C   1 
ATOM   105  O O   . LEU A  1 14  ? 26.115  -28.375 -3.600  1.00 25.16 ? 13   LEU A O   1 
ATOM   106  C CB  . LEU A  1 14  ? 23.374  -27.047 -4.921  1.00 24.70 ? 13   LEU A CB  1 
ATOM   107  C CG  . LEU A  1 14  ? 22.736  -27.330 -3.556  1.00 26.37 ? 13   LEU A CG  1 
ATOM   108  C CD1 . LEU A  1 14  ? 23.220  -26.375 -2.441  1.00 26.96 ? 13   LEU A CD1 1 
ATOM   109  C CD2 . LEU A  1 14  ? 21.212  -27.233 -3.742  1.00 27.13 ? 13   LEU A CD2 1 
ATOM   110  N N   . GLU A  1 15  ? 25.656  -29.104 -5.668  1.00 25.55 ? 14   GLU A N   1 
ATOM   111  C CA  . GLU A  1 15  ? 26.351  -30.379 -5.520  1.00 27.02 ? 14   GLU A CA  1 
ATOM   112  C C   . GLU A  1 15  ? 27.849  -30.198 -5.239  1.00 26.08 ? 14   GLU A C   1 
ATOM   113  O O   . GLU A  1 15  ? 28.404  -30.851 -4.349  1.00 26.16 ? 14   GLU A O   1 
ATOM   114  C CB  . GLU A  1 15  ? 26.134  -31.235 -6.774  1.00 27.50 ? 14   GLU A CB  1 
ATOM   115  C CG  . GLU A  1 15  ? 25.653  -32.645 -6.481  1.00 33.45 ? 14   GLU A CG  1 
ATOM   116  C CD  . GLU A  1 15  ? 24.412  -33.018 -7.273  1.00 38.88 ? 14   GLU A CD  1 
ATOM   117  O OE1 . GLU A  1 15  ? 24.423  -32.874 -8.524  1.00 41.76 ? 14   GLU A OE1 1 
ATOM   118  O OE2 . GLU A  1 15  ? 23.421  -33.468 -6.644  1.00 42.59 ? 14   GLU A OE2 1 
ATOM   119  N N   . TRP A  1 16  ? 28.487  -29.305 -5.993  1.00 26.19 ? 15   TRP A N   1 
ATOM   120  C CA  . TRP A  1 16  ? 29.889  -28.943 -5.759  1.00 25.60 ? 15   TRP A CA  1 
ATOM   121  C C   . TRP A  1 16  ? 30.090  -28.405 -4.348  1.00 25.54 ? 15   TRP A C   1 
ATOM   122  O O   . TRP A  1 16  ? 31.016  -28.819 -3.648  1.00 24.60 ? 15   TRP A O   1 
ATOM   123  C CB  . TRP A  1 16  ? 30.380  -27.915 -6.784  1.00 25.46 ? 15   TRP A CB  1 
ATOM   124  C CG  . TRP A  1 16  ? 31.886  -27.764 -6.800  1.00 26.87 ? 15   TRP A CG  1 
ATOM   125  C CD1 . TRP A  1 16  ? 32.761  -28.357 -7.677  1.00 28.49 ? 15   TRP A CD1 1 
ATOM   126  C CD2 . TRP A  1 16  ? 32.698  -26.985 -5.897  1.00 27.52 ? 15   TRP A CD2 1 
ATOM   127  N NE1 . TRP A  1 16  ? 34.053  -27.996 -7.377  1.00 27.81 ? 15   TRP A NE1 1 
ATOM   128  C CE2 . TRP A  1 16  ? 34.048  -27.158 -6.291  1.00 27.59 ? 15   TRP A CE2 1 
ATOM   129  C CE3 . TRP A  1 16  ? 32.419  -26.151 -4.796  1.00 27.01 ? 15   TRP A CE3 1 
ATOM   130  C CZ2 . TRP A  1 16  ? 35.114  -26.532 -5.631  1.00 28.05 ? 15   TRP A CZ2 1 
ATOM   131  C CZ3 . TRP A  1 16  ? 33.476  -25.548 -4.127  1.00 26.59 ? 15   TRP A CZ3 1 
ATOM   132  C CH2 . TRP A  1 16  ? 34.815  -25.733 -4.558  1.00 26.85 ? 15   TRP A CH2 1 
ATOM   133  N N   . HIS A  1 17  ? 29.217  -27.482 -3.934  1.00 25.67 ? 16   HIS A N   1 
ATOM   134  C CA  . HIS A  1 17  ? 29.263  -26.942 -2.578  1.00 25.59 ? 16   HIS A CA  1 
ATOM   135  C C   . HIS A  1 17  ? 29.190  -28.044 -1.524  1.00 26.13 ? 16   HIS A C   1 
ATOM   136  O O   . HIS A  1 17  ? 29.971  -28.047 -0.576  1.00 25.91 ? 16   HIS A O   1 
ATOM   137  C CB  . HIS A  1 17  ? 28.148  -25.897 -2.362  1.00 25.33 ? 16   HIS A CB  1 
ATOM   138  C CG  . HIS A  1 17  ? 28.163  -25.276 -0.998  1.00 24.53 ? 16   HIS A CG  1 
ATOM   139  N ND1 . HIS A  1 17  ? 27.527  -25.840 0.085   1.00 25.75 ? 16   HIS A ND1 1 
ATOM   140  C CD2 . HIS A  1 17  ? 28.737  -24.138 -0.544  1.00 23.29 ? 16   HIS A CD2 1 
ATOM   141  C CE1 . HIS A  1 17  ? 27.721  -25.085 1.152   1.00 25.33 ? 16   HIS A CE1 1 
ATOM   142  N NE2 . HIS A  1 17  ? 28.456  -24.048 0.798   1.00 23.89 ? 16   HIS A NE2 1 
ATOM   143  N N   . ARG A  1 18  ? 28.247  -28.976 -1.693  1.00 26.81 ? 17   ARG A N   1 
ATOM   144  C CA  . ARG A  1 18  ? 28.125  -30.139 -0.806  1.00 27.86 ? 17   ARG A CA  1 
ATOM   145  C C   . ARG A  1 18  ? 29.431  -30.953 -0.727  1.00 27.89 ? 17   ARG A C   1 
ATOM   146  O O   . ARG A  1 18  ? 29.883  -31.321 0.362   1.00 27.74 ? 17   ARG A O   1 
ATOM   147  C CB  . ARG A  1 18  ? 26.994  -31.057 -1.283  1.00 27.87 ? 17   ARG A CB  1 
ATOM   148  C CG  . ARG A  1 18  ? 25.594  -30.528 -1.065  1.00 31.11 ? 17   ARG A CG  1 
ATOM   149  C CD  . ARG A  1 18  ? 24.519  -31.620 -1.120  1.00 36.03 ? 17   ARG A CD  1 
ATOM   150  N NE  . ARG A  1 18  ? 23.175  -31.085 -1.361  1.00 39.09 ? 17   ARG A NE  1 
ATOM   151  C CZ  . ARG A  1 18  ? 22.574  -31.031 -2.550  1.00 41.27 ? 17   ARG A CZ  1 
ATOM   152  N NH1 . ARG A  1 18  ? 23.190  -31.465 -3.649  1.00 41.81 ? 17   ARG A NH1 1 
ATOM   153  N NH2 . ARG A  1 18  ? 21.347  -30.529 -2.642  1.00 42.33 ? 17   ARG A NH2 1 
ATOM   154  N N   . ALA A  1 19  ? 30.034  -31.220 -1.884  1.00 28.00 ? 18   ALA A N   1 
ATOM   155  C CA  . ALA A  1 19  ? 31.207  -32.096 -1.958  1.00 28.11 ? 18   ALA A CA  1 
ATOM   156  C C   . ALA A  1 19  ? 32.511  -31.432 -1.511  1.00 28.55 ? 18   ALA A C   1 
ATOM   157  O O   . ALA A  1 19  ? 33.388  -32.099 -0.961  1.00 29.06 ? 18   ALA A O   1 
ATOM   158  C CB  . ALA A  1 19  ? 31.361  -32.667 -3.382  1.00 27.95 ? 18   ALA A CB  1 
ATOM   159  N N   . ASN A  1 20  ? 32.631  -30.120 -1.726  1.00 28.17 ? 19   ASN A N   1 
ATOM   160  C CA  . ASN A  1 20  ? 33.939  -29.457 -1.659  1.00 28.24 ? 19   ASN A CA  1 
ATOM   161  C C   . ASN A  1 20  ? 34.077  -28.251 -0.739  1.00 28.45 ? 19   ASN A C   1 
ATOM   162  O O   . ASN A  1 20  ? 35.197  -27.901 -0.353  1.00 28.46 ? 19   ASN A O   1 
ATOM   163  C CB  . ASN A  1 20  ? 34.369  -29.013 -3.056  1.00 28.42 ? 19   ASN A CB  1 
ATOM   164  C CG  . ASN A  1 20  ? 34.451  -30.161 -4.033  1.00 29.56 ? 19   ASN A CG  1 
ATOM   165  O OD1 . ASN A  1 20  ? 33.539  -30.382 -4.826  1.00 30.53 ? 19   ASN A OD1 1 
ATOM   166  N ND2 . ASN A  1 20  ? 35.559  -30.896 -3.989  1.00 30.42 ? 19   ASN A ND2 1 
ATOM   167  N N   . SER A  1 21  ? 32.964  -27.593 -0.419  1.00 28.07 ? 20   SER A N   1 
ATOM   168  C CA  . SER A  1 21  ? 33.032  -26.301 0.280   1.00 28.45 ? 20   SER A CA  1 
ATOM   169  C C   . SER A  1 21  ? 33.751  -26.360 1.629   1.00 28.64 ? 20   SER A C   1 
ATOM   170  O O   . SER A  1 21  ? 34.445  -25.417 2.007   1.00 28.37 ? 20   SER A O   1 
ATOM   171  C CB  . SER A  1 21  ? 31.637  -25.674 0.418   1.00 28.16 ? 20   SER A CB  1 
ATOM   172  O OG  . SER A  1 21  ? 30.903  -26.287 1.464   1.00 28.30 ? 20   SER A OG  1 
ATOM   173  N N   . ALA A  1 22  ? 33.618  -27.488 2.329   1.00 29.67 ? 21   ALA A N   1 
ATOM   174  C CA  . ALA A  1 22  ? 34.296  -27.703 3.610   1.00 30.29 ? 21   ALA A CA  1 
ATOM   175  C C   . ALA A  1 22  ? 35.830  -27.635 3.511   1.00 30.47 ? 21   ALA A C   1 
ATOM   176  O O   . ALA A  1 22  ? 36.510  -27.401 4.515   1.00 31.42 ? 21   ALA A O   1 
ATOM   177  C CB  . ALA A  1 22  ? 33.864  -29.035 4.216   1.00 30.82 ? 21   ALA A CB  1 
ATOM   178  N N   . ASN A  1 23  ? 36.355  -27.832 2.304   1.00 30.39 ? 22   ASN A N   1 
ATOM   179  C CA  . ASN A  1 23  ? 37.797  -27.852 2.062   1.00 30.24 ? 22   ASN A CA  1 
ATOM   180  C C   . ASN A  1 23  ? 38.387  -26.471 1.750   1.00 29.38 ? 22   ASN A C   1 
ATOM   181  O O   . ASN A  1 23  ? 39.614  -26.321 1.671   1.00 29.69 ? 22   ASN A O   1 
ATOM   182  C CB  . ASN A  1 23  ? 38.156  -28.843 0.940   1.00 30.67 ? 22   ASN A CB  1 
ATOM   183  C CG  . ASN A  1 23  ? 37.655  -30.262 1.212   1.00 32.14 ? 22   ASN A CG  1 
ATOM   184  O OD1 . ASN A  1 23  ? 37.123  -30.925 0.314   1.00 34.75 ? 22   ASN A OD1 1 
ATOM   185  N ND2 . ASN A  1 23  ? 37.812  -30.728 2.445   1.00 33.44 ? 22   ASN A ND2 1 
ATOM   186  N N   . LEU A  1 24  ? 37.518  -25.469 1.576   1.00 27.78 ? 23   LEU A N   1 
ATOM   187  C CA  . LEU A  1 24  ? 37.953  -24.103 1.278   1.00 26.53 ? 23   LEU A CA  1 
ATOM   188  C C   . LEU A  1 24  ? 38.387  -23.402 2.553   1.00 25.82 ? 23   LEU A C   1 
ATOM   189  O O   . LEU A  1 24  ? 37.609  -23.270 3.498   1.00 25.30 ? 23   LEU A O   1 
ATOM   190  C CB  . LEU A  1 24  ? 36.844  -23.302 0.591   1.00 26.42 ? 23   LEU A CB  1 
ATOM   191  C CG  . LEU A  1 24  ? 36.381  -23.770 -0.785  1.00 27.04 ? 23   LEU A CG  1 
ATOM   192  C CD1 . LEU A  1 24  ? 35.106  -23.036 -1.152  1.00 28.70 ? 23   LEU A CD1 1 
ATOM   193  C CD2 . LEU A  1 24  ? 37.462  -23.570 -1.851  1.00 28.17 ? 23   LEU A CD2 1 
ATOM   194  N N   . LYS A  1 25  ? 39.646  -22.976 2.568   1.00 24.34 ? 24   LYS A N   1 
ATOM   195  C CA  . LYS A  1 25  ? 40.249  -22.323 3.715   1.00 24.15 ? 24   LYS A CA  1 
ATOM   196  C C   . LYS A  1 25  ? 40.978  -21.091 3.191   1.00 23.17 ? 24   LYS A C   1 
ATOM   197  O O   . LYS A  1 25  ? 41.922  -21.211 2.395   1.00 22.50 ? 24   LYS A O   1 
ATOM   198  C CB  . LYS A  1 25  ? 41.239  -23.263 4.421   1.00 24.51 ? 24   LYS A CB  1 
ATOM   199  C CG  . LYS A  1 25  ? 40.644  -24.614 4.852   1.00 26.89 ? 24   LYS A CG  1 
ATOM   200  C CD  . LYS A  1 25  ? 39.893  -24.514 6.180   1.00 31.28 ? 24   LYS A CD  1 
ATOM   201  C CE  . LYS A  1 25  ? 39.476  -25.904 6.685   1.00 33.77 ? 24   LYS A CE  1 
ATOM   202  N NZ  . LYS A  1 25  ? 39.609  -26.953 5.620   1.00 35.67 ? 24   LYS A NZ  1 
ATOM   203  N N   . LEU A  1 26  ? 40.513  -19.910 3.593   1.00 21.70 ? 25   LEU A N   1 
ATOM   204  C CA  . LEU A  1 26  ? 41.036  -18.664 3.042   1.00 21.13 ? 25   LEU A CA  1 
ATOM   205  C C   . LEU A  1 26  ? 42.547  -18.522 3.245   1.00 20.77 ? 25   LEU A C   1 
ATOM   206  O O   . LEU A  1 26  ? 43.250  -18.117 2.328   1.00 19.46 ? 25   LEU A O   1 
ATOM   207  C CB  . LEU A  1 26  ? 40.300  -17.454 3.651   1.00 20.98 ? 25   LEU A CB  1 
ATOM   208  C CG  . LEU A  1 26  ? 38.840  -17.233 3.234   1.00 22.52 ? 25   LEU A CG  1 
ATOM   209  C CD1 . LEU A  1 26  ? 38.207  -16.089 4.015   1.00 21.19 ? 25   LEU A CD1 1 
ATOM   210  C CD2 . LEU A  1 26  ? 38.716  -16.988 1.728   1.00 25.27 ? 25   LEU A CD2 1 
ATOM   211  N N   . ARG A  1 27  ? 43.030  -18.844 4.448   1.00 20.86 ? 26   ARG A N   1 
ATOM   212  C CA  . ARG A  1 27  ? 44.471  -18.779 4.747   1.00 22.45 ? 26   ARG A CA  1 
ATOM   213  C C   . ARG A  1 27  ? 45.277  -19.557 3.720   1.00 22.22 ? 26   ARG A C   1 
ATOM   214  O O   . ARG A  1 27  ? 46.308  -19.088 3.210   1.00 21.66 ? 26   ARG A O   1 
ATOM   215  C CB  . ARG A  1 27  ? 44.757  -19.343 6.136   1.00 23.37 ? 26   ARG A CB  1 
ATOM   216  C CG  . ARG A  1 27  ? 45.406  -18.380 7.105   1.00 25.70 ? 26   ARG A CG  1 
ATOM   217  C CD  . ARG A  1 27  ? 45.733  -19.005 8.452   1.00 28.22 ? 26   ARG A CD  1 
ATOM   218  N NE  . ARG A  1 27  ? 47.045  -18.582 8.942   1.00 33.76 ? 26   ARG A NE  1 
ATOM   219  C CZ  . ARG A  1 27  ? 47.324  -18.285 10.211  1.00 33.98 ? 26   ARG A CZ  1 
ATOM   220  N NH1 . ARG A  1 27  ? 46.376  -18.324 11.137  1.00 33.47 ? 26   ARG A NH1 1 
ATOM   221  N NH2 . ARG A  1 27  ? 48.558  -17.911 10.544  1.00 35.28 ? 26   ARG A NH2 1 
ATOM   222  N N   . GLU A  1 28  ? 44.787  -20.752 3.416   1.00 22.06 ? 27   GLU A N   1 
ATOM   223  C CA  . GLU A  1 28  ? 45.459  -21.662 2.496   1.00 22.40 ? 27   GLU A CA  1 
ATOM   224  C C   . GLU A  1 28  ? 45.299  -21.227 1.040   1.00 21.36 ? 27   GLU A C   1 
ATOM   225  O O   . GLU A  1 28  ? 46.219  -21.380 0.246   1.00 21.84 ? 27   GLU A O   1 
ATOM   226  C CB  . GLU A  1 28  ? 44.977  -23.105 2.745   1.00 22.42 ? 27   GLU A CB  1 
ATOM   227  C CG  . GLU A  1 28  ? 45.075  -23.509 4.222   1.00 26.86 ? 27   GLU A CG  1 
ATOM   228  C CD  . GLU A  1 28  ? 44.748  -24.973 4.516   1.00 30.01 ? 27   GLU A CD  1 
ATOM   229  O OE1 . GLU A  1 28  ? 44.891  -25.377 5.683   1.00 32.65 ? 27   GLU A OE1 1 
ATOM   230  O OE2 . GLU A  1 28  ? 44.346  -25.729 3.613   1.00 33.34 ? 27   GLU A OE2 1 
ATOM   231  N N   . LEU A  1 29  ? 44.153  -20.635 0.688   1.00 20.53 ? 28   LEU A N   1 
ATOM   232  C CA  . LEU A  1 29  ? 43.936  -20.138 -0.672  1.00 19.88 ? 28   LEU A CA  1 
ATOM   233  C C   . LEU A  1 29  ? 44.946  -19.030 -1.005  1.00 19.40 ? 28   LEU A C   1 
ATOM   234  O O   . LEU A  1 29  ? 45.494  -18.983 -2.106  1.00 19.74 ? 28   LEU A O   1 
ATOM   235  C CB  . LEU A  1 29  ? 42.497  -19.624 -0.852  1.00 20.19 ? 28   LEU A CB  1 
ATOM   236  C CG  . LEU A  1 29  ? 41.382  -20.688 -0.885  1.00 20.88 ? 28   LEU A CG  1 
ATOM   237  C CD1 . LEU A  1 29  ? 40.024  -20.022 -0.672  1.00 21.24 ? 28   LEU A CD1 1 
ATOM   238  C CD2 . LEU A  1 29  ? 41.384  -21.499 -2.190  1.00 23.56 ? 28   LEU A CD2 1 
ATOM   239  N N   . PHE A  1 30  ? 45.203  -18.159 -0.033  1.00 18.66 ? 29   PHE A N   1 
ATOM   240  C CA  . PHE A  1 30  ? 46.181  -17.090 -0.217  1.00 18.02 ? 29   PHE A CA  1 
ATOM   241  C C   . PHE A  1 30  ? 47.629  -17.612 -0.249  1.00 19.09 ? 29   PHE A C   1 
ATOM   242  O O   . PHE A  1 30  ? 48.414  -17.178 -1.090  1.00 19.16 ? 29   PHE A O   1 
ATOM   243  C CB  . PHE A  1 30  ? 45.984  -15.981 0.823   1.00 17.55 ? 29   PHE A CB  1 
ATOM   244  C CG  . PHE A  1 30  ? 44.902  -15.003 0.455   1.00 17.09 ? 29   PHE A CG  1 
ATOM   245  C CD1 . PHE A  1 30  ? 43.606  -15.171 0.922   1.00 16.97 ? 29   PHE A CD1 1 
ATOM   246  C CD2 . PHE A  1 30  ? 45.178  -13.922 -0.382  1.00 16.70 ? 29   PHE A CD2 1 
ATOM   247  C CE1 . PHE A  1 30  ? 42.587  -14.273 0.553   1.00 17.70 ? 29   PHE A CE1 1 
ATOM   248  C CE2 . PHE A  1 30  ? 44.168  -13.016 -0.745  1.00 17.58 ? 29   PHE A CE2 1 
ATOM   249  C CZ  . PHE A  1 30  ? 42.878  -13.198 -0.277  1.00 17.31 ? 29   PHE A CZ  1 
ATOM   250  N N   . GLU A  1 31  ? 47.958  -18.561 0.625   1.00 20.15 ? 30   GLU A N   1 
ATOM   251  C CA  . GLU A  1 31  ? 49.319  -19.127 0.630   1.00 21.24 ? 30   GLU A CA  1 
ATOM   252  C C   . GLU A  1 31  ? 49.661  -19.823 -0.696  1.00 21.83 ? 30   GLU A C   1 
ATOM   253  O O   . GLU A  1 31  ? 50.802  -19.735 -1.175  1.00 22.19 ? 30   GLU A O   1 
ATOM   254  C CB  . GLU A  1 31  ? 49.522  -20.090 1.803   1.00 22.05 ? 30   GLU A CB  1 
ATOM   255  C CG  . GLU A  1 31  ? 49.684  -19.422 3.161   1.00 24.60 ? 30   GLU A CG  1 
ATOM   256  C CD  . GLU A  1 31  ? 50.953  -18.591 3.308   1.00 27.83 ? 30   GLU A CD  1 
ATOM   257  O OE1 . GLU A  1 31  ? 51.025  -17.813 4.285   1.00 30.57 ? 30   GLU A OE1 1 
ATOM   258  O OE2 . GLU A  1 31  ? 51.886  -18.694 2.475   1.00 26.93 ? 30   GLU A OE2 1 
ATOM   259  N N   . ALA A  1 32  ? 48.681  -20.493 -1.291  1.00 21.65 ? 31   ALA A N   1 
ATOM   260  C CA  . ALA A  1 32  ? 48.911  -21.311 -2.490  1.00 22.11 ? 31   ALA A CA  1 
ATOM   261  C C   . ALA A  1 32  ? 48.968  -20.498 -3.771  1.00 22.46 ? 31   ALA A C   1 
ATOM   262  O O   . ALA A  1 32  ? 49.393  -20.998 -4.820  1.00 23.30 ? 31   ALA A O   1 
ATOM   263  C CB  . ALA A  1 32  ? 47.818  -22.388 -2.600  1.00 22.37 ? 31   ALA A CB  1 
ATOM   264  N N   . ASP A  1 33  ? 48.529  -19.240 -3.698  1.00 22.24 ? 32   ASP A N   1 
ATOM   265  C CA  . ASP A  1 33  ? 48.320  -18.467 -4.905  1.00 22.28 ? 32   ASP A CA  1 
ATOM   266  C C   . ASP A  1 33  ? 48.714  -17.001 -4.713  1.00 22.36 ? 32   ASP A C   1 
ATOM   267  O O   . ASP A  1 33  ? 47.873  -16.197 -4.296  1.00 21.92 ? 32   ASP A O   1 
ATOM   268  C CB  . ASP A  1 33  ? 46.848  -18.591 -5.310  1.00 22.59 ? 32   ASP A CB  1 
ATOM   269  C CG  . ASP A  1 33  ? 46.493  -17.768 -6.525  1.00 24.41 ? 32   ASP A CG  1 
ATOM   270  O OD1 . ASP A  1 33  ? 47.411  -17.290 -7.227  1.00 24.39 ? 32   ASP A OD1 1 
ATOM   271  O OD2 . ASP A  1 33  ? 45.303  -17.540 -6.857  1.00 25.60 ? 32   ASP A OD2 1 
ATOM   272  N N   . PRO A  1 34  ? 49.973  -16.651 -5.006  1.00 21.82 ? 33   PRO A N   1 
ATOM   273  C CA  . PRO A  1 34  ? 50.459  -15.264 -4.875  1.00 21.96 ? 33   PRO A CA  1 
ATOM   274  C C   . PRO A  1 34  ? 49.698  -14.259 -5.747  1.00 21.77 ? 33   PRO A C   1 
ATOM   275  O O   . PRO A  1 34  ? 49.753  -13.053 -5.482  1.00 22.15 ? 33   PRO A O   1 
ATOM   276  C CB  . PRO A  1 34  ? 51.925  -15.362 -5.338  1.00 21.99 ? 33   PRO A CB  1 
ATOM   277  C CG  . PRO A  1 34  ? 52.294  -16.797 -5.054  1.00 22.05 ? 33   PRO A CG  1 
ATOM   278  C CD  . PRO A  1 34  ? 51.051  -17.576 -5.423  1.00 22.11 ? 33   PRO A CD  1 
ATOM   279  N N   . GLU A  1 35  ? 49.008  -14.753 -6.771  1.00 21.36 ? 34   GLU A N   1 
ATOM   280  C CA  . GLU A  1 35  ? 48.252  -13.914 -7.709  1.00 21.55 ? 34   GLU A CA  1 
ATOM   281  C C   . GLU A  1 35  ? 46.768  -13.764 -7.317  1.00 20.36 ? 34   GLU A C   1 
ATOM   282  O O   . GLU A  1 35  ? 45.976  -13.218 -8.084  1.00 20.00 ? 34   GLU A O   1 
ATOM   283  C CB  . GLU A  1 35  ? 48.344  -14.475 -9.135  1.00 22.75 ? 34   GLU A CB  1 
ATOM   284  C CG  . GLU A  1 35  ? 49.733  -14.410 -9.777  1.00 26.53 ? 34   GLU A CG  1 
ATOM   285  C CD  . GLU A  1 35  ? 50.211  -12.987 -10.020 1.00 31.64 ? 34   GLU A CD  1 
ATOM   286  O OE1 . GLU A  1 35  ? 49.447  -12.177 -10.593 1.00 32.91 ? 34   GLU A OE1 1 
ATOM   287  O OE2 . GLU A  1 35  ? 51.355  -12.671 -9.634  1.00 36.34 ? 34   GLU A OE2 1 
ATOM   288  N N   . ARG A  1 36  ? 46.399  -14.239 -6.124  1.00 19.44 ? 35   ARG A N   1 
ATOM   289  C CA  . ARG A  1 36  ? 44.979  -14.285 -5.743  1.00 18.40 ? 35   ARG A CA  1 
ATOM   290  C C   . ARG A  1 36  ? 44.314  -12.898 -5.766  1.00 18.35 ? 35   ARG A C   1 
ATOM   291  O O   . ARG A  1 36  ? 43.255  -12.752 -6.360  1.00 18.07 ? 35   ARG A O   1 
ATOM   292  C CB  . ARG A  1 36  ? 44.769  -14.975 -4.383  1.00 18.15 ? 35   ARG A CB  1 
ATOM   293  C CG  . ARG A  1 36  ? 43.279  -15.183 -4.037  1.00 17.46 ? 35   ARG A CG  1 
ATOM   294  C CD  . ARG A  1 36  ? 43.015  -16.041 -2.805  1.00 18.73 ? 35   ARG A CD  1 
ATOM   295  N NE  . ARG A  1 36  ? 41.584  -16.029 -2.485  1.00 17.77 ? 35   ARG A NE  1 
ATOM   296  C CZ  . ARG A  1 36  ? 40.673  -16.814 -3.042  1.00 17.94 ? 35   ARG A CZ  1 
ATOM   297  N NH1 . ARG A  1 36  ? 41.022  -17.714 -3.961  1.00 18.07 ? 35   ARG A NH1 1 
ATOM   298  N NH2 . ARG A  1 36  ? 39.391  -16.707 -2.678  1.00 18.00 ? 35   ARG A NH2 1 
ATOM   299  N N   . PHE A  1 37  ? 44.926  -11.891 -5.136  1.00 18.44 ? 36   PHE A N   1 
ATOM   300  C CA  . PHE A  1 37  ? 44.361  -10.533 -5.216  1.00 18.07 ? 36   PHE A CA  1 
ATOM   301  C C   . PHE A  1 37  ? 44.192  -10.074 -6.675  1.00 19.49 ? 36   PHE A C   1 
ATOM   302  O O   . PHE A  1 37  ? 43.117  -9.614  -7.073  1.00 19.39 ? 36   PHE A O   1 
ATOM   303  C CB  . PHE A  1 37  ? 45.204  -9.524  -4.405  1.00 18.47 ? 36   PHE A CB  1 
ATOM   304  C CG  . PHE A  1 37  ? 44.855  -8.078  -4.683  1.00 17.89 ? 36   PHE A CG  1 
ATOM   305  C CD1 . PHE A  1 37  ? 43.768  -7.475  -4.043  1.00 18.26 ? 36   PHE A CD1 1 
ATOM   306  C CD2 . PHE A  1 37  ? 45.613  -7.316  -5.574  1.00 17.22 ? 36   PHE A CD2 1 
ATOM   307  C CE1 . PHE A  1 37  ? 43.432  -6.143  -4.308  1.00 17.33 ? 36   PHE A CE1 1 
ATOM   308  C CE2 . PHE A  1 37  ? 45.287  -5.982  -5.847  1.00 16.72 ? 36   PHE A CE2 1 
ATOM   309  C CZ  . PHE A  1 37  ? 44.197  -5.383  -5.204  1.00 17.12 ? 36   PHE A CZ  1 
ATOM   310  N N   . ASN A  1 38  ? 45.248  -10.217 -7.472  1.00 20.34 ? 37   ASN A N   1 
ATOM   311  C CA  . ASN A  1 38  ? 45.227  -9.808  -8.873  1.00 22.16 ? 37   ASN A CA  1 
ATOM   312  C C   . ASN A  1 38  ? 44.088  -10.421 -9.679  1.00 22.19 ? 37   ASN A C   1 
ATOM   313  O O   . ASN A  1 38  ? 43.505  -9.765  -10.551 1.00 23.35 ? 37   ASN A O   1 
ATOM   314  C CB  . ASN A  1 38  ? 46.545  -10.212 -9.541  1.00 22.87 ? 37   ASN A CB  1 
ATOM   315  C CG  . ASN A  1 38  ? 47.685  -9.279  -9.239  1.00 26.39 ? 37   ASN A CG  1 
ATOM   316  O OD1 . ASN A  1 38  ? 48.848  -9.624  -9.493  1.00 32.22 ? 37   ASN A OD1 1 
ATOM   317  N ND2 . ASN A  1 38  ? 47.391  -8.101  -8.705  1.00 27.66 ? 37   ASN A ND2 1 
ATOM   318  N N   . ASN A  1 39  ? 43.783  -11.683 -9.390  1.00 22.06 ? 38   ASN A N   1 
ATOM   319  C CA  . ASN A  1 39  ? 42.816  -12.442 -10.157 1.00 22.38 ? 38   ASN A CA  1 
ATOM   320  C C   . ASN A  1 39  ? 41.390  -12.368 -9.628  1.00 21.58 ? 38   ASN A C   1 
ATOM   321  O O   . ASN A  1 39  ? 40.462  -12.750 -10.329 1.00 22.37 ? 38   ASN A O   1 
ATOM   322  C CB  . ASN A  1 39  ? 43.262  -13.905 -10.257 1.00 23.13 ? 38   ASN A CB  1 
ATOM   323  C CG  . ASN A  1 39  ? 44.522  -14.079 -11.114 1.00 24.89 ? 38   ASN A CG  1 
ATOM   324  O OD1 . ASN A  1 39  ? 45.240  -15.062 -10.969 1.00 29.26 ? 38   ASN A OD1 1 
ATOM   325  N ND2 . ASN A  1 39  ? 44.786  -13.122 -12.002 1.00 27.66 ? 38   ASN A ND2 1 
ATOM   326  N N   . PHE A  1 40  ? 41.226  -11.880 -8.400  1.00 20.41 ? 39   PHE A N   1 
ATOM   327  C CA  . PHE A  1 40  ? 39.898  -11.805 -7.773  1.00 19.57 ? 39   PHE A CA  1 
ATOM   328  C C   . PHE A  1 40  ? 39.574  -10.372 -7.312  1.00 19.24 ? 39   PHE A C   1 
ATOM   329  O O   . PHE A  1 40  ? 39.009  -10.158 -6.228  1.00 19.20 ? 39   PHE A O   1 
ATOM   330  C CB  . PHE A  1 40  ? 39.802  -12.804 -6.614  1.00 19.10 ? 39   PHE A CB  1 
ATOM   331  C CG  . PHE A  1 40  ? 39.830  -14.249 -7.051  1.00 18.95 ? 39   PHE A CG  1 
ATOM   332  C CD1 . PHE A  1 40  ? 41.041  -14.918 -7.237  1.00 18.89 ? 39   PHE A CD1 1 
ATOM   333  C CD2 . PHE A  1 40  ? 38.641  -14.943 -7.237  1.00 20.36 ? 39   PHE A CD2 1 
ATOM   334  C CE1 . PHE A  1 40  ? 41.054  -16.271 -7.637  1.00 19.40 ? 39   PHE A CE1 1 
ATOM   335  C CE2 . PHE A  1 40  ? 38.636  -16.292 -7.645  1.00 21.52 ? 39   PHE A CE2 1 
ATOM   336  C CZ  . PHE A  1 40  ? 39.848  -16.946 -7.843  1.00 19.38 ? 39   PHE A CZ  1 
ATOM   337  N N   . SER A  1 41  ? 39.938  -9.401  -8.144  1.00 18.90 ? 40   SER A N   1 
ATOM   338  C CA  . SER A  1 41  ? 39.618  -7.993  -7.895  1.00 18.83 ? 40   SER A CA  1 
ATOM   339  C C   . SER A  1 41  ? 39.391  -7.256  -9.206  1.00 19.55 ? 40   SER A C   1 
ATOM   340  O O   . SER A  1 41  ? 39.870  -7.686  -10.261 1.00 19.22 ? 40   SER A O   1 
ATOM   341  C CB  . SER A  1 41  ? 40.711  -7.305  -7.056  1.00 19.90 ? 40   SER A CB  1 
ATOM   342  O OG  . SER A  1 41  ? 41.955  -7.266  -7.764  1.00 19.97 ? 40   SER A OG  1 
ATOM   343  N N   . LEU A  1 42  ? 38.633  -6.164  -9.135  1.00 19.02 ? 41   LEU A N   1 
ATOM   344  C CA  . LEU A  1 42  ? 38.382  -5.297  -10.281 1.00 19.51 ? 41   LEU A CA  1 
ATOM   345  C C   . LEU A  1 42  ? 38.759  -3.865  -9.934  1.00 20.15 ? 41   LEU A C   1 
ATOM   346  O O   . LEU A  1 42  ? 38.285  -3.316  -8.929  1.00 19.60 ? 41   LEU A O   1 
ATOM   347  C CB  . LEU A  1 42  ? 36.906  -5.324  -10.678 1.00 19.98 ? 41   LEU A CB  1 
ATOM   348  C CG  . LEU A  1 42  ? 36.262  -6.557  -11.289 1.00 22.78 ? 41   LEU A CG  1 
ATOM   349  C CD1 . LEU A  1 42  ? 34.751  -6.323  -11.288 1.00 23.95 ? 41   LEU A CD1 1 
ATOM   350  C CD2 . LEU A  1 42  ? 36.781  -6.785  -12.720 1.00 24.73 ? 41   LEU A CD2 1 
ATOM   351  N N   . ASN A  1 43  ? 39.596  -3.258  -10.771 1.00 19.89 ? 42   ASN A N   1 
ATOM   352  C CA  . ASN A  1 43  ? 40.045  -1.886  -10.542 1.00 20.14 ? 42   ASN A CA  1 
ATOM   353  C C   . ASN A  1 43  ? 39.435  -1.033  -11.639 1.00 20.11 ? 42   ASN A C   1 
ATOM   354  O O   . ASN A  1 43  ? 39.921  -1.043  -12.783 1.00 20.76 ? 42   ASN A O   1 
ATOM   355  C CB  . ASN A  1 43  ? 41.584  -1.813  -10.540 1.00 19.98 ? 42   ASN A CB  1 
ATOM   356  C CG  . ASN A  1 43  ? 42.127  -0.447  -10.104 1.00 21.79 ? 42   ASN A CG  1 
ATOM   357  O OD1 . ASN A  1 43  ? 43.208  -0.357  -9.520  1.00 25.76 ? 42   ASN A OD1 1 
ATOM   358  N ND2 . ASN A  1 43  ? 41.393  0.612   -10.400 1.00 21.41 ? 42   ASN A ND2 1 
ATOM   359  N N   . LEU A  1 44  ? 38.352  -0.326  -11.305 1.00 19.15 ? 43   LEU A N   1 
ATOM   360  C CA  . LEU A  1 44  ? 37.588  0.431   -12.293 1.00 19.73 ? 43   LEU A CA  1 
ATOM   361  C C   . LEU A  1 44  ? 38.058  1.869   -12.334 1.00 19.55 ? 43   LEU A C   1 
ATOM   362  O O   . LEU A  1 44  ? 38.018  2.557   -11.318 1.00 19.36 ? 43   LEU A O   1 
ATOM   363  C CB  . LEU A  1 44  ? 36.079  0.380   -11.978 1.00 19.73 ? 43   LEU A CB  1 
ATOM   364  C CG  . LEU A  1 44  ? 35.417  -1.003  -11.862 1.00 22.14 ? 43   LEU A CG  1 
ATOM   365  C CD1 . LEU A  1 44  ? 33.934  -0.881  -11.553 1.00 23.47 ? 43   LEU A CD1 1 
ATOM   366  C CD2 . LEU A  1 44  ? 35.630  -1.852  -13.119 1.00 23.76 ? 43   LEU A CD2 1 
ATOM   367  N N   . ASN A  1 45  ? 38.509  2.307   -13.511 1.00 19.30 ? 44   ASN A N   1 
ATOM   368  C CA  . ASN A  1 45  ? 38.876  3.698   -13.729 1.00 19.96 ? 44   ASN A CA  1 
ATOM   369  C C   . ASN A  1 45  ? 37.713  4.432   -14.376 1.00 19.80 ? 44   ASN A C   1 
ATOM   370  O O   . ASN A  1 45  ? 37.398  4.194   -15.558 1.00 20.95 ? 44   ASN A O   1 
ATOM   371  C CB  . ASN A  1 45  ? 40.137  3.773   -14.612 1.00 20.61 ? 44   ASN A CB  1 
ATOM   372  C CG  . ASN A  1 45  ? 40.628  5.197   -14.831 1.00 22.90 ? 44   ASN A CG  1 
ATOM   373  O OD1 . ASN A  1 45  ? 41.557  5.427   -15.623 1.00 25.99 ? 44   ASN A OD1 1 
ATOM   374  N ND2 . ASN A  1 45  ? 40.033  6.159   -14.127 1.00 20.25 ? 44   ASN A ND2 1 
ATOM   375  N N   . THR A  1 46  ? 37.063  5.309   -13.608 1.00 19.14 ? 45   THR A N   1 
ATOM   376  C CA  . THR A  1 46  ? 35.901  6.065   -14.094 1.00 19.88 ? 45   THR A CA  1 
ATOM   377  C C   . THR A  1 46  ? 36.279  7.364   -14.806 1.00 20.56 ? 45   THR A C   1 
ATOM   378  O O   . THR A  1 46  ? 35.398  8.061   -15.349 1.00 21.23 ? 45   THR A O   1 
ATOM   379  C CB  . THR A  1 46  ? 34.925  6.444   -12.955 1.00 19.50 ? 45   THR A CB  1 
ATOM   380  O OG1 . THR A  1 46  ? 35.508  7.502   -12.167 1.00 19.25 ? 45   THR A OG1 1 
ATOM   381  C CG2 . THR A  1 46  ? 34.677  5.282   -11.989 1.00 19.19 ? 45   THR A CG2 1 
ATOM   382  N N   . ASN A  1 47  ? 37.568  7.691   -14.768 1.00 21.88 ? 46   ASN A N   1 
ATOM   383  C CA  . ASN A  1 47  ? 38.105  8.981   -15.243 1.00 22.68 ? 46   ASN A CA  1 
ATOM   384  C C   . ASN A  1 47  ? 37.779  10.144  -14.306 1.00 22.83 ? 46   ASN A C   1 
ATOM   385  O O   . ASN A  1 47  ? 38.194  11.290  -14.526 1.00 22.80 ? 46   ASN A O   1 
ATOM   386  C CB  . ASN A  1 47  ? 37.724  9.254   -16.708 1.00 24.30 ? 46   ASN A CB  1 
ATOM   387  C CG  . ASN A  1 47  ? 38.240  8.168   -17.640 1.00 27.54 ? 46   ASN A CG  1 
ATOM   388  O OD1 . ASN A  1 47  ? 37.483  7.591   -18.430 1.00 33.78 ? 46   ASN A OD1 1 
ATOM   389  N ND2 . ASN A  1 47  ? 39.529  7.860   -17.527 1.00 31.03 ? 46   ASN A ND2 1 
ATOM   390  N N   . HIS A  1 48  ? 37.075  9.824   -13.223 1.00 22.29 ? 47   HIS A N   1 
ATOM   391  C CA  . HIS A  1 48  ? 36.874  10.771  -12.130 1.00 21.54 ? 47   HIS A CA  1 
ATOM   392  C C   . HIS A  1 48  ? 37.127  10.087  -10.791 1.00 20.62 ? 47   HIS A C   1 
ATOM   393  O O   . HIS A  1 48  ? 36.414  10.321  -9.813  1.00 19.80 ? 47   HIS A O   1 
ATOM   394  C CB  . HIS A  1 48  ? 35.465  11.368  -12.195 1.00 22.71 ? 47   HIS A CB  1 
ATOM   395  C CG  . HIS A  1 48  ? 35.153  11.999  -13.516 1.00 25.49 ? 47   HIS A CG  1 
ATOM   396  N ND1 . HIS A  1 48  ? 35.759  13.164  -13.947 1.00 28.62 ? 47   HIS A ND1 1 
ATOM   397  C CD2 . HIS A  1 48  ? 34.334  11.606  -14.518 1.00 28.05 ? 47   HIS A CD2 1 
ATOM   398  C CE1 . HIS A  1 48  ? 35.308  13.472  -15.150 1.00 29.26 ? 47   HIS A CE1 1 
ATOM   399  N NE2 . HIS A  1 48  ? 34.443  12.543  -15.519 1.00 29.99 ? 47   HIS A NE2 1 
ATOM   400  N N   . GLY A  1 49  ? 38.164  9.253   -10.757 1.00 19.37 ? 48   GLY A N   1 
ATOM   401  C CA  . GLY A  1 49  ? 38.485  8.458   -9.583  1.00 18.35 ? 48   GLY A CA  1 
ATOM   402  C C   . GLY A  1 49  ? 38.387  6.976   -9.889  1.00 18.03 ? 48   GLY A C   1 
ATOM   403  O O   . GLY A  1 49  ? 37.743  6.566   -10.875 1.00 17.70 ? 48   GLY A O   1 
ATOM   404  N N   . HIS A  1 50  ? 39.033  6.180   -9.050  1.00 16.98 ? 49   HIS A N   1 
ATOM   405  C CA  . HIS A  1 50  ? 39.014  4.728   -9.208  1.00 16.97 ? 49   HIS A CA  1 
ATOM   406  C C   . HIS A  1 50  ? 38.130  4.089   -8.143  1.00 16.95 ? 49   HIS A C   1 
ATOM   407  O O   . HIS A  1 50  ? 38.052  4.587   -7.015  1.00 16.72 ? 49   HIS A O   1 
ATOM   408  C CB  . HIS A  1 50  ? 40.440  4.176   -9.070  1.00 18.09 ? 49   HIS A CB  1 
ATOM   409  C CG  . HIS A  1 50  ? 41.276  4.329   -10.304 1.00 20.27 ? 49   HIS A CG  1 
ATOM   410  N ND1 . HIS A  1 50  ? 41.689  5.553   -10.786 1.00 23.74 ? 49   HIS A ND1 1 
ATOM   411  C CD2 . HIS A  1 50  ? 41.791  3.399   -11.143 1.00 23.18 ? 49   HIS A CD2 1 
ATOM   412  C CE1 . HIS A  1 50  ? 42.419  5.369   -11.876 1.00 22.70 ? 49   HIS A CE1 1 
ATOM   413  N NE2 . HIS A  1 50  ? 42.479  4.073   -12.124 1.00 24.95 ? 49   HIS A NE2 1 
ATOM   414  N N   . ILE A  1 51  ? 37.464  2.998   -8.509  1.00 15.93 ? 50   ILE A N   1 
ATOM   415  C CA  . ILE A  1 51  ? 36.775  2.134   -7.543  1.00 16.33 ? 50   ILE A CA  1 
ATOM   416  C C   . ILE A  1 51  ? 37.373  0.740   -7.659  1.00 15.81 ? 50   ILE A C   1 
ATOM   417  O O   . ILE A  1 51  ? 37.287  0.105   -8.721  1.00 16.98 ? 50   ILE A O   1 
ATOM   418  C CB  . ILE A  1 51  ? 35.251  2.076   -7.825  1.00 16.07 ? 50   ILE A CB  1 
ATOM   419  C CG1 . ILE A  1 51  ? 34.626  3.481   -7.825  1.00 16.81 ? 50   ILE A CG1 1 
ATOM   420  C CG2 . ILE A  1 51  ? 34.545  1.163   -6.801  1.00 17.14 ? 50   ILE A CG2 1 
ATOM   421  C CD1 . ILE A  1 51  ? 33.224  3.524   -8.474  1.00 19.06 ? 50   ILE A CD1 1 
ATOM   422  N N   . LEU A  1 52  ? 37.976  0.287   -6.566  1.00 15.04 ? 51   LEU A N   1 
ATOM   423  C CA  . LEU A  1 52  ? 38.524  -1.071  -6.473  1.00 14.98 ? 51   LEU A CA  1 
ATOM   424  C C   . LEU A  1 52  ? 37.549  -1.967  -5.733  1.00 15.39 ? 51   LEU A C   1 
ATOM   425  O O   . LEU A  1 52  ? 37.266  -1.736  -4.536  1.00 15.14 ? 51   LEU A O   1 
ATOM   426  C CB  . LEU A  1 52  ? 39.887  -1.069  -5.770  1.00 15.29 ? 51   LEU A CB  1 
ATOM   427  C CG  . LEU A  1 52  ? 40.494  -2.418  -5.339  1.00 16.04 ? 51   LEU A CG  1 
ATOM   428  C CD1 . LEU A  1 52  ? 40.787  -3.311  -6.574  1.00 17.18 ? 51   LEU A CD1 1 
ATOM   429  C CD2 . LEU A  1 52  ? 41.766  -2.209  -4.524  1.00 16.90 ? 51   LEU A CD2 1 
ATOM   430  N N   . VAL A  1 53  ? 37.059  -2.991  -6.440  1.00 14.49 ? 52   VAL A N   1 
ATOM   431  C CA  . VAL A  1 53  ? 36.190  -4.014  -5.831  1.00 14.84 ? 52   VAL A CA  1 
ATOM   432  C C   . VAL A  1 53  ? 37.033  -5.286  -5.589  1.00 14.88 ? 52   VAL A C   1 
ATOM   433  O O   . VAL A  1 53  ? 37.286  -6.057  -6.505  1.00 15.92 ? 52   VAL A O   1 
ATOM   434  C CB  . VAL A  1 53  ? 34.976  -4.318  -6.726  1.00 14.58 ? 52   VAL A CB  1 
ATOM   435  C CG1 . VAL A  1 53  ? 34.043  -5.365  -6.075  1.00 14.11 ? 52   VAL A CG1 1 
ATOM   436  C CG2 . VAL A  1 53  ? 34.207  -3.028  -7.054  1.00 17.03 ? 52   VAL A CG2 1 
ATOM   437  N N   . ASP A  1 54  ? 37.473  -5.481  -4.357  1.00 14.62 ? 53   ASP A N   1 
ATOM   438  C CA  . ASP A  1 54  ? 38.360  -6.594  -4.039  1.00 14.83 ? 53   ASP A CA  1 
ATOM   439  C C   . ASP A  1 54  ? 37.514  -7.673  -3.403  1.00 14.87 ? 53   ASP A C   1 
ATOM   440  O O   . ASP A  1 54  ? 37.083  -7.532  -2.255  1.00 14.42 ? 53   ASP A O   1 
ATOM   441  C CB  . ASP A  1 54  ? 39.462  -6.135  -3.075  1.00 14.49 ? 53   ASP A CB  1 
ATOM   442  C CG  . ASP A  1 54  ? 40.339  -7.288  -2.582  1.00 14.53 ? 53   ASP A CG  1 
ATOM   443  O OD1 . ASP A  1 54  ? 40.205  -8.446  -3.075  1.00 15.64 ? 53   ASP A OD1 1 
ATOM   444  O OD2 . ASP A  1 54  ? 41.181  -7.106  -1.678  1.00 16.00 ? 53   ASP A OD2 1 
ATOM   445  N N   . TYR A  1 55  ? 37.298  -8.756  -4.146  1.00 14.81 ? 54   TYR A N   1 
ATOM   446  C CA  . TYR A  1 55  ? 36.488  -9.881  -3.679  1.00 15.17 ? 54   TYR A CA  1 
ATOM   447  C C   . TYR A  1 55  ? 37.330  -11.139 -3.418  1.00 14.79 ? 54   TYR A C   1 
ATOM   448  O O   . TYR A  1 55  ? 36.790  -12.255 -3.354  1.00 15.73 ? 54   TYR A O   1 
ATOM   449  C CB  . TYR A  1 55  ? 35.320  -10.154 -4.647  1.00 15.24 ? 54   TYR A CB  1 
ATOM   450  C CG  . TYR A  1 55  ? 35.703  -10.520 -6.081  1.00 15.66 ? 54   TYR A CG  1 
ATOM   451  C CD1 . TYR A  1 55  ? 35.822  -11.856 -6.471  1.00 18.42 ? 54   TYR A CD1 1 
ATOM   452  C CD2 . TYR A  1 55  ? 35.932  -9.538  -7.034  1.00 16.66 ? 54   TYR A CD2 1 
ATOM   453  C CE1 . TYR A  1 55  ? 36.161  -12.195 -7.776  1.00 20.23 ? 54   TYR A CE1 1 
ATOM   454  C CE2 . TYR A  1 55  ? 36.270  -9.866  -8.346  1.00 18.22 ? 54   TYR A CE2 1 
ATOM   455  C CZ  . TYR A  1 55  ? 36.384  -11.202 -8.703  1.00 20.29 ? 54   TYR A CZ  1 
ATOM   456  O OH  . TYR A  1 55  ? 36.713  -11.535 -10.006 1.00 20.95 ? 54   TYR A OH  1 
ATOM   457  N N   . SER A  1 56  ? 38.635  -10.942 -3.226  1.00 14.85 ? 55   SER A N   1 
ATOM   458  C CA  . SER A  1 56  ? 39.558  -12.057 -2.996  1.00 15.03 ? 55   SER A CA  1 
ATOM   459  C C   . SER A  1 56  ? 39.437  -12.756 -1.648  1.00 15.11 ? 55   SER A C   1 
ATOM   460  O O   . SER A  1 56  ? 39.798  -13.935 -1.536  1.00 15.39 ? 55   SER A O   1 
ATOM   461  C CB  . SER A  1 56  ? 41.010  -11.642 -3.288  1.00 14.88 ? 55   SER A CB  1 
ATOM   462  O OG  . SER A  1 56  ? 41.480  -10.703 -2.354  1.00 15.43 ? 55   SER A OG  1 
ATOM   463  N N   . LYS A  1 57  ? 38.942  -12.059 -0.622  1.00 14.81 ? 56   LYS A N   1 
ATOM   464  C CA  . LYS A  1 57  ? 38.766  -12.681 0.689   1.00 14.86 ? 56   LYS A CA  1 
ATOM   465  C C   . LYS A  1 57  ? 37.411  -13.387 0.791   1.00 15.74 ? 56   LYS A C   1 
ATOM   466  O O   . LYS A  1 57  ? 36.821  -13.433 1.864   1.00 17.03 ? 56   LYS A O   1 
ATOM   467  C CB  . LYS A  1 57  ? 38.942  -11.677 1.849   1.00 14.28 ? 56   LYS A CB  1 
ATOM   468  C CG  . LYS A  1 57  ? 40.305  -10.978 1.922   1.00 13.92 ? 56   LYS A CG  1 
ATOM   469  C CD  . LYS A  1 57  ? 40.479  -10.359 3.319   1.00 14.90 ? 56   LYS A CD  1 
ATOM   470  C CE  . LYS A  1 57  ? 41.656  -9.378  3.440   1.00 14.65 ? 56   LYS A CE  1 
ATOM   471  N NZ  . LYS A  1 57  ? 41.454  -8.102  2.678   1.00 14.89 ? 56   LYS A NZ  1 
ATOM   472  N N   . ASN A  1 58  ? 36.940  -13.948 -0.320  1.00 16.50 ? 57   ASN A N   1 
ATOM   473  C CA  . ASN A  1 58  ? 35.727  -14.772 -0.350  1.00 16.73 ? 57   ASN A CA  1 
ATOM   474  C C   . ASN A  1 58  ? 36.038  -16.253 -0.506  1.00 17.42 ? 57   ASN A C   1 
ATOM   475  O O   . ASN A  1 58  ? 37.095  -16.621 -1.046  1.00 17.60 ? 57   ASN A O   1 
ATOM   476  C CB  . ASN A  1 58  ? 34.785  -14.320 -1.457  1.00 16.46 ? 57   ASN A CB  1 
ATOM   477  C CG  . ASN A  1 58  ? 34.018  -13.069 -1.086  1.00 17.20 ? 57   ASN A CG  1 
ATOM   478  O OD1 . ASN A  1 58  ? 33.118  -13.104 -0.251  1.00 18.38 ? 57   ASN A OD1 1 
ATOM   479  N ND2 . ASN A  1 58  ? 34.396  -11.952 -1.685  1.00 16.78 ? 57   ASN A ND2 1 
ATOM   480  N N   . LEU A  1 59  ? 35.118  -17.091 -0.013  1.00 17.45 ? 58   LEU A N   1 
ATOM   481  C CA  . LEU A  1 59  ? 35.277  -18.540 -0.053  1.00 18.45 ? 58   LEU A CA  1 
ATOM   482  C C   . LEU A  1 59  ? 34.979  -19.083 -1.451  1.00 18.49 ? 58   LEU A C   1 
ATOM   483  O O   . LEU A  1 59  ? 33.990  -19.799 -1.673  1.00 18.77 ? 58   LEU A O   1 
ATOM   484  C CB  . LEU A  1 59  ? 34.386  -19.194 1.009   1.00 18.27 ? 58   LEU A CB  1 
ATOM   485  C CG  . LEU A  1 59  ? 34.885  -19.019 2.445   1.00 18.09 ? 58   LEU A CG  1 
ATOM   486  C CD1 . LEU A  1 59  ? 33.729  -19.289 3.421   1.00 18.86 ? 58   LEU A CD1 1 
ATOM   487  C CD2 . LEU A  1 59  ? 36.069  -19.969 2.756   1.00 20.15 ? 58   LEU A CD2 1 
ATOM   488  N N   . VAL A  1 60  ? 35.858  -18.728 -2.387  1.00 18.67 ? 59   VAL A N   1 
ATOM   489  C CA  . VAL A  1 60  ? 35.702  -19.064 -3.798  1.00 19.11 ? 59   VAL A CA  1 
ATOM   490  C C   . VAL A  1 60  ? 37.051  -19.377 -4.430  1.00 19.53 ? 59   VAL A C   1 
ATOM   491  O O   . VAL A  1 60  ? 38.095  -18.960 -3.926  1.00 19.44 ? 59   VAL A O   1 
ATOM   492  C CB  . VAL A  1 60  ? 35.033  -17.918 -4.622  1.00 19.11 ? 59   VAL A CB  1 
ATOM   493  C CG1 . VAL A  1 60  ? 33.601  -17.619 -4.119  1.00 19.57 ? 59   VAL A CG1 1 
ATOM   494  C CG2 . VAL A  1 60  ? 35.884  -16.638 -4.613  1.00 19.35 ? 59   VAL A CG2 1 
ATOM   495  N N   . ASN A  1 61  ? 36.999  -20.105 -5.543  1.00 20.91 ? 60   ASN A N   1 
ATOM   496  C CA  . ASN A  1 61  ? 38.147  -20.295 -6.425  1.00 21.44 ? 60   ASN A CA  1 
ATOM   497  C C   . ASN A  1 61  ? 37.730  -20.083 -7.880  1.00 21.95 ? 60   ASN A C   1 
ATOM   498  O O   . ASN A  1 61  ? 36.583  -19.706 -8.159  1.00 21.86 ? 60   ASN A O   1 
ATOM   499  C CB  . ASN A  1 61  ? 38.800  -21.678 -6.214  1.00 22.10 ? 60   ASN A CB  1 
ATOM   500  C CG  . ASN A  1 61  ? 37.841  -22.846 -6.489  1.00 21.95 ? 60   ASN A CG  1 
ATOM   501  O OD1 . ASN A  1 61  ? 36.824  -22.697 -7.159  1.00 23.58 ? 60   ASN A OD1 1 
ATOM   502  N ND2 . ASN A  1 61  ? 38.191  -24.025 -5.982  1.00 23.92 ? 60   ASN A ND2 1 
ATOM   503  N N   . LYS A  1 62  ? 38.653  -20.331 -8.811  1.00 22.32 ? 61   LYS A N   1 
ATOM   504  C CA  . LYS A  1 62  ? 38.367  -20.183 -10.242 1.00 22.71 ? 61   LYS A CA  1 
ATOM   505  C C   . LYS A  1 62  ? 37.128  -20.982 -10.682 1.00 22.61 ? 61   LYS A C   1 
ATOM   506  O O   . LYS A  1 62  ? 36.275  -20.459 -11.414 1.00 22.20 ? 61   LYS A O   1 
ATOM   507  C CB  . LYS A  1 62  ? 39.597  -20.595 -11.074 1.00 23.56 ? 61   LYS A CB  1 
ATOM   508  C CG  . LYS A  1 62  ? 39.414  -20.531 -12.584 1.00 25.73 ? 61   LYS A CG  1 
ATOM   509  C CD  . LYS A  1 62  ? 40.698  -20.954 -13.313 1.00 29.41 ? 61   LYS A CD  1 
ATOM   510  C CE  . LYS A  1 62  ? 40.451  -21.150 -14.812 1.00 32.37 ? 61   LYS A CE  1 
ATOM   511  N NZ  . LYS A  1 62  ? 41.713  -21.065 -15.619 1.00 34.76 ? 61   LYS A NZ  1 
ATOM   512  N N   . GLU A  1 63  ? 37.041  -22.240 -10.238 1.00 22.59 ? 62   GLU A N   1 
ATOM   513  C CA  . GLU A  1 63  ? 35.931  -23.141 -10.595 1.00 22.83 ? 62   GLU A CA  1 
ATOM   514  C C   . GLU A  1 63  ? 34.578  -22.590 -10.117 1.00 22.36 ? 62   GLU A C   1 
ATOM   515  O O   . GLU A  1 63  ? 33.593  -22.568 -10.872 1.00 22.60 ? 62   GLU A O   1 
ATOM   516  C CB  A GLU A  1 63  ? 36.172  -24.559 -10.041 0.35 22.85 ? 62   GLU A CB  1 
ATOM   517  C CB  B GLU A  1 63  ? 36.174  -24.541 -10.010 0.65 23.55 ? 62   GLU A CB  1 
ATOM   518  C CG  A GLU A  1 63  ? 35.088  -25.567 -10.410 0.35 22.84 ? 62   GLU A CG  1 
ATOM   519  C CG  B GLU A  1 63  ? 37.549  -25.116 -10.316 0.65 26.04 ? 62   GLU A CG  1 
ATOM   520  C CD  A GLU A  1 63  ? 35.483  -27.026 -10.201 0.35 23.10 ? 62   GLU A CD  1 
ATOM   521  C CD  B GLU A  1 63  ? 38.480  -25.077 -9.119  0.65 28.60 ? 62   GLU A CD  1 
ATOM   522  O OE1 A GLU A  1 63  ? 34.767  -27.895 -10.739 0.35 24.45 ? 62   GLU A OE1 1 
ATOM   523  O OE1 B GLU A  1 63  ? 38.437  -26.043 -8.314  0.65 30.79 ? 62   GLU A OE1 1 
ATOM   524  O OE2 A GLU A  1 63  ? 36.482  -27.320 -9.506  0.35 22.59 ? 62   GLU A OE2 1 
ATOM   525  O OE2 B GLU A  1 63  ? 39.251  -24.088 -8.989  0.65 27.72 ? 62   GLU A OE2 1 
ATOM   526  N N   . VAL A  1 64  ? 34.543  -22.119 -8.870  1.00 21.75 ? 63   VAL A N   1 
ATOM   527  C CA  . VAL A  1 64  ? 33.307  -21.586 -8.300  1.00 21.09 ? 63   VAL A CA  1 
ATOM   528  C C   . VAL A  1 64  ? 32.824  -20.362 -9.085  1.00 21.08 ? 63   VAL A C   1 
ATOM   529  O O   . VAL A  1 64  ? 31.633  -20.264 -9.423  1.00 21.30 ? 63   VAL A O   1 
ATOM   530  C CB  . VAL A  1 64  ? 33.462  -21.276 -6.787  1.00 20.99 ? 63   VAL A CB  1 
ATOM   531  C CG1 . VAL A  1 64  ? 32.201  -20.579 -6.229  1.00 20.42 ? 63   VAL A CG1 1 
ATOM   532  C CG2 . VAL A  1 64  ? 33.724  -22.561 -6.025  1.00 21.06 ? 63   VAL A CG2 1 
ATOM   533  N N   . MET A  1 65  ? 33.747  -19.455 -9.408  1.00 20.83 ? 64   MET A N   1 
ATOM   534  C CA  . MET A  1 65  ? 33.391  -18.258 -10.170 1.00 20.81 ? 64   MET A CA  1 
ATOM   535  C C   . MET A  1 65  ? 32.872  -18.602 -11.565 1.00 20.97 ? 64   MET A C   1 
ATOM   536  O O   . MET A  1 65  ? 31.910  -17.995 -12.032 1.00 21.13 ? 64   MET A O   1 
ATOM   537  C CB  . MET A  1 65  ? 34.561  -17.253 -10.232 1.00 20.82 ? 64   MET A CB  1 
ATOM   538  C CG  . MET A  1 65  ? 35.016  -16.707 -8.860  1.00 21.82 ? 64   MET A CG  1 
ATOM   539  S SD  . MET A  1 65  ? 33.668  -15.982 -7.839  1.00 20.90 ? 64   MET A SD  1 
ATOM   540  C CE  . MET A  1 65  ? 33.085  -14.634 -8.937  1.00 20.04 ? 64   MET A CE  1 
ATOM   541  N N   . GLN A  1 66  ? 33.505  -19.581 -12.223 1.00 21.07 ? 65   GLN A N   1 
ATOM   542  C CA  . GLN A  1 66  ? 33.005  -20.079 -13.508 1.00 22.25 ? 65   GLN A CA  1 
ATOM   543  C C   . GLN A  1 66  ? 31.583  -20.646 -13.410 1.00 21.23 ? 65   GLN A C   1 
ATOM   544  O O   . GLN A  1 66  ? 30.721  -20.289 -14.213 1.00 21.26 ? 65   GLN A O   1 
ATOM   545  C CB  . GLN A  1 66  ? 33.969  -21.114 -14.117 1.00 22.68 ? 65   GLN A CB  1 
ATOM   546  C CG  . GLN A  1 66  ? 35.089  -20.473 -14.925 1.00 27.49 ? 65   GLN A CG  1 
ATOM   547  C CD  . GLN A  1 66  ? 36.229  -21.433 -15.289 1.00 32.93 ? 65   GLN A CD  1 
ATOM   548  O OE1 . GLN A  1 66  ? 37.175  -21.034 -15.982 1.00 35.83 ? 65   GLN A OE1 1 
ATOM   549  N NE2 . GLN A  1 66  ? 36.150  -22.681 -14.820 1.00 34.64 ? 65   GLN A NE2 1 
ATOM   550  N N   . MET A  1 67  ? 31.338  -21.498 -12.419 1.00 21.20 ? 66   MET A N   1 
ATOM   551  C CA  . MET A  1 67  ? 30.001  -22.049 -12.200 1.00 21.13 ? 66   MET A CA  1 
ATOM   552  C C   . MET A  1 67  ? 28.965  -20.955 -11.925 1.00 20.96 ? 66   MET A C   1 
ATOM   553  O O   . MET A  1 67  ? 27.828  -21.035 -12.390 1.00 20.95 ? 66   MET A O   1 
ATOM   554  C CB  . MET A  1 67  ? 30.007  -23.064 -11.059 1.00 21.40 ? 66   MET A CB  1 
ATOM   555  C CG  . MET A  1 67  ? 30.736  -24.372 -11.398 1.00 23.63 ? 66   MET A CG  1 
ATOM   556  S SD  . MET A  1 67  ? 30.474  -25.613 -10.114 1.00 26.73 ? 66   MET A SD  1 
ATOM   557  C CE  . MET A  1 67  ? 31.595  -25.036 -8.806  1.00 26.80 ? 66   MET A CE  1 
ATOM   558  N N   . LEU A  1 68  ? 29.369  -19.928 -11.179 1.00 20.23 ? 67   LEU A N   1 
ATOM   559  C CA  . LEU A  1 68  ? 28.442  -18.836 -10.857 1.00 20.14 ? 67   LEU A CA  1 
ATOM   560  C C   . LEU A  1 68  ? 28.096  -17.992 -12.080 1.00 20.01 ? 67   LEU A C   1 
ATOM   561  O O   . LEU A  1 68  ? 26.937  -17.650 -12.313 1.00 19.84 ? 67   LEU A O   1 
ATOM   562  C CB  . LEU A  1 68  ? 28.991  -17.963 -9.710  1.00 19.96 ? 67   LEU A CB  1 
ATOM   563  C CG  . LEU A  1 68  ? 28.949  -18.525 -8.285  1.00 19.81 ? 67   LEU A CG  1 
ATOM   564  C CD1 . LEU A  1 68  ? 29.860  -17.722 -7.350  1.00 20.11 ? 67   LEU A CD1 1 
ATOM   565  C CD2 . LEU A  1 68  ? 27.518  -18.540 -7.748  1.00 19.46 ? 67   LEU A CD2 1 
ATOM   566  N N   . VAL A  1 69  ? 29.115  -17.662 -12.865 1.00 20.18 ? 68   VAL A N   1 
ATOM   567  C CA  . VAL A  1 69  ? 28.922  -16.971 -14.133 1.00 20.12 ? 68   VAL A CA  1 
ATOM   568  C C   . VAL A  1 69  ? 28.045  -17.762 -15.119 1.00 20.89 ? 68   VAL A C   1 
ATOM   569  O O   . VAL A  1 69  ? 27.152  -17.186 -15.734 1.00 19.75 ? 68   VAL A O   1 
ATOM   570  C CB  . VAL A  1 69  ? 30.287  -16.541 -14.755 1.00 20.71 ? 68   VAL A CB  1 
ATOM   571  C CG1 . VAL A  1 69  ? 30.077  -15.965 -16.134 1.00 20.88 ? 68   VAL A CG1 1 
ATOM   572  C CG2 . VAL A  1 69  ? 30.952  -15.486 -13.878 1.00 20.08 ? 68   VAL A CG2 1 
ATOM   573  N N   . GLU A  1 70  ? 28.268  -19.073 -15.235 1.00 21.87 ? 69   GLU A N   1 
ATOM   574  C CA  . GLU A  1 70  ? 27.400  -19.912 -16.073 1.00 23.07 ? 69   GLU A CA  1 
ATOM   575  C C   . GLU A  1 70  ? 25.960  -19.859 -15.598 1.00 22.61 ? 69   GLU A C   1 
ATOM   576  O O   . GLU A  1 70  ? 25.045  -19.820 -16.417 1.00 23.36 ? 69   GLU A O   1 
ATOM   577  C CB  . GLU A  1 70  ? 27.861  -21.377 -16.134 1.00 24.01 ? 69   GLU A CB  1 
ATOM   578  C CG  . GLU A  1 70  ? 29.294  -21.586 -16.596 1.00 28.94 ? 69   GLU A CG  1 
ATOM   579  C CD  . GLU A  1 70  ? 29.522  -21.249 -18.054 1.00 34.54 ? 69   GLU A CD  1 
ATOM   580  O OE1 . GLU A  1 70  ? 30.713  -21.185 -18.433 1.00 38.47 ? 69   GLU A OE1 1 
ATOM   581  O OE2 . GLU A  1 70  ? 28.538  -21.058 -18.822 1.00 37.16 ? 69   GLU A OE2 1 
ATOM   582  N N   . LEU A  1 71  ? 25.764  -19.838 -14.281 1.00 21.80 ? 70   LEU A N   1 
ATOM   583  C CA  . LEU A  1 71  ? 24.420  -19.735 -13.722 1.00 21.24 ? 70   LEU A CA  1 
ATOM   584  C C   . LEU A  1 71  ? 23.734  -18.422 -14.127 1.00 20.99 ? 70   LEU A C   1 
ATOM   585  O O   . LEU A  1 71  ? 22.574  -18.426 -14.520 1.00 20.45 ? 70   LEU A O   1 
ATOM   586  C CB  . LEU A  1 71  ? 24.421  -19.922 -12.198 1.00 21.28 ? 70   LEU A CB  1 
ATOM   587  C CG  . LEU A  1 71  ? 23.046  -19.791 -11.533 1.00 21.03 ? 70   LEU A CG  1 
ATOM   588  C CD1 . LEU A  1 71  ? 22.028  -20.811 -12.093 1.00 21.73 ? 70   LEU A CD1 1 
ATOM   589  C CD2 . LEU A  1 71  ? 23.164  -19.926 -10.031 1.00 20.66 ? 70   LEU A CD2 1 
ATOM   590  N N   . ALA A  1 72  ? 24.448  -17.298 -14.026 1.00 21.04 ? 71   ALA A N   1 
ATOM   591  C CA  . ALA A  1 72  ? 23.904  -16.016 -14.489 1.00 21.20 ? 71   ALA A CA  1 
ATOM   592  C C   . ALA A  1 72  ? 23.493  -16.062 -15.965 1.00 21.79 ? 71   ALA A C   1 
ATOM   593  O O   . ALA A  1 72  ? 22.420  -15.575 -16.342 1.00 21.87 ? 71   ALA A O   1 
ATOM   594  C CB  . ALA A  1 72  ? 24.908  -14.880 -14.234 1.00 21.12 ? 71   ALA A CB  1 
ATOM   595  N N   . LYS A  1 73  ? 24.339  -16.677 -16.789 1.00 22.87 ? 72   LYS A N   1 
ATOM   596  C CA  . LYS A  1 73  ? 24.024  -16.849 -18.199 1.00 24.07 ? 72   LYS A CA  1 
ATOM   597  C C   . LYS A  1 73  ? 22.781  -17.707 -18.384 1.00 23.49 ? 72   LYS A C   1 
ATOM   598  O O   . LYS A  1 73  ? 21.891  -17.336 -19.137 1.00 24.96 ? 72   LYS A O   1 
ATOM   599  C CB  . LYS A  1 73  ? 25.223  -17.411 -18.978 1.00 24.19 ? 72   LYS A CB  1 
ATOM   600  C CG  . LYS A  1 73  ? 26.278  -16.344 -19.276 1.00 26.92 ? 72   LYS A CG  1 
ATOM   601  C CD  . LYS A  1 73  ? 27.600  -16.928 -19.742 1.00 30.02 ? 72   LYS A CD  1 
ATOM   602  C CE  . LYS A  1 73  ? 28.669  -15.843 -19.870 1.00 32.46 ? 72   LYS A CE  1 
ATOM   603  N NZ  . LYS A  1 73  ? 29.758  -16.236 -20.829 1.00 33.68 ? 72   LYS A NZ  1 
ATOM   604  N N   . SER A  1 74  ? 22.698  -18.821 -17.653 1.00 23.98 ? 73   SER A N   1 
ATOM   605  C CA  . SER A  1 74  ? 21.562  -19.742 -17.773 1.00 23.49 ? 73   SER A CA  1 
ATOM   606  C C   . SER A  1 74  ? 20.242  -19.174 -17.211 1.00 23.78 ? 73   SER A C   1 
ATOM   607  O O   . SER A  1 74  ? 19.151  -19.596 -17.599 1.00 24.48 ? 73   SER A O   1 
ATOM   608  C CB  . SER A  1 74  ? 21.923  -21.111 -17.172 1.00 23.83 ? 73   SER A CB  1 
ATOM   609  O OG  A SER A  1 74  ? 20.811  -21.976 -17.130 0.50 22.78 ? 73   SER A OG  1 
ATOM   610  O OG  B SER A  1 74  ? 21.754  -21.161 -15.768 0.50 24.27 ? 73   SER A OG  1 
ATOM   611  N N   . ARG A  1 75  ? 20.348  -18.187 -16.318 1.00 22.54 ? 74   ARG A N   1 
ATOM   612  C CA  . ARG A  1 75  ? 19.167  -17.535 -15.760 1.00 22.12 ? 74   ARG A CA  1 
ATOM   613  C C   . ARG A  1 75  ? 18.719  -16.316 -16.588 1.00 21.86 ? 74   ARG A C   1 
ATOM   614  O O   . ARG A  1 75  ? 17.726  -15.669 -16.266 1.00 22.08 ? 74   ARG A O   1 
ATOM   615  C CB  . ARG A  1 75  ? 19.385  -17.178 -14.272 1.00 21.30 ? 74   ARG A CB  1 
ATOM   616  C CG  . ARG A  1 75  ? 19.466  -18.375 -13.303 1.00 21.59 ? 74   ARG A CG  1 
ATOM   617  C CD  . ARG A  1 75  ? 18.140  -19.164 -13.113 1.00 21.08 ? 74   ARG A CD  1 
ATOM   618  N NE  . ARG A  1 75  ? 17.059  -18.239 -12.803 1.00 20.80 ? 74   ARG A NE  1 
ATOM   619  C CZ  . ARG A  1 75  ? 15.973  -18.032 -13.533 1.00 21.84 ? 74   ARG A CZ  1 
ATOM   620  N NH1 . ARG A  1 75  ? 15.726  -18.751 -14.631 1.00 21.05 ? 74   ARG A NH1 1 
ATOM   621  N NH2 . ARG A  1 75  ? 15.104  -17.105 -13.139 1.00 23.35 ? 74   ARG A NH2 1 
ATOM   622  N N   . GLY A  1 76  ? 19.436  -16.030 -17.676 1.00 21.63 ? 75   GLY A N   1 
ATOM   623  C CA  . GLY A  1 76  ? 19.055  -14.963 -18.590 1.00 21.64 ? 75   GLY A CA  1 
ATOM   624  C C   . GLY A  1 76  ? 19.253  -13.535 -18.098 1.00 21.54 ? 75   GLY A C   1 
ATOM   625  O O   . GLY A  1 76  ? 18.486  -12.618 -18.443 1.00 21.54 ? 75   GLY A O   1 
ATOM   626  N N   . VAL A  1 77  ? 20.315  -13.334 -17.333 1.00 21.24 ? 76   VAL A N   1 
ATOM   627  C CA  . VAL A  1 77  ? 20.600  -12.022 -16.726 1.00 21.32 ? 76   VAL A CA  1 
ATOM   628  C C   . VAL A  1 77  ? 20.842  -10.926 -17.780 1.00 21.38 ? 76   VAL A C   1 
ATOM   629  O O   . VAL A  1 77  ? 20.321  -9.809  -17.657 1.00 21.24 ? 76   VAL A O   1 
ATOM   630  C CB  . VAL A  1 77  ? 21.773  -12.132 -15.724 1.00 20.21 ? 76   VAL A CB  1 
ATOM   631  C CG1 . VAL A  1 77  ? 22.319  -10.745 -15.316 1.00 21.97 ? 76   VAL A CG1 1 
ATOM   632  C CG2 . VAL A  1 77  ? 21.325  -12.899 -14.487 1.00 21.38 ? 76   VAL A CG2 1 
ATOM   633  N N   . GLU A  1 78  ? 21.579  -11.251 -18.844 1.00 22.18 ? 77   GLU A N   1 
ATOM   634  C CA  . GLU A  1 78  ? 21.882  -10.250 -19.875 1.00 22.81 ? 77   GLU A CA  1 
ATOM   635  C C   . GLU A  1 78  ? 20.639  -9.765  -20.619 1.00 22.33 ? 77   GLU A C   1 
ATOM   636  O O   . GLU A  1 78  ? 20.453  -8.565  -20.799 1.00 22.17 ? 77   GLU A O   1 
ATOM   637  C CB  . GLU A  1 78  ? 22.969  -10.737 -20.844 1.00 23.26 ? 77   GLU A CB  1 
ATOM   638  C CG  . GLU A  1 78  ? 24.352  -10.689 -20.226 1.00 26.12 ? 77   GLU A CG  1 
ATOM   639  C CD  . GLU A  1 78  ? 25.413  -11.400 -21.043 1.00 30.84 ? 77   GLU A CD  1 
ATOM   640  O OE1 . GLU A  1 78  ? 26.411  -10.739 -21.387 1.00 33.98 ? 77   GLU A OE1 1 
ATOM   641  O OE2 . GLU A  1 78  ? 25.269  -12.613 -21.316 1.00 32.56 ? 77   GLU A OE2 1 
ATOM   642  N N   . ALA A  1 79  ? 19.773  -10.695 -21.028 1.00 21.64 ? 78   ALA A N   1 
ATOM   643  C CA  . ALA A  1 79  ? 18.545  -10.311 -21.709 1.00 21.16 ? 78   ALA A CA  1 
ATOM   644  C C   . ALA A  1 79  ? 17.623  -9.505  -20.789 1.00 20.47 ? 78   ALA A C   1 
ATOM   645  O O   . ALA A  1 79  ? 17.003  -8.549  -21.224 1.00 20.77 ? 78   ALA A O   1 
ATOM   646  C CB  . ALA A  1 79  ? 17.818  -11.546 -22.268 1.00 21.35 ? 78   ALA A CB  1 
ATOM   647  N N   . ALA A  1 80  ? 17.543  -9.893  -19.513 1.00 20.67 ? 79   ALA A N   1 
ATOM   648  C CA  . ALA A  1 80  ? 16.681  -9.176  -18.573 1.00 20.08 ? 79   ALA A CA  1 
ATOM   649  C C   . ALA A  1 80  ? 17.170  -7.736  -18.393 1.00 20.27 ? 79   ALA A C   1 
ATOM   650  O O   . ALA A  1 80  ? 16.368  -6.780  -18.395 1.00 19.91 ? 79   ALA A O   1 
ATOM   651  C CB  . ALA A  1 80  ? 16.639  -9.905  -17.231 1.00 20.98 ? 79   ALA A CB  1 
ATOM   652  N N   . ARG A  1 81  ? 18.487  -7.595  -18.269 1.00 20.38 ? 80   ARG A N   1 
ATOM   653  C CA  . ARG A  1 81  ? 19.120  -6.282  -18.165 1.00 20.49 ? 80   ARG A CA  1 
ATOM   654  C C   . ARG A  1 81  ? 18.804  -5.397  -19.367 1.00 20.64 ? 80   ARG A C   1 
ATOM   655  O O   . ARG A  1 81  ? 18.370  -4.244  -19.212 1.00 19.66 ? 80   ARG A O   1 
ATOM   656  C CB  . ARG A  1 81  ? 20.629  -6.434  -17.993 1.00 20.28 ? 80   ARG A CB  1 
ATOM   657  C CG  . ARG A  1 81  ? 21.414  -5.104  -18.029 1.00 19.09 ? 80   ARG A CG  1 
ATOM   658  C CD  . ARG A  1 81  ? 22.884  -5.281  -18.328 1.00 21.20 ? 80   ARG A CD  1 
ATOM   659  N NE  . ARG A  1 81  ? 23.048  -5.994  -19.598 1.00 23.91 ? 80   ARG A NE  1 
ATOM   660  C CZ  . ARG A  1 81  ? 24.130  -6.676  -19.966 1.00 24.63 ? 80   ARG A CZ  1 
ATOM   661  N NH1 . ARG A  1 81  ? 25.202  -6.736  -19.192 1.00 23.79 ? 80   ARG A NH1 1 
ATOM   662  N NH2 . ARG A  1 81  ? 24.124  -7.317  -21.134 1.00 26.89 ? 80   ARG A NH2 1 
ATOM   663  N N   . ASP A  1 82  ? 19.011  -5.938  -20.572 1.00 21.32 ? 81   ASP A N   1 
ATOM   664  C CA  . ASP A  1 82  ? 18.742  -5.189  -21.794 1.00 22.08 ? 81   ASP A CA  1 
ATOM   665  C C   . ASP A  1 82  ? 17.277  -4.746  -21.876 1.00 22.18 ? 81   ASP A C   1 
ATOM   666  O O   . ASP A  1 82  ? 16.976  -3.641  -22.328 1.00 22.17 ? 81   ASP A O   1 
ATOM   667  C CB  . ASP A  1 82  ? 19.128  -6.021  -23.032 1.00 22.49 ? 81   ASP A CB  1 
ATOM   668  C CG  . ASP A  1 82  ? 20.629  -6.313  -23.117 1.00 24.06 ? 81   ASP A CG  1 
ATOM   669  O OD1 . ASP A  1 82  ? 21.426  -5.771  -22.320 1.00 24.51 ? 81   ASP A OD1 1 
ATOM   670  O OD2 . ASP A  1 82  ? 21.113  -7.103  -23.965 1.00 27.56 ? 81   ASP A OD2 1 
ATOM   671  N N   . ASN A  1 83  ? 16.369  -5.615  -21.420 1.00 22.43 ? 82   ASN A N   1 
ATOM   672  C CA  . ASN A  1 83  ? 14.949  -5.288  -21.357 1.00 22.33 ? 82   ASN A CA  1 
ATOM   673  C C   . ASN A  1 83  ? 14.640  -4.143  -20.371 1.00 22.02 ? 82   ASN A C   1 
ATOM   674  O O   . ASN A  1 83  ? 13.815  -3.280  -20.650 1.00 21.22 ? 82   ASN A O   1 
ATOM   675  C CB  . ASN A  1 83  ? 14.140  -6.538  -21.016 1.00 23.35 ? 82   ASN A CB  1 
ATOM   676  C CG  . ASN A  1 83  ? 13.967  -7.471  -22.213 1.00 26.05 ? 82   ASN A CG  1 
ATOM   677  O OD1 . ASN A  1 83  ? 13.910  -8.688  -22.059 1.00 29.94 ? 82   ASN A OD1 1 
ATOM   678  N ND2 . ASN A  1 83  ? 13.853  -6.894  -23.402 1.00 29.04 ? 82   ASN A ND2 1 
ATOM   679  N N   . MET A  1 84  ? 15.300  -4.141  -19.212 1.00 21.18 ? 83   MET A N   1 
ATOM   680  C CA  . MET A  1 84  ? 15.166  -2.988  -18.312 1.00 20.59 ? 83   MET A CA  1 
ATOM   681  C C   . MET A  1 84  ? 15.578  -1.677  -19.006 1.00 20.13 ? 83   MET A C   1 
ATOM   682  O O   . MET A  1 84  ? 14.833  -0.691  -18.992 1.00 19.49 ? 83   MET A O   1 
ATOM   683  C CB  . MET A  1 84  ? 15.978  -3.168  -17.020 1.00 20.70 ? 83   MET A CB  1 
ATOM   684  C CG  . MET A  1 84  ? 15.889  -1.942  -16.117 1.00 20.99 ? 83   MET A CG  1 
ATOM   685  S SD  . MET A  1 84  ? 16.528  -2.200  -14.442 1.00 22.52 ? 83   MET A SD  1 
ATOM   686  C CE  . MET A  1 84  ? 18.179  -2.080  -14.819 1.00 20.74 ? 83   MET A CE  1 
ATOM   687  N N   . PHE A  1 85  ? 16.775  -1.669  -19.591 1.00 20.68 ? 84   PHE A N   1 
ATOM   688  C CA  . PHE A  1 85  ? 17.341  -0.445  -20.164 1.00 21.48 ? 84   PHE A CA  1 
ATOM   689  C C   . PHE A  1 85  ? 16.544  0.060   -21.365 1.00 22.12 ? 84   PHE A C   1 
ATOM   690  O O   . PHE A  1 85  ? 16.560  1.254   -21.673 1.00 22.95 ? 84   PHE A O   1 
ATOM   691  C CB  . PHE A  1 85  ? 18.796  -0.660  -20.595 1.00 21.37 ? 84   PHE A CB  1 
ATOM   692  C CG  . PHE A  1 85  ? 19.811  -0.511  -19.484 1.00 20.99 ? 84   PHE A CG  1 
ATOM   693  C CD1 . PHE A  1 85  ? 19.903  -1.461  -18.461 1.00 20.79 ? 84   PHE A CD1 1 
ATOM   694  C CD2 . PHE A  1 85  ? 20.708  0.556   -19.483 1.00 22.81 ? 84   PHE A CD2 1 
ATOM   695  C CE1 . PHE A  1 85  ? 20.862  -1.342  -17.460 1.00 20.64 ? 84   PHE A CE1 1 
ATOM   696  C CE2 . PHE A  1 85  ? 21.675  0.677   -18.474 1.00 21.72 ? 84   PHE A CE2 1 
ATOM   697  C CZ  . PHE A  1 85  ? 21.747  -0.268  -17.465 1.00 22.05 ? 84   PHE A CZ  1 
ATOM   698  N N   . SER A  1 86  ? 15.855  -0.850  -22.048 1.00 22.88 ? 85   SER A N   1 
ATOM   699  C CA  . SER A  1 86  ? 15.108  -0.467  -23.248 1.00 23.49 ? 85   SER A CA  1 
ATOM   700  C C   . SER A  1 86  ? 13.644  -0.078  -22.984 1.00 23.63 ? 85   SER A C   1 
ATOM   701  O O   . SER A  1 86  ? 12.915  0.266   -23.910 1.00 23.49 ? 85   SER A O   1 
ATOM   702  C CB  . SER A  1 86  ? 15.193  -1.579  -24.297 1.00 23.81 ? 85   SER A CB  1 
ATOM   703  O OG  . SER A  1 86  ? 14.362  -2.657  -23.917 1.00 25.67 ? 85   SER A OG  1 
ATOM   704  N N   . GLY A  1 87  ? 13.211  -0.139  -21.724 1.00 22.92 ? 86   GLY A N   1 
ATOM   705  C CA  . GLY A  1 87  ? 11.875  0.298   -21.368 1.00 22.84 ? 86   GLY A CA  1 
ATOM   706  C C   . GLY A  1 87  ? 10.787  -0.763  -21.484 1.00 22.68 ? 86   GLY A C   1 
ATOM   707  O O   . GLY A  1 87  ? 9.604   -0.435  -21.466 1.00 22.70 ? 86   GLY A O   1 
ATOM   708  N N   . SER A  1 88  ? 11.185  -2.029  -21.564 1.00 23.07 ? 87   SER A N   1 
ATOM   709  C CA  . SER A  1 88  ? 10.225  -3.131  -21.449 1.00 23.31 ? 87   SER A CA  1 
ATOM   710  C C   . SER A  1 88  ? 9.545   -3.128  -20.078 1.00 23.66 ? 87   SER A C   1 
ATOM   711  O O   . SER A  1 88  ? 10.141  -2.683  -19.083 1.00 23.30 ? 87   SER A O   1 
ATOM   712  C CB  . SER A  1 88  ? 10.896  -4.472  -21.725 1.00 23.88 ? 87   SER A CB  1 
ATOM   713  O OG  A SER A  1 88  ? 9.922   -5.494  -21.834 0.50 24.58 ? 87   SER A OG  1 
ATOM   714  O OG  B SER A  1 88  ? 11.453  -4.489  -23.031 0.50 24.02 ? 87   SER A OG  1 
ATOM   715  N N   . LYS A  1 89  ? 8.301   -3.610  -20.029 1.00 23.26 ? 88   LYS A N   1 
ATOM   716  C CA  . LYS A  1 89  ? 7.497   -3.531  -18.800 1.00 22.39 ? 88   LYS A CA  1 
ATOM   717  C C   . LYS A  1 89  ? 7.775   -4.711  -17.868 1.00 22.24 ? 88   LYS A C   1 
ATOM   718  O O   . LYS A  1 89  ? 6.920   -5.582  -17.653 1.00 22.43 ? 88   LYS A O   1 
ATOM   719  C CB  . LYS A  1 89  ? 6.004   -3.339  -19.129 1.00 22.69 ? 88   LYS A CB  1 
ATOM   720  C CG  . LYS A  1 89  ? 5.729   -2.031  -19.878 1.00 22.75 ? 88   LYS A CG  1 
ATOM   721  C CD  . LYS A  1 89  ? 4.247   -1.871  -20.215 1.00 25.56 ? 88   LYS A CD  1 
ATOM   722  C CE  . LYS A  1 89  ? 3.993   -0.541  -20.896 1.00 27.50 ? 88   LYS A CE  1 
ATOM   723  N NZ  . LYS A  1 89  ? 2.547   -0.333  -21.213 1.00 29.76 ? 88   LYS A NZ  1 
ATOM   724  N N   . ILE A  1 90  ? 8.991   -4.723  -17.321 1.00 20.70 ? 89   ILE A N   1 
ATOM   725  C CA  . ILE A  1 90  ? 9.518   -5.882  -16.573 1.00 20.47 ? 89   ILE A CA  1 
ATOM   726  C C   . ILE A  1 90  ? 8.974   -5.976  -15.139 1.00 20.39 ? 89   ILE A C   1 
ATOM   727  O O   . ILE A  1 90  ? 9.137   -7.013  -14.489 1.00 20.93 ? 89   ILE A O   1 
ATOM   728  C CB  . ILE A  1 90  ? 11.079  -5.926  -16.582 1.00 20.45 ? 89   ILE A CB  1 
ATOM   729  C CG1 . ILE A  1 90  ? 11.668  -4.716  -15.849 1.00 20.14 ? 89   ILE A CG1 1 
ATOM   730  C CG2 . ILE A  1 90  ? 11.656  -6.036  -18.019 1.00 22.09 ? 89   ILE A CG2 1 
ATOM   731  C CD1 . ILE A  1 90  ? 13.080  -4.952  -15.336 1.00 21.20 ? 89   ILE A CD1 1 
ATOM   732  N N   . ASN A  1 91  ? 8.377   -4.884  -14.649 1.00 20.44 ? 90   ASN A N   1 
ATOM   733  C CA  . ASN A  1 91  ? 7.562   -4.905  -13.432 1.00 20.32 ? 90   ASN A CA  1 
ATOM   734  C C   . ASN A  1 91  ? 6.231   -5.533  -13.843 1.00 20.56 ? 90   ASN A C   1 
ATOM   735  O O   . ASN A  1 91  ? 5.264   -4.823  -14.108 1.00 21.20 ? 90   ASN A O   1 
ATOM   736  C CB  . ASN A  1 91  ? 7.368   -3.472  -12.884 1.00 20.26 ? 90   ASN A CB  1 
ATOM   737  C CG  . ASN A  1 91  ? 6.579   -3.406  -11.561 1.00 20.31 ? 90   ASN A CG  1 
ATOM   738  O OD1 . ASN A  1 91  ? 6.510   -2.336  -10.941 1.00 21.70 ? 90   ASN A OD1 1 
ATOM   739  N ND2 . ASN A  1 91  ? 5.972   -4.510  -11.144 1.00 17.38 ? 90   ASN A ND2 1 
ATOM   740  N N   . TYR A  1 92  ? 6.208   -6.867  -13.913 1.00 21.10 ? 91   TYR A N   1 
ATOM   741  C CA  . TYR A  1 92  ? 5.105   -7.602  -14.535 1.00 22.06 ? 91   TYR A CA  1 
ATOM   742  C C   . TYR A  1 92  ? 3.827   -7.666  -13.694 1.00 22.26 ? 91   TYR A C   1 
ATOM   743  O O   . TYR A  1 92  ? 2.728   -7.778  -14.249 1.00 24.03 ? 91   TYR A O   1 
ATOM   744  C CB  . TYR A  1 92  ? 5.563   -9.004  -14.990 1.00 22.13 ? 91   TYR A CB  1 
ATOM   745  C CG  . TYR A  1 92  ? 6.330   -9.794  -13.937 1.00 22.59 ? 91   TYR A CG  1 
ATOM   746  C CD1 . TYR A  1 92  ? 7.720   -9.851  -13.961 1.00 23.51 ? 91   TYR A CD1 1 
ATOM   747  C CD2 . TYR A  1 92  ? 5.655   -10.487 -12.918 1.00 23.56 ? 91   TYR A CD2 1 
ATOM   748  C CE1 . TYR A  1 92  ? 8.430   -10.574 -13.017 1.00 24.22 ? 91   TYR A CE1 1 
ATOM   749  C CE2 . TYR A  1 92  ? 6.365   -11.220 -11.950 1.00 21.91 ? 91   TYR A CE2 1 
ATOM   750  C CZ  . TYR A  1 92  ? 7.759   -11.247 -12.010 1.00 22.61 ? 91   TYR A CZ  1 
ATOM   751  O OH  . TYR A  1 92  ? 8.506   -11.950 -11.092 1.00 25.06 ? 91   TYR A OH  1 
ATOM   752  N N   . THR A  1 93  ? 3.931   -7.573  -12.366 1.00 21.51 ? 92   THR A N   1 
ATOM   753  C CA  . THR A  1 93  ? 2.707   -7.569  -11.566 1.00 20.93 ? 92   THR A CA  1 
ATOM   754  C C   . THR A  1 93  ? 1.953   -6.248  -11.660 1.00 21.01 ? 92   THR A C   1 
ATOM   755  O O   . THR A  1 93  ? 0.738   -6.226  -11.486 1.00 22.18 ? 92   THR A O   1 
ATOM   756  C CB  . THR A  1 93  ? 2.965   -7.931  -10.083 1.00 21.03 ? 92   THR A CB  1 
ATOM   757  O OG1 . THR A  1 93  ? 3.815   -6.933  -9.501  1.00 20.43 ? 92   THR A OG1 1 
ATOM   758  C CG2 . THR A  1 93  ? 3.761   -9.261  -9.927  1.00 20.61 ? 92   THR A CG2 1 
ATOM   759  N N   . GLU A  1 94  ? 2.660   -5.144  -11.915 1.00 20.99 ? 93   GLU A N   1 
ATOM   760  C CA  . GLU A  1 94  ? 2.038   -3.819  -11.994 1.00 20.88 ? 93   GLU A CA  1 
ATOM   761  C C   . GLU A  1 94  ? 1.949   -3.327  -13.444 1.00 21.24 ? 93   GLU A C   1 
ATOM   762  O O   . GLU A  1 94  ? 1.351   -2.270  -13.721 1.00 21.33 ? 93   GLU A O   1 
ATOM   763  C CB  . GLU A  1 94  ? 2.795   -2.799  -11.123 1.00 20.97 ? 93   GLU A CB  1 
ATOM   764  C CG  . GLU A  1 94  ? 2.690   -3.112  -9.637  1.00 21.30 ? 93   GLU A CG  1 
ATOM   765  C CD  . GLU A  1 94  ? 3.364   -2.089  -8.735  1.00 22.50 ? 93   GLU A CD  1 
ATOM   766  O OE1 . GLU A  1 94  ? 4.524   -1.728  -8.987  1.00 22.06 ? 93   GLU A OE1 1 
ATOM   767  O OE2 . GLU A  1 94  ? 2.738   -1.672  -7.737  1.00 26.42 ? 93   GLU A OE2 1 
ATOM   768  N N   . ASP A  1 95  ? 2.537   -4.127  -14.338 1.00 21.77 ? 94   ASP A N   1 
ATOM   769  C CA  . ASP A  1 95  ? 2.652   -3.826  -15.776 1.00 22.01 ? 94   ASP A CA  1 
ATOM   770  C C   . ASP A  1 95  ? 3.249   -2.429  -16.020 1.00 21.64 ? 94   ASP A C   1 
ATOM   771  O O   . ASP A  1 95  ? 2.636   -1.557  -16.636 1.00 22.58 ? 94   ASP A O   1 
ATOM   772  C CB  . ASP A  1 95  ? 1.305   -4.019  -16.499 1.00 22.87 ? 94   ASP A CB  1 
ATOM   773  C CG  . ASP A  1 95  ? 1.434   -3.913  -18.018 1.00 24.24 ? 94   ASP A CG  1 
ATOM   774  O OD1 . ASP A  1 95  ? 2.435   -4.402  -18.580 1.00 26.13 ? 94   ASP A OD1 1 
ATOM   775  O OD2 . ASP A  1 95  ? 0.572   -3.347  -18.733 1.00 29.42 ? 94   ASP A OD2 1 
ATOM   776  N N   . ARG A  1 96  ? 4.457   -2.237  -15.501 1.00 20.41 ? 95   ARG A N   1 
ATOM   777  C CA  . ARG A  1 96  ? 5.173   -0.972  -15.603 1.00 19.87 ? 95   ARG A CA  1 
ATOM   778  C C   . ARG A  1 96  ? 6.584   -1.190  -16.100 1.00 19.13 ? 95   ARG A C   1 
ATOM   779  O O   . ARG A  1 96  ? 7.174   -2.235  -15.854 1.00 19.11 ? 95   ARG A O   1 
ATOM   780  C CB  . ARG A  1 96  ? 5.280   -0.304  -14.226 1.00 19.93 ? 95   ARG A CB  1 
ATOM   781  C CG  . ARG A  1 96  ? 4.005   0.246   -13.653 1.00 20.44 ? 95   ARG A CG  1 
ATOM   782  C CD  . ARG A  1 96  ? 4.166   0.762   -12.214 1.00 20.44 ? 95   ARG A CD  1 
ATOM   783  N NE  . ARG A  1 96  ? 2.907   1.297   -11.681 1.00 22.96 ? 95   ARG A NE  1 
ATOM   784  C CZ  . ARG A  1 96  ? 2.725   1.758   -10.445 1.00 24.84 ? 95   ARG A CZ  1 
ATOM   785  N NH1 . ARG A  1 96  ? 3.723   1.776   -9.561  1.00 24.49 ? 95   ARG A NH1 1 
ATOM   786  N NH2 . ARG A  1 96  ? 1.525   2.216   -10.094 1.00 26.62 ? 95   ARG A NH2 1 
ATOM   787  N N   . ALA A  1 97  ? 7.135   -0.172  -16.767 1.00 18.24 ? 96   ALA A N   1 
ATOM   788  C CA  . ALA A  1 97  ? 8.565   -0.139  -17.039 1.00 18.12 ? 96   ALA A CA  1 
ATOM   789  C C   . ALA A  1 97  ? 9.333   0.107   -15.732 1.00 17.78 ? 96   ALA A C   1 
ATOM   790  O O   . ALA A  1 97  ? 8.736   0.440   -14.686 1.00 17.81 ? 96   ALA A O   1 
ATOM   791  C CB  . ALA A  1 97  ? 8.896   0.944   -18.065 1.00 18.28 ? 96   ALA A CB  1 
ATOM   792  N N   . VAL A  1 98  ? 10.643  -0.092  -15.807 1.00 17.11 ? 97   VAL A N   1 
ATOM   793  C CA  . VAL A  1 98  ? 11.528  0.117   -14.668 1.00 17.29 ? 97   VAL A CA  1 
ATOM   794  C C   . VAL A  1 98  ? 12.698  0.957   -15.177 1.00 16.89 ? 97   VAL A C   1 
ATOM   795  O O   . VAL A  1 98  ? 13.654  0.420   -15.752 1.00 17.41 ? 97   VAL A O   1 
ATOM   796  C CB  . VAL A  1 98  ? 11.983  -1.223  -14.075 1.00 17.05 ? 97   VAL A CB  1 
ATOM   797  C CG1 . VAL A  1 98  ? 13.023  -0.999  -12.960 1.00 16.55 ? 97   VAL A CG1 1 
ATOM   798  C CG2 . VAL A  1 98  ? 10.769  -1.975  -13.515 1.00 17.40 ? 97   VAL A CG2 1 
ATOM   799  N N   . LEU A  1 99  ? 12.628  2.269   -14.938 1.00 17.21 ? 98   LEU A N   1 
ATOM   800  C CA  . LEU A  1 99  ? 13.511  3.186   -15.660 1.00 17.02 ? 98   LEU A CA  1 
ATOM   801  C C   . LEU A  1 99  ? 14.207  4.238   -14.808 1.00 17.07 ? 98   LEU A C   1 
ATOM   802  O O   . LEU A  1 99  ? 14.379  5.386   -15.239 1.00 17.77 ? 98   LEU A O   1 
ATOM   803  C CB  . LEU A  1 99  ? 12.785  3.826   -16.858 1.00 17.58 ? 98   LEU A CB  1 
ATOM   804  C CG  . LEU A  1 99  ? 12.690  2.944   -18.116 1.00 18.30 ? 98   LEU A CG  1 
ATOM   805  C CD1 . LEU A  1 99  ? 11.841  3.661   -19.137 1.00 19.14 ? 98   LEU A CD1 1 
ATOM   806  C CD2 . LEU A  1 99  ? 14.066  2.601   -18.659 1.00 18.69 ? 98   LEU A CD2 1 
ATOM   807  N N   . HIS A  1 100 ? 14.652  3.853   -13.612 1.00 16.22 ? 99   HIS A N   1 
ATOM   808  C CA  . HIS A  1 100 ? 15.573  4.749   -12.896 1.00 15.77 ? 99   HIS A CA  1 
ATOM   809  C C   . HIS A  1 100 ? 16.822  5.050   -13.748 1.00 16.16 ? 99   HIS A C   1 
ATOM   810  O O   . HIS A  1 100 ? 17.380  6.154   -13.651 1.00 15.81 ? 99   HIS A O   1 
ATOM   811  C CB  . HIS A  1 100 ? 15.921  4.224   -11.481 1.00 15.36 ? 99   HIS A CB  1 
ATOM   812  C CG  . HIS A  1 100 ? 16.192  2.755   -11.434 1.00 14.58 ? 99   HIS A CG  1 
ATOM   813  N ND1 . HIS A  1 100 ? 15.182  1.812   -11.423 1.00 13.91 ? 99   HIS A ND1 1 
ATOM   814  C CD2 . HIS A  1 100 ? 17.353  2.066   -11.386 1.00 14.66 ? 99   HIS A CD2 1 
ATOM   815  C CE1 . HIS A  1 100 ? 15.713  0.605   -11.367 1.00 14.66 ? 99   HIS A CE1 1 
ATOM   816  N NE2 . HIS A  1 100 ? 17.030  0.729   -11.332 1.00 14.86 ? 99   HIS A NE2 1 
ATOM   817  N N   . VAL A  1 101 ? 17.235  4.117   -14.617 1.00 17.02 ? 100  VAL A N   1 
ATOM   818  C CA  . VAL A  1 101 ? 18.391  4.401   -15.489 1.00 17.58 ? 100  VAL A CA  1 
ATOM   819  C C   . VAL A  1 101 ? 18.101  5.561   -16.457 1.00 17.90 ? 100  VAL A C   1 
ATOM   820  O O   . VAL A  1 101 ? 19.024  6.263   -16.868 1.00 18.54 ? 100  VAL A O   1 
ATOM   821  C CB  . VAL A  1 101 ? 18.952  3.165   -16.225 1.00 17.69 ? 100  VAL A CB  1 
ATOM   822  C CG1 . VAL A  1 101 ? 19.377  2.098   -15.201 1.00 16.76 ? 100  VAL A CG1 1 
ATOM   823  C CG2 . VAL A  1 101 ? 17.923  2.598   -17.236 1.00 17.74 ? 100  VAL A CG2 1 
ATOM   824  N N   . ALA A  1 102 ? 16.838  5.782   -16.802 1.00 18.30 ? 101  ALA A N   1 
ATOM   825  C CA  . ALA A  1 102 ? 16.504  6.932   -17.657 1.00 17.55 ? 101  ALA A CA  1 
ATOM   826  C C   . ALA A  1 102 ? 16.731  8.273   -16.964 1.00 17.72 ? 101  ALA A C   1 
ATOM   827  O O   . ALA A  1 102 ? 17.141  9.243   -17.591 1.00 17.74 ? 101  ALA A O   1 
ATOM   828  C CB  . ALA A  1 102 ? 15.072  6.849   -18.167 1.00 17.66 ? 101  ALA A CB  1 
ATOM   829  N N   . LEU A  1 103 ? 16.468  8.314   -15.656 1.00 17.16 ? 102  LEU A N   1 
ATOM   830  C CA  . LEU A  1 103 ? 16.587  9.545   -14.873 1.00 16.47 ? 102  LEU A CA  1 
ATOM   831  C C   . LEU A  1 103 ? 17.984  10.168  -14.933 1.00 16.57 ? 102  LEU A C   1 
ATOM   832  O O   . LEU A  1 103 ? 18.117  11.409  -14.915 1.00 17.59 ? 102  LEU A O   1 
ATOM   833  C CB  . LEU A  1 103 ? 16.228  9.263   -13.411 1.00 15.94 ? 102  LEU A CB  1 
ATOM   834  C CG  . LEU A  1 103 ? 14.814  8.744   -13.183 1.00 15.50 ? 102  LEU A CG  1 
ATOM   835  C CD1 . LEU A  1 103 ? 14.671  8.347   -11.693 1.00 16.88 ? 102  LEU A CD1 1 
ATOM   836  C CD2 . LEU A  1 103 ? 13.779  9.806   -13.553 1.00 16.23 ? 102  LEU A CD2 1 
ATOM   837  N N   . ARG A  1 104 ? 19.000  9.310   -15.016 1.00 17.36 ? 103  ARG A N   1 
ATOM   838  C CA  . ARG A  1 104 ? 20.402  9.729   -15.067 1.00 18.00 ? 103  ARG A CA  1 
ATOM   839  C C   . ARG A  1 104 ? 21.064  9.466   -16.419 1.00 18.60 ? 103  ARG A C   1 
ATOM   840  O O   . ARG A  1 104 ? 22.298  9.380   -16.494 1.00 18.53 ? 103  ARG A O   1 
ATOM   841  C CB  . ARG A  1 104 ? 21.208  9.032   -13.968 1.00 17.53 ? 103  ARG A CB  1 
ATOM   842  C CG  . ARG A  1 104 ? 21.212  7.488   -14.062 1.00 17.39 ? 103  ARG A CG  1 
ATOM   843  C CD  . ARG A  1 104 ? 20.556  6.786   -12.879 1.00 18.36 ? 103  ARG A CD  1 
ATOM   844  N NE  . ARG A  1 104 ? 20.945  5.373   -12.810 1.00 15.78 ? 103  ARG A NE  1 
ATOM   845  C CZ  . ARG A  1 104 ? 20.628  4.561   -11.796 1.00 14.78 ? 103  ARG A CZ  1 
ATOM   846  N NH1 . ARG A  1 104 ? 19.889  5.011   -10.791 1.00 13.55 ? 103  ARG A NH1 1 
ATOM   847  N NH2 . ARG A  1 104 ? 21.048  3.299   -11.788 1.00 15.05 ? 103  ARG A NH2 1 
ATOM   848  N N   . ASN A  1 105 ? 20.253  9.329   -17.470 1.00 19.91 ? 104  ASN A N   1 
ATOM   849  C CA  . ASN A  1 105 ? 20.754  8.985   -18.811 1.00 20.18 ? 104  ASN A CA  1 
ATOM   850  C C   . ASN A  1 105 ? 21.370  10.229  -19.456 1.00 21.20 ? 104  ASN A C   1 
ATOM   851  O O   . ASN A  1 105 ? 20.732  10.897  -20.263 1.00 20.69 ? 104  ASN A O   1 
ATOM   852  C CB  . ASN A  1 105 ? 19.625  8.376   -19.660 1.00 20.62 ? 104  ASN A CB  1 
ATOM   853  C CG  . ASN A  1 105 ? 20.032  8.110   -21.119 1.00 21.76 ? 104  ASN A CG  1 
ATOM   854  O OD1 . ASN A  1 105 ? 19.173  8.116   -22.020 1.00 24.50 ? 104  ASN A OD1 1 
ATOM   855  N ND2 . ASN A  1 105 ? 21.324  7.869   -21.353 1.00 23.24 ? 104  ASN A ND2 1 
ATOM   856  N N   . ARG A  1 106 ? 22.616  10.515  -19.083 1.00 21.97 ? 105  ARG A N   1 
ATOM   857  C CA  . ARG A  1 106 ? 23.301  11.746  -19.491 1.00 23.40 ? 105  ARG A CA  1 
ATOM   858  C C   . ARG A  1 106 ? 23.537  11.791  -20.999 1.00 24.56 ? 105  ARG A C   1 
ATOM   859  O O   . ARG A  1 106 ? 23.571  12.872  -21.595 1.00 25.33 ? 105  ARG A O   1 
ATOM   860  C CB  . ARG A  1 106 ? 24.634  11.899  -18.746 1.00 23.08 ? 105  ARG A CB  1 
ATOM   861  C CG  . ARG A  1 106 ? 24.536  11.877  -17.214 1.00 22.65 ? 105  ARG A CG  1 
ATOM   862  C CD  . ARG A  1 106 ? 23.521  12.852  -16.644 1.00 21.54 ? 105  ARG A CD  1 
ATOM   863  N NE  . ARG A  1 106 ? 23.915  14.250  -16.862 1.00 23.18 ? 105  ARG A NE  1 
ATOM   864  C CZ  . ARG A  1 106 ? 23.098  15.298  -16.728 1.00 24.21 ? 105  ARG A CZ  1 
ATOM   865  N NH1 . ARG A  1 106 ? 21.828  15.138  -16.369 1.00 24.22 ? 105  ARG A NH1 1 
ATOM   866  N NH2 . ARG A  1 106 ? 23.561  16.526  -16.939 1.00 27.35 ? 105  ARG A NH2 1 
ATOM   867  N N   . SER A  1 107 ? 23.679  10.611  -21.599 1.00 25.66 ? 106  SER A N   1 
ATOM   868  C CA  . SER A  1 107 ? 23.874  10.452  -23.049 1.00 26.97 ? 106  SER A CA  1 
ATOM   869  C C   . SER A  1 107 ? 22.680  10.904  -23.888 1.00 27.72 ? 106  SER A C   1 
ATOM   870  O O   . SER A  1 107 ? 22.839  11.230  -25.073 1.00 28.01 ? 106  SER A O   1 
ATOM   871  C CB  . SER A  1 107 ? 24.188  8.995   -23.367 1.00 27.14 ? 106  SER A CB  1 
ATOM   872  O OG  A SER A  1 107 ? 22.992  8.244   -23.551 0.50 26.72 ? 106  SER A OG  1 
ATOM   873  O OG  B SER A  1 107 ? 25.389  8.582   -22.729 0.50 27.29 ? 106  SER A OG  1 
ATOM   874  N N   . ASN A  1 108 ? 21.497  10.908  -23.265 1.00 28.00 ? 107  ASN A N   1 
ATOM   875  C CA  . ASN A  1 108 ? 20.229  11.269  -23.899 1.00 28.77 ? 107  ASN A CA  1 
ATOM   876  C C   . ASN A  1 108 ? 19.780  10.380  -25.058 1.00 28.91 ? 107  ASN A C   1 
ATOM   877  O O   . ASN A  1 108 ? 18.903  10.783  -25.834 1.00 29.13 ? 107  ASN A O   1 
ATOM   878  C CB  . ASN A  1 108 ? 20.206  12.749  -24.305 1.00 28.87 ? 107  ASN A CB  1 
ATOM   879  C CG  . ASN A  1 108 ? 20.020  13.669  -23.119 1.00 29.96 ? 107  ASN A CG  1 
ATOM   880  O OD1 . ASN A  1 108 ? 19.250  13.374  -22.201 1.00 30.02 ? 107  ASN A OD1 1 
ATOM   881  N ND2 . ASN A  1 108 ? 20.731  14.794  -23.127 1.00 30.18 ? 107  ASN A ND2 1 
ATOM   882  N N   . THR A  1 109 ? 20.363  9.187   -25.167 1.00 29.05 ? 108  THR A N   1 
ATOM   883  C CA  . THR A  1 109 ? 19.876  8.176   -26.114 1.00 29.87 ? 108  THR A CA  1 
ATOM   884  C C   . THR A  1 109 ? 18.411  7.863   -25.780 1.00 29.81 ? 108  THR A C   1 
ATOM   885  O O   . THR A  1 109 ? 18.069  7.721   -24.599 1.00 29.50 ? 108  THR A O   1 
ATOM   886  C CB  . THR A  1 109 ? 20.753  6.897   -26.083 1.00 30.16 ? 108  THR A CB  1 
ATOM   887  O OG1 A THR A  1 109 ? 22.132  7.257   -26.243 0.50 31.28 ? 108  THR A OG1 1 
ATOM   888  O OG1 B THR A  1 109 ? 20.867  6.403   -24.741 0.50 29.74 ? 108  THR A OG1 1 
ATOM   889  C CG2 A THR A  1 109 ? 20.491  6.012   -27.293 0.50 29.92 ? 108  THR A CG2 1 
ATOM   890  C CG2 B THR A  1 109 ? 22.198  7.206   -26.484 0.50 30.70 ? 108  THR A CG2 1 
ATOM   891  N N   . PRO A  1 110 ? 17.544  7.802   -26.798 1.00 29.81 ? 109  PRO A N   1 
ATOM   892  C CA  . PRO A  1 110 ? 16.102  7.613   -26.573 1.00 29.27 ? 109  PRO A CA  1 
ATOM   893  C C   . PRO A  1 110 ? 15.781  6.324   -25.828 1.00 28.89 ? 109  PRO A C   1 
ATOM   894  O O   . PRO A  1 110 ? 16.400  5.292   -26.079 1.00 28.72 ? 109  PRO A O   1 
ATOM   895  C CB  . PRO A  1 110 ? 15.512  7.574   -27.996 1.00 29.92 ? 109  PRO A CB  1 
ATOM   896  C CG  . PRO A  1 110 ? 16.671  7.357   -28.907 1.00 30.43 ? 109  PRO A CG  1 
ATOM   897  C CD  . PRO A  1 110 ? 17.865  7.951   -28.233 1.00 30.05 ? 109  PRO A CD  1 
ATOM   898  N N   . ILE A  1 111 ? 14.852  6.416   -24.879 1.00 28.29 ? 110  ILE A N   1 
ATOM   899  C CA  . ILE A  1 111 ? 14.332  5.247   -24.177 1.00 27.52 ? 110  ILE A CA  1 
ATOM   900  C C   . ILE A  1 111 ? 12.821  5.365   -24.250 1.00 27.63 ? 110  ILE A C   1 
ATOM   901  O O   . ILE A  1 111 ? 12.221  6.324   -23.734 1.00 26.73 ? 110  ILE A O   1 
ATOM   902  C CB  . ILE A  1 111 ? 14.827  5.169   -22.702 1.00 27.42 ? 110  ILE A CB  1 
ATOM   903  C CG1 . ILE A  1 111 ? 16.353  5.071   -22.632 1.00 26.46 ? 110  ILE A CG1 1 
ATOM   904  C CG2 . ILE A  1 111 ? 14.211  3.952   -22.004 1.00 27.19 ? 110  ILE A CG2 1 
ATOM   905  C CD1 . ILE A  1 111 ? 16.939  5.242   -21.203 1.00 25.65 ? 110  ILE A CD1 1 
ATOM   906  N N   . LYS A  1 112 ? 12.205  4.399   -24.924 1.00 27.82 ? 111  LYS A N   1 
ATOM   907  C CA  . LYS A  1 112 ? 10.781  4.477   -25.224 1.00 28.74 ? 111  LYS A CA  1 
ATOM   908  C C   . LYS A  1 112 ? 9.921   3.666   -24.265 1.00 28.68 ? 111  LYS A C   1 
ATOM   909  O O   . LYS A  1 112 ? 10.237  2.517   -23.946 1.00 28.59 ? 111  LYS A O   1 
ATOM   910  C CB  . LYS A  1 112 ? 10.502  4.032   -26.666 1.00 28.78 ? 111  LYS A CB  1 
ATOM   911  C CG  . LYS A  1 112 ? 11.235  4.857   -27.704 1.00 30.63 ? 111  LYS A CG  1 
ATOM   912  C CD  . LYS A  1 112 ? 10.710  4.585   -29.094 1.00 34.23 ? 111  LYS A CD  1 
ATOM   913  C CE  . LYS A  1 112 ? 10.936  5.798   -29.974 1.00 37.20 ? 111  LYS A CE  1 
ATOM   914  N NZ  . LYS A  1 112 ? 11.995  5.541   -31.000 1.00 39.48 ? 111  LYS A NZ  1 
ATOM   915  N N   . VAL A  1 113 ? 8.842   4.290   -23.808 1.00 28.85 ? 112  VAL A N   1 
ATOM   916  C CA  . VAL A  1 113 ? 7.754   3.591   -23.129 1.00 29.61 ? 112  VAL A CA  1 
ATOM   917  C C   . VAL A  1 113 ? 6.464   3.874   -23.900 1.00 30.13 ? 112  VAL A C   1 
ATOM   918  O O   . VAL A  1 113 ? 6.087   5.038   -24.090 1.00 29.87 ? 112  VAL A O   1 
ATOM   919  C CB  . VAL A  1 113 ? 7.600   4.025   -21.647 1.00 29.28 ? 112  VAL A CB  1 
ATOM   920  C CG1 . VAL A  1 113 ? 6.426   3.298   -20.999 1.00 29.79 ? 112  VAL A CG1 1 
ATOM   921  C CG2 . VAL A  1 113 ? 8.878   3.735   -20.873 1.00 28.27 ? 112  VAL A CG2 1 
ATOM   922  N N   . ASP A  1 114 ? 5.800   2.804   -24.339 1.00 30.95 ? 113  ASP A N   1 
ATOM   923  C CA  . ASP A  1 114 ? 4.584   2.903   -25.153 1.00 31.79 ? 113  ASP A CA  1 
ATOM   924  C C   . ASP A  1 114 ? 4.888   3.727   -26.410 1.00 31.72 ? 113  ASP A C   1 
ATOM   925  O O   . ASP A  1 114 ? 4.131   4.641   -26.761 1.00 32.22 ? 113  ASP A O   1 
ATOM   926  C CB  . ASP A  1 114 ? 3.420   3.541   -24.371 1.00 32.10 ? 113  ASP A CB  1 
ATOM   927  C CG  . ASP A  1 114 ? 2.999   2.735   -23.145 1.00 33.84 ? 113  ASP A CG  1 
ATOM   928  O OD1 . ASP A  1 114 ? 2.838   1.496   -23.247 1.00 34.73 ? 113  ASP A OD1 1 
ATOM   929  O OD2 . ASP A  1 114 ? 2.787   3.276   -22.034 1.00 35.63 ? 113  ASP A OD2 1 
ATOM   930  N N   . GLY A  1 115 ? 6.015   3.414   -27.052 1.00 31.79 ? 114  GLY A N   1 
ATOM   931  C CA  . GLY A  1 115 ? 6.434   4.057   -28.291 1.00 31.66 ? 114  GLY A CA  1 
ATOM   932  C C   . GLY A  1 115 ? 6.903   5.502   -28.202 1.00 31.65 ? 114  GLY A C   1 
ATOM   933  O O   . GLY A  1 115 ? 7.161   6.129   -29.238 1.00 31.56 ? 114  GLY A O   1 
ATOM   934  N N   . LYS A  1 116 ? 7.026   6.024   -26.979 1.00 31.00 ? 115  LYS A N   1 
ATOM   935  C CA  . LYS A  1 116 ? 7.348   7.432   -26.737 1.00 30.80 ? 115  LYS A CA  1 
ATOM   936  C C   . LYS A  1 116 ? 8.610   7.598   -25.880 1.00 30.00 ? 115  LYS A C   1 
ATOM   937  O O   . LYS A  1 116 ? 8.723   7.008   -24.805 1.00 29.89 ? 115  LYS A O   1 
ATOM   938  C CB  . LYS A  1 116 ? 6.161   8.121   -26.063 1.00 31.42 ? 115  LYS A CB  1 
ATOM   939  C CG  . LYS A  1 116 ? 6.256   9.637   -25.971 1.00 33.79 ? 115  LYS A CG  1 
ATOM   940  C CD  . LYS A  1 116 ? 4.933   10.221  -25.489 1.00 37.15 ? 115  LYS A CD  1 
ATOM   941  C CE  . LYS A  1 116 ? 5.114   11.090  -24.244 1.00 39.78 ? 115  LYS A CE  1 
ATOM   942  N NZ  . LYS A  1 116 ? 5.361   10.277  -23.007 1.00 41.74 ? 115  LYS A NZ  1 
ATOM   943  N N   . ASP A  1 117 ? 9.540   8.417   -26.364 1.00 28.75 ? 116  ASP A N   1 
ATOM   944  C CA  . ASP A  1 117 ? 10.799  8.681   -25.671 1.00 28.10 ? 116  ASP A CA  1 
ATOM   945  C C   . ASP A  1 117 ? 10.532  9.423   -24.359 1.00 26.99 ? 116  ASP A C   1 
ATOM   946  O O   . ASP A  1 117 ? 9.785   10.410  -24.324 1.00 26.79 ? 116  ASP A O   1 
ATOM   947  C CB  . ASP A  1 117 ? 11.735  9.484   -26.588 1.00 28.05 ? 116  ASP A CB  1 
ATOM   948  C CG  . ASP A  1 117 ? 13.129  9.713   -25.993 1.00 29.02 ? 116  ASP A CG  1 
ATOM   949  O OD1 . ASP A  1 117 ? 13.512  9.088   -24.962 1.00 27.62 ? 116  ASP A OD1 1 
ATOM   950  O OD2 . ASP A  1 117 ? 13.926  10.523  -26.533 1.00 29.81 ? 116  ASP A OD2 1 
ATOM   951  N N   . VAL A  1 118 ? 11.126  8.930   -23.271 1.00 25.86 ? 117  VAL A N   1 
ATOM   952  C CA  . VAL A  1 118 ? 10.903  9.545   -21.958 1.00 25.20 ? 117  VAL A CA  1 
ATOM   953  C C   . VAL A  1 118 ? 11.883  10.671  -21.646 1.00 24.68 ? 117  VAL A C   1 
ATOM   954  O O   . VAL A  1 118 ? 11.650  11.450  -20.724 1.00 24.42 ? 117  VAL A O   1 
ATOM   955  C CB  . VAL A  1 118 ? 10.955  8.507   -20.796 1.00 24.88 ? 117  VAL A CB  1 
ATOM   956  C CG1 . VAL A  1 118 ? 9.905   7.418   -21.005 1.00 24.90 ? 117  VAL A CG1 1 
ATOM   957  C CG2 . VAL A  1 118 ? 12.346  7.908   -20.650 1.00 24.68 ? 117  VAL A CG2 1 
ATOM   958  N N   . MET A  1 119 ? 12.964  10.753  -22.418 1.00 24.43 ? 118  MET A N   1 
ATOM   959  C CA  . MET A  1 119 ? 14.051  11.675  -22.109 1.00 24.49 ? 118  MET A CA  1 
ATOM   960  C C   . MET A  1 119 ? 13.660  13.162  -22.141 1.00 24.74 ? 118  MET A C   1 
ATOM   961  O O   . MET A  1 119 ? 14.076  13.908  -21.257 1.00 24.38 ? 118  MET A O   1 
ATOM   962  C CB  . MET A  1 119 ? 15.295  11.397  -22.968 1.00 24.37 ? 118  MET A CB  1 
ATOM   963  C CG  . MET A  1 119 ? 16.012  10.077  -22.672 1.00 23.10 ? 118  MET A CG  1 
ATOM   964  S SD  . MET A  1 119 ? 16.232  9.690   -20.887 1.00 21.78 ? 118  MET A SD  1 
ATOM   965  C CE  . MET A  1 119 ? 17.212  11.150  -20.304 1.00 21.16 ? 118  MET A CE  1 
ATOM   966  N N   . PRO A  1 120 ? 12.887  13.627  -23.130 1.00 25.36 ? 119  PRO A N   1 
ATOM   967  C CA  . PRO A  1 120 ? 12.393  15.009  -23.072 1.00 25.04 ? 119  PRO A CA  1 
ATOM   968  C C   . PRO A  1 120 ? 11.701  15.384  -21.748 1.00 24.83 ? 119  PRO A C   1 
ATOM   969  O O   . PRO A  1 120 ? 12.004  16.450  -21.221 1.00 24.78 ? 119  PRO A O   1 
ATOM   970  C CB  . PRO A  1 120 ? 11.433  15.095  -24.277 1.00 24.76 ? 119  PRO A CB  1 
ATOM   971  C CG  . PRO A  1 120 ? 11.965  14.130  -25.211 1.00 25.66 ? 119  PRO A CG  1 
ATOM   972  C CD  . PRO A  1 120 ? 12.469  12.964  -24.382 1.00 25.36 ? 119  PRO A CD  1 
ATOM   973  N N   . GLU A  1 121 ? 10.830  14.533  -21.205 1.00 24.43 ? 120  GLU A N   1 
ATOM   974  C CA  . GLU A  1 121 ? 10.171  14.875  -19.944 1.00 24.35 ? 120  GLU A CA  1 
ATOM   975  C C   . GLU A  1 121 ? 11.107  14.770  -18.728 1.00 22.84 ? 120  GLU A C   1 
ATOM   976  O O   . GLU A  1 121 ? 11.009  15.583  -17.799 1.00 21.80 ? 120  GLU A O   1 
ATOM   977  C CB  . GLU A  1 121 ? 8.880   14.081  -19.737 1.00 25.01 ? 120  GLU A CB  1 
ATOM   978  C CG  . GLU A  1 121 ? 7.675   14.673  -20.480 1.00 29.12 ? 120  GLU A CG  1 
ATOM   979  C CD  . GLU A  1 121 ? 7.215   16.012  -19.922 1.00 32.96 ? 120  GLU A CD  1 
ATOM   980  O OE1 . GLU A  1 121 ? 7.620   17.061  -20.458 1.00 34.21 ? 120  GLU A OE1 1 
ATOM   981  O OE2 . GLU A  1 121 ? 6.445   16.019  -18.938 1.00 37.61 ? 120  GLU A OE2 1 
ATOM   982  N N   . VAL A  1 122 ? 12.018  13.796  -18.746 1.00 22.20 ? 121  VAL A N   1 
ATOM   983  C CA  . VAL A  1 122 ? 13.050  13.690  -17.702 1.00 21.17 ? 121  VAL A CA  1 
ATOM   984  C C   . VAL A  1 122 ? 13.875  14.986  -17.656 1.00 21.39 ? 121  VAL A C   1 
ATOM   985  O O   . VAL A  1 122 ? 14.079  15.593  -16.588 1.00 20.82 ? 121  VAL A O   1 
ATOM   986  C CB  . VAL A  1 122 ? 13.985  12.473  -17.948 1.00 21.27 ? 121  VAL A CB  1 
ATOM   987  C CG1 . VAL A  1 122 ? 15.267  12.547  -17.095 1.00 19.68 ? 121  VAL A CG1 1 
ATOM   988  C CG2 . VAL A  1 122 ? 13.251  11.164  -17.724 1.00 20.85 ? 121  VAL A CG2 1 
ATOM   989  N N   . ASN A  1 123 ? 14.309  15.430  -18.840 1.00 21.07 ? 122  ASN A N   1 
ATOM   990  C CA  . ASN A  1 123 ? 15.142  16.629  -18.950 1.00 21.12 ? 122  ASN A CA  1 
ATOM   991  C C   . ASN A  1 123 ? 14.396  17.925  -18.643 1.00 21.00 ? 122  ASN A C   1 
ATOM   992  O O   . ASN A  1 123 ? 14.978  18.860  -18.104 1.00 21.01 ? 122  ASN A O   1 
ATOM   993  C CB  . ASN A  1 123 ? 15.796  16.691  -20.339 1.00 20.98 ? 122  ASN A CB  1 
ATOM   994  C CG  . ASN A  1 123 ? 16.886  15.663  -20.502 1.00 22.06 ? 122  ASN A CG  1 
ATOM   995  O OD1 . ASN A  1 123 ? 17.574  15.308  -19.535 1.00 23.26 ? 122  ASN A OD1 1 
ATOM   996  N ND2 . ASN A  1 123 ? 17.052  15.159  -21.719 1.00 23.37 ? 122  ASN A ND2 1 
ATOM   997  N N   . ARG A  1 124 ? 13.112  17.977  -18.984 1.00 21.30 ? 123  ARG A N   1 
ATOM   998  C CA  . ARG A  1 124 ? 12.288  19.120  -18.623 1.00 21.94 ? 123  ARG A CA  1 
ATOM   999  C C   . ARG A  1 124 ? 12.203  19.286  -17.101 1.00 20.98 ? 123  ARG A C   1 
ATOM   1000 O O   . ARG A  1 124 ? 12.342  20.399  -16.596 1.00 20.50 ? 123  ARG A O   1 
ATOM   1001 C CB  . ARG A  1 124 ? 10.888  19.022  -19.248 1.00 22.97 ? 123  ARG A CB  1 
ATOM   1002 C CG  . ARG A  1 124 ? 9.972   20.167  -18.889 1.00 27.40 ? 123  ARG A CG  1 
ATOM   1003 C CD  . ARG A  1 124 ? 8.499   19.785  -18.852 1.00 34.76 ? 123  ARG A CD  1 
ATOM   1004 N NE  . ARG A  1 124 ? 7.666   20.744  -19.577 1.00 40.81 ? 123  ARG A NE  1 
ATOM   1005 C CZ  . ARG A  1 124 ? 7.502   20.758  -20.902 1.00 43.37 ? 123  ARG A CZ  1 
ATOM   1006 N NH1 . ARG A  1 124 ? 8.120   19.862  -21.671 1.00 44.85 ? 123  ARG A NH1 1 
ATOM   1007 N NH2 . ARG A  1 124 ? 6.719   21.675  -21.461 1.00 45.07 ? 123  ARG A NH2 1 
ATOM   1008 N N   . VAL A  1 125 ? 12.012  18.182  -16.372 1.00 20.34 ? 124  VAL A N   1 
ATOM   1009 C CA  . VAL A  1 125 ? 11.909  18.275  -14.910 1.00 19.40 ? 124  VAL A CA  1 
ATOM   1010 C C   . VAL A  1 125 ? 13.255  18.674  -14.300 1.00 18.57 ? 124  VAL A C   1 
ATOM   1011 O O   . VAL A  1 125 ? 13.290  19.481  -13.374 1.00 18.58 ? 124  VAL A O   1 
ATOM   1012 C CB  . VAL A  1 125 ? 11.356  16.982  -14.255 1.00 19.40 ? 124  VAL A CB  1 
ATOM   1013 C CG1 . VAL A  1 125 ? 11.389  17.081  -12.721 1.00 20.59 ? 124  VAL A CG1 1 
ATOM   1014 C CG2 . VAL A  1 125 ? 9.925   16.720  -14.723 1.00 19.80 ? 124  VAL A CG2 1 
ATOM   1015 N N   . LEU A  1 126 ? 14.346  18.119  -14.825 1.00 18.23 ? 125  LEU A N   1 
ATOM   1016 C CA  . LEU A  1 126 ? 15.686  18.512  -14.390 1.00 18.95 ? 125  LEU A CA  1 
ATOM   1017 C C   . LEU A  1 126 ? 15.934  20.000  -14.613 1.00 19.32 ? 125  LEU A C   1 
ATOM   1018 O O   . LEU A  1 126 ? 16.485  20.664  -13.738 1.00 19.94 ? 125  LEU A O   1 
ATOM   1019 C CB  . LEU A  1 126 ? 16.772  17.669  -15.070 1.00 18.74 ? 125  LEU A CB  1 
ATOM   1020 C CG  . LEU A  1 126 ? 16.898  16.207  -14.591 1.00 19.30 ? 125  LEU A CG  1 
ATOM   1021 C CD1 . LEU A  1 126 ? 17.814  15.401  -15.492 1.00 19.43 ? 125  LEU A CD1 1 
ATOM   1022 C CD2 . LEU A  1 126 ? 17.371  16.141  -13.120 1.00 18.52 ? 125  LEU A CD2 1 
ATOM   1023 N N   . ASP A  1 127 ? 15.517  20.533  -15.767 1.00 20.14 ? 126  ASP A N   1 
ATOM   1024 C CA  . ASP A  1 127 ? 15.650  21.979  -16.015 1.00 20.84 ? 126  ASP A CA  1 
ATOM   1025 C C   . ASP A  1 127 ? 14.890  22.807  -14.984 1.00 20.29 ? 126  ASP A C   1 
ATOM   1026 O O   . ASP A  1 127 ? 15.396  23.828  -14.482 1.00 20.19 ? 126  ASP A O   1 
ATOM   1027 C CB  . ASP A  1 127 ? 15.171  22.351  -17.427 1.00 21.47 ? 126  ASP A CB  1 
ATOM   1028 C CG  . ASP A  1 127 ? 16.097  21.842  -18.520 1.00 24.22 ? 126  ASP A CG  1 
ATOM   1029 O OD1 . ASP A  1 127 ? 17.248  21.441  -18.234 1.00 28.26 ? 126  ASP A OD1 1 
ATOM   1030 O OD2 . ASP A  1 127 ? 15.747  21.799  -19.712 1.00 29.75 ? 126  ASP A OD2 1 
ATOM   1031 N N   . LYS A  1 128 ? 13.671  22.372  -14.664 1.00 20.27 ? 127  LYS A N   1 
ATOM   1032 C CA  . LYS A  1 128 ? 12.843  23.049  -13.665 1.00 20.70 ? 127  LYS A CA  1 
ATOM   1033 C C   . LYS A  1 128 ? 13.510  22.978  -12.281 1.00 20.15 ? 127  LYS A C   1 
ATOM   1034 O O   . LYS A  1 128 ? 13.524  23.963  -11.541 1.00 20.26 ? 127  LYS A O   1 
ATOM   1035 C CB  . LYS A  1 128 ? 11.449  22.418  -13.603 1.00 21.82 ? 127  LYS A CB  1 
ATOM   1036 C CG  . LYS A  1 128 ? 10.562  22.689  -14.829 1.00 24.96 ? 127  LYS A CG  1 
ATOM   1037 C CD  . LYS A  1 128 ? 9.122   22.178  -14.599 1.00 28.79 ? 127  LYS A CD  1 
ATOM   1038 C CE  . LYS A  1 128 ? 8.375   22.983  -13.524 1.00 31.66 ? 127  LYS A CE  1 
ATOM   1039 N NZ  . LYS A  1 128 ? 6.980   22.477  -13.294 1.00 34.72 ? 127  LYS A NZ  1 
ATOM   1040 N N   . MET A  1 129 ? 14.070  21.818  -11.944 1.00 19.19 ? 128  MET A N   1 
ATOM   1041 C CA  . MET A  1 129 ? 14.809  21.668  -10.684 1.00 18.47 ? 128  MET A CA  1 
ATOM   1042 C C   . MET A  1 129 ? 15.991  22.647  -10.612 1.00 18.55 ? 128  MET A C   1 
ATOM   1043 O O   . MET A  1 129 ? 16.205  23.299  -9.579  1.00 18.15 ? 128  MET A O   1 
ATOM   1044 C CB  . MET A  1 129 ? 15.322  20.228  -10.512 1.00 18.76 ? 128  MET A CB  1 
ATOM   1045 C CG  . MET A  1 129 ? 14.232  19.154  -10.449 1.00 20.02 ? 128  MET A CG  1 
ATOM   1046 S SD  . MET A  1 129 ? 14.874  17.452  -10.353 1.00 23.20 ? 128  MET A SD  1 
ATOM   1047 C CE  . MET A  1 129 ? 15.384  17.364  -8.634  1.00 20.41 ? 128  MET A CE  1 
ATOM   1048 N N   . LYS A  1 130 ? 16.756  22.727  -11.701 1.00 17.96 ? 129  LYS A N   1 
ATOM   1049 C CA  . LYS A  1 130 ? 17.925  23.616  -11.786 1.00 19.01 ? 129  LYS A CA  1 
ATOM   1050 C C   . LYS A  1 130 ? 17.538  25.068  -11.566 1.00 19.51 ? 129  LYS A C   1 
ATOM   1051 O O   . LYS A  1 130 ? 18.172  25.772  -10.770 1.00 20.19 ? 129  LYS A O   1 
ATOM   1052 C CB  . LYS A  1 130 ? 18.635  23.444  -13.131 1.00 19.02 ? 129  LYS A CB  1 
ATOM   1053 C CG  . LYS A  1 130 ? 19.884  24.311  -13.298 1.00 20.97 ? 129  LYS A CG  1 
ATOM   1054 C CD  . LYS A  1 130 ? 20.554  23.999  -14.623 1.00 24.76 ? 129  LYS A CD  1 
ATOM   1055 C CE  . LYS A  1 130 ? 21.593  25.037  -14.952 1.00 28.91 ? 129  LYS A CE  1 
ATOM   1056 N NZ  . LYS A  1 130 ? 22.851  24.798  -14.218 1.00 31.77 ? 129  LYS A NZ  1 
ATOM   1057 N N   . SER A  1 131 ? 16.476  25.500  -12.237 1.00 20.30 ? 130  SER A N   1 
ATOM   1058 C CA  . SER A  1 131 ? 16.000  26.876  -12.125 1.00 20.46 ? 130  SER A CA  1 
ATOM   1059 C C   . SER A  1 131 ? 15.536  27.181  -10.696 1.00 19.67 ? 130  SER A C   1 
ATOM   1060 O O   . SER A  1 131 ? 15.892  28.214  -10.130 1.00 20.45 ? 130  SER A O   1 
ATOM   1061 C CB  . SER A  1 131 ? 14.891  27.147  -13.157 1.00 21.37 ? 130  SER A CB  1 
ATOM   1062 O OG  . SER A  1 131 ? 14.250  28.377  -12.865 1.00 25.13 ? 130  SER A OG  1 
ATOM   1063 N N   . PHE A  1 132 ? 14.789  26.259  -10.090 1.00 19.17 ? 131  PHE A N   1 
ATOM   1064 C CA  . PHE A  1 132 ? 14.317  26.439  -8.724  1.00 18.84 ? 131  PHE A CA  1 
ATOM   1065 C C   . PHE A  1 132 ? 15.466  26.522  -7.712  1.00 19.12 ? 131  PHE A C   1 
ATOM   1066 O O   . PHE A  1 132 ? 15.440  27.341  -6.801  1.00 18.73 ? 131  PHE A O   1 
ATOM   1067 C CB  . PHE A  1 132 ? 13.332  25.332  -8.346  1.00 19.02 ? 131  PHE A CB  1 
ATOM   1068 C CG  . PHE A  1 132 ? 12.666  25.534  -7.010  1.00 20.66 ? 131  PHE A CG  1 
ATOM   1069 C CD1 . PHE A  1 132 ? 11.901  26.668  -6.748  1.00 21.90 ? 131  PHE A CD1 1 
ATOM   1070 C CD2 . PHE A  1 132 ? 12.821  24.588  -6.006  1.00 22.60 ? 131  PHE A CD2 1 
ATOM   1071 C CE1 . PHE A  1 132 ? 11.284  26.844  -5.506  1.00 23.30 ? 131  PHE A CE1 1 
ATOM   1072 C CE2 . PHE A  1 132 ? 12.206  24.755  -4.764  1.00 21.85 ? 131  PHE A CE2 1 
ATOM   1073 C CZ  . PHE A  1 132 ? 11.441  25.884  -4.514  1.00 22.95 ? 131  PHE A CZ  1 
ATOM   1074 N N   . CYS A  1 133 ? 16.457  25.653  -7.879  1.00 18.70 ? 132  CYS A N   1 
ATOM   1075 C CA  . CYS A  1 133 ? 17.610  25.643  -6.987  1.00 19.09 ? 132  CYS A CA  1 
ATOM   1076 C C   . CYS A  1 133 ? 18.354  26.978  -7.063  1.00 18.91 ? 132  CYS A C   1 
ATOM   1077 O O   . CYS A  1 133 ? 18.751  27.524  -6.037  1.00 18.34 ? 132  CYS A O   1 
ATOM   1078 C CB  . CYS A  1 133 ? 18.541  24.485  -7.338  1.00 18.85 ? 132  CYS A CB  1 
ATOM   1079 S SG  . CYS A  1 133 ? 17.890  22.897  -6.764  1.00 21.00 ? 132  CYS A SG  1 
ATOM   1080 N N   . GLN A  1 134 ? 18.543  27.489  -8.277  1.00 19.48 ? 133  GLN A N   1 
ATOM   1081 C CA  . GLN A  1 134 ? 19.162  28.807  -8.451  1.00 20.41 ? 133  GLN A CA  1 
ATOM   1082 C C   . GLN A  1 134 ? 18.396  29.898  -7.691  1.00 19.57 ? 133  GLN A C   1 
ATOM   1083 O O   . GLN A  1 134 ? 19.010  30.712  -6.998  1.00 20.31 ? 133  GLN A O   1 
ATOM   1084 C CB  . GLN A  1 134 ? 19.273  29.170  -9.936  1.00 20.50 ? 133  GLN A CB  1 
ATOM   1085 C CG  . GLN A  1 134 ? 20.170  30.378  -10.251 1.00 25.00 ? 133  GLN A CG  1 
ATOM   1086 C CD  . GLN A  1 134 ? 19.459  31.724  -10.134 1.00 28.81 ? 133  GLN A CD  1 
ATOM   1087 O OE1 . GLN A  1 134 ? 18.256  31.836  -10.402 1.00 32.89 ? 133  GLN A OE1 1 
ATOM   1088 N NE2 . GLN A  1 134 ? 20.206  32.754  -9.733  1.00 31.56 ? 133  GLN A NE2 1 
ATOM   1089 N N   . ARG A  1 135 ? 17.073  29.906  -7.808  1.00 19.21 ? 134  ARG A N   1 
ATOM   1090 C CA  . ARG A  1 135 ? 16.247  30.938  -7.184  1.00 18.94 ? 134  ARG A CA  1 
ATOM   1091 C C   . ARG A  1 135 ? 16.335  30.892  -5.670  1.00 18.72 ? 134  ARG A C   1 
ATOM   1092 O O   . ARG A  1 135 ? 16.452  31.918  -5.012  1.00 18.22 ? 134  ARG A O   1 
ATOM   1093 C CB  . ARG A  1 135 ? 14.785  30.806  -7.631  1.00 20.02 ? 134  ARG A CB  1 
ATOM   1094 C CG  . ARG A  1 135 ? 14.572  31.105  -9.107  1.00 22.84 ? 134  ARG A CG  1 
ATOM   1095 C CD  . ARG A  1 135 ? 13.133  31.473  -9.484  1.00 29.20 ? 134  ARG A CD  1 
ATOM   1096 N NE  . ARG A  1 135 ? 12.753  32.764  -8.896  1.00 35.34 ? 134  ARG A NE  1 
ATOM   1097 C CZ  . ARG A  1 135 ? 11.510  33.238  -8.810  1.00 37.63 ? 134  ARG A CZ  1 
ATOM   1098 N NH1 . ARG A  1 135 ? 11.303  34.426  -8.252  1.00 39.54 ? 134  ARG A NH1 1 
ATOM   1099 N NH2 . ARG A  1 135 ? 10.478  32.543  -9.275  1.00 38.16 ? 134  ARG A NH2 1 
ATOM   1100 N N   . VAL A  1 136 ? 16.274  29.686  -5.111  1.00 17.09 ? 135  VAL A N   1 
ATOM   1101 C CA  . VAL A  1 136 ? 16.331  29.548  -3.665  1.00 16.93 ? 135  VAL A CA  1 
ATOM   1102 C C   . VAL A  1 136 ? 17.731  29.828  -3.099  1.00 16.80 ? 135  VAL A C   1 
ATOM   1103 O O   . VAL A  1 136 ? 17.879  30.594  -2.130  1.00 17.27 ? 135  VAL A O   1 
ATOM   1104 C CB  . VAL A  1 136 ? 15.846  28.138  -3.236  1.00 16.24 ? 135  VAL A CB  1 
ATOM   1105 C CG1 . VAL A  1 136 ? 16.095  27.924  -1.763  1.00 17.92 ? 135  VAL A CG1 1 
ATOM   1106 C CG2 . VAL A  1 136 ? 14.367  27.980  -3.563  1.00 16.57 ? 135  VAL A CG2 1 
ATOM   1107 N N   . ARG A  1 137 ? 18.750  29.194  -3.679  1.00 17.23 ? 136  ARG A N   1 
ATOM   1108 C CA  . ARG A  1 137 ? 20.115  29.264  -3.142  1.00 17.63 ? 136  ARG A CA  1 
ATOM   1109 C C   . ARG A  1 137 ? 20.741  30.656  -3.274  1.00 18.22 ? 136  ARG A C   1 
ATOM   1110 O O   . ARG A  1 137 ? 21.577  31.035  -2.456  1.00 18.97 ? 136  ARG A O   1 
ATOM   1111 C CB  . ARG A  1 137 ? 21.000  28.217  -3.830  1.00 16.91 ? 136  ARG A CB  1 
ATOM   1112 C CG  . ARG A  1 137 ? 20.723  26.785  -3.369  1.00 17.51 ? 136  ARG A CG  1 
ATOM   1113 C CD  . ARG A  1 137 ? 21.378  25.722  -4.243  1.00 17.92 ? 136  ARG A CD  1 
ATOM   1114 N NE  . ARG A  1 137 ? 22.846  25.846  -4.252  1.00 19.87 ? 136  ARG A NE  1 
ATOM   1115 C CZ  . ARG A  1 137 ? 23.664  25.351  -3.319  1.00 19.21 ? 136  ARG A CZ  1 
ATOM   1116 N NH1 . ARG A  1 137 ? 23.188  24.680  -2.274  1.00 18.37 ? 136  ARG A NH1 1 
ATOM   1117 N NH2 . ARG A  1 137 ? 24.979  25.511  -3.450  1.00 19.89 ? 136  ARG A NH2 1 
ATOM   1118 N N   . SER A  1 138 ? 20.331  31.396  -4.299  1.00 17.74 ? 137  SER A N   1 
ATOM   1119 C CA  . SER A  1 138 ? 20.837  32.750  -4.554  1.00 18.26 ? 137  SER A CA  1 
ATOM   1120 C C   . SER A  1 138 ? 20.258  33.764  -3.574  1.00 18.07 ? 137  SER A C   1 
ATOM   1121 O O   . SER A  1 138 ? 20.771  34.888  -3.454  1.00 18.35 ? 137  SER A O   1 
ATOM   1122 C CB  . SER A  1 138 ? 20.521  33.164  -5.990  1.00 18.56 ? 137  SER A CB  1 
ATOM   1123 O OG  . SER A  1 138 ? 19.146  33.468  -6.135  1.00 19.30 ? 137  SER A OG  1 
ATOM   1124 N N   . GLY A  1 139 ? 19.185  33.387  -2.887  1.00 17.56 ? 138  GLY A N   1 
ATOM   1125 C CA  . GLY A  1 139 ? 18.492  34.324  -2.016  1.00 17.65 ? 138  GLY A CA  1 
ATOM   1126 C C   . GLY A  1 139 ? 17.357  35.055  -2.716  1.00 17.67 ? 138  GLY A C   1 
ATOM   1127 O O   . GLY A  1 139 ? 16.653  35.815  -2.081  1.00 18.85 ? 138  GLY A O   1 
ATOM   1128 N N   . ASP A  1 140 ? 17.173  34.811  -4.012  1.00 17.86 ? 139  ASP A N   1 
ATOM   1129 C CA  . ASP A  1 140 ? 16.145  35.494  -4.804  1.00 18.42 ? 139  ASP A CA  1 
ATOM   1130 C C   . ASP A  1 140 ? 14.727  35.107  -4.403  1.00 17.92 ? 139  ASP A C   1 
ATOM   1131 O O   . ASP A  1 140 ? 13.842  35.957  -4.324  1.00 18.34 ? 139  ASP A O   1 
ATOM   1132 C CB  A ASP A  1 140 ? 16.382  35.196  -6.294  0.20 18.36 ? 139  ASP A CB  1 
ATOM   1133 C CB  B ASP A  1 140 ? 16.358  35.243  -6.295  0.80 18.97 ? 139  ASP A CB  1 
ATOM   1134 C CG  A ASP A  1 140 ? 15.454  35.968  -7.214  0.20 19.03 ? 139  ASP A CG  1 
ATOM   1135 C CG  B ASP A  1 140 ? 17.422  36.129  -6.873  0.80 21.81 ? 139  ASP A CG  1 
ATOM   1136 O OD1 A ASP A  1 140 ? 15.520  37.216  -7.232  0.20 20.51 ? 139  ASP A OD1 1 
ATOM   1137 O OD1 B ASP A  1 140 ? 17.690  35.995  -8.091  0.80 25.51 ? 139  ASP A OD1 1 
ATOM   1138 O OD2 A ASP A  1 140 ? 14.639  35.406  -7.974  0.20 19.80 ? 139  ASP A OD2 1 
ATOM   1139 O OD2 B ASP A  1 140 ? 18.052  36.977  -6.189  0.80 24.73 ? 139  ASP A OD2 1 
ATOM   1140 N N   . TRP A  1 141 ? 14.518  33.828  -4.118  1.00 16.88 ? 140  TRP A N   1 
ATOM   1141 C CA  . TRP A  1 141 ? 13.194  33.340  -3.735  1.00 16.76 ? 140  TRP A CA  1 
ATOM   1142 C C   . TRP A  1 141 ? 12.900  33.837  -2.330  1.00 16.42 ? 140  TRP A C   1 
ATOM   1143 O O   . TRP A  1 141 ? 13.644  33.556  -1.387  1.00 17.27 ? 140  TRP A O   1 
ATOM   1144 C CB  . TRP A  1 141 ? 13.172  31.809  -3.756  1.00 16.47 ? 140  TRP A CB  1 
ATOM   1145 C CG  . TRP A  1 141 ? 11.826  31.191  -3.505  1.00 17.65 ? 140  TRP A CG  1 
ATOM   1146 C CD1 . TRP A  1 141 ? 11.234  30.996  -2.289  1.00 15.88 ? 140  TRP A CD1 1 
ATOM   1147 C CD2 . TRP A  1 141 ? 10.915  30.663  -4.485  1.00 18.36 ? 140  TRP A CD2 1 
ATOM   1148 N NE1 . TRP A  1 141 ? 10.014  30.379  -2.449  1.00 15.62 ? 140  TRP A NE1 1 
ATOM   1149 C CE2 . TRP A  1 141 ? 9.795   30.158  -3.784  1.00 19.14 ? 140  TRP A CE2 1 
ATOM   1150 C CE3 . TRP A  1 141 ? 10.930  30.565  -5.890  1.00 19.89 ? 140  TRP A CE3 1 
ATOM   1151 C CZ2 . TRP A  1 141 ? 8.692   29.584  -4.431  1.00 21.85 ? 140  TRP A CZ2 1 
ATOM   1152 C CZ3 . TRP A  1 141 ? 9.831   29.978  -6.540  1.00 23.00 ? 140  TRP A CZ3 1 
ATOM   1153 C CH2 . TRP A  1 141 ? 8.731   29.496  -5.804  1.00 22.79 ? 140  TRP A CH2 1 
ATOM   1154 N N   . LYS A  1 142 ? 11.798  34.574  -2.180  1.00 16.38 ? 141  LYS A N   1 
ATOM   1155 C CA  . LYS A  1 142 ? 11.453  35.156  -0.890  1.00 16.07 ? 141  LYS A CA  1 
ATOM   1156 C C   . LYS A  1 142 ? 10.225  34.545  -0.235  1.00 16.31 ? 141  LYS A C   1 
ATOM   1157 O O   . LYS A  1 142 ? 9.290   34.136  -0.912  1.00 16.60 ? 141  LYS A O   1 
ATOM   1158 C CB  . LYS A  1 142 ? 11.205  36.668  -1.056  1.00 16.52 ? 141  LYS A CB  1 
ATOM   1159 C CG  . LYS A  1 142 ? 12.387  37.416  -1.629  1.00 17.01 ? 141  LYS A CG  1 
ATOM   1160 C CD  . LYS A  1 142 ? 13.550  37.527  -0.629  1.00 17.47 ? 141  LYS A CD  1 
ATOM   1161 C CE  . LYS A  1 142 ? 14.670  38.375  -1.257  1.00 17.90 ? 141  LYS A CE  1 
ATOM   1162 N NZ  . LYS A  1 142 ? 15.933  38.447  -0.460  1.00 19.65 ? 141  LYS A NZ  1 
ATOM   1163 N N   . GLY A  1 143 ? 10.233  34.514  1.094   1.00 15.73 ? 142  GLY A N   1 
ATOM   1164 C CA  . GLY A  1 143 ? 9.086   34.053  1.865   1.00 15.30 ? 142  GLY A CA  1 
ATOM   1165 C C   . GLY A  1 143 ? 8.027   35.134  2.029   1.00 15.52 ? 142  GLY A C   1 
ATOM   1166 O O   . GLY A  1 143 ? 8.183   36.247  1.500   1.00 15.76 ? 142  GLY A O   1 
ATOM   1167 N N   . TYR A  1 144 ? 6.962   34.814  2.767   1.00 14.94 ? 143  TYR A N   1 
ATOM   1168 C CA  . TYR A  1 144 ? 5.749   35.651  2.787   1.00 15.75 ? 143  TYR A CA  1 
ATOM   1169 C C   . TYR A  1 144 ? 5.962   37.022  3.425   1.00 15.90 ? 143  TYR A C   1 
ATOM   1170 O O   . TYR A  1 144 ? 5.168   37.944  3.182   1.00 16.53 ? 143  TYR A O   1 
ATOM   1171 C CB  . TYR A  1 144 ? 4.544   34.918  3.421   1.00 15.39 ? 143  TYR A CB  1 
ATOM   1172 C CG  . TYR A  1 144 ? 4.552   34.840  4.933   1.00 16.21 ? 143  TYR A CG  1 
ATOM   1173 C CD1 . TYR A  1 144 ? 3.858   35.774  5.705   1.00 17.30 ? 143  TYR A CD1 1 
ATOM   1174 C CD2 . TYR A  1 144 ? 5.230   33.810  5.590   1.00 16.77 ? 143  TYR A CD2 1 
ATOM   1175 C CE1 . TYR A  1 144 ? 3.864   35.712  7.089   1.00 17.18 ? 143  TYR A CE1 1 
ATOM   1176 C CE2 . TYR A  1 144 ? 5.241   33.733  6.985   1.00 18.69 ? 143  TYR A CE2 1 
ATOM   1177 C CZ  . TYR A  1 144 ? 4.558   34.686  7.725   1.00 20.15 ? 143  TYR A CZ  1 
ATOM   1178 O OH  . TYR A  1 144 ? 4.560   34.627  9.100   1.00 22.08 ? 143  TYR A OH  1 
ATOM   1179 N N   . THR A  1 145 ? 7.026   37.162  4.223   1.00 15.23 ? 144  THR A N   1 
ATOM   1180 C CA  . THR A  1 145 ? 7.408   38.462  4.796   1.00 16.01 ? 144  THR A CA  1 
ATOM   1181 C C   . THR A  1 145 ? 8.602   39.134  4.115   1.00 16.34 ? 144  THR A C   1 
ATOM   1182 O O   . THR A  1 145 ? 9.108   40.147  4.616   1.00 17.72 ? 144  THR A O   1 
ATOM   1183 C CB  . THR A  1 145 ? 7.684   38.389  6.312   1.00 15.38 ? 144  THR A CB  1 
ATOM   1184 O OG1 . THR A  1 145 ? 8.870   37.599  6.562   1.00 16.70 ? 144  THR A OG1 1 
ATOM   1185 C CG2 . THR A  1 145 ? 6.564   37.716  7.039   1.00 16.41 ? 144  THR A CG2 1 
ATOM   1186 N N   . GLY A  1 146 ? 9.035   38.599  2.981   1.00 16.35 ? 145  GLY A N   1 
ATOM   1187 C CA  . GLY A  1 146 ? 10.088  39.216  2.185   1.00 16.12 ? 145  GLY A CA  1 
ATOM   1188 C C   . GLY A  1 146 ? 11.516  38.804  2.510   1.00 16.50 ? 145  GLY A C   1 
ATOM   1189 O O   . GLY A  1 146 ? 12.469  39.519  2.141   1.00 16.86 ? 145  GLY A O   1 
ATOM   1190 N N   . LYS A  1 147 ? 11.679  37.669  3.195   1.00 15.58 ? 146  LYS A N   1 
ATOM   1191 C CA  . LYS A  1 147 ? 13.017  37.192  3.597   1.00 15.76 ? 146  LYS A CA  1 
ATOM   1192 C C   . LYS A  1 147 ? 13.476  36.000  2.765   1.00 16.03 ? 146  LYS A C   1 
ATOM   1193 O O   . LYS A  1 147 ? 12.658  35.177  2.335   1.00 15.45 ? 146  LYS A O   1 
ATOM   1194 C CB  . LYS A  1 147 ? 13.013  36.792  5.088   1.00 15.99 ? 146  LYS A CB  1 
ATOM   1195 C CG  . LYS A  1 147 ? 12.831  37.952  6.079   1.00 18.52 ? 146  LYS A CG  1 
ATOM   1196 C CD  . LYS A  1 147 ? 12.763  37.407  7.503   1.00 21.56 ? 146  LYS A CD  1 
ATOM   1197 C CE  . LYS A  1 147 ? 12.574  38.502  8.518   1.00 24.20 ? 146  LYS A CE  1 
ATOM   1198 N NZ  . LYS A  1 147 ? 12.408  37.921  9.881   1.00 27.46 ? 146  LYS A NZ  1 
ATOM   1199 N N   . SER A  1 148 ? 14.785  35.896  2.537   1.00 15.60 ? 147  SER A N   1 
ATOM   1200 C CA  . SER A  1 148 ? 15.353  34.720  1.881   1.00 15.42 ? 147  SER A CA  1 
ATOM   1201 C C   . SER A  1 148 ? 15.147  33.436  2.705   1.00 15.51 ? 147  SER A C   1 
ATOM   1202 O O   . SER A  1 148 ? 15.006  33.488  3.925   1.00 15.55 ? 147  SER A O   1 
ATOM   1203 C CB  . SER A  1 148 ? 16.843  34.936  1.639   1.00 16.52 ? 147  SER A CB  1 
ATOM   1204 O OG  . SER A  1 148 ? 17.014  35.929  0.625   1.00 18.36 ? 147  SER A OG  1 
ATOM   1205 N N   . ILE A  1 149 ? 15.111  32.300  2.008   1.00 15.14 ? 148  ILE A N   1 
ATOM   1206 C CA  . ILE A  1 149 ? 14.896  30.999  2.638   1.00 15.63 ? 148  ILE A CA  1 
ATOM   1207 C C   . ILE A  1 149 ? 16.189  30.523  3.327   1.00 15.86 ? 148  ILE A C   1 
ATOM   1208 O O   . ILE A  1 149 ? 17.261  30.560  2.717   1.00 16.65 ? 148  ILE A O   1 
ATOM   1209 C CB  . ILE A  1 149 ? 14.445  29.967  1.581   1.00 15.48 ? 148  ILE A CB  1 
ATOM   1210 C CG1 . ILE A  1 149 ? 13.090  30.349  0.967   1.00 15.47 ? 148  ILE A CG1 1 
ATOM   1211 C CG2 . ILE A  1 149 ? 14.394  28.540  2.174   1.00 16.33 ? 148  ILE A CG2 1 
ATOM   1212 C CD1 . ILE A  1 149 ? 11.997  30.684  1.979   1.00 13.55 ? 148  ILE A CD1 1 
ATOM   1213 N N   . THR A  1 150 ? 16.069  30.049  4.563   1.00 15.98 ? 149  THR A N   1 
ATOM   1214 C CA  . THR A  1 150 ? 17.235  29.539  5.309   1.00 16.10 ? 149  THR A CA  1 
ATOM   1215 C C   . THR A  1 150 ? 17.165  28.049  5.608   1.00 15.54 ? 149  THR A C   1 
ATOM   1216 O O   . THR A  1 150 ? 18.193  27.449  5.908   1.00 15.77 ? 149  THR A O   1 
ATOM   1217 C CB  . THR A  1 150 ? 17.435  30.287  6.652   1.00 16.13 ? 149  THR A CB  1 
ATOM   1218 O OG1 . THR A  1 150 ? 16.238  30.226  7.443   1.00 17.92 ? 149  THR A OG1 1 
ATOM   1219 C CG2 . THR A  1 150 ? 17.688  31.806  6.425   1.00 16.51 ? 149  THR A CG2 1 
ATOM   1220 N N   . ASP A  1 151 ? 15.963  27.474  5.549   1.00 15.27 ? 150  ASP A N   1 
ATOM   1221 C CA  . ASP A  1 151 ? 15.744  26.070  5.919   1.00 15.39 ? 150  ASP A CA  1 
ATOM   1222 C C   . ASP A  1 151 ? 14.832  25.378  4.913   1.00 14.94 ? 150  ASP A C   1 
ATOM   1223 O O   . ASP A  1 151 ? 13.813  25.949  4.517   1.00 15.30 ? 150  ASP A O   1 
ATOM   1224 C CB  . ASP A  1 151 ? 15.083  26.013  7.281   1.00 14.60 ? 150  ASP A CB  1 
ATOM   1225 C CG  . ASP A  1 151 ? 15.991  26.512  8.378   1.00 16.40 ? 150  ASP A CG  1 
ATOM   1226 O OD1 . ASP A  1 151 ? 15.923  27.720  8.746   1.00 16.98 ? 150  ASP A OD1 1 
ATOM   1227 O OD2 . ASP A  1 151 ? 16.827  25.752  8.908   1.00 16.35 ? 150  ASP A OD2 1 
ATOM   1228 N N   . ILE A  1 152 ? 15.230  24.180  4.482   1.00 15.07 ? 151  ILE A N   1 
ATOM   1229 C CA  . ILE A  1 152 ? 14.433  23.321  3.607   1.00 15.71 ? 151  ILE A CA  1 
ATOM   1230 C C   . ILE A  1 152 ? 13.959  22.139  4.453   1.00 15.54 ? 151  ILE A C   1 
ATOM   1231 O O   . ILE A  1 152 ? 14.770  21.532  5.156   1.00 14.77 ? 151  ILE A O   1 
ATOM   1232 C CB  . ILE A  1 152 ? 15.284  22.783  2.438   1.00 16.56 ? 151  ILE A CB  1 
ATOM   1233 C CG1 . ILE A  1 152 ? 15.938  23.920  1.633   1.00 18.42 ? 151  ILE A CG1 1 
ATOM   1234 C CG2 . ILE A  1 152 ? 14.461  21.830  1.546   1.00 18.56 ? 151  ILE A CG2 1 
ATOM   1235 C CD1 . ILE A  1 152 ? 14.947  24.910  1.073   1.00 19.65 ? 151  ILE A CD1 1 
ATOM   1236 N N   . ILE A  1 153 ? 12.673  21.806  4.389   1.00 14.30 ? 152  ILE A N   1 
ATOM   1237 C CA  . ILE A  1 153 ? 12.153  20.687  5.192   1.00 14.62 ? 152  ILE A CA  1 
ATOM   1238 C C   . ILE A  1 153 ? 11.493  19.678  4.258   1.00 14.56 ? 152  ILE A C   1 
ATOM   1239 O O   . ILE A  1 153 ? 10.435  19.953  3.644   1.00 14.80 ? 152  ILE A O   1 
ATOM   1240 C CB  . ILE A  1 153 ? 11.137  21.149  6.289   1.00 14.31 ? 152  ILE A CB  1 
ATOM   1241 C CG1 . ILE A  1 153 ? 11.730  22.199  7.232   1.00 16.03 ? 152  ILE A CG1 1 
ATOM   1242 C CG2 . ILE A  1 153 ? 10.689  19.946  7.122   1.00 14.98 ? 152  ILE A CG2 1 
ATOM   1243 C CD1 . ILE A  1 153 ? 11.532  23.643  6.753   1.00 16.04 ? 152  ILE A CD1 1 
ATOM   1244 N N   . ASN A  1 154 ? 12.129  18.521  4.122   1.00 14.05 ? 153  ASN A N   1 
ATOM   1245 C CA  . ASN A  1 154 ? 11.562  17.442  3.324   1.00 14.52 ? 153  ASN A CA  1 
ATOM   1246 C C   . ASN A  1 154 ? 10.593  16.642  4.179   1.00 14.15 ? 153  ASN A C   1 
ATOM   1247 O O   . ASN A  1 154 ? 10.938  16.226  5.291   1.00 14.62 ? 153  ASN A O   1 
ATOM   1248 C CB  . ASN A  1 154 ? 12.687  16.538  2.822   1.00 14.91 ? 153  ASN A CB  1 
ATOM   1249 C CG  . ASN A  1 154 ? 12.220  15.525  1.822   1.00 16.74 ? 153  ASN A CG  1 
ATOM   1250 O OD1 . ASN A  1 154 ? 12.021  14.332  2.155   1.00 18.94 ? 153  ASN A OD1 1 
ATOM   1251 N ND2 . ASN A  1 154 ? 12.078  15.952  0.577   1.00 16.21 ? 153  ASN A ND2 1 
ATOM   1252 N N   . ILE A  1 155 ? 9.362   16.497  3.698   1.00 14.46 ? 154  ILE A N   1 
ATOM   1253 C CA  . ILE A  1 155 ? 8.366   15.674  4.384   1.00 13.86 ? 154  ILE A CA  1 
ATOM   1254 C C   . ILE A  1 155 ? 8.038   14.503  3.481   1.00 14.22 ? 154  ILE A C   1 
ATOM   1255 O O   . ILE A  1 155 ? 7.558   14.686  2.351   1.00 15.03 ? 154  ILE A O   1 
ATOM   1256 C CB  . ILE A  1 155 ? 7.078   16.485  4.720   1.00 12.80 ? 154  ILE A CB  1 
ATOM   1257 C CG1 . ILE A  1 155 ? 7.402   17.691  5.621   1.00 15.14 ? 154  ILE A CG1 1 
ATOM   1258 C CG2 . ILE A  1 155 ? 6.048   15.552  5.379   1.00 15.36 ? 154  ILE A CG2 1 
ATOM   1259 C CD1 . ILE A  1 155 ? 6.172   18.530  6.044   1.00 15.13 ? 154  ILE A CD1 1 
ATOM   1260 N N   . GLY A  1 156 ? 8.342   13.297  3.957   1.00 14.45 ? 155  GLY A N   1 
ATOM   1261 C CA  . GLY A  1 156 ? 8.114   12.093  3.181   1.00 14.46 ? 155  GLY A CA  1 
ATOM   1262 C C   . GLY A  1 156 ? 8.615   10.898  3.961   1.00 15.07 ? 155  GLY A C   1 
ATOM   1263 O O   . GLY A  1 156 ? 9.294   11.063  4.956   1.00 14.18 ? 155  GLY A O   1 
ATOM   1264 N N   . ILE A  1 157 ? 8.280   9.702   3.499   1.00 14.94 ? 156  ILE A N   1 
ATOM   1265 C CA  . ILE A  1 157 ? 8.658   8.487   4.215   1.00 15.43 ? 156  ILE A CA  1 
ATOM   1266 C C   . ILE A  1 157 ? 9.137   7.400   3.251   1.00 15.85 ? 156  ILE A C   1 
ATOM   1267 O O   . ILE A  1 157 ? 8.773   7.395   2.074   1.00 15.37 ? 156  ILE A O   1 
ATOM   1268 C CB  . ILE A  1 157 ? 7.476   8.022   5.150   1.00 15.76 ? 156  ILE A CB  1 
ATOM   1269 C CG1 . ILE A  1 157 ? 7.958   7.079   6.273   1.00 15.55 ? 156  ILE A CG1 1 
ATOM   1270 C CG2 . ILE A  1 157 ? 6.328   7.433   4.375   1.00 16.16 ? 156  ILE A CG2 1 
ATOM   1271 C CD1 . ILE A  1 157 ? 6.909   6.860   7.400   1.00 16.45 ? 156  ILE A CD1 1 
ATOM   1272 N N   . GLY A  1 158 ? 9.970   6.489   3.748   1.00 15.16 ? 157  GLY A N   1 
ATOM   1273 C CA  . GLY A  1 158 ? 10.522  5.425   2.917   1.00 15.45 ? 157  GLY A CA  1 
ATOM   1274 C C   . GLY A  1 158 ? 11.304  5.975   1.738   1.00 15.13 ? 157  GLY A C   1 
ATOM   1275 O O   . GLY A  1 158 ? 12.283  6.715   1.919   1.00 15.15 ? 157  GLY A O   1 
ATOM   1276 N N   . GLY A  1 159 ? 10.865  5.611   0.536   1.00 15.84 ? 158  GLY A N   1 
ATOM   1277 C CA  . GLY A  1 159 ? 11.523  6.042   -0.694  1.00 15.92 ? 158  GLY A CA  1 
ATOM   1278 C C   . GLY A  1 159 ? 11.574  7.541   -0.915  1.00 16.02 ? 158  GLY A C   1 
ATOM   1279 O O   . GLY A  1 159 ? 12.407  8.040   -1.669  1.00 16.03 ? 158  GLY A O   1 
ATOM   1280 N N   . SER A  1 160 ? 10.686  8.263   -0.253  1.00 16.03 ? 159  SER A N   1 
ATOM   1281 C CA  . SER A  1 160 ? 10.666  9.713   -0.367  1.00 16.18 ? 159  SER A CA  1 
ATOM   1282 C C   . SER A  1 160 ? 11.472  10.401  0.729   1.00 16.58 ? 159  SER A C   1 
ATOM   1283 O O   . SER A  1 160 ? 11.435  11.638  0.834   1.00 17.45 ? 159  SER A O   1 
ATOM   1284 C CB  . SER A  1 160 ? 9.223   10.204  -0.365  1.00 16.36 ? 159  SER A CB  1 
ATOM   1285 O OG  . SER A  1 160 ? 8.562   9.808   -1.571  1.00 14.94 ? 159  SER A OG  1 
ATOM   1286 N N   . ASP A  1 161 ? 12.185  9.610   1.540   1.00 15.25 ? 160  ASP A N   1 
ATOM   1287 C CA  . ASP A  1 161 ? 12.955  10.112  2.686   1.00 15.69 ? 160  ASP A CA  1 
ATOM   1288 C C   . ASP A  1 161 ? 14.394  9.587   2.711   1.00 14.97 ? 160  ASP A C   1 
ATOM   1289 O O   . ASP A  1 161 ? 15.343  10.369  2.831   1.00 14.82 ? 160  ASP A O   1 
ATOM   1290 C CB  . ASP A  1 161 ? 12.215  9.729   3.997   1.00 15.77 ? 160  ASP A CB  1 
ATOM   1291 C CG  . ASP A  1 161 ? 13.084  9.831   5.265   1.00 15.37 ? 160  ASP A CG  1 
ATOM   1292 O OD1 . ASP A  1 161 ? 13.379  10.956  5.751   1.00 16.30 ? 160  ASP A OD1 1 
ATOM   1293 O OD2 . ASP A  1 161 ? 13.499  8.818   5.884   1.00 17.75 ? 160  ASP A OD2 1 
ATOM   1294 N N   . LEU A  1 162 ? 14.552  8.267   2.599   1.00 14.56 ? 161  LEU A N   1 
ATOM   1295 C CA  . LEU A  1 162 ? 15.830  7.618   2.890   1.00 14.43 ? 161  LEU A CA  1 
ATOM   1296 C C   . LEU A  1 162 ? 16.954  8.019   1.947   1.00 13.95 ? 161  LEU A C   1 
ATOM   1297 O O   . LEU A  1 162 ? 18.081  8.190   2.401   1.00 14.33 ? 161  LEU A O   1 
ATOM   1298 C CB  . LEU A  1 162 ? 15.698  6.083   2.933   1.00 14.69 ? 161  LEU A CB  1 
ATOM   1299 C CG  . LEU A  1 162 ? 14.876  5.393   4.027   1.00 17.42 ? 161  LEU A CG  1 
ATOM   1300 C CD1 . LEU A  1 162 ? 14.899  3.870   3.843   1.00 17.49 ? 161  LEU A CD1 1 
ATOM   1301 C CD2 . LEU A  1 162 ? 15.441  5.735   5.403   1.00 17.83 ? 161  LEU A CD2 1 
ATOM   1302 N N   . GLY A  1 163 ? 16.642  8.167   0.659   1.00 13.73 ? 162  GLY A N   1 
ATOM   1303 C CA  . GLY A  1 163 ? 17.628  8.567   -0.344  1.00 14.22 ? 162  GLY A CA  1 
ATOM   1304 C C   . GLY A  1 163 ? 18.118  9.997   -0.137  1.00 14.00 ? 162  GLY A C   1 
ATOM   1305 O O   . GLY A  1 163 ? 19.316  10.219  -0.021  1.00 13.34 ? 162  GLY A O   1 
ATOM   1306 N N   . PRO A  1 164 ? 17.215  10.976  -0.145  1.00 14.04 ? 163  PRO A N   1 
ATOM   1307 C CA  . PRO A  1 164 ? 17.623  12.365  0.096   1.00 14.31 ? 163  PRO A CA  1 
ATOM   1308 C C   . PRO A  1 164 ? 18.351  12.520  1.439   1.00 13.90 ? 163  PRO A C   1 
ATOM   1309 O O   . PRO A  1 164 ? 19.339  13.270  1.493   1.00 14.49 ? 163  PRO A O   1 
ATOM   1310 C CB  . PRO A  1 164 ? 16.295  13.136  0.086   1.00 14.98 ? 163  PRO A CB  1 
ATOM   1311 C CG  . PRO A  1 164 ? 15.369  12.278  -0.714  1.00 15.32 ? 163  PRO A CG  1 
ATOM   1312 C CD  . PRO A  1 164 ? 15.780  10.859  -0.458  1.00 14.77 ? 163  PRO A CD  1 
ATOM   1313 N N   . LEU A  1 165 ? 17.887  11.852  2.489   1.00 13.10 ? 164  LEU A N   1 
ATOM   1314 C CA  . LEU A  1 165 ? 18.575  11.928  3.771   1.00 13.07 ? 164  LEU A CA  1 
ATOM   1315 C C   . LEU A  1 165 ? 19.995  11.347  3.692   1.00 12.70 ? 164  LEU A C   1 
ATOM   1316 O O   . LEU A  1 165 ? 20.968  11.987  4.110   1.00 13.07 ? 164  LEU A O   1 
ATOM   1317 C CB  . LEU A  1 165 ? 17.747  11.239  4.875   1.00 13.16 ? 164  LEU A CB  1 
ATOM   1318 C CG  A LEU A  1 165 ? 18.160  11.508  6.334   0.35 11.59 ? 164  LEU A CG  1 
ATOM   1319 C CG  B LEU A  1 165 ? 18.353  11.092  6.279   0.65 15.03 ? 164  LEU A CG  1 
ATOM   1320 C CD1 A LEU A  1 165 ? 16.974  11.386  7.278   0.35 12.48 ? 164  LEU A CD1 1 
ATOM   1321 C CD1 B LEU A  1 165 ? 18.871  12.402  6.847   0.65 16.40 ? 164  LEU A CD1 1 
ATOM   1322 C CD2 A LEU A  1 165 ? 19.307  10.589  6.791   0.35 9.70  ? 164  LEU A CD2 1 
ATOM   1323 C CD2 B LEU A  1 165 ? 17.342  10.457  7.220   0.65 17.60 ? 164  LEU A CD2 1 
ATOM   1324 N N   . MET A  1 166 ? 20.114  10.123  3.183   1.00 12.41 ? 165  MET A N   1 
ATOM   1325 C CA  . MET A  1 166 ? 21.426  9.480   3.097   1.00 11.95 ? 165  MET A CA  1 
ATOM   1326 C C   . MET A  1 166 ? 22.410  10.286  2.239   1.00 12.31 ? 165  MET A C   1 
ATOM   1327 O O   . MET A  1 166 ? 23.589  10.396  2.596   1.00 12.75 ? 165  MET A O   1 
ATOM   1328 C CB  . MET A  1 166 ? 21.301  8.044   2.580   1.00 11.88 ? 165  MET A CB  1 
ATOM   1329 C CG  . MET A  1 166 ? 22.658  7.261   2.494   1.00 13.03 ? 165  MET A CG  1 
ATOM   1330 S SD  . MET A  1 166 ? 23.506  7.494   0.914   1.00 14.22 ? 165  MET A SD  1 
ATOM   1331 C CE  . MET A  1 166 ? 22.533  6.358   -0.178  1.00 16.07 ? 165  MET A CE  1 
ATOM   1332 N N   . VAL A  1 167 ? 21.933  10.846  1.129   1.00 13.01 ? 166  VAL A N   1 
ATOM   1333 C CA  . VAL A  1 167 ? 22.821  11.529  0.204   1.00 12.38 ? 166  VAL A CA  1 
ATOM   1334 C C   . VAL A  1 167 ? 23.245  12.887  0.769   1.00 12.66 ? 166  VAL A C   1 
ATOM   1335 O O   . VAL A  1 167 ? 24.423  13.257  0.664   1.00 12.25 ? 166  VAL A O   1 
ATOM   1336 C CB  . VAL A  1 167 ? 22.217  11.627  -1.227  1.00 13.22 ? 166  VAL A CB  1 
ATOM   1337 C CG1 . VAL A  1 167 ? 23.065  12.548  -2.168  1.00 12.62 ? 166  VAL A CG1 1 
ATOM   1338 C CG2 . VAL A  1 167 ? 22.061  10.211  -1.813  1.00 13.47 ? 166  VAL A CG2 1 
ATOM   1339 N N   . THR A  1 168 ? 22.311  13.629  1.373   1.00 12.48 ? 167  THR A N   1 
ATOM   1340 C CA  . THR A  1 168 ? 22.710  14.918  1.955   1.00 13.49 ? 167  THR A CA  1 
ATOM   1341 C C   . THR A  1 168 ? 23.680  14.722  3.110   1.00 13.79 ? 167  THR A C   1 
ATOM   1342 O O   . THR A  1 168 ? 24.590  15.528  3.300   1.00 14.53 ? 167  THR A O   1 
ATOM   1343 C CB  . THR A  1 168 ? 21.506  15.807  2.371   1.00 12.96 ? 167  THR A CB  1 
ATOM   1344 O OG1 . THR A  1 168 ? 20.626  15.075  3.245   1.00 13.70 ? 167  THR A OG1 1 
ATOM   1345 C CG2 . THR A  1 168 ? 20.664  16.189  1.123   1.00 14.42 ? 167  THR A CG2 1 
ATOM   1346 N N   . GLU A  1 169 ? 23.502  13.632  3.869   1.00 14.07 ? 168  GLU A N   1 
ATOM   1347 C CA  . GLU A  1 169 ? 24.449  13.292  4.939   1.00 13.87 ? 168  GLU A CA  1 
ATOM   1348 C C   . GLU A  1 169 ? 25.826  12.946  4.382   1.00 14.41 ? 168  GLU A C   1 
ATOM   1349 O O   . GLU A  1 169 ? 26.853  13.463  4.852   1.00 14.32 ? 168  GLU A O   1 
ATOM   1350 C CB  . GLU A  1 169 ? 23.914  12.141  5.804   1.00 14.68 ? 168  GLU A CB  1 
ATOM   1351 C CG  . GLU A  1 169 ? 22.776  12.586  6.725   1.00 12.89 ? 168  GLU A CG  1 
ATOM   1352 C CD  . GLU A  1 169 ? 23.211  13.627  7.750   1.00 17.11 ? 168  GLU A CD  1 
ATOM   1353 O OE1 . GLU A  1 169 ? 22.663  14.753  7.726   1.00 18.60 ? 168  GLU A OE1 1 
ATOM   1354 O OE2 . GLU A  1 169 ? 24.097  13.335  8.591   1.00 15.45 ? 168  GLU A OE2 1 
ATOM   1355 N N   . ALA A  1 170 ? 25.851  12.131  3.331   1.00 13.23 ? 169  ALA A N   1 
ATOM   1356 C CA  . ALA A  1 170 ? 27.116  11.673  2.752   1.00 13.62 ? 169  ALA A CA  1 
ATOM   1357 C C   . ALA A  1 170 ? 27.890  12.778  2.023   1.00 13.90 ? 169  ALA A C   1 
ATOM   1358 O O   . ALA A  1 170 ? 29.115  12.735  1.968   1.00 14.00 ? 169  ALA A O   1 
ATOM   1359 C CB  . ALA A  1 170 ? 26.855  10.512  1.809   1.00 13.30 ? 169  ALA A CB  1 
ATOM   1360 N N   . LEU A  1 171 ? 27.156  13.759  1.495   1.00 13.49 ? 170  LEU A N   1 
ATOM   1361 C CA  . LEU A  1 171 ? 27.732  14.868  0.719   1.00 14.62 ? 170  LEU A CA  1 
ATOM   1362 C C   . LEU A  1 171 ? 27.737  16.193  1.469   1.00 15.44 ? 170  LEU A C   1 
ATOM   1363 O O   . LEU A  1 171 ? 27.847  17.248  0.866   1.00 14.96 ? 170  LEU A O   1 
ATOM   1364 C CB  . LEU A  1 171 ? 27.011  15.005  -0.638  1.00 14.07 ? 170  LEU A CB  1 
ATOM   1365 C CG  . LEU A  1 171 ? 27.085  13.759  -1.548  1.00 14.78 ? 170  LEU A CG  1 
ATOM   1366 C CD1 . LEU A  1 171 ? 26.381  14.074  -2.839  1.00 14.68 ? 170  LEU A CD1 1 
ATOM   1367 C CD2 . LEU A  1 171 ? 28.550  13.307  -1.791  1.00 14.61 ? 170  LEU A CD2 1 
ATOM   1368 N N   . LYS A  1 172 ? 27.664  16.121  2.801   1.00 15.97 ? 171  LYS A N   1 
ATOM   1369 C CA  . LYS A  1 172 ? 27.653  17.317  3.649   1.00 17.66 ? 171  LYS A CA  1 
ATOM   1370 C C   . LYS A  1 172 ? 28.746  18.367  3.337   1.00 17.87 ? 171  LYS A C   1 
ATOM   1371 O O   . LYS A  1 172 ? 28.436  19.564  3.326   1.00 17.99 ? 171  LYS A O   1 
ATOM   1372 C CB  . LYS A  1 172 ? 27.666  16.897  5.123   1.00 17.59 ? 171  LYS A CB  1 
ATOM   1373 C CG  . LYS A  1 172 ? 27.269  17.967  6.128   1.00 19.29 ? 171  LYS A CG  1 
ATOM   1374 C CD  . LYS A  1 172 ? 25.840  18.479  5.930   1.00 20.11 ? 171  LYS A CD  1 
ATOM   1375 C CE  . LYS A  1 172 ? 24.753  17.418  6.142   1.00 18.92 ? 171  LYS A CE  1 
ATOM   1376 N NZ  . LYS A  1 172 ? 23.399  18.091  5.995   1.00 20.06 ? 171  LYS A NZ  1 
ATOM   1377 N N   . PRO A  1 173 ? 29.994  17.966  3.054   1.00 18.12 ? 172  PRO A N   1 
ATOM   1378 C CA  . PRO A  1 173 ? 31.024  18.968  2.718   1.00 18.85 ? 172  PRO A CA  1 
ATOM   1379 C C   . PRO A  1 173 ? 30.738  19.758  1.428   1.00 19.60 ? 172  PRO A C   1 
ATOM   1380 O O   . PRO A  1 173 ? 31.354  20.817  1.220   1.00 21.20 ? 172  PRO A O   1 
ATOM   1381 C CB  . PRO A  1 173 ? 32.319  18.140  2.551   1.00 18.72 ? 172  PRO A CB  1 
ATOM   1382 C CG  . PRO A  1 173 ? 32.044  16.811  3.030   1.00 17.99 ? 172  PRO A CG  1 
ATOM   1383 C CD  . PRO A  1 173 ? 30.556  16.599  3.083   1.00 18.25 ? 172  PRO A CD  1 
ATOM   1384 N N   . TYR A  1 174 ? 29.823  19.280  0.590   1.00 18.73 ? 173  TYR A N   1 
ATOM   1385 C CA  . TYR A  1 174 ? 29.473  19.989  -0.654  1.00 18.85 ? 173  TYR A CA  1 
ATOM   1386 C C   . TYR A  1 174 ? 28.314  20.980  -0.465  1.00 19.34 ? 173  TYR A C   1 
ATOM   1387 O O   . TYR A  1 174 ? 27.862  21.585  -1.434  1.00 19.67 ? 173  TYR A O   1 
ATOM   1388 C CB  . TYR A  1 174 ? 29.215  18.986  -1.803  1.00 18.80 ? 173  TYR A CB  1 
ATOM   1389 C CG  . TYR A  1 174 ? 30.430  18.127  -2.035  1.00 17.69 ? 173  TYR A CG  1 
ATOM   1390 C CD1 . TYR A  1 174 ? 30.578  16.900  -1.391  1.00 16.99 ? 173  TYR A CD1 1 
ATOM   1391 C CD2 . TYR A  1 174 ? 31.471  18.573  -2.844  1.00 17.59 ? 173  TYR A CD2 1 
ATOM   1392 C CE1 . TYR A  1 174 ? 31.740  16.116  -1.553  1.00 16.98 ? 173  TYR A CE1 1 
ATOM   1393 C CE2 . TYR A  1 174 ? 32.607  17.805  -3.024  1.00 18.68 ? 173  TYR A CE2 1 
ATOM   1394 C CZ  . TYR A  1 174 ? 32.744  16.580  -2.381  1.00 18.52 ? 173  TYR A CZ  1 
ATOM   1395 O OH  . TYR A  1 174 ? 33.880  15.842  -2.570  1.00 18.20 ? 173  TYR A OH  1 
ATOM   1396 N N   . SER A  1 175 ? 27.882  21.163  0.784   1.00 19.23 ? 174  SER A N   1 
ATOM   1397 C CA  . SER A  1 175 ? 26.729  22.010  1.134   1.00 20.41 ? 174  SER A CA  1 
ATOM   1398 C C   . SER A  1 175 ? 27.072  23.424  1.645   1.00 21.65 ? 174  SER A C   1 
ATOM   1399 O O   . SER A  1 175 ? 26.184  24.157  2.104   1.00 21.57 ? 174  SER A O   1 
ATOM   1400 C CB  . SER A  1 175 ? 25.851  21.303  2.169   1.00 20.18 ? 174  SER A CB  1 
ATOM   1401 O OG  . SER A  1 175 ? 26.430  21.322  3.469   1.00 20.02 ? 174  SER A OG  1 
ATOM   1402 N N   . LYS A  1 176 ? 28.343  23.813  1.560   1.00 23.40 ? 175  LYS A N   1 
ATOM   1403 C CA  . LYS A  1 176 ? 28.758  25.128  2.050   1.00 24.81 ? 175  LYS A CA  1 
ATOM   1404 C C   . LYS A  1 176 ? 27.968  26.207  1.338   1.00 25.14 ? 175  LYS A C   1 
ATOM   1405 O O   . LYS A  1 176 ? 27.815  26.168  0.116   1.00 25.29 ? 175  LYS A O   1 
ATOM   1406 C CB  . LYS A  1 176 ? 30.267  25.346  1.858   1.00 25.66 ? 175  LYS A CB  1 
ATOM   1407 C CG  . LYS A  1 176 ? 31.129  24.549  2.833   1.00 27.22 ? 175  LYS A CG  1 
ATOM   1408 C CD  . LYS A  1 176 ? 32.632  24.735  2.564   1.00 31.11 ? 175  LYS A CD  1 
ATOM   1409 C CE  . LYS A  1 176 ? 33.275  23.535  1.857   1.00 34.51 ? 175  LYS A CE  1 
ATOM   1410 N NZ  . LYS A  1 176 ? 33.455  22.310  2.711   1.00 32.60 ? 175  LYS A NZ  1 
ATOM   1411 N N   . GLY A  1 177 ? 27.443  27.149  2.111   1.00 25.49 ? 176  GLY A N   1 
ATOM   1412 C CA  . GLY A  1 177 ? 26.636  28.220  1.562   1.00 26.42 ? 176  GLY A CA  1 
ATOM   1413 C C   . GLY A  1 177 ? 25.223  27.851  1.153   1.00 26.21 ? 176  GLY A C   1 
ATOM   1414 O O   . GLY A  1 177 ? 24.499  28.716  0.652   1.00 28.07 ? 176  GLY A O   1 
ATOM   1415 N N   . GLY A  1 178 ? 24.836  26.582  1.325   1.00 25.17 ? 177  GLY A N   1 
ATOM   1416 C CA  . GLY A  1 178 ? 23.491  26.128  0.985   1.00 23.24 ? 177  GLY A CA  1 
ATOM   1417 C C   . GLY A  1 178 ? 22.556  26.269  2.180   1.00 21.61 ? 177  GLY A C   1 
ATOM   1418 O O   . GLY A  1 178 ? 23.027  26.438  3.308   1.00 21.38 ? 177  GLY A O   1 
ATOM   1419 N N   . PRO A  1 179 ? 21.242  26.181  1.973   1.00 20.44 ? 178  PRO A N   1 
ATOM   1420 C CA  . PRO A  1 179 ? 20.305  26.235  3.102   1.00 19.35 ? 178  PRO A CA  1 
ATOM   1421 C C   . PRO A  1 179 ? 20.408  24.982  3.970   1.00 18.52 ? 178  PRO A C   1 
ATOM   1422 O O   . PRO A  1 179 ? 20.846  23.954  3.459   1.00 19.30 ? 178  PRO A O   1 
ATOM   1423 C CB  . PRO A  1 179 ? 18.935  26.281  2.422   1.00 19.97 ? 178  PRO A CB  1 
ATOM   1424 C CG  . PRO A  1 179 ? 19.154  25.626  1.096   1.00 21.05 ? 178  PRO A CG  1 
ATOM   1425 C CD  . PRO A  1 179 ? 20.548  26.012  0.683   1.00 20.42 ? 178  PRO A CD  1 
ATOM   1426 N N   . ARG A  1 180 ? 20.038  25.075  5.242   1.00 17.54 ? 179  ARG A N   1 
ATOM   1427 C CA  . ARG A  1 180 ? 19.949  23.882  6.097   1.00 17.06 ? 179  ARG A CA  1 
ATOM   1428 C C   . ARG A  1 180 ? 18.867  22.941  5.560   1.00 16.69 ? 179  ARG A C   1 
ATOM   1429 O O   . ARG A  1 180 ? 17.876  23.416  4.988   1.00 16.78 ? 179  ARG A O   1 
ATOM   1430 C CB  . ARG A  1 180 ? 19.640  24.267  7.551   1.00 17.18 ? 179  ARG A CB  1 
ATOM   1431 C CG  . ARG A  1 180 ? 20.776  24.991  8.273   1.00 19.80 ? 179  ARG A CG  1 
ATOM   1432 C CD  . ARG A  1 180 ? 20.399  25.498  9.678   1.00 21.94 ? 179  ARG A CD  1 
ATOM   1433 N NE  . ARG A  1 180 ? 19.357  26.540  9.646   1.00 23.93 ? 179  ARG A NE  1 
ATOM   1434 C CZ  . ARG A  1 180 ? 19.574  27.840  9.802   1.00 24.24 ? 179  ARG A CZ  1 
ATOM   1435 N NH1 . ARG A  1 180 ? 20.805  28.292  10.014  1.00 26.96 ? 179  ARG A NH1 1 
ATOM   1436 N NH2 . ARG A  1 180 ? 18.554  28.704  9.750   1.00 25.08 ? 179  ARG A NH2 1 
ATOM   1437 N N   . VAL A  1 181 ? 19.079  21.620  5.705   1.00 15.22 ? 180  VAL A N   1 
ATOM   1438 C CA  . VAL A  1 181 ? 18.051  20.610  5.368   1.00 15.60 ? 180  VAL A CA  1 
ATOM   1439 C C   . VAL A  1 181 ? 17.597  19.816  6.575   1.00 15.87 ? 180  VAL A C   1 
ATOM   1440 O O   . VAL A  1 181 ? 18.412  19.437  7.440   1.00 16.34 ? 180  VAL A O   1 
ATOM   1441 C CB  . VAL A  1 181 ? 18.410  19.532  4.276   1.00 16.47 ? 180  VAL A CB  1 
ATOM   1442 C CG1 A VAL A  1 181 ? 18.623  20.215  2.949   0.50 16.30 ? 180  VAL A CG1 1 
ATOM   1443 C CG1 B VAL A  1 181 ? 17.653  19.685  2.981   0.50 16.26 ? 180  VAL A CG1 1 
ATOM   1444 C CG2 A VAL A  1 181 ? 19.655  18.722  4.621   0.50 13.24 ? 180  VAL A CG2 1 
ATOM   1445 C CG2 B VAL A  1 181 ? 19.896  19.145  4.190   0.50 14.07 ? 180  VAL A CG2 1 
ATOM   1446 N N   . TRP A  1 182 ? 16.289  19.561  6.620   1.00 15.13 ? 181  TRP A N   1 
ATOM   1447 C CA  . TRP A  1 182 ? 15.651  18.797  7.676   1.00 15.08 ? 181  TRP A CA  1 
ATOM   1448 C C   . TRP A  1 182 ? 14.801  17.717  7.029   1.00 14.61 ? 181  TRP A C   1 
ATOM   1449 O O   . TRP A  1 182 ? 14.221  17.937  5.967   1.00 14.85 ? 181  TRP A O   1 
ATOM   1450 C CB  . TRP A  1 182 ? 14.742  19.710  8.501   1.00 15.22 ? 181  TRP A CB  1 
ATOM   1451 C CG  . TRP A  1 182 ? 15.405  20.921  9.102   1.00 15.53 ? 181  TRP A CG  1 
ATOM   1452 C CD1 . TRP A  1 182 ? 15.803  22.070  8.456   1.00 16.09 ? 181  TRP A CD1 1 
ATOM   1453 C CD2 . TRP A  1 182 ? 15.677  21.136  10.492  1.00 19.23 ? 181  TRP A CD2 1 
ATOM   1454 N NE1 . TRP A  1 182 ? 16.331  22.965  9.359   1.00 18.06 ? 181  TRP A NE1 1 
ATOM   1455 C CE2 . TRP A  1 182 ? 16.267  22.418  10.615  1.00 19.53 ? 181  TRP A CE2 1 
ATOM   1456 C CE3 . TRP A  1 182 ? 15.499  20.362  11.657  1.00 22.61 ? 181  TRP A CE3 1 
ATOM   1457 C CZ2 . TRP A  1 182 ? 16.682  22.946  11.856  1.00 22.21 ? 181  TRP A CZ2 1 
ATOM   1458 C CZ3 . TRP A  1 182 ? 15.904  20.890  12.887  1.00 23.56 ? 181  TRP A CZ3 1 
ATOM   1459 C CH2 . TRP A  1 182 ? 16.485  22.169  12.976  1.00 25.24 ? 181  TRP A CH2 1 
ATOM   1460 N N   . PHE A  1 183 ? 14.715  16.553  7.676   1.00 14.78 ? 182  PHE A N   1 
ATOM   1461 C CA  . PHE A  1 183 ? 13.865  15.462  7.204   1.00 14.88 ? 182  PHE A CA  1 
ATOM   1462 C C   . PHE A  1 183 ? 12.844  15.063  8.255   1.00 15.05 ? 182  PHE A C   1 
ATOM   1463 O O   . PHE A  1 183 ? 13.186  14.719  9.408   1.00 17.49 ? 182  PHE A O   1 
ATOM   1464 C CB  . PHE A  1 183 ? 14.716  14.262  6.728   1.00 15.26 ? 182  PHE A CB  1 
ATOM   1465 C CG  . PHE A  1 183 ? 15.637  14.617  5.609   1.00 14.72 ? 182  PHE A CG  1 
ATOM   1466 C CD1 . PHE A  1 183 ? 16.890  15.194  5.869   1.00 15.88 ? 182  PHE A CD1 1 
ATOM   1467 C CD2 . PHE A  1 183 ? 15.223  14.476  4.287   1.00 16.91 ? 182  PHE A CD2 1 
ATOM   1468 C CE1 . PHE A  1 183 ? 17.719  15.576  4.835   1.00 16.20 ? 182  PHE A CE1 1 
ATOM   1469 C CE2 . PHE A  1 183 ? 16.045  14.860  3.256   1.00 17.70 ? 182  PHE A CE2 1 
ATOM   1470 C CZ  . PHE A  1 183 ? 17.306  15.417  3.530   1.00 15.25 ? 182  PHE A CZ  1 
ATOM   1471 N N   . VAL A  1 184 ? 11.584  15.183  7.860   1.00 14.45 ? 183  VAL A N   1 
ATOM   1472 C CA  . VAL A  1 184 ? 10.462  14.748  8.675   1.00 14.01 ? 183  VAL A CA  1 
ATOM   1473 C C   . VAL A  1 184 ? 9.809   13.547  7.995   1.00 14.38 ? 183  VAL A C   1 
ATOM   1474 O O   . VAL A  1 184 ? 9.474   13.606  6.821   1.00 15.16 ? 183  VAL A O   1 
ATOM   1475 C CB  . VAL A  1 184 ? 9.445   15.901  8.893   1.00 13.60 ? 183  VAL A CB  1 
ATOM   1476 C CG1 . VAL A  1 184 ? 8.211   15.391  9.651   1.00 15.23 ? 183  VAL A CG1 1 
ATOM   1477 C CG2 . VAL A  1 184 ? 10.099  17.060  9.635   1.00 13.79 ? 183  VAL A CG2 1 
ATOM   1478 N N   . SER A  1 185 ? 9.648   12.447  8.721   1.00 13.68 ? 184  SER A N   1 
ATOM   1479 C CA  . SER A  1 185 ? 9.203   11.204  8.083   1.00 14.27 ? 184  SER A CA  1 
ATOM   1480 C C   . SER A  1 185 ? 8.195   10.425  8.916   1.00 14.14 ? 184  SER A C   1 
ATOM   1481 O O   . SER A  1 185 ? 7.133   10.011  8.415   1.00 14.22 ? 184  SER A O   1 
ATOM   1482 C CB  . SER A  1 185 ? 10.429  10.319  7.739   1.00 14.31 ? 184  SER A CB  1 
ATOM   1483 O OG  . SER A  1 185 ? 11.220  10.037  8.887   1.00 16.04 ? 184  SER A OG  1 
ATOM   1484 N N   . ASN A  1 186 ? 8.527   10.190  10.183  1.00 14.08 ? 185  ASN A N   1 
ATOM   1485 C CA  . ASN A  1 186 ? 7.657   9.417   11.057  1.00 13.50 ? 185  ASN A CA  1 
ATOM   1486 C C   . ASN A  1 186 ? 6.317   10.116  11.262  1.00 13.92 ? 185  ASN A C   1 
ATOM   1487 O O   . ASN A  1 186 ? 6.286   11.345  11.366  1.00 14.07 ? 185  ASN A O   1 
ATOM   1488 C CB  . ASN A  1 186 ? 8.362   9.206   12.413  1.00 13.69 ? 185  ASN A CB  1 
ATOM   1489 C CG  . ASN A  1 186 ? 7.904   7.944   13.136  1.00 12.43 ? 185  ASN A CG  1 
ATOM   1490 O OD1 . ASN A  1 186 ? 6.754   7.526   13.023  1.00 13.46 ? 185  ASN A OD1 1 
ATOM   1491 N ND2 . ASN A  1 186 ? 8.803   7.351   13.936  1.00 14.39 ? 185  ASN A ND2 1 
ATOM   1492 N N   . ILE A  1 187 ? 5.227   9.350   11.314  1.00 13.50 ? 186  ILE A N   1 
ATOM   1493 C CA  . ILE A  1 187 ? 3.948   9.927   11.768  1.00 13.69 ? 186  ILE A CA  1 
ATOM   1494 C C   . ILE A  1 187 ? 4.043   10.340  13.242  1.00 13.93 ? 186  ILE A C   1 
ATOM   1495 O O   . ILE A  1 187 ? 3.385   11.298  13.655  1.00 14.63 ? 186  ILE A O   1 
ATOM   1496 C CB  . ILE A  1 187 ? 2.726   9.002   11.527  1.00 13.16 ? 186  ILE A CB  1 
ATOM   1497 C CG1 . ILE A  1 187 ? 1.394   9.698   11.917  1.00 16.11 ? 186  ILE A CG1 1 
ATOM   1498 C CG2 . ILE A  1 187 ? 2.853   7.698   12.316  1.00 13.95 ? 186  ILE A CG2 1 
ATOM   1499 C CD1 . ILE A  1 187 ? 1.053   10.901  11.090  1.00 18.23 ? 186  ILE A CD1 1 
ATOM   1500 N N   . ASP A  1 188 ? 4.859   9.644   14.027  1.00 14.31 ? 187  ASP A N   1 
ATOM   1501 C CA  . ASP A  1 188 ? 5.092   10.033  15.430  1.00 13.91 ? 187  ASP A CA  1 
ATOM   1502 C C   . ASP A  1 188 ? 5.272   11.557  15.531  1.00 14.65 ? 187  ASP A C   1 
ATOM   1503 O O   . ASP A  1 188 ? 6.205   12.107  14.953  1.00 13.80 ? 187  ASP A O   1 
ATOM   1504 C CB  . ASP A  1 188 ? 6.342   9.324   15.964  1.00 13.63 ? 187  ASP A CB  1 
ATOM   1505 C CG  . ASP A  1 188 ? 6.652   9.675   17.419  1.00 15.42 ? 187  ASP A CG  1 
ATOM   1506 O OD1 . ASP A  1 188 ? 7.659   9.148   17.934  1.00 15.81 ? 187  ASP A OD1 1 
ATOM   1507 O OD2 . ASP A  1 188 ? 5.955   10.448  18.119  1.00 15.85 ? 187  ASP A OD2 1 
ATOM   1508 N N   . GLY A  1 189 ? 4.381   12.211  16.282  1.00 14.26 ? 188  GLY A N   1 
ATOM   1509 C CA  . GLY A  1 189 ? 4.302   13.671  16.329  1.00 14.59 ? 188  GLY A CA  1 
ATOM   1510 C C   . GLY A  1 189 ? 5.566   14.328  16.862  1.00 14.74 ? 188  GLY A C   1 
ATOM   1511 O O   . GLY A  1 189 ? 5.800   15.521  16.655  1.00 15.50 ? 188  GLY A O   1 
ATOM   1512 N N   . THR A  1 190 ? 6.402   13.550  17.547  1.00 14.64 ? 189  THR A N   1 
ATOM   1513 C CA  . THR A  1 190 ? 7.723   14.013  17.965  1.00 15.67 ? 189  THR A CA  1 
ATOM   1514 C C   . THR A  1 190 ? 8.517   14.569  16.784  1.00 15.46 ? 189  THR A C   1 
ATOM   1515 O O   . THR A  1 190 ? 9.239   15.570  16.909  1.00 15.85 ? 189  THR A O   1 
ATOM   1516 C CB  . THR A  1 190 ? 8.481   12.827  18.613  1.00 15.40 ? 189  THR A CB  1 
ATOM   1517 O OG1 . THR A  1 190 ? 7.943   12.609  19.926  1.00 16.94 ? 189  THR A OG1 1 
ATOM   1518 C CG2 . THR A  1 190 ? 9.947   13.163  18.851  1.00 16.41 ? 189  THR A CG2 1 
ATOM   1519 N N   . HIS A  1 191 ? 8.385   13.915  15.635  1.00 15.22 ? 190  HIS A N   1 
ATOM   1520 C CA  . HIS A  1 191 ? 9.259   14.220  14.533  1.00 15.77 ? 190  HIS A CA  1 
ATOM   1521 C C   . HIS A  1 191 ? 8.977   15.623  14.001  1.00 16.00 ? 190  HIS A C   1 
ATOM   1522 O O   . HIS A  1 191 ? 9.882   16.466  13.997  1.00 16.78 ? 190  HIS A O   1 
ATOM   1523 C CB  . HIS A  1 191 ? 9.191   13.150  13.448  1.00 16.28 ? 190  HIS A CB  1 
ATOM   1524 C CG  . HIS A  1 191 ? 10.497  12.926  12.747  1.00 15.85 ? 190  HIS A CG  1 
ATOM   1525 N ND1 . HIS A  1 191 ? 10.613  12.138  11.623  1.00 16.60 ? 190  HIS A ND1 1 
ATOM   1526 C CD2 . HIS A  1 191 ? 11.740  13.407  13.000  1.00 17.63 ? 190  HIS A CD2 1 
ATOM   1527 C CE1 . HIS A  1 191 ? 11.876  12.125  11.224  1.00 18.58 ? 190  HIS A CE1 1 
ATOM   1528 N NE2 . HIS A  1 191 ? 12.581  12.883  12.046  1.00 19.06 ? 190  HIS A NE2 1 
ATOM   1529 N N   . ILE A  1 192 ? 7.725   15.888  13.631  1.00 15.21 ? 191  ILE A N   1 
ATOM   1530 C CA  . ILE A  1 192 ? 7.371   17.219  13.136  1.00 15.20 ? 191  ILE A CA  1 
ATOM   1531 C C   . ILE A  1 192 ? 7.456   18.286  14.250  1.00 16.11 ? 191  ILE A C   1 
ATOM   1532 O O   . ILE A  1 192 ? 7.926   19.389  14.001  1.00 15.00 ? 191  ILE A O   1 
ATOM   1533 C CB  . ILE A  1 192 ? 6.008   17.226  12.397  1.00 16.10 ? 191  ILE A CB  1 
ATOM   1534 C CG1 . ILE A  1 192 ? 5.894   18.495  11.532  1.00 16.61 ? 191  ILE A CG1 1 
ATOM   1535 C CG2 . ILE A  1 192 ? 4.845   17.087  13.383  1.00 15.57 ? 191  ILE A CG2 1 
ATOM   1536 C CD1 . ILE A  1 192 ? 5.071   18.335  10.305  1.00 21.62 ? 191  ILE A CD1 1 
ATOM   1537 N N   . ALA A  1 193 ? 7.039   17.945  15.468  1.00 16.15 ? 192  ALA A N   1 
ATOM   1538 C CA  . ALA A  1 193 ? 7.030   18.925  16.564  1.00 17.54 ? 192  ALA A CA  1 
ATOM   1539 C C   . ALA A  1 193 ? 8.419   19.462  16.874  1.00 18.03 ? 192  ALA A C   1 
ATOM   1540 O O   . ALA A  1 193 ? 8.605   20.684  16.959  1.00 18.59 ? 192  ALA A O   1 
ATOM   1541 C CB  . ALA A  1 193 ? 6.400   18.355  17.811  1.00 17.59 ? 192  ALA A CB  1 
ATOM   1542 N N   . LYS A  1 194 ? 9.396   18.564  17.021  1.00 18.68 ? 193  LYS A N   1 
ATOM   1543 C CA  . LYS A  1 194 ? 10.764  18.982  17.310  1.00 20.20 ? 193  LYS A CA  1 
ATOM   1544 C C   . LYS A  1 194 ? 11.429  19.752  16.168  1.00 20.46 ? 193  LYS A C   1 
ATOM   1545 O O   . LYS A  1 194 ? 12.229  20.662  16.397  1.00 20.96 ? 193  LYS A O   1 
ATOM   1546 C CB  . LYS A  1 194 ? 11.607  17.784  17.741  1.00 21.69 ? 193  LYS A CB  1 
ATOM   1547 C CG  . LYS A  1 194 ? 11.440  17.481  19.212  1.00 24.74 ? 193  LYS A CG  1 
ATOM   1548 C CD  . LYS A  1 194 ? 11.890  18.686  20.074  1.00 29.33 ? 193  LYS A CD  1 
ATOM   1549 C CE  . LYS A  1 194 ? 13.318  18.526  20.607  1.00 30.76 ? 193  LYS A CE  1 
ATOM   1550 N NZ  . LYS A  1 194 ? 14.389  18.645  19.569  1.00 33.88 ? 193  LYS A NZ  1 
ATOM   1551 N N   . THR A  1 195 ? 11.066  19.413  14.945  1.00 19.56 ? 194  THR A N   1 
ATOM   1552 C CA  . THR A  1 195 ? 11.542  20.153  13.787  1.00 20.10 ? 194  THR A CA  1 
ATOM   1553 C C   . THR A  1 195 ? 10.951  21.570  13.761  1.00 20.02 ? 194  THR A C   1 
ATOM   1554 O O   . THR A  1 195 ? 11.712  22.550  13.660  1.00 20.56 ? 194  THR A O   1 
ATOM   1555 C CB  . THR A  1 195 ? 11.211  19.366  12.502  1.00 19.79 ? 194  THR A CB  1 
ATOM   1556 O OG1 . THR A  1 195 ? 11.867  18.089  12.538  1.00 20.73 ? 194  THR A OG1 1 
ATOM   1557 C CG2 . THR A  1 195 ? 11.796  20.057  11.256  1.00 18.49 ? 194  THR A CG2 1 
ATOM   1558 N N   . LEU A  1 196 ? 9.626   21.692  13.891  1.00 20.03 ? 195  LEU A N   1 
ATOM   1559 C CA  . LEU A  1 196 ? 8.965   23.005  13.769  1.00 20.45 ? 195  LEU A CA  1 
ATOM   1560 C C   . LEU A  1 196 ? 9.402   23.949  14.898  1.00 21.44 ? 195  LEU A C   1 
ATOM   1561 O O   . LEU A  1 196 ? 9.457   25.185  14.720  1.00 20.40 ? 195  LEU A O   1 
ATOM   1562 C CB  . LEU A  1 196 ? 7.428   22.886  13.707  1.00 20.21 ? 195  LEU A CB  1 
ATOM   1563 C CG  . LEU A  1 196 ? 6.793   22.095  12.546  1.00 20.54 ? 195  LEU A CG  1 
ATOM   1564 C CD1 . LEU A  1 196 ? 5.284   21.977  12.754  1.00 18.80 ? 195  LEU A CD1 1 
ATOM   1565 C CD2 . LEU A  1 196 ? 7.130   22.688  11.189  1.00 19.12 ? 195  LEU A CD2 1 
ATOM   1566 N N   . ALA A  1 197 ? 9.758   23.360  16.038  1.00 21.81 ? 196  ALA A N   1 
ATOM   1567 C CA  . ALA A  1 197 ? 10.182  24.127  17.212  1.00 22.85 ? 196  ALA A CA  1 
ATOM   1568 C C   . ALA A  1 197 ? 11.405  24.986  16.936  1.00 23.42 ? 196  ALA A C   1 
ATOM   1569 O O   . ALA A  1 197 ? 11.572  26.042  17.554  1.00 24.94 ? 196  ALA A O   1 
ATOM   1570 C CB  . ALA A  1 197 ? 10.455  23.191  18.392  1.00 23.23 ? 196  ALA A CB  1 
ATOM   1571 N N   . SER A  1 198 ? 12.242  24.526  16.010  1.00 23.70 ? 197  SER A N   1 
ATOM   1572 C CA  . SER A  1 198 ? 13.500  25.167  15.656  1.00 24.03 ? 197  SER A CA  1 
ATOM   1573 C C   . SER A  1 198 ? 13.416  26.050  14.416  1.00 23.24 ? 197  SER A C   1 
ATOM   1574 O O   . SER A  1 198 ? 14.449  26.498  13.900  1.00 24.68 ? 197  SER A O   1 
ATOM   1575 C CB  . SER A  1 198 ? 14.570  24.099  15.405  1.00 24.46 ? 197  SER A CB  1 
ATOM   1576 O OG  . SER A  1 198 ? 14.863  23.384  16.594  1.00 28.56 ? 197  SER A OG  1 
ATOM   1577 N N   . LEU A  1 199 ? 12.212  26.305  13.927  1.00 21.34 ? 198  LEU A N   1 
ATOM   1578 C CA  . LEU A  1 199 ? 12.088  26.966  12.625  1.00 20.30 ? 198  LEU A CA  1 
ATOM   1579 C C   . LEU A  1 199 ? 11.189  28.180  12.689  1.00 19.62 ? 198  LEU A C   1 
ATOM   1580 O O   . LEU A  1 199 ? 10.353  28.306  13.589  1.00 19.05 ? 198  LEU A O   1 
ATOM   1581 C CB  . LEU A  1 199 ? 11.503  26.010  11.594  1.00 20.86 ? 198  LEU A CB  1 
ATOM   1582 C CG  . LEU A  1 199 ? 12.288  24.760  11.232  1.00 21.67 ? 198  LEU A CG  1 
ATOM   1583 C CD1 . LEU A  1 199 ? 11.325  23.893  10.452  1.00 22.38 ? 198  LEU A CD1 1 
ATOM   1584 C CD2 . LEU A  1 199 ? 13.504  25.108  10.418  1.00 24.13 ? 198  LEU A CD2 1 
ATOM   1585 N N   . SER A  1 200 ? 11.360  29.065  11.711  1.00 18.76 ? 199  SER A N   1 
ATOM   1586 C CA  . SER A  1 200 ? 10.451  30.205  11.541  1.00 18.83 ? 199  SER A CA  1 
ATOM   1587 C C   . SER A  1 200 ? 9.648   29.987  10.273  1.00 17.91 ? 199  SER A C   1 
ATOM   1588 O O   . SER A  1 200 ? 10.223  29.642  9.250   1.00 17.65 ? 199  SER A O   1 
ATOM   1589 C CB  . SER A  1 200 ? 11.234  31.509  11.379  1.00 19.04 ? 199  SER A CB  1 
ATOM   1590 O OG  . SER A  1 200 ? 10.350  32.577  11.010  1.00 20.66 ? 199  SER A OG  1 
ATOM   1591 N N   . PRO A  1 201 ? 8.330   30.191  10.324  1.00 18.07 ? 200  PRO A N   1 
ATOM   1592 C CA  . PRO A  1 201 ? 7.490   30.058  9.133   1.00 17.89 ? 200  PRO A CA  1 
ATOM   1593 C C   . PRO A  1 201 ? 7.923   31.004  8.020   1.00 17.05 ? 200  PRO A C   1 
ATOM   1594 O O   . PRO A  1 201 ? 7.710   30.693  6.839   1.00 18.34 ? 200  PRO A O   1 
ATOM   1595 C CB  . PRO A  1 201 ? 6.088   30.445  9.628   1.00 17.64 ? 200  PRO A CB  1 
ATOM   1596 C CG  . PRO A  1 201 ? 6.124   30.261  11.116  1.00 20.04 ? 200  PRO A CG  1 
ATOM   1597 C CD  . PRO A  1 201 ? 7.552   30.512  11.533  1.00 18.10 ? 200  PRO A CD  1 
ATOM   1598 N N   . GLU A  1 202 ? 8.547   32.120  8.391   1.00 17.67 ? 201  GLU A N   1 
ATOM   1599 C CA  . GLU A  1 202 ? 8.948   33.148  7.407   1.00 17.38 ? 201  GLU A CA  1 
ATOM   1600 C C   . GLU A  1 202 ? 10.081  32.722  6.478   1.00 16.18 ? 201  GLU A C   1 
ATOM   1601 O O   . GLU A  1 202 ? 10.211  33.236  5.363   1.00 15.54 ? 201  GLU A O   1 
ATOM   1602 C CB  . GLU A  1 202 ? 9.354   34.451  8.099   1.00 17.88 ? 201  GLU A CB  1 
ATOM   1603 C CG  . GLU A  1 202 ? 8.260   35.099  8.929   1.00 21.49 ? 201  GLU A CG  1 
ATOM   1604 C CD  . GLU A  1 202 ? 8.739   36.325  9.699   1.00 24.72 ? 201  GLU A CD  1 
ATOM   1605 O OE1 . GLU A  1 202 ? 8.400   36.415  10.903  1.00 28.08 ? 201  GLU A OE1 1 
ATOM   1606 O OE2 . GLU A  1 202 ? 9.421   37.206  9.116   1.00 22.81 ? 201  GLU A OE2 1 
ATOM   1607 N N   . THR A  1 203 ? 10.904  31.773  6.926   1.00 15.67 ? 202  THR A N   1 
ATOM   1608 C CA  . THR A  1 203 ? 12.134  31.449  6.203   1.00 15.26 ? 202  THR A CA  1 
ATOM   1609 C C   . THR A  1 203 ? 12.298  29.961  5.879   1.00 14.77 ? 202  THR A C   1 
ATOM   1610 O O   . THR A  1 203 ? 13.398  29.532  5.510   1.00 14.37 ? 202  THR A O   1 
ATOM   1611 C CB  . THR A  1 203 ? 13.354  31.945  7.008   1.00 14.86 ? 202  THR A CB  1 
ATOM   1612 O OG1 . THR A  1 203 ? 13.222  31.543  8.379   1.00 16.63 ? 202  THR A OG1 1 
ATOM   1613 C CG2 . THR A  1 203 ? 13.348  33.503  7.074   1.00 16.71 ? 202  THR A CG2 1 
ATOM   1614 N N   . SER A  1 204 ? 11.203  29.206  5.988   1.00 14.37 ? 203  SER A N   1 
ATOM   1615 C CA  . SER A  1 204 ? 11.213  27.759  5.849   1.00 15.19 ? 203  SER A CA  1 
ATOM   1616 C C   . SER A  1 204 ? 10.469  27.370  4.580   1.00 14.51 ? 203  SER A C   1 
ATOM   1617 O O   . SER A  1 204 ? 9.361   27.868  4.318   1.00 15.35 ? 203  SER A O   1 
ATOM   1618 C CB  . SER A  1 204 ? 10.529  27.111  7.058   1.00 15.00 ? 203  SER A CB  1 
ATOM   1619 O OG  . SER A  1 204 ? 11.321  27.243  8.233   1.00 16.46 ? 203  SER A OG  1 
ATOM   1620 N N   . LEU A  1 205 ? 11.059  26.488  3.795   1.00 15.14 ? 204  LEU A N   1 
ATOM   1621 C CA  . LEU A  1 205 ? 10.404  25.971  2.592   1.00 14.84 ? 204  LEU A CA  1 
ATOM   1622 C C   . LEU A  1 205 ? 10.155  24.478  2.795   1.00 15.45 ? 204  LEU A C   1 
ATOM   1623 O O   . LEU A  1 205 ? 11.102  23.719  3.068   1.00 14.53 ? 204  LEU A O   1 
ATOM   1624 C CB  . LEU A  1 205 ? 11.275  26.223  1.346   1.00 16.15 ? 204  LEU A CB  1 
ATOM   1625 C CG  . LEU A  1 205 ? 10.939  25.585  -0.017  1.00 18.06 ? 204  LEU A CG  1 
ATOM   1626 C CD1 . LEU A  1 205 ? 9.618   26.145  -0.544  1.00 20.88 ? 204  LEU A CD1 1 
ATOM   1627 C CD2 . LEU A  1 205 ? 12.063  25.955  -1.003  1.00 20.49 ? 204  LEU A CD2 1 
ATOM   1628 N N   . PHE A  1 206 ? 8.890   24.067  2.673   1.00 14.65 ? 205  PHE A N   1 
ATOM   1629 C CA  . PHE A  1 206 ? 8.500   22.651  2.807   1.00 15.30 ? 205  PHE A CA  1 
ATOM   1630 C C   . PHE A  1 206 ? 8.426   21.955  1.455   1.00 15.18 ? 205  PHE A C   1 
ATOM   1631 O O   . PHE A  1 206 ? 7.904   22.498  0.478   1.00 15.85 ? 205  PHE A O   1 
ATOM   1632 C CB  . PHE A  1 206 ? 7.163   22.527  3.535   1.00 14.43 ? 205  PHE A CB  1 
ATOM   1633 C CG  . PHE A  1 206 ? 7.214   22.990  4.956   1.00 14.13 ? 205  PHE A CG  1 
ATOM   1634 C CD1 . PHE A  1 206 ? 6.914   24.310  5.289   1.00 15.23 ? 205  PHE A CD1 1 
ATOM   1635 C CD2 . PHE A  1 206 ? 7.564   22.106  5.965   1.00 15.15 ? 205  PHE A CD2 1 
ATOM   1636 C CE1 . PHE A  1 206 ? 6.976   24.746  6.628   1.00 15.99 ? 205  PHE A CE1 1 
ATOM   1637 C CE2 . PHE A  1 206 ? 7.642   22.530  7.289   1.00 17.16 ? 205  PHE A CE2 1 
ATOM   1638 C CZ  . PHE A  1 206 ? 7.333   23.844  7.626   1.00 18.10 ? 205  PHE A CZ  1 
ATOM   1639 N N   . ILE A  1 207 ? 8.973   20.744  1.405   1.00 14.65 ? 206  ILE A N   1 
ATOM   1640 C CA  . ILE A  1 207 ? 8.955   19.927  0.198   1.00 16.10 ? 206  ILE A CA  1 
ATOM   1641 C C   . ILE A  1 207 ? 8.147   18.685  0.557   1.00 16.17 ? 206  ILE A C   1 
ATOM   1642 O O   . ILE A  1 207 ? 8.603   17.887  1.371   1.00 16.69 ? 206  ILE A O   1 
ATOM   1643 C CB  . ILE A  1 207 ? 10.409  19.513  -0.182  1.00 16.24 ? 206  ILE A CB  1 
ATOM   1644 C CG1 . ILE A  1 207 ? 11.265  20.737  -0.514  1.00 18.76 ? 206  ILE A CG1 1 
ATOM   1645 C CG2 . ILE A  1 207 ? 10.397  18.486  -1.323  1.00 19.02 ? 206  ILE A CG2 1 
ATOM   1646 C CD1 . ILE A  1 207 ? 12.673  20.361  -0.922  1.00 19.91 ? 206  ILE A CD1 1 
ATOM   1647 N N   . ILE A  1 208 ? 6.961   18.537  -0.034  1.00 15.63 ? 207  ILE A N   1 
ATOM   1648 C CA  . ILE A  1 208 ? 6.104   17.374  0.236   1.00 15.69 ? 207  ILE A CA  1 
ATOM   1649 C C   . ILE A  1 208 ? 6.368   16.309  -0.825  1.00 15.58 ? 207  ILE A C   1 
ATOM   1650 O O   . ILE A  1 208 ? 5.966   16.462  -1.995  1.00 16.83 ? 207  ILE A O   1 
ATOM   1651 C CB  . ILE A  1 208 ? 4.587   17.753  0.293   1.00 15.93 ? 207  ILE A CB  1 
ATOM   1652 C CG1 . ILE A  1 208 ? 4.352   19.094  0.999   1.00 16.58 ? 207  ILE A CG1 1 
ATOM   1653 C CG2 . ILE A  1 208 ? 3.807   16.623  0.962   1.00 15.34 ? 207  ILE A CG2 1 
ATOM   1654 C CD1 . ILE A  1 208 ? 4.835   19.134  2.440   1.00 17.29 ? 207  ILE A CD1 1 
ATOM   1655 N N   . ALA A  1 209 ? 7.060   15.242  -0.397  1.00 15.83 ? 208  ALA A N   1 
ATOM   1656 C CA  . ALA A  1 209 ? 7.594   14.207  -1.286  1.00 15.99 ? 208  ALA A CA  1 
ATOM   1657 C C   . ALA A  1 209 ? 6.770   12.935  -1.139  1.00 16.53 ? 208  ALA A C   1 
ATOM   1658 O O   . ALA A  1 209 ? 6.788   12.295  -0.090  1.00 15.67 ? 208  ALA A O   1 
ATOM   1659 C CB  . ALA A  1 209 ? 9.070   13.928  -0.959  1.00 16.42 ? 208  ALA A CB  1 
ATOM   1660 N N   . SER A  1 210 ? 6.018   12.597  -2.175  1.00 17.67 ? 209  SER A N   1 
ATOM   1661 C CA  . SER A  1 210 ? 5.211   11.384  -2.155  1.00 17.85 ? 209  SER A CA  1 
ATOM   1662 C C   . SER A  1 210 ? 4.780   10.994  -3.564  1.00 18.70 ? 209  SER A C   1 
ATOM   1663 O O   . SER A  1 210 ? 4.091   11.765  -4.252  1.00 18.91 ? 209  SER A O   1 
ATOM   1664 C CB  . SER A  1 210 ? 3.981   11.589  -1.265  1.00 19.39 ? 209  SER A CB  1 
ATOM   1665 O OG  . SER A  1 210 ? 3.129   10.456  -1.306  1.00 18.60 ? 209  SER A OG  1 
ATOM   1666 N N   . LYS A  1 211 ? 5.160   9.781   -3.971  1.00 19.24 ? 210  LYS A N   1 
ATOM   1667 C CA  . LYS A  1 211 ? 4.843   9.284   -5.306  1.00 20.13 ? 210  LYS A CA  1 
ATOM   1668 C C   . LYS A  1 211 ? 3.330   9.291   -5.518  1.00 20.28 ? 210  LYS A C   1 
ATOM   1669 O O   . LYS A  1 211 ? 2.841   9.876   -6.501  1.00 20.67 ? 210  LYS A O   1 
ATOM   1670 C CB  . LYS A  1 211 ? 5.450   7.891   -5.529  1.00 19.72 ? 210  LYS A CB  1 
ATOM   1671 C CG  . LYS A  1 211 ? 5.165   7.329   -6.924  1.00 20.09 ? 210  LYS A CG  1 
ATOM   1672 C CD  . LYS A  1 211 ? 5.994   6.098   -7.219  1.00 19.58 ? 210  LYS A CD  1 
ATOM   1673 C CE  . LYS A  1 211 ? 5.634   5.531   -8.594  1.00 20.05 ? 210  LYS A CE  1 
ATOM   1674 N NZ  . LYS A  1 211 ? 6.260   4.195   -8.877  1.00 19.73 ? 210  LYS A NZ  1 
ATOM   1675 N N   . THR A  1 212 ? 2.600   8.692   -4.572  1.00 19.97 ? 211  THR A N   1 
ATOM   1676 C CA  . THR A  1 212 ? 1.131   8.629   -4.625  1.00 20.84 ? 211  THR A CA  1 
ATOM   1677 C C   . THR A  1 212 ? 0.445   9.920   -4.183  1.00 20.68 ? 211  THR A C   1 
ATOM   1678 O O   . THR A  1 212 ? -0.676  10.211  -4.600  1.00 20.77 ? 211  THR A O   1 
ATOM   1679 C CB  . THR A  1 212 ? 0.591   7.482   -3.746  1.00 20.63 ? 211  THR A CB  1 
ATOM   1680 O OG1 . THR A  1 212 ? 0.965   7.715   -2.377  1.00 22.39 ? 211  THR A OG1 1 
ATOM   1681 C CG2 . THR A  1 212 ? 1.225   6.147   -4.121  1.00 21.81 ? 211  THR A CG2 1 
ATOM   1682 N N   . PHE A  1 213 ? 1.109   10.678  -3.305  1.00 20.12 ? 212  PHE A N   1 
ATOM   1683 C CA  . PHE A  1 213 ? 0.466   11.771  -2.565  1.00 20.37 ? 212  PHE A CA  1 
ATOM   1684 C C   . PHE A  1 213 ? -0.771  11.354  -1.743  1.00 20.16 ? 212  PHE A C   1 
ATOM   1685 O O   . PHE A  1 213 ? -1.669  12.164  -1.514  1.00 19.52 ? 212  PHE A O   1 
ATOM   1686 C CB  . PHE A  1 213 ? 0.148   12.982  -3.463  1.00 20.14 ? 212  PHE A CB  1 
ATOM   1687 C CG  . PHE A  1 213 ? 0.656   14.290  -2.906  1.00 19.59 ? 212  PHE A CG  1 
ATOM   1688 C CD1 . PHE A  1 213 ? 2.019   14.607  -2.963  1.00 19.35 ? 212  PHE A CD1 1 
ATOM   1689 C CD2 . PHE A  1 213 ? -0.226  15.207  -2.328  1.00 20.10 ? 212  PHE A CD2 1 
ATOM   1690 C CE1 . PHE A  1 213 ? 2.496   15.831  -2.434  1.00 19.07 ? 212  PHE A CE1 1 
ATOM   1691 C CE2 . PHE A  1 213 ? 0.239   16.414  -1.799  1.00 19.95 ? 212  PHE A CE2 1 
ATOM   1692 C CZ  . PHE A  1 213 ? 1.603   16.725  -1.863  1.00 19.08 ? 212  PHE A CZ  1 
ATOM   1693 N N   . THR A  1 214 ? -0.804  10.097  -1.299  1.00 19.92 ? 213  THR A N   1 
ATOM   1694 C CA  . THR A  1 214 ? -1.883  9.637   -0.411  1.00 20.38 ? 213  THR A CA  1 
ATOM   1695 C C   . THR A  1 214 ? -1.363  8.947   0.848   1.00 20.04 ? 213  THR A C   1 
ATOM   1696 O O   . THR A  1 214 ? -2.156  8.516   1.694   1.00 21.06 ? 213  THR A O   1 
ATOM   1697 C CB  . THR A  1 214 ? -2.864  8.680   -1.162  1.00 20.30 ? 213  THR A CB  1 
ATOM   1698 O OG1 . THR A  1 214 ? -2.149  7.527   -1.641  1.00 21.78 ? 213  THR A OG1 1 
ATOM   1699 C CG2 . THR A  1 214 ? -3.434  9.351   -2.425  1.00 21.11 ? 213  THR A CG2 1 
ATOM   1700 N N   . THR A  1 215 ? -0.039  8.823   0.973   1.00 19.44 ? 214  THR A N   1 
ATOM   1701 C CA  . THR A  1 215 ? 0.570   8.125   2.106   1.00 19.26 ? 214  THR A CA  1 
ATOM   1702 C C   . THR A  1 215 ? 0.159   8.803   3.395   1.00 18.93 ? 214  THR A C   1 
ATOM   1703 O O   . THR A  1 215 ? 0.344   10.012  3.541   1.00 18.81 ? 214  THR A O   1 
ATOM   1704 C CB  . THR A  1 215 ? 2.077   8.166   1.943   1.00 19.12 ? 214  THR A CB  1 
ATOM   1705 O OG1 . THR A  1 215 ? 2.395   7.448   0.745   1.00 21.99 ? 214  THR A OG1 1 
ATOM   1706 C CG2 . THR A  1 215 ? 2.779   7.392   3.062   1.00 20.28 ? 214  THR A CG2 1 
ATOM   1707 N N   . GLN A  1 216 ? -0.389  8.030   4.324   1.00 18.52 ? 215  GLN A N   1 
ATOM   1708 C CA  . GLN A  1 216 ? -0.993  8.634   5.509   1.00 18.75 ? 215  GLN A CA  1 
ATOM   1709 C C   . GLN A  1 216 ? -0.004  9.469   6.314   1.00 17.75 ? 215  GLN A C   1 
ATOM   1710 O O   . GLN A  1 216 ? -0.322  10.598  6.700   1.00 16.85 ? 215  GLN A O   1 
ATOM   1711 C CB  . GLN A  1 216 ? -1.705  7.612   6.411   1.00 19.94 ? 215  GLN A CB  1 
ATOM   1712 C CG  . GLN A  1 216 ? -2.648  8.341   7.386   1.00 21.84 ? 215  GLN A CG  1 
ATOM   1713 C CD  . GLN A  1 216 ? -3.411  7.458   8.350   1.00 24.09 ? 215  GLN A CD  1 
ATOM   1714 O OE1 . GLN A  1 216 ? -4.540  7.795   8.712   1.00 26.79 ? 215  GLN A OE1 1 
ATOM   1715 N NE2 . GLN A  1 216 ? -2.805  6.366   8.797   1.00 23.20 ? 215  GLN A NE2 1 
ATOM   1716 N N   . GLU A  1 217 ? 1.189   8.933   6.548   1.00 17.08 ? 216  GLU A N   1 
ATOM   1717 C CA  . GLU A  1 217 ? 2.157   9.657   7.384   1.00 16.55 ? 216  GLU A CA  1 
ATOM   1718 C C   . GLU A  1 217 ? 2.502   11.002  6.748   1.00 16.12 ? 216  GLU A C   1 
ATOM   1719 O O   . GLU A  1 217 ? 2.556   12.040  7.437   1.00 16.20 ? 216  GLU A O   1 
ATOM   1720 C CB  . GLU A  1 217 ? 3.438   8.834   7.590   1.00 16.63 ? 216  GLU A CB  1 
ATOM   1721 C CG  . GLU A  1 217 ? 3.248   7.556   8.427   1.00 18.76 ? 216  GLU A CG  1 
ATOM   1722 C CD  . GLU A  1 217 ? 3.031   6.299   7.596   1.00 19.42 ? 216  GLU A CD  1 
ATOM   1723 O OE1 . GLU A  1 217 ? 3.551   5.230   8.009   1.00 18.87 ? 216  GLU A OE1 1 
ATOM   1724 O OE2 . GLU A  1 217 ? 2.341   6.350   6.547   1.00 19.50 ? 216  GLU A OE2 1 
ATOM   1725 N N   . THR A  1 218 ? 2.743   10.987  5.444   1.00 15.33 ? 217  THR A N   1 
ATOM   1726 C CA  . THR A  1 218 ? 3.226   12.172  4.732   1.00 15.69 ? 217  THR A CA  1 
ATOM   1727 C C   . THR A  1 218 ? 2.149   13.254  4.605   1.00 15.83 ? 217  THR A C   1 
ATOM   1728 O O   . THR A  1 218 ? 2.406   14.432  4.836   1.00 15.85 ? 217  THR A O   1 
ATOM   1729 C CB  . THR A  1 218 ? 3.757   11.766  3.347   1.00 15.44 ? 217  THR A CB  1 
ATOM   1730 O OG1 . THR A  1 218 ? 4.858   10.866  3.520   1.00 16.31 ? 217  THR A OG1 1 
ATOM   1731 C CG2 . THR A  1 218 ? 4.351   12.970  2.600   1.00 17.57 ? 217  THR A CG2 1 
ATOM   1732 N N   . ILE A  1 219 ? 0.945   12.853  4.229   1.00 16.70 ? 218  ILE A N   1 
ATOM   1733 C CA  . ILE A  1 219 ? -0.144  13.820  4.130   1.00 16.88 ? 218  ILE A CA  1 
ATOM   1734 C C   . ILE A  1 219 ? -0.528  14.414  5.483   1.00 16.40 ? 218  ILE A C   1 
ATOM   1735 O O   . ILE A  1 219 ? -0.777  15.609  5.561   1.00 16.08 ? 218  ILE A O   1 
ATOM   1736 C CB  . ILE A  1 219 ? -1.361  13.208  3.378   1.00 17.48 ? 218  ILE A CB  1 
ATOM   1737 C CG1 . ILE A  1 219 ? -0.928  12.749  1.979   1.00 19.86 ? 218  ILE A CG1 1 
ATOM   1738 C CG2 . ILE A  1 219 ? -2.519  14.219  3.300   1.00 19.99 ? 218  ILE A CG2 1 
ATOM   1739 C CD1 . ILE A  1 219 ? -0.430  13.867  1.031   1.00 23.99 ? 218  ILE A CD1 1 
ATOM   1740 N N   . THR A  1 220 ? -0.515  13.605  6.542   1.00 15.59 ? 219  THR A N   1 
ATOM   1741 C CA  . THR A  1 220 ? -0.829  14.104  7.879   1.00 15.42 ? 219  THR A CA  1 
ATOM   1742 C C   . THR A  1 220 ? 0.243   15.090  8.333   1.00 14.98 ? 219  THR A C   1 
ATOM   1743 O O   . THR A  1 220 ? -0.079  16.203  8.794   1.00 15.17 ? 219  THR A O   1 
ATOM   1744 C CB  . THR A  1 220 ? -1.011  12.950  8.882   1.00 15.73 ? 219  THR A CB  1 
ATOM   1745 O OG1 . THR A  1 220 ? -2.080  12.094  8.426   1.00 17.56 ? 219  THR A OG1 1 
ATOM   1746 C CG2 . THR A  1 220 ? -1.481  13.493  10.233  1.00 15.93 ? 219  THR A CG2 1 
ATOM   1747 N N   . ASN A  1 221 ? 1.511   14.703  8.166   1.00 14.28 ? 220  ASN A N   1 
ATOM   1748 C CA  . ASN A  1 221 ? 2.616   15.602  8.454   1.00 14.72 ? 220  ASN A CA  1 
ATOM   1749 C C   . ASN A  1 221 ? 2.509   16.909  7.658   1.00 14.81 ? 220  ASN A C   1 
ATOM   1750 O O   . ASN A  1 221 ? 2.717   17.986  8.224   1.00 15.55 ? 220  ASN A O   1 
ATOM   1751 C CB  . ASN A  1 221 ? 3.973   14.925  8.197   1.00 14.22 ? 220  ASN A CB  1 
ATOM   1752 C CG  . ASN A  1 221 ? 4.454   14.096  9.382   1.00 13.48 ? 220  ASN A CG  1 
ATOM   1753 O OD1 . ASN A  1 221 ? 4.235   14.457  10.547  1.00 13.19 ? 220  ASN A OD1 1 
ATOM   1754 N ND2 . ASN A  1 221 ? 5.126   12.988  9.089   1.00 12.22 ? 220  ASN A ND2 1 
ATOM   1755 N N   . ALA A  1 222 ? 2.193   16.807  6.361   1.00 14.84 ? 221  ALA A N   1 
ATOM   1756 C CA  . ALA A  1 222 ? 2.083   17.994  5.500   1.00 15.52 ? 221  ALA A CA  1 
ATOM   1757 C C   . ALA A  1 222 ? 0.937   18.896  5.966   1.00 15.98 ? 221  ALA A C   1 
ATOM   1758 O O   . ALA A  1 222 ? 1.077   20.117  5.967   1.00 15.84 ? 221  ALA A O   1 
ATOM   1759 C CB  . ALA A  1 222 ? 1.892   17.590  4.031   1.00 15.13 ? 221  ALA A CB  1 
ATOM   1760 N N   . GLU A  1 223 ? -0.177  18.288  6.373   1.00 16.55 ? 222  GLU A N   1 
ATOM   1761 C CA  . GLU A  1 223 ? -1.314  19.068  6.904   1.00 17.43 ? 222  GLU A CA  1 
ATOM   1762 C C   . GLU A  1 223 ? -0.963  19.791  8.215   1.00 16.79 ? 222  GLU A C   1 
ATOM   1763 O O   . GLU A  1 223 ? -1.339  20.959  8.427   1.00 16.88 ? 222  GLU A O   1 
ATOM   1764 C CB  . GLU A  1 223 ? -2.578  18.198  7.012   1.00 18.26 ? 222  GLU A CB  1 
ATOM   1765 C CG  . GLU A  1 223 ? -3.063  17.817  5.605   1.00 22.67 ? 222  GLU A CG  1 
ATOM   1766 C CD  . GLU A  1 223 ? -4.482  17.295  5.499   1.00 29.49 ? 222  GLU A CD  1 
ATOM   1767 O OE1 . GLU A  1 223 ? -5.083  17.512  4.414   1.00 32.83 ? 222  GLU A OE1 1 
ATOM   1768 O OE2 . GLU A  1 223 ? -4.992  16.648  6.444   1.00 30.60 ? 222  GLU A OE2 1 
ATOM   1769 N N   . THR A  1 224 ? -0.224  19.118  9.088   1.00 15.65 ? 223  THR A N   1 
ATOM   1770 C CA  . THR A  1 224 ? 0.232   19.729  10.325  1.00 15.55 ? 223  THR A CA  1 
ATOM   1771 C C   . THR A  1 224 ? 1.164   20.907  10.028  1.00 15.78 ? 223  THR A C   1 
ATOM   1772 O O   . THR A  1 224 ? 1.045   21.983  10.636  1.00 15.50 ? 223  THR A O   1 
ATOM   1773 C CB  . THR A  1 224 ? 0.914   18.657  11.198  1.00 15.37 ? 223  THR A CB  1 
ATOM   1774 O OG1 . THR A  1 224 ? -0.104  17.754  11.631  1.00 16.18 ? 223  THR A OG1 1 
ATOM   1775 C CG2 . THR A  1 224 ? 1.460   19.242  12.508  1.00 16.50 ? 223  THR A CG2 1 
ATOM   1776 N N   . ALA A  1 225 ? 2.081   20.711  9.086   1.00 14.87 ? 224  ALA A N   1 
ATOM   1777 C CA  . ALA A  1 225 ? 2.999   21.774  8.679   1.00 14.88 ? 224  ALA A CA  1 
ATOM   1778 C C   . ALA A  1 225 ? 2.243   22.985  8.110   1.00 15.82 ? 224  ALA A C   1 
ATOM   1779 O O   . ALA A  1 225 ? 2.551   24.131  8.450   1.00 15.45 ? 224  ALA A O   1 
ATOM   1780 C CB  . ALA A  1 225 ? 4.019   21.246  7.662   1.00 16.35 ? 224  ALA A CB  1 
ATOM   1781 N N   . LYS A  1 226 ? 1.257   22.706  7.264   1.00 15.93 ? 225  LYS A N   1 
ATOM   1782 C CA  . LYS A  1 226 ? 0.452   23.778  6.641   1.00 16.91 ? 225  LYS A CA  1 
ATOM   1783 C C   . LYS A  1 226 ? -0.367  24.535  7.681   1.00 17.45 ? 225  LYS A C   1 
ATOM   1784 O O   . LYS A  1 226 ? -0.502  25.758  7.584   1.00 17.54 ? 225  LYS A O   1 
ATOM   1785 C CB  . LYS A  1 226 ? -0.436  23.226  5.514   1.00 17.24 ? 225  LYS A CB  1 
ATOM   1786 C CG  . LYS A  1 226 ? -1.168  24.314  4.677   1.00 19.95 ? 225  LYS A CG  1 
ATOM   1787 C CD  . LYS A  1 226 ? -1.627  23.746  3.325   1.00 24.88 ? 225  LYS A CD  1 
ATOM   1788 C CE  . LYS A  1 226 ? -2.900  22.936  3.458   1.00 28.17 ? 225  LYS A CE  1 
ATOM   1789 N NZ  . LYS A  1 226 ? -4.094  23.816  3.282   1.00 31.69 ? 225  LYS A NZ  1 
ATOM   1790 N N   . GLU A  1 227 ? -0.873  23.821  8.693   1.00 17.80 ? 226  GLU A N   1 
ATOM   1791 C CA  . GLU A  1 227 ? -1.627  24.459  9.783   1.00 18.60 ? 226  GLU A CA  1 
ATOM   1792 C C   . GLU A  1 227 ? -0.725  25.385  10.607  1.00 18.07 ? 226  GLU A C   1 
ATOM   1793 O O   . GLU A  1 227 ? -1.096  26.537  10.885  1.00 19.02 ? 226  GLU A O   1 
ATOM   1794 C CB  . GLU A  1 227 ? -2.348  23.408  10.660  1.00 19.45 ? 226  GLU A CB  1 
ATOM   1795 C CG  . GLU A  1 227 ? -3.203  23.977  11.786  1.00 23.56 ? 226  GLU A CG  1 
ATOM   1796 C CD  . GLU A  1 227 ? -3.678  22.899  12.755  1.00 29.17 ? 226  GLU A CD  1 
ATOM   1797 O OE1 . GLU A  1 227 ? -2.832  22.297  13.442  1.00 31.22 ? 226  GLU A OE1 1 
ATOM   1798 O OE2 . GLU A  1 227 ? -4.898  22.642  12.830  1.00 32.92 ? 226  GLU A OE2 1 
ATOM   1799 N N   . TRP A  1 228 ? 0.471   24.897  10.956  1.00 16.69 ? 227  TRP A N   1 
ATOM   1800 C CA  . TRP A  1 228 ? 1.473   25.678  11.680  1.00 17.57 ? 227  TRP A CA  1 
ATOM   1801 C C   . TRP A  1 228 ? 1.844   26.923  10.874  1.00 17.43 ? 227  TRP A C   1 
ATOM   1802 O O   . TRP A  1 228 ? 1.931   28.030  11.431  1.00 17.33 ? 227  TRP A O   1 
ATOM   1803 C CB  . TRP A  1 228 ? 2.691   24.779  11.942  1.00 17.08 ? 227  TRP A CB  1 
ATOM   1804 C CG  . TRP A  1 228 ? 3.962   25.434  12.475  1.00 17.02 ? 227  TRP A CG  1 
ATOM   1805 C CD1 . TRP A  1 228 ? 4.290   25.633  13.790  1.00 17.69 ? 227  TRP A CD1 1 
ATOM   1806 C CD2 . TRP A  1 228 ? 5.097   25.875  11.712  1.00 17.23 ? 227  TRP A CD2 1 
ATOM   1807 N NE1 . TRP A  1 228 ? 5.546   26.187  13.886  1.00 18.10 ? 227  TRP A NE1 1 
ATOM   1808 C CE2 . TRP A  1 228 ? 6.069   26.341  12.628  1.00 18.69 ? 227  TRP A CE2 1 
ATOM   1809 C CE3 . TRP A  1 228 ? 5.394   25.932  10.337  1.00 16.48 ? 227  TRP A CE3 1 
ATOM   1810 C CZ2 . TRP A  1 228 ? 7.304   26.862  12.223  1.00 18.78 ? 227  TRP A CZ2 1 
ATOM   1811 C CZ3 . TRP A  1 228 ? 6.638   26.438  9.938   1.00 18.17 ? 227  TRP A CZ3 1 
ATOM   1812 C CH2 . TRP A  1 228 ? 7.576   26.897  10.882  1.00 18.30 ? 227  TRP A CH2 1 
ATOM   1813 N N   . PHE A  1 229 ? 2.025   26.740  9.569   1.00 16.95 ? 228  PHE A N   1 
ATOM   1814 C CA  . PHE A  1 229 ? 2.379   27.834  8.684   1.00 16.69 ? 228  PHE A CA  1 
ATOM   1815 C C   . PHE A  1 229 ? 1.271   28.897  8.615   1.00 16.42 ? 228  PHE A C   1 
ATOM   1816 O O   . PHE A  1 229 ? 1.549   30.094  8.705   1.00 16.11 ? 228  PHE A O   1 
ATOM   1817 C CB  . PHE A  1 229 ? 2.686   27.330  7.265   1.00 16.68 ? 228  PHE A CB  1 
ATOM   1818 C CG  . PHE A  1 229 ? 2.930   28.439  6.301   1.00 16.72 ? 228  PHE A CG  1 
ATOM   1819 C CD1 . PHE A  1 229 ? 4.138   29.128  6.334   1.00 16.73 ? 228  PHE A CD1 1 
ATOM   1820 C CD2 . PHE A  1 229 ? 1.924   28.848  5.408   1.00 17.58 ? 228  PHE A CD2 1 
ATOM   1821 C CE1 . PHE A  1 229 ? 4.381   30.181  5.465   1.00 19.98 ? 228  PHE A CE1 1 
ATOM   1822 C CE2 . PHE A  1 229 ? 2.146   29.910  4.522   1.00 18.83 ? 228  PHE A CE2 1 
ATOM   1823 C CZ  . PHE A  1 229 ? 3.370   30.590  4.562   1.00 17.35 ? 228  PHE A CZ  1 
ATOM   1824 N N   . LEU A  1 230 ? 0.038   28.457  8.412   1.00 17.02 ? 229  LEU A N   1 
ATOM   1825 C CA  . LEU A  1 230 ? -1.086  29.395  8.254   1.00 17.78 ? 229  LEU A CA  1 
ATOM   1826 C C   . LEU A  1 230 ? -1.457  30.124  9.546   1.00 18.78 ? 229  LEU A C   1 
ATOM   1827 O O   . LEU A  1 230 ? -2.027  31.238  9.509   1.00 18.24 ? 229  LEU A O   1 
ATOM   1828 C CB  . LEU A  1 230 ? -2.306  28.697  7.658   1.00 17.54 ? 229  LEU A CB  1 
ATOM   1829 C CG  . LEU A  1 230 ? -2.195  28.437  6.158   1.00 18.80 ? 229  LEU A CG  1 
ATOM   1830 C CD1 . LEU A  1 230 ? -3.349  27.564  5.637   1.00 20.65 ? 229  LEU A CD1 1 
ATOM   1831 C CD2 . LEU A  1 230 ? -2.156  29.779  5.433   1.00 19.28 ? 229  LEU A CD2 1 
ATOM   1832 N N   . GLU A  1 231 ? -1.139  29.516  10.688  1.00 19.87 ? 230  GLU A N   1 
ATOM   1833 C CA  . GLU A  1 231 ? -1.355  30.159  11.983  1.00 21.14 ? 230  GLU A CA  1 
ATOM   1834 C C   . GLU A  1 231 ? -0.499  31.430  12.088  1.00 20.77 ? 230  GLU A C   1 
ATOM   1835 O O   . GLU A  1 231 ? -0.920  32.414  12.703  1.00 22.10 ? 230  GLU A O   1 
ATOM   1836 C CB  A GLU A  1 231 ? -1.009  29.198  13.131  0.50 21.39 ? 230  GLU A CB  1 
ATOM   1837 C CB  B GLU A  1 231 ? -1.102  29.184  13.137  0.50 21.47 ? 230  GLU A CB  1 
ATOM   1838 C CG  A GLU A  1 231 ? -1.350  29.696  14.535  0.50 23.56 ? 230  GLU A CG  1 
ATOM   1839 C CG  B GLU A  1 231 ? -2.339  28.382  13.519  0.50 23.93 ? 230  GLU A CG  1 
ATOM   1840 C CD  A GLU A  1 231 ? -0.299  30.625  15.133  0.50 25.69 ? 230  GLU A CD  1 
ATOM   1841 C CD  B GLU A  1 231 ? -2.041  26.953  13.955  0.50 27.45 ? 230  GLU A CD  1 
ATOM   1842 O OE1 A GLU A  1 231 ? 0.917   30.334  15.032  0.50 27.91 ? 230  GLU A OE1 1 
ATOM   1843 O OE1 B GLU A  1 231 ? -0.979  26.408  13.582  0.50 31.47 ? 230  GLU A OE1 1 
ATOM   1844 O OE2 A GLU A  1 231 ? -0.690  31.664  15.713  0.50 27.19 ? 230  GLU A OE2 1 
ATOM   1845 O OE2 B GLU A  1 231 ? -2.876  26.355  14.666  0.50 28.47 ? 230  GLU A OE2 1 
ATOM   1846 N N   . ALA A  1 232 ? 0.686   31.407  11.476  1.00 20.38 ? 231  ALA A N   1 
ATOM   1847 C CA  . ALA A  1 232 ? 1.565   32.567  11.428  1.00 20.03 ? 231  ALA A CA  1 
ATOM   1848 C C   . ALA A  1 232 ? 1.248   33.516  10.260  1.00 19.95 ? 231  ALA A C   1 
ATOM   1849 O O   . ALA A  1 232 ? 1.149   34.745  10.471  1.00 20.73 ? 231  ALA A O   1 
ATOM   1850 C CB  . ALA A  1 232 ? 3.038   32.140  11.381  1.00 20.22 ? 231  ALA A CB  1 
ATOM   1851 N N   . ALA A  1 233 ? 1.098   32.961  9.053   1.00 19.66 ? 232  ALA A N   1 
ATOM   1852 C CA  . ALA A  1 233 ? 0.981   33.750  7.817   1.00 19.18 ? 232  ALA A CA  1 
ATOM   1853 C C   . ALA A  1 233 ? -0.412  34.327  7.578   1.00 19.53 ? 232  ALA A C   1 
ATOM   1854 O O   . ALA A  1 233 ? -0.539  35.432  7.020   1.00 19.24 ? 232  ALA A O   1 
ATOM   1855 C CB  . ALA A  1 233 ? 1.428   32.932  6.609   1.00 18.94 ? 232  ALA A CB  1 
ATOM   1856 N N   . LYS A  1 234 ? -1.439  33.565  7.959   1.00 19.37 ? 233  LYS A N   1 
ATOM   1857 C CA  . LYS A  1 234 ? -2.846  34.007  7.902   1.00 19.86 ? 233  LYS A CA  1 
ATOM   1858 C C   . LYS A  1 234 ? -3.284  34.409  6.486   1.00 19.94 ? 233  LYS A C   1 
ATOM   1859 O O   . LYS A  1 234 ? -4.120  35.295  6.291   1.00 19.87 ? 233  LYS A O   1 
ATOM   1860 C CB  . LYS A  1 234 ? -3.105  35.120  8.931   1.00 20.34 ? 233  LYS A CB  1 
ATOM   1861 C CG  . LYS A  1 234 ? -2.563  34.841  10.337  1.00 22.07 ? 233  LYS A CG  1 
ATOM   1862 C CD  . LYS A  1 234 ? -2.832  36.018  11.265  1.00 25.70 ? 233  LYS A CD  1 
ATOM   1863 C CE  . LYS A  1 234 ? -2.230  35.802  12.639  1.00 27.85 ? 233  LYS A CE  1 
ATOM   1864 N NZ  . LYS A  1 234 ? -2.823  36.742  13.637  1.00 31.27 ? 233  LYS A NZ  1 
ATOM   1865 N N   . ASP A  1 235 ? -2.715  33.734  5.497   1.00 19.08 ? 234  ASP A N   1 
ATOM   1866 C CA  . ASP A  1 235 ? -2.918  34.085  4.106   1.00 19.90 ? 234  ASP A CA  1 
ATOM   1867 C C   . ASP A  1 235 ? -2.731  32.834  3.257   1.00 20.13 ? 234  ASP A C   1 
ATOM   1868 O O   . ASP A  1 235 ? -1.595  32.403  3.039   1.00 18.94 ? 234  ASP A O   1 
ATOM   1869 C CB  . ASP A  1 235 ? -1.899  35.160  3.709   1.00 20.15 ? 234  ASP A CB  1 
ATOM   1870 C CG  . ASP A  1 235 ? -2.036  35.610  2.268   1.00 21.48 ? 234  ASP A CG  1 
ATOM   1871 O OD1 . ASP A  1 235 ? -1.322  36.593  1.904   1.00 22.52 ? 234  ASP A OD1 1 
ATOM   1872 O OD2 . ASP A  1 235 ? -2.809  35.070  1.438   1.00 21.60 ? 234  ASP A OD2 1 
ATOM   1873 N N   . PRO A  1 236 ? -3.825  32.259  2.761   1.00 20.77 ? 235  PRO A N   1 
ATOM   1874 C CA  . PRO A  1 236 ? -3.741  31.030  1.962   1.00 21.16 ? 235  PRO A CA  1 
ATOM   1875 C C   . PRO A  1 236 ? -2.857  31.171  0.728   1.00 21.10 ? 235  PRO A C   1 
ATOM   1876 O O   . PRO A  1 236 ? -2.232  30.188  0.329   1.00 20.95 ? 235  PRO A O   1 
ATOM   1877 C CB  . PRO A  1 236 ? -5.194  30.774  1.548   1.00 21.71 ? 235  PRO A CB  1 
ATOM   1878 C CG  . PRO A  1 236 ? -6.014  31.522  2.534   1.00 23.04 ? 235  PRO A CG  1 
ATOM   1879 C CD  . PRO A  1 236 ? -5.215  32.737  2.913   1.00 21.17 ? 235  PRO A CD  1 
ATOM   1880 N N   . SER A  1 237 ? -2.775  32.375  0.154   1.00 20.82 ? 236  SER A N   1 
ATOM   1881 C CA  . SER A  1 237 ? -1.966  32.604  -1.033  1.00 20.90 ? 236  SER A CA  1 
ATOM   1882 C C   . SER A  1 237 ? -0.457  32.463  -0.746  1.00 20.80 ? 236  SER A C   1 
ATOM   1883 O O   . SER A  1 237 ? 0.318   32.206  -1.659  1.00 22.19 ? 236  SER A O   1 
ATOM   1884 C CB  . SER A  1 237 ? -2.274  33.976  -1.651  1.00 21.38 ? 236  SER A CB  1 
ATOM   1885 O OG  . SER A  1 237 ? -1.710  35.017  -0.881  1.00 23.59 ? 236  SER A OG  1 
ATOM   1886 N N   . ALA A  1 238 ? -0.067  32.626  0.521   1.00 19.75 ? 237  ALA A N   1 
ATOM   1887 C CA  . ALA A  1 238 ? 1.345   32.527  0.930   1.00 19.45 ? 237  ALA A CA  1 
ATOM   1888 C C   . ALA A  1 238 ? 1.876   31.088  0.888   1.00 18.95 ? 237  ALA A C   1 
ATOM   1889 O O   . ALA A  1 238 ? 3.099   30.854  0.875   1.00 17.95 ? 237  ALA A O   1 
ATOM   1890 C CB  . ALA A  1 238 ? 1.519   33.123  2.301   1.00 19.82 ? 237  ALA A CB  1 
ATOM   1891 N N   . VAL A  1 239 ? 0.968   30.117  0.847   1.00 18.43 ? 238  VAL A N   1 
ATOM   1892 C CA  . VAL A  1 239 ? 1.359   28.703  0.751   1.00 18.84 ? 238  VAL A CA  1 
ATOM   1893 C C   . VAL A  1 239 ? 2.242   28.454  -0.477  1.00 19.04 ? 238  VAL A C   1 
ATOM   1894 O O   . VAL A  1 239 ? 3.218   27.689  -0.398  1.00 18.96 ? 238  VAL A O   1 
ATOM   1895 C CB  . VAL A  1 239 ? 0.108   27.767  0.802   1.00 18.27 ? 238  VAL A CB  1 
ATOM   1896 C CG1 . VAL A  1 239 ? 0.417   26.318  0.353   1.00 19.10 ? 238  VAL A CG1 1 
ATOM   1897 C CG2 . VAL A  1 239 ? -0.507  27.762  2.207   1.00 19.08 ? 238  VAL A CG2 1 
ATOM   1898 N N   . ALA A  1 240 ? 1.926   29.104  -1.602  1.00 18.75 ? 239  ALA A N   1 
ATOM   1899 C CA  . ALA A  1 240 ? 2.711   28.957  -2.830  1.00 18.59 ? 239  ALA A CA  1 
ATOM   1900 C C   . ALA A  1 240 ? 4.181   29.407  -2.720  1.00 18.01 ? 239  ALA A C   1 
ATOM   1901 O O   . ALA A  1 240 ? 4.991   29.037  -3.574  1.00 19.10 ? 239  ALA A O   1 
ATOM   1902 C CB  . ALA A  1 240 ? 2.020   29.675  -4.009  1.00 19.27 ? 239  ALA A CB  1 
ATOM   1903 N N   . LYS A  1 241 ? 4.509   30.210  -1.704  1.00 17.47 ? 240  LYS A N   1 
ATOM   1904 C CA  . LYS A  1 241 ? 5.894   30.642  -1.487  1.00 16.91 ? 240  LYS A CA  1 
ATOM   1905 C C   . LYS A  1 241 ? 6.670   29.666  -0.591  1.00 16.49 ? 240  LYS A C   1 
ATOM   1906 O O   . LYS A  1 241 ? 7.893   29.720  -0.549  1.00 16.33 ? 240  LYS A O   1 
ATOM   1907 C CB  . LYS A  1 241 ? 5.962   32.054  -0.879  1.00 17.59 ? 240  LYS A CB  1 
ATOM   1908 C CG  . LYS A  1 241 ? 5.363   33.157  -1.751  1.00 18.95 ? 240  LYS A CG  1 
ATOM   1909 C CD  . LYS A  1 241 ? 5.357   34.489  -1.002  1.00 21.41 ? 240  LYS A CD  1 
ATOM   1910 C CE  . LYS A  1 241 ? 4.804   35.632  -1.881  1.00 21.56 ? 240  LYS A CE  1 
ATOM   1911 N NZ  . LYS A  1 241 ? 5.757   36.086  -2.938  1.00 25.39 ? 240  LYS A NZ  1 
ATOM   1912 N N   . HIS A  1 242 ? 5.944   28.772  0.085   1.00 15.83 ? 241  HIS A N   1 
ATOM   1913 C CA  . HIS A  1 242 ? 6.519   27.946  1.145   1.00 15.58 ? 241  HIS A CA  1 
ATOM   1914 C C   . HIS A  1 242 ? 6.341   26.435  1.019   1.00 15.79 ? 241  HIS A C   1 
ATOM   1915 O O   . HIS A  1 242 ? 6.862   25.691  1.868   1.00 15.42 ? 241  HIS A O   1 
ATOM   1916 C CB  . HIS A  1 242 ? 6.010   28.435  2.514   1.00 15.03 ? 241  HIS A CB  1 
ATOM   1917 C CG  . HIS A  1 242 ? 6.519   29.800  2.883   1.00 15.30 ? 241  HIS A CG  1 
ATOM   1918 N ND1 . HIS A  1 242 ? 7.686   29.993  3.592   1.00 14.70 ? 241  HIS A ND1 1 
ATOM   1919 C CD2 . HIS A  1 242 ? 6.033   31.037  2.612   1.00 15.10 ? 241  HIS A CD2 1 
ATOM   1920 C CE1 . HIS A  1 242 ? 7.895   31.291  3.746   1.00 16.07 ? 241  HIS A CE1 1 
ATOM   1921 N NE2 . HIS A  1 242 ? 6.902   31.944  3.161   1.00 15.04 ? 241  HIS A NE2 1 
ATOM   1922 N N   . PHE A  1 243 ? 5.584   25.984  0.010   1.00 15.76 ? 242  PHE A N   1 
ATOM   1923 C CA  . PHE A  1 243 ? 5.326   24.543  -0.172  1.00 15.88 ? 242  PHE A CA  1 
ATOM   1924 C C   . PHE A  1 243 ? 5.507   24.169  -1.631  1.00 16.51 ? 242  PHE A C   1 
ATOM   1925 O O   . PHE A  1 243 ? 4.998   24.844  -2.535  1.00 17.85 ? 242  PHE A O   1 
ATOM   1926 C CB  . PHE A  1 243 ? 3.901   24.168  0.271   1.00 15.59 ? 242  PHE A CB  1 
ATOM   1927 C CG  . PHE A  1 243 ? 3.699   24.181  1.749   1.00 15.00 ? 242  PHE A CG  1 
ATOM   1928 C CD1 . PHE A  1 243 ? 3.560   25.390  2.437   1.00 15.90 ? 242  PHE A CD1 1 
ATOM   1929 C CD2 . PHE A  1 243 ? 3.651   22.981  2.465   1.00 14.54 ? 242  PHE A CD2 1 
ATOM   1930 C CE1 . PHE A  1 243 ? 3.403   25.412  3.799   1.00 15.33 ? 242  PHE A CE1 1 
ATOM   1931 C CE2 . PHE A  1 243 ? 3.473   22.998  3.848   1.00 15.44 ? 242  PHE A CE2 1 
ATOM   1932 C CZ  . PHE A  1 243 ? 3.345   24.198  4.512   1.00 16.56 ? 242  PHE A CZ  1 
ATOM   1933 N N   . VAL A  1 244 ? 6.248   23.094  -1.866  1.00 16.73 ? 243  VAL A N   1 
ATOM   1934 C CA  . VAL A  1 244 ? 6.432   22.534  -3.200  1.00 17.52 ? 243  VAL A CA  1 
ATOM   1935 C C   . VAL A  1 244 ? 6.115   21.037  -3.104  1.00 17.74 ? 243  VAL A C   1 
ATOM   1936 O O   . VAL A  1 244 ? 6.325   20.416  -2.061  1.00 18.95 ? 243  VAL A O   1 
ATOM   1937 C CB  . VAL A  1 244 ? 7.867   22.810  -3.757  1.00 18.39 ? 243  VAL A CB  1 
ATOM   1938 C CG1 A VAL A  1 244 ? 8.170   21.962  -4.999  0.50 17.50 ? 243  VAL A CG1 1 
ATOM   1939 C CG1 B VAL A  1 244 ? 8.272   24.271  -3.543  0.50 18.85 ? 243  VAL A CG1 1 
ATOM   1940 C CG2 A VAL A  1 244 ? 8.027   24.288  -4.083  0.50 18.39 ? 243  VAL A CG2 1 
ATOM   1941 C CG2 B VAL A  1 244 ? 8.877   21.900  -3.129  0.50 18.22 ? 243  VAL A CG2 1 
ATOM   1942 N N   . ALA A  1 245 ? 5.578   20.471  -4.178  1.00 16.67 ? 244  ALA A N   1 
ATOM   1943 C CA  . ALA A  1 245 ? 5.224   19.056  -4.190  1.00 16.35 ? 244  ALA A CA  1 
ATOM   1944 C C   . ALA A  1 245 ? 6.064   18.258  -5.189  1.00 16.14 ? 244  ALA A C   1 
ATOM   1945 O O   . ALA A  1 245 ? 6.342   18.724  -6.307  1.00 16.14 ? 244  ALA A O   1 
ATOM   1946 C CB  . ALA A  1 245 ? 3.733   18.888  -4.490  1.00 17.00 ? 244  ALA A CB  1 
ATOM   1947 N N   . LEU A  1 246 ? 6.462   17.057  -4.772  1.00 16.27 ? 245  LEU A N   1 
ATOM   1948 C CA  . LEU A  1 246 ? 7.159   16.115  -5.652  1.00 16.95 ? 245  LEU A CA  1 
ATOM   1949 C C   . LEU A  1 246 ? 6.300   14.858  -5.751  1.00 17.79 ? 245  LEU A C   1 
ATOM   1950 O O   . LEU A  1 246 ? 6.184   14.114  -4.780  1.00 18.07 ? 245  LEU A O   1 
ATOM   1951 C CB  . LEU A  1 246 ? 8.542   15.746  -5.084  1.00 16.25 ? 245  LEU A CB  1 
ATOM   1952 C CG  . LEU A  1 246 ? 9.390   16.886  -4.478  1.00 16.23 ? 245  LEU A CG  1 
ATOM   1953 C CD1 . LEU A  1 246 ? 10.646  16.327  -3.788  1.00 17.89 ? 245  LEU A CD1 1 
ATOM   1954 C CD2 . LEU A  1 246 ? 9.768   17.906  -5.562  1.00 18.40 ? 245  LEU A CD2 1 
ATOM   1955 N N   . SER A  1 247 ? 5.707   14.607  -6.920  1.00 19.20 ? 246  SER A N   1 
ATOM   1956 C CA  . SER A  1 247 ? 4.718   13.535  -7.028  1.00 19.89 ? 246  SER A CA  1 
ATOM   1957 C C   . SER A  1 247 ? 4.456   13.080  -8.470  1.00 21.18 ? 246  SER A C   1 
ATOM   1958 O O   . SER A  1 247 ? 4.927   13.723  -9.412  1.00 21.00 ? 246  SER A O   1 
ATOM   1959 C CB  . SER A  1 247 ? 3.420   14.018  -6.398  1.00 19.99 ? 246  SER A CB  1 
ATOM   1960 O OG  . SER A  1 247 ? 2.548   12.938  -6.147  1.00 21.08 ? 246  SER A OG  1 
ATOM   1961 N N   . THR A  1 248 ? 3.722   11.969  -8.619  1.00 21.85 ? 247  THR A N   1 
ATOM   1962 C CA  . THR A  1 248 ? 3.163   11.557  -9.918  1.00 23.58 ? 247  THR A CA  1 
ATOM   1963 C C   . THR A  1 248 ? 1.679   11.919  -10.021 1.00 24.67 ? 247  THR A C   1 
ATOM   1964 O O   . THR A  1 248 ? 1.102   11.854  -11.111 1.00 24.99 ? 247  THR A O   1 
ATOM   1965 C CB  . THR A  1 248 ? 3.289   10.032  -10.155 1.00 23.70 ? 247  THR A CB  1 
ATOM   1966 O OG1 . THR A  1 248 ? 2.413   9.332   -9.251  1.00 25.34 ? 247  THR A OG1 1 
ATOM   1967 C CG2 . THR A  1 248 ? 4.703   9.517   -9.841  1.00 22.69 ? 247  THR A CG2 1 
ATOM   1968 N N   . ASN A  1 249 ? 1.075   12.304  -8.892  1.00 24.84 ? 248  ASN A N   1 
ATOM   1969 C CA  . ASN A  1 249 ? -0.379  12.407  -8.770  1.00 26.39 ? 248  ASN A CA  1 
ATOM   1970 C C   . ASN A  1 249 ? -0.866  13.853  -8.665  1.00 26.68 ? 248  ASN A C   1 
ATOM   1971 O O   . ASN A  1 249 ? -1.179  14.344  -7.571  1.00 26.80 ? 248  ASN A O   1 
ATOM   1972 C CB  . ASN A  1 249 ? -0.858  11.567  -7.569  1.00 26.09 ? 248  ASN A CB  1 
ATOM   1973 C CG  . ASN A  1 249 ? -2.355  11.273  -7.590  1.00 28.10 ? 248  ASN A CG  1 
ATOM   1974 O OD1 . ASN A  1 249 ? -3.162  12.042  -8.134  1.00 27.98 ? 248  ASN A OD1 1 
ATOM   1975 N ND2 . ASN A  1 249 ? -2.737  10.156  -6.965  1.00 29.17 ? 248  ASN A ND2 1 
ATOM   1976 N N   . THR A  1 250 ? -0.940  14.520  -9.817  1.00 27.31 ? 249  THR A N   1 
ATOM   1977 C CA  . THR A  1 250 ? -1.382  15.918  -9.902  1.00 27.64 ? 249  THR A CA  1 
ATOM   1978 C C   . THR A  1 250 ? -2.714  16.170  -9.179  1.00 27.55 ? 249  THR A C   1 
ATOM   1979 O O   . THR A  1 250 ? -2.845  17.134  -8.434  1.00 27.24 ? 249  THR A O   1 
ATOM   1980 C CB  . THR A  1 250 ? -1.459  16.353  -11.393 1.00 28.25 ? 249  THR A CB  1 
ATOM   1981 O OG1 . THR A  1 250 ? -0.184  16.137  -12.012 1.00 29.77 ? 249  THR A OG1 1 
ATOM   1982 C CG2 . THR A  1 250 ? -1.646  17.851  -11.523 1.00 28.71 ? 249  THR A CG2 1 
ATOM   1983 N N   . ALA A  1 251 ? -3.691  15.280  -9.381  1.00 27.85 ? 250  ALA A N   1 
ATOM   1984 C CA  . ALA A  1 251 ? -5.018  15.442  -8.779  1.00 27.79 ? 250  ALA A CA  1 
ATOM   1985 C C   . ALA A  1 251 ? -4.966  15.585  -7.257  1.00 27.92 ? 250  ALA A C   1 
ATOM   1986 O O   . ALA A  1 251 ? -5.607  16.475  -6.687  1.00 28.41 ? 250  ALA A O   1 
ATOM   1987 C CB  . ALA A  1 251 ? -5.924  14.287  -9.171  1.00 27.99 ? 250  ALA A CB  1 
ATOM   1988 N N   . LYS A  1 252 ? -4.193  14.710  -6.613  1.00 27.69 ? 251  LYS A N   1 
ATOM   1989 C CA  . LYS A  1 252 ? -4.090  14.711  -5.157  1.00 27.33 ? 251  LYS A CA  1 
ATOM   1990 C C   . LYS A  1 252 ? -3.270  15.908  -4.650  1.00 26.97 ? 251  LYS A C   1 
ATOM   1991 O O   . LYS A  1 252 ? -3.539  16.449  -3.573  1.00 26.70 ? 251  LYS A O   1 
ATOM   1992 C CB  . LYS A  1 252 ? -3.514  13.377  -4.654  1.00 27.44 ? 251  LYS A CB  1 
ATOM   1993 C CG  . LYS A  1 252 ? -4.466  12.171  -4.801  1.00 28.25 ? 251  LYS A CG  1 
ATOM   1994 C CD  . LYS A  1 252 ? -5.728  12.345  -3.962  1.00 31.40 ? 251  LYS A CD  1 
ATOM   1995 C CE  . LYS A  1 252 ? -6.717  11.208  -4.184  1.00 32.66 ? 251  LYS A CE  1 
ATOM   1996 N NZ  . LYS A  1 252 ? -7.756  11.255  -3.112  1.00 35.53 ? 251  LYS A NZ  1 
ATOM   1997 N N   . VAL A  1 253 ? -2.278  16.323  -5.435  1.00 26.69 ? 252  VAL A N   1 
ATOM   1998 C CA  . VAL A  1 253 ? -1.501  17.518  -5.112  1.00 26.84 ? 252  VAL A CA  1 
ATOM   1999 C C   . VAL A  1 253 ? -2.417  18.755  -5.107  1.00 27.53 ? 252  VAL A C   1 
ATOM   2000 O O   . VAL A  1 253 ? -2.367  19.575  -4.187  1.00 27.69 ? 252  VAL A O   1 
ATOM   2001 C CB  . VAL A  1 253 ? -0.300  17.692  -6.085  1.00 26.41 ? 252  VAL A CB  1 
ATOM   2002 C CG1 . VAL A  1 253 ? 0.339   19.061  -5.932  1.00 26.31 ? 252  VAL A CG1 1 
ATOM   2003 C CG2 . VAL A  1 253 ? 0.740   16.580  -5.869  1.00 25.68 ? 252  VAL A CG2 1 
ATOM   2004 N N   . LYS A  1 254 ? -3.271  18.857  -6.123  1.00 28.41 ? 253  LYS A N   1 
ATOM   2005 C CA  . LYS A  1 254 ? -4.246  19.948  -6.227  1.00 29.84 ? 253  LYS A CA  1 
ATOM   2006 C C   . LYS A  1 254 ? -5.226  19.939  -5.056  1.00 29.98 ? 253  LYS A C   1 
ATOM   2007 O O   . LYS A  1 254 ? -5.509  20.988  -4.463  1.00 30.45 ? 253  LYS A O   1 
ATOM   2008 C CB  . LYS A  1 254 ? -5.008  19.867  -7.555  1.00 29.86 ? 253  LYS A CB  1 
ATOM   2009 C CG  . LYS A  1 254 ? -4.147  20.093  -8.787  1.00 32.62 ? 253  LYS A CG  1 
ATOM   2010 C CD  . LYS A  1 254 ? -4.886  19.603  -10.036 1.00 36.91 ? 253  LYS A CD  1 
ATOM   2011 C CE  . LYS A  1 254 ? -4.839  20.623  -11.170 1.00 39.51 ? 253  LYS A CE  1 
ATOM   2012 N NZ  . LYS A  1 254 ? -4.268  20.021  -12.418 1.00 41.49 ? 253  LYS A NZ  1 
ATOM   2013 N N   . GLU A  1 255 ? -5.719  18.744  -4.728  1.00 30.89 ? 254  GLU A N   1 
ATOM   2014 C CA  . GLU A  1 255 ? -6.630  18.508  -3.606  1.00 31.65 ? 254  GLU A CA  1 
ATOM   2015 C C   . GLU A  1 255 ? -6.039  18.931  -2.253  1.00 31.38 ? 254  GLU A C   1 
ATOM   2016 O O   . GLU A  1 255 ? -6.755  19.458  -1.390  1.00 31.55 ? 254  GLU A O   1 
ATOM   2017 C CB  . GLU A  1 255 ? -7.004  17.025  -3.569  1.00 32.40 ? 254  GLU A CB  1 
ATOM   2018 C CG  . GLU A  1 255 ? -8.279  16.695  -2.809  1.00 35.69 ? 254  GLU A CG  1 
ATOM   2019 C CD  . GLU A  1 255 ? -8.636  15.226  -2.917  1.00 39.21 ? 254  GLU A CD  1 
ATOM   2020 O OE1 . GLU A  1 255 ? -8.693  14.546  -1.871  1.00 42.57 ? 254  GLU A OE1 1 
ATOM   2021 O OE2 . GLU A  1 255 ? -8.845  14.739  -4.054  1.00 42.46 ? 254  GLU A OE2 1 
ATOM   2022 N N   . PHE A  1 256 ? -4.740  18.688  -2.069  1.00 30.55 ? 255  PHE A N   1 
ATOM   2023 C CA  . PHE A  1 256 ? -4.050  19.110  -0.850  1.00 29.99 ? 255  PHE A CA  1 
ATOM   2024 C C   . PHE A  1 256 ? -3.994  20.631  -0.739  1.00 30.05 ? 255  PHE A C   1 
ATOM   2025 O O   . PHE A  1 256 ? -3.996  21.172  0.360   1.00 30.29 ? 255  PHE A O   1 
ATOM   2026 C CB  . PHE A  1 256 ? -2.629  18.524  -0.776  1.00 29.25 ? 255  PHE A CB  1 
ATOM   2027 C CG  . PHE A  1 256 ? -1.830  19.016  0.411   1.00 27.87 ? 255  PHE A CG  1 
ATOM   2028 C CD1 . PHE A  1 256 ? -2.093  18.527  1.692   1.00 27.03 ? 255  PHE A CD1 1 
ATOM   2029 C CD2 . PHE A  1 256 ? -0.826  19.972  0.253   1.00 25.99 ? 255  PHE A CD2 1 
ATOM   2030 C CE1 . PHE A  1 256 ? -1.364  18.983  2.798   1.00 25.38 ? 255  PHE A CE1 1 
ATOM   2031 C CE2 . PHE A  1 256 ? -0.095  20.437  1.354   1.00 26.26 ? 255  PHE A CE2 1 
ATOM   2032 C CZ  . PHE A  1 256 ? -0.376  19.934  2.632   1.00 25.10 ? 255  PHE A CZ  1 
ATOM   2033 N N   . GLY A  1 257 ? -3.950  21.314  -1.881  1.00 30.03 ? 256  GLY A N   1 
ATOM   2034 C CA  . GLY A  1 257 ? -3.908  22.763  -1.899  1.00 30.08 ? 256  GLY A CA  1 
ATOM   2035 C C   . GLY A  1 257 ? -2.666  23.362  -2.533  1.00 30.42 ? 256  GLY A C   1 
ATOM   2036 O O   . GLY A  1 257 ? -2.360  24.532  -2.277  1.00 30.52 ? 256  GLY A O   1 
ATOM   2037 N N   . ILE A  1 258 ? -1.947  22.567  -3.334  1.00 30.16 ? 257  ILE A N   1 
ATOM   2038 C CA  . ILE A  1 258 ? -0.770  23.043  -4.073  1.00 30.48 ? 257  ILE A CA  1 
ATOM   2039 C C   . ILE A  1 258 ? -1.089  23.005  -5.570  1.00 31.30 ? 257  ILE A C   1 
ATOM   2040 O O   . ILE A  1 258 ? -1.601  22.002  -6.082  1.00 32.07 ? 257  ILE A O   1 
ATOM   2041 C CB  . ILE A  1 258 ? 0.505   22.183  -3.749  1.00 29.94 ? 257  ILE A CB  1 
ATOM   2042 C CG1 . ILE A  1 258 ? 1.017   22.442  -2.320  1.00 29.28 ? 257  ILE A CG1 1 
ATOM   2043 C CG2 . ILE A  1 258 ? 1.630   22.451  -4.756  1.00 28.97 ? 257  ILE A CG2 1 
ATOM   2044 C CD1 . ILE A  1 258 ? 1.965   21.346  -1.765  1.00 26.67 ? 257  ILE A CD1 1 
ATOM   2045 N N   . ASP A  1 259 ? -0.800  24.104  -6.259  1.00 32.05 ? 258  ASP A N   1 
ATOM   2046 C CA  . ASP A  1 259 ? -0.987  24.205  -7.707  1.00 33.31 ? 258  ASP A CA  1 
ATOM   2047 C C   . ASP A  1 259 ? 0.097   23.422  -8.473  1.00 33.46 ? 258  ASP A C   1 
ATOM   2048 O O   . ASP A  1 259 ? 1.244   23.378  -8.033  1.00 33.18 ? 258  ASP A O   1 
ATOM   2049 C CB  . ASP A  1 259 ? -0.974  25.687  -8.108  1.00 33.59 ? 258  ASP A CB  1 
ATOM   2050 C CG  . ASP A  1 259 ? -1.359  25.910  -9.554  1.00 35.23 ? 258  ASP A CG  1 
ATOM   2051 O OD1 . ASP A  1 259 ? -2.461  26.458  -9.807  1.00 37.39 ? 258  ASP A OD1 1 
ATOM   2052 O OD2 . ASP A  1 259 ? -0.623  25.577  -10.504 1.00 36.60 ? 258  ASP A OD2 1 
ATOM   2053 N N   . PRO A  1 260 ? -0.258  22.795  -9.604  1.00 33.98 ? 259  PRO A N   1 
ATOM   2054 C CA  . PRO A  1 260 ? 0.738   22.115  -10.456 1.00 34.00 ? 259  PRO A CA  1 
ATOM   2055 C C   . PRO A  1 260 ? 1.983   22.933  -10.837 1.00 33.64 ? 259  PRO A C   1 
ATOM   2056 O O   . PRO A  1 260 ? 3.008   22.322  -11.125 1.00 33.75 ? 259  PRO A O   1 
ATOM   2057 C CB  . PRO A  1 260 ? -0.062  21.742  -11.706 1.00 34.51 ? 259  PRO A CB  1 
ATOM   2058 C CG  . PRO A  1 260 ? -1.455  21.560  -11.194 1.00 34.78 ? 259  PRO A CG  1 
ATOM   2059 C CD  . PRO A  1 260 ? -1.628  22.632  -10.133 1.00 34.17 ? 259  PRO A CD  1 
ATOM   2060 N N   . GLN A  1 261 ? 1.916   24.264  -10.837 1.00 33.08 ? 260  GLN A N   1 
ATOM   2061 C CA  . GLN A  1 261 ? 3.112   25.076  -11.079 1.00 33.09 ? 260  GLN A CA  1 
ATOM   2062 C C   . GLN A  1 261 ? 4.121   24.926  -9.938  1.00 32.24 ? 260  GLN A C   1 
ATOM   2063 O O   . GLN A  1 261 ? 5.311   25.162  -10.128 1.00 32.24 ? 260  GLN A O   1 
ATOM   2064 C CB  . GLN A  1 261 ? 2.768   26.558  -11.293 1.00 33.83 ? 260  GLN A CB  1 
ATOM   2065 C CG  . GLN A  1 261 ? 1.930   27.203  -10.170 1.00 36.42 ? 260  GLN A CG  1 
ATOM   2066 C CD  . GLN A  1 261 ? 2.080   28.716  -10.077 1.00 40.03 ? 260  GLN A CD  1 
ATOM   2067 O OE1 . GLN A  1 261 ? 2.166   29.265  -8.973  1.00 41.49 ? 260  GLN A OE1 1 
ATOM   2068 N NE2 . GLN A  1 261 ? 2.099   29.396  -11.227 1.00 40.86 ? 260  GLN A NE2 1 
ATOM   2069 N N   . ASN A  1 262 ? 3.621   24.539  -8.762  1.00 31.49 ? 261  ASN A N   1 
ATOM   2070 C CA  . ASN A  1 262 ? 4.443   24.323  -7.569  1.00 30.51 ? 261  ASN A CA  1 
ATOM   2071 C C   . ASN A  1 262 ? 4.736   22.838  -7.361  1.00 29.19 ? 261  ASN A C   1 
ATOM   2072 O O   . ASN A  1 262 ? 5.039   22.407  -6.242  1.00 28.22 ? 261  ASN A O   1 
ATOM   2073 C CB  . ASN A  1 262 ? 3.745   24.896  -6.330  1.00 31.24 ? 261  ASN A CB  1 
ATOM   2074 C CG  . ASN A  1 262 ? 4.254   26.272  -5.954  1.00 33.92 ? 261  ASN A CG  1 
ATOM   2075 O OD1 . ASN A  1 262 ? 4.628   26.512  -4.801  1.00 37.46 ? 261  ASN A OD1 1 
ATOM   2076 N ND2 . ASN A  1 262 ? 4.288   27.181  -6.925  1.00 34.64 ? 261  ASN A ND2 1 
ATOM   2077 N N   . MET A  1 263 ? 4.654   22.073  -8.452  1.00 27.11 ? 262  MET A N   1 
ATOM   2078 C CA  . MET A  1 263 ? 4.845   20.624  -8.425  1.00 25.92 ? 262  MET A CA  1 
ATOM   2079 C C   . MET A  1 263 ? 5.935   20.207  -9.411  1.00 25.14 ? 262  MET A C   1 
ATOM   2080 O O   . MET A  1 263 ? 5.971   20.700  -10.530 1.00 25.25 ? 262  MET A O   1 
ATOM   2081 C CB  . MET A  1 263 ? 3.527   19.918  -8.763  1.00 25.95 ? 262  MET A CB  1 
ATOM   2082 C CG  . MET A  1 263 ? 3.630   18.424  -8.956  1.00 26.94 ? 262  MET A CG  1 
ATOM   2083 S SD  . MET A  1 263 ? 2.059   17.733  -9.519  1.00 27.70 ? 262  MET A SD  1 
ATOM   2084 C CE  . MET A  1 263 ? 2.502   16.076  -9.762  1.00 27.12 ? 262  MET A CE  1 
ATOM   2085 N N   . LEU A  1 264 ? 6.832   19.315  -8.980  1.00 23.53 ? 263  LEU A N   1 
ATOM   2086 C CA  . LEU A  1 264 ? 7.820   18.711  -9.870  1.00 23.02 ? 263  LEU A CA  1 
ATOM   2087 C C   . LEU A  1 264 ? 7.465   17.242  -10.000 1.00 22.65 ? 263  LEU A C   1 
ATOM   2088 O O   . LEU A  1 264 ? 7.365   16.518  -9.001  1.00 22.32 ? 263  LEU A O   1 
ATOM   2089 C CB  . LEU A  1 264 ? 9.247   18.871  -9.346  1.00 23.38 ? 263  LEU A CB  1 
ATOM   2090 C CG  . LEU A  1 264 ? 9.823   20.293  -9.263  1.00 25.08 ? 263  LEU A CG  1 
ATOM   2091 C CD1 . LEU A  1 264 ? 11.200  20.229  -8.658  1.00 25.79 ? 263  LEU A CD1 1 
ATOM   2092 C CD2 . LEU A  1 264 ? 9.886   20.940  -10.635 1.00 27.12 ? 263  LEU A CD2 1 
ATOM   2093 N N   . GLU A  1 265 ? 7.252   16.800  -11.226 1.00 21.88 ? 264  GLU A N   1 
ATOM   2094 C CA  . GLU A  1 265 ? 6.703   15.471  -11.417 1.00 22.23 ? 264  GLU A CA  1 
ATOM   2095 C C   . GLU A  1 265 ? 7.729   14.394  -11.693 1.00 20.55 ? 264  GLU A C   1 
ATOM   2096 O O   . GLU A  1 265 ? 8.847   14.662  -12.143 1.00 20.37 ? 264  GLU A O   1 
ATOM   2097 C CB  . GLU A  1 265 ? 5.608   15.452  -12.480 1.00 23.28 ? 264  GLU A CB  1 
ATOM   2098 C CG  . GLU A  1 265 ? 6.040   15.753  -13.886 1.00 26.50 ? 264  GLU A CG  1 
ATOM   2099 C CD  . GLU A  1 265 ? 4.821   15.948  -14.765 1.00 32.17 ? 264  GLU A CD  1 
ATOM   2100 O OE1 . GLU A  1 265 ? 4.159   14.931  -15.067 1.00 34.62 ? 264  GLU A OE1 1 
ATOM   2101 O OE2 . GLU A  1 265 ? 4.508   17.114  -15.106 1.00 36.19 ? 264  GLU A OE2 1 
ATOM   2102 N N   . PHE A  1 266 ? 7.328   13.172  -11.376 1.00 19.82 ? 265  PHE A N   1 
ATOM   2103 C CA  . PHE A  1 266 ? 8.002   11.985  -11.868 1.00 19.35 ? 265  PHE A CA  1 
ATOM   2104 C C   . PHE A  1 266 ? 6.956   10.993  -12.366 1.00 19.06 ? 265  PHE A C   1 
ATOM   2105 O O   . PHE A  1 266 ? 5.791   11.382  -12.575 1.00 20.26 ? 265  PHE A O   1 
ATOM   2106 C CB  . PHE A  1 266 ? 9.053   11.396  -10.887 1.00 18.36 ? 265  PHE A CB  1 
ATOM   2107 C CG  . PHE A  1 266 ? 8.556   11.057  -9.484  1.00 18.17 ? 265  PHE A CG  1 
ATOM   2108 C CD1 . PHE A  1 266 ? 8.614   9.741   -9.028  1.00 18.24 ? 265  PHE A CD1 1 
ATOM   2109 C CD2 . PHE A  1 266 ? 8.132   12.045  -8.592  1.00 17.55 ? 265  PHE A CD2 1 
ATOM   2110 C CE1 . PHE A  1 266 ? 8.229   9.394   -7.707  1.00 18.14 ? 265  PHE A CE1 1 
ATOM   2111 C CE2 . PHE A  1 266 ? 7.723   11.707  -7.271  1.00 16.51 ? 265  PHE A CE2 1 
ATOM   2112 C CZ  . PHE A  1 266 ? 7.778   10.378  -6.842  1.00 17.51 ? 265  PHE A CZ  1 
ATOM   2113 N N   . TRP A  1 267 ? 7.364   9.748   -12.594 1.00 19.59 ? 266  TRP A N   1 
ATOM   2114 C CA  . TRP A  1 267 ? 6.555   8.808   -13.402 1.00 19.25 ? 266  TRP A CA  1 
ATOM   2115 C C   . TRP A  1 267 ? 6.403   7.446   -12.744 1.00 19.40 ? 266  TRP A C   1 
ATOM   2116 O O   . TRP A  1 267 ? 7.183   7.100   -11.854 1.00 19.06 ? 266  TRP A O   1 
ATOM   2117 C CB  . TRP A  1 267 ? 7.173   8.684   -14.804 1.00 20.21 ? 266  TRP A CB  1 
ATOM   2118 C CG  . TRP A  1 267 ? 7.283   10.040  -15.391 1.00 20.44 ? 266  TRP A CG  1 
ATOM   2119 C CD1 . TRP A  1 267 ? 6.307   10.732  -16.055 1.00 21.26 ? 266  TRP A CD1 1 
ATOM   2120 C CD2 . TRP A  1 267 ? 8.394   10.934  -15.266 1.00 21.01 ? 266  TRP A CD2 1 
ATOM   2121 N NE1 . TRP A  1 267 ? 6.759   11.993  -16.379 1.00 21.81 ? 266  TRP A NE1 1 
ATOM   2122 C CE2 . TRP A  1 267 ? 8.039   12.140  -15.912 1.00 22.38 ? 266  TRP A CE2 1 
ATOM   2123 C CE3 . TRP A  1 267 ? 9.672   10.828  -14.701 1.00 22.17 ? 266  TRP A CE3 1 
ATOM   2124 C CZ2 . TRP A  1 267 ? 8.910   13.233  -15.991 1.00 22.54 ? 266  TRP A CZ2 1 
ATOM   2125 C CZ3 . TRP A  1 267 ? 10.535  11.902  -14.790 1.00 22.83 ? 266  TRP A CZ3 1 
ATOM   2126 C CH2 . TRP A  1 267 ? 10.146  13.094  -15.422 1.00 21.36 ? 266  TRP A CH2 1 
ATOM   2127 N N   . ASP A  1 268 ? 5.423   6.653   -13.196 1.00 19.33 ? 267  ASP A N   1 
ATOM   2128 C CA  . ASP A  1 268 ? 5.157   5.366   -12.535 1.00 19.60 ? 267  ASP A CA  1 
ATOM   2129 C C   . ASP A  1 268 ? 6.321   4.360   -12.593 1.00 18.82 ? 267  ASP A C   1 
ATOM   2130 O O   . ASP A  1 268 ? 6.439   3.485   -11.719 1.00 19.95 ? 267  ASP A O   1 
ATOM   2131 C CB  . ASP A  1 268 ? 3.807   4.736   -12.964 1.00 20.49 ? 267  ASP A CB  1 
ATOM   2132 C CG  . ASP A  1 268 ? 3.762   4.309   -14.441 1.00 24.05 ? 267  ASP A CG  1 
ATOM   2133 O OD1 . ASP A  1 268 ? 4.782   4.360   -15.155 1.00 27.34 ? 267  ASP A OD1 1 
ATOM   2134 O OD2 . ASP A  1 268 ? 2.705   3.878   -14.972 1.00 27.22 ? 267  ASP A OD2 1 
ATOM   2135 N N   . TRP A  1 269 ? 7.196   4.511   -13.589 1.00 18.24 ? 268  TRP A N   1 
ATOM   2136 C CA  . TRP A  1 269 ? 8.350   3.636   -13.785 1.00 17.62 ? 268  TRP A CA  1 
ATOM   2137 C C   . TRP A  1 269 ? 9.564   4.031   -12.932 1.00 17.25 ? 268  TRP A C   1 
ATOM   2138 O O   . TRP A  1 269 ? 10.632  3.433   -13.044 1.00 17.63 ? 268  TRP A O   1 
ATOM   2139 C CB  . TRP A  1 269 ? 8.746   3.541   -15.280 1.00 18.62 ? 268  TRP A CB  1 
ATOM   2140 C CG  . TRP A  1 269 ? 8.637   4.808   -16.092 1.00 19.44 ? 268  TRP A CG  1 
ATOM   2141 C CD1 . TRP A  1 269 ? 7.631   5.132   -16.969 1.00 20.58 ? 268  TRP A CD1 1 
ATOM   2142 C CD2 . TRP A  1 269 ? 9.569   5.899   -16.139 1.00 20.57 ? 268  TRP A CD2 1 
ATOM   2143 N NE1 . TRP A  1 269 ? 7.873   6.359   -17.543 1.00 21.96 ? 268  TRP A NE1 1 
ATOM   2144 C CE2 . TRP A  1 269 ? 9.056   6.854   -17.052 1.00 20.82 ? 268  TRP A CE2 1 
ATOM   2145 C CE3 . TRP A  1 269 ? 10.786  6.178   -15.491 1.00 21.70 ? 268  TRP A CE3 1 
ATOM   2146 C CZ2 . TRP A  1 269 ? 9.716   8.059   -17.337 1.00 20.84 ? 268  TRP A CZ2 1 
ATOM   2147 C CZ3 . TRP A  1 269 ? 11.444  7.382   -15.770 1.00 20.64 ? 268  TRP A CZ3 1 
ATOM   2148 C CH2 . TRP A  1 269 ? 10.906  8.303   -16.698 1.00 19.18 ? 268  TRP A CH2 1 
ATOM   2149 N N   . VAL A  1 270 ? 9.364   5.022   -12.066 1.00 16.80 ? 269  VAL A N   1 
ATOM   2150 C CA  . VAL A  1 270 ? 10.320  5.342   -10.996 1.00 16.64 ? 269  VAL A CA  1 
ATOM   2151 C C   . VAL A  1 270 ? 9.847   4.709   -9.673  1.00 16.09 ? 269  VAL A C   1 
ATOM   2152 O O   . VAL A  1 270 ? 8.913   5.205   -9.029  1.00 17.02 ? 269  VAL A O   1 
ATOM   2153 C CB  . VAL A  1 270 ? 10.447  6.865   -10.813 1.00 16.50 ? 269  VAL A CB  1 
ATOM   2154 C CG1 . VAL A  1 270 ? 11.511  7.171   -9.728  1.00 16.44 ? 269  VAL A CG1 1 
ATOM   2155 C CG2 . VAL A  1 270 ? 10.782  7.556   -12.143 1.00 17.34 ? 269  VAL A CG2 1 
ATOM   2156 N N   . GLY A  1 271 ? 10.493  3.625   -9.254  1.00 15.65 ? 270  GLY A N   1 
ATOM   2157 C CA  . GLY A  1 271 ? 10.128  3.033   -7.980  1.00 15.90 ? 270  GLY A CA  1 
ATOM   2158 C C   . GLY A  1 271 ? 10.567  3.960   -6.859  1.00 15.60 ? 270  GLY A C   1 
ATOM   2159 O O   . GLY A  1 271 ? 11.585  4.627   -6.985  1.00 15.74 ? 270  GLY A O   1 
ATOM   2160 N N   . GLY A  1 272 ? 9.818   3.993   -5.757  1.00 15.78 ? 271  GLY A N   1 
ATOM   2161 C CA  . GLY A  1 272 ? 10.142  4.900   -4.661  1.00 15.88 ? 271  GLY A CA  1 
ATOM   2162 C C   . GLY A  1 272 ? 11.564  4.694   -4.140  1.00 15.03 ? 271  GLY A C   1 
ATOM   2163 O O   . GLY A  1 272 ? 12.316  5.646   -3.893  1.00 15.90 ? 271  GLY A O   1 
ATOM   2164 N N   . ARG A  1 273 ? 11.960  3.429   -4.007  1.00 14.65 ? 272  ARG A N   1 
ATOM   2165 C CA  . ARG A  1 273 ? 13.289  3.105   -3.468  1.00 14.25 ? 272  ARG A CA  1 
ATOM   2166 C C   . ARG A  1 273 ? 14.402  3.219   -4.515  1.00 14.13 ? 272  ARG A C   1 
ATOM   2167 O O   . ARG A  1 273 ? 15.557  2.870   -4.219  1.00 13.62 ? 272  ARG A O   1 
ATOM   2168 C CB  . ARG A  1 273 ? 13.317  1.702   -2.831  1.00 14.41 ? 272  ARG A CB  1 
ATOM   2169 C CG  . ARG A  1 273 ? 12.907  0.560   -3.770  1.00 13.25 ? 272  ARG A CG  1 
ATOM   2170 C CD  . ARG A  1 273 ? 12.670  -0.767  -3.038  1.00 13.77 ? 272  ARG A CD  1 
ATOM   2171 N NE  . ARG A  1 273 ? 12.131  -1.785  -3.964  1.00 14.45 ? 272  ARG A NE  1 
ATOM   2172 C CZ  . ARG A  1 273 ? 10.838  -2.018  -4.150  1.00 14.04 ? 272  ARG A CZ  1 
ATOM   2173 N NH1 . ARG A  1 273 ? 9.919   -1.348  -3.449  1.00 13.94 ? 272  ARG A NH1 1 
ATOM   2174 N NH2 . ARG A  1 273 ? 10.465  -2.957  -5.025  1.00 15.01 ? 272  ARG A NH2 1 
ATOM   2175 N N   . TYR A  1 274 ? 14.028  3.687   -5.717  1.00 14.50 ? 273  TYR A N   1 
ATOM   2176 C CA  . TYR A  1 274 ? 14.947  4.032   -6.804  1.00 15.19 ? 273  TYR A CA  1 
ATOM   2177 C C   . TYR A  1 274 ? 14.703  5.477   -7.246  1.00 15.45 ? 273  TYR A C   1 
ATOM   2178 O O   . TYR A  1 274 ? 14.963  5.825   -8.396  1.00 16.12 ? 273  TYR A O   1 
ATOM   2179 C CB  . TYR A  1 274 ? 14.740  3.080   -8.011  1.00 14.93 ? 273  TYR A CB  1 
ATOM   2180 C CG  . TYR A  1 274 ? 15.007  1.620   -7.712  1.00 15.30 ? 273  TYR A CG  1 
ATOM   2181 C CD1 . TYR A  1 274 ? 13.957  0.738   -7.425  1.00 15.52 ? 273  TYR A CD1 1 
ATOM   2182 C CD2 . TYR A  1 274 ? 16.312  1.119   -7.696  1.00 14.40 ? 273  TYR A CD2 1 
ATOM   2183 C CE1 . TYR A  1 274 ? 14.208  -0.614  -7.127  1.00 14.38 ? 273  TYR A CE1 1 
ATOM   2184 C CE2 . TYR A  1 274 ? 16.567  -0.230  -7.401  1.00 15.62 ? 273  TYR A CE2 1 
ATOM   2185 C CZ  . TYR A  1 274 ? 15.513  -1.081  -7.117  1.00 13.52 ? 273  TYR A CZ  1 
ATOM   2186 O OH  . TYR A  1 274 ? 15.790  -2.396  -6.811  1.00 16.01 ? 273  TYR A OH  1 
ATOM   2187 N N   . SER A  1 275 ? 14.227  6.334   -6.334  1.00 14.53 ? 274  SER A N   1 
ATOM   2188 C CA  . SER A  1 275 ? 13.663  7.617   -6.760  1.00 14.42 ? 274  SER A CA  1 
ATOM   2189 C C   . SER A  1 275 ? 14.518  8.854   -6.513  1.00 14.61 ? 274  SER A C   1 
ATOM   2190 O O   . SER A  1 275 ? 14.174  9.938   -6.986  1.00 14.18 ? 274  SER A O   1 
ATOM   2191 C CB  . SER A  1 275 ? 12.260  7.829   -6.166  1.00 14.92 ? 274  SER A CB  1 
ATOM   2192 O OG  . SER A  1 275 ? 12.316  8.121   -4.790  1.00 15.93 ? 274  SER A OG  1 
ATOM   2193 N N   . LEU A  1 276 ? 15.621  8.718   -5.789  1.00 13.32 ? 275  LEU A N   1 
ATOM   2194 C CA  . LEU A  1 276 ? 16.423  9.928   -5.454  1.00 13.36 ? 275  LEU A CA  1 
ATOM   2195 C C   . LEU A  1 276 ? 16.980  10.653  -6.702  1.00 14.06 ? 275  LEU A C   1 
ATOM   2196 O O   . LEU A  1 276 ? 17.300  11.856  -6.661  1.00 14.30 ? 275  LEU A O   1 
ATOM   2197 C CB  . LEU A  1 276 ? 17.538  9.609   -4.438  1.00 14.01 ? 275  LEU A CB  1 
ATOM   2198 C CG  . LEU A  1 276 ? 18.722  8.740   -4.872  1.00 13.48 ? 275  LEU A CG  1 
ATOM   2199 C CD1 . LEU A  1 276 ? 19.770  9.614   -5.595  1.00 14.70 ? 275  LEU A CD1 1 
ATOM   2200 C CD2 . LEU A  1 276 ? 19.341  8.072   -3.629  1.00 15.08 ? 275  LEU A CD2 1 
ATOM   2201 N N   . TRP A  1 277 ? 17.072  9.915   -7.804  1.00 13.93 ? 276  TRP A N   1 
ATOM   2202 C CA  . TRP A  1 277 ? 17.596  10.449  -9.068  1.00 15.18 ? 276  TRP A CA  1 
ATOM   2203 C C   . TRP A  1 277 ? 16.604  11.358  -9.800  1.00 14.99 ? 276  TRP A C   1 
ATOM   2204 O O   . TRP A  1 277 ? 16.979  12.015  -10.781 1.00 16.48 ? 276  TRP A O   1 
ATOM   2205 C CB  . TRP A  1 277 ? 17.962  9.274   -9.986  1.00 14.33 ? 276  TRP A CB  1 
ATOM   2206 C CG  . TRP A  1 277 ? 18.610  8.128   -9.255  1.00 14.15 ? 276  TRP A CG  1 
ATOM   2207 C CD1 . TRP A  1 277 ? 18.011  6.984   -8.807  1.00 13.83 ? 276  TRP A CD1 1 
ATOM   2208 C CD2 . TRP A  1 277 ? 19.982  8.037   -8.876  1.00 13.15 ? 276  TRP A CD2 1 
ATOM   2209 N NE1 . TRP A  1 277 ? 18.935  6.178   -8.180  1.00 13.97 ? 276  TRP A NE1 1 
ATOM   2210 C CE2 . TRP A  1 277 ? 20.151  6.813   -8.193  1.00 14.42 ? 276  TRP A CE2 1 
ATOM   2211 C CE3 . TRP A  1 277 ? 21.094  8.884   -9.021  1.00 13.73 ? 276  TRP A CE3 1 
ATOM   2212 C CZ2 . TRP A  1 277 ? 21.386  6.394   -7.704  1.00 12.94 ? 276  TRP A CZ2 1 
ATOM   2213 C CZ3 . TRP A  1 277 ? 22.308  8.484   -8.525  1.00 13.70 ? 276  TRP A CZ3 1 
ATOM   2214 C CH2 . TRP A  1 277 ? 22.462  7.243   -7.875  1.00 14.55 ? 276  TRP A CH2 1 
ATOM   2215 N N   . SER A  1 278 ? 15.341  11.319  -9.370  1.00 14.73 ? 277  SER A N   1 
ATOM   2216 C CA  . SER A  1 278 ? 14.244  12.058  -9.983  1.00 14.88 ? 277  SER A CA  1 
ATOM   2217 C C   . SER A  1 278 ? 14.008  13.369  -9.243  1.00 14.64 ? 277  SER A C   1 
ATOM   2218 O O   . SER A  1 278 ? 14.874  13.824  -8.487  1.00 14.94 ? 277  SER A O   1 
ATOM   2219 C CB  . SER A  1 278 ? 12.970  11.192  -9.947  1.00 15.29 ? 277  SER A CB  1 
ATOM   2220 O OG  . SER A  1 278 ? 12.384  11.190  -8.637  1.00 15.48 ? 277  SER A OG  1 
ATOM   2221 N N   . ALA A  1 279 ? 12.840  13.978  -9.468  1.00 15.06 ? 278  ALA A N   1 
ATOM   2222 C CA  . ALA A  1 279 ? 12.371  15.131  -8.694  1.00 15.04 ? 278  ALA A CA  1 
ATOM   2223 C C   . ALA A  1 279 ? 12.502  14.920  -7.181  1.00 14.95 ? 278  ALA A C   1 
ATOM   2224 O O   . ALA A  1 279 ? 12.690  15.879  -6.448  1.00 15.30 ? 278  ALA A O   1 
ATOM   2225 C CB  . ALA A  1 279 ? 10.915  15.428  -9.034  1.00 15.97 ? 278  ALA A CB  1 
ATOM   2226 N N   . ILE A  1 280 ? 12.395  13.670  -6.729  1.00 14.94 ? 279  ILE A N   1 
ATOM   2227 C CA  . ILE A  1 280 ? 12.533  13.364  -5.289  1.00 14.88 ? 279  ILE A CA  1 
ATOM   2228 C C   . ILE A  1 280 ? 13.886  13.834  -4.739  1.00 14.80 ? 279  ILE A C   1 
ATOM   2229 O O   . ILE A  1 280 ? 14.022  14.112  -3.537  1.00 15.18 ? 279  ILE A O   1 
ATOM   2230 C CB  . ILE A  1 280 ? 12.285  11.839  -5.019  1.00 14.80 ? 279  ILE A CB  1 
ATOM   2231 C CG1 . ILE A  1 280 ? 10.809  11.467  -5.243  1.00 16.07 ? 279  ILE A CG1 1 
ATOM   2232 C CG2 . ILE A  1 280 ? 12.760  11.395  -3.609  1.00 14.90 ? 279  ILE A CG2 1 
ATOM   2233 C CD1 . ILE A  1 280 ? 9.862   11.949  -4.156  1.00 15.19 ? 279  ILE A CD1 1 
ATOM   2234 N N   . GLY A  1 281 ? 14.877  13.954  -5.611  1.00 14.14 ? 280  GLY A N   1 
ATOM   2235 C CA  . GLY A  1 281 ? 16.176  14.464  -5.201  1.00 13.93 ? 280  GLY A CA  1 
ATOM   2236 C C   . GLY A  1 281 ? 16.245  15.975  -5.063  1.00 13.97 ? 280  GLY A C   1 
ATOM   2237 O O   . GLY A  1 281 ? 17.337  16.507  -4.889  1.00 14.29 ? 280  GLY A O   1 
ATOM   2238 N N   . LEU A  1 282 ? 15.107  16.673  -5.112  1.00 13.70 ? 281  LEU A N   1 
ATOM   2239 C CA  . LEU A  1 282 ? 15.160  18.139  -5.005  1.00 14.39 ? 281  LEU A CA  1 
ATOM   2240 C C   . LEU A  1 282 ? 15.893  18.628  -3.750  1.00 14.34 ? 281  LEU A C   1 
ATOM   2241 O O   . LEU A  1 282 ? 16.683  19.568  -3.823  1.00 14.73 ? 281  LEU A O   1 
ATOM   2242 C CB  . LEU A  1 282 ? 13.752  18.754  -5.104  1.00 13.93 ? 281  LEU A CB  1 
ATOM   2243 C CG  . LEU A  1 282 ? 13.726  20.292  -5.025  1.00 15.63 ? 281  LEU A CG  1 
ATOM   2244 C CD1 . LEU A  1 282 ? 14.444  20.934  -6.217  1.00 17.28 ? 281  LEU A CD1 1 
ATOM   2245 C CD2 . LEU A  1 282 ? 12.280  20.800  -4.905  1.00 17.16 ? 281  LEU A CD2 1 
ATOM   2246 N N   . SER A  1 283 ? 15.647  18.006  -2.596  1.00 14.89 ? 282  SER A N   1 
ATOM   2247 C CA  . SER A  1 283 ? 16.292  18.487  -1.371  1.00 14.25 ? 282  SER A CA  1 
ATOM   2248 C C   . SER A  1 283 ? 17.815  18.286  -1.401  1.00 14.37 ? 282  SER A C   1 
ATOM   2249 O O   . SER A  1 283 ? 18.548  19.058  -0.774  1.00 14.35 ? 282  SER A O   1 
ATOM   2250 C CB  . SER A  1 283 ? 15.680  17.828  -0.133  1.00 14.15 ? 282  SER A CB  1 
ATOM   2251 O OG  . SER A  1 283 ? 15.813  16.411  -0.203  1.00 16.93 ? 282  SER A OG  1 
ATOM   2252 N N   . ILE A  1 284 ? 18.279  17.276  -2.140  1.00 14.71 ? 283  ILE A N   1 
ATOM   2253 C CA  . ILE A  1 284 ? 19.725  17.105  -2.401  1.00 14.97 ? 283  ILE A CA  1 
ATOM   2254 C C   . ILE A  1 284 ? 20.268  18.285  -3.212  1.00 15.28 ? 283  ILE A C   1 
ATOM   2255 O O   . ILE A  1 284 ? 21.233  18.940  -2.808  1.00 15.08 ? 283  ILE A O   1 
ATOM   2256 C CB  . ILE A  1 284 ? 20.040  15.782  -3.153  1.00 14.58 ? 283  ILE A CB  1 
ATOM   2257 C CG1 . ILE A  1 284 ? 19.498  14.568  -2.385  1.00 15.20 ? 283  ILE A CG1 1 
ATOM   2258 C CG2 . ILE A  1 284 ? 21.563  15.658  -3.343  1.00 15.01 ? 283  ILE A CG2 1 
ATOM   2259 C CD1 . ILE A  1 284 ? 19.467  13.251  -3.211  1.00 15.71 ? 283  ILE A CD1 1 
ATOM   2260 N N   . ALA A  1 285 ? 19.648  18.532  -4.365  1.00 15.89 ? 284  ALA A N   1 
ATOM   2261 C CA  . ALA A  1 285 ? 20.037  19.643  -5.229  1.00 16.22 ? 284  ALA A CA  1 
ATOM   2262 C C   . ALA A  1 285 ? 19.983  21.000  -4.506  1.00 16.41 ? 284  ALA A C   1 
ATOM   2263 O O   . ALA A  1 285 ? 20.878  21.829  -4.695  1.00 16.54 ? 284  ALA A O   1 
ATOM   2264 C CB  . ALA A  1 285 ? 19.202  19.632  -6.482  1.00 16.86 ? 284  ALA A CB  1 
ATOM   2265 N N   . LEU A  1 286 ? 18.966  21.221  -3.663  1.00 15.82 ? 285  LEU A N   1 
ATOM   2266 C CA  . LEU A  1 286 ? 18.897  22.483  -2.901  1.00 15.74 ? 285  LEU A CA  1 
ATOM   2267 C C   . LEU A  1 286 ? 20.041  22.630  -1.896  1.00 16.06 ? 285  LEU A C   1 
ATOM   2268 O O   . LEU A  1 286 ? 20.553  23.725  -1.678  1.00 15.37 ? 285  LEU A O   1 
ATOM   2269 C CB  . LEU A  1 286 ? 17.556  22.625  -2.169  1.00 15.93 ? 285  LEU A CB  1 
ATOM   2270 C CG  . LEU A  1 286 ? 16.354  22.984  -3.042  1.00 15.98 ? 285  LEU A CG  1 
ATOM   2271 C CD1 . LEU A  1 286 ? 15.054  22.696  -2.290  1.00 16.11 ? 285  LEU A CD1 1 
ATOM   2272 C CD2 . LEU A  1 286 ? 16.383  24.459  -3.504  1.00 18.22 ? 285  LEU A CD2 1 
ATOM   2273 N N   . HIS A  1 287 ? 20.419  21.523  -1.264  1.00 17.04 ? 286  HIS A N   1 
ATOM   2274 C CA  . HIS A  1 287 ? 21.437  21.536  -0.224  1.00 16.67 ? 286  HIS A CA  1 
ATOM   2275 C C   . HIS A  1 287 ? 22.851  21.654  -0.785  1.00 17.34 ? 286  HIS A C   1 
ATOM   2276 O O   . HIS A  1 287 ? 23.650  22.467  -0.272  1.00 17.46 ? 286  HIS A O   1 
ATOM   2277 C CB  . HIS A  1 287 ? 21.294  20.265  0.623   1.00 16.65 ? 286  HIS A CB  1 
ATOM   2278 C CG  . HIS A  1 287 ? 22.046  20.290  1.917   1.00 15.03 ? 286  HIS A CG  1 
ATOM   2279 N ND1 . HIS A  1 287 ? 21.973  21.330  2.819   1.00 15.39 ? 286  HIS A ND1 1 
ATOM   2280 C CD2 . HIS A  1 287 ? 22.838  19.348  2.487   1.00 15.96 ? 286  HIS A CD2 1 
ATOM   2281 C CE1 . HIS A  1 287 ? 22.704  21.034  3.881   1.00 16.64 ? 286  HIS A CE1 1 
ATOM   2282 N NE2 . HIS A  1 287 ? 23.243  19.838  3.699   1.00 14.78 ? 286  HIS A NE2 1 
ATOM   2283 N N   . VAL A  1 288 ? 23.158  20.884  -1.840  1.00 17.24 ? 287  VAL A N   1 
ATOM   2284 C CA  . VAL A  1 288 ? 24.518  20.881  -2.401  1.00 17.83 ? 287  VAL A CA  1 
ATOM   2285 C C   . VAL A  1 288 ? 24.692  21.624  -3.722  1.00 18.15 ? 287  VAL A C   1 
ATOM   2286 O O   . VAL A  1 288 ? 25.821  21.797  -4.203  1.00 18.64 ? 287  VAL A O   1 
ATOM   2287 C CB  . VAL A  1 288 ? 25.156  19.444  -2.500  1.00 17.83 ? 287  VAL A CB  1 
ATOM   2288 C CG1 . VAL A  1 288 ? 25.246  18.805  -1.122  1.00 18.41 ? 287  VAL A CG1 1 
ATOM   2289 C CG2 . VAL A  1 288 ? 24.407  18.549  -3.504  1.00 18.41 ? 287  VAL A CG2 1 
ATOM   2290 N N   . GLY A  1 289 ? 23.584  22.061  -4.300  1.00 17.69 ? 288  GLY A N   1 
ATOM   2291 C CA  . GLY A  1 289 ? 23.602  22.706  -5.601  1.00 17.96 ? 288  GLY A CA  1 
ATOM   2292 C C   . GLY A  1 289 ? 23.318  21.739  -6.731  1.00 18.73 ? 288  GLY A C   1 
ATOM   2293 O O   . GLY A  1 289 ? 23.666  20.547  -6.673  1.00 17.57 ? 288  GLY A O   1 
ATOM   2294 N N   . PHE A  1 290 ? 22.708  22.264  -7.785  1.00 17.91 ? 289  PHE A N   1 
ATOM   2295 C CA  . PHE A  1 290 ? 22.376  21.451  -8.946  1.00 18.67 ? 289  PHE A CA  1 
ATOM   2296 C C   . PHE A  1 290 ? 23.602  20.856  -9.641  1.00 18.63 ? 289  PHE A C   1 
ATOM   2297 O O   . PHE A  1 290 ? 23.547  19.716  -10.086 1.00 18.83 ? 289  PHE A O   1 
ATOM   2298 C CB  . PHE A  1 290 ? 21.500  22.220  -9.935  1.00 19.17 ? 289  PHE A CB  1 
ATOM   2299 C CG  . PHE A  1 290 ? 20.852  21.334  -10.945 1.00 18.65 ? 289  PHE A CG  1 
ATOM   2300 C CD1 . PHE A  1 290 ? 19.735  20.580  -10.607 1.00 20.28 ? 289  PHE A CD1 1 
ATOM   2301 C CD2 . PHE A  1 290 ? 21.393  21.209  -12.227 1.00 20.76 ? 289  PHE A CD2 1 
ATOM   2302 C CE1 . PHE A  1 290 ? 19.146  19.721  -11.547 1.00 20.98 ? 289  PHE A CE1 1 
ATOM   2303 C CE2 . PHE A  1 290 ? 20.799  20.367  -13.171 1.00 22.08 ? 289  PHE A CE2 1 
ATOM   2304 C CZ  . PHE A  1 290 ? 19.679  19.625  -12.828 1.00 22.42 ? 289  PHE A CZ  1 
ATOM   2305 N N   . ASP A  1 291 ? 24.706  21.601  -9.717  1.00 18.41 ? 290  ASP A N   1 
ATOM   2306 C CA  . ASP A  1 291 ? 25.938  21.060  -10.317 1.00 19.19 ? 290  ASP A CA  1 
ATOM   2307 C C   . ASP A  1 291 ? 26.376  19.741  -9.663  1.00 18.06 ? 290  ASP A C   1 
ATOM   2308 O O   . ASP A  1 291 ? 26.680  18.774  -10.361 1.00 17.87 ? 290  ASP A O   1 
ATOM   2309 C CB  . ASP A  1 291 ? 27.108  22.060  -10.286 1.00 19.72 ? 290  ASP A CB  1 
ATOM   2310 C CG  . ASP A  1 291 ? 26.886  23.271  -11.190 1.00 25.80 ? 290  ASP A CG  1 
ATOM   2311 O OD1 . ASP A  1 291 ? 25.906  23.298  -11.976 1.00 31.98 ? 290  ASP A OD1 1 
ATOM   2312 O OD2 . ASP A  1 291 ? 27.655  24.261  -11.173 1.00 31.03 ? 290  ASP A OD2 1 
ATOM   2313 N N   . HIS A  1 292 ? 26.401  19.709  -8.332  1.00 17.18 ? 291  HIS A N   1 
ATOM   2314 C CA  . HIS A  1 292 ? 26.775  18.483  -7.620  1.00 16.97 ? 291  HIS A CA  1 
ATOM   2315 C C   . HIS A  1 292 ? 25.727  17.377  -7.801  1.00 16.58 ? 291  HIS A C   1 
ATOM   2316 O O   . HIS A  1 292 ? 26.083  16.195  -7.872  1.00 17.26 ? 291  HIS A O   1 
ATOM   2317 C CB  . HIS A  1 292 ? 27.029  18.757  -6.132  1.00 16.24 ? 291  HIS A CB  1 
ATOM   2318 C CG  . HIS A  1 292 ? 28.302  19.503  -5.867  1.00 17.78 ? 291  HIS A CG  1 
ATOM   2319 N ND1 . HIS A  1 292 ? 28.364  20.578  -5.012  1.00 18.77 ? 291  HIS A ND1 1 
ATOM   2320 C CD2 . HIS A  1 292 ? 29.555  19.338  -6.360  1.00 18.14 ? 291  HIS A CD2 1 
ATOM   2321 C CE1 . HIS A  1 292 ? 29.603  21.039  -4.976  1.00 19.02 ? 291  HIS A CE1 1 
ATOM   2322 N NE2 . HIS A  1 292 ? 30.347  20.302  -5.780  1.00 20.90 ? 291  HIS A NE2 1 
ATOM   2323 N N   . PHE A  1 293 ? 24.447  17.754  -7.870  1.00 16.75 ? 292  PHE A N   1 
ATOM   2324 C CA  . PHE A  1 293 ? 23.389  16.780  -8.167  1.00 16.61 ? 292  PHE A CA  1 
ATOM   2325 C C   . PHE A  1 293 ? 23.607  16.144  -9.552  1.00 17.31 ? 292  PHE A C   1 
ATOM   2326 O O   . PHE A  1 293 ? 23.516  14.926  -9.706  1.00 16.71 ? 292  PHE A O   1 
ATOM   2327 C CB  . PHE A  1 293 ? 21.993  17.417  -8.007  1.00 16.72 ? 292  PHE A CB  1 
ATOM   2328 C CG  . PHE A  1 293 ? 20.845  16.437  -8.172  1.00 15.75 ? 292  PHE A CG  1 
ATOM   2329 C CD1 . PHE A  1 293 ? 20.566  15.478  -7.191  1.00 16.91 ? 292  PHE A CD1 1 
ATOM   2330 C CD2 . PHE A  1 293 ? 20.064  16.469  -9.327  1.00 16.71 ? 292  PHE A CD2 1 
ATOM   2331 C CE1 . PHE A  1 293 ? 19.491  14.579  -7.347  1.00 16.89 ? 292  PHE A CE1 1 
ATOM   2332 C CE2 . PHE A  1 293 ? 18.996  15.577  -9.502  1.00 17.09 ? 292  PHE A CE2 1 
ATOM   2333 C CZ  . PHE A  1 293 ? 18.716  14.618  -8.518  1.00 16.70 ? 292  PHE A CZ  1 
ATOM   2334 N N   . GLU A  1 294 ? 23.944  16.960  -10.551 1.00 17.56 ? 293  GLU A N   1 
ATOM   2335 C CA  . GLU A  1 294 ? 24.265  16.428  -11.882 1.00 18.17 ? 293  GLU A CA  1 
ATOM   2336 C C   . GLU A  1 294 ? 25.457  15.483  -11.863 1.00 17.83 ? 293  GLU A C   1 
ATOM   2337 O O   . GLU A  1 294 ? 25.478  14.517  -12.618 1.00 18.16 ? 293  GLU A O   1 
ATOM   2338 C CB  . GLU A  1 294 ? 24.558  17.549  -12.874 1.00 19.01 ? 293  GLU A CB  1 
ATOM   2339 C CG  . GLU A  1 294 ? 23.327  18.161  -13.494 1.00 23.07 ? 293  GLU A CG  1 
ATOM   2340 C CD  . GLU A  1 294 ? 23.672  19.168  -14.581 1.00 26.79 ? 293  GLU A CD  1 
ATOM   2341 O OE1 . GLU A  1 294 ? 24.648  19.941  -14.415 1.00 30.87 ? 293  GLU A OE1 1 
ATOM   2342 O OE2 . GLU A  1 294 ? 22.965  19.186  -15.602 1.00 28.90 ? 293  GLU A OE2 1 
ATOM   2343 N N   . GLN A  1 295 ? 26.467  15.783  -11.047 1.00 16.70 ? 294  GLN A N   1 
ATOM   2344 C CA  . GLN A  1 295 ? 27.620  14.880  -10.908 1.00 16.15 ? 294  GLN A CA  1 
ATOM   2345 C C   . GLN A  1 295 ? 27.224  13.542  -10.265 1.00 16.11 ? 294  GLN A C   1 
ATOM   2346 O O   . GLN A  1 295 ? 27.752  12.499  -10.636 1.00 15.65 ? 294  GLN A O   1 
ATOM   2347 C CB  A GLN A  1 295 ? 28.819  15.542  -10.216 0.20 16.43 ? 294  GLN A CB  1 
ATOM   2348 C CB  B GLN A  1 295 ? 28.719  15.544  -10.049 0.80 16.03 ? 294  GLN A CB  1 
ATOM   2349 C CG  A GLN A  1 295 ? 29.754  16.281  -11.196 0.20 17.04 ? 294  GLN A CG  1 
ATOM   2350 C CG  B GLN A  1 295 ? 29.400  16.745  -10.738 0.80 16.53 ? 294  GLN A CG  1 
ATOM   2351 C CD  A GLN A  1 295 ? 30.538  15.348  -12.124 0.20 17.69 ? 294  GLN A CD  1 
ATOM   2352 C CD  B GLN A  1 295 ? 30.108  17.693  -9.777  0.80 18.85 ? 294  GLN A CD  1 
ATOM   2353 O OE1 A GLN A  1 295 ? 30.078  15.020  -13.221 0.20 18.28 ? 294  GLN A OE1 1 
ATOM   2354 O OE1 B GLN A  1 295 ? 30.511  17.311  -8.662  0.80 18.95 ? 294  GLN A OE1 1 
ATOM   2355 N NE2 A GLN A  1 295 ? 31.727  14.940  -11.693 0.20 18.35 ? 294  GLN A NE2 1 
ATOM   2356 N NE2 B GLN A  1 295 ? 30.270  18.948  -10.214 0.80 19.13 ? 294  GLN A NE2 1 
ATOM   2357 N N   . LEU A  1 296 ? 26.294  13.588  -9.314  1.00 15.17 ? 295  LEU A N   1 
ATOM   2358 C CA  . LEU A  1 296 ? 25.716  12.369  -8.720  1.00 15.58 ? 295  LEU A CA  1 
ATOM   2359 C C   . LEU A  1 296 ? 25.037  11.506  -9.784  1.00 15.45 ? 295  LEU A C   1 
ATOM   2360 O O   . LEU A  1 296 ? 25.305  10.292  -9.867  1.00 14.90 ? 295  LEU A O   1 
ATOM   2361 C CB  . LEU A  1 296 ? 24.731  12.739  -7.599  1.00 14.97 ? 295  LEU A CB  1 
ATOM   2362 C CG  . LEU A  1 296 ? 24.015  11.606  -6.865  1.00 15.04 ? 295  LEU A CG  1 
ATOM   2363 C CD1 . LEU A  1 296 ? 24.893  11.019  -5.779  1.00 14.54 ? 295  LEU A CD1 1 
ATOM   2364 C CD2 . LEU A  1 296 ? 22.735  12.127  -6.284  1.00 15.66 ? 295  LEU A CD2 1 
ATOM   2365 N N   . LEU A  1 297 ? 24.208  12.143  -10.615 1.00 15.29 ? 296  LEU A N   1 
ATOM   2366 C CA  . LEU A  1 297 ? 23.562  11.476  -11.745 1.00 16.38 ? 296  LEU A CA  1 
ATOM   2367 C C   . LEU A  1 297 ? 24.595  10.918  -12.729 1.00 15.81 ? 296  LEU A C   1 
ATOM   2368 O O   . LEU A  1 297 ? 24.441  9.789   -13.213 1.00 16.17 ? 296  LEU A O   1 
ATOM   2369 C CB  . LEU A  1 297 ? 22.642  12.450  -12.506 1.00 16.25 ? 296  LEU A CB  1 
ATOM   2370 C CG  . LEU A  1 297 ? 21.467  13.087  -11.770 1.00 19.60 ? 296  LEU A CG  1 
ATOM   2371 C CD1 . LEU A  1 297 ? 20.678  14.027  -12.679 1.00 22.03 ? 296  LEU A CD1 1 
ATOM   2372 C CD2 . LEU A  1 297 ? 20.584  11.995  -11.283 1.00 20.59 ? 296  LEU A CD2 1 
ATOM   2373 N N   . SER A  1 298 ? 25.654  11.690  -12.998 1.00 15.89 ? 297  SER A N   1 
ATOM   2374 C CA  . SER A  1 298 ? 26.677  11.285  -13.979 1.00 16.24 ? 297  SER A CA  1 
ATOM   2375 C C   . SER A  1 298 ? 27.442  10.038  -13.542 1.00 16.15 ? 297  SER A C   1 
ATOM   2376 O O   . SER A  1 298 ? 27.758  9.179   -14.365 1.00 16.04 ? 297  SER A O   1 
ATOM   2377 C CB  . SER A  1 298 ? 27.658  12.430  -14.248 1.00 16.07 ? 297  SER A CB  1 
ATOM   2378 O OG  A SER A  1 298 ? 27.027  13.449  -15.002 0.50 16.22 ? 297  SER A OG  1 
ATOM   2379 O OG  B SER A  1 298 ? 28.441  12.133  -15.382 0.50 18.63 ? 297  SER A OG  1 
ATOM   2380 N N   . GLY A  1 299 ? 27.717  9.938   -12.238 1.00 15.24 ? 298  GLY A N   1 
ATOM   2381 C CA  . GLY A  1 299 ? 28.376  8.776   -11.654 1.00 15.38 ? 298  GLY A CA  1 
ATOM   2382 C C   . GLY A  1 299 ? 27.517  7.526   -11.737 1.00 14.69 ? 298  GLY A C   1 
ATOM   2383 O O   . GLY A  1 299 ? 28.029  6.449   -12.053 1.00 14.71 ? 298  GLY A O   1 
ATOM   2384 N N   . ALA A  1 300 ? 26.222  7.672   -11.464 1.00 15.26 ? 299  ALA A N   1 
ATOM   2385 C CA  . ALA A  1 300 ? 25.298  6.549   -11.644 1.00 15.84 ? 299  ALA A CA  1 
ATOM   2386 C C   . ALA A  1 300 ? 25.292  6.116   -13.118 1.00 16.04 ? 299  ALA A C   1 
ATOM   2387 O O   . ALA A  1 300 ? 25.375  4.923   -13.401 1.00 16.15 ? 299  ALA A O   1 
ATOM   2388 C CB  . ALA A  1 300 ? 23.904  6.916   -11.182 1.00 15.37 ? 299  ALA A CB  1 
ATOM   2389 N N   . HIS A  1 301 ? 25.223  7.088   -14.034 1.00 16.72 ? 300  HIS A N   1 
ATOM   2390 C CA  . HIS A  1 301 ? 25.265  6.811   -15.480 1.00 16.84 ? 300  HIS A CA  1 
ATOM   2391 C C   . HIS A  1 301 ? 26.512  6.007   -15.885 1.00 16.57 ? 300  HIS A C   1 
ATOM   2392 O O   . HIS A  1 301 ? 26.428  5.062   -16.689 1.00 16.44 ? 300  HIS A O   1 
ATOM   2393 C CB  . HIS A  1 301 ? 25.159  8.121   -16.292 1.00 17.29 ? 300  HIS A CB  1 
ATOM   2394 C CG  . HIS A  1 301 ? 25.049  7.906   -17.774 1.00 18.68 ? 300  HIS A CG  1 
ATOM   2395 N ND1 . HIS A  1 301 ? 24.016  7.201   -18.351 1.00 20.38 ? 300  HIS A ND1 1 
ATOM   2396 C CD2 . HIS A  1 301 ? 25.853  8.299   -18.792 1.00 21.60 ? 300  HIS A CD2 1 
ATOM   2397 C CE1 . HIS A  1 301 ? 24.189  7.164   -19.663 1.00 21.66 ? 300  HIS A CE1 1 
ATOM   2398 N NE2 . HIS A  1 301 ? 25.297  7.824   -19.956 1.00 22.88 ? 300  HIS A NE2 1 
ATOM   2399 N N   . TRP A  1 302 ? 27.668  6.378   -15.344 1.00 16.56 ? 301  TRP A N   1 
ATOM   2400 C CA  . TRP A  1 302 ? 28.904  5.640   -15.602 1.00 16.33 ? 301  TRP A CA  1 
ATOM   2401 C C   . TRP A  1 302 ? 28.756  4.169   -15.191 1.00 16.68 ? 301  TRP A C   1 
ATOM   2402 O O   . TRP A  1 302 ? 29.125  3.263   -15.935 1.00 16.46 ? 301  TRP A O   1 
ATOM   2403 C CB  . TRP A  1 302 ? 30.115  6.277   -14.883 1.00 17.44 ? 301  TRP A CB  1 
ATOM   2404 C CG  . TRP A  1 302 ? 31.410  5.641   -15.297 1.00 17.25 ? 301  TRP A CG  1 
ATOM   2405 C CD1 . TRP A  1 302 ? 32.300  6.123   -16.227 1.00 18.82 ? 301  TRP A CD1 1 
ATOM   2406 C CD2 . TRP A  1 302 ? 31.953  4.392   -14.841 1.00 17.88 ? 301  TRP A CD2 1 
ATOM   2407 N NE1 . TRP A  1 302 ? 33.357  5.256   -16.366 1.00 19.00 ? 301  TRP A NE1 1 
ATOM   2408 C CE2 . TRP A  1 302 ? 33.170  4.181   -15.538 1.00 18.61 ? 301  TRP A CE2 1 
ATOM   2409 C CE3 . TRP A  1 302 ? 31.530  3.412   -13.920 1.00 17.90 ? 301  TRP A CE3 1 
ATOM   2410 C CZ2 . TRP A  1 302 ? 33.965  3.046   -15.345 1.00 20.42 ? 301  TRP A CZ2 1 
ATOM   2411 C CZ3 . TRP A  1 302 ? 32.313  2.282   -13.732 1.00 19.67 ? 301  TRP A CZ3 1 
ATOM   2412 C CH2 . TRP A  1 302 ? 33.525  2.103   -14.444 1.00 19.13 ? 301  TRP A CH2 1 
ATOM   2413 N N   . MET A  1 303 ? 28.252  3.937   -13.975 1.00 15.79 ? 302  MET A N   1 
ATOM   2414 C CA  . MET A  1 303 ? 28.026  2.583   -13.497 1.00 15.83 ? 302  MET A CA  1 
ATOM   2415 C C   . MET A  1 303 ? 26.961  1.824   -14.314 1.00 16.20 ? 302  MET A C   1 
ATOM   2416 O O   . MET A  1 303 ? 27.100  0.607   -14.514 1.00 16.21 ? 302  MET A O   1 
ATOM   2417 C CB  . MET A  1 303 ? 27.699  2.599   -11.989 1.00 15.13 ? 302  MET A CB  1 
ATOM   2418 C CG  . MET A  1 303 ? 27.603  1.181   -11.365 1.00 15.91 ? 302  MET A CG  1 
ATOM   2419 S SD  . MET A  1 303 ? 29.099  0.191   -11.477 1.00 16.97 ? 302  MET A SD  1 
ATOM   2420 C CE  . MET A  1 303 ? 30.206  1.091   -10.411 1.00 16.37 ? 302  MET A CE  1 
ATOM   2421 N N   . ASP A  1 304 ? 25.934  2.541   -14.783 1.00 16.38 ? 303  ASP A N   1 
ATOM   2422 C CA  . ASP A  1 304 ? 24.910  1.966   -15.664 1.00 17.12 ? 303  ASP A CA  1 
ATOM   2423 C C   . ASP A  1 304 ? 25.581  1.422   -16.929 1.00 17.89 ? 303  ASP A C   1 
ATOM   2424 O O   . ASP A  1 304 ? 25.326  0.285   -17.321 1.00 18.22 ? 303  ASP A O   1 
ATOM   2425 C CB  . ASP A  1 304 ? 23.863  2.998   -16.075 1.00 16.94 ? 303  ASP A CB  1 
ATOM   2426 C CG  . ASP A  1 304 ? 22.967  3.431   -14.932 1.00 16.91 ? 303  ASP A CG  1 
ATOM   2427 O OD1 . ASP A  1 304 ? 22.926  2.748   -13.864 1.00 15.91 ? 303  ASP A OD1 1 
ATOM   2428 O OD2 . ASP A  1 304 ? 22.267  4.448   -15.033 1.00 17.55 ? 303  ASP A OD2 1 
ATOM   2429 N N   . GLN A  1 305 ? 26.453  2.230   -17.534 1.00 18.77 ? 304  GLN A N   1 
ATOM   2430 C CA  . GLN A  1 305 ? 27.178  1.814   -18.743 1.00 19.57 ? 304  GLN A CA  1 
ATOM   2431 C C   . GLN A  1 305 ? 28.148  0.652   -18.480 1.00 19.51 ? 304  GLN A C   1 
ATOM   2432 O O   . GLN A  1 305 ? 28.287  -0.257  -19.318 1.00 19.38 ? 304  GLN A O   1 
ATOM   2433 C CB  . GLN A  1 305 ? 27.890  3.028   -19.384 1.00 19.72 ? 304  GLN A CB  1 
ATOM   2434 C CG  . GLN A  1 305 ? 26.904  4.070   -19.945 1.00 22.31 ? 304  GLN A CG  1 
ATOM   2435 C CD  . GLN A  1 305 ? 26.074  3.538   -21.116 1.00 26.02 ? 304  GLN A CD  1 
ATOM   2436 O OE1 . GLN A  1 305 ? 24.843  3.534   -21.072 1.00 28.03 ? 304  GLN A OE1 1 
ATOM   2437 N NE2 . GLN A  1 305 ? 26.752  3.082   -22.156 1.00 28.10 ? 304  GLN A NE2 1 
ATOM   2438 N N   . HIS A  1 306 ? 28.793  0.649   -17.308 1.00 18.51 ? 305  HIS A N   1 
ATOM   2439 C CA  . HIS A  1 306 ? 29.657  -0.465  -16.905 1.00 18.58 ? 305  HIS A CA  1 
ATOM   2440 C C   . HIS A  1 306 ? 28.848  -1.758  -16.825 1.00 18.24 ? 305  HIS A C   1 
ATOM   2441 O O   . HIS A  1 306 ? 29.268  -2.800  -17.322 1.00 18.95 ? 305  HIS A O   1 
ATOM   2442 C CB  . HIS A  1 306 ? 30.299  -0.214  -15.538 1.00 18.59 ? 305  HIS A CB  1 
ATOM   2443 C CG  . HIS A  1 306 ? 31.035  -1.404  -14.995 1.00 18.18 ? 305  HIS A CG  1 
ATOM   2444 N ND1 . HIS A  1 306 ? 32.296  -1.759  -15.424 1.00 17.14 ? 305  HIS A ND1 1 
ATOM   2445 C CD2 . HIS A  1 306 ? 30.666  -2.346  -14.092 1.00 17.99 ? 305  HIS A CD2 1 
ATOM   2446 C CE1 . HIS A  1 306 ? 32.681  -2.855  -14.792 1.00 18.42 ? 305  HIS A CE1 1 
ATOM   2447 N NE2 . HIS A  1 306 ? 31.711  -3.229  -13.976 1.00 18.92 ? 305  HIS A NE2 1 
ATOM   2448 N N   . PHE A  1 307 ? 27.686  -1.682  -16.185 1.00 17.38 ? 306  PHE A N   1 
ATOM   2449 C CA  . PHE A  1 307 ? 26.788  -2.840  -16.072 1.00 18.27 ? 306  PHE A CA  1 
ATOM   2450 C C   . PHE A  1 307 ? 26.281  -3.331  -17.433 1.00 19.50 ? 306  PHE A C   1 
ATOM   2451 O O   . PHE A  1 307 ? 26.233  -4.548  -17.687 1.00 20.24 ? 306  PHE A O   1 
ATOM   2452 C CB  . PHE A  1 307 ? 25.611  -2.447  -15.169 1.00 16.96 ? 306  PHE A CB  1 
ATOM   2453 C CG  . PHE A  1 307 ? 24.594  -3.542  -14.942 1.00 17.45 ? 306  PHE A CG  1 
ATOM   2454 C CD1 . PHE A  1 307 ? 24.986  -4.858  -14.658 1.00 17.72 ? 306  PHE A CD1 1 
ATOM   2455 C CD2 . PHE A  1 307 ? 23.235  -3.233  -14.982 1.00 15.26 ? 306  PHE A CD2 1 
ATOM   2456 C CE1 . PHE A  1 307 ? 24.015  -5.861  -14.429 1.00 17.47 ? 306  PHE A CE1 1 
ATOM   2457 C CE2 . PHE A  1 307 ? 22.264  -4.207  -14.742 1.00 15.52 ? 306  PHE A CE2 1 
ATOM   2458 C CZ  . PHE A  1 307 ? 22.653  -5.518  -14.468 1.00 16.31 ? 306  PHE A CZ  1 
ATOM   2459 N N   . LEU A  1 308 ? 25.931  -2.389  -18.297 1.00 20.20 ? 307  LEU A N   1 
ATOM   2460 C CA  . LEU A  1 308 ? 25.353  -2.697  -19.614 1.00 21.54 ? 307  LEU A CA  1 
ATOM   2461 C C   . LEU A  1 308 ? 26.356  -3.348  -20.566 1.00 22.59 ? 307  LEU A C   1 
ATOM   2462 O O   . LEU A  1 308 ? 25.993  -4.251  -21.325 1.00 23.01 ? 307  LEU A O   1 
ATOM   2463 C CB  . LEU A  1 308 ? 24.787  -1.431  -20.248 1.00 21.85 ? 307  LEU A CB  1 
ATOM   2464 C CG  . LEU A  1 308 ? 23.946  -1.533  -21.531 1.00 22.09 ? 307  LEU A CG  1 
ATOM   2465 C CD1 . LEU A  1 308 ? 22.702  -2.404  -21.308 1.00 22.03 ? 307  LEU A CD1 1 
ATOM   2466 C CD2 . LEU A  1 308 ? 23.558  -0.131  -22.022 1.00 23.59 ? 307  LEU A CD2 1 
ATOM   2467 N N   . LYS A  1 309 ? 27.610  -2.912  -20.502 1.00 23.00 ? 308  LYS A N   1 
ATOM   2468 C CA  . LYS A  1 309 ? 28.558  -3.185  -21.594 1.00 24.09 ? 308  LYS A CA  1 
ATOM   2469 C C   . LYS A  1 309 ? 29.684  -4.167  -21.265 1.00 24.12 ? 308  LYS A C   1 
ATOM   2470 O O   . LYS A  1 309 ? 30.416  -4.596  -22.164 1.00 25.48 ? 308  LYS A O   1 
ATOM   2471 C CB  . LYS A  1 309 ? 29.137  -1.861  -22.133 1.00 23.54 ? 308  LYS A CB  1 
ATOM   2472 C CG  . LYS A  1 309 ? 28.107  -0.854  -22.664 1.00 26.66 ? 308  LYS A CG  1 
ATOM   2473 C CD  . LYS A  1 309 ? 27.244  -1.448  -23.792 1.00 29.80 ? 308  LYS A CD  1 
ATOM   2474 C CE  . LYS A  1 309 ? 26.358  -0.411  -24.489 1.00 31.53 ? 308  LYS A CE  1 
ATOM   2475 N NZ  . LYS A  1 309 ? 26.906  0.986   -24.486 1.00 34.72 ? 308  LYS A NZ  1 
ATOM   2476 N N   . THR A  1 310 ? 29.832  -4.535  -19.996 1.00 23.18 ? 309  THR A N   1 
ATOM   2477 C CA  . THR A  1 310 ? 30.939  -5.385  -19.566 1.00 23.07 ? 309  THR A CA  1 
ATOM   2478 C C   . THR A  1 310 ? 30.541  -6.863  -19.541 1.00 23.03 ? 309  THR A C   1 
ATOM   2479 O O   . THR A  1 310 ? 29.443  -7.195  -19.060 1.00 22.72 ? 309  THR A O   1 
ATOM   2480 C CB  . THR A  1 310 ? 31.387  -4.930  -18.165 1.00 22.71 ? 309  THR A CB  1 
ATOM   2481 O OG1 . THR A  1 310 ? 31.712  -3.534  -18.225 1.00 24.29 ? 309  THR A OG1 1 
ATOM   2482 C CG2 . THR A  1 310 ? 32.681  -5.598  -17.728 1.00 22.87 ? 309  THR A CG2 1 
ATOM   2483 N N   . PRO A  1 311 ? 31.412  -7.749  -20.050 1.00 23.17 ? 310  PRO A N   1 
ATOM   2484 C CA  . PRO A  1 311 ? 31.170  -9.193  -19.959 1.00 22.76 ? 310  PRO A CA  1 
ATOM   2485 C C   . PRO A  1 311 ? 30.981  -9.602  -18.497 1.00 22.87 ? 310  PRO A C   1 
ATOM   2486 O O   . PRO A  1 311 ? 31.664  -9.054  -17.636 1.00 21.71 ? 310  PRO A O   1 
ATOM   2487 C CB  . PRO A  1 311 ? 32.471  -9.804  -20.503 1.00 23.58 ? 310  PRO A CB  1 
ATOM   2488 C CG  . PRO A  1 311 ? 33.034  -8.787  -21.386 1.00 22.49 ? 310  PRO A CG  1 
ATOM   2489 C CD  . PRO A  1 311 ? 32.688  -7.453  -20.738 1.00 23.32 ? 310  PRO A CD  1 
ATOM   2490 N N   . LEU A  1 312 ? 30.075  -10.538 -18.242 1.00 22.69 ? 311  LEU A N   1 
ATOM   2491 C CA  . LEU A  1 312 ? 29.674  -10.901 -16.876 1.00 23.19 ? 311  LEU A CA  1 
ATOM   2492 C C   . LEU A  1 312 ? 30.835  -11.210 -15.927 1.00 23.44 ? 311  LEU A C   1 
ATOM   2493 O O   . LEU A  1 312 ? 30.801  -10.814 -14.770 1.00 22.73 ? 311  LEU A O   1 
ATOM   2494 C CB  . LEU A  1 312 ? 28.676  -12.068 -16.903 1.00 23.37 ? 311  LEU A CB  1 
ATOM   2495 C CG  . LEU A  1 312 ? 27.406  -11.905 -17.744 1.00 24.27 ? 311  LEU A CG  1 
ATOM   2496 C CD1 . LEU A  1 312 ? 26.656  -13.208 -17.747 1.00 27.98 ? 311  LEU A CD1 1 
ATOM   2497 C CD2 . LEU A  1 312 ? 26.506  -10.797 -17.192 1.00 25.90 ? 311  LEU A CD2 1 
ATOM   2498 N N   . GLU A  1 313 ? 31.865  -11.913 -16.410 1.00 23.46 ? 312  GLU A N   1 
ATOM   2499 C CA  . GLU A  1 313 ? 32.959  -12.352 -15.548 1.00 24.39 ? 312  GLU A CA  1 
ATOM   2500 C C   . GLU A  1 313 ? 33.829  -11.222 -14.959 1.00 23.60 ? 312  GLU A C   1 
ATOM   2501 O O   . GLU A  1 313 ? 34.573  -11.457 -13.995 1.00 23.47 ? 312  GLU A O   1 
ATOM   2502 C CB  . GLU A  1 313 ? 33.818  -13.407 -16.265 1.00 24.73 ? 312  GLU A CB  1 
ATOM   2503 C CG  . GLU A  1 313 ? 34.675  -12.834 -17.378 1.00 27.10 ? 312  GLU A CG  1 
ATOM   2504 C CD  . GLU A  1 313 ? 33.996  -12.883 -18.737 1.00 29.90 ? 312  GLU A CD  1 
ATOM   2505 O OE1 . GLU A  1 313 ? 32.757  -13.090 -18.816 1.00 28.92 ? 312  GLU A OE1 1 
ATOM   2506 O OE2 . GLU A  1 313 ? 34.721  -12.705 -19.742 1.00 33.48 ? 312  GLU A OE2 1 
ATOM   2507 N N   . LYS A  1 314 ? 33.697  -10.018 -15.524 1.00 23.10 ? 313  LYS A N   1 
ATOM   2508 C CA  . LYS A  1 314 ? 34.427  -8.819  -15.098 1.00 23.02 ? 313  LYS A CA  1 
ATOM   2509 C C   . LYS A  1 314 ? 33.501  -7.640  -14.753 1.00 21.82 ? 313  LYS A C   1 
ATOM   2510 O O   . LYS A  1 314 ? 33.948  -6.493  -14.684 1.00 21.92 ? 313  LYS A O   1 
ATOM   2511 C CB  . LYS A  1 314 ? 35.410  -8.385  -16.189 1.00 23.72 ? 313  LYS A CB  1 
ATOM   2512 C CG  . LYS A  1 314 ? 36.642  -9.257  -16.279 1.00 27.44 ? 313  LYS A CG  1 
ATOM   2513 C CD  . LYS A  1 314 ? 37.489  -8.863  -17.488 1.00 31.50 ? 313  LYS A CD  1 
ATOM   2514 C CE  . LYS A  1 314 ? 38.911  -9.435  -17.399 1.00 33.53 ? 313  LYS A CE  1 
ATOM   2515 N NZ  . LYS A  1 314 ? 38.947  -10.800 -16.806 1.00 35.62 ? 313  LYS A NZ  1 
ATOM   2516 N N   . ASN A  1 315 ? 32.224  -7.941  -14.523 1.00 20.55 ? 314  ASN A N   1 
ATOM   2517 C CA  . ASN A  1 315 ? 31.159  -6.943  -14.332 1.00 19.29 ? 314  ASN A CA  1 
ATOM   2518 C C   . ASN A  1 315 ? 30.862  -6.755  -12.822 1.00 18.79 ? 314  ASN A C   1 
ATOM   2519 O O   . ASN A  1 315 ? 30.368  -7.675  -12.186 1.00 18.94 ? 314  ASN A O   1 
ATOM   2520 C CB  . ASN A  1 315 ? 29.916  -7.460  -15.078 1.00 19.04 ? 314  ASN A CB  1 
ATOM   2521 C CG  . ASN A  1 315 ? 28.811  -6.433  -15.217 1.00 19.90 ? 314  ASN A CG  1 
ATOM   2522 O OD1 . ASN A  1 315 ? 28.414  -5.785  -14.245 1.00 20.74 ? 314  ASN A OD1 1 
ATOM   2523 N ND2 . ASN A  1 315 ? 28.267  -6.306  -16.434 1.00 19.11 ? 314  ASN A ND2 1 
ATOM   2524 N N   . ALA A  1 316 ? 31.139  -5.572  -12.255 1.00 17.55 ? 315  ALA A N   1 
ATOM   2525 C CA  . ALA A  1 316 ? 31.130  -5.431  -10.779 1.00 17.67 ? 315  ALA A CA  1 
ATOM   2526 C C   . ALA A  1 316 ? 29.799  -5.800  -10.091 1.00 16.93 ? 315  ALA A C   1 
ATOM   2527 O O   . ALA A  1 316 ? 29.804  -6.645  -9.174  1.00 16.52 ? 315  ALA A O   1 
ATOM   2528 C CB  . ALA A  1 316 ? 31.606  -4.014  -10.335 1.00 17.91 ? 315  ALA A CB  1 
ATOM   2529 N N   . PRO A  1 317 ? 28.673  -5.188  -10.472 1.00 17.13 ? 316  PRO A N   1 
ATOM   2530 C CA  . PRO A  1 317 ? 27.402  -5.554  -9.819  1.00 17.36 ? 316  PRO A CA  1 
ATOM   2531 C C   . PRO A  1 317 ? 27.017  -7.026  -10.038 1.00 17.15 ? 316  PRO A C   1 
ATOM   2532 O O   . PRO A  1 317 ? 26.442  -7.643  -9.137  1.00 15.72 ? 316  PRO A O   1 
ATOM   2533 C CB  . PRO A  1 317 ? 26.375  -4.598  -10.442 1.00 17.31 ? 316  PRO A CB  1 
ATOM   2534 C CG  . PRO A  1 317 ? 27.014  -4.050  -11.696 1.00 18.66 ? 316  PRO A CG  1 
ATOM   2535 C CD  . PRO A  1 317 ? 28.490  -4.100  -11.454 1.00 17.24 ? 316  PRO A CD  1 
ATOM   2536 N N   . VAL A  1 318 ? 27.349  -7.584  -11.202 1.00 16.61 ? 317  VAL A N   1 
ATOM   2537 C CA  . VAL A  1 318 ? 27.145  -9.025  -11.428 1.00 17.00 ? 317  VAL A CA  1 
ATOM   2538 C C   . VAL A  1 318 ? 27.942  -9.908  -10.435 1.00 17.03 ? 317  VAL A C   1 
ATOM   2539 O O   . VAL A  1 318 ? 27.386  -10.816 -9.805  1.00 16.56 ? 317  VAL A O   1 
ATOM   2540 C CB  . VAL A  1 318 ? 27.437  -9.429  -12.900 1.00 16.63 ? 317  VAL A CB  1 
ATOM   2541 C CG1 . VAL A  1 318 ? 27.316  -10.949 -13.077 1.00 16.66 ? 317  VAL A CG1 1 
ATOM   2542 C CG2 . VAL A  1 318 ? 26.487  -8.692  -13.868 1.00 17.50 ? 317  VAL A CG2 1 
ATOM   2543 N N   . LEU A  1 319 ? 29.236  -9.627  -10.262 1.00 16.90 ? 318  LEU A N   1 
ATOM   2544 C CA  . LEU A  1 319 ? 30.073  -10.423 -9.357  1.00 16.63 ? 318  LEU A CA  1 
ATOM   2545 C C   . LEU A  1 319 ? 29.611  -10.319 -7.904  1.00 15.89 ? 318  LEU A C   1 
ATOM   2546 O O   . LEU A  1 319 ? 29.555  -11.317 -7.184  1.00 16.25 ? 318  LEU A O   1 
ATOM   2547 C CB  . LEU A  1 319 ? 31.560  -10.062 -9.506  1.00 17.38 ? 318  LEU A CB  1 
ATOM   2548 C CG  . LEU A  1 319 ? 32.177  -10.410 -10.874 1.00 19.12 ? 318  LEU A CG  1 
ATOM   2549 C CD1 . LEU A  1 319 ? 33.645  -10.055 -10.889 1.00 22.00 ? 318  LEU A CD1 1 
ATOM   2550 C CD2 . LEU A  1 319 ? 31.991  -11.888 -11.226 1.00 21.37 ? 318  LEU A CD2 1 
ATOM   2551 N N   . LEU A  1 320 ? 29.245  -9.103  -7.491  1.00 14.96 ? 319  LEU A N   1 
ATOM   2552 C CA  . LEU A  1 320 ? 28.708  -8.904  -6.150  1.00 14.11 ? 319  LEU A CA  1 
ATOM   2553 C C   . LEU A  1 320 ? 27.424  -9.704  -5.950  1.00 14.05 ? 319  LEU A C   1 
ATOM   2554 O O   . LEU A  1 320 ? 27.233  -10.310 -4.884  1.00 14.37 ? 319  LEU A O   1 
ATOM   2555 C CB  . LEU A  1 320 ? 28.454  -7.414  -5.878  1.00 14.44 ? 319  LEU A CB  1 
ATOM   2556 C CG  . LEU A  1 320 ? 29.710  -6.534  -5.769  1.00 15.51 ? 319  LEU A CG  1 
ATOM   2557 C CD1 . LEU A  1 320 ? 29.240  -5.088  -5.568  1.00 17.72 ? 319  LEU A CD1 1 
ATOM   2558 C CD2 . LEU A  1 320 ? 30.610  -6.995  -4.636  1.00 15.22 ? 319  LEU A CD2 1 
ATOM   2559 N N   . ALA A  1 321 ? 26.553  -9.693  -6.963  1.00 14.07 ? 320  ALA A N   1 
ATOM   2560 C CA  . ALA A  1 321 ? 25.288  -10.434 -6.900  1.00 13.88 ? 320  ALA A CA  1 
ATOM   2561 C C   . ALA A  1 321 ? 25.551  -11.929 -6.783  1.00 14.94 ? 320  ALA A C   1 
ATOM   2562 O O   . ALA A  1 321 ? 24.934  -12.609 -5.960  1.00 14.72 ? 320  ALA A O   1 
ATOM   2563 C CB  . ALA A  1 321 ? 24.418  -10.120 -8.131  1.00 13.78 ? 320  ALA A CB  1 
ATOM   2564 N N   . LEU A  1 322 ? 26.475  -12.437 -7.602  1.00 14.67 ? 321  LEU A N   1 
ATOM   2565 C CA  . LEU A  1 322 ? 26.808  -13.872 -7.586  1.00 15.24 ? 321  LEU A CA  1 
ATOM   2566 C C   . LEU A  1 322 ? 27.401  -14.353 -6.266  1.00 15.74 ? 321  LEU A C   1 
ATOM   2567 O O   . LEU A  1 322 ? 27.058  -15.443 -5.790  1.00 16.35 ? 321  LEU A O   1 
ATOM   2568 C CB  . LEU A  1 322 ? 27.741  -14.225 -8.753  1.00 15.60 ? 321  LEU A CB  1 
ATOM   2569 C CG  . LEU A  1 322 ? 27.097  -14.098 -10.129 1.00 17.91 ? 321  LEU A CG  1 
ATOM   2570 C CD1 . LEU A  1 322 ? 28.170  -14.305 -11.199 1.00 18.21 ? 321  LEU A CD1 1 
ATOM   2571 C CD2 . LEU A  1 322 ? 25.935  -15.089 -10.330 1.00 18.79 ? 321  LEU A CD2 1 
ATOM   2572 N N   . LEU A  1 323 ? 28.311  -13.566 -5.688  1.00 15.08 ? 322  LEU A N   1 
ATOM   2573 C CA  . LEU A  1 323 ? 28.863  -13.915 -4.386  1.00 14.73 ? 322  LEU A CA  1 
ATOM   2574 C C   . LEU A  1 323 ? 27.738  -14.006 -3.362  1.00 15.09 ? 322  LEU A C   1 
ATOM   2575 O O   . LEU A  1 323 ? 27.738  -14.892 -2.517  1.00 14.92 ? 322  LEU A O   1 
ATOM   2576 C CB  . LEU A  1 323 ? 29.941  -12.901 -3.958  1.00 14.17 ? 322  LEU A CB  1 
ATOM   2577 C CG  . LEU A  1 323 ? 31.214  -12.950 -4.809  1.00 15.19 ? 322  LEU A CG  1 
ATOM   2578 C CD1 . LEU A  1 323 ? 31.992  -11.643 -4.694  1.00 16.45 ? 322  LEU A CD1 1 
ATOM   2579 C CD2 . LEU A  1 323 ? 32.098  -14.136 -4.429  1.00 17.55 ? 322  LEU A CD2 1 
ATOM   2580 N N   . GLY A  1 324 ? 26.762  -13.100 -3.464  1.00 15.39 ? 323  GLY A N   1 
ATOM   2581 C CA  . GLY A  1 324 ? 25.647  -13.106 -2.526  1.00 16.11 ? 323  GLY A CA  1 
ATOM   2582 C C   . GLY A  1 324 ? 24.821  -14.378 -2.670  1.00 16.75 ? 323  GLY A C   1 
ATOM   2583 O O   . GLY A  1 324 ? 24.422  -14.977 -1.680  1.00 17.21 ? 323  GLY A O   1 
ATOM   2584 N N   . ILE A  1 325 ? 24.553  -14.782 -3.907  1.00 17.00 ? 324  ILE A N   1 
ATOM   2585 C CA  . ILE A  1 325 ? 23.784  -16.019 -4.167  1.00 17.83 ? 324  ILE A CA  1 
ATOM   2586 C C   . ILE A  1 325 ? 24.506  -17.238 -3.588  1.00 17.84 ? 324  ILE A C   1 
ATOM   2587 O O   . ILE A  1 325 ? 23.883  -18.134 -3.011  1.00 17.59 ? 324  ILE A O   1 
ATOM   2588 C CB  . ILE A  1 325 ? 23.578  -16.220 -5.703  1.00 18.50 ? 324  ILE A CB  1 
ATOM   2589 C CG1 . ILE A  1 325 ? 22.782  -15.067 -6.327  1.00 20.52 ? 324  ILE A CG1 1 
ATOM   2590 C CG2 . ILE A  1 325 ? 22.938  -17.591 -6.005  1.00 18.74 ? 324  ILE A CG2 1 
ATOM   2591 C CD1 . ILE A  1 325 ? 21.310  -15.094 -6.093  1.00 22.81 ? 324  ILE A CD1 1 
ATOM   2592 N N   . TRP A  1 326 ? 25.830  -17.262 -3.741  1.00 17.27 ? 325  TRP A N   1 
ATOM   2593 C CA  . TRP A  1 326 ? 26.667  -18.328 -3.202  1.00 17.44 ? 325  TRP A CA  1 
ATOM   2594 C C   . TRP A  1 326 ? 26.453  -18.443 -1.687  1.00 17.24 ? 325  TRP A C   1 
ATOM   2595 O O   . TRP A  1 326 ? 26.191  -19.525 -1.174  1.00 17.82 ? 325  TRP A O   1 
ATOM   2596 C CB  . TRP A  1 326 ? 28.133  -18.033 -3.578  1.00 17.31 ? 325  TRP A CB  1 
ATOM   2597 C CG  . TRP A  1 326 ? 29.236  -18.968 -3.072  1.00 18.01 ? 325  TRP A CG  1 
ATOM   2598 C CD1 . TRP A  1 326 ? 30.306  -18.611 -2.309  1.00 17.96 ? 325  TRP A CD1 1 
ATOM   2599 C CD2 . TRP A  1 326 ? 29.412  -20.364 -3.371  1.00 18.69 ? 325  TRP A CD2 1 
ATOM   2600 N NE1 . TRP A  1 326 ? 31.125  -19.695 -2.085  1.00 17.72 ? 325  TRP A NE1 1 
ATOM   2601 C CE2 . TRP A  1 326 ? 30.605  -20.783 -2.736  1.00 19.39 ? 325  TRP A CE2 1 
ATOM   2602 C CE3 . TRP A  1 326 ? 28.683  -21.306 -4.121  1.00 18.97 ? 325  TRP A CE3 1 
ATOM   2603 C CZ2 . TRP A  1 326 ? 31.076  -22.102 -2.800  1.00 21.12 ? 325  TRP A CZ2 1 
ATOM   2604 C CZ3 . TRP A  1 326 ? 29.160  -22.621 -4.193  1.00 20.40 ? 325  TRP A CZ3 1 
ATOM   2605 C CH2 . TRP A  1 326 ? 30.342  -23.000 -3.535  1.00 19.64 ? 325  TRP A CH2 1 
ATOM   2606 N N   . TYR A  1 327 ? 26.494  -17.316 -0.971  1.00 16.81 ? 326  TYR A N   1 
ATOM   2607 C CA  . TYR A  1 327 ? 26.310  -17.348 0.471   1.00 16.82 ? 326  TYR A CA  1 
ATOM   2608 C C   . TYR A  1 327 ? 24.863  -17.588 0.893   1.00 17.14 ? 326  TYR A C   1 
ATOM   2609 O O   . TYR A  1 327 ? 24.624  -18.256 1.899   1.00 18.34 ? 326  TYR A O   1 
ATOM   2610 C CB  . TYR A  1 327 ? 26.863  -16.066 1.127   1.00 16.24 ? 326  TYR A CB  1 
ATOM   2611 C CG  . TYR A  1 327 ? 28.365  -15.925 0.942   1.00 15.84 ? 326  TYR A CG  1 
ATOM   2612 C CD1 . TYR A  1 327 ? 29.223  -16.966 1.299   1.00 15.10 ? 326  TYR A CD1 1 
ATOM   2613 C CD2 . TYR A  1 327 ? 28.923  -14.764 0.397   1.00 16.12 ? 326  TYR A CD2 1 
ATOM   2614 C CE1 . TYR A  1 327 ? 30.603  -16.868 1.104   1.00 16.21 ? 326  TYR A CE1 1 
ATOM   2615 C CE2 . TYR A  1 327 ? 30.297  -14.648 0.202   1.00 15.26 ? 326  TYR A CE2 1 
ATOM   2616 C CZ  . TYR A  1 327 ? 31.135  -15.703 0.566   1.00 16.75 ? 326  TYR A CZ  1 
ATOM   2617 O OH  . TYR A  1 327 ? 32.503  -15.629 0.397   1.00 16.56 ? 326  TYR A OH  1 
ATOM   2618 N N   . ILE A  1 328 ? 23.910  -17.058 0.134   1.00 16.37 ? 327  ILE A N   1 
ATOM   2619 C CA  . ILE A  1 328 ? 22.501  -17.173 0.509   1.00 17.25 ? 327  ILE A CA  1 
ATOM   2620 C C   . ILE A  1 328 ? 21.963  -18.573 0.221   1.00 18.10 ? 327  ILE A C   1 
ATOM   2621 O O   . ILE A  1 328 ? 21.381  -19.213 1.098   1.00 18.95 ? 327  ILE A O   1 
ATOM   2622 C CB  . ILE A  1 328 ? 21.653  -16.097 -0.204  1.00 16.48 ? 327  ILE A CB  1 
ATOM   2623 C CG1 . ILE A  1 328 ? 21.932  -14.711 0.402   1.00 16.58 ? 327  ILE A CG1 1 
ATOM   2624 C CG2 . ILE A  1 328 ? 20.154  -16.416 -0.118  1.00 17.20 ? 327  ILE A CG2 1 
ATOM   2625 C CD1 . ILE A  1 328 ? 21.457  -13.556 -0.491  1.00 16.60 ? 327  ILE A CD1 1 
ATOM   2626 N N   . ASN A  1 329 ? 22.154  -19.019 -1.012  1.00 18.22 ? 328  ASN A N   1 
ATOM   2627 C CA  . ASN A  1 329 ? 21.530  -20.256 -1.470  1.00 18.52 ? 328  ASN A CA  1 
ATOM   2628 C C   . ASN A  1 329 ? 22.374  -21.507 -1.293  1.00 19.72 ? 328  ASN A C   1 
ATOM   2629 O O   . ASN A  1 329 ? 21.837  -22.617 -1.316  1.00 19.92 ? 328  ASN A O   1 
ATOM   2630 C CB  . ASN A  1 329 ? 21.113  -20.106 -2.923  1.00 18.72 ? 328  ASN A CB  1 
ATOM   2631 C CG  . ASN A  1 329 ? 20.054  -19.031 -3.116  1.00 18.40 ? 328  ASN A CG  1 
ATOM   2632 O OD1 . ASN A  1 329 ? 20.273  -18.071 -3.848  1.00 18.92 ? 328  ASN A OD1 1 
ATOM   2633 N ND2 . ASN A  1 329 ? 18.874  -19.224 -2.513  1.00 18.26 ? 328  ASN A ND2 1 
ATOM   2634 N N   . CYS A  1 330 ? 23.684  -21.350 -1.145  1.00 20.11 ? 329  CYS A N   1 
ATOM   2635 C CA  . CYS A  1 330 ? 24.523  -22.520 -0.866  1.00 20.99 ? 329  CYS A CA  1 
ATOM   2636 C C   . CYS A  1 330 ? 24.922  -22.615 0.614   1.00 21.07 ? 329  CYS A C   1 
ATOM   2637 O O   . CYS A  1 330 ? 24.794  -23.678 1.213   1.00 22.58 ? 329  CYS A O   1 
ATOM   2638 C CB  . CYS A  1 330 ? 25.723  -22.604 -1.816  1.00 21.15 ? 329  CYS A CB  1 
ATOM   2639 S SG  . CYS A  1 330 ? 25.214  -22.745 -3.545  1.00 25.65 ? 329  CYS A SG  1 
ATOM   2640 N N   . TYR A  1 331 ? 25.362  -21.512 1.221   1.00 20.82 ? 330  TYR A N   1 
ATOM   2641 C CA  . TYR A  1 331 ? 25.732  -21.521 2.645   1.00 21.34 ? 330  TYR A CA  1 
ATOM   2642 C C   . TYR A  1 331 ? 24.544  -21.262 3.597   1.00 21.99 ? 330  TYR A C   1 
ATOM   2643 O O   . TYR A  1 331 ? 24.613  -21.604 4.780   1.00 23.50 ? 330  TYR A O   1 
ATOM   2644 C CB  . TYR A  1 331 ? 26.848  -20.508 2.931   1.00 21.16 ? 330  TYR A CB  1 
ATOM   2645 C CG  . TYR A  1 331 ? 28.240  -20.953 2.538   1.00 20.68 ? 330  TYR A CG  1 
ATOM   2646 C CD1 . TYR A  1 331 ? 29.036  -21.670 3.428   1.00 19.57 ? 330  TYR A CD1 1 
ATOM   2647 C CD2 . TYR A  1 331 ? 28.768  -20.629 1.280   1.00 20.65 ? 330  TYR A CD2 1 
ATOM   2648 C CE1 . TYR A  1 331 ? 30.325  -22.067 3.083   1.00 20.04 ? 330  TYR A CE1 1 
ATOM   2649 C CE2 . TYR A  1 331 ? 30.046  -21.022 0.923   1.00 20.01 ? 330  TYR A CE2 1 
ATOM   2650 C CZ  . TYR A  1 331 ? 30.819  -21.744 1.826   1.00 20.85 ? 330  TYR A CZ  1 
ATOM   2651 O OH  . TYR A  1 331 ? 32.092  -22.134 1.487   1.00 22.86 ? 330  TYR A OH  1 
ATOM   2652 N N   . GLY A  1 332 ? 23.475  -20.645 3.096   1.00 21.53 ? 331  GLY A N   1 
ATOM   2653 C CA  . GLY A  1 332 ? 22.305  -20.369 3.924   1.00 20.94 ? 331  GLY A CA  1 
ATOM   2654 C C   . GLY A  1 332 ? 22.434  -19.188 4.882   1.00 20.15 ? 331  GLY A C   1 
ATOM   2655 O O   . GLY A  1 332 ? 21.758  -19.148 5.904   1.00 20.88 ? 331  GLY A O   1 
ATOM   2656 N N   . CYS A  1 333 ? 23.298  -18.226 4.575   1.00 19.23 ? 332  CYS A N   1 
ATOM   2657 C CA  . CYS A  1 333 ? 23.463  -17.046 5.441   1.00 18.13 ? 332  CYS A CA  1 
ATOM   2658 C C   . CYS A  1 333 ? 22.255  -16.117 5.321   1.00 17.25 ? 332  CYS A C   1 
ATOM   2659 O O   . CYS A  1 333 ? 21.902  -15.712 4.210   1.00 17.58 ? 332  CYS A O   1 
ATOM   2660 C CB  . CYS A  1 333 ? 24.715  -16.246 5.047   1.00 17.53 ? 332  CYS A CB  1 
ATOM   2661 S SG  . CYS A  1 333 ? 26.272  -17.173 5.082   1.00 20.41 ? 332  CYS A SG  1 
ATOM   2662 N N   . GLU A  1 334 ? 21.644  -15.765 6.452   1.00 15.92 ? 333  GLU A N   1 
ATOM   2663 C CA  . GLU A  1 334 ? 20.450  -14.920 6.458   1.00 15.33 ? 333  GLU A CA  1 
ATOM   2664 C C   . GLU A  1 334 ? 20.735  -13.453 6.146   1.00 14.96 ? 333  GLU A C   1 
ATOM   2665 O O   . GLU A  1 334 ? 19.841  -12.739 5.709   1.00 14.55 ? 333  GLU A O   1 
ATOM   2666 C CB  . GLU A  1 334 ? 19.735  -14.978 7.817   1.00 15.99 ? 333  GLU A CB  1 
ATOM   2667 C CG  . GLU A  1 334 ? 18.889  -16.228 8.056   1.00 16.95 ? 333  GLU A CG  1 
ATOM   2668 C CD  . GLU A  1 334 ? 17.976  -16.061 9.256   1.00 19.74 ? 333  GLU A CD  1 
ATOM   2669 O OE1 . GLU A  1 334 ? 17.570  -14.917 9.542   1.00 21.52 ? 333  GLU A OE1 1 
ATOM   2670 O OE2 . GLU A  1 334 ? 17.669  -17.068 9.926   1.00 20.20 ? 333  GLU A OE2 1 
ATOM   2671 N N   . THR A  1 335 ? 21.951  -12.998 6.442   1.00 15.16 ? 334  THR A N   1 
ATOM   2672 C CA  . THR A  1 335 ? 22.213  -11.550 6.471   1.00 14.86 ? 334  THR A CA  1 
ATOM   2673 C C   . THR A  1 335 ? 23.395  -11.097 5.626   1.00 15.68 ? 334  THR A C   1 
ATOM   2674 O O   . THR A  1 335 ? 24.226  -11.912 5.186   1.00 14.93 ? 334  THR A O   1 
ATOM   2675 C CB  . THR A  1 335 ? 22.392  -11.017 7.945   1.00 14.00 ? 334  THR A CB  1 
ATOM   2676 O OG1 . THR A  1 335 ? 23.737  -11.230 8.402   1.00 15.39 ? 334  THR A OG1 1 
ATOM   2677 C CG2 . THR A  1 335 ? 21.479  -11.724 8.934   1.00 16.50 ? 334  THR A CG2 1 
ATOM   2678 N N   . HIS A  1 336 ? 23.452  -9.789  5.385   1.00 14.92 ? 335  HIS A N   1 
ATOM   2679 C CA  . HIS A  1 336 ? 24.535  -9.190  4.651   1.00 15.55 ? 335  HIS A CA  1 
ATOM   2680 C C   . HIS A  1 336 ? 24.837  -7.864  5.355   1.00 14.91 ? 335  HIS A C   1 
ATOM   2681 O O   . HIS A  1 336 ? 23.939  -7.030  5.468   1.00 14.96 ? 335  HIS A O   1 
ATOM   2682 C CB  . HIS A  1 336 ? 24.098  -8.920  3.203   1.00 15.95 ? 335  HIS A CB  1 
ATOM   2683 C CG  . HIS A  1 336 ? 25.185  -8.323  2.368   1.00 17.61 ? 335  HIS A CG  1 
ATOM   2684 N ND1 . HIS A  1 336 ? 26.130  -9.090  1.719   1.00 20.44 ? 335  HIS A ND1 1 
ATOM   2685 C CD2 . HIS A  1 336 ? 25.514  -7.035  2.127   1.00 18.59 ? 335  HIS A CD2 1 
ATOM   2686 C CE1 . HIS A  1 336 ? 26.994  -8.296  1.111   1.00 21.19 ? 335  HIS A CE1 1 
ATOM   2687 N NE2 . HIS A  1 336 ? 26.647  -7.045  1.349   1.00 20.33 ? 335  HIS A NE2 1 
ATOM   2688 N N   . ALA A  1 337 ? 26.067  -7.682  5.831   1.00 14.52 ? 336  ALA A N   1 
ATOM   2689 C CA  . ALA A  1 337 ? 26.420  -6.442  6.535   1.00 14.57 ? 336  ALA A CA  1 
ATOM   2690 C C   . ALA A  1 337 ? 27.118  -5.439  5.616   1.00 13.98 ? 336  ALA A C   1 
ATOM   2691 O O   . ALA A  1 337 ? 28.023  -5.794  4.856   1.00 14.30 ? 336  ALA A O   1 
ATOM   2692 C CB  . ALA A  1 337 ? 27.304  -6.752  7.745   1.00 14.05 ? 336  ALA A CB  1 
ATOM   2693 N N   . LEU A  1 338 ? 26.683  -4.182  5.703   1.00 13.10 ? 337  LEU A N   1 
ATOM   2694 C CA  . LEU A  1 338 ? 27.303  -3.067  5.006   1.00 13.34 ? 337  LEU A CA  1 
ATOM   2695 C C   . LEU A  1 338 ? 28.011  -2.198  6.027   1.00 13.93 ? 337  LEU A C   1 
ATOM   2696 O O   . LEU A  1 338 ? 27.364  -1.595  6.894   1.00 14.66 ? 337  LEU A O   1 
ATOM   2697 C CB  . LEU A  1 338 ? 26.224  -2.241  4.322   1.00 14.31 ? 337  LEU A CB  1 
ATOM   2698 C CG  . LEU A  1 338 ? 25.921  -2.434  2.836   1.00 19.05 ? 337  LEU A CG  1 
ATOM   2699 C CD1 . LEU A  1 338 ? 26.408  -3.692  2.135   1.00 18.41 ? 337  LEU A CD1 1 
ATOM   2700 C CD2 . LEU A  1 338 ? 24.474  -2.041  2.526   1.00 15.84 ? 337  LEU A CD2 1 
ATOM   2701 N N   . LEU A  1 339 ? 29.335  -2.133  5.914   1.00 13.51 ? 338  LEU A N   1 
ATOM   2702 C CA  . LEU A  1 339 ? 30.175  -1.501  6.942   1.00 13.11 ? 338  LEU A CA  1 
ATOM   2703 C C   . LEU A  1 339 ? 31.085  -0.408  6.333   1.00 13.45 ? 338  LEU A C   1 
ATOM   2704 O O   . LEU A  1 339 ? 32.289  -0.636  6.122   1.00 14.13 ? 338  LEU A O   1 
ATOM   2705 C CB  . LEU A  1 339 ? 31.028  -2.570  7.672   1.00 13.02 ? 338  LEU A CB  1 
ATOM   2706 C CG  . LEU A  1 339 ? 30.243  -3.754  8.276   1.00 12.73 ? 338  LEU A CG  1 
ATOM   2707 C CD1 . LEU A  1 339 ? 31.178  -4.874  8.744   1.00 13.78 ? 338  LEU A CD1 1 
ATOM   2708 C CD2 . LEU A  1 339 ? 29.372  -3.280  9.436   1.00 15.84 ? 338  LEU A CD2 1 
ATOM   2709 N N   . PRO A  1 340 ? 30.539  0.784   6.071   1.00 13.44 ? 339  PRO A N   1 
ATOM   2710 C CA  . PRO A  1 340 ? 31.335  1.891   5.508   1.00 13.20 ? 339  PRO A CA  1 
ATOM   2711 C C   . PRO A  1 340 ? 32.205  2.539   6.589   1.00 13.57 ? 339  PRO A C   1 
ATOM   2712 O O   . PRO A  1 340 ? 31.692  2.960   7.630   1.00 13.71 ? 339  PRO A O   1 
ATOM   2713 C CB  . PRO A  1 340 ? 30.270  2.886   5.014   1.00 14.95 ? 339  PRO A CB  1 
ATOM   2714 C CG  . PRO A  1 340 ? 29.069  2.621   5.868   1.00 15.10 ? 339  PRO A CG  1 
ATOM   2715 C CD  . PRO A  1 340 ? 29.129  1.163   6.282   1.00 13.96 ? 339  PRO A CD  1 
ATOM   2716 N N   . TYR A  1 341 ? 33.504  2.608   6.340   1.00 13.37 ? 340  TYR A N   1 
ATOM   2717 C CA  . TYR A  1 341 ? 34.422  3.294   7.243   1.00 13.27 ? 340  TYR A CA  1 
ATOM   2718 C C   . TYR A  1 341 ? 34.422  4.799   6.935   1.00 13.57 ? 340  TYR A C   1 
ATOM   2719 O O   . TYR A  1 341 ? 35.434  5.405   6.513   1.00 13.79 ? 340  TYR A O   1 
ATOM   2720 C CB  . TYR A  1 341 ? 35.831  2.636   7.213   1.00 13.15 ? 340  TYR A CB  1 
ATOM   2721 C CG  . TYR A  1 341 ? 35.887  1.425   8.134   1.00 13.21 ? 340  TYR A CG  1 
ATOM   2722 C CD1 . TYR A  1 341 ? 35.012  0.346   7.958   1.00 12.88 ? 340  TYR A CD1 1 
ATOM   2723 C CD2 . TYR A  1 341 ? 36.801  1.357   9.208   1.00 12.70 ? 340  TYR A CD2 1 
ATOM   2724 C CE1 . TYR A  1 341 ? 35.023  -0.745  8.832   1.00 12.89 ? 340  TYR A CE1 1 
ATOM   2725 C CE2 . TYR A  1 341 ? 36.832  0.252   10.074  1.00 14.84 ? 340  TYR A CE2 1 
ATOM   2726 C CZ  . TYR A  1 341 ? 35.938  -0.794  9.882   1.00 13.56 ? 340  TYR A CZ  1 
ATOM   2727 O OH  . TYR A  1 341 ? 35.958  -1.877  10.730  1.00 14.69 ? 340  TYR A OH  1 
ATOM   2728 N N   . ASP A  1 342 ? 33.270  5.417   7.199   1.00 13.39 ? 341  ASP A N   1 
ATOM   2729 C CA  . ASP A  1 342 ? 33.051  6.805   6.828   1.00 13.90 ? 341  ASP A CA  1 
ATOM   2730 C C   . ASP A  1 342 ? 31.825  7.289   7.572   1.00 14.66 ? 341  ASP A C   1 
ATOM   2731 O O   . ASP A  1 342 ? 30.712  6.787   7.346   1.00 14.94 ? 341  ASP A O   1 
ATOM   2732 C CB  . ASP A  1 342 ? 32.878  6.939   5.299   1.00 14.19 ? 341  ASP A CB  1 
ATOM   2733 C CG  . ASP A  1 342 ? 32.751  8.359   4.866   1.00 16.32 ? 341  ASP A CG  1 
ATOM   2734 O OD1 . ASP A  1 342 ? 33.767  9.003   4.493   1.00 17.17 ? 341  ASP A OD1 1 
ATOM   2735 O OD2 . ASP A  1 342 ? 31.658  8.935   4.899   1.00 17.93 ? 341  ASP A OD2 1 
ATOM   2736 N N   . GLN A  1 343 ? 32.039  8.237   8.486   1.00 14.25 ? 342  GLN A N   1 
ATOM   2737 C CA  . GLN A  1 343 ? 30.956  8.805   9.299   1.00 14.13 ? 342  GLN A CA  1 
ATOM   2738 C C   . GLN A  1 343 ? 29.890  9.526   8.448   1.00 14.22 ? 342  GLN A C   1 
ATOM   2739 O O   . GLN A  1 343 ? 28.698  9.478   8.776   1.00 14.17 ? 342  GLN A O   1 
ATOM   2740 C CB  . GLN A  1 343 ? 31.545  9.718   10.404  1.00 16.07 ? 342  GLN A CB  1 
ATOM   2741 C CG  . GLN A  1 343 ? 30.554  10.170  11.472  1.00 16.77 ? 342  GLN A CG  1 
ATOM   2742 C CD  . GLN A  1 343 ? 29.990  9.038   12.296  1.00 19.40 ? 342  GLN A CD  1 
ATOM   2743 O OE1 . GLN A  1 343 ? 30.667  8.039   12.563  1.00 18.54 ? 342  GLN A OE1 1 
ATOM   2744 N NE2 . GLN A  1 343 ? 28.721  9.166   12.671  1.00 21.91 ? 342  GLN A NE2 1 
ATOM   2745 N N   . TYR A  1 344 ? 30.297  10.162  7.347   1.00 13.92 ? 343  TYR A N   1 
ATOM   2746 C CA  . TYR A  1 344 ? 29.331  10.805  6.471   1.00 14.04 ? 343  TYR A CA  1 
ATOM   2747 C C   . TYR A  1 344 ? 28.387  9.750   5.861   1.00 13.72 ? 343  TYR A C   1 
ATOM   2748 O O   . TYR A  1 344 ? 27.232  10.056  5.574   1.00 13.35 ? 343  TYR A O   1 
ATOM   2749 C CB  . TYR A  1 344 ? 30.028  11.626  5.380   1.00 13.89 ? 343  TYR A CB  1 
ATOM   2750 C CG  . TYR A  1 344 ? 30.540  12.995  5.791   1.00 14.55 ? 343  TYR A CG  1 
ATOM   2751 C CD1 . TYR A  1 344 ? 31.828  13.408  5.438   1.00 14.21 ? 343  TYR A CD1 1 
ATOM   2752 C CD2 . TYR A  1 344 ? 29.734  13.885  6.497   1.00 15.91 ? 343  TYR A CD2 1 
ATOM   2753 C CE1 . TYR A  1 344 ? 32.303  14.697  5.771   1.00 14.42 ? 343  TYR A CE1 1 
ATOM   2754 C CE2 . TYR A  1 344 ? 30.203  15.154  6.856   1.00 14.85 ? 343  TYR A CE2 1 
ATOM   2755 C CZ  . TYR A  1 344 ? 31.470  15.554  6.480   1.00 15.41 ? 343  TYR A CZ  1 
ATOM   2756 O OH  . TYR A  1 344 ? 31.906  16.810  6.853   1.00 16.67 ? 343  TYR A OH  1 
ATOM   2757 N N   . MET A  1 345 ? 28.876  8.515   5.712   1.00 13.46 ? 344  MET A N   1 
ATOM   2758 C CA  . MET A  1 345 ? 28.051  7.427   5.153   1.00 13.65 ? 344  MET A CA  1 
ATOM   2759 C C   . MET A  1 345 ? 27.217  6.700   6.217   1.00 14.00 ? 344  MET A C   1 
ATOM   2760 O O   . MET A  1 345 ? 26.789  5.551   5.991   1.00 13.67 ? 344  MET A O   1 
ATOM   2761 C CB  . MET A  1 345 ? 28.915  6.419   4.359   1.00 14.03 ? 344  MET A CB  1 
ATOM   2762 C CG  . MET A  1 345 ? 29.561  6.980   3.081   1.00 13.97 ? 344  MET A CG  1 
ATOM   2763 S SD  . MET A  1 345 ? 30.638  5.762   2.246   1.00 16.77 ? 344  MET A SD  1 
ATOM   2764 C CE  . MET A  1 345 ? 29.377  4.685   1.526   1.00 15.81 ? 344  MET A CE  1 
ATOM   2765 N N   . HIS A  1 346 ? 26.952  7.366   7.354   1.00 13.37 ? 345  HIS A N   1 
ATOM   2766 C CA  . HIS A  1 346 ? 26.268  6.695   8.470   1.00 13.89 ? 345  HIS A CA  1 
ATOM   2767 C C   . HIS A  1 346 ? 24.843  6.191   8.181   1.00 14.26 ? 345  HIS A C   1 
ATOM   2768 O O   . HIS A  1 346 ? 24.353  5.346   8.924   1.00 15.13 ? 345  HIS A O   1 
ATOM   2769 C CB  . HIS A  1 346 ? 26.305  7.546   9.751   1.00 13.64 ? 345  HIS A CB  1 
ATOM   2770 C CG  . HIS A  1 346 ? 25.458  8.775   9.699   1.00 14.87 ? 345  HIS A CG  1 
ATOM   2771 N ND1 . HIS A  1 346 ? 24.360  8.957   10.521  1.00 17.51 ? 345  HIS A ND1 1 
ATOM   2772 C CD2 . HIS A  1 346 ? 25.548  9.890   8.936   1.00 15.65 ? 345  HIS A CD2 1 
ATOM   2773 C CE1 . HIS A  1 346 ? 23.816  10.136  10.265  1.00 16.15 ? 345  HIS A CE1 1 
ATOM   2774 N NE2 . HIS A  1 346 ? 24.511  10.719  9.304   1.00 15.56 ? 345  HIS A NE2 1 
ATOM   2775 N N   . ARG A  1 347 ? 24.202  6.672   7.104   1.00 12.96 ? 346  ARG A N   1 
ATOM   2776 C CA  . ARG A  1 347 ? 22.857  6.217   6.756   1.00 13.39 ? 346  ARG A CA  1 
ATOM   2777 C C   . ARG A  1 347 ? 22.845  5.359   5.492   1.00 13.59 ? 346  ARG A C   1 
ATOM   2778 O O   . ARG A  1 347 ? 21.779  5.064   4.974   1.00 13.95 ? 346  ARG A O   1 
ATOM   2779 C CB  . ARG A  1 347 ? 21.898  7.405   6.618   1.00 13.49 ? 346  ARG A CB  1 
ATOM   2780 C CG  . ARG A  1 347 ? 21.712  8.185   7.929   1.00 14.80 ? 346  ARG A CG  1 
ATOM   2781 C CD  . ARG A  1 347 ? 21.533  7.294   9.175   1.00 18.56 ? 346  ARG A CD  1 
ATOM   2782 N NE  . ARG A  1 347 ? 20.191  6.703   9.215   1.00 18.57 ? 346  ARG A NE  1 
ATOM   2783 C CZ  . ARG A  1 347 ? 19.840  5.634   9.942   1.00 20.30 ? 346  ARG A CZ  1 
ATOM   2784 N NH1 . ARG A  1 347 ? 20.724  4.985   10.690  1.00 21.98 ? 346  ARG A NH1 1 
ATOM   2785 N NH2 . ARG A  1 347 ? 18.592  5.204   9.904   1.00 19.47 ? 346  ARG A NH2 1 
ATOM   2786 N N   . PHE A  1 348 ? 24.020  4.948   5.030   1.00 13.46 ? 347  PHE A N   1 
ATOM   2787 C CA  . PHE A  1 348 ? 24.129  4.121   3.807   1.00 14.54 ? 347  PHE A CA  1 
ATOM   2788 C C   . PHE A  1 348 ? 23.476  2.748   3.998   1.00 14.25 ? 347  PHE A C   1 
ATOM   2789 O O   . PHE A  1 348 ? 22.708  2.279   3.141   1.00 13.89 ? 347  PHE A O   1 
ATOM   2790 C CB  . PHE A  1 348 ? 25.603  3.981   3.436   1.00 14.35 ? 347  PHE A CB  1 
ATOM   2791 C CG  . PHE A  1 348 ? 25.862  3.368   2.080   1.00 15.15 ? 347  PHE A CG  1 
ATOM   2792 C CD1 . PHE A  1 348 ? 25.766  4.136   0.922   1.00 15.30 ? 347  PHE A CD1 1 
ATOM   2793 C CD2 . PHE A  1 348 ? 26.272  2.034   1.983   1.00 17.27 ? 347  PHE A CD2 1 
ATOM   2794 C CE1 . PHE A  1 348 ? 26.055  3.585   -0.339  1.00 17.30 ? 347  PHE A CE1 1 
ATOM   2795 C CE2 . PHE A  1 348 ? 26.564  1.465   0.725   1.00 17.75 ? 347  PHE A CE2 1 
ATOM   2796 C CZ  . PHE A  1 348 ? 26.450  2.236   -0.427  1.00 18.73 ? 347  PHE A CZ  1 
ATOM   2797 N N   . ALA A  1 349 ? 23.760  2.094   5.123   1.00 14.06 ? 348  ALA A N   1 
ATOM   2798 C CA  . ALA A  1 349 ? 23.158  0.775   5.384   1.00 14.74 ? 348  ALA A CA  1 
ATOM   2799 C C   . ALA A  1 349 ? 21.633  0.855   5.510   1.00 14.29 ? 348  ALA A C   1 
ATOM   2800 O O   . ALA A  1 349 ? 20.900  0.012   4.951   1.00 15.55 ? 348  ALA A O   1 
ATOM   2801 C CB  . ALA A  1 349 ? 23.790  0.130   6.642   1.00 15.50 ? 348  ALA A CB  1 
ATOM   2802 N N   . ALA A  1 350 ? 21.126  1.867   6.224   1.00 13.75 ? 349  ALA A N   1 
ATOM   2803 C CA  . ALA A  1 350 ? 19.677  2.075   6.326   1.00 13.60 ? 349  ALA A CA  1 
ATOM   2804 C C   . ALA A  1 350 ? 19.000  2.270   4.959   1.00 13.40 ? 349  ALA A C   1 
ATOM   2805 O O   . ALA A  1 350 ? 17.894  1.794   4.749   1.00 13.35 ? 349  ALA A O   1 
ATOM   2806 C CB  . ALA A  1 350 ? 19.351  3.248   7.275   1.00 14.35 ? 349  ALA A CB  1 
ATOM   2807 N N   . TYR A  1 351 ? 19.663  2.986   4.054   1.00 13.02 ? 350  TYR A N   1 
ATOM   2808 C CA  . TYR A  1 351 ? 19.147  3.177   2.705   1.00 13.47 ? 350  TYR A CA  1 
ATOM   2809 C C   . TYR A  1 351 ? 19.004  1.825   1.997   1.00 13.79 ? 350  TYR A C   1 
ATOM   2810 O O   . TYR A  1 351 ? 17.961  1.557   1.371   1.00 13.36 ? 350  TYR A O   1 
ATOM   2811 C CB  . TYR A  1 351 ? 20.055  4.125   1.909   1.00 13.36 ? 350  TYR A CB  1 
ATOM   2812 C CG  . TYR A  1 351 ? 19.596  4.295   0.480   1.00 12.61 ? 350  TYR A CG  1 
ATOM   2813 C CD1 . TYR A  1 351 ? 18.562  5.187   0.176   1.00 13.70 ? 350  TYR A CD1 1 
ATOM   2814 C CD2 . TYR A  1 351 ? 20.157  3.541   -0.553  1.00 13.48 ? 350  TYR A CD2 1 
ATOM   2815 C CE1 . TYR A  1 351 ? 18.114  5.354   -1.146  1.00 13.84 ? 350  TYR A CE1 1 
ATOM   2816 C CE2 . TYR A  1 351 ? 19.704  3.699   -1.884  1.00 13.35 ? 350  TYR A CE2 1 
ATOM   2817 C CZ  . TYR A  1 351 ? 18.692  4.613   -2.155  1.00 15.03 ? 350  TYR A CZ  1 
ATOM   2818 O OH  . TYR A  1 351 ? 18.228  4.788   -3.438  1.00 14.97 ? 350  TYR A OH  1 
ATOM   2819 N N   . PHE A  1 352 ? 20.043  0.986   2.091   1.00 13.53 ? 351  PHE A N   1 
ATOM   2820 C CA  . PHE A  1 352 ? 20.006  -0.314  1.414   1.00 15.12 ? 351  PHE A CA  1 
ATOM   2821 C C   . PHE A  1 352 ? 19.160  -1.367  2.122   1.00 15.94 ? 351  PHE A C   1 
ATOM   2822 O O   . PHE A  1 352 ? 18.766  -2.369  1.513   1.00 15.40 ? 351  PHE A O   1 
ATOM   2823 C CB  . PHE A  1 352 ? 21.396  -0.769  0.952   1.00 14.51 ? 351  PHE A CB  1 
ATOM   2824 C CG  . PHE A  1 352 ? 21.790  -0.127  -0.339  1.00 14.83 ? 351  PHE A CG  1 
ATOM   2825 C CD1 . PHE A  1 352 ? 22.799  0.840   -0.394  1.00 15.83 ? 351  PHE A CD1 1 
ATOM   2826 C CD2 . PHE A  1 352 ? 21.059  -0.407  -1.480  1.00 15.21 ? 351  PHE A CD2 1 
ATOM   2827 C CE1 . PHE A  1 352 ? 23.100  1.466   -1.596  1.00 15.45 ? 351  PHE A CE1 1 
ATOM   2828 C CE2 . PHE A  1 352 ? 21.341  0.218   -2.689  1.00 15.24 ? 351  PHE A CE2 1 
ATOM   2829 C CZ  . PHE A  1 352 ? 22.369  1.156   -2.742  1.00 14.94 ? 351  PHE A CZ  1 
ATOM   2830 N N   . GLN A  1 353 ? 18.780  -1.119  3.372   1.00 16.61 ? 352  GLN A N   1 
ATOM   2831 C CA  . GLN A  1 353 ? 17.672  -1.897  3.935   1.00 17.01 ? 352  GLN A CA  1 
ATOM   2832 C C   . GLN A  1 353 ? 16.419  -1.807  3.072   1.00 17.77 ? 352  GLN A C   1 
ATOM   2833 O O   . GLN A  1 353 ? 15.837  -2.853  2.761   1.00 18.22 ? 352  GLN A O   1 
ATOM   2834 C CB  . GLN A  1 353 ? 17.350  -1.515  5.378   1.00 17.93 ? 352  GLN A CB  1 
ATOM   2835 C CG  . GLN A  1 353 ? 18.363  -2.079  6.336   1.00 17.44 ? 352  GLN A CG  1 
ATOM   2836 C CD  . GLN A  1 353 ? 18.048  -1.752  7.768   1.00 16.53 ? 352  GLN A CD  1 
ATOM   2837 O OE1 . GLN A  1 353 ? 17.466  -0.705  8.063   1.00 17.43 ? 352  GLN A OE1 1 
ATOM   2838 N NE2 . GLN A  1 353 ? 18.473  -2.619  8.671   1.00 14.78 ? 352  GLN A NE2 1 
ATOM   2839 N N   . GLN A  1 354 ? 15.983  -0.603  2.673   1.00 16.40 ? 353  GLN A N   1 
ATOM   2840 C CA  . GLN A  1 354 ? 14.853  -0.508  1.751   1.00 16.32 ? 353  GLN A CA  1 
ATOM   2841 C C   . GLN A  1 354 ? 15.233  -1.022  0.378   1.00 15.86 ? 353  GLN A C   1 
ATOM   2842 O O   . GLN A  1 354 ? 14.530  -1.843  -0.207  1.00 15.19 ? 353  GLN A O   1 
ATOM   2843 C CB  . GLN A  1 354 ? 14.236  0.907   1.626   1.00 15.63 ? 353  GLN A CB  1 
ATOM   2844 C CG  . GLN A  1 354 ? 12.946  0.857   0.781   1.00 17.97 ? 353  GLN A CG  1 
ATOM   2845 C CD  . GLN A  1 354 ? 12.218  2.175   0.616   1.00 16.93 ? 353  GLN A CD  1 
ATOM   2846 O OE1 . GLN A  1 354 ? 11.060  2.182   0.209   1.00 21.48 ? 353  GLN A OE1 1 
ATOM   2847 N NE2 . GLN A  1 354 ? 12.886  3.279   0.903   1.00 17.57 ? 353  GLN A NE2 1 
ATOM   2848 N N   . GLY A  1 355 ? 16.358  -0.547  -0.145  1.00 15.47 ? 354  GLY A N   1 
ATOM   2849 C CA  . GLY A  1 355 ? 16.693  -0.860  -1.529  1.00 14.79 ? 354  GLY A CA  1 
ATOM   2850 C C   . GLY A  1 355 ? 16.775  -2.359  -1.789  1.00 14.98 ? 354  GLY A C   1 
ATOM   2851 O O   . GLY A  1 355 ? 16.269  -2.835  -2.821  1.00 15.28 ? 354  GLY A O   1 
ATOM   2852 N N   . ASP A  1 356 ? 17.438  -3.077  -0.885  1.00 14.07 ? 355  ASP A N   1 
ATOM   2853 C CA  . ASP A  1 356 ? 17.604  -4.524  -1.013  1.00 13.20 ? 355  ASP A CA  1 
ATOM   2854 C C   . ASP A  1 356 ? 16.342  -5.240  -0.504  1.00 12.94 ? 355  ASP A C   1 
ATOM   2855 O O   . ASP A  1 356 ? 15.712  -6.005  -1.241  1.00 13.17 ? 355  ASP A O   1 
ATOM   2856 C CB  . ASP A  1 356 ? 18.861  -4.970  -0.230  1.00 14.10 ? 355  ASP A CB  1 
ATOM   2857 C CG  . ASP A  1 356 ? 19.406  -6.293  -0.679  1.00 15.60 ? 355  ASP A CG  1 
ATOM   2858 O OD1 . ASP A  1 356 ? 18.589  -7.173  -1.035  1.00 17.05 ? 355  ASP A OD1 1 
ATOM   2859 O OD2 . ASP A  1 356 ? 20.652  -6.535  -0.705  1.00 16.76 ? 355  ASP A OD2 1 
ATOM   2860 N N   . MET A  1 357 ? 15.969  -5.006  0.752   1.00 12.65 ? 356  MET A N   1 
ATOM   2861 C CA  . MET A  1 357 ? 14.940  -5.847  1.391   1.00 12.69 ? 356  MET A CA  1 
ATOM   2862 C C   . MET A  1 357 ? 13.529  -5.647  0.817   1.00 13.02 ? 356  MET A C   1 
ATOM   2863 O O   . MET A  1 357 ? 12.748  -6.617  0.717   1.00 12.60 ? 356  MET A O   1 
ATOM   2864 C CB  . MET A  1 357 ? 14.951  -5.653  2.927   1.00 12.19 ? 356  MET A CB  1 
ATOM   2865 C CG  . MET A  1 357 ? 16.297  -6.075  3.578   1.00 12.80 ? 356  MET A CG  1 
ATOM   2866 S SD  . MET A  1 357 ? 16.376  -5.671  5.318   1.00 13.92 ? 356  MET A SD  1 
ATOM   2867 C CE  . MET A  1 357 ? 15.303  -6.928  5.964   1.00 14.52 ? 356  MET A CE  1 
ATOM   2868 N N   . GLU A  1 358 ? 13.189  -4.417  0.448   1.00 12.95 ? 357  GLU A N   1 
ATOM   2869 C CA  . GLU A  1 358 ? 11.865  -4.178  -0.135  1.00 13.28 ? 357  GLU A CA  1 
ATOM   2870 C C   . GLU A  1 358 ? 11.816  -4.689  -1.583  1.00 13.32 ? 357  GLU A C   1 
ATOM   2871 O O   . GLU A  1 358 ? 10.739  -5.083  -2.044  1.00 14.27 ? 357  GLU A O   1 
ATOM   2872 C CB  . GLU A  1 358 ? 11.421  -2.718  -0.048  1.00 13.74 ? 357  GLU A CB  1 
ATOM   2873 C CG  . GLU A  1 358 ? 9.905   -2.565  -0.130  1.00 14.99 ? 357  GLU A CG  1 
ATOM   2874 C CD  . GLU A  1 358 ? 9.435   -1.138  0.034   1.00 18.32 ? 357  GLU A CD  1 
ATOM   2875 O OE1 . GLU A  1 358 ? 8.707   -0.849  1.010   1.00 21.58 ? 357  GLU A OE1 1 
ATOM   2876 O OE2 . GLU A  1 358 ? 9.786   -0.308  -0.822  1.00 19.02 ? 357  GLU A OE2 1 
ATOM   2877 N N   . SER A  1 359 ? 12.963  -4.709  -2.277  1.00 13.58 ? 358  SER A N   1 
ATOM   2878 C CA  . SER A  1 359 ? 13.036  -5.265  -3.637  1.00 13.89 ? 358  SER A CA  1 
ATOM   2879 C C   . SER A  1 359 ? 12.941  -6.794  -3.640  1.00 13.95 ? 358  SER A C   1 
ATOM   2880 O O   . SER A  1 359 ? 12.117  -7.384  -4.374  1.00 13.94 ? 358  SER A O   1 
ATOM   2881 C CB  . SER A  1 359 ? 14.342  -4.868  -4.349  1.00 13.86 ? 358  SER A CB  1 
ATOM   2882 O OG  . SER A  1 359 ? 14.398  -3.468  -4.567  1.00 12.94 ? 358  SER A OG  1 
ATOM   2883 N N   . ASN A  1 360 ? 13.802  -7.434  -2.849  1.00 13.87 ? 359  ASN A N   1 
ATOM   2884 C CA  . ASN A  1 360 ? 13.980  -8.876  -2.972  1.00 13.78 ? 359  ASN A CA  1 
ATOM   2885 C C   . ASN A  1 360 ? 13.436  -9.726  -1.817  1.00 14.50 ? 359  ASN A C   1 
ATOM   2886 O O   . ASN A  1 360 ? 13.628  -10.949 -1.802  1.00 14.42 ? 359  ASN A O   1 
ATOM   2887 C CB  . ASN A  1 360 ? 15.448  -9.201  -3.288  1.00 14.14 ? 359  ASN A CB  1 
ATOM   2888 C CG  . ASN A  1 360 ? 15.853  -8.722  -4.670  1.00 13.83 ? 359  ASN A CG  1 
ATOM   2889 O OD1 . ASN A  1 360 ? 14.996  -8.415  -5.505  1.00 15.20 ? 359  ASN A OD1 1 
ATOM   2890 N ND2 . ASN A  1 360 ? 17.156  -8.639  -4.918  1.00 13.76 ? 359  ASN A ND2 1 
ATOM   2891 N N   . GLY A  1 361 ? 12.741  -9.085  -0.868  1.00 13.32 ? 360  GLY A N   1 
ATOM   2892 C CA  . GLY A  1 361 ? 12.024  -9.809  0.178   1.00 13.37 ? 360  GLY A CA  1 
ATOM   2893 C C   . GLY A  1 361 ? 10.689  -10.299 -0.347  1.00 13.49 ? 360  GLY A C   1 
ATOM   2894 O O   . GLY A  1 361 ? 9.632   -9.752  -0.045  1.00 13.26 ? 360  GLY A O   1 
ATOM   2895 N N   . LYS A  1 362 ? 10.779  -11.357 -1.151  1.00 13.62 ? 361  LYS A N   1 
ATOM   2896 C CA  . LYS A  1 362 ? 9.678   -11.824 -2.007  1.00 13.48 ? 361  LYS A CA  1 
ATOM   2897 C C   . LYS A  1 362 ? 9.603   -13.345 -1.972  1.00 13.69 ? 361  LYS A C   1 
ATOM   2898 O O   . LYS A  1 362 ? 10.603  -14.034 -1.722  1.00 13.42 ? 361  LYS A O   1 
ATOM   2899 C CB  . LYS A  1 362 ? 9.927   -11.391 -3.466  1.00 14.08 ? 361  LYS A CB  1 
ATOM   2900 C CG  . LYS A  1 362 ? 9.992   -9.873  -3.735  1.00 12.79 ? 361  LYS A CG  1 
ATOM   2901 C CD  . LYS A  1 362 ? 8.681   -9.140  -3.503  1.00 13.71 ? 361  LYS A CD  1 
ATOM   2902 C CE  . LYS A  1 362 ? 8.896   -7.624  -3.297  1.00 13.99 ? 361  LYS A CE  1 
ATOM   2903 N NZ  . LYS A  1 362 ? 9.386   -6.922  -4.541  1.00 15.04 ? 361  LYS A NZ  1 
ATOM   2904 N N   . TYR A  1 363 ? 8.428   -13.892 -2.286  1.00 14.41 ? 362  TYR A N   1 
ATOM   2905 C CA  . TYR A  1 363 ? 8.301   -15.346 -2.249  1.00 15.24 ? 362  TYR A CA  1 
ATOM   2906 C C   . TYR A  1 363 ? 7.553   -15.986 -3.411  1.00 15.51 ? 362  TYR A C   1 
ATOM   2907 O O   . TYR A  1 363 ? 7.435   -17.211 -3.451  1.00 16.63 ? 362  TYR A O   1 
ATOM   2908 C CB  . TYR A  1 363 ? 7.733   -15.829 -0.894  1.00 15.26 ? 362  TYR A CB  1 
ATOM   2909 C CG  . TYR A  1 363 ? 6.226   -15.715 -0.696  1.00 15.20 ? 362  TYR A CG  1 
ATOM   2910 C CD1 . TYR A  1 363 ? 5.459   -16.857 -0.467  1.00 17.77 ? 362  TYR A CD1 1 
ATOM   2911 C CD2 . TYR A  1 363 ? 5.574   -14.476 -0.711  1.00 15.64 ? 362  TYR A CD2 1 
ATOM   2912 C CE1 . TYR A  1 363 ? 4.084   -16.782 -0.252  1.00 18.51 ? 362  TYR A CE1 1 
ATOM   2913 C CE2 . TYR A  1 363 ? 4.183   -14.392 -0.510  1.00 17.66 ? 362  TYR A CE2 1 
ATOM   2914 C CZ  . TYR A  1 363 ? 3.450   -15.552 -0.288  1.00 17.98 ? 362  TYR A CZ  1 
ATOM   2915 O OH  . TYR A  1 363 ? 2.081   -15.485 -0.079  1.00 17.19 ? 362  TYR A OH  1 
ATOM   2916 N N   . ILE A  1 364 ? 7.048   -15.164 -4.327  1.00 15.78 ? 363  ILE A N   1 
ATOM   2917 C CA  . ILE A  1 364 ? 6.359   -15.660 -5.527  1.00 16.42 ? 363  ILE A CA  1 
ATOM   2918 C C   . ILE A  1 364 ? 7.160   -15.318 -6.780  1.00 16.97 ? 363  ILE A C   1 
ATOM   2919 O O   . ILE A  1 364 ? 7.623   -14.176 -6.954  1.00 18.42 ? 363  ILE A O   1 
ATOM   2920 C CB  . ILE A  1 364 ? 4.925   -15.062 -5.646  1.00 16.38 ? 363  ILE A CB  1 
ATOM   2921 C CG1 . ILE A  1 364 ? 4.089   -15.278 -4.369  1.00 15.70 ? 363  ILE A CG1 1 
ATOM   2922 C CG2 . ILE A  1 364 ? 4.202   -15.627 -6.890  1.00 15.77 ? 363  ILE A CG2 1 
ATOM   2923 C CD1 . ILE A  1 364 ? 3.870   -16.746 -3.913  1.00 17.14 ? 363  ILE A CD1 1 
ATOM   2924 N N   . THR A  1 365 ? 7.304   -16.298 -7.676  1.00 17.15 ? 364  THR A N   1 
ATOM   2925 C CA  . THR A  1 365 ? 8.020   -16.062 -8.943  1.00 18.01 ? 364  THR A CA  1 
ATOM   2926 C C   . THR A  1 365 ? 7.154   -15.581 -10.101 1.00 19.20 ? 364  THR A C   1 
ATOM   2927 O O   . THR A  1 365 ? 5.913   -15.519 -10.020 1.00 19.35 ? 364  THR A O   1 
ATOM   2928 C CB  . THR A  1 365 ? 8.788   -17.313 -9.405  1.00 18.10 ? 364  THR A CB  1 
ATOM   2929 O OG1 . THR A  1 365 ? 7.832   -18.294 -9.871  1.00 17.98 ? 364  THR A OG1 1 
ATOM   2930 C CG2 . THR A  1 365 ? 9.566   -17.960 -8.269  1.00 18.35 ? 364  THR A CG2 1 
ATOM   2931 N N   . LYS A  1 366 ? 7.836   -15.266 -11.200 1.00 19.57 ? 365  LYS A N   1 
ATOM   2932 C CA  . LYS A  1 366 ? 7.188   -14.841 -12.442 1.00 20.60 ? 365  LYS A CA  1 
ATOM   2933 C C   . LYS A  1 366 ? 6.194   -15.888 -12.943 1.00 21.09 ? 365  LYS A C   1 
ATOM   2934 O O   . LYS A  1 366 ? 5.200   -15.535 -13.581 1.00 22.63 ? 365  LYS A O   1 
ATOM   2935 C CB  . LYS A  1 366 ? 8.236   -14.541 -13.511 1.00 21.50 ? 365  LYS A CB  1 
ATOM   2936 C CG  . LYS A  1 366 ? 7.681   -13.888 -14.788 1.00 20.76 ? 365  LYS A CG  1 
ATOM   2937 C CD  . LYS A  1 366 ? 8.816   -13.352 -15.644 1.00 25.87 ? 365  LYS A CD  1 
ATOM   2938 C CE  . LYS A  1 366 ? 8.267   -12.696 -16.904 1.00 28.06 ? 365  LYS A CE  1 
ATOM   2939 N NZ  . LYS A  1 366 ? 9.346   -12.568 -17.935 1.00 30.98 ? 365  LYS A NZ  1 
ATOM   2940 N N   . SER A  1 367 ? 6.448   -17.157 -12.639 1.00 21.01 ? 366  SER A N   1 
ATOM   2941 C CA  . SER A  1 367 ? 5.529   -18.225 -13.070 1.00 21.43 ? 366  SER A CA  1 
ATOM   2942 C C   . SER A  1 367 ? 4.320   -18.373 -12.149 1.00 21.93 ? 366  SER A C   1 
ATOM   2943 O O   . SER A  1 367 ? 3.372   -19.094 -12.470 1.00 22.43 ? 366  SER A O   1 
ATOM   2944 C CB  . SER A  1 367 ? 6.279   -19.552 -13.180 1.00 21.32 ? 366  SER A CB  1 
ATOM   2945 O OG  . SER A  1 367 ? 6.549   -20.072 -11.893 1.00 22.65 ? 366  SER A OG  1 
ATOM   2946 N N   . GLY A  1 368 ? 4.348   -17.703 -11.001 1.00 21.64 ? 367  GLY A N   1 
ATOM   2947 C CA  . GLY A  1 368 ? 3.303   -17.887 -10.005 1.00 20.83 ? 367  GLY A CA  1 
ATOM   2948 C C   . GLY A  1 368 ? 3.695   -18.906 -8.949  1.00 20.39 ? 367  GLY A C   1 
ATOM   2949 O O   . GLY A  1 368 ? 2.937   -19.149 -8.017  1.00 20.85 ? 367  GLY A O   1 
ATOM   2950 N N   . ALA A  1 369 ? 4.882   -19.494 -9.079  1.00 20.06 ? 368  ALA A N   1 
ATOM   2951 C CA  . ALA A  1 369 ? 5.337   -20.513 -8.132  1.00 19.76 ? 368  ALA A CA  1 
ATOM   2952 C C   . ALA A  1 369 ? 5.790   -19.926 -6.799  1.00 20.20 ? 368  ALA A C   1 
ATOM   2953 O O   . ALA A  1 369 ? 6.374   -18.828 -6.755  1.00 20.18 ? 368  ALA A O   1 
ATOM   2954 C CB  . ALA A  1 369 ? 6.453   -21.344 -8.745  1.00 19.49 ? 368  ALA A CB  1 
ATOM   2955 N N   . ARG A  1 370 ? 5.532   -20.658 -5.716  1.00 19.97 ? 369  ARG A N   1 
ATOM   2956 C CA  . ARG A  1 370 ? 6.108   -20.324 -4.419  1.00 20.56 ? 369  ARG A CA  1 
ATOM   2957 C C   . ARG A  1 370 ? 7.566   -20.767 -4.433  1.00 20.32 ? 369  ARG A C   1 
ATOM   2958 O O   . ARG A  1 370 ? 7.861   -21.919 -4.756  1.00 20.55 ? 369  ARG A O   1 
ATOM   2959 C CB  . ARG A  1 370 ? 5.363   -21.009 -3.281  1.00 21.41 ? 369  ARG A CB  1 
ATOM   2960 C CG  . ARG A  1 370 ? 5.537   -20.291 -1.947  1.00 24.48 ? 369  ARG A CG  1 
ATOM   2961 C CD  . ARG A  1 370 ? 5.664   -21.176 -0.731  1.00 29.31 ? 369  ARG A CD  1 
ATOM   2962 N NE  . ARG A  1 370 ? 5.849   -20.373 0.484   1.00 31.29 ? 369  ARG A NE  1 
ATOM   2963 C CZ  . ARG A  1 370 ? 7.019   -19.891 0.944   1.00 32.50 ? 369  ARG A CZ  1 
ATOM   2964 N NH1 . ARG A  1 370 ? 8.178   -20.114 0.308   1.00 32.25 ? 369  ARG A NH1 1 
ATOM   2965 N NH2 . ARG A  1 370 ? 7.031   -19.184 2.073   1.00 31.11 ? 369  ARG A NH2 1 
ATOM   2966 N N   . VAL A  1 371 ? 8.482   -19.861 -4.093  1.00 19.62 ? 370  VAL A N   1 
ATOM   2967 C CA  . VAL A  1 371 ? 9.892   -20.229 -4.037  1.00 19.13 ? 370  VAL A CA  1 
ATOM   2968 C C   . VAL A  1 371 ? 10.122  -21.364 -3.036  1.00 19.06 ? 370  VAL A C   1 
ATOM   2969 O O   . VAL A  1 371 ? 9.466   -21.432 -1.988  1.00 18.80 ? 370  VAL A O   1 
ATOM   2970 C CB  . VAL A  1 371 ? 10.829  -19.015 -3.698  1.00 19.07 ? 370  VAL A CB  1 
ATOM   2971 C CG1 . VAL A  1 371 ? 10.684  -17.911 -4.734  1.00 19.30 ? 370  VAL A CG1 1 
ATOM   2972 C CG2 . VAL A  1 371 ? 10.569  -18.500 -2.269  1.00 19.45 ? 370  VAL A CG2 1 
ATOM   2973 N N   . ASP A  1 372 ? 11.030  -22.275 -3.389  1.00 18.88 ? 371  ASP A N   1 
ATOM   2974 C CA  . ASP A  1 372 ? 11.454  -23.327 -2.480  1.00 19.58 ? 371  ASP A CA  1 
ATOM   2975 C C   . ASP A  1 372 ? 12.932  -23.169 -2.146  1.00 19.23 ? 371  ASP A C   1 
ATOM   2976 O O   . ASP A  1 372 ? 13.662  -24.144 -1.961  1.00 19.56 ? 371  ASP A O   1 
ATOM   2977 C CB  . ASP A  1 372 ? 11.147  -24.719 -3.064  1.00 19.75 ? 371  ASP A CB  1 
ATOM   2978 C CG  . ASP A  1 372 ? 11.808  -24.964 -4.420  1.00 22.90 ? 371  ASP A CG  1 
ATOM   2979 O OD1 . ASP A  1 372 ? 12.487  -24.062 -4.982  1.00 22.73 ? 371  ASP A OD1 1 
ATOM   2980 O OD2 . ASP A  1 372 ? 11.682  -26.067 -5.014  1.00 27.07 ? 371  ASP A OD2 1 
ATOM   2981 N N   . HIS A  1 373 ? 13.345  -21.905 -2.079  1.00 17.76 ? 372  HIS A N   1 
ATOM   2982 C CA  . HIS A  1 373 ? 14.707  -21.501 -1.760  1.00 17.45 ? 372  HIS A CA  1 
ATOM   2983 C C   . HIS A  1 373 ? 14.656  -20.112 -1.133  1.00 16.90 ? 372  HIS A C   1 
ATOM   2984 O O   . HIS A  1 373 ? 13.625  -19.431 -1.188  1.00 17.41 ? 372  HIS A O   1 
ATOM   2985 C CB  . HIS A  1 373 ? 15.575  -21.449 -3.013  1.00 16.65 ? 372  HIS A CB  1 
ATOM   2986 C CG  . HIS A  1 373 ? 15.012  -20.587 -4.105  1.00 17.35 ? 372  HIS A CG  1 
ATOM   2987 N ND1 . HIS A  1 373 ? 15.208  -19.216 -4.160  1.00 16.91 ? 372  HIS A ND1 1 
ATOM   2988 C CD2 . HIS A  1 373 ? 14.241  -20.899 -5.173  1.00 17.54 ? 372  HIS A CD2 1 
ATOM   2989 C CE1 . HIS A  1 373 ? 14.594  -18.733 -5.226  1.00 17.46 ? 372  HIS A CE1 1 
ATOM   2990 N NE2 . HIS A  1 373 ? 13.986  -19.731 -5.849  1.00 17.54 ? 372  HIS A NE2 1 
ATOM   2991 N N   . GLN A  1 374 ? 15.778  -19.703 -0.558  1.00 16.99 ? 373  GLN A N   1 
ATOM   2992 C CA  . GLN A  1 374 ? 15.901  -18.366 0.020   1.00 16.41 ? 373  GLN A CA  1 
ATOM   2993 C C   . GLN A  1 374 ? 15.889  -17.269 -1.042  1.00 16.41 ? 373  GLN A C   1 
ATOM   2994 O O   . GLN A  1 374 ? 16.385  -17.459 -2.167  1.00 15.99 ? 373  GLN A O   1 
ATOM   2995 C CB  . GLN A  1 374 ? 17.194  -18.284 0.839   1.00 16.66 ? 373  GLN A CB  1 
ATOM   2996 C CG  . GLN A  1 374 ? 17.134  -19.014 2.182   1.00 17.51 ? 373  GLN A CG  1 
ATOM   2997 C CD  . GLN A  1 374 ? 16.008  -18.514 3.071   1.00 19.21 ? 373  GLN A CD  1 
ATOM   2998 O OE1 . GLN A  1 374 ? 15.858  -17.304 3.292   1.00 17.75 ? 373  GLN A OE1 1 
ATOM   2999 N NE2 . GLN A  1 374 ? 15.198  -19.441 3.572   1.00 20.42 ? 373  GLN A NE2 1 
ATOM   3000 N N   . THR A  1 375 ? 15.305  -16.126 -0.689  1.00 15.13 ? 374  THR A N   1 
ATOM   3001 C CA  . THR A  1 375 ? 15.476  -14.905 -1.492  1.00 14.37 ? 374  THR A CA  1 
ATOM   3002 C C   . THR A  1 375 ? 16.299  -13.875 -0.688  1.00 13.82 ? 374  THR A C   1 
ATOM   3003 O O   . THR A  1 375 ? 17.292  -14.240 -0.085  1.00 14.43 ? 374  THR A O   1 
ATOM   3004 C CB  . THR A  1 375 ? 14.137  -14.335 -1.982  1.00 14.22 ? 374  THR A CB  1 
ATOM   3005 O OG1 . THR A  1 375 ? 13.239  -14.173 -0.876  1.00 15.22 ? 374  THR A OG1 1 
ATOM   3006 C CG2 . THR A  1 375 ? 13.423  -15.370 -2.943  1.00 13.60 ? 374  THR A CG2 1 
ATOM   3007 N N   . GLY A  1 376 ? 15.898  -12.607 -0.704  1.00 13.94 ? 375  GLY A N   1 
ATOM   3008 C CA  . GLY A  1 376 ? 16.763  -11.518 -0.235  1.00 13.89 ? 375  GLY A CA  1 
ATOM   3009 C C   . GLY A  1 376 ? 17.189  -11.648 1.217   1.00 13.96 ? 375  GLY A C   1 
ATOM   3010 O O   . GLY A  1 376 ? 16.433  -12.158 2.037   1.00 14.86 ? 375  GLY A O   1 
ATOM   3011 N N   . PRO A  1 377 ? 18.400  -11.185 1.537   1.00 14.02 ? 376  PRO A N   1 
ATOM   3012 C CA  . PRO A  1 377 ? 18.918  -11.248 2.910   1.00 13.61 ? 376  PRO A CA  1 
ATOM   3013 C C   . PRO A  1 377 ? 18.467  -10.058 3.767   1.00 13.65 ? 376  PRO A C   1 
ATOM   3014 O O   . PRO A  1 377 ? 17.941  -9.056  3.235   1.00 14.08 ? 376  PRO A O   1 
ATOM   3015 C CB  . PRO A  1 377 ? 20.436  -11.190 2.696   1.00 13.54 ? 376  PRO A CB  1 
ATOM   3016 C CG  . PRO A  1 377 ? 20.564  -10.261 1.510   1.00 14.64 ? 376  PRO A CG  1 
ATOM   3017 C CD  . PRO A  1 377 ? 19.371  -10.557 0.616   1.00 13.81 ? 376  PRO A CD  1 
ATOM   3018 N N   . ILE A  1 378 ? 18.670  -10.181 5.078   1.00 13.65 ? 377  ILE A N   1 
ATOM   3019 C CA  . ILE A  1 378 ? 18.519  -9.052  5.987   1.00 13.48 ? 377  ILE A CA  1 
ATOM   3020 C C   . ILE A  1 378 ? 19.795  -8.212  5.918   1.00 13.68 ? 377  ILE A C   1 
ATOM   3021 O O   . ILE A  1 378 ? 20.888  -8.732  6.130   1.00 13.67 ? 377  ILE A O   1 
ATOM   3022 C CB  . ILE A  1 378 ? 18.244  -9.553  7.433   1.00 13.67 ? 377  ILE A CB  1 
ATOM   3023 C CG1 . ILE A  1 378 ? 16.895  -10.279 7.464   1.00 14.00 ? 377  ILE A CG1 1 
ATOM   3024 C CG2 . ILE A  1 378 ? 18.298  -8.391  8.432   1.00 14.41 ? 377  ILE A CG2 1 
ATOM   3025 C CD1 . ILE A  1 378 ? 16.784  -11.352 8.547   1.00 17.68 ? 377  ILE A CD1 1 
ATOM   3026 N N   . VAL A  1 379 ? 19.641  -6.935  5.561   1.00 12.77 ? 378  VAL A N   1 
ATOM   3027 C CA  . VAL A  1 379 ? 20.770  -5.997  5.432   1.00 13.77 ? 378  VAL A CA  1 
ATOM   3028 C C   . VAL A  1 379 ? 20.845  -5.170  6.713   1.00 13.88 ? 378  VAL A C   1 
ATOM   3029 O O   . VAL A  1 379 ? 19.818  -4.762  7.248   1.00 13.38 ? 378  VAL A O   1 
ATOM   3030 C CB  . VAL A  1 379 ? 20.596  -5.115  4.169   1.00 14.36 ? 378  VAL A CB  1 
ATOM   3031 C CG1 . VAL A  1 379 ? 21.650  -3.994  4.094   1.00 15.92 ? 378  VAL A CG1 1 
ATOM   3032 C CG2 . VAL A  1 379 ? 20.614  -5.991  2.910   1.00 16.17 ? 378  VAL A CG2 1 
ATOM   3033 N N   . TRP A  1 380 ? 22.069  -4.950  7.215   1.00 13.75 ? 379  TRP A N   1 
ATOM   3034 C CA  . TRP A  1 380 ? 22.279  -4.216  8.464   1.00 13.37 ? 379  TRP A CA  1 
ATOM   3035 C C   . TRP A  1 380 ? 23.704  -3.670  8.500   1.00 14.09 ? 379  TRP A C   1 
ATOM   3036 O O   . TRP A  1 380 ? 24.511  -3.970  7.612   1.00 14.18 ? 379  TRP A O   1 
ATOM   3037 C CB  . TRP A  1 380 ? 21.993  -5.122  9.679   1.00 13.95 ? 379  TRP A CB  1 
ATOM   3038 C CG  . TRP A  1 380 ? 22.958  -6.319  9.821   1.00 13.44 ? 379  TRP A CG  1 
ATOM   3039 C CD1 . TRP A  1 380 ? 22.975  -7.462  9.062   1.00 14.17 ? 379  TRP A CD1 1 
ATOM   3040 C CD2 . TRP A  1 380 ? 24.010  -6.467  10.787  1.00 15.37 ? 379  TRP A CD2 1 
ATOM   3041 N NE1 . TRP A  1 380 ? 23.979  -8.306  9.491   1.00 14.22 ? 379  TRP A NE1 1 
ATOM   3042 C CE2 . TRP A  1 380 ? 24.635  -7.717  10.542  1.00 15.04 ? 379  TRP A CE2 1 
ATOM   3043 C CE3 . TRP A  1 380 ? 24.504  -5.662  11.826  1.00 15.50 ? 379  TRP A CE3 1 
ATOM   3044 C CZ2 . TRP A  1 380 ? 25.715  -8.189  11.309  1.00 14.14 ? 379  TRP A CZ2 1 
ATOM   3045 C CZ3 . TRP A  1 380 ? 25.578  -6.131  12.598  1.00 14.23 ? 379  TRP A CZ3 1 
ATOM   3046 C CH2 . TRP A  1 380 ? 26.177  -7.384  12.329  1.00 14.23 ? 379  TRP A CH2 1 
ATOM   3047 N N   . GLY A  1 381 ? 24.013  -2.864  9.507   1.00 13.87 ? 380  GLY A N   1 
ATOM   3048 C CA  . GLY A  1 381 ? 25.359  -2.327  9.616   1.00 14.32 ? 380  GLY A CA  1 
ATOM   3049 C C   . GLY A  1 381 ? 25.412  -0.964  10.275  1.00 15.06 ? 380  GLY A C   1 
ATOM   3050 O O   . GLY A  1 381 ? 24.412  -0.241  10.331  1.00 15.17 ? 380  GLY A O   1 
ATOM   3051 N N   . GLU A  1 382 ? 26.602  -0.636  10.769  1.00 14.83 ? 381  GLU A N   1 
ATOM   3052 C CA  . GLU A  1 382 ? 26.935  0.685   11.297  1.00 15.78 ? 381  GLU A CA  1 
ATOM   3053 C C   . GLU A  1 382 ? 28.311  1.063   10.744  1.00 15.57 ? 381  GLU A C   1 
ATOM   3054 O O   . GLU A  1 382 ? 29.103  0.174   10.396  1.00 15.87 ? 381  GLU A O   1 
ATOM   3055 C CB  . GLU A  1 382 ? 26.968  0.682   12.831  1.00 16.02 ? 381  GLU A CB  1 
ATOM   3056 C CG  . GLU A  1 382 ? 25.615  0.653   13.546  1.00 17.85 ? 381  GLU A CG  1 
ATOM   3057 C CD  . GLU A  1 382 ? 24.784  1.925   13.385  1.00 19.52 ? 381  GLU A CD  1 
ATOM   3058 O OE1 . GLU A  1 382 ? 25.331  3.018   13.125  1.00 23.49 ? 381  GLU A OE1 1 
ATOM   3059 O OE2 . GLU A  1 382 ? 23.555  1.848   13.540  1.00 24.22 ? 381  GLU A OE2 1 
ATOM   3060 N N   . PRO A  1 383 ? 28.622  2.349   10.630  1.00 15.44 ? 382  PRO A N   1 
ATOM   3061 C CA  . PRO A  1 383 ? 29.944  2.734   10.112  1.00 15.80 ? 382  PRO A CA  1 
ATOM   3062 C C   . PRO A  1 383 ? 31.109  2.302   11.012  1.00 16.50 ? 382  PRO A C   1 
ATOM   3063 O O   . PRO A  1 383 ? 30.976  2.237   12.247  1.00 17.13 ? 382  PRO A O   1 
ATOM   3064 C CB  . PRO A  1 383 ? 29.860  4.265   10.001  1.00 16.51 ? 382  PRO A CB  1 
ATOM   3065 C CG  . PRO A  1 383 ? 28.709  4.672   10.797  1.00 15.52 ? 382  PRO A CG  1 
ATOM   3066 C CD  . PRO A  1 383 ? 27.778  3.519   10.930  1.00 16.03 ? 382  PRO A CD  1 
ATOM   3067 N N   . GLY A  1 384 ? 32.244  1.976   10.395  1.00 15.76 ? 383  GLY A N   1 
ATOM   3068 C CA  . GLY A  1 384 ? 33.486  1.788   11.140  1.00 16.18 ? 383  GLY A CA  1 
ATOM   3069 C C   . GLY A  1 384 ? 34.090  3.140   11.488  1.00 16.74 ? 383  GLY A C   1 
ATOM   3070 O O   . GLY A  1 384 ? 33.897  4.094   10.718  1.00 15.28 ? 383  GLY A O   1 
ATOM   3071 N N   . THR A  1 385 ? 34.808  3.256   12.617  1.00 17.48 ? 384  THR A N   1 
ATOM   3072 C CA  . THR A  1 385 ? 35.151  2.145   13.527  1.00 19.59 ? 384  THR A CA  1 
ATOM   3073 C C   . THR A  1 385 ? 34.107  1.843   14.605  1.00 20.67 ? 384  THR A C   1 
ATOM   3074 O O   . THR A  1 385 ? 34.323  0.917   15.397  1.00 21.63 ? 384  THR A O   1 
ATOM   3075 C CB  . THR A  1 385 ? 36.504  2.414   14.251  1.00 19.85 ? 384  THR A CB  1 
ATOM   3076 O OG1 . THR A  1 385 ? 36.467  3.734   14.829  1.00 21.78 ? 384  THR A OG1 1 
ATOM   3077 C CG2 . THR A  1 385 ? 37.672  2.453   13.256  1.00 20.23 ? 384  THR A CG2 1 
ATOM   3078 N N   . ASN A  1 386 ? 33.000  2.593   14.619  1.00 21.48 ? 385  ASN A N   1 
ATOM   3079 C CA  . ASN A  1 386 ? 31.926  2.432   15.624  1.00 23.51 ? 385  ASN A CA  1 
ATOM   3080 C C   . ASN A  1 386 ? 31.528  0.958   15.803  1.00 24.14 ? 385  ASN A C   1 
ATOM   3081 O O   . ASN A  1 386 ? 31.568  0.425   16.920  1.00 24.85 ? 385  ASN A O   1 
ATOM   3082 C CB  . ASN A  1 386 ? 30.669  3.274   15.313  1.00 23.60 ? 385  ASN A CB  1 
ATOM   3083 C CG  . ASN A  1 386 ? 30.968  4.755   15.012  1.00 26.73 ? 385  ASN A CG  1 
ATOM   3084 O OD1 . ASN A  1 386 ? 32.066  5.236   15.237  1.00 27.66 ? 385  ASN A OD1 1 
ATOM   3085 N ND2 . ASN A  1 386 ? 29.960  5.478   14.502  1.00 29.64 ? 385  ASN A ND2 1 
ATOM   3086 N N   . GLY A  1 387 ? 31.181  0.294   14.702  1.00 24.40 ? 386  GLY A N   1 
ATOM   3087 C CA  . GLY A  1 387 ? 30.803  -1.121  14.752  1.00 24.06 ? 386  GLY A CA  1 
ATOM   3088 C C   . GLY A  1 387 ? 31.752  -2.078  15.465  1.00 23.87 ? 386  GLY A C   1 
ATOM   3089 O O   . GLY A  1 387 ? 31.296  -3.035  16.090  1.00 23.95 ? 386  GLY A O   1 
ATOM   3090 N N   . GLN A  1 388 ? 33.067  -1.843  15.360  1.00 23.34 ? 387  GLN A N   1 
ATOM   3091 C CA  . GLN A  1 388 ? 34.094  -2.682  16.000  1.00 23.07 ? 387  GLN A CA  1 
ATOM   3092 C C   . GLN A  1 388 ? 33.905  -2.792  17.493  1.00 23.69 ? 387  GLN A C   1 
ATOM   3093 O O   . GLN A  1 388 ? 34.266  -3.799  18.100  1.00 25.02 ? 387  GLN A O   1 
ATOM   3094 C CB  . GLN A  1 388 ? 35.494  -2.095  15.771  1.00 22.64 ? 387  GLN A CB  1 
ATOM   3095 C CG  . GLN A  1 388 ? 36.054  -2.365  14.413  1.00 20.90 ? 387  GLN A CG  1 
ATOM   3096 C CD  . GLN A  1 388 ? 37.321  -1.600  14.127  1.00 18.35 ? 387  GLN A CD  1 
ATOM   3097 O OE1 . GLN A  1 388 ? 38.160  -1.347  15.027  1.00 20.27 ? 387  GLN A OE1 1 
ATOM   3098 N NE2 . GLN A  1 388 ? 37.495  -1.251  12.886  1.00 12.83 ? 387  GLN A NE2 1 
ATOM   3099 N N   . HIS A  1 389 ? 33.392  -1.711  18.078  1.00 23.63 ? 388  HIS A N   1 
ATOM   3100 C CA  . HIS A  1 389 ? 33.265  -1.599  19.518  1.00 24.03 ? 388  HIS A CA  1 
ATOM   3101 C C   . HIS A  1 389 ? 31.834  -1.875  19.927  1.00 23.67 ? 388  HIS A C   1 
ATOM   3102 O O   . HIS A  1 389 ? 31.455  -1.653  21.077  1.00 25.15 ? 388  HIS A O   1 
ATOM   3103 C CB  . HIS A  1 389 ? 33.694  -0.196  19.947  1.00 24.32 ? 388  HIS A CB  1 
ATOM   3104 C CG  . HIS A  1 389 ? 35.046  0.193   19.439  1.00 25.96 ? 388  HIS A CG  1 
ATOM   3105 N ND1 . HIS A  1 389 ? 36.209  -0.244  20.026  1.00 29.93 ? 388  HIS A ND1 1 
ATOM   3106 C CD2 . HIS A  1 389 ? 35.418  0.980   18.404  1.00 27.93 ? 388  HIS A CD2 1 
ATOM   3107 C CE1 . HIS A  1 389 ? 37.244  0.251   19.368  1.00 30.38 ? 388  HIS A CE1 1 
ATOM   3108 N NE2 . HIS A  1 389 ? 36.789  0.991   18.376  1.00 29.94 ? 388  HIS A NE2 1 
ATOM   3109 N N   . ALA A  1 390 ? 31.029  -2.344  18.974  1.00 22.77 ? 389  ALA A N   1 
ATOM   3110 C CA  . ALA A  1 390 ? 29.657  -2.718  19.265  1.00 21.33 ? 389  ALA A CA  1 
ATOM   3111 C C   . ALA A  1 390 ? 29.425  -4.210  19.046  1.00 20.86 ? 389  ALA A C   1 
ATOM   3112 O O   . ALA A  1 390 ? 29.075  -4.927  19.967  1.00 21.55 ? 389  ALA A O   1 
ATOM   3113 C CB  . ALA A  1 390 ? 28.679  -1.885  18.419  1.00 21.11 ? 389  ALA A CB  1 
ATOM   3114 N N   . PHE A  1 391 ? 29.600  -4.675  17.816  1.00 18.49 ? 390  PHE A N   1 
ATOM   3115 C CA  . PHE A  1 391 ? 29.136  -6.004  17.451  1.00 17.39 ? 390  PHE A CA  1 
ATOM   3116 C C   . PHE A  1 391 ? 30.162  -6.895  16.747  1.00 16.57 ? 390  PHE A C   1 
ATOM   3117 O O   . PHE A  1 391 ? 29.847  -8.037  16.403  1.00 17.07 ? 390  PHE A O   1 
ATOM   3118 C CB  . PHE A  1 391 ? 27.837  -5.925  16.612  1.00 17.06 ? 390  PHE A CB  1 
ATOM   3119 C CG  . PHE A  1 391 ? 27.936  -5.038  15.390  1.00 16.94 ? 390  PHE A CG  1 
ATOM   3120 C CD1 . PHE A  1 391 ? 28.622  -5.466  14.251  1.00 17.81 ? 390  PHE A CD1 1 
ATOM   3121 C CD2 . PHE A  1 391 ? 27.301  -3.803  15.364  1.00 18.66 ? 390  PHE A CD2 1 
ATOM   3122 C CE1 . PHE A  1 391 ? 28.715  -4.655  13.105  1.00 16.99 ? 390  PHE A CE1 1 
ATOM   3123 C CE2 . PHE A  1 391 ? 27.380  -2.984  14.235  1.00 18.02 ? 390  PHE A CE2 1 
ATOM   3124 C CZ  . PHE A  1 391 ? 28.084  -3.421  13.095  1.00 16.94 ? 390  PHE A CZ  1 
ATOM   3125 N N   . TYR A  1 392 ? 31.380  -6.397  16.506  1.00 16.27 ? 391  TYR A N   1 
ATOM   3126 C CA  . TYR A  1 392 ? 32.324  -7.253  15.781  1.00 16.20 ? 391  TYR A CA  1 
ATOM   3127 C C   . TYR A  1 392 ? 32.733  -8.470  16.611  1.00 16.05 ? 391  TYR A C   1 
ATOM   3128 O O   . TYR A  1 392 ? 33.154  -9.466  16.045  1.00 16.09 ? 391  TYR A O   1 
ATOM   3129 C CB  . TYR A  1 392 ? 33.571  -6.523  15.292  1.00 15.87 ? 391  TYR A CB  1 
ATOM   3130 C CG  . TYR A  1 392 ? 33.443  -5.618  14.071  1.00 15.95 ? 391  TYR A CG  1 
ATOM   3131 C CD1 . TYR A  1 392 ? 32.273  -4.912  13.767  1.00 16.29 ? 391  TYR A CD1 1 
ATOM   3132 C CD2 . TYR A  1 392 ? 34.555  -5.402  13.260  1.00 14.22 ? 391  TYR A CD2 1 
ATOM   3133 C CE1 . TYR A  1 392 ? 32.230  -4.024  12.652  1.00 13.22 ? 391  TYR A CE1 1 
ATOM   3134 C CE2 . TYR A  1 392 ? 34.527  -4.524  12.167  1.00 15.29 ? 391  TYR A CE2 1 
ATOM   3135 C CZ  . TYR A  1 392 ? 33.362  -3.840  11.872  1.00 14.72 ? 391  TYR A CZ  1 
ATOM   3136 O OH  . TYR A  1 392 ? 33.345  -2.949  10.806  1.00 15.83 ? 391  TYR A OH  1 
ATOM   3137 N N   . GLN A  1 393 ? 32.546  -8.414  17.931  1.00 16.37 ? 392  GLN A N   1 
ATOM   3138 C CA  . GLN A  1 393 ? 32.756  -9.607  18.765  1.00 16.10 ? 392  GLN A CA  1 
ATOM   3139 C C   . GLN A  1 393 ? 31.998  -10.813 18.200  1.00 16.20 ? 392  GLN A C   1 
ATOM   3140 O O   . GLN A  1 393 ? 32.542  -11.910 18.081  1.00 16.10 ? 392  GLN A O   1 
ATOM   3141 C CB  . GLN A  1 393 ? 32.324  -9.336  20.216  1.00 16.01 ? 392  GLN A CB  1 
ATOM   3142 C CG  . GLN A  1 393 ? 32.073  -10.601 21.067  1.00 15.92 ? 392  GLN A CG  1 
ATOM   3143 C CD  . GLN A  1 393 ? 33.352  -11.351 21.422  1.00 16.77 ? 392  GLN A CD  1 
ATOM   3144 O OE1 . GLN A  1 393 ? 34.321  -10.744 21.848  1.00 19.25 ? 392  GLN A OE1 1 
ATOM   3145 N NE2 . GLN A  1 393 ? 33.334  -12.669 21.271  1.00 16.66 ? 392  GLN A NE2 1 
ATOM   3146 N N   . LEU A  1 394 ? 30.740  -10.602 17.822  1.00 16.00 ? 393  LEU A N   1 
ATOM   3147 C CA  . LEU A  1 394 ? 29.923  -11.678 17.295  1.00 15.73 ? 393  LEU A CA  1 
ATOM   3148 C C   . LEU A  1 394 ? 30.394  -12.096 15.882  1.00 15.74 ? 393  LEU A C   1 
ATOM   3149 O O   . LEU A  1 394 ? 30.332  -13.280 15.508  1.00 17.30 ? 393  LEU A O   1 
ATOM   3150 C CB  . LEU A  1 394 ? 28.437  -11.265 17.295  1.00 14.89 ? 393  LEU A CB  1 
ATOM   3151 C CG  . LEU A  1 394 ? 27.479  -12.373 16.877  1.00 16.05 ? 393  LEU A CG  1 
ATOM   3152 C CD1 . LEU A  1 394 ? 26.174  -12.248 17.641  1.00 16.11 ? 393  LEU A CD1 1 
ATOM   3153 C CD2 . LEU A  1 394 ? 27.221  -12.361 15.353  1.00 16.78 ? 393  LEU A CD2 1 
ATOM   3154 N N   . ILE A  1 395 ? 30.854  -11.128 15.092  1.00 16.25 ? 394  ILE A N   1 
ATOM   3155 C CA  . ILE A  1 395 ? 31.333  -11.458 13.747  1.00 15.92 ? 394  ILE A CA  1 
ATOM   3156 C C   . ILE A  1 395 ? 32.583  -12.357 13.808  1.00 16.39 ? 394  ILE A C   1 
ATOM   3157 O O   . ILE A  1 395 ? 32.691  -13.322 13.029  1.00 15.82 ? 394  ILE A O   1 
ATOM   3158 C CB  . ILE A  1 395 ? 31.557  -10.182 12.877  1.00 15.70 ? 394  ILE A CB  1 
ATOM   3159 C CG1 . ILE A  1 395 ? 30.265  -9.337  12.817  1.00 16.40 ? 394  ILE A CG1 1 
ATOM   3160 C CG2 . ILE A  1 395 ? 31.983  -10.568 11.450  1.00 16.82 ? 394  ILE A CG2 1 
ATOM   3161 C CD1 . ILE A  1 395 ? 30.404  -8.056  11.974  1.00 17.64 ? 394  ILE A CD1 1 
ATOM   3162 N N   . HIS A  1 396 ? 33.485  -12.070 14.757  1.00 16.94 ? 395  HIS A N   1 
ATOM   3163 C CA  . HIS A  1 396 ? 34.735  -12.833 14.914  1.00 17.33 ? 395  HIS A CA  1 
ATOM   3164 C C   . HIS A  1 396 ? 34.556  -14.176 15.625  1.00 18.45 ? 395  HIS A C   1 
ATOM   3165 O O   . HIS A  1 396 ? 35.235  -15.150 15.288  1.00 18.37 ? 395  HIS A O   1 
ATOM   3166 C CB  . HIS A  1 396 ? 35.785  -12.006 15.681  1.00 17.73 ? 395  HIS A CB  1 
ATOM   3167 C CG  . HIS A  1 396 ? 36.391  -10.900 14.870  1.00 17.64 ? 395  HIS A CG  1 
ATOM   3168 N ND1 . HIS A  1 396 ? 37.441  -11.106 14.000  1.00 18.36 ? 395  HIS A ND1 1 
ATOM   3169 C CD2 . HIS A  1 396 ? 36.094  -9.578  14.795  1.00 18.77 ? 395  HIS A CD2 1 
ATOM   3170 C CE1 . HIS A  1 396 ? 37.756  -9.963  13.412  1.00 16.95 ? 395  HIS A CE1 1 
ATOM   3171 N NE2 . HIS A  1 396 ? 36.953  -9.020  13.874  1.00 18.76 ? 395  HIS A NE2 1 
ATOM   3172 N N   . GLN A  1 397 ? 33.657  -14.226 16.609  1.00 18.48 ? 396  GLN A N   1 
ATOM   3173 C CA  . GLN A  1 397 ? 33.644  -15.355 17.553  1.00 19.33 ? 396  GLN A CA  1 
ATOM   3174 C C   . GLN A  1 397 ? 32.248  -15.861 17.929  1.00 19.75 ? 396  GLN A C   1 
ATOM   3175 O O   . GLN A  1 397 ? 32.094  -16.602 18.906  1.00 20.26 ? 396  GLN A O   1 
ATOM   3176 C CB  . GLN A  1 397 ? 34.409  -14.970 18.822  1.00 19.88 ? 396  GLN A CB  1 
ATOM   3177 C CG  . GLN A  1 397 ? 35.950  -15.017 18.731  1.00 20.04 ? 396  GLN A CG  1 
ATOM   3178 C CD  . GLN A  1 397 ? 36.600  -14.957 20.116  1.00 20.89 ? 396  GLN A CD  1 
ATOM   3179 O OE1 . GLN A  1 397 ? 36.069  -14.316 21.030  1.00 18.13 ? 396  GLN A OE1 1 
ATOM   3180 N NE2 . GLN A  1 397 ? 37.751  -15.624 20.272  1.00 20.09 ? 396  GLN A NE2 1 
ATOM   3181 N N   . GLY A  1 398 ? 31.233  -15.442 17.172  1.00 19.09 ? 397  GLY A N   1 
ATOM   3182 C CA  . GLY A  1 398 ? 29.888  -15.991 17.298  1.00 19.37 ? 397  GLY A CA  1 
ATOM   3183 C C   . GLY A  1 398 ? 29.696  -17.276 16.506  1.00 19.96 ? 397  GLY A C   1 
ATOM   3184 O O   . GLY A  1 398 ? 30.676  -17.946 16.105  1.00 20.52 ? 397  GLY A O   1 
ATOM   3185 N N   . THR A  1 399 ? 28.434  -17.635 16.277  1.00 19.62 ? 398  THR A N   1 
ATOM   3186 C CA  . THR A  1 399 ? 28.103  -18.866 15.554  1.00 19.62 ? 398  THR A CA  1 
ATOM   3187 C C   . THR A  1 399 ? 27.409  -18.650 14.203  1.00 20.20 ? 398  THR A C   1 
ATOM   3188 O O   . THR A  1 399 ? 26.845  -19.594 13.656  1.00 21.04 ? 398  THR A O   1 
ATOM   3189 C CB  . THR A  1 399 ? 27.194  -19.769 16.417  1.00 19.90 ? 398  THR A CB  1 
ATOM   3190 O OG1 . THR A  1 399 ? 26.047  -19.023 16.854  1.00 19.07 ? 398  THR A OG1 1 
ATOM   3191 C CG2 . THR A  1 399 ? 27.897  -20.174 17.701  1.00 18.65 ? 398  THR A CG2 1 
ATOM   3192 N N   . LYS A  1 400 ? 27.457  -17.420 13.690  1.00 20.34 ? 399  LYS A N   1 
ATOM   3193 C CA  . LYS A  1 400 ? 26.836  -17.052 12.410  1.00 20.31 ? 399  LYS A CA  1 
ATOM   3194 C C   . LYS A  1 400 ? 27.911  -16.731 11.376  1.00 19.38 ? 399  LYS A C   1 
ATOM   3195 O O   . LYS A  1 400 ? 28.934  -16.117 11.689  1.00 20.19 ? 399  LYS A O   1 
ATOM   3196 C CB  . LYS A  1 400 ? 25.962  -15.786 12.569  1.00 20.53 ? 399  LYS A CB  1 
ATOM   3197 C CG  . LYS A  1 400 ? 24.536  -16.000 13.077  1.00 22.09 ? 399  LYS A CG  1 
ATOM   3198 C CD  . LYS A  1 400 ? 24.473  -16.021 14.614  1.00 22.47 ? 399  LYS A CD  1 
ATOM   3199 C CE  . LYS A  1 400 ? 23.027  -16.261 15.049  1.00 23.85 ? 399  LYS A CE  1 
ATOM   3200 N NZ  . LYS A  1 400 ? 22.890  -16.946 16.379  1.00 22.67 ? 399  LYS A NZ  1 
ATOM   3201 N N   . MET A  1 401 ? 27.669  -17.150 10.141  1.00 18.94 ? 400  MET A N   1 
ATOM   3202 C CA  . MET A  1 401 ? 28.460  -16.689 9.009   1.00 18.30 ? 400  MET A CA  1 
ATOM   3203 C C   . MET A  1 401 ? 27.768  -15.451 8.436   1.00 17.01 ? 400  MET A C   1 
ATOM   3204 O O   . MET A  1 401 ? 26.567  -15.472 8.152   1.00 17.05 ? 400  MET A O   1 
ATOM   3205 C CB  . MET A  1 401 ? 28.535  -17.791 7.958   1.00 18.92 ? 400  MET A CB  1 
ATOM   3206 C CG  . MET A  1 401 ? 29.364  -17.440 6.751   1.00 21.50 ? 400  MET A CG  1 
ATOM   3207 S SD  . MET A  1 401 ? 29.304  -18.833 5.591   1.00 27.63 ? 400  MET A SD  1 
ATOM   3208 C CE  . MET A  1 401 ? 30.306  -18.226 4.397   1.00 25.52 ? 400  MET A CE  1 
ATOM   3209 N N   . ILE A  1 402 ? 28.540  -14.376 8.276   1.00 16.15 ? 401  ILE A N   1 
ATOM   3210 C CA  . ILE A  1 402 ? 27.997  -13.064 7.924   1.00 15.21 ? 401  ILE A CA  1 
ATOM   3211 C C   . ILE A  1 402 ? 28.855  -12.425 6.838   1.00 14.78 ? 401  ILE A C   1 
ATOM   3212 O O   . ILE A  1 402 ? 29.888  -11.837 7.130   1.00 15.96 ? 401  ILE A O   1 
ATOM   3213 C CB  . ILE A  1 402 ? 27.965  -12.137 9.164   1.00 15.44 ? 401  ILE A CB  1 
ATOM   3214 C CG1 . ILE A  1 402 ? 27.156  -12.770 10.310  1.00 15.84 ? 401  ILE A CG1 1 
ATOM   3215 C CG2 . ILE A  1 402 ? 27.398  -10.737 8.784   1.00 14.96 ? 401  ILE A CG2 1 
ATOM   3216 C CD1 . ILE A  1 402 ? 27.401  -12.110 11.688  1.00 15.86 ? 401  ILE A CD1 1 
ATOM   3217 N N   . PRO A  1 403 ? 28.451  -12.541 5.578   1.00 15.07 ? 402  PRO A N   1 
ATOM   3218 C CA  . PRO A  1 403 ? 29.172  -11.809 4.527   1.00 15.26 ? 402  PRO A CA  1 
ATOM   3219 C C   . PRO A  1 403 ? 29.140  -10.309 4.850   1.00 14.60 ? 402  PRO A C   1 
ATOM   3220 O O   . PRO A  1 403 ? 28.060  -9.789  5.160   1.00 14.81 ? 402  PRO A O   1 
ATOM   3221 C CB  . PRO A  1 403 ? 28.353  -12.109 3.269   1.00 15.63 ? 402  PRO A CB  1 
ATOM   3222 C CG  . PRO A  1 403 ? 27.612  -13.391 3.603   1.00 16.41 ? 402  PRO A CG  1 
ATOM   3223 C CD  . PRO A  1 403 ? 27.309  -13.314 5.063   1.00 15.92 ? 402  PRO A CD  1 
ATOM   3224 N N   . CYS A  1 404 ? 30.294  -9.646  4.775   1.00 14.99 ? 403  CYS A N   1 
ATOM   3225 C CA  . CYS A  1 404 ? 30.389  -8.199  5.026   1.00 14.42 ? 403  CYS A CA  1 
ATOM   3226 C C   . CYS A  1 404 ? 31.000  -7.489  3.830   1.00 14.25 ? 403  CYS A C   1 
ATOM   3227 O O   . CYS A  1 404 ? 31.993  -7.956  3.265   1.00 15.32 ? 403  CYS A O   1 
ATOM   3228 C CB  . CYS A  1 404 ? 31.282  -7.928  6.232   1.00 14.99 ? 403  CYS A CB  1 
ATOM   3229 S SG  . CYS A  1 404 ? 30.713  -8.580  7.803   1.00 15.76 ? 403  CYS A SG  1 
ATOM   3230 N N   . ASP A  1 405 ? 30.443  -6.335  3.459   1.00 13.60 ? 404  ASP A N   1 
ATOM   3231 C CA  . ASP A  1 405 ? 31.136  -5.404  2.550   1.00 13.77 ? 404  ASP A CA  1 
ATOM   3232 C C   . ASP A  1 405 ? 31.729  -4.259  3.380   1.00 13.55 ? 404  ASP A C   1 
ATOM   3233 O O   . ASP A  1 405 ? 30.986  -3.518  4.040   1.00 13.39 ? 404  ASP A O   1 
ATOM   3234 C CB  . ASP A  1 405 ? 30.190  -4.788  1.528   1.00 14.13 ? 404  ASP A CB  1 
ATOM   3235 C CG  . ASP A  1 405 ? 29.622  -5.791  0.555   1.00 13.92 ? 404  ASP A CG  1 
ATOM   3236 O OD1 . ASP A  1 405 ? 30.125  -6.949  0.457   1.00 14.88 ? 404  ASP A OD1 1 
ATOM   3237 O OD2 . ASP A  1 405 ? 28.647  -5.492  -0.151  1.00 16.75 ? 404  ASP A OD2 1 
ATOM   3238 N N   . PHE A  1 406 ? 33.051  -4.127  3.347   1.00 13.33 ? 405  PHE A N   1 
ATOM   3239 C CA  . PHE A  1 406 ? 33.757  -2.995  3.975   1.00 13.27 ? 405  PHE A CA  1 
ATOM   3240 C C   . PHE A  1 406 ? 34.012  -1.938  2.880   1.00 13.68 ? 405  PHE A C   1 
ATOM   3241 O O   . PHE A  1 406 ? 34.522  -2.283  1.791   1.00 14.45 ? 405  PHE A O   1 
ATOM   3242 C CB  . PHE A  1 406 ? 35.101  -3.485  4.529   1.00 12.99 ? 405  PHE A CB  1 
ATOM   3243 C CG  . PHE A  1 406 ? 34.996  -4.232  5.831   1.00 12.21 ? 405  PHE A CG  1 
ATOM   3244 C CD1 . PHE A  1 406 ? 34.374  -5.479  5.905   1.00 13.47 ? 405  PHE A CD1 1 
ATOM   3245 C CD2 . PHE A  1 406 ? 35.564  -3.704  6.981   1.00 13.37 ? 405  PHE A CD2 1 
ATOM   3246 C CE1 . PHE A  1 406 ? 34.282  -6.168  7.130   1.00 14.39 ? 405  PHE A CE1 1 
ATOM   3247 C CE2 . PHE A  1 406 ? 35.491  -4.385  8.187   1.00 14.52 ? 405  PHE A CE2 1 
ATOM   3248 C CZ  . PHE A  1 406 ? 34.847  -5.616  8.262   1.00 14.19 ? 405  PHE A CZ  1 
ATOM   3249 N N   . LEU A  1 407 ? 33.647  -0.677  3.141   1.00 13.56 ? 406  LEU A N   1 
ATOM   3250 C CA  . LEU A  1 407 ? 33.818  0.397   2.159   1.00 13.31 ? 406  LEU A CA  1 
ATOM   3251 C C   . LEU A  1 407 ? 34.635  1.545   2.758   1.00 13.19 ? 406  LEU A C   1 
ATOM   3252 O O   . LEU A  1 407 ? 34.476  1.841   3.944   1.00 13.75 ? 406  LEU A O   1 
ATOM   3253 C CB  . LEU A  1 407 ? 32.445  0.945   1.706   1.00 13.17 ? 406  LEU A CB  1 
ATOM   3254 C CG  . LEU A  1 407 ? 31.464  -0.095  1.127   1.00 13.73 ? 406  LEU A CG  1 
ATOM   3255 C CD1 . LEU A  1 407 ? 30.442  -0.546  2.189   1.00 15.21 ? 406  LEU A CD1 1 
ATOM   3256 C CD2 . LEU A  1 407 ? 30.750  0.467   -0.070  1.00 15.23 ? 406  LEU A CD2 1 
ATOM   3257 N N   . ILE A  1 408 ? 35.496  2.180   1.962   1.00 12.61 ? 407  ILE A N   1 
ATOM   3258 C CA  . ILE A  1 408 ? 36.236  3.377   2.449   1.00 13.06 ? 407  ILE A CA  1 
ATOM   3259 C C   . ILE A  1 408 ? 36.783  4.253   1.314   1.00 13.47 ? 407  ILE A C   1 
ATOM   3260 O O   . ILE A  1 408 ? 37.225  3.729   0.293   1.00 13.19 ? 407  ILE A O   1 
ATOM   3261 C CB  . ILE A  1 408 ? 37.373  2.969   3.439   1.00 13.67 ? 407  ILE A CB  1 
ATOM   3262 C CG1 . ILE A  1 408 ? 37.814  4.167   4.287   1.00 13.35 ? 407  ILE A CG1 1 
ATOM   3263 C CG2 . ILE A  1 408 ? 38.603  2.361   2.722   1.00 12.85 ? 407  ILE A CG2 1 
ATOM   3264 C CD1 . ILE A  1 408 ? 38.810  3.784   5.404   1.00 14.48 ? 407  ILE A CD1 1 
ATOM   3265 N N   . PRO A  1 409 ? 36.735  5.579   1.469   1.00 13.42 ? 408  PRO A N   1 
ATOM   3266 C CA  . PRO A  1 409 ? 37.518  6.473   0.595   1.00 13.47 ? 408  PRO A CA  1 
ATOM   3267 C C   . PRO A  1 409 ? 38.992  6.566   1.010   1.00 14.02 ? 408  PRO A C   1 
ATOM   3268 O O   . PRO A  1 409 ? 39.300  6.684   2.191   1.00 13.92 ? 408  PRO A O   1 
ATOM   3269 C CB  . PRO A  1 409 ? 36.850  7.831   0.800   1.00 13.76 ? 408  PRO A CB  1 
ATOM   3270 C CG  . PRO A  1 409 ? 36.352  7.797   2.227   1.00 14.50 ? 408  PRO A CG  1 
ATOM   3271 C CD  . PRO A  1 409 ? 35.915  6.338   2.448   1.00 14.21 ? 408  PRO A CD  1 
ATOM   3272 N N   . VAL A  1 410 ? 39.884  6.553   0.023   1.00 13.56 ? 409  VAL A N   1 
ATOM   3273 C CA  . VAL A  1 410 ? 41.319  6.755   0.263   1.00 14.20 ? 409  VAL A CA  1 
ATOM   3274 C C   . VAL A  1 410 ? 41.570  8.164   0.804   1.00 14.68 ? 409  VAL A C   1 
ATOM   3275 O O   . VAL A  1 410 ? 42.272  8.312   1.813   1.00 15.01 ? 409  VAL A O   1 
ATOM   3276 C CB  . VAL A  1 410 ? 42.114  6.552   -1.035  1.00 14.35 ? 409  VAL A CB  1 
ATOM   3277 C CG1 . VAL A  1 410 ? 43.611  6.823   -0.787  1.00 14.38 ? 409  VAL A CG1 1 
ATOM   3278 C CG2 . VAL A  1 410 ? 41.915  5.126   -1.530  1.00 13.94 ? 409  VAL A CG2 1 
ATOM   3279 N N   . GLN A  1 411 ? 40.972  9.163   0.140   1.00 14.36 ? 410  GLN A N   1 
ATOM   3280 C CA  . GLN A  1 411 ? 41.079  10.578  0.553   1.00 14.95 ? 410  GLN A CA  1 
ATOM   3281 C C   . GLN A  1 411 ? 39.924  11.001  1.452   1.00 15.66 ? 410  GLN A C   1 
ATOM   3282 O O   . GLN A  1 411 ? 38.754  10.874  1.090   1.00 16.07 ? 410  GLN A O   1 
ATOM   3283 C CB  . GLN A  1 411 ? 41.162  11.495  -0.664  1.00 15.99 ? 410  GLN A CB  1 
ATOM   3284 C CG  . GLN A  1 411 ? 42.349  11.189  -1.582  1.00 17.56 ? 410  GLN A CG  1 
ATOM   3285 C CD  . GLN A  1 411 ? 42.376  12.030  -2.831  1.00 19.02 ? 410  GLN A CD  1 
ATOM   3286 O OE1 . GLN A  1 411 ? 41.803  13.119  -2.875  1.00 19.73 ? 410  GLN A OE1 1 
ATOM   3287 N NE2 . GLN A  1 411 ? 43.073  11.541  -3.855  1.00 19.06 ? 410  GLN A NE2 1 
ATOM   3288 N N   . THR A  1 412 ? 40.264  11.513  2.633   1.00 16.12 ? 411  THR A N   1 
ATOM   3289 C CA  . THR A  1 412 ? 39.260  12.083  3.528   1.00 16.39 ? 411  THR A CA  1 
ATOM   3290 C C   . THR A  1 412 ? 38.878  13.531  3.165   1.00 16.78 ? 411  THR A C   1 
ATOM   3291 O O   . THR A  1 412 ? 39.684  14.301  2.615   1.00 16.88 ? 411  THR A O   1 
ATOM   3292 C CB  . THR A  1 412 ? 39.712  11.952  5.001   1.00 15.49 ? 411  THR A CB  1 
ATOM   3293 O OG1 . THR A  1 412 ? 38.710  12.503  5.867   1.00 16.35 ? 411  THR A OG1 1 
ATOM   3294 C CG2 . THR A  1 412 ? 40.988  12.802  5.294   1.00 15.22 ? 411  THR A CG2 1 
ATOM   3295 N N   . GLN A  1 413 ? 37.639  13.897  3.495   1.00 16.64 ? 412  GLN A N   1 
ATOM   3296 C CA  . GLN A  1 413 ? 37.176  15.270  3.372   1.00 17.68 ? 412  GLN A CA  1 
ATOM   3297 C C   . GLN A  1 413 ? 37.762  16.177  4.467   1.00 18.40 ? 412  GLN A C   1 
ATOM   3298 O O   . GLN A  1 413 ? 37.697  17.404  4.348   1.00 19.55 ? 412  GLN A O   1 
ATOM   3299 C CB  . GLN A  1 413 ? 35.651  15.315  3.442   1.00 17.31 ? 412  GLN A CB  1 
ATOM   3300 C CG  . GLN A  1 413 ? 34.934  14.525  2.332   1.00 16.55 ? 412  GLN A CG  1 
ATOM   3301 C CD  . GLN A  1 413 ? 34.905  15.229  0.984   1.00 17.82 ? 412  GLN A CD  1 
ATOM   3302 O OE1 . GLN A  1 413 ? 35.146  16.435  0.894   1.00 20.76 ? 412  GLN A OE1 1 
ATOM   3303 N NE2 . GLN A  1 413 ? 34.633  14.470  -0.076  1.00 17.82 ? 412  GLN A NE2 1 
ATOM   3304 N N   . HIS A  1 414 ? 38.314  15.580  5.524   1.00 18.20 ? 413  HIS A N   1 
ATOM   3305 C CA  . HIS A  1 414 ? 38.848  16.346  6.655   1.00 19.07 ? 413  HIS A CA  1 
ATOM   3306 C C   . HIS A  1 414 ? 40.205  15.801  7.110   1.00 18.06 ? 413  HIS A C   1 
ATOM   3307 O O   . HIS A  1 414 ? 40.271  15.080  8.098   1.00 18.72 ? 413  HIS A O   1 
ATOM   3308 C CB  . HIS A  1 414 ? 37.850  16.321  7.827   1.00 19.00 ? 413  HIS A CB  1 
ATOM   3309 C CG  . HIS A  1 414 ? 36.526  16.938  7.503   1.00 20.30 ? 413  HIS A CG  1 
ATOM   3310 N ND1 . HIS A  1 414 ? 36.326  18.303  7.471   1.00 22.00 ? 413  HIS A ND1 1 
ATOM   3311 C CD2 . HIS A  1 414 ? 35.339  16.374  7.171   1.00 20.73 ? 413  HIS A CD2 1 
ATOM   3312 C CE1 . HIS A  1 414 ? 35.068  18.552  7.147   1.00 21.98 ? 413  HIS A CE1 1 
ATOM   3313 N NE2 . HIS A  1 414 ? 34.451  17.397  6.957   1.00 20.72 ? 413  HIS A NE2 1 
ATOM   3314 N N   . PRO A  1 415 ? 41.281  16.127  6.388   1.00 18.04 ? 414  PRO A N   1 
ATOM   3315 C CA  . PRO A  1 415 ? 42.616  15.591  6.692   1.00 18.96 ? 414  PRO A CA  1 
ATOM   3316 C C   . PRO A  1 415 ? 43.270  16.293  7.872   1.00 19.85 ? 414  PRO A C   1 
ATOM   3317 O O   . PRO A  1 415 ? 44.381  16.833  7.746   1.00 20.67 ? 414  PRO A O   1 
ATOM   3318 C CB  . PRO A  1 415 ? 43.393  15.829  5.384   1.00 18.45 ? 414  PRO A CB  1 
ATOM   3319 C CG  . PRO A  1 415 ? 42.780  17.057  4.832   1.00 19.15 ? 414  PRO A CG  1 
ATOM   3320 C CD  . PRO A  1 415 ? 41.302  17.010  5.205   1.00 17.81 ? 414  PRO A CD  1 
ATOM   3321 N N   . ILE A  1 416 ? 42.586  16.252  9.015   1.00 19.88 ? 415  ILE A N   1 
ATOM   3322 C CA  . ILE A  1 416 ? 43.074  16.893  10.244  1.00 20.34 ? 415  ILE A CA  1 
ATOM   3323 C C   . ILE A  1 416 ? 44.301  16.191  10.839  1.00 20.68 ? 415  ILE A C   1 
ATOM   3324 O O   . ILE A  1 416 ? 44.570  15.031  10.536  1.00 21.00 ? 415  ILE A O   1 
ATOM   3325 C CB  . ILE A  1 416 ? 41.943  16.987  11.295  1.00 20.20 ? 415  ILE A CB  1 
ATOM   3326 C CG1 . ILE A  1 416 ? 41.453  15.595  11.709  1.00 20.54 ? 415  ILE A CG1 1 
ATOM   3327 C CG2 . ILE A  1 416 ? 40.805  17.866  10.781  1.00 20.31 ? 415  ILE A CG2 1 
ATOM   3328 C CD1 . ILE A  1 416 ? 40.496  15.625  12.900  1.00 19.35 ? 415  ILE A CD1 1 
ATOM   3329 N N   . ARG A  1 417 ? 45.051  16.909  11.683  1.00 21.37 ? 416  ARG A N   1 
ATOM   3330 C CA  . ARG A  1 417 ? 46.242  16.354  12.342  1.00 21.70 ? 416  ARG A CA  1 
ATOM   3331 C C   . ARG A  1 417 ? 47.207  15.730  11.333  1.00 21.77 ? 416  ARG A C   1 
ATOM   3332 O O   . ARG A  1 417 ? 47.769  14.662  11.590  1.00 21.72 ? 416  ARG A O   1 
ATOM   3333 C CB  . ARG A  1 417 ? 45.862  15.316  13.409  1.00 21.83 ? 416  ARG A CB  1 
ATOM   3334 C CG  . ARG A  1 417 ? 44.867  15.781  14.481  1.00 23.47 ? 416  ARG A CG  1 
ATOM   3335 C CD  . ARG A  1 417 ? 45.503  16.472  15.692  1.00 23.66 ? 416  ARG A CD  1 
ATOM   3336 N NE  . ARG A  1 417 ? 46.691  15.782  16.215  1.00 25.39 ? 416  ARG A NE  1 
ATOM   3337 C CZ  . ARG A  1 417 ? 46.683  14.837  17.156  1.00 24.76 ? 416  ARG A CZ  1 
ATOM   3338 N NH1 . ARG A  1 417 ? 45.545  14.407  17.687  1.00 23.95 ? 416  ARG A NH1 1 
ATOM   3339 N NH2 . ARG A  1 417 ? 47.830  14.301  17.558  1.00 26.40 ? 416  ARG A NH2 1 
ATOM   3340 N N   . LYS A  1 418 ? 47.371  16.398  10.190  1.00 21.93 ? 417  LYS A N   1 
ATOM   3341 C CA  . LYS A  1 418 ? 48.245  15.940  9.099   1.00 22.53 ? 417  LYS A CA  1 
ATOM   3342 C C   . LYS A  1 418 ? 47.936  14.513  8.637   1.00 22.14 ? 417  LYS A C   1 
ATOM   3343 O O   . LYS A  1 418 ? 48.831  13.769  8.209   1.00 22.35 ? 417  LYS A O   1 
ATOM   3344 C CB  . LYS A  1 418 ? 49.727  16.088  9.485   1.00 22.94 ? 417  LYS A CB  1 
ATOM   3345 C CG  . LYS A  1 418 ? 50.163  17.533  9.736   1.00 25.94 ? 417  LYS A CG  1 
ATOM   3346 C CD  . LYS A  1 418 ? 51.569  17.597  10.343  1.00 31.06 ? 417  LYS A CD  1 
ATOM   3347 C CE  . LYS A  1 418 ? 52.650  17.576  9.270   1.00 34.43 ? 417  LYS A CE  1 
ATOM   3348 N NZ  . LYS A  1 418 ? 53.727  16.590  9.593   1.00 37.58 ? 417  LYS A NZ  1 
ATOM   3349 N N   . GLY A  1 419 ? 46.657  14.139  8.730   1.00 20.94 ? 418  GLY A N   1 
ATOM   3350 C CA  . GLY A  1 419 ? 46.199  12.848  8.229   1.00 20.36 ? 418  GLY A CA  1 
ATOM   3351 C C   . GLY A  1 419 ? 46.167  11.720  9.242   1.00 20.02 ? 418  GLY A C   1 
ATOM   3352 O O   . GLY A  1 419 ? 45.851  10.584  8.879   1.00 19.04 ? 418  GLY A O   1 
ATOM   3353 N N   . LEU A  1 420 ? 46.444  12.028  10.510  1.00 18.80 ? 419  LEU A N   1 
ATOM   3354 C CA  . LEU A  1 420 ? 46.566  11.013  11.561  1.00 18.53 ? 419  LEU A CA  1 
ATOM   3355 C C   . LEU A  1 420 ? 45.284  10.195  11.760  1.00 17.48 ? 419  LEU A C   1 
ATOM   3356 O O   . LEU A  1 420 ? 45.347  8.978   11.891  1.00 17.69 ? 419  LEU A O   1 
ATOM   3357 C CB  . LEU A  1 420 ? 46.976  11.652  12.900  1.00 19.34 ? 419  LEU A CB  1 
ATOM   3358 C CG  . LEU A  1 420 ? 47.039  10.748  14.145  1.00 20.87 ? 419  LEU A CG  1 
ATOM   3359 C CD1 . LEU A  1 420 ? 48.049  9.585   13.990  1.00 22.64 ? 419  LEU A CD1 1 
ATOM   3360 C CD2 . LEU A  1 420 ? 47.345  11.571  15.392  1.00 21.89 ? 419  LEU A CD2 1 
ATOM   3361 N N   . HIS A  1 421 ? 44.141  10.880  11.811  1.00 16.99 ? 420  HIS A N   1 
ATOM   3362 C CA  . HIS A  1 421 ? 42.861  10.211  12.015  1.00 16.58 ? 420  HIS A CA  1 
ATOM   3363 C C   . HIS A  1 421 ? 42.565  9.230   10.877  1.00 16.85 ? 420  HIS A C   1 
ATOM   3364 O O   . HIS A  1 421 ? 42.141  8.095   11.118  1.00 16.80 ? 420  HIS A O   1 
ATOM   3365 C CB  . HIS A  1 421 ? 41.723  11.249  12.146  1.00 15.60 ? 420  HIS A CB  1 
ATOM   3366 C CG  . HIS A  1 421 ? 41.588  11.873  13.511  1.00 16.43 ? 420  HIS A CG  1 
ATOM   3367 N ND1 . HIS A  1 421 ? 42.492  12.785  14.020  1.00 19.10 ? 420  HIS A ND1 1 
ATOM   3368 C CD2 . HIS A  1 421 ? 40.605  11.768  14.435  1.00 14.76 ? 420  HIS A CD2 1 
ATOM   3369 C CE1 . HIS A  1 421 ? 42.079  13.199  15.209  1.00 15.26 ? 420  HIS A CE1 1 
ATOM   3370 N NE2 . HIS A  1 421 ? 40.949  12.577  15.497  1.00 18.11 ? 420  HIS A NE2 1 
ATOM   3371 N N   . HIS A  1 422 ? 42.792  9.670   9.639   1.00 16.40 ? 421  HIS A N   1 
ATOM   3372 C CA  . HIS A  1 422 ? 42.471  8.842   8.481   1.00 15.81 ? 421  HIS A CA  1 
ATOM   3373 C C   . HIS A  1 422 ? 43.434  7.669   8.330   1.00 15.48 ? 421  HIS A C   1 
ATOM   3374 O O   . HIS A  1 422 ? 43.041  6.588   7.876   1.00 15.75 ? 421  HIS A O   1 
ATOM   3375 C CB  . HIS A  1 422 ? 42.395  9.669   7.205   1.00 15.70 ? 421  HIS A CB  1 
ATOM   3376 C CG  . HIS A  1 422 ? 41.562  9.027   6.135   1.00 14.54 ? 421  HIS A CG  1 
ATOM   3377 N ND1 . HIS A  1 422 ? 40.245  8.669   6.335   1.00 14.90 ? 421  HIS A ND1 1 
ATOM   3378 C CD2 . HIS A  1 422 ? 41.860  8.672   4.863   1.00 15.49 ? 421  HIS A CD2 1 
ATOM   3379 C CE1 . HIS A  1 422 ? 39.767  8.120   5.234   1.00 15.38 ? 421  HIS A CE1 1 
ATOM   3380 N NE2 . HIS A  1 422 ? 40.729  8.100   4.326   1.00 13.72 ? 421  HIS A NE2 1 
ATOM   3381 N N   . LYS A  1 423 ? 44.693  7.896   8.699   1.00 15.52 ? 422  LYS A N   1 
ATOM   3382 C CA  . LYS A  1 423 ? 45.674  6.807   8.784   1.00 15.91 ? 422  LYS A CA  1 
ATOM   3383 C C   . LYS A  1 423 ? 45.192  5.672   9.714   1.00 15.93 ? 422  LYS A C   1 
ATOM   3384 O O   . LYS A  1 423 ? 45.260  4.484   9.353   1.00 16.11 ? 422  LYS A O   1 
ATOM   3385 C CB  . LYS A  1 423 ? 47.038  7.352   9.247   1.00 16.83 ? 422  LYS A CB  1 
ATOM   3386 C CG  . LYS A  1 423 ? 48.082  6.240   9.515   1.00 19.56 ? 422  LYS A CG  1 
ATOM   3387 C CD  . LYS A  1 423 ? 49.480  6.801   9.725   1.00 23.01 ? 422  LYS A CD  1 
ATOM   3388 C CE  . LYS A  1 423 ? 49.648  7.302   11.138  1.00 25.35 ? 422  LYS A CE  1 
ATOM   3389 N NZ  . LYS A  1 423 ? 50.873  8.150   11.234  1.00 26.61 ? 422  LYS A NZ  1 
ATOM   3390 N N   . ILE A  1 424 ? 44.704  6.044   10.902  1.00 15.41 ? 423  ILE A N   1 
ATOM   3391 C CA  . ILE A  1 424 ? 44.202  5.088   11.886  1.00 15.77 ? 423  ILE A CA  1 
ATOM   3392 C C   . ILE A  1 424 ? 42.933  4.407   11.335  1.00 14.97 ? 423  ILE A C   1 
ATOM   3393 O O   . ILE A  1 424 ? 42.797  3.187   11.410  1.00 15.86 ? 423  ILE A O   1 
ATOM   3394 C CB  . ILE A  1 424 ? 43.952  5.773   13.257  1.00 15.39 ? 423  ILE A CB  1 
ATOM   3395 C CG1 . ILE A  1 424 ? 45.286  6.328   13.814  1.00 17.05 ? 423  ILE A CG1 1 
ATOM   3396 C CG2 . ILE A  1 424 ? 43.279  4.791   14.231  1.00 16.37 ? 423  ILE A CG2 1 
ATOM   3397 C CD1 . ILE A  1 424 ? 45.141  7.236   15.053  1.00 18.20 ? 423  ILE A CD1 1 
ATOM   3398 N N   . LEU A  1 425 ? 42.029  5.197   10.773  1.00 15.17 ? 424  LEU A N   1 
ATOM   3399 C CA  . LEU A  1 425 ? 40.816  4.647   10.151  1.00 14.14 ? 424  LEU A CA  1 
ATOM   3400 C C   . LEU A  1 425 ? 41.117  3.586   9.087   1.00 15.16 ? 424  LEU A C   1 
ATOM   3401 O O   . LEU A  1 425 ? 40.551  2.471   9.128   1.00 15.23 ? 424  LEU A O   1 
ATOM   3402 C CB  . LEU A  1 425 ? 39.976  5.787   9.537   1.00 13.88 ? 424  LEU A CB  1 
ATOM   3403 C CG  . LEU A  1 425 ? 38.568  5.396   9.060   1.00 12.78 ? 424  LEU A CG  1 
ATOM   3404 C CD1 . LEU A  1 425 ? 37.648  4.977   10.211  1.00 15.68 ? 424  LEU A CD1 1 
ATOM   3405 C CD2 . LEU A  1 425 ? 37.928  6.533   8.230   1.00 14.05 ? 424  LEU A CD2 1 
ATOM   3406 N N   . LEU A  1 426 ? 41.992  3.941   8.142   1.00 15.13 ? 425  LEU A N   1 
ATOM   3407 C CA  . LEU A  1 426 ? 42.448  3.006   7.104   1.00 15.37 ? 425  LEU A CA  1 
ATOM   3408 C C   . LEU A  1 426 ? 43.077  1.736   7.695   1.00 15.15 ? 425  LEU A C   1 
ATOM   3409 O O   . LEU A  1 426 ? 42.800  0.631   7.230   1.00 15.30 ? 425  LEU A O   1 
ATOM   3410 C CB  . LEU A  1 426 ? 43.434  3.699   6.144   1.00 15.46 ? 425  LEU A CB  1 
ATOM   3411 C CG  . LEU A  1 426 ? 42.849  4.665   5.102   1.00 16.25 ? 425  LEU A CG  1 
ATOM   3412 C CD1 . LEU A  1 426 ? 43.921  5.636   4.589   1.00 17.61 ? 425  LEU A CD1 1 
ATOM   3413 C CD2 . LEU A  1 426 ? 42.219  3.929   3.926   1.00 16.43 ? 425  LEU A CD2 1 
ATOM   3414 N N   . ALA A  1 427 ? 43.940  1.881   8.711   1.00 15.35 ? 426  ALA A N   1 
ATOM   3415 C CA  . ALA A  1 427 ? 44.566  0.718   9.351   1.00 15.75 ? 426  ALA A CA  1 
ATOM   3416 C C   . ALA A  1 427 ? 43.543  -0.279  9.909   1.00 15.64 ? 426  ALA A C   1 
ATOM   3417 O O   . ALA A  1 427 ? 43.711  -1.500  9.779   1.00 15.87 ? 426  ALA A O   1 
ATOM   3418 C CB  . ALA A  1 427 ? 45.533  1.166   10.469  1.00 15.97 ? 426  ALA A CB  1 
ATOM   3419 N N   . ASN A  1 428 ? 42.511  0.247   10.569  1.00 16.04 ? 427  ASN A N   1 
ATOM   3420 C CA  . ASN A  1 428 ? 41.419  -0.580  11.084  1.00 16.07 ? 427  ASN A CA  1 
ATOM   3421 C C   . ASN A  1 428 ? 40.601  -1.250  9.977   1.00 15.96 ? 427  ASN A C   1 
ATOM   3422 O O   . ASN A  1 428 ? 40.282  -2.439  10.080  1.00 16.22 ? 427  ASN A O   1 
ATOM   3423 C CB  . ASN A  1 428 ? 40.524  0.243   12.014  1.00 16.37 ? 427  ASN A CB  1 
ATOM   3424 C CG  . ASN A  1 428 ? 41.134  0.416   13.394  1.00 17.27 ? 427  ASN A CG  1 
ATOM   3425 O OD1 . ASN A  1 428 ? 40.933  -0.416  14.289  1.00 17.68 ? 427  ASN A OD1 1 
ATOM   3426 N ND2 . ASN A  1 428 ? 41.869  1.505   13.581  1.00 19.46 ? 427  ASN A ND2 1 
ATOM   3427 N N   . PHE A  1 429 ? 40.307  -0.495  8.915   1.00 15.80 ? 428  PHE A N   1 
ATOM   3428 C CA  . PHE A  1 429 ? 39.635  -1.022  7.728   1.00 15.48 ? 428  PHE A CA  1 
ATOM   3429 C C   . PHE A  1 429 ? 40.359  -2.247  7.174   1.00 16.03 ? 428  PHE A C   1 
ATOM   3430 O O   . PHE A  1 429 ? 39.745  -3.287  6.905   1.00 15.96 ? 428  PHE A O   1 
ATOM   3431 C CB  . PHE A  1 429 ? 39.518  0.086   6.668   1.00 15.68 ? 428  PHE A CB  1 
ATOM   3432 C CG  . PHE A  1 429 ? 39.000  -0.380  5.337   1.00 15.67 ? 428  PHE A CG  1 
ATOM   3433 C CD1 . PHE A  1 429 ? 37.632  -0.333  5.048   1.00 14.68 ? 428  PHE A CD1 1 
ATOM   3434 C CD2 . PHE A  1 429 ? 39.878  -0.848  4.350   1.00 15.90 ? 428  PHE A CD2 1 
ATOM   3435 C CE1 . PHE A  1 429 ? 37.154  -0.750  3.796   1.00 14.91 ? 428  PHE A CE1 1 
ATOM   3436 C CE2 . PHE A  1 429 ? 39.407  -1.267  3.107   1.00 15.92 ? 428  PHE A CE2 1 
ATOM   3437 C CZ  . PHE A  1 429 ? 38.038  -1.214  2.827   1.00 15.33 ? 428  PHE A CZ  1 
ATOM   3438 N N   . LEU A  1 430 ? 41.673  -2.119  7.010   1.00 15.74 ? 429  LEU A N   1 
ATOM   3439 C CA  . LEU A  1 430 ? 42.501  -3.206  6.481   1.00 16.08 ? 429  LEU A CA  1 
ATOM   3440 C C   . LEU A  1 430 ? 42.656  -4.371  7.460   1.00 16.21 ? 429  LEU A C   1 
ATOM   3441 O O   . LEU A  1 430 ? 42.579  -5.544  7.069   1.00 16.05 ? 429  LEU A O   1 
ATOM   3442 C CB  . LEU A  1 430 ? 43.880  -2.670  6.091   1.00 16.60 ? 429  LEU A CB  1 
ATOM   3443 C CG  . LEU A  1 430 ? 43.873  -1.618  4.980   1.00 16.27 ? 429  LEU A CG  1 
ATOM   3444 C CD1 . LEU A  1 430 ? 45.161  -0.781  4.997   1.00 16.81 ? 429  LEU A CD1 1 
ATOM   3445 C CD2 . LEU A  1 430 ? 43.648  -2.237  3.606   1.00 19.15 ? 429  LEU A CD2 1 
ATOM   3446 N N   . ALA A  1 431 ? 42.886  -4.048  8.728   1.00 15.92 ? 430  ALA A N   1 
ATOM   3447 C CA  . ALA A  1 431 ? 43.126  -5.075  9.732   1.00 16.22 ? 430  ALA A CA  1 
ATOM   3448 C C   . ALA A  1 431 ? 41.920  -5.958  10.019  1.00 16.13 ? 430  ALA A C   1 
ATOM   3449 O O   . ALA A  1 431 ? 42.072  -7.147  10.332  1.00 16.66 ? 430  ALA A O   1 
ATOM   3450 C CB  . ALA A  1 431 ? 43.620  -4.439  11.043  1.00 16.16 ? 430  ALA A CB  1 
ATOM   3451 N N   . GLN A  1 432 ? 40.723  -5.376  9.992   1.00 15.91 ? 431  GLN A N   1 
ATOM   3452 C CA  . GLN A  1 432 ? 39.536  -6.171  10.310  1.00 15.65 ? 431  GLN A CA  1 
ATOM   3453 C C   . GLN A  1 432 ? 39.268  -7.282  9.291   1.00 15.06 ? 431  GLN A C   1 
ATOM   3454 O O   . GLN A  1 432 ? 38.933  -8.401  9.680   1.00 15.99 ? 431  GLN A O   1 
ATOM   3455 C CB  . GLN A  1 432 ? 38.306  -5.257  10.487  1.00 15.30 ? 431  GLN A CB  1 
ATOM   3456 C CG  . GLN A  1 432 ? 38.351  -4.444  11.803  1.00 16.61 ? 431  GLN A CG  1 
ATOM   3457 C CD  . GLN A  1 432 ? 38.201  -5.320  13.048  1.00 17.27 ? 431  GLN A CD  1 
ATOM   3458 O OE1 . GLN A  1 432 ? 37.621  -6.400  12.996  1.00 17.99 ? 431  GLN A OE1 1 
ATOM   3459 N NE2 . GLN A  1 432 ? 38.748  -4.854  14.158  1.00 17.71 ? 431  GLN A NE2 1 
ATOM   3460 N N   . THR A  1 433 ? 39.409  -6.998  7.995   1.00 15.36 ? 432  THR A N   1 
ATOM   3461 C CA  . THR A  1 433 ? 39.155  -8.040  6.996   1.00 15.10 ? 432  THR A CA  1 
ATOM   3462 C C   . THR A  1 433 ? 40.287  -9.052  7.007   1.00 15.48 ? 432  THR A C   1 
ATOM   3463 O O   . THR A  1 433 ? 40.054  -10.244 6.756   1.00 14.80 ? 432  THR A O   1 
ATOM   3464 C CB  . THR A  1 433 ? 39.004  -7.490  5.568   1.00 15.08 ? 432  THR A CB  1 
ATOM   3465 O OG1 . THR A  1 433 ? 40.221  -6.851  5.183   1.00 15.98 ? 432  THR A OG1 1 
ATOM   3466 C CG2 . THR A  1 433 ? 37.896  -6.404  5.477   1.00 15.26 ? 432  THR A CG2 1 
ATOM   3467 N N   . GLU A  1 434 ? 41.498  -8.583  7.315   1.00 16.15 ? 433  GLU A N   1 
ATOM   3468 C CA  . GLU A  1 434 ? 42.648  -9.487  7.455   1.00 16.51 ? 433  GLU A CA  1 
ATOM   3469 C C   . GLU A  1 434 ? 42.418  -10.435 8.632   1.00 16.91 ? 433  GLU A C   1 
ATOM   3470 O O   . GLU A  1 434 ? 42.637  -11.650 8.519   1.00 17.59 ? 433  GLU A O   1 
ATOM   3471 C CB  . GLU A  1 434 ? 43.958  -8.698  7.642   1.00 16.82 ? 433  GLU A CB  1 
ATOM   3472 C CG  . GLU A  1 434 ? 45.214  -9.567  7.697   1.00 18.25 ? 433  GLU A CG  1 
ATOM   3473 C CD  . GLU A  1 434 ? 46.476  -8.805  8.077   1.00 20.83 ? 433  GLU A CD  1 
ATOM   3474 O OE1 . GLU A  1 434 ? 46.382  -7.703  8.670   1.00 21.59 ? 433  GLU A OE1 1 
ATOM   3475 O OE2 . GLU A  1 434 ? 47.576  -9.324  7.806   1.00 22.12 ? 433  GLU A OE2 1 
ATOM   3476 N N   . ALA A  1 435 ? 41.972  -9.886  9.761   1.00 16.69 ? 434  ALA A N   1 
ATOM   3477 C CA  . ALA A  1 435 ? 41.674  -10.689 10.949  1.00 16.88 ? 434  ALA A CA  1 
ATOM   3478 C C   . ALA A  1 435 ? 40.552  -11.709 10.716  1.00 17.30 ? 434  ALA A C   1 
ATOM   3479 O O   . ALA A  1 435 ? 40.630  -12.870 11.150  1.00 17.03 ? 434  ALA A O   1 
ATOM   3480 C CB  . ALA A  1 435 ? 41.322  -9.777  12.114  1.00 17.15 ? 434  ALA A CB  1 
ATOM   3481 N N   . LEU A  1 436 ? 39.479  -11.256 10.057  1.00 16.51 ? 435  LEU A N   1 
ATOM   3482 C CA  . LEU A  1 436 ? 38.349  -12.127 9.737   1.00 17.14 ? 435  LEU A CA  1 
ATOM   3483 C C   . LEU A  1 436 ? 38.780  -13.297 8.857   1.00 18.00 ? 435  LEU A C   1 
ATOM   3484 O O   . LEU A  1 436 ? 38.324  -14.425 9.038   1.00 17.95 ? 435  LEU A O   1 
ATOM   3485 C CB  . LEU A  1 436 ? 37.211  -11.332 9.080   1.00 16.72 ? 435  LEU A CB  1 
ATOM   3486 C CG  . LEU A  1 436 ? 36.404  -10.486 10.076  1.00 16.80 ? 435  LEU A CG  1 
ATOM   3487 C CD1 . LEU A  1 436 ? 35.513  -9.521  9.307   1.00 17.04 ? 435  LEU A CD1 1 
ATOM   3488 C CD2 . LEU A  1 436 ? 35.584  -11.344 11.049  1.00 15.85 ? 435  LEU A CD2 1 
ATOM   3489 N N   . MET A  1 437 ? 39.674  -13.012 7.909   1.00 18.32 ? 436  MET A N   1 
ATOM   3490 C CA  . MET A  1 437 ? 40.218  -14.026 7.023   1.00 20.13 ? 436  MET A CA  1 
ATOM   3491 C C   . MET A  1 437 ? 41.147  -15.018 7.761   1.00 19.97 ? 436  MET A C   1 
ATOM   3492 O O   . MET A  1 437 ? 40.969  -16.238 7.672   1.00 19.61 ? 436  MET A O   1 
ATOM   3493 C CB  . MET A  1 437 ? 40.984  -13.320 5.904   1.00 20.14 ? 436  MET A CB  1 
ATOM   3494 C CG  A MET A  1 437 ? 41.449  -14.222 4.766   0.50 19.71 ? 436  MET A CG  1 
ATOM   3495 C CG  B MET A  1 437 ? 40.967  -14.058 4.587   0.50 23.42 ? 436  MET A CG  1 
ATOM   3496 S SD  A MET A  1 437 ? 43.019  -15.028 5.101   0.50 16.99 ? 436  MET A SD  1 
ATOM   3497 S SD  B MET A  1 437 ? 42.573  -14.120 3.834   0.50 28.33 ? 436  MET A SD  1 
ATOM   3498 C CE  A MET A  1 437 ? 44.188  -13.692 4.730   0.50 17.31 ? 436  MET A CE  1 
ATOM   3499 C CE  B MET A  1 437 ? 43.504  -15.022 5.063   0.50 26.13 ? 436  MET A CE  1 
ATOM   3500 N N   . LYS A  1 438 ? 42.138  -14.474 8.454   1.00 20.71 ? 437  LYS A N   1 
ATOM   3501 C CA  . LYS A  1 438 ? 43.268  -15.249 8.964   1.00 22.24 ? 437  LYS A CA  1 
ATOM   3502 C C   . LYS A  1 438 ? 42.952  -16.020 10.248  1.00 22.13 ? 437  LYS A C   1 
ATOM   3503 O O   . LYS A  1 438 ? 43.324  -17.196 10.379  1.00 22.12 ? 437  LYS A O   1 
ATOM   3504 C CB  . LYS A  1 438 ? 44.471  -14.312 9.152   1.00 22.83 ? 437  LYS A CB  1 
ATOM   3505 C CG  . LYS A  1 438 ? 45.596  -14.795 10.039  1.00 27.16 ? 437  LYS A CG  1 
ATOM   3506 C CD  . LYS A  1 438 ? 46.608  -13.666 10.228  1.00 28.91 ? 437  LYS A CD  1 
ATOM   3507 C CE  . LYS A  1 438 ? 47.964  -14.189 10.672  1.00 31.12 ? 437  LYS A CE  1 
ATOM   3508 N NZ  . LYS A  1 438 ? 49.028  -13.713 9.761   1.00 33.87 ? 437  LYS A NZ  1 
ATOM   3509 N N   . GLY A  1 439 ? 42.276  -15.358 11.187  1.00 22.29 ? 438  GLY A N   1 
ATOM   3510 C CA  . GLY A  1 439 ? 42.032  -15.926 12.500  1.00 22.56 ? 438  GLY A CA  1 
ATOM   3511 C C   . GLY A  1 439 ? 43.322  -16.034 13.307  1.00 23.16 ? 438  GLY A C   1 
ATOM   3512 O O   . GLY A  1 439 ? 44.331  -15.408 12.978  1.00 22.87 ? 438  GLY A O   1 
ATOM   3513 N N   . LYS A  1 440 ? 43.271  -16.836 14.365  1.00 23.63 ? 439  LYS A N   1 
ATOM   3514 C CA  . LYS A  1 440 ? 44.406  -17.089 15.241  1.00 24.30 ? 439  LYS A CA  1 
ATOM   3515 C C   . LYS A  1 440 ? 44.293  -18.539 15.710  1.00 25.36 ? 439  LYS A C   1 
ATOM   3516 O O   . LYS A  1 440 ? 43.316  -18.916 16.364  1.00 25.27 ? 439  LYS A O   1 
ATOM   3517 C CB  . LYS A  1 440 ? 44.413  -16.107 16.422  1.00 24.38 ? 439  LYS A CB  1 
ATOM   3518 C CG  . LYS A  1 440 ? 45.689  -16.110 17.273  1.00 23.31 ? 439  LYS A CG  1 
ATOM   3519 C CD  . LYS A  1 440 ? 45.550  -15.288 18.561  1.00 25.28 ? 439  LYS A CD  1 
ATOM   3520 C CE  . LYS A  1 440 ? 45.519  -13.779 18.284  1.00 23.17 ? 439  LYS A CE  1 
ATOM   3521 N NZ  . LYS A  1 440 ? 45.567  -12.984 19.558  1.00 24.80 ? 439  LYS A NZ  1 
ATOM   3522 N N   . LEU A  1 441 ? 45.282  -19.354 15.328  1.00 25.99 ? 440  LEU A N   1 
ATOM   3523 C CA  . LEU A  1 441 ? 45.333  -20.774 15.685  1.00 26.97 ? 440  LEU A CA  1 
ATOM   3524 C C   . LEU A  1 441 ? 45.652  -20.960 17.171  1.00 26.75 ? 440  LEU A C   1 
ATOM   3525 O O   . LEU A  1 441 ? 46.283  -20.102 17.775  1.00 27.09 ? 440  LEU A O   1 
ATOM   3526 C CB  . LEU A  1 441 ? 46.411  -21.481 14.850  1.00 27.12 ? 440  LEU A CB  1 
ATOM   3527 C CG  . LEU A  1 441 ? 46.049  -22.184 13.533  1.00 29.15 ? 440  LEU A CG  1 
ATOM   3528 C CD1 . LEU A  1 441 ? 44.704  -21.795 12.959  1.00 33.83 ? 440  LEU A CD1 1 
ATOM   3529 C CD2 . LEU A  1 441 ? 47.171  -22.011 12.495  1.00 31.56 ? 440  LEU A CD2 1 
ATOM   3530 N N   . PRO A  1 442 ? 45.207  -22.072 17.755  1.00 27.66 ? 441  PRO A N   1 
ATOM   3531 C CA  . PRO A  1 442 ? 45.536  -22.411 19.149  1.00 28.41 ? 441  PRO A CA  1 
ATOM   3532 C C   . PRO A  1 442 ? 47.034  -22.308 19.445  1.00 29.02 ? 441  PRO A C   1 
ATOM   3533 O O   . PRO A  1 442 ? 47.392  -21.727 20.470  1.00 29.04 ? 441  PRO A O   1 
ATOM   3534 C CB  . PRO A  1 442 ? 45.057  -23.860 19.277  1.00 28.29 ? 441  PRO A CB  1 
ATOM   3535 C CG  . PRO A  1 442 ? 43.936  -23.966 18.289  1.00 27.88 ? 441  PRO A CG  1 
ATOM   3536 C CD  . PRO A  1 442 ? 44.333  -23.084 17.133  1.00 27.26 ? 441  PRO A CD  1 
ATOM   3537 N N   . GLU A  1 443 ? 47.881  -22.826 18.555  1.00 30.30 ? 442  GLU A N   1 
ATOM   3538 C CA  . GLU A  1 443 ? 49.339  -22.750 18.746  1.00 31.31 ? 442  GLU A CA  1 
ATOM   3539 C C   . GLU A  1 443 ? 49.854  -21.306 18.770  1.00 31.01 ? 442  GLU A C   1 
ATOM   3540 O O   . GLU A  1 443 ? 50.744  -20.974 19.546  1.00 31.35 ? 442  GLU A O   1 
ATOM   3541 C CB  . GLU A  1 443 ? 50.100  -23.642 17.736  1.00 31.77 ? 442  GLU A CB  1 
ATOM   3542 C CG  . GLU A  1 443 ? 50.434  -23.009 16.385  1.00 35.80 ? 442  GLU A CG  1 
ATOM   3543 C CD  . GLU A  1 443 ? 51.422  -23.829 15.563  1.00 40.45 ? 442  GLU A CD  1 
ATOM   3544 O OE1 . GLU A  1 443 ? 52.647  -23.556 15.631  1.00 43.01 ? 442  GLU A OE1 1 
ATOM   3545 O OE2 . GLU A  1 443 ? 50.974  -24.746 14.835  1.00 42.78 ? 442  GLU A OE2 1 
ATOM   3546 N N   . GLU A  1 444 ? 49.263  -20.442 17.942  1.00 30.69 ? 443  GLU A N   1 
ATOM   3547 C CA  . GLU A  1 444 ? 49.611  -19.025 17.936  1.00 30.24 ? 443  GLU A CA  1 
ATOM   3548 C C   . GLU A  1 444 ? 49.152  -18.330 19.222  1.00 29.51 ? 443  GLU A C   1 
ATOM   3549 O O   . GLU A  1 444 ? 49.882  -17.528 19.804  1.00 29.05 ? 443  GLU A O   1 
ATOM   3550 C CB  . GLU A  1 444 ? 49.012  -18.343 16.701  1.00 30.54 ? 443  GLU A CB  1 
ATOM   3551 C CG  . GLU A  1 444 ? 49.479  -18.977 15.395  1.00 32.18 ? 443  GLU A CG  1 
ATOM   3552 C CD  . GLU A  1 444 ? 48.775  -18.445 14.154  1.00 35.86 ? 443  GLU A CD  1 
ATOM   3553 O OE1 . GLU A  1 444 ? 47.603  -18.017 14.246  1.00 34.22 ? 443  GLU A OE1 1 
ATOM   3554 O OE2 . GLU A  1 444 ? 49.402  -18.481 13.064  1.00 37.39 ? 443  GLU A OE2 1 
ATOM   3555 N N   . ALA A  1 445 ? 47.934  -18.639 19.664  1.00 29.32 ? 444  ALA A N   1 
ATOM   3556 C CA  . ALA A  1 445 ? 47.415  -18.074 20.906  1.00 29.02 ? 444  ALA A CA  1 
ATOM   3557 C C   . ALA A  1 445 ? 48.201  -18.564 22.131  1.00 29.15 ? 444  ALA A C   1 
ATOM   3558 O O   . ALA A  1 445 ? 48.419  -17.803 23.070  1.00 28.45 ? 444  ALA A O   1 
ATOM   3559 C CB  . ALA A  1 445 ? 45.929  -18.369 21.053  1.00 28.81 ? 444  ALA A CB  1 
ATOM   3560 N N   . ARG A  1 446 ? 48.627  -19.826 22.103  1.00 29.93 ? 445  ARG A N   1 
ATOM   3561 C CA  . ARG A  1 446 ? 49.439  -20.412 23.184  1.00 31.02 ? 445  ARG A CA  1 
ATOM   3562 C C   . ARG A  1 446 ? 50.784  -19.702 23.381  1.00 31.42 ? 445  ARG A C   1 
ATOM   3563 O O   . ARG A  1 446 ? 51.150  -19.361 24.505  1.00 31.10 ? 445  ARG A O   1 
ATOM   3564 C CB  . ARG A  1 446 ? 49.645  -21.909 22.943  1.00 31.05 ? 445  ARG A CB  1 
ATOM   3565 C CG  . ARG A  1 446 ? 50.384  -22.651 24.061  1.00 32.85 ? 445  ARG A CG  1 
ATOM   3566 C CD  . ARG A  1 446 ? 50.772  -24.084 23.689  1.00 33.95 ? 445  ARG A CD  1 
ATOM   3567 N NE  A ARG A  1 446 ? 49.633  -25.000 23.739  0.40 34.52 ? 445  ARG A NE  1 
ATOM   3568 N NE  B ARG A  1 446 ? 49.613  -24.981 23.633  0.60 33.80 ? 445  ARG A NE  1 
ATOM   3569 C CZ  A ARG A  1 446 ? 49.024  -25.514 22.675  0.40 34.52 ? 445  ARG A CZ  1 
ATOM   3570 C CZ  B ARG A  1 446 ? 48.966  -25.462 24.697  0.60 33.75 ? 445  ARG A CZ  1 
ATOM   3571 N NH1 A ARG A  1 446 ? 49.429  -25.209 21.449  0.40 35.36 ? 445  ARG A NH1 1 
ATOM   3572 N NH1 B ARG A  1 446 ? 49.347  -25.138 25.928  0.60 33.50 ? 445  ARG A NH1 1 
ATOM   3573 N NH2 A ARG A  1 446 ? 48.000  -26.340 22.838  0.40 35.19 ? 445  ARG A NH2 1 
ATOM   3574 N NH2 B ARG A  1 446 ? 47.928  -26.273 24.531  0.60 33.28 ? 445  ARG A NH2 1 
ATOM   3575 N N   . LYS A  1 447 ? 51.498  -19.470 22.284  1.00 32.26 ? 446  LYS A N   1 
ATOM   3576 C CA  . LYS A  1 447 ? 52.756  -18.724 22.309  1.00 33.24 ? 446  LYS A CA  1 
ATOM   3577 C C   . LYS A  1 447 ? 52.599  -17.296 22.818  1.00 33.40 ? 446  LYS A C   1 
ATOM   3578 O O   . LYS A  1 447 ? 53.491  -16.774 23.486  1.00 33.02 ? 446  LYS A O   1 
ATOM   3579 C CB  . LYS A  1 447 ? 53.403  -18.710 20.923  1.00 33.38 ? 446  LYS A CB  1 
ATOM   3580 C CG  . LYS A  1 447 ? 53.752  -20.093 20.395  1.00 35.56 ? 446  LYS A CG  1 
ATOM   3581 C CD  . LYS A  1 447 ? 55.246  -20.268 20.201  1.00 38.43 ? 446  LYS A CD  1 
ATOM   3582 C CE  . LYS A  1 447 ? 55.617  -21.747 20.133  1.00 39.84 ? 446  LYS A CE  1 
ATOM   3583 N NZ  . LYS A  1 447 ? 56.499  -22.172 21.273  1.00 41.14 ? 446  LYS A NZ  1 
ATOM   3584 N N   . GLU A  1 448 ? 51.472  -16.657 22.495  1.00 33.73 ? 447  GLU A N   1 
ATOM   3585 C CA  . GLU A  1 448 ? 51.209  -15.300 22.974  1.00 34.16 ? 447  GLU A CA  1 
ATOM   3586 C C   . GLU A  1 448 ? 51.019  -15.288 24.486  1.00 34.84 ? 447  GLU A C   1 
ATOM   3587 O O   . GLU A  1 448 ? 51.517  -14.397 25.178  1.00 34.57 ? 447  GLU A O   1 
ATOM   3588 C CB  . GLU A  1 448 ? 49.987  -14.689 22.273  1.00 34.21 ? 447  GLU A CB  1 
ATOM   3589 C CG  . GLU A  1 448 ? 50.236  -14.284 20.826  1.00 34.70 ? 447  GLU A CG  1 
ATOM   3590 C CD  . GLU A  1 448 ? 49.007  -13.670 20.165  1.00 35.01 ? 447  GLU A CD  1 
ATOM   3591 O OE1 . GLU A  1 448 ? 47.952  -13.582 20.824  1.00 34.87 ? 447  GLU A OE1 1 
ATOM   3592 O OE2 . GLU A  1 448 ? 49.103  -13.279 18.984  1.00 35.96 ? 447  GLU A OE2 1 
ATOM   3593 N N   . LEU A  1 449 ? 50.312  -16.292 24.992  1.00 35.59 ? 448  LEU A N   1 
ATOM   3594 C CA  . LEU A  1 449 ? 50.051  -16.411 26.418  1.00 37.18 ? 448  LEU A CA  1 
ATOM   3595 C C   . LEU A  1 449 ? 51.342  -16.754 27.170  1.00 38.27 ? 448  LEU A C   1 
ATOM   3596 O O   . LEU A  1 449 ? 51.590  -16.225 28.253  1.00 38.56 ? 448  LEU A O   1 
ATOM   3597 C CB  . LEU A  1 449 ? 48.964  -17.464 26.680  1.00 36.87 ? 448  LEU A CB  1 
ATOM   3598 C CG  . LEU A  1 449 ? 47.510  -17.070 26.371  1.00 36.51 ? 448  LEU A CG  1 
ATOM   3599 C CD1 . LEU A  1 449 ? 46.651  -18.308 26.193  1.00 35.42 ? 448  LEU A CD1 1 
ATOM   3600 C CD2 . LEU A  1 449 ? 46.931  -16.185 27.462  1.00 35.58 ? 448  LEU A CD2 1 
ATOM   3601 N N   . GLN A  1 450 ? 52.161  -17.619 26.569  1.00 39.64 ? 449  GLN A N   1 
ATOM   3602 C CA  . GLN A  1 450 ? 53.457  -18.010 27.135  1.00 41.11 ? 449  GLN A CA  1 
ATOM   3603 C C   . GLN A  1 450 ? 54.354  -16.790 27.297  1.00 42.15 ? 449  GLN A C   1 
ATOM   3604 O O   . GLN A  1 450 ? 54.960  -16.589 28.360  1.00 42.55 ? 449  GLN A O   1 
ATOM   3605 C CB  . GLN A  1 450 ? 54.143  -19.043 26.237  1.00 41.13 ? 449  GLN A CB  1 
ATOM   3606 C CG  . GLN A  1 450 ? 53.807  -20.481 26.574  1.00 41.52 ? 449  GLN A CG  1 
ATOM   3607 C CD  . GLN A  1 450 ? 54.122  -21.459 25.455  1.00 42.51 ? 449  GLN A CD  1 
ATOM   3608 O OE1 . GLN A  1 450 ? 53.723  -22.623 25.524  1.00 44.20 ? 449  GLN A OE1 1 
ATOM   3609 N NE2 . GLN A  1 450 ? 54.834  -21.000 24.428  1.00 41.68 ? 449  GLN A NE2 1 
ATOM   3610 N N   . ALA A  1 451 ? 54.415  -15.973 26.244  1.00 43.06 ? 450  ALA A N   1 
ATOM   3611 C CA  . ALA A  1 451 ? 55.224  -14.753 26.224  1.00 44.34 ? 450  ALA A CA  1 
ATOM   3612 C C   . ALA A  1 451 ? 54.694  -13.665 27.157  1.00 45.19 ? 450  ALA A C   1 
ATOM   3613 O O   . ALA A  1 451 ? 55.445  -12.776 27.574  1.00 45.63 ? 450  ALA A O   1 
ATOM   3614 C CB  . ALA A  1 451 ? 55.342  -14.221 24.799  1.00 44.38 ? 450  ALA A CB  1 
ATOM   3615 N N   . ALA A  1 452 ? 53.404  -13.735 27.480  1.00 46.10 ? 451  ALA A N   1 
ATOM   3616 C CA  . ALA A  1 452 ? 52.777  -12.776 28.391  1.00 46.99 ? 451  ALA A CA  1 
ATOM   3617 C C   . ALA A  1 452 ? 53.060  -13.109 29.859  1.00 47.58 ? 451  ALA A C   1 
ATOM   3618 O O   . ALA A  1 452 ? 52.650  -12.370 30.760  1.00 47.81 ? 451  ALA A O   1 
ATOM   3619 C CB  . ALA A  1 452 ? 51.273  -12.696 28.132  1.00 46.96 ? 451  ALA A CB  1 
ATOM   3620 N N   . GLY A  1 453 ? 53.754  -14.224 30.085  1.00 48.12 ? 452  GLY A N   1 
ATOM   3621 C CA  . GLY A  1 453 ? 54.171  -14.634 31.415  1.00 48.74 ? 452  GLY A CA  1 
ATOM   3622 C C   . GLY A  1 453 ? 53.085  -15.328 32.216  1.00 49.10 ? 452  GLY A C   1 
ATOM   3623 O O   . GLY A  1 453 ? 53.060  -15.237 33.447  1.00 49.24 ? 452  GLY A O   1 
ATOM   3624 N N   . LYS A  1 454 ? 52.191  -16.022 31.518  1.00 49.31 ? 453  LYS A N   1 
ATOM   3625 C CA  . LYS A  1 454 ? 51.083  -16.729 32.152  1.00 49.45 ? 453  LYS A CA  1 
ATOM   3626 C C   . LYS A  1 454 ? 51.517  -18.113 32.622  1.00 49.61 ? 453  LYS A C   1 
ATOM   3627 O O   . LYS A  1 454 ? 52.307  -18.785 31.954  1.00 49.68 ? 453  LYS A O   1 
ATOM   3628 C CB  . LYS A  1 454 ? 49.898  -16.843 31.182  1.00 49.74 ? 453  LYS A CB  1 
ATOM   3629 C CG  . LYS A  1 454 ? 48.629  -16.121 31.637  1.00 49.80 ? 453  LYS A CG  1 
ATOM   3630 C CD  . LYS A  1 454 ? 48.587  -14.681 31.152  1.00 50.08 ? 453  LYS A CD  1 
ATOM   3631 C CE  . LYS A  1 454 ? 47.153  -14.161 31.081  1.00 50.23 ? 453  LYS A CE  1 
ATOM   3632 N NZ  . LYS A  1 454 ? 46.678  -13.629 32.392  1.00 49.83 ? 453  LYS A NZ  1 
ATOM   3633 N N   . SER A  1 455 ? 50.995  -18.527 33.777  1.00 49.59 ? 454  SER A N   1 
ATOM   3634 C CA  . SER A  1 455 ? 51.258  -19.851 34.336  1.00 49.43 ? 454  SER A CA  1 
ATOM   3635 C C   . SER A  1 455 ? 50.544  -20.930 33.521  1.00 49.39 ? 454  SER A C   1 
ATOM   3636 O O   . SER A  1 455 ? 49.505  -20.649 32.919  1.00 49.47 ? 454  SER A O   1 
ATOM   3637 C CB  . SER A  1 455 ? 50.808  -19.901 35.800  1.00 49.54 ? 454  SER A CB  1 
ATOM   3638 O OG  . SER A  1 455 ? 49.481  -20.389 35.925  1.00 49.88 ? 454  SER A OG  1 
ATOM   3639 N N   . PRO A  1 456 ? 51.088  -22.152 33.493  1.00 49.13 ? 455  PRO A N   1 
ATOM   3640 C CA  . PRO A  1 456 ? 50.447  -23.269 32.780  1.00 48.90 ? 455  PRO A CA  1 
ATOM   3641 C C   . PRO A  1 456 ? 48.973  -23.462 33.144  1.00 48.68 ? 455  PRO A C   1 
ATOM   3642 O O   . PRO A  1 456 ? 48.187  -23.842 32.272  1.00 48.85 ? 455  PRO A O   1 
ATOM   3643 C CB  . PRO A  1 456 ? 51.273  -24.493 33.208  1.00 48.92 ? 455  PRO A CB  1 
ATOM   3644 C CG  . PRO A  1 456 ? 52.129  -24.019 34.344  1.00 49.11 ? 455  PRO A CG  1 
ATOM   3645 C CD  . PRO A  1 456 ? 52.365  -22.562 34.109  1.00 49.06 ? 455  PRO A CD  1 
ATOM   3646 N N   . GLU A  1 457 ? 48.611  -23.197 34.399  1.00 48.34 ? 456  GLU A N   1 
ATOM   3647 C CA  . GLU A  1 457 ? 47.228  -23.330 34.861  1.00 47.72 ? 456  GLU A CA  1 
ATOM   3648 C C   . GLU A  1 457 ? 46.313  -22.269 34.233  1.00 46.68 ? 456  GLU A C   1 
ATOM   3649 O O   . GLU A  1 457 ? 45.287  -22.607 33.642  1.00 46.50 ? 456  GLU A O   1 
ATOM   3650 C CB  . GLU A  1 457 ? 47.166  -23.275 36.395  1.00 48.24 ? 456  GLU A CB  1 
ATOM   3651 C CG  . GLU A  1 457 ? 45.763  -23.161 36.983  1.00 49.75 ? 456  GLU A CG  1 
ATOM   3652 C CD  . GLU A  1 457 ? 45.209  -24.486 37.489  1.00 52.07 ? 456  GLU A CD  1 
ATOM   3653 O OE1 . GLU A  1 457 ? 46.005  -25.390 37.838  1.00 53.20 ? 456  GLU A OE1 1 
ATOM   3654 O OE2 . GLU A  1 457 ? 43.964  -24.625 37.540  1.00 52.75 ? 456  GLU A OE2 1 
ATOM   3655 N N   . ASP A  1 458 ? 46.692  -20.998 34.372  1.00 45.59 ? 457  ASP A N   1 
ATOM   3656 C CA  . ASP A  1 458 ? 45.941  -19.884 33.789  1.00 44.52 ? 457  ASP A CA  1 
ATOM   3657 C C   . ASP A  1 458 ? 45.919  -19.954 32.258  1.00 43.49 ? 457  ASP A C   1 
ATOM   3658 O O   . ASP A  1 458 ? 44.915  -19.601 31.628  1.00 43.29 ? 457  ASP A O   1 
ATOM   3659 C CB  . ASP A  1 458 ? 46.507  -18.537 34.260  1.00 44.67 ? 457  ASP A CB  1 
ATOM   3660 C CG  . ASP A  1 458 ? 46.304  -18.296 35.754  1.00 45.55 ? 457  ASP A CG  1 
ATOM   3661 O OD1 . ASP A  1 458 ? 46.587  -17.169 36.215  1.00 46.44 ? 457  ASP A OD1 1 
ATOM   3662 O OD2 . ASP A  1 458 ? 45.867  -19.160 36.547  1.00 46.14 ? 457  ASP A OD2 1 
ATOM   3663 N N   . LEU A  1 459 ? 47.019  -20.426 31.672  1.00 42.10 ? 458  LEU A N   1 
ATOM   3664 C CA  . LEU A  1 459 ? 47.136  -20.574 30.219  1.00 40.74 ? 458  LEU A CA  1 
ATOM   3665 C C   . LEU A  1 459 ? 46.079  -21.506 29.624  1.00 40.17 ? 458  LEU A C   1 
ATOM   3666 O O   . LEU A  1 459 ? 45.417  -21.141 28.649  1.00 39.35 ? 458  LEU A O   1 
ATOM   3667 C CB  . LEU A  1 459 ? 48.542  -21.057 29.821  1.00 40.69 ? 458  LEU A CB  1 
ATOM   3668 C CG  . LEU A  1 459 ? 48.923  -20.981 28.338  1.00 40.08 ? 458  LEU A CG  1 
ATOM   3669 C CD1 . LEU A  1 459 ? 50.404  -20.690 28.166  1.00 40.05 ? 458  LEU A CD1 1 
ATOM   3670 C CD2 . LEU A  1 459 ? 48.541  -22.254 27.586  1.00 39.84 ? 458  LEU A CD2 1 
ATOM   3671 N N   . GLU A  1 460 ? 45.931  -22.699 30.203  1.00 39.32 ? 459  GLU A N   1 
ATOM   3672 C CA  . GLU A  1 460 ? 45.027  -23.717 29.658  1.00 39.13 ? 459  GLU A CA  1 
ATOM   3673 C C   . GLU A  1 460 ? 43.558  -23.319 29.767  1.00 38.49 ? 459  GLU A C   1 
ATOM   3674 O O   . GLU A  1 460 ? 42.757  -23.659 28.899  1.00 38.58 ? 459  GLU A O   1 
ATOM   3675 C CB  . GLU A  1 460 ? 45.236  -25.092 30.318  1.00 39.52 ? 459  GLU A CB  1 
ATOM   3676 C CG  . GLU A  1 460 ? 46.610  -25.732 30.123  1.00 40.69 ? 459  GLU A CG  1 
ATOM   3677 C CD  . GLU A  1 460 ? 46.961  -26.062 28.677  1.00 42.81 ? 459  GLU A CD  1 
ATOM   3678 O OE1 . GLU A  1 460 ? 48.175  -26.068 28.367  1.00 43.80 ? 459  GLU A OE1 1 
ATOM   3679 O OE2 . GLU A  1 460 ? 46.052  -26.326 27.853  1.00 43.10 ? 459  GLU A OE2 1 
ATOM   3680 N N   . LYS A  1 461 ? 43.214  -22.612 30.840  1.00 38.05 ? 460  LYS A N   1 
ATOM   3681 C CA  . LYS A  1 461 ? 41.844  -22.154 31.065  1.00 37.56 ? 460  LYS A CA  1 
ATOM   3682 C C   . LYS A  1 461 ? 41.450  -21.074 30.056  1.00 36.65 ? 460  LYS A C   1 
ATOM   3683 O O   . LYS A  1 461 ? 40.334  -21.090 29.532  1.00 36.70 ? 460  LYS A O   1 
ATOM   3684 C CB  . LYS A  1 461 ? 41.670  -21.635 32.498  1.00 38.03 ? 460  LYS A CB  1 
ATOM   3685 C CG  . LYS A  1 461 ? 41.162  -22.693 33.483  1.00 39.52 ? 460  LYS A CG  1 
ATOM   3686 C CD  . LYS A  1 461 ? 40.143  -22.109 34.466  1.00 42.57 ? 460  LYS A CD  1 
ATOM   3687 C CE  . LYS A  1 461 ? 38.768  -22.759 34.315  1.00 43.57 ? 460  LYS A CE  1 
ATOM   3688 N NZ  . LYS A  1 461 ? 37.655  -21.795 34.618  1.00 45.56 ? 460  LYS A NZ  1 
ATOM   3689 N N   . LEU A  1 462 ? 42.380  -20.164 29.776  1.00 35.32 ? 461  LEU A N   1 
ATOM   3690 C CA  . LEU A  1 462 ? 42.147  -19.030 28.874  1.00 33.95 ? 461  LEU A CA  1 
ATOM   3691 C C   . LEU A  1 462 ? 42.256  -19.364 27.384  1.00 32.81 ? 461  LEU A C   1 
ATOM   3692 O O   . LEU A  1 462 ? 41.605  -18.715 26.554  1.00 32.45 ? 461  LEU A O   1 
ATOM   3693 C CB  . LEU A  1 462 ? 43.144  -17.911 29.188  1.00 34.29 ? 461  LEU A CB  1 
ATOM   3694 C CG  . LEU A  1 462 ? 42.676  -16.539 29.673  1.00 35.41 ? 461  LEU A CG  1 
ATOM   3695 C CD1 . LEU A  1 462 ? 43.795  -15.529 29.477  1.00 35.08 ? 461  LEU A CD1 1 
ATOM   3696 C CD2 . LEU A  1 462 ? 41.405  -16.066 28.969  1.00 36.29 ? 461  LEU A CD2 1 
ATOM   3697 N N   . LEU A  1 463 ? 43.081  -20.359 27.048  1.00 31.38 ? 462  LEU A N   1 
ATOM   3698 C CA  . LEU A  1 463 ? 43.459  -20.635 25.655  1.00 30.22 ? 462  LEU A CA  1 
ATOM   3699 C C   . LEU A  1 463 ? 42.300  -20.683 24.643  1.00 29.41 ? 462  LEU A C   1 
ATOM   3700 O O   . LEU A  1 463 ? 42.335  -19.940 23.662  1.00 28.76 ? 462  LEU A O   1 
ATOM   3701 C CB  . LEU A  1 463 ? 44.376  -21.869 25.530  1.00 30.31 ? 462  LEU A CB  1 
ATOM   3702 C CG  . LEU A  1 463 ? 44.800  -22.324 24.127  1.00 30.82 ? 462  LEU A CG  1 
ATOM   3703 C CD1 . LEU A  1 463 ? 45.579  -21.249 23.366  1.00 31.31 ? 462  LEU A CD1 1 
ATOM   3704 C CD2 . LEU A  1 463 ? 45.625  -23.615 24.211  1.00 31.84 ? 462  LEU A CD2 1 
ATOM   3705 N N   . PRO A  1 464 ? 41.294  -21.538 24.850  1.00 28.48 ? 463  PRO A N   1 
ATOM   3706 C CA  . PRO A  1 464 ? 40.249  -21.695 23.829  1.00 27.61 ? 463  PRO A CA  1 
ATOM   3707 C C   . PRO A  1 464 ? 39.494  -20.384 23.552  1.00 26.74 ? 463  PRO A C   1 
ATOM   3708 O O   . PRO A  1 464 ? 39.085  -20.151 22.410  1.00 26.18 ? 463  PRO A O   1 
ATOM   3709 C CB  . PRO A  1 464 ? 39.313  -22.750 24.425  1.00 27.98 ? 463  PRO A CB  1 
ATOM   3710 C CG  . PRO A  1 464 ? 39.595  -22.753 25.869  1.00 28.56 ? 463  PRO A CG  1 
ATOM   3711 C CD  . PRO A  1 464 ? 41.049  -22.408 26.022  1.00 28.58 ? 463  PRO A CD  1 
ATOM   3712 N N   . HIS A  1 465 ? 39.342  -19.546 24.577  1.00 26.03 ? 464  HIS A N   1 
ATOM   3713 C CA  . HIS A  1 465 ? 38.666  -18.246 24.431  1.00 25.74 ? 464  HIS A CA  1 
ATOM   3714 C C   . HIS A  1 465 ? 39.450  -17.263 23.572  1.00 24.95 ? 464  HIS A C   1 
ATOM   3715 O O   . HIS A  1 465 ? 38.886  -16.276 23.074  1.00 24.64 ? 464  HIS A O   1 
ATOM   3716 C CB  . HIS A  1 465 ? 38.424  -17.604 25.799  1.00 25.72 ? 464  HIS A CB  1 
ATOM   3717 C CG  . HIS A  1 465 ? 37.603  -18.445 26.725  1.00 26.66 ? 464  HIS A CG  1 
ATOM   3718 N ND1 . HIS A  1 465 ? 36.223  -18.431 26.724  1.00 26.69 ? 464  HIS A ND1 1 
ATOM   3719 C CD2 . HIS A  1 465 ? 37.971  -19.326 27.687  1.00 26.54 ? 464  HIS A CD2 1 
ATOM   3720 C CE1 . HIS A  1 465 ? 35.775  -19.267 27.644  1.00 27.61 ? 464  HIS A CE1 1 
ATOM   3721 N NE2 . HIS A  1 465 ? 36.815  -19.822 28.244  1.00 27.38 ? 464  HIS A NE2 1 
ATOM   3722 N N   . LYS A  1 466 ? 40.749  -17.511 23.419  1.00 24.95 ? 465  LYS A N   1 
ATOM   3723 C CA  . LYS A  1 466 ? 41.646  -16.591 22.713  1.00 24.52 ? 465  LYS A CA  1 
ATOM   3724 C C   . LYS A  1 466 ? 41.869  -16.981 21.240  1.00 23.78 ? 465  LYS A C   1 
ATOM   3725 O O   . LYS A  1 466 ? 42.580  -16.293 20.499  1.00 23.23 ? 465  LYS A O   1 
ATOM   3726 C CB  . LYS A  1 466 ? 42.985  -16.479 23.469  1.00 25.15 ? 465  LYS A CB  1 
ATOM   3727 C CG  . LYS A  1 466 ? 42.895  -15.684 24.765  1.00 27.44 ? 465  LYS A CG  1 
ATOM   3728 C CD  . LYS A  1 466 ? 43.928  -14.576 24.782  1.00 30.96 ? 465  LYS A CD  1 
ATOM   3729 C CE  . LYS A  1 466 ? 43.810  -13.716 26.013  1.00 33.37 ? 465  LYS A CE  1 
ATOM   3730 N NZ  . LYS A  1 466 ? 44.379  -12.364 25.745  1.00 35.51 ? 465  LYS A NZ  1 
ATOM   3731 N N   . VAL A  1 467 ? 41.232  -18.077 20.837  1.00 23.26 ? 466  VAL A N   1 
ATOM   3732 C CA  . VAL A  1 467 ? 41.337  -18.645 19.502  1.00 23.26 ? 466  VAL A CA  1 
ATOM   3733 C C   . VAL A  1 467 ? 40.292  -18.007 18.573  1.00 23.06 ? 466  VAL A C   1 
ATOM   3734 O O   . VAL A  1 467 ? 39.135  -17.812 18.972  1.00 22.74 ? 466  VAL A O   1 
ATOM   3735 C CB  . VAL A  1 467 ? 41.171  -20.188 19.545  1.00 23.30 ? 466  VAL A CB  1 
ATOM   3736 C CG1 . VAL A  1 467 ? 41.078  -20.784 18.142  1.00 23.23 ? 466  VAL A CG1 1 
ATOM   3737 C CG2 . VAL A  1 467 ? 42.335  -20.825 20.331  1.00 24.16 ? 466  VAL A CG2 1 
ATOM   3738 N N   . PHE A  1 468 ? 40.727  -17.671 17.358  1.00 22.46 ? 467  PHE A N   1 
ATOM   3739 C CA  . PHE A  1 468 ? 39.861  -17.123 16.306  1.00 22.02 ? 467  PHE A CA  1 
ATOM   3740 C C   . PHE A  1 468 ? 39.859  -18.100 15.142  1.00 21.99 ? 467  PHE A C   1 
ATOM   3741 O O   . PHE A  1 468 ? 40.897  -18.331 14.522  1.00 22.50 ? 467  PHE A O   1 
ATOM   3742 C CB  . PHE A  1 468 ? 40.380  -15.760 15.818  1.00 21.83 ? 467  PHE A CB  1 
ATOM   3743 C CG  . PHE A  1 468 ? 40.217  -14.625 16.816  1.00 21.09 ? 467  PHE A CG  1 
ATOM   3744 C CD1 . PHE A  1 468 ? 41.022  -14.540 17.948  1.00 22.75 ? 467  PHE A CD1 1 
ATOM   3745 C CD2 . PHE A  1 468 ? 39.289  -13.603 16.580  1.00 20.30 ? 467  PHE A CD2 1 
ATOM   3746 C CE1 . PHE A  1 468 ? 40.884  -13.478 18.866  1.00 21.48 ? 467  PHE A CE1 1 
ATOM   3747 C CE2 . PHE A  1 468 ? 39.146  -12.538 17.485  1.00 20.44 ? 467  PHE A CE2 1 
ATOM   3748 C CZ  . PHE A  1 468 ? 39.945  -12.479 18.634  1.00 21.05 ? 467  PHE A CZ  1 
ATOM   3749 N N   . GLU A  1 469 ? 38.706  -18.685 14.847  1.00 21.62 ? 468  GLU A N   1 
ATOM   3750 C CA  . GLU A  1 469 ? 38.631  -19.703 13.799  1.00 22.41 ? 468  GLU A CA  1 
ATOM   3751 C C   . GLU A  1 469 ? 38.846  -19.153 12.393  1.00 21.93 ? 468  GLU A C   1 
ATOM   3752 O O   . GLU A  1 469 ? 39.261  -19.893 11.495  1.00 22.77 ? 468  GLU A O   1 
ATOM   3753 C CB  . GLU A  1 469 ? 37.346  -20.521 13.911  1.00 23.41 ? 468  GLU A CB  1 
ATOM   3754 C CG  . GLU A  1 469 ? 37.316  -21.346 15.197  1.00 25.30 ? 468  GLU A CG  1 
ATOM   3755 C CD  . GLU A  1 469 ? 36.106  -22.246 15.326  1.00 29.34 ? 468  GLU A CD  1 
ATOM   3756 O OE1 . GLU A  1 469 ? 35.002  -21.855 14.898  1.00 31.23 ? 468  GLU A OE1 1 
ATOM   3757 O OE2 . GLU A  1 469 ? 36.260  -23.351 15.890  1.00 30.84 ? 468  GLU A OE2 1 
ATOM   3758 N N   . GLY A  1 470 ? 38.587  -17.852 12.215  1.00 20.92 ? 469  GLY A N   1 
ATOM   3759 C CA  . GLY A  1 470 ? 38.830  -17.185 10.947  1.00 20.24 ? 469  GLY A CA  1 
ATOM   3760 C C   . GLY A  1 470 ? 37.958  -17.756 9.855   1.00 19.57 ? 469  GLY A C   1 
ATOM   3761 O O   . GLY A  1 470 ? 36.854  -18.260 10.123  1.00 19.32 ? 469  GLY A O   1 
ATOM   3762 N N   . ASN A  1 471 ? 38.446  -17.673 8.619   1.00 19.44 ? 470  ASN A N   1 
ATOM   3763 C CA  . ASN A  1 471 ? 37.715  -18.151 7.452   1.00 19.63 ? 470  ASN A CA  1 
ATOM   3764 C C   . ASN A  1 471 ? 36.384  -17.421 7.246   1.00 19.07 ? 470  ASN A C   1 
ATOM   3765 O O   . ASN A  1 471 ? 35.421  -17.992 6.733   1.00 20.05 ? 470  ASN A O   1 
ATOM   3766 C CB  . ASN A  1 471 ? 37.490  -19.674 7.542   1.00 19.93 ? 470  ASN A CB  1 
ATOM   3767 C CG  . ASN A  1 471 ? 37.610  -20.359 6.193   1.00 22.16 ? 470  ASN A CG  1 
ATOM   3768 O OD1 . ASN A  1 471 ? 38.312  -19.879 5.296   1.00 23.98 ? 470  ASN A OD1 1 
ATOM   3769 N ND2 . ASN A  1 471 ? 36.919  -21.484 6.037   1.00 24.23 ? 470  ASN A ND2 1 
ATOM   3770 N N   . ARG A  1 472 ? 36.346  -16.159 7.676   1.00 18.29 ? 471  ARG A N   1 
ATOM   3771 C CA  . ARG A  1 472 ? 35.141  -15.340 7.550   1.00 17.30 ? 471  ARG A CA  1 
ATOM   3772 C C   . ARG A  1 472 ? 35.307  -14.352 6.389   1.00 17.16 ? 471  ARG A C   1 
ATOM   3773 O O   . ARG A  1 472 ? 36.193  -13.493 6.424   1.00 16.19 ? 471  ARG A O   1 
ATOM   3774 C CB  . ARG A  1 472 ? 34.855  -14.609 8.857   1.00 18.08 ? 471  ARG A CB  1 
ATOM   3775 C CG  . ARG A  1 472 ? 34.411  -15.584 9.946   1.00 18.89 ? 471  ARG A CG  1 
ATOM   3776 C CD  . ARG A  1 472 ? 34.890  -15.247 11.313  1.00 21.65 ? 471  ARG A CD  1 
ATOM   3777 N NE  . ARG A  1 472 ? 33.991  -15.772 12.338  1.00 22.13 ? 471  ARG A NE  1 
ATOM   3778 C CZ  . ARG A  1 472 ? 34.023  -17.015 12.812  1.00 22.29 ? 471  ARG A CZ  1 
ATOM   3779 N NH1 . ARG A  1 472 ? 34.918  -17.901 12.363  1.00 22.21 ? 471  ARG A NH1 1 
ATOM   3780 N NH2 . ARG A  1 472 ? 33.155  -17.379 13.748  1.00 22.89 ? 471  ARG A NH2 1 
ATOM   3781 N N   . PRO A  1 473 ? 34.458  -14.476 5.374   1.00 16.56 ? 472  PRO A N   1 
ATOM   3782 C CA  . PRO A  1 473 ? 34.666  -13.798 4.086   1.00 16.31 ? 472  PRO A CA  1 
ATOM   3783 C C   . PRO A  1 473 ? 34.165  -12.351 4.027   1.00 16.08 ? 472  PRO A C   1 
ATOM   3784 O O   . PRO A  1 473 ? 33.142  -11.997 4.640   1.00 16.51 ? 472  PRO A O   1 
ATOM   3785 C CB  . PRO A  1 473 ? 33.874  -14.665 3.131   1.00 16.67 ? 472  PRO A CB  1 
ATOM   3786 C CG  . PRO A  1 473 ? 32.698  -15.119 3.965   1.00 17.01 ? 472  PRO A CG  1 
ATOM   3787 C CD  . PRO A  1 473 ? 33.227  -15.298 5.367   1.00 16.90 ? 472  PRO A CD  1 
ATOM   3788 N N   . THR A  1 474 ? 34.917  -11.516 3.307   1.00 15.07 ? 473  THR A N   1 
ATOM   3789 C CA  . THR A  1 474 ? 34.543  -10.107 3.128   1.00 15.00 ? 473  THR A CA  1 
ATOM   3790 C C   . THR A  1 474 ? 34.794  -9.649  1.696   1.00 15.01 ? 473  THR A C   1 
ATOM   3791 O O   . THR A  1 474 ? 35.585  -10.275 0.950   1.00 15.16 ? 473  THR A O   1 
ATOM   3792 C CB  . THR A  1 474 ? 35.368  -9.190  4.060   1.00 15.30 ? 473  THR A CB  1 
ATOM   3793 O OG1 . THR A  1 474 ? 36.771  -9.411  3.827   1.00 15.25 ? 473  THR A OG1 1 
ATOM   3794 C CG2 . THR A  1 474 ? 35.158  -9.561  5.536   1.00 14.49 ? 473  THR A CG2 1 
ATOM   3795 N N   . ASN A  1 475 ? 34.116  -8.556  1.319   1.00 14.04 ? 474  ASN A N   1 
ATOM   3796 C CA  . ASN A  1 475 ? 34.490  -7.735  0.167   1.00 14.28 ? 474  ASN A CA  1 
ATOM   3797 C C   . ASN A  1 475 ? 35.098  -6.454  0.715   1.00 14.42 ? 474  ASN A C   1 
ATOM   3798 O O   . ASN A  1 475 ? 34.623  -5.949  1.752   1.00 13.73 ? 474  ASN A O   1 
ATOM   3799 C CB  . ASN A  1 475 ? 33.256  -7.332  -0.661  1.00 13.99 ? 474  ASN A CB  1 
ATOM   3800 C CG  . ASN A  1 475 ? 32.639  -8.497  -1.409  1.00 14.41 ? 474  ASN A CG  1 
ATOM   3801 O OD1 . ASN A  1 475 ? 31.397  -8.646  -1.458  1.00 17.51 ? 474  ASN A OD1 1 
ATOM   3802 N ND2 . ASN A  1 475 ? 33.480  -9.321  -1.991  1.00 12.36 ? 474  ASN A ND2 1 
ATOM   3803 N N   . SER A  1 476 ? 36.128  -5.932  0.044   1.00 13.48 ? 475  SER A N   1 
ATOM   3804 C CA  . SER A  1 476 ? 36.642  -4.582  0.353   1.00 14.05 ? 475  SER A CA  1 
ATOM   3805 C C   . SER A  1 476 ? 36.433  -3.716  -0.874  1.00 14.62 ? 475  SER A C   1 
ATOM   3806 O O   . SER A  1 476 ? 36.890  -4.061  -1.966  1.00 14.61 ? 475  SER A O   1 
ATOM   3807 C CB  . SER A  1 476 ? 38.121  -4.615  0.731   1.00 14.24 ? 475  SER A CB  1 
ATOM   3808 O OG  . SER A  1 476 ? 38.273  -5.133  2.031   1.00 15.31 ? 475  SER A OG  1 
ATOM   3809 N N   . ILE A  1 477 ? 35.728  -2.597  -0.690  1.00 14.03 ? 476  ILE A N   1 
ATOM   3810 C CA  . ILE A  1 477 ? 35.411  -1.681  -1.779  1.00 14.58 ? 476  ILE A CA  1 
ATOM   3811 C C   . ILE A  1 477 ? 36.046  -0.334  -1.419  1.00 14.14 ? 476  ILE A C   1 
ATOM   3812 O O   . ILE A  1 477 ? 35.643  0.319   -0.443  1.00 14.53 ? 476  ILE A O   1 
ATOM   3813 C CB  . ILE A  1 477 ? 33.884  -1.566  -1.967  1.00 14.78 ? 476  ILE A CB  1 
ATOM   3814 C CG1 . ILE A  1 477 ? 33.286  -2.952  -2.290  1.00 15.14 ? 476  ILE A CG1 1 
ATOM   3815 C CG2 . ILE A  1 477 ? 33.540  -0.526  -3.048  1.00 15.90 ? 476  ILE A CG2 1 
ATOM   3816 C CD1 . ILE A  1 477 ? 31.751  -3.013  -2.242  1.00 17.73 ? 476  ILE A CD1 1 
ATOM   3817 N N   . VAL A  1 478 ? 37.056  0.055   -2.187  1.00 13.78 ? 477  VAL A N   1 
ATOM   3818 C CA  . VAL A  1 478 ? 37.879  1.228   -1.858  1.00 14.42 ? 477  VAL A CA  1 
ATOM   3819 C C   . VAL A  1 478 ? 37.849  2.180   -3.041  1.00 15.03 ? 477  VAL A C   1 
ATOM   3820 O O   . VAL A  1 478 ? 37.938  1.756   -4.189  1.00 15.96 ? 477  VAL A O   1 
ATOM   3821 C CB  . VAL A  1 478 ? 39.365  0.816   -1.518  1.00 14.62 ? 477  VAL A CB  1 
ATOM   3822 C CG1 . VAL A  1 478 ? 40.161  2.022   -0.976  1.00 14.82 ? 477  VAL A CG1 1 
ATOM   3823 C CG2 . VAL A  1 478 ? 39.414  -0.372  -0.527  1.00 15.27 ? 477  VAL A CG2 1 
ATOM   3824 N N   . PHE A  1 479 ? 37.701  3.477   -2.782  1.00 15.14 ? 478  PHE A N   1 
ATOM   3825 C CA  . PHE A  1 479 ? 37.516  4.421   -3.876  1.00 14.68 ? 478  PHE A CA  1 
ATOM   3826 C C   . PHE A  1 479 ? 38.350  5.679   -3.580  1.00 14.38 ? 478  PHE A C   1 
ATOM   3827 O O   . PHE A  1 479 ? 38.627  5.967   -2.419  1.00 12.92 ? 478  PHE A O   1 
ATOM   3828 C CB  . PHE A  1 479 ? 36.014  4.715   -4.074  1.00 15.84 ? 478  PHE A CB  1 
ATOM   3829 C CG  . PHE A  1 479 ? 35.215  4.689   -2.800  1.00 15.49 ? 478  PHE A CG  1 
ATOM   3830 C CD1 . PHE A  1 479 ? 34.920  5.884   -2.117  1.00 14.73 ? 478  PHE A CD1 1 
ATOM   3831 C CD2 . PHE A  1 479 ? 34.701  3.488   -2.303  1.00 15.65 ? 478  PHE A CD2 1 
ATOM   3832 C CE1 . PHE A  1 479 ? 34.173  5.853   -0.920  1.00 16.56 ? 478  PHE A CE1 1 
ATOM   3833 C CE2 . PHE A  1 479 ? 33.948  3.467   -1.117  1.00 16.58 ? 478  PHE A CE2 1 
ATOM   3834 C CZ  . PHE A  1 479 ? 33.691  4.632   -0.440  1.00 15.18 ? 478  PHE A CZ  1 
ATOM   3835 N N   . THR A  1 480 ? 38.746  6.414   -4.624  1.00 13.56 ? 479  THR A N   1 
ATOM   3836 C CA  . THR A  1 480 ? 39.671  7.554   -4.453  1.00 14.57 ? 479  THR A CA  1 
ATOM   3837 C C   . THR A  1 480 ? 39.192  8.548   -3.375  1.00 14.36 ? 479  THR A C   1 
ATOM   3838 O O   . THR A  1 480 ? 39.949  8.916   -2.448  1.00 14.61 ? 479  THR A O   1 
ATOM   3839 C CB  . THR A  1 480 ? 39.859  8.254   -5.811  1.00 15.12 ? 479  THR A CB  1 
ATOM   3840 O OG1 . THR A  1 480 ? 40.353  7.290   -6.757  1.00 16.44 ? 479  THR A OG1 1 
ATOM   3841 C CG2 . THR A  1 480 ? 40.968  9.313   -5.734  1.00 14.91 ? 479  THR A CG2 1 
ATOM   3842 N N   . LYS A  1 481 ? 37.916  8.939   -3.474  1.00 14.70 ? 480  LYS A N   1 
ATOM   3843 C CA  . LYS A  1 481 ? 37.329  9.943   -2.589  1.00 14.91 ? 480  LYS A CA  1 
ATOM   3844 C C   . LYS A  1 481 ? 35.813  9.842   -2.697  1.00 14.56 ? 480  LYS A C   1 
ATOM   3845 O O   . LYS A  1 481 ? 35.288  9.500   -3.768  1.00 14.62 ? 480  LYS A O   1 
ATOM   3846 C CB  . LYS A  1 481 ? 37.775  11.350  -3.029  1.00 15.17 ? 480  LYS A CB  1 
ATOM   3847 C CG  . LYS A  1 481 ? 37.513  12.450  -2.011  1.00 17.32 ? 480  LYS A CG  1 
ATOM   3848 C CD  . LYS A  1 481 ? 38.060  13.805  -2.486  1.00 18.20 ? 480  LYS A CD  1 
ATOM   3849 C CE  . LYS A  1 481 ? 38.041  14.820  -1.343  1.00 21.33 ? 480  LYS A CE  1 
ATOM   3850 N NZ  . LYS A  1 481 ? 38.750  16.128  -1.680  1.00 21.05 ? 480  LYS A NZ  1 
ATOM   3851 N N   . LEU A  1 482 ? 35.099  10.143  -1.615  1.00 13.78 ? 481  LEU A N   1 
ATOM   3852 C CA  . LEU A  1 482 ? 33.633  10.157  -1.707  1.00 14.04 ? 481  LEU A CA  1 
ATOM   3853 C C   . LEU A  1 482 ? 33.077  11.507  -2.233  1.00 13.34 ? 481  LEU A C   1 
ATOM   3854 O O   . LEU A  1 482 ? 32.595  12.351  -1.476  1.00 15.10 ? 481  LEU A O   1 
ATOM   3855 C CB  . LEU A  1 482 ? 32.982  9.716   -0.388  1.00 13.43 ? 481  LEU A CB  1 
ATOM   3856 C CG  . LEU A  1 482 ? 31.470  9.442   -0.488  1.00 14.69 ? 481  LEU A CG  1 
ATOM   3857 C CD1 . LEU A  1 482 ? 31.164  8.169   -1.307  1.00 16.98 ? 481  LEU A CD1 1 
ATOM   3858 C CD2 . LEU A  1 482 ? 30.841  9.377   0.892   1.00 17.32 ? 481  LEU A CD2 1 
ATOM   3859 N N   . THR A  1 483 ? 33.180  11.690  -3.549  1.00 14.34 ? 482  THR A N   1 
ATOM   3860 C CA  . THR A  1 483 ? 32.627  12.842  -4.227  1.00 14.46 ? 482  THR A CA  1 
ATOM   3861 C C   . THR A  1 483 ? 31.196  12.527  -4.663  1.00 14.13 ? 482  THR A C   1 
ATOM   3862 O O   . THR A  1 483 ? 30.763  11.370  -4.635  1.00 13.87 ? 482  THR A O   1 
ATOM   3863 C CB  . THR A  1 483 ? 33.432  13.112  -5.507  1.00 14.65 ? 482  THR A CB  1 
ATOM   3864 O OG1 . THR A  1 483 ? 33.400  11.929  -6.324  1.00 14.85 ? 482  THR A OG1 1 
ATOM   3865 C CG2 . THR A  1 483 ? 34.905  13.330  -5.204  1.00 15.78 ? 482  THR A CG2 1 
ATOM   3866 N N   . PRO A  1 484 ? 30.437  13.540  -5.076  1.00 14.24 ? 483  PRO A N   1 
ATOM   3867 C CA  . PRO A  1 484 ? 29.110  13.266  -5.641  1.00 14.27 ? 483  PRO A CA  1 
ATOM   3868 C C   . PRO A  1 484 ? 29.119  12.211  -6.758  1.00 15.24 ? 483  PRO A C   1 
ATOM   3869 O O   . PRO A  1 484 ? 28.289  11.305  -6.764  1.00 14.64 ? 483  PRO A O   1 
ATOM   3870 C CB  . PRO A  1 484 ? 28.682  14.635  -6.163  1.00 14.79 ? 483  PRO A CB  1 
ATOM   3871 C CG  . PRO A  1 484 ? 29.328  15.584  -5.177  1.00 13.82 ? 483  PRO A CG  1 
ATOM   3872 C CD  . PRO A  1 484 ? 30.696  14.998  -4.950  1.00 14.03 ? 483  PRO A CD  1 
ATOM   3873 N N   . PHE A  1 485 ? 30.069  12.320  -7.676  1.00 15.48 ? 484  PHE A N   1 
ATOM   3874 C CA  . PHE A  1 485 ? 30.166  11.365  -8.783  1.00 15.48 ? 484  PHE A CA  1 
ATOM   3875 C C   . PHE A  1 485 ? 30.406  9.942   -8.275  1.00 15.35 ? 484  PHE A C   1 
ATOM   3876 O O   . PHE A  1 485 ? 29.703  9.000   -8.680  1.00 15.65 ? 484  PHE A O   1 
ATOM   3877 C CB  . PHE A  1 485 ? 31.300  11.799  -9.732  1.00 16.35 ? 484  PHE A CB  1 
ATOM   3878 C CG  . PHE A  1 485 ? 31.475  10.908  -10.921 1.00 15.00 ? 484  PHE A CG  1 
ATOM   3879 C CD1 . PHE A  1 485 ? 30.914  11.252  -12.148 1.00 17.02 ? 484  PHE A CD1 1 
ATOM   3880 C CD2 . PHE A  1 485 ? 32.230  9.732   -10.829 1.00 18.03 ? 484  PHE A CD2 1 
ATOM   3881 C CE1 . PHE A  1 485 ? 31.068  10.420  -13.261 1.00 18.09 ? 484  PHE A CE1 1 
ATOM   3882 C CE2 . PHE A  1 485 ? 32.382  8.891   -11.947 1.00 17.06 ? 484  PHE A CE2 1 
ATOM   3883 C CZ  . PHE A  1 485 ? 31.816  9.255   -13.154 1.00 18.17 ? 484  PHE A CZ  1 
ATOM   3884 N N   . ILE A  1 486 ? 31.392  9.771   -7.397  1.00 14.34 ? 485  ILE A N   1 
ATOM   3885 C CA  . ILE A  1 486 ? 31.707  8.419   -6.905  1.00 14.13 ? 485  ILE A CA  1 
ATOM   3886 C C   . ILE A  1 486 ? 30.534  7.845   -6.095  1.00 13.78 ? 485  ILE A C   1 
ATOM   3887 O O   . ILE A  1 486 ? 30.195  6.661   -6.245  1.00 14.26 ? 485  ILE A O   1 
ATOM   3888 C CB  . ILE A  1 486 ? 33.068  8.410   -6.137  1.00 14.22 ? 485  ILE A CB  1 
ATOM   3889 C CG1 . ILE A  1 486 ? 34.214  8.700   -7.108  1.00 15.52 ? 485  ILE A CG1 1 
ATOM   3890 C CG2 . ILE A  1 486 ? 33.336  7.081   -5.403  1.00 14.19 ? 485  ILE A CG2 1 
ATOM   3891 C CD1 . ILE A  1 486 ? 34.559  7.545   -8.055  1.00 17.39 ? 485  ILE A CD1 1 
ATOM   3892 N N   . LEU A  1 487 ? 29.885  8.680   -5.278  1.00 13.29 ? 486  LEU A N   1 
ATOM   3893 C CA  . LEU A  1 487 ? 28.711  8.228   -4.525  1.00 13.34 ? 486  LEU A CA  1 
ATOM   3894 C C   . LEU A  1 487 ? 27.624  7.714   -5.460  1.00 13.47 ? 486  LEU A C   1 
ATOM   3895 O O   . LEU A  1 487 ? 27.037  6.652   -5.202  1.00 13.70 ? 486  LEU A O   1 
ATOM   3896 C CB  . LEU A  1 487 ? 28.161  9.328   -3.594  1.00 12.79 ? 486  LEU A CB  1 
ATOM   3897 C CG  . LEU A  1 487 ? 26.917  8.940   -2.765  1.00 12.47 ? 486  LEU A CG  1 
ATOM   3898 C CD1 . LEU A  1 487 ? 27.208  7.775   -1.774  1.00 13.89 ? 486  LEU A CD1 1 
ATOM   3899 C CD2 . LEU A  1 487 ? 26.383  10.170  -2.009  1.00 12.12 ? 486  LEU A CD2 1 
ATOM   3900 N N   . GLY A  1 488 ? 27.356  8.458   -6.544  1.00 13.36 ? 487  GLY A N   1 
ATOM   3901 C CA  . GLY A  1 488 ? 26.370  8.041   -7.535  1.00 13.83 ? 487  GLY A CA  1 
ATOM   3902 C C   . GLY A  1 488 ? 26.703  6.674   -8.122  1.00 13.77 ? 487  GLY A C   1 
ATOM   3903 O O   . GLY A  1 488 ? 25.824  5.810   -8.250  1.00 13.74 ? 487  GLY A O   1 
ATOM   3904 N N   . ALA A  1 489 ? 27.987  6.459   -8.419  1.00 13.30 ? 488  ALA A N   1 
ATOM   3905 C CA  . ALA A  1 489 ? 28.450  5.190   -8.972  1.00 13.42 ? 488  ALA A CA  1 
ATOM   3906 C C   . ALA A  1 489 ? 28.260  4.032   -7.987  1.00 13.48 ? 488  ALA A C   1 
ATOM   3907 O O   . ALA A  1 489 ? 27.846  2.934   -8.368  1.00 13.65 ? 488  ALA A O   1 
ATOM   3908 C CB  . ALA A  1 489 ? 29.922  5.311   -9.412  1.00 13.75 ? 488  ALA A CB  1 
ATOM   3909 N N   . LEU A  1 490 ? 28.563  4.280   -6.715  1.00 12.63 ? 489  LEU A N   1 
ATOM   3910 C CA  . LEU A  1 490 ? 28.392  3.257   -5.685  1.00 13.19 ? 489  LEU A CA  1 
ATOM   3911 C C   . LEU A  1 490 ? 26.924  2.863   -5.483  1.00 12.49 ? 489  LEU A C   1 
ATOM   3912 O O   . LEU A  1 490 ? 26.618  1.671   -5.345  1.00 13.68 ? 489  LEU A O   1 
ATOM   3913 C CB  . LEU A  1 490 ? 29.010  3.705   -4.347  1.00 12.25 ? 489  LEU A CB  1 
ATOM   3914 C CG  . LEU A  1 490 ? 30.534  3.864   -4.345  1.00 13.83 ? 489  LEU A CG  1 
ATOM   3915 C CD1 . LEU A  1 490 ? 30.995  4.536   -3.055  1.00 15.14 ? 489  LEU A CD1 1 
ATOM   3916 C CD2 . LEU A  1 490 ? 31.226  2.488   -4.508  1.00 15.13 ? 489  LEU A CD2 1 
ATOM   3917 N N   . ILE A  1 491 ? 26.029  3.848   -5.434  1.00 12.66 ? 490  ILE A N   1 
ATOM   3918 C CA  . ILE A  1 491 ? 24.611  3.556   -5.224  1.00 12.81 ? 490  ILE A CA  1 
ATOM   3919 C C   . ILE A  1 491 ? 24.083  2.737   -6.396  1.00 12.95 ? 490  ILE A C   1 
ATOM   3920 O O   . ILE A  1 491 ? 23.411  1.737   -6.198  1.00 13.20 ? 490  ILE A O   1 
ATOM   3921 C CB  . ILE A  1 491 ? 23.768  4.848   -5.029  1.00 12.91 ? 490  ILE A CB  1 
ATOM   3922 C CG1 . ILE A  1 491 ? 24.230  5.635   -3.782  1.00 15.13 ? 490  ILE A CG1 1 
ATOM   3923 C CG2 . ILE A  1 491 ? 22.267  4.512   -4.922  1.00 13.44 ? 490  ILE A CG2 1 
ATOM   3924 C CD1 . ILE A  1 491 ? 23.743  7.088   -3.781  1.00 14.51 ? 490  ILE A CD1 1 
ATOM   3925 N N   . ALA A  1 492 ? 24.411  3.168   -7.608  1.00 13.93 ? 491  ALA A N   1 
ATOM   3926 C CA  . ALA A  1 492 ? 23.962  2.427   -8.793  1.00 14.38 ? 491  ALA A CA  1 
ATOM   3927 C C   . ALA A  1 492 ? 24.535  1.005   -8.830  1.00 14.61 ? 491  ALA A C   1 
ATOM   3928 O O   . ALA A  1 492 ? 23.852  0.091   -9.301  1.00 14.57 ? 491  ALA A O   1 
ATOM   3929 C CB  . ALA A  1 492 ? 24.341  3.162   -10.053 1.00 14.06 ? 491  ALA A CB  1 
ATOM   3930 N N   . MET A  1 493 ? 25.775  0.810   -8.364  1.00 13.75 ? 492  MET A N   1 
ATOM   3931 C CA  . MET A  1 493 ? 26.380  -0.523  -8.337  1.00 13.77 ? 492  MET A CA  1 
ATOM   3932 C C   . MET A  1 493 ? 25.506  -1.493  -7.512  1.00 14.30 ? 492  MET A C   1 
ATOM   3933 O O   . MET A  1 493 ? 25.234  -2.619  -7.925  1.00 14.39 ? 492  MET A O   1 
ATOM   3934 C CB  . MET A  1 493 ? 27.809  -0.451  -7.755  1.00 13.83 ? 492  MET A CB  1 
ATOM   3935 C CG  . MET A  1 493 ? 28.558  -1.789  -7.729  1.00 14.66 ? 492  MET A CG  1 
ATOM   3936 S SD  . MET A  1 493 ? 30.285  -1.619  -7.196  1.00 17.50 ? 492  MET A SD  1 
ATOM   3937 C CE  . MET A  1 493 ? 30.087  -1.369  -5.470  1.00 16.54 ? 492  MET A CE  1 
ATOM   3938 N N   . TYR A  1 494 ? 25.074  -1.040  -6.337  1.00 13.91 ? 493  TYR A N   1 
ATOM   3939 C CA  . TYR A  1 494 ? 24.241  -1.884  -5.492  1.00 14.32 ? 493  TYR A CA  1 
ATOM   3940 C C   . TYR A  1 494 ? 22.835  -2.041  -6.046  1.00 13.85 ? 493  TYR A C   1 
ATOM   3941 O O   . TYR A  1 494 ? 22.248  -3.126  -5.937  1.00 13.58 ? 493  TYR A O   1 
ATOM   3942 C CB  . TYR A  1 494 ? 24.218  -1.347  -4.053  1.00 13.10 ? 493  TYR A CB  1 
ATOM   3943 C CG  . TYR A  1 494 ? 25.426  -1.732  -3.234  1.00 15.01 ? 493  TYR A CG  1 
ATOM   3944 C CD1 . TYR A  1 494 ? 26.473  -0.828  -3.021  1.00 15.82 ? 493  TYR A CD1 1 
ATOM   3945 C CD2 . TYR A  1 494 ? 25.516  -2.997  -2.652  1.00 17.55 ? 493  TYR A CD2 1 
ATOM   3946 C CE1 . TYR A  1 494 ? 27.585  -1.188  -2.244  1.00 18.24 ? 493  TYR A CE1 1 
ATOM   3947 C CE2 . TYR A  1 494 ? 26.616  -3.369  -1.880  1.00 17.82 ? 493  TYR A CE2 1 
ATOM   3948 C CZ  . TYR A  1 494 ? 27.649  -2.455  -1.677  1.00 19.03 ? 493  TYR A CZ  1 
ATOM   3949 O OH  . TYR A  1 494 ? 28.740  -2.803  -0.911  1.00 19.17 ? 493  TYR A OH  1 
ATOM   3950 N N   . GLU A  1 495 ? 22.295  -0.990  -6.679  1.00 13.81 ? 494  GLU A N   1 
ATOM   3951 C CA  . GLU A  1 495 ? 21.017  -1.115  -7.380  1.00 14.43 ? 494  GLU A CA  1 
ATOM   3952 C C   . GLU A  1 495 ? 21.095  -2.289  -8.382  1.00 14.88 ? 494  GLU A C   1 
ATOM   3953 O O   . GLU A  1 495 ? 20.197  -3.130  -8.432  1.00 15.19 ? 494  GLU A O   1 
ATOM   3954 C CB  . GLU A  1 495 ? 20.663  0.176   -8.126  1.00 15.16 ? 494  GLU A CB  1 
ATOM   3955 C CG  . GLU A  1 495 ? 20.225  1.304   -7.208  1.00 15.43 ? 494  GLU A CG  1 
ATOM   3956 C CD  . GLU A  1 495 ? 19.825  2.579   -7.933  1.00 17.45 ? 494  GLU A CD  1 
ATOM   3957 O OE1 . GLU A  1 495 ? 20.201  2.770   -9.104  1.00 16.16 ? 494  GLU A OE1 1 
ATOM   3958 O OE2 . GLU A  1 495 ? 19.131  3.414   -7.313  1.00 16.16 ? 494  GLU A OE2 1 
ATOM   3959 N N   . HIS A  1 496 ? 22.177  -2.343  -9.166  1.00 14.35 ? 495  HIS A N   1 
ATOM   3960 C CA  . HIS A  1 496 ? 22.322  -3.412  -10.153 1.00 14.57 ? 495  HIS A CA  1 
ATOM   3961 C C   . HIS A  1 496 ? 22.615  -4.798  -9.570  1.00 14.25 ? 495  HIS A C   1 
ATOM   3962 O O   . HIS A  1 496 ? 22.126  -5.804  -10.106 1.00 14.49 ? 495  HIS A O   1 
ATOM   3963 C CB  . HIS A  1 496 ? 23.273  -2.978  -11.289 1.00 14.22 ? 495  HIS A CB  1 
ATOM   3964 C CG  . HIS A  1 496 ? 22.775  -1.785  -12.064 1.00 15.91 ? 495  HIS A CG  1 
ATOM   3965 N ND1 . HIS A  1 496 ? 21.448  -1.604  -12.409 1.00 16.92 ? 495  HIS A ND1 1 
ATOM   3966 C CD2 . HIS A  1 496 ? 23.435  -0.701  -12.540 1.00 15.40 ? 495  HIS A CD2 1 
ATOM   3967 C CE1 . HIS A  1 496 ? 21.320  -0.466  -13.065 1.00 16.02 ? 495  HIS A CE1 1 
ATOM   3968 N NE2 . HIS A  1 496 ? 22.513  0.094   -13.170 1.00 14.64 ? 495  HIS A NE2 1 
ATOM   3969 N N   . LYS A  1 497 ? 23.360  -4.864  -8.464  1.00 14.44 ? 496  LYS A N   1 
ATOM   3970 C CA  . LYS A  1 497 ? 23.514  -6.116  -7.720  1.00 14.39 ? 496  LYS A CA  1 
ATOM   3971 C C   . LYS A  1 497 ? 22.126  -6.676  -7.370  1.00 14.65 ? 496  LYS A C   1 
ATOM   3972 O O   . LYS A  1 497 ? 21.835  -7.864  -7.625  1.00 14.34 ? 496  LYS A O   1 
ATOM   3973 C CB  . LYS A  1 497 ? 24.315  -5.879  -6.436  1.00 14.50 ? 496  LYS A CB  1 
ATOM   3974 C CG  . LYS A  1 497 ? 24.463  -7.131  -5.580  1.00 14.46 ? 496  LYS A CG  1 
ATOM   3975 C CD  . LYS A  1 497 ? 24.803  -6.785  -4.114  1.00 13.34 ? 496  LYS A CD  1 
ATOM   3976 C CE  . LYS A  1 497 ? 24.775  -8.045  -3.249  1.00 14.25 ? 496  LYS A CE  1 
ATOM   3977 N NZ  . LYS A  1 497 ? 25.094  -7.784  -1.784  1.00 13.83 ? 496  LYS A NZ  1 
ATOM   3978 N N   . ILE A  1 498 ? 21.287  -5.819  -6.773  1.00 14.64 ? 497  ILE A N   1 
ATOM   3979 C CA  . ILE A  1 498 ? 19.920  -6.188  -6.379  1.00 14.50 ? 497  ILE A CA  1 
ATOM   3980 C C   . ILE A  1 498 ? 19.103  -6.707  -7.576  1.00 15.25 ? 497  ILE A C   1 
ATOM   3981 O O   . ILE A  1 498 ? 18.434  -7.739  -7.478  1.00 15.40 ? 497  ILE A O   1 
ATOM   3982 C CB  . ILE A  1 498 ? 19.254  -4.978  -5.637  1.00 14.62 ? 497  ILE A CB  1 
ATOM   3983 C CG1 . ILE A  1 498 ? 19.923  -4.805  -4.277  1.00 14.60 ? 497  ILE A CG1 1 
ATOM   3984 C CG2 . ILE A  1 498 ? 17.727  -5.155  -5.468  1.00 15.24 ? 497  ILE A CG2 1 
ATOM   3985 C CD1 . ILE A  1 498 ? 19.776  -3.374  -3.736  1.00 16.50 ? 497  ILE A CD1 1 
ATOM   3986 N N   . PHE A  1 499 ? 19.197  -6.018  -8.710  1.00 15.20 ? 498  PHE A N   1 
ATOM   3987 C CA  . PHE A  1 499 ? 18.543  -6.429  -9.956  1.00 15.52 ? 498  PHE A CA  1 
ATOM   3988 C C   . PHE A  1 499 ? 18.969  -7.843  -10.382 1.00 15.32 ? 498  PHE A C   1 
ATOM   3989 O O   . PHE A  1 499 ? 18.113  -8.704  -10.673 1.00 15.18 ? 498  PHE A O   1 
ATOM   3990 C CB  . PHE A  1 499 ? 18.872  -5.439  -11.088 1.00 15.67 ? 498  PHE A CB  1 
ATOM   3991 C CG  . PHE A  1 499 ? 18.339  -5.871  -12.443 1.00 16.54 ? 498  PHE A CG  1 
ATOM   3992 C CD1 . PHE A  1 499 ? 17.004  -5.673  -12.771 1.00 17.95 ? 498  PHE A CD1 1 
ATOM   3993 C CD2 . PHE A  1 499 ? 19.178  -6.493  -13.359 1.00 19.58 ? 498  PHE A CD2 1 
ATOM   3994 C CE1 . PHE A  1 499 ? 16.492  -6.094  -14.034 1.00 18.92 ? 498  PHE A CE1 1 
ATOM   3995 C CE2 . PHE A  1 499 ? 18.692  -6.912  -14.595 1.00 20.91 ? 498  PHE A CE2 1 
ATOM   3996 C CZ  . PHE A  1 499 ? 17.346  -6.696  -14.936 1.00 20.26 ? 498  PHE A CZ  1 
ATOM   3997 N N   . VAL A  1 500 ? 20.279  -8.067  -10.450 1.00 15.01 ? 499  VAL A N   1 
ATOM   3998 C CA  . VAL A  1 500 ? 20.819  -9.362  -10.881 1.00 15.33 ? 499  VAL A CA  1 
ATOM   3999 C C   . VAL A  1 500 ? 20.316  -10.490 -9.970  1.00 15.24 ? 499  VAL A C   1 
ATOM   4000 O O   . VAL A  1 500 ? 19.862  -11.540 -10.457 1.00 15.93 ? 499  VAL A O   1 
ATOM   4001 C CB  . VAL A  1 500 ? 22.376  -9.359  -10.970 1.00 14.67 ? 499  VAL A CB  1 
ATOM   4002 C CG1 . VAL A  1 500 ? 22.896  -10.785 -11.228 1.00 15.15 ? 499  VAL A CG1 1 
ATOM   4003 C CG2 . VAL A  1 500 ? 22.854  -8.396  -12.079 1.00 15.76 ? 499  VAL A CG2 1 
ATOM   4004 N N   . GLN A  1 501 ? 20.358  -10.281 -8.654  1.00 15.24 ? 500  GLN A N   1 
ATOM   4005 C CA  . GLN A  1 501 ? 19.855  -11.305 -7.737  1.00 15.12 ? 500  GLN A CA  1 
ATOM   4006 C C   . GLN A  1 501 ? 18.367  -11.614 -7.952  1.00 14.88 ? 500  GLN A C   1 
ATOM   4007 O O   . GLN A  1 501 ? 17.967  -12.799 -7.958  1.00 15.12 ? 500  GLN A O   1 
ATOM   4008 C CB  . GLN A  1 501 ? 20.120  -10.919 -6.283  1.00 14.88 ? 500  GLN A CB  1 
ATOM   4009 C CG  . GLN A  1 501 ? 21.618  -10.910 -5.932  1.00 15.10 ? 500  GLN A CG  1 
ATOM   4010 C CD  . GLN A  1 501 ? 21.885  -10.591 -4.490  1.00 16.32 ? 500  GLN A CD  1 
ATOM   4011 O OE1 . GLN A  1 501 ? 21.152  -9.816  -3.879  1.00 17.48 ? 500  GLN A OE1 1 
ATOM   4012 N NE2 . GLN A  1 501 ? 22.940  -11.196 -3.934  1.00 15.20 ? 500  GLN A NE2 1 
ATOM   4013 N N   . GLY A  1 502 ? 17.552  -10.576 -8.121  1.00 14.51 ? 501  GLY A N   1 
ATOM   4014 C CA  . GLY A  1 502 ? 16.132  -10.757 -8.370  1.00 15.28 ? 501  GLY A CA  1 
ATOM   4015 C C   . GLY A  1 502 ? 15.875  -11.593 -9.614  1.00 16.25 ? 501  GLY A C   1 
ATOM   4016 O O   . GLY A  1 502 ? 15.029  -12.495 -9.588  1.00 16.25 ? 501  GLY A O   1 
ATOM   4017 N N   . ILE A  1 503 ? 16.600  -11.305 -10.698 1.00 16.87 ? 502  ILE A N   1 
ATOM   4018 C CA  . ILE A  1 503 ? 16.445  -12.087 -11.941 1.00 18.08 ? 502  ILE A CA  1 
ATOM   4019 C C   . ILE A  1 503 ? 16.806  -13.544 -11.717 1.00 18.55 ? 502  ILE A C   1 
ATOM   4020 O O   . ILE A  1 503 ? 16.080  -14.447 -12.190 1.00 18.66 ? 502  ILE A O   1 
ATOM   4021 C CB  . ILE A  1 503 ? 17.286  -11.488 -13.116 1.00 17.75 ? 502  ILE A CB  1 
ATOM   4022 C CG1 . ILE A  1 503 ? 16.786  -10.092 -13.536 1.00 17.90 ? 502  ILE A CG1 1 
ATOM   4023 C CG2 . ILE A  1 503 ? 17.303  -12.436 -14.359 1.00 18.51 ? 502  ILE A CG2 1 
ATOM   4024 C CD1 . ILE A  1 503 ? 15.264  -9.966  -13.805 1.00 19.10 ? 502  ILE A CD1 1 
ATOM   4025 N N   . MET A  1 504 ? 17.897  -13.795 -10.990 1.00 17.92 ? 503  MET A N   1 
ATOM   4026 C CA  . MET A  1 504 ? 18.328  -15.169 -10.746 1.00 18.57 ? 503  MET A CA  1 
ATOM   4027 C C   . MET A  1 504 ? 17.315  -15.954 -9.888  1.00 18.16 ? 503  MET A C   1 
ATOM   4028 O O   . MET A  1 504 ? 17.101  -17.159 -10.099 1.00 18.09 ? 503  MET A O   1 
ATOM   4029 C CB  . MET A  1 504 ? 19.738  -15.197 -10.180 1.00 19.19 ? 503  MET A CB  1 
ATOM   4030 C CG  . MET A  1 504 ? 20.730  -14.602 -11.182 1.00 21.38 ? 503  MET A CG  1 
ATOM   4031 S SD  . MET A  1 504 ? 22.431  -14.647 -10.676 1.00 25.15 ? 503  MET A SD  1 
ATOM   4032 C CE  . MET A  1 504 ? 22.714  -16.448 -10.628 1.00 23.10 ? 503  MET A CE  1 
ATOM   4033 N N   . TRP A  1 505 ? 16.664  -15.259 -8.958  1.00 17.33 ? 504  TRP A N   1 
ATOM   4034 C CA  . TRP A  1 505 ? 15.612  -15.858 -8.132  1.00 17.61 ? 504  TRP A CA  1 
ATOM   4035 C C   . TRP A  1 505 ? 14.253  -15.921 -8.842  1.00 17.38 ? 504  TRP A C   1 
ATOM   4036 O O   . TRP A  1 505 ? 13.312  -16.541 -8.332  1.00 18.66 ? 504  TRP A O   1 
ATOM   4037 C CB  . TRP A  1 505 ? 15.472  -15.123 -6.772  1.00 16.42 ? 504  TRP A CB  1 
ATOM   4038 C CG  . TRP A  1 505 ? 16.639  -15.312 -5.823  1.00 17.41 ? 504  TRP A CG  1 
ATOM   4039 C CD1 . TRP A  1 505 ? 17.364  -16.448 -5.623  1.00 16.29 ? 504  TRP A CD1 1 
ATOM   4040 C CD2 . TRP A  1 505 ? 17.213  -14.319 -4.959  1.00 15.55 ? 504  TRP A CD2 1 
ATOM   4041 N NE1 . TRP A  1 505 ? 18.354  -16.230 -4.696  1.00 16.91 ? 504  TRP A NE1 1 
ATOM   4042 C CE2 . TRP A  1 505 ? 18.288  -14.928 -4.273  1.00 16.71 ? 504  TRP A CE2 1 
ATOM   4043 C CE3 . TRP A  1 505 ? 16.937  -12.964 -4.708  1.00 15.29 ? 504  TRP A CE3 1 
ATOM   4044 C CZ2 . TRP A  1 505 ? 19.083  -14.240 -3.347  1.00 16.05 ? 504  TRP A CZ2 1 
ATOM   4045 C CZ3 . TRP A  1 505 ? 17.723  -12.280 -3.791  1.00 14.22 ? 504  TRP A CZ3 1 
ATOM   4046 C CH2 . TRP A  1 505 ? 18.783  -12.911 -3.121  1.00 14.70 ? 504  TRP A CH2 1 
ATOM   4047 N N   . ASP A  1 506 ? 14.155  -15.326 -10.032 1.00 17.64 ? 505  ASP A N   1 
ATOM   4048 C CA  . ASP A  1 506 ? 12.901  -15.283 -10.805 1.00 17.78 ? 505  ASP A CA  1 
ATOM   4049 C C   . ASP A  1 506 ? 11.776  -14.508 -10.102 1.00 16.90 ? 505  ASP A C   1 
ATOM   4050 O O   . ASP A  1 506 ? 10.595  -14.790 -10.309 1.00 17.11 ? 505  ASP A O   1 
ATOM   4051 C CB  . ASP A  1 506 ? 12.419  -16.709 -11.156 1.00 18.54 ? 505  ASP A CB  1 
ATOM   4052 C CG  . ASP A  1 506 ? 11.623  -16.760 -12.441 1.00 21.61 ? 505  ASP A CG  1 
ATOM   4053 O OD1 . ASP A  1 506 ? 12.015  -16.082 -13.424 1.00 24.95 ? 505  ASP A OD1 1 
ATOM   4054 O OD2 . ASP A  1 506 ? 10.582  -17.461 -12.568 1.00 21.57 ? 505  ASP A OD2 1 
ATOM   4055 N N   . ILE A  1 507 ? 12.134  -13.510 -9.290  1.00 16.36 ? 506  ILE A N   1 
ATOM   4056 C CA  . ILE A  1 507 ? 11.139  -12.691 -8.617  1.00 16.32 ? 506  ILE A CA  1 
ATOM   4057 C C   . ILE A  1 507 ? 11.068  -11.290 -9.223  1.00 16.18 ? 506  ILE A C   1 
ATOM   4058 O O   . ILE A  1 507 ? 11.906  -10.927 -10.069 1.00 16.57 ? 506  ILE A O   1 
ATOM   4059 C CB  . ILE A  1 507 ? 11.437  -12.608 -7.084  1.00 15.49 ? 506  ILE A CB  1 
ATOM   4060 C CG1 . ILE A  1 507 ? 12.852  -12.049 -6.858  1.00 17.60 ? 506  ILE A CG1 1 
ATOM   4061 C CG2 . ILE A  1 507 ? 11.249  -13.987 -6.419  1.00 17.99 ? 506  ILE A CG2 1 
ATOM   4062 C CD1 . ILE A  1 507 ? 13.141  -11.599 -5.434  1.00 19.67 ? 506  ILE A CD1 1 
ATOM   4063 N N   . ASN A  1 508 ? 10.061  -10.524 -8.802  1.00 16.51 ? 507  ASN A N   1 
ATOM   4064 C CA  . ASN A  1 508 ? 9.906   -9.135  -9.210  1.00 15.75 ? 507  ASN A CA  1 
ATOM   4065 C C   . ASN A  1 508 ? 10.532  -8.189  -8.195  1.00 15.63 ? 507  ASN A C   1 
ATOM   4066 O O   . ASN A  1 508 ? 9.951   -7.966  -7.130  1.00 15.84 ? 507  ASN A O   1 
ATOM   4067 C CB  . ASN A  1 508 ? 8.417   -8.803  -9.356  1.00 16.38 ? 507  ASN A CB  1 
ATOM   4068 C CG  . ASN A  1 508 ? 8.174   -7.455  -10.003 1.00 17.38 ? 507  ASN A CG  1 
ATOM   4069 O OD1 . ASN A  1 508 ? 9.114   -6.690  -10.284 1.00 18.15 ? 507  ASN A OD1 1 
ATOM   4070 N ND2 . ASN A  1 508 ? 6.911   -7.154  -10.257 1.00 15.82 ? 507  ASN A ND2 1 
ATOM   4071 N N   . SER A  1 509 ? 11.696  -7.639  -8.530  1.00 15.02 ? 508  SER A N   1 
ATOM   4072 C CA  . SER A  1 509 ? 12.408  -6.732  -7.621  1.00 14.57 ? 508  SER A CA  1 
ATOM   4073 C C   . SER A  1 509 ? 11.718  -5.376  -7.473  1.00 14.88 ? 508  SER A C   1 
ATOM   4074 O O   . SER A  1 509 ? 12.151  -4.543  -6.671  1.00 14.62 ? 508  SER A O   1 
ATOM   4075 C CB  . SER A  1 509 ? 13.847  -6.493  -8.099  1.00 14.51 ? 508  SER A CB  1 
ATOM   4076 O OG  . SER A  1 509 ? 14.631  -7.670  -8.045  1.00 14.78 ? 508  SER A OG  1 
ATOM   4077 N N   . PHE A  1 510 ? 10.656  -5.141  -8.236  1.00 14.76 ? 509  PHE A N   1 
ATOM   4078 C CA  . PHE A  1 510 ? 10.154  -3.779  -8.433  1.00 14.63 ? 509  PHE A CA  1 
ATOM   4079 C C   . PHE A  1 510 ? 8.737   -3.481  -7.923  1.00 14.97 ? 509  PHE A C   1 
ATOM   4080 O O   . PHE A  1 510 ? 8.275   -2.344  -7.990  1.00 15.28 ? 509  PHE A O   1 
ATOM   4081 C CB  . PHE A  1 510 ? 10.403  -3.363  -9.898  1.00 14.81 ? 509  PHE A CB  1 
ATOM   4082 C CG  . PHE A  1 510 ? 11.848  -3.498  -10.281 1.00 15.55 ? 509  PHE A CG  1 
ATOM   4083 C CD1 . PHE A  1 510 ? 12.310  -4.555  -11.080 1.00 16.15 ? 509  PHE A CD1 1 
ATOM   4084 C CD2 . PHE A  1 510 ? 12.778  -2.597  -9.756  1.00 14.65 ? 509  PHE A CD2 1 
ATOM   4085 C CE1 . PHE A  1 510 ? 13.686  -4.686  -11.379 1.00 15.72 ? 509  PHE A CE1 1 
ATOM   4086 C CE2 . PHE A  1 510 ? 14.130  -2.721  -10.051 1.00 16.24 ? 509  PHE A CE2 1 
ATOM   4087 C CZ  . PHE A  1 510 ? 14.593  -3.752  -10.863 1.00 16.84 ? 509  PHE A CZ  1 
ATOM   4088 N N   . ASP A  1 511 ? 8.079   -4.499  -7.369  1.00 15.52 ? 510  ASP A N   1 
ATOM   4089 C CA  . ASP A  1 511 ? 6.790   -4.289  -6.709  1.00 15.00 ? 510  ASP A CA  1 
ATOM   4090 C C   . ASP A  1 511 ? 6.943   -4.350  -5.183  1.00 15.23 ? 510  ASP A C   1 
ATOM   4091 O O   . ASP A  1 511 ? 8.052   -4.505  -4.680  1.00 14.47 ? 510  ASP A O   1 
ATOM   4092 C CB  . ASP A  1 511 ? 5.731   -5.271  -7.248  1.00 15.72 ? 510  ASP A CB  1 
ATOM   4093 C CG  . ASP A  1 511 ? 6.062   -6.725  -6.957  1.00 15.97 ? 510  ASP A CG  1 
ATOM   4094 O OD1 . ASP A  1 511 ? 6.976   -7.008  -6.139  1.00 15.18 ? 510  ASP A OD1 1 
ATOM   4095 O OD2 . ASP A  1 511 ? 5.429   -7.679  -7.490  1.00 16.28 ? 510  ASP A OD2 1 
ATOM   4096 N N   . GLN A  1 512 ? 5.840   -4.178  -4.456  1.00 14.98 ? 511  GLN A N   1 
ATOM   4097 C CA  . GLN A  1 512 ? 5.852   -4.220  -2.979  1.00 14.50 ? 511  GLN A CA  1 
ATOM   4098 C C   . GLN A  1 512 ? 4.440   -4.471  -2.431  1.00 14.90 ? 511  GLN A C   1 
ATOM   4099 O O   . GLN A  1 512 ? 3.857   -3.652  -1.720  1.00 15.13 ? 511  GLN A O   1 
ATOM   4100 C CB  . GLN A  1 512 ? 6.527   -2.970  -2.349  1.00 14.24 ? 511  GLN A CB  1 
ATOM   4101 C CG  . GLN A  1 512 ? 5.914   -1.620  -2.711  1.00 13.94 ? 511  GLN A CG  1 
ATOM   4102 C CD  . GLN A  1 512 ? 6.198   -1.196  -4.146  1.00 15.42 ? 511  GLN A CD  1 
ATOM   4103 O OE1 . GLN A  1 512 ? 7.331   -1.300  -4.615  1.00 15.82 ? 511  GLN A OE1 1 
ATOM   4104 N NE2 . GLN A  1 512 ? 5.173   -0.687  -4.828  1.00 17.87 ? 511  GLN A NE2 1 
ATOM   4105 N N   . TRP A  1 513 ? 3.878   -5.624  -2.780  1.00 15.41 ? 512  TRP A N   1 
ATOM   4106 C CA  . TRP A  1 513 ? 2.539   -5.940  -2.320  1.00 15.70 ? 512  TRP A CA  1 
ATOM   4107 C C   . TRP A  1 513 ? 2.480   -6.198  -0.811  1.00 16.33 ? 512  TRP A C   1 
ATOM   4108 O O   . TRP A  1 513 ? 1.400   -6.133  -0.211  1.00 16.24 ? 512  TRP A O   1 
ATOM   4109 C CB  . TRP A  1 513 ? 1.996   -7.152  -3.093  1.00 15.77 ? 512  TRP A CB  1 
ATOM   4110 C CG  . TRP A  1 513 ? 1.914   -6.912  -4.577  1.00 17.80 ? 512  TRP A CG  1 
ATOM   4111 C CD1 . TRP A  1 513 ? 2.648   -7.516  -5.547  1.00 18.90 ? 512  TRP A CD1 1 
ATOM   4112 C CD2 . TRP A  1 513 ? 1.042   -5.997  -5.243  1.00 20.17 ? 512  TRP A CD2 1 
ATOM   4113 N NE1 . TRP A  1 513 ? 2.291   -7.034  -6.787  1.00 19.74 ? 512  TRP A NE1 1 
ATOM   4114 C CE2 . TRP A  1 513 ? 1.304   -6.100  -6.632  1.00 21.48 ? 512  TRP A CE2 1 
ATOM   4115 C CE3 . TRP A  1 513 ? 0.070   -5.080  -4.807  1.00 24.99 ? 512  TRP A CE3 1 
ATOM   4116 C CZ2 . TRP A  1 513 ? 0.631   -5.329  -7.585  1.00 24.09 ? 512  TRP A CZ2 1 
ATOM   4117 C CZ3 . TRP A  1 513 ? -0.604  -4.310  -5.761  1.00 27.31 ? 512  TRP A CZ3 1 
ATOM   4118 C CH2 . TRP A  1 513 ? -0.316  -4.449  -7.138  1.00 26.48 ? 512  TRP A CH2 1 
ATOM   4119 N N   . GLY A  1 514 ? 3.641   -6.456  -0.209  1.00 16.52 ? 513  GLY A N   1 
ATOM   4120 C CA  . GLY A  1 514 ? 3.742   -6.869  1.176   1.00 17.35 ? 513  GLY A CA  1 
ATOM   4121 C C   . GLY A  1 514 ? 3.515   -5.780  2.198   1.00 17.49 ? 513  GLY A C   1 
ATOM   4122 O O   . GLY A  1 514 ? 3.484   -6.053  3.408   1.00 18.56 ? 513  GLY A O   1 
ATOM   4123 N N   . VAL A  1 515 ? 3.385   -4.544  1.736   1.00 17.93 ? 514  VAL A N   1 
ATOM   4124 C CA  . VAL A  1 515 ? 3.066   -3.441  2.642   1.00 18.32 ? 514  VAL A CA  1 
ATOM   4125 C C   . VAL A  1 515 ? 1.556   -3.158  2.777   1.00 18.40 ? 514  VAL A C   1 
ATOM   4126 O O   . VAL A  1 515 ? 1.152   -2.391  3.651   1.00 18.27 ? 514  VAL A O   1 
ATOM   4127 C CB  . VAL A  1 515 ? 3.856   -2.142  2.271   1.00 18.57 ? 514  VAL A CB  1 
ATOM   4128 C CG1 . VAL A  1 515 ? 5.359   -2.416  2.238   1.00 19.33 ? 514  VAL A CG1 1 
ATOM   4129 C CG2 . VAL A  1 515 ? 3.363   -1.530  0.965   1.00 20.97 ? 514  VAL A CG2 1 
ATOM   4130 N N   . GLU A  1 516 ? 0.725   -3.800  1.949   1.00 18.06 ? 515  GLU A N   1 
ATOM   4131 C CA  . GLU A  1 516 ? -0.704  -3.455  1.887   1.00 18.85 ? 515  GLU A CA  1 
ATOM   4132 C C   . GLU A  1 516 ? -1.476  -3.851  3.138   1.00 18.31 ? 515  GLU A C   1 
ATOM   4133 O O   . GLU A  1 516 ? -2.236  -3.041  3.677   1.00 17.42 ? 515  GLU A O   1 
ATOM   4134 C CB  . GLU A  1 516 ? -1.367  -4.056  0.633   1.00 19.25 ? 515  GLU A CB  1 
ATOM   4135 C CG  . GLU A  1 516 ? -2.768  -3.538  0.327   1.00 25.94 ? 515  GLU A CG  1 
ATOM   4136 C CD  . GLU A  1 516 ? -3.452  -4.300  -0.804  1.00 32.18 ? 515  GLU A CD  1 
ATOM   4137 O OE1 . GLU A  1 516 ? -4.674  -4.577  -0.680  1.00 36.52 ? 515  GLU A OE1 1 
ATOM   4138 O OE2 . GLU A  1 516 ? -2.790  -4.617  -1.825  1.00 34.93 ? 515  GLU A OE2 1 
ATOM   4139 N N   . LEU A  1 517 ? -1.263  -5.074  3.628   1.00 17.34 ? 516  LEU A N   1 
ATOM   4140 C CA  . LEU A  1 517 ? -2.080  -5.572  4.741   1.00 17.17 ? 516  LEU A CA  1 
ATOM   4141 C C   . LEU A  1 517 ? -1.998  -4.690  6.013   1.00 17.49 ? 516  LEU A C   1 
ATOM   4142 O O   . LEU A  1 517 ? -3.022  -4.392  6.627   1.00 16.81 ? 516  LEU A O   1 
ATOM   4143 C CB  . LEU A  1 517 ? -1.754  -7.038  5.052   1.00 17.52 ? 516  LEU A CB  1 
ATOM   4144 C CG  . LEU A  1 517 ? -2.487  -7.712  6.224   1.00 17.54 ? 516  LEU A CG  1 
ATOM   4145 C CD1 . LEU A  1 517 ? -4.009  -7.720  5.981   1.00 19.35 ? 516  LEU A CD1 1 
ATOM   4146 C CD2 . LEU A  1 517 ? -1.986  -9.123  6.424   1.00 18.38 ? 516  LEU A CD2 1 
ATOM   4147 N N   . GLY A  1 518 ? -0.787  -4.273  6.390   1.00 17.34 ? 517  GLY A N   1 
ATOM   4148 C CA  . GLY A  1 518 ? -0.604  -3.421  7.558   1.00 17.35 ? 517  GLY A CA  1 
ATOM   4149 C C   . GLY A  1 518 ? -1.346  -2.097  7.460   1.00 17.48 ? 517  GLY A C   1 
ATOM   4150 O O   . GLY A  1 518 ? -1.885  -1.611  8.452   1.00 17.42 ? 517  GLY A O   1 
ATOM   4151 N N   . LYS A  1 519 ? -1.377  -1.511  6.264   1.00 17.15 ? 518  LYS A N   1 
ATOM   4152 C CA  . LYS A  1 519 ? -2.101  -0.260  6.046   1.00 17.98 ? 518  LYS A CA  1 
ATOM   4153 C C   . LYS A  1 519 ? -3.602  -0.463  6.235   1.00 17.88 ? 518  LYS A C   1 
ATOM   4154 O O   . LYS A  1 519 ? -4.279  0.381   6.832   1.00 17.72 ? 518  LYS A O   1 
ATOM   4155 C CB  . LYS A  1 519 ? -1.827  0.281   4.638   1.00 18.18 ? 518  LYS A CB  1 
ATOM   4156 C CG  . LYS A  1 519 ? -0.390  0.756   4.420   1.00 19.98 ? 518  LYS A CG  1 
ATOM   4157 C CD  . LYS A  1 519 ? -0.194  1.135   2.957   1.00 21.66 ? 518  LYS A CD  1 
ATOM   4158 C CE  . LYS A  1 519 ? 1.244   1.511   2.665   1.00 24.03 ? 518  LYS A CE  1 
ATOM   4159 N NZ  . LYS A  1 519 ? 1.386   1.819   1.211   1.00 25.47 ? 518  LYS A NZ  1 
ATOM   4160 N N   . GLN A  1 520 ? -4.114  -1.584  5.721   1.00 17.83 ? 519  GLN A N   1 
ATOM   4161 C CA  . GLN A  1 520 ? -5.543  -1.885  5.812   1.00 18.06 ? 519  GLN A CA  1 
ATOM   4162 C C   . GLN A  1 520 ? -5.960  -2.077  7.253   1.00 18.45 ? 519  GLN A C   1 
ATOM   4163 O O   . GLN A  1 520 ? -6.983  -1.528  7.712   1.00 18.69 ? 519  GLN A O   1 
ATOM   4164 C CB  . GLN A  1 520 ? -5.878  -3.151  5.014   1.00 18.20 ? 519  GLN A CB  1 
ATOM   4165 C CG  . GLN A  1 520 ? -5.669  -3.008  3.510   1.00 19.68 ? 519  GLN A CG  1 
ATOM   4166 C CD  . GLN A  1 520 ? -5.902  -4.309  2.778   1.00 21.76 ? 519  GLN A CD  1 
ATOM   4167 O OE1 . GLN A  1 520 ? -5.080  -5.230  2.857   1.00 21.39 ? 519  GLN A OE1 1 
ATOM   4168 N NE2 . GLN A  1 520 ? -7.022  -4.393  2.062   1.00 23.58 ? 519  GLN A NE2 1 
ATOM   4169 N N   . LEU A  1 521 ? -5.172  -2.856  7.986   1.00 18.16 ? 520  LEU A N   1 
ATOM   4170 C CA  . LEU A  1 521 ? -5.546  -3.158  9.369   1.00 17.79 ? 520  LEU A CA  1 
ATOM   4171 C C   . LEU A  1 521 ? -5.421  -1.930  10.273  1.00 18.40 ? 520  LEU A C   1 
ATOM   4172 O O   . LEU A  1 521 ? -6.150  -1.814  11.268  1.00 19.72 ? 520  LEU A O   1 
ATOM   4173 C CB  . LEU A  1 521 ? -4.745  -4.352  9.917   1.00 18.14 ? 520  LEU A CB  1 
ATOM   4174 C CG  . LEU A  1 521 ? -5.012  -5.702  9.241   1.00 18.32 ? 520  LEU A CG  1 
ATOM   4175 C CD1 . LEU A  1 521 ? -4.323  -6.833  10.015  1.00 19.74 ? 520  LEU A CD1 1 
ATOM   4176 C CD2 . LEU A  1 521 ? -6.508  -5.989  9.047   1.00 19.51 ? 520  LEU A CD2 1 
ATOM   4177 N N   . ALA A  1 522 ? -4.523  -1.002  9.933   1.00 18.53 ? 521  ALA A N   1 
ATOM   4178 C CA  . ALA A  1 522 ? -4.365  0.223   10.727  1.00 18.24 ? 521  ALA A CA  1 
ATOM   4179 C C   . ALA A  1 522 ? -5.567  1.143   10.580  1.00 19.50 ? 521  ALA A C   1 
ATOM   4180 O O   . ALA A  1 522 ? -6.004  1.748   11.555  1.00 19.01 ? 521  ALA A O   1 
ATOM   4181 C CB  . ALA A  1 522 ? -3.071  0.957   10.356  1.00 18.05 ? 521  ALA A CB  1 
ATOM   4182 N N   . LYS A  1 523 ? -6.093  1.243   9.359   1.00 19.58 ? 522  LYS A N   1 
ATOM   4183 C CA  . LYS A  1 523 ? -7.277  2.064   9.081   1.00 21.57 ? 522  LYS A CA  1 
ATOM   4184 C C   . LYS A  1 523 ? -8.504  1.566   9.833   1.00 21.68 ? 522  LYS A C   1 
ATOM   4185 O O   . LYS A  1 523 ? -9.383  2.356   10.152  1.00 22.48 ? 522  LYS A O   1 
ATOM   4186 C CB  . LYS A  1 523 ? -7.587  2.096   7.581   1.00 21.81 ? 522  LYS A CB  1 
ATOM   4187 C CG  . LYS A  1 523 ? -6.653  2.969   6.760   1.00 24.77 ? 522  LYS A CG  1 
ATOM   4188 C CD  . LYS A  1 523 ? -6.735  2.584   5.280   1.00 31.85 ? 522  LYS A CD  1 
ATOM   4189 C CE  . LYS A  1 523 ? -6.419  3.765   4.372   1.00 35.27 ? 522  LYS A CE  1 
ATOM   4190 N NZ  . LYS A  1 523 ? -6.468  3.399   2.920   1.00 36.54 ? 522  LYS A NZ  1 
ATOM   4191 N N   . LYS A  1 524 ? -8.552  0.265   10.111  1.00 22.41 ? 523  LYS A N   1 
ATOM   4192 C CA  . LYS A  1 524 ? -9.661  -0.319  10.864  1.00 23.47 ? 523  LYS A CA  1 
ATOM   4193 C C   . LYS A  1 524 ? -9.557  -0.020  12.351  1.00 22.95 ? 523  LYS A C   1 
ATOM   4194 O O   . LYS A  1 524 ? -10.565 0.192   13.021  1.00 23.31 ? 523  LYS A O   1 
ATOM   4195 C CB  . LYS A  1 524 ? -9.741  -1.833  10.643  1.00 23.72 ? 523  LYS A CB  1 
ATOM   4196 C CG  . LYS A  1 524 ? -10.026 -2.224  9.205   1.00 27.93 ? 523  LYS A CG  1 
ATOM   4197 C CD  . LYS A  1 524 ? -10.300 -3.713  9.066   1.00 32.11 ? 523  LYS A CD  1 
ATOM   4198 C CE  . LYS A  1 524 ? -11.799 -4.021  9.169   1.00 36.01 ? 523  LYS A CE  1 
ATOM   4199 N NZ  . LYS A  1 524 ? -12.249 -4.197  10.584  1.00 38.30 ? 523  LYS A NZ  1 
ATOM   4200 N N   . ILE A  1 525 ? -8.331  -0.006  12.863  1.00 22.66 ? 524  ILE A N   1 
ATOM   4201 C CA  . ILE A  1 525 ? -8.113  0.220   14.283  1.00 21.79 ? 524  ILE A CA  1 
ATOM   4202 C C   . ILE A  1 525 ? -8.271  1.699   14.668  1.00 22.60 ? 524  ILE A C   1 
ATOM   4203 O O   . ILE A  1 525 ? -8.715  1.991   15.780  1.00 22.38 ? 524  ILE A O   1 
ATOM   4204 C CB  . ILE A  1 525 ? -6.744  -0.395  14.724  1.00 21.86 ? 524  ILE A CB  1 
ATOM   4205 C CG1 . ILE A  1 525 ? -6.832  -1.931  14.697  1.00 21.35 ? 524  ILE A CG1 1 
ATOM   4206 C CG2 . ILE A  1 525 ? -6.330  0.069   16.119  1.00 20.83 ? 524  ILE A CG2 1 
ATOM   4207 C CD1 . ILE A  1 525 ? -5.499  -2.635  14.787  1.00 22.15 ? 524  ILE A CD1 1 
ATOM   4208 N N   . GLU A  1 526 ? -7.948  2.624   13.757  1.00 22.56 ? 525  GLU A N   1 
ATOM   4209 C CA  . GLU A  1 526 ? -7.961  4.065   14.076  1.00 24.41 ? 525  GLU A CA  1 
ATOM   4210 C C   . GLU A  1 526 ? -9.240  4.519   14.803  1.00 25.19 ? 525  GLU A C   1 
ATOM   4211 O O   . GLU A  1 526 ? -9.148  5.087   15.895  1.00 24.91 ? 525  GLU A O   1 
ATOM   4212 C CB  . GLU A  1 526 ? -7.729  4.924   12.819  1.00 24.70 ? 525  GLU A CB  1 
ATOM   4213 C CG  . GLU A  1 526 ? -6.287  5.165   12.437  1.00 27.38 ? 525  GLU A CG  1 
ATOM   4214 C CD  . GLU A  1 526 ? -6.154  6.038   11.197  1.00 30.40 ? 525  GLU A CD  1 
ATOM   4215 O OE1 . GLU A  1 526 ? -6.763  7.119   11.162  1.00 33.04 ? 525  GLU A OE1 1 
ATOM   4216 O OE2 . GLU A  1 526 ? -5.426  5.646   10.263  1.00 35.19 ? 525  GLU A OE2 1 
ATOM   4217 N N   . PRO A  1 527 ? -10.424 4.271   14.222  1.00 26.11 ? 526  PRO A N   1 
ATOM   4218 C CA  . PRO A  1 527 ? -11.684 4.690   14.872  1.00 26.55 ? 526  PRO A CA  1 
ATOM   4219 C C   . PRO A  1 527 ? -11.989 3.972   16.186  1.00 27.12 ? 526  PRO A C   1 
ATOM   4220 O O   . PRO A  1 527 ? -12.669 4.554   17.032  1.00 27.21 ? 526  PRO A O   1 
ATOM   4221 C CB  . PRO A  1 527 ? -12.771 4.368   13.833  1.00 26.97 ? 526  PRO A CB  1 
ATOM   4222 C CG  . PRO A  1 527 ? -12.073 3.958   12.585  1.00 27.32 ? 526  PRO A CG  1 
ATOM   4223 C CD  . PRO A  1 527 ? -10.660 3.619   12.920  1.00 26.24 ? 526  PRO A CD  1 
ATOM   4224 N N   . GLU A  1 528 ? -11.487 2.750   16.362  1.00 27.40 ? 527  GLU A N   1 
ATOM   4225 C CA  . GLU A  1 528 ? -11.745 1.975   17.571  1.00 27.77 ? 527  GLU A CA  1 
ATOM   4226 C C   . GLU A  1 528 ? -11.011 2.514   18.791  1.00 27.98 ? 527  GLU A C   1 
ATOM   4227 O O   . GLU A  1 528 ? -11.411 2.262   19.931  1.00 27.91 ? 527  GLU A O   1 
ATOM   4228 C CB  . GLU A  1 528 ? -11.390 0.501   17.348  1.00 28.49 ? 527  GLU A CB  1 
ATOM   4229 C CG  . GLU A  1 528 ? -12.117 -0.135  16.173  1.00 29.89 ? 527  GLU A CG  1 
ATOM   4230 C CD  . GLU A  1 528 ? -11.654 -1.555  15.912  1.00 32.12 ? 527  GLU A CD  1 
ATOM   4231 O OE1 . GLU A  1 528 ? -10.498 -1.888  16.257  1.00 32.95 ? 527  GLU A OE1 1 
ATOM   4232 O OE2 . GLU A  1 528 ? -12.452 -2.342  15.370  1.00 36.55 ? 527  GLU A OE2 1 
ATOM   4233 N N   . LEU A  1 529 ? -9.932  3.259   18.547  1.00 27.40 ? 528  LEU A N   1 
ATOM   4234 C CA  . LEU A  1 529 ? -9.184  3.873   19.631  1.00 27.38 ? 528  LEU A CA  1 
ATOM   4235 C C   . LEU A  1 529 ? -9.942  5.047   20.242  1.00 28.83 ? 528  LEU A C   1 
ATOM   4236 O O   . LEU A  1 529 ? -9.712  5.383   21.388  1.00 28.51 ? 528  LEU A O   1 
ATOM   4237 C CB  . LEU A  1 529 ? -7.790  4.306   19.164  1.00 26.12 ? 528  LEU A CB  1 
ATOM   4238 C CG  . LEU A  1 529 ? -6.848  3.144   18.816  1.00 24.42 ? 528  LEU A CG  1 
ATOM   4239 C CD1 . LEU A  1 529 ? -5.583  3.646   18.118  1.00 21.36 ? 528  LEU A CD1 1 
ATOM   4240 C CD2 . LEU A  1 529 ? -6.488  2.347   20.075  1.00 24.51 ? 528  LEU A CD2 1 
ATOM   4241 N N   . GLU A  1 530 ? -10.838 5.659   19.469  1.00 30.59 ? 529  GLU A N   1 
ATOM   4242 C CA  . GLU A  1 530 ? -11.631 6.791   19.951  1.00 32.87 ? 529  GLU A CA  1 
ATOM   4243 C C   . GLU A  1 530 ? -12.687 6.317   20.952  1.00 33.66 ? 529  GLU A C   1 
ATOM   4244 O O   . GLU A  1 530 ? -13.336 5.295   20.734  1.00 34.11 ? 529  GLU A O   1 
ATOM   4245 C CB  . GLU A  1 530 ? -12.282 7.531   18.771  1.00 33.23 ? 529  GLU A CB  1 
ATOM   4246 C CG  . GLU A  1 530 ? -11.285 8.170   17.809  1.00 35.56 ? 529  GLU A CG  1 
ATOM   4247 C CD  . GLU A  1 530 ? -11.914 8.642   16.509  1.00 39.47 ? 529  GLU A CD  1 
ATOM   4248 O OE1 . GLU A  1 530 ? -12.979 9.290   16.561  1.00 42.61 ? 529  GLU A OE1 1 
ATOM   4249 O OE2 . GLU A  1 530 ? -11.341 8.376   15.424  1.00 40.87 ? 529  GLU A OE2 1 
ATOM   4250 N N   . GLY A  1 531 ? -12.841 7.045   22.057  1.00 34.58 ? 530  GLY A N   1 
ATOM   4251 C CA  . GLY A  1 531 ? -13.829 6.700   23.072  1.00 35.30 ? 530  GLY A CA  1 
ATOM   4252 C C   . GLY A  1 531 ? -13.317 5.678   24.072  1.00 36.12 ? 530  GLY A C   1 
ATOM   4253 O O   . GLY A  1 531 ? -12.229 5.130   23.899  1.00 35.95 ? 530  GLY A O   1 
ATOM   4254 N N   . SER A  1 532 ? -14.100 5.405   25.115  1.00 36.70 ? 531  SER A N   1 
ATOM   4255 C CA  . SER A  1 532 ? -13.626 4.557   26.213  1.00 37.55 ? 531  SER A CA  1 
ATOM   4256 C C   . SER A  1 532 ? -14.211 3.137   26.229  1.00 37.57 ? 531  SER A C   1 
ATOM   4257 O O   . SER A  1 532 ? -13.898 2.347   27.123  1.00 38.25 ? 531  SER A O   1 
ATOM   4258 C CB  . SER A  1 532 ? -13.854 5.251   27.560  1.00 37.69 ? 531  SER A CB  1 
ATOM   4259 O OG  . SER A  1 532 ? -15.232 5.504   27.765  1.00 38.24 ? 531  SER A OG  1 
ATOM   4260 N N   . SER A  1 533 ? -15.033 2.807   25.234  1.00 37.58 ? 532  SER A N   1 
ATOM   4261 C CA  . SER A  1 533 ? -15.628 1.470   25.141  1.00 37.22 ? 532  SER A CA  1 
ATOM   4262 C C   . SER A  1 533 ? -14.597 0.392   24.790  1.00 36.69 ? 532  SER A C   1 
ATOM   4263 O O   . SER A  1 533 ? -13.649 0.648   24.036  1.00 36.25 ? 532  SER A O   1 
ATOM   4264 C CB  . SER A  1 533 ? -16.794 1.457   24.143  1.00 37.51 ? 532  SER A CB  1 
ATOM   4265 O OG  . SER A  1 533 ? -16.341 1.339   22.803  1.00 38.98 ? 532  SER A OG  1 
ATOM   4266 N N   . ALA A  1 534 ? -14.793 -0.805  25.345  1.00 35.70 ? 533  ALA A N   1 
ATOM   4267 C CA  . ALA A  1 534 ? -13.928 -1.947  25.076  1.00 34.77 ? 533  ALA A CA  1 
ATOM   4268 C C   . ALA A  1 534 ? -14.049 -2.390  23.618  1.00 34.07 ? 533  ALA A C   1 
ATOM   4269 O O   . ALA A  1 534 ? -15.121 -2.301  23.015  1.00 34.20 ? 533  ALA A O   1 
ATOM   4270 C CB  . ALA A  1 534 ? -14.263 -3.100  26.017  1.00 35.13 ? 533  ALA A CB  1 
ATOM   4271 N N   . VAL A  1 535 ? -12.937 -2.838  23.044  1.00 32.86 ? 534  VAL A N   1 
ATOM   4272 C CA  . VAL A  1 535 ? -12.946 -3.392  21.688  1.00 31.78 ? 534  VAL A CA  1 
ATOM   4273 C C   . VAL A  1 535 ? -12.879 -4.914  21.790  1.00 31.33 ? 534  VAL A C   1 
ATOM   4274 O O   . VAL A  1 535 ? -12.073 -5.457  22.557  1.00 30.97 ? 534  VAL A O   1 
ATOM   4275 C CB  . VAL A  1 535 ? -11.782 -2.816  20.832  1.00 31.86 ? 534  VAL A CB  1 
ATOM   4276 C CG1 . VAL A  1 535 ? -11.717 -3.479  19.458  1.00 31.98 ? 534  VAL A CG1 1 
ATOM   4277 C CG2 . VAL A  1 535 ? -11.942 -1.311  20.679  1.00 31.53 ? 534  VAL A CG2 1 
ATOM   4278 N N   . THR A  1 536 ? -13.746 -5.593  21.038  1.00 30.49 ? 535  THR A N   1 
ATOM   4279 C CA  . THR A  1 536 ? -13.864 -7.051  21.094  1.00 30.24 ? 535  THR A CA  1 
ATOM   4280 C C   . THR A  1 536 ? -13.764 -7.683  19.706  1.00 29.88 ? 535  THR A C   1 
ATOM   4281 O O   . THR A  1 536 ? -13.886 -8.901  19.569  1.00 30.81 ? 535  THR A O   1 
ATOM   4282 C CB  . THR A  1 536 ? -15.220 -7.451  21.733  1.00 30.46 ? 535  THR A CB  1 
ATOM   4283 O OG1 . THR A  1 536 ? -16.285 -6.883  20.962  1.00 31.25 ? 535  THR A OG1 1 
ATOM   4284 C CG2 . THR A  1 536 ? -15.397 -6.811  23.100  1.00 30.40 ? 535  THR A CG2 1 
ATOM   4285 N N   . SER A  1 537 ? -13.542 -6.860  18.685  1.00 29.52 ? 536  SER A N   1 
ATOM   4286 C CA  . SER A  1 537 ? -13.628 -7.307  17.287  1.00 28.96 ? 536  SER A CA  1 
ATOM   4287 C C   . SER A  1 537 ? -12.411 -8.069  16.736  1.00 28.08 ? 536  SER A C   1 
ATOM   4288 O O   . SER A  1 537 ? -12.474 -8.605  15.621  1.00 28.76 ? 536  SER A O   1 
ATOM   4289 C CB  . SER A  1 537 ? -13.935 -6.122  16.375  1.00 29.22 ? 536  SER A CB  1 
ATOM   4290 O OG  . SER A  1 537 ? -12.962 -5.110  16.547  1.00 31.32 ? 536  SER A OG  1 
ATOM   4291 N N   . HIS A  1 538 ? -11.313 -8.096  17.489  1.00 26.14 ? 537  HIS A N   1 
ATOM   4292 C CA  . HIS A  1 538 ? -10.069 -8.726  17.020  1.00 24.74 ? 537  HIS A CA  1 
ATOM   4293 C C   . HIS A  1 538 ? -9.739  -9.972  17.829  1.00 24.07 ? 537  HIS A C   1 
ATOM   4294 O O   . HIS A  1 538 ? -10.529 -10.398 18.676  1.00 24.76 ? 537  HIS A O   1 
ATOM   4295 C CB  . HIS A  1 538 ? -8.890  -7.735  17.099  1.00 24.02 ? 537  HIS A CB  1 
ATOM   4296 C CG  . HIS A  1 538 ? -9.155  -6.418  16.439  1.00 24.77 ? 537  HIS A CG  1 
ATOM   4297 N ND1 . HIS A  1 538 ? -8.719  -6.124  15.164  1.00 25.20 ? 537  HIS A ND1 1 
ATOM   4298 C CD2 . HIS A  1 538 ? -9.791  -5.309  16.886  1.00 25.62 ? 537  HIS A CD2 1 
ATOM   4299 C CE1 . HIS A  1 538 ? -9.098  -4.898  14.845  1.00 26.80 ? 537  HIS A CE1 1 
ATOM   4300 N NE2 . HIS A  1 538 ? -9.745  -4.380  15.875  1.00 27.04 ? 537  HIS A NE2 1 
ATOM   4301 N N   . ASP A  1 539 ? -8.569  -10.562 17.574  1.00 22.83 ? 538  ASP A N   1 
ATOM   4302 C CA  . ASP A  1 539 ? -8.021  -11.589 18.435  1.00 21.92 ? 538  ASP A CA  1 
ATOM   4303 C C   . ASP A  1 539 ? -7.833  -10.989 19.834  1.00 21.32 ? 538  ASP A C   1 
ATOM   4304 O O   . ASP A  1 539 ? -7.815  -9.762  20.001  1.00 20.76 ? 538  ASP A O   1 
ATOM   4305 C CB  . ASP A  1 539 ? -6.667  -12.045 17.901  1.00 21.51 ? 538  ASP A CB  1 
ATOM   4306 C CG  . ASP A  1 539 ? -5.674  -10.909 17.861  1.00 21.72 ? 538  ASP A CG  1 
ATOM   4307 O OD1 . ASP A  1 539 ? -4.903  -10.791 18.820  1.00 21.76 ? 538  ASP A OD1 1 
ATOM   4308 O OD2 . ASP A  1 539 ? -5.638  -10.072 16.928  1.00 22.15 ? 538  ASP A OD2 1 
ATOM   4309 N N   . SER A  1 540 ? -7.669  -11.848 20.832  1.00 21.31 ? 539  SER A N   1 
ATOM   4310 C CA  . SER A  1 540 ? -7.577  -11.400 22.220  1.00 21.05 ? 539  SER A CA  1 
ATOM   4311 C C   . SER A  1 540 ? -6.344  -10.553 22.563  1.00 20.56 ? 539  SER A C   1 
ATOM   4312 O O   . SER A  1 540 ? -6.407  -9.735  23.481  1.00 20.85 ? 539  SER A O   1 
ATOM   4313 C CB  . SER A  1 540 ? -7.755  -12.569 23.207  1.00 21.00 ? 539  SER A CB  1 
ATOM   4314 O OG  . SER A  1 540 ? -6.581  -13.367 23.356  1.00 22.42 ? 539  SER A OG  1 
ATOM   4315 N N   . SER A  1 541 ? -5.244  -10.729 21.825  1.00 20.15 ? 540  SER A N   1 
ATOM   4316 C CA  . SER A  1 541 ? -4.071  -9.862  22.019  1.00 19.17 ? 540  SER A CA  1 
ATOM   4317 C C   . SER A  1 541 ? -4.337  -8.426  21.585  1.00 18.97 ? 540  SER A C   1 
ATOM   4318 O O   . SER A  1 541 ? -4.146  -7.511  22.359  1.00 19.10 ? 540  SER A O   1 
ATOM   4319 C CB  . SER A  1 541 ? -2.825  -10.399 21.290  1.00 19.33 ? 540  SER A CB  1 
ATOM   4320 O OG  . SER A  1 541 ? -1.733  -9.488  21.467  1.00 18.19 ? 540  SER A OG  1 
ATOM   4321 N N   . THR A  1 542 ? -4.752  -8.243  20.335  1.00 18.75 ? 541  THR A N   1 
ATOM   4322 C CA  . THR A  1 542 ? -5.100  -6.918  19.820  1.00 18.71 ? 541  THR A CA  1 
ATOM   4323 C C   . THR A  1 542 ? -6.133  -6.256  20.733  1.00 19.42 ? 541  THR A C   1 
ATOM   4324 O O   . THR A  1 542 ? -5.968  -5.093  21.108  1.00 19.32 ? 541  THR A O   1 
ATOM   4325 C CB  . THR A  1 542 ? -5.606  -7.014  18.367  1.00 18.50 ? 541  THR A CB  1 
ATOM   4326 O OG1 . THR A  1 542 ? -4.598  -7.620  17.541  1.00 18.47 ? 541  THR A OG1 1 
ATOM   4327 C CG2 . THR A  1 542 ? -5.831  -5.617  17.759  1.00 17.78 ? 541  THR A CG2 1 
ATOM   4328 N N   . ASN A  1 543 ? -7.170  -7.011  21.120  1.00 19.79 ? 542  ASN A N   1 
ATOM   4329 C CA  . ASN A  1 543 ? -8.185  -6.488  22.039  1.00 20.19 ? 542  ASN A CA  1 
ATOM   4330 C C   . ASN A  1 543 ? -7.581  -6.059  23.382  1.00 20.06 ? 542  ASN A C   1 
ATOM   4331 O O   . ASN A  1 543 ? -7.946  -5.012  23.918  1.00 21.23 ? 542  ASN A O   1 
ATOM   4332 C CB  . ASN A  1 543 ? -9.283  -7.538  22.327  1.00 20.22 ? 542  ASN A CB  1 
ATOM   4333 C CG  . ASN A  1 543 ? -10.162 -7.890  21.107  1.00 21.37 ? 542  ASN A CG  1 
ATOM   4334 O OD1 . ASN A  1 543 ? -10.833 -8.934  21.126  1.00 24.70 ? 542  ASN A OD1 1 
ATOM   4335 N ND2 . ASN A  1 543 ? -10.197 -7.044  20.094  1.00 19.92 ? 542  ASN A ND2 1 
ATOM   4336 N N   . GLY A  1 544 ? -6.665  -6.876  23.909  1.00 19.52 ? 543  GLY A N   1 
ATOM   4337 C CA  . GLY A  1 544 ? -6.062  -6.654  25.219  1.00 19.93 ? 543  GLY A CA  1 
ATOM   4338 C C   . GLY A  1 544 ? -5.108  -5.475  25.231  1.00 19.45 ? 543  GLY A C   1 
ATOM   4339 O O   . GLY A  1 544 ? -5.030  -4.701  26.214  1.00 20.10 ? 543  GLY A O   1 
ATOM   4340 N N   . LEU A  1 545 ? -4.387  -5.325  24.119  1.00 18.92 ? 544  LEU A N   1 
ATOM   4341 C CA  . LEU A  1 545 ? -3.481  -4.193  23.952  1.00 18.40 ? 544  LEU A CA  1 
ATOM   4342 C C   . LEU A  1 545 ? -4.266  -2.886  23.852  1.00 18.38 ? 544  LEU A C   1 
ATOM   4343 O O   . LEU A  1 545 ? -3.869  -1.881  24.434  1.00 18.57 ? 544  LEU A O   1 
ATOM   4344 C CB  . LEU A  1 545 ? -2.571  -4.384  22.732  1.00 17.90 ? 544  LEU A CB  1 
ATOM   4345 C CG  . LEU A  1 545 ? -1.558  -5.529  22.745  1.00 16.95 ? 544  LEU A CG  1 
ATOM   4346 C CD1 . LEU A  1 545 ? -1.103  -5.879  21.327  1.00 18.01 ? 544  LEU A CD1 1 
ATOM   4347 C CD2 . LEU A  1 545 ? -0.375  -5.196  23.646  1.00 19.11 ? 544  LEU A CD2 1 
ATOM   4348 N N   . ILE A  1 546 ? -5.385  -2.913  23.129  1.00 18.79 ? 545  ILE A N   1 
ATOM   4349 C CA  . ILE A  1 546 ? -6.282  -1.755  23.058  1.00 19.49 ? 545  ILE A CA  1 
ATOM   4350 C C   . ILE A  1 546 ? -6.858  -1.393  24.437  1.00 20.32 ? 545  ILE A C   1 
ATOM   4351 O O   . ILE A  1 546 ? -6.912  -0.221  24.796  1.00 19.71 ? 545  ILE A O   1 
ATOM   4352 C CB  . ILE A  1 546 ? -7.393  -1.944  21.990  1.00 19.88 ? 545  ILE A CB  1 
ATOM   4353 C CG1 . ILE A  1 546 ? -6.766  -1.989  20.588  1.00 20.77 ? 545  ILE A CG1 1 
ATOM   4354 C CG2 . ILE A  1 546 ? -8.404  -0.796  22.058  1.00 19.74 ? 545  ILE A CG2 1 
ATOM   4355 C CD1 . ILE A  1 546 ? -7.717  -2.402  19.470  1.00 21.44 ? 545  ILE A CD1 1 
ATOM   4356 N N   . SER A  1 547 ? -7.242  -2.404  25.218  1.00 20.90 ? 546  SER A N   1 
ATOM   4357 C CA  . SER A  1 547 ? -7.730  -2.173  26.587  1.00 21.67 ? 546  SER A CA  1 
ATOM   4358 C C   . SER A  1 547 ? -6.703  -1.472  27.460  1.00 21.11 ? 546  SER A C   1 
ATOM   4359 O O   . SER A  1 547 ? -7.033  -0.518  28.166  1.00 21.59 ? 546  SER A O   1 
ATOM   4360 C CB  . SER A  1 547 ? -8.146  -3.491  27.252  1.00 21.36 ? 546  SER A CB  1 
ATOM   4361 O OG  . SER A  1 547 ? -9.217  -4.072  26.541  1.00 26.95 ? 546  SER A OG  1 
ATOM   4362 N N   . PHE A  1 548 ? -5.462  -1.950  27.396  1.00 20.61 ? 547  PHE A N   1 
ATOM   4363 C CA  . PHE A  1 548 ? -4.351  -1.331  28.100  1.00 20.12 ? 547  PHE A CA  1 
ATOM   4364 C C   . PHE A  1 548 ? -4.171  0.124   27.678  1.00 20.11 ? 547  PHE A C   1 
ATOM   4365 O O   . PHE A  1 548 ? -4.011  1.009   28.523  1.00 19.99 ? 547  PHE A O   1 
ATOM   4366 C CB  . PHE A  1 548 ? -3.065  -2.136  27.876  1.00 20.08 ? 547  PHE A CB  1 
ATOM   4367 C CG  . PHE A  1 548 ? -1.896  -1.675  28.711  1.00 19.79 ? 547  PHE A CG  1 
ATOM   4368 C CD1 . PHE A  1 548 ? -1.745  -2.108  30.026  1.00 21.10 ? 547  PHE A CD1 1 
ATOM   4369 C CD2 . PHE A  1 548 ? -0.914  -0.844  28.163  1.00 19.33 ? 547  PHE A CD2 1 
ATOM   4370 C CE1 . PHE A  1 548 ? -0.650  -1.687  30.786  1.00 19.64 ? 547  PHE A CE1 1 
ATOM   4371 C CE2 . PHE A  1 548 ? 0.174   -0.429  28.901  1.00 20.20 ? 547  PHE A CE2 1 
ATOM   4372 C CZ  . PHE A  1 548 ? 0.321   -0.852  30.224  1.00 19.15 ? 547  PHE A CZ  1 
ATOM   4373 N N   . ILE A  1 549 ? -4.194  0.377   26.368  1.00 19.78 ? 548  ILE A N   1 
ATOM   4374 C CA  . ILE A  1 549 ? -4.044  1.738   25.875  1.00 20.38 ? 548  ILE A CA  1 
ATOM   4375 C C   . ILE A  1 549 ? -5.147  2.650   26.442  1.00 21.13 ? 548  ILE A C   1 
ATOM   4376 O O   . ILE A  1 549 ? -4.866  3.741   26.934  1.00 21.37 ? 548  ILE A O   1 
ATOM   4377 C CB  . ILE A  1 549 ? -3.992  1.745   24.321  1.00 19.95 ? 548  ILE A CB  1 
ATOM   4378 C CG1 . ILE A  1 549 ? -2.654  1.174   23.833  1.00 19.41 ? 548  ILE A CG1 1 
ATOM   4379 C CG2 . ILE A  1 549 ? -4.253  3.139   23.734  1.00 20.17 ? 548  ILE A CG2 1 
ATOM   4380 C CD1 . ILE A  1 549 ? -2.739  0.514   22.453  1.00 18.84 ? 548  ILE A CD1 1 
ATOM   4381 N N   . LYS A  1 550 ? -6.392  2.189   26.387  1.00 22.19 ? 549  LYS A N   1 
ATOM   4382 C CA  . LYS A  1 550 ? -7.504  2.999   26.868  1.00 23.51 ? 549  LYS A CA  1 
ATOM   4383 C C   . LYS A  1 550 ? -7.417  3.228   28.377  1.00 24.22 ? 549  LYS A C   1 
ATOM   4384 O O   . LYS A  1 550 ? -7.701  4.326   28.844  1.00 24.79 ? 549  LYS A O   1 
ATOM   4385 C CB  . LYS A  1 550 ? -8.852  2.395   26.450  1.00 23.38 ? 549  LYS A CB  1 
ATOM   4386 C CG  . LYS A  1 550 ? -9.051  2.406   24.941  1.00 24.21 ? 549  LYS A CG  1 
ATOM   4387 C CD  . LYS A  1 550 ? -10.491 2.124   24.538  1.00 26.76 ? 549  LYS A CD  1 
ATOM   4388 C CE  . LYS A  1 550 ? -10.692 2.323   23.039  1.00 26.27 ? 549  LYS A CE  1 
ATOM   4389 N NZ  . LYS A  1 550 ? -12.129 2.495   22.655  1.00 26.39 ? 549  LYS A NZ  1 
ATOM   4390 N N   . GLN A  1 551 ? -6.986  2.208   29.116  1.00 25.28 ? 550  GLN A N   1 
ATOM   4391 C CA  . GLN A  1 551 ? -6.835  2.304   30.572  1.00 26.81 ? 550  GLN A CA  1 
ATOM   4392 C C   . GLN A  1 551 ? -5.703  3.248   30.993  1.00 27.36 ? 550  GLN A C   1 
ATOM   4393 O O   . GLN A  1 551 ? -5.828  3.999   31.962  1.00 27.37 ? 550  GLN A O   1 
ATOM   4394 C CB  . GLN A  1 551 ? -6.599  0.912   31.153  1.00 27.56 ? 550  GLN A CB  1 
ATOM   4395 C CG  . GLN A  1 551 ? -6.993  0.766   32.605  1.00 30.08 ? 550  GLN A CG  1 
ATOM   4396 C CD  . GLN A  1 551 ? -5.801  0.775   33.524  1.00 35.19 ? 550  GLN A CD  1 
ATOM   4397 O OE1 . GLN A  1 551 ? -4.744  0.213   33.196  1.00 35.88 ? 550  GLN A OE1 1 
ATOM   4398 N NE2 . GLN A  1 551 ? -5.961  1.399   34.693  1.00 36.26 ? 550  GLN A NE2 1 
ATOM   4399 N N   . GLN A  1 552 ? -4.598  3.215   30.254  1.00 27.47 ? 551  GLN A N   1 
ATOM   4400 C CA  . GLN A  1 552 ? -3.400  3.973   30.627  1.00 28.12 ? 551  GLN A CA  1 
ATOM   4401 C C   . GLN A  1 552 ? -3.323  5.392   30.044  1.00 29.26 ? 551  GLN A C   1 
ATOM   4402 O O   . GLN A  1 552 ? -2.485  6.195   30.459  1.00 29.00 ? 551  GLN A O   1 
ATOM   4403 C CB  . GLN A  1 552 ? -2.146  3.154   30.301  1.00 27.52 ? 551  GLN A CB  1 
ATOM   4404 C CG  . GLN A  1 552 ? -1.993  1.919   31.198  1.00 27.82 ? 551  GLN A CG  1 
ATOM   4405 C CD  . GLN A  1 552 ? -1.803  2.273   32.667  1.00 29.28 ? 551  GLN A CD  1 
ATOM   4406 O OE1 . GLN A  1 552 ? -0.917  3.038   33.011  1.00 29.54 ? 551  GLN A OE1 1 
ATOM   4407 N NE2 . GLN A  1 552 ? -2.647  1.721   33.528  1.00 30.62 ? 551  GLN A NE2 1 
ATOM   4408 N N   . ARG A  1 553 ? -4.214  5.676   29.101  1.00 31.24 ? 552  ARG A N   1 
ATOM   4409 C CA  . ARG A  1 553 ? -4.377  6.972   28.433  1.00 33.86 ? 552  ARG A CA  1 
ATOM   4410 C C   . ARG A  1 553 ? -4.292  8.215   29.327  1.00 35.78 ? 552  ARG A C   1 
ATOM   4411 O O   . ARG A  1 553 ? -3.657  9.211   28.962  1.00 35.72 ? 552  ARG A O   1 
ATOM   4412 C CB  . ARG A  1 553 ? -5.752  6.981   27.760  1.00 33.90 ? 552  ARG A CB  1 
ATOM   4413 C CG  . ARG A  1 553 ? -5.836  7.729   26.468  1.00 34.53 ? 552  ARG A CG  1 
ATOM   4414 C CD  . ARG A  1 553 ? -6.345  6.866   25.340  1.00 33.19 ? 552  ARG A CD  1 
ATOM   4415 N NE  . ARG A  1 553 ? -7.803  6.734   25.324  1.00 32.89 ? 552  ARG A NE  1 
ATOM   4416 C CZ  . ARG A  1 553 ? -8.495  6.343   24.261  1.00 33.35 ? 552  ARG A CZ  1 
ATOM   4417 N NH1 . ARG A  1 553 ? -9.815  6.244   24.329  1.00 32.62 ? 552  ARG A NH1 1 
ATOM   4418 N NH2 . ARG A  1 553 ? -7.864  6.037   23.126  1.00 32.19 ? 552  ARG A NH2 1 
ATOM   4419 N N   . ASP A  1 554 ? -4.952  8.159   30.480  1.00 37.92 ? 553  ASP A N   1 
ATOM   4420 C CA  . ASP A  1 554 ? -5.168  9.355   31.294  1.00 40.56 ? 553  ASP A CA  1 
ATOM   4421 C C   . ASP A  1 554 ? -4.583  9.278   32.700  1.00 41.88 ? 553  ASP A C   1 
ATOM   4422 O O   . ASP A  1 554 ? -4.922  10.093  33.569  1.00 42.48 ? 553  ASP A O   1 
ATOM   4423 C CB  . ASP A  1 554 ? -6.666  9.680   31.367  1.00 41.07 ? 553  ASP A CB  1 
ATOM   4424 C CG  . ASP A  1 554 ? -7.230  10.129  30.037  1.00 42.17 ? 553  ASP A CG  1 
ATOM   4425 O OD1 . ASP A  1 554 ? -6.843  11.223  29.560  1.00 45.31 ? 553  ASP A OD1 1 
ATOM   4426 O OD2 . ASP A  1 554 ? -8.061  9.448   29.396  1.00 43.96 ? 553  ASP A OD2 1 
ATOM   4427 N N   . THR A  1 555 ? -3.716  8.298   32.927  1.00 43.17 ? 554  THR A N   1 
ATOM   4428 C CA  . THR A  1 555 ? -2.984  8.211   34.182  1.00 44.39 ? 554  THR A CA  1 
ATOM   4429 C C   . THR A  1 555 ? -2.015  9.393   34.253  1.00 45.14 ? 554  THR A C   1 
ATOM   4430 O O   . THR A  1 555 ? -1.126  9.529   33.408  1.00 45.07 ? 554  THR A O   1 
ATOM   4431 C CB  . THR A  1 555 ? -2.233  6.869   34.285  1.00 44.40 ? 554  THR A CB  1 
ATOM   4432 O OG1 . THR A  1 555 ? -1.370  6.727   33.156  1.00 45.76 ? 554  THR A OG1 1 
ATOM   4433 C CG2 . THR A  1 555 ? -3.189  5.697   34.124  1.00 44.50 ? 554  THR A CG2 1 
ATOM   4434 N N   . LYS A  1 556 ? -2.215  10.264  35.240  1.00 46.03 ? 555  LYS A N   1 
ATOM   4435 C CA  . LYS A  1 556 ? -1.355  11.429  35.421  1.00 46.98 ? 555  LYS A CA  1 
ATOM   4436 C C   . LYS A  1 556 ? -0.122  11.028  36.227  1.00 47.46 ? 555  LYS A C   1 
ATOM   4437 O O   . LYS A  1 556 ? -0.162  10.977  37.460  1.00 47.71 ? 555  LYS A O   1 
ATOM   4438 C CB  . LYS A  1 556 ? -2.119  12.575  36.102  1.00 47.13 ? 555  LYS A CB  1 
ATOM   4439 C CG  . LYS A  1 556 ? -2.330  13.808  35.217  1.00 48.13 ? 555  LYS A CG  1 
ATOM   4440 C CD  . LYS A  1 556 ? -3.805  14.027  34.886  1.00 49.49 ? 555  LYS A CD  1 
ATOM   4441 C CE  . LYS A  1 556 ? -4.087  13.793  33.400  1.00 50.49 ? 555  LYS A CE  1 
ATOM   4442 N NZ  . LYS A  1 556 ? -5.553  13.739  33.098  1.00 50.82 ? 555  LYS A NZ  1 
ATOM   4443 N N   . LEU A  1 557 ? 0.967   10.730  35.519  1.00 47.77 ? 556  LEU A N   1 
ATOM   4444 C CA  . LEU A  1 557 ? 2.197   10.248  36.142  1.00 47.97 ? 556  LEU A CA  1 
ATOM   4445 C C   . LEU A  1 557 ? 2.923   11.335  36.939  1.00 48.23 ? 556  LEU A C   1 
ATOM   4446 O O   . LEU A  1 557 ? 3.435   12.303  36.373  1.00 48.60 ? 556  LEU A O   1 
ATOM   4447 C CB  . LEU A  1 557 ? 3.133   9.630   35.093  1.00 47.98 ? 556  LEU A CB  1 
ATOM   4448 C CG  . LEU A  1 557 ? 2.876   8.180   34.660  1.00 47.59 ? 556  LEU A CG  1 
ATOM   4449 C CD1 . LEU A  1 557 ? 3.944   7.714   33.683  1.00 47.02 ? 556  LEU A CD1 1 
ATOM   4450 C CD2 . LEU A  1 557 ? 2.792   7.227   35.849  1.00 47.50 ? 556  LEU A CD2 1 
ATOM   4451 N N   . ALA B  1 2   ? 28.870  -29.935 24.485  1.00 26.16 ? 1    ALA B N   1 
ATOM   4452 C CA  . ALA B  1 2   ? 28.390  -28.661 25.085  1.00 25.91 ? 1    ALA B CA  1 
ATOM   4453 C C   . ALA B  1 2   ? 27.240  -28.927 26.046  1.00 25.20 ? 1    ALA B C   1 
ATOM   4454 O O   . ALA B  1 2   ? 26.373  -29.760 25.758  1.00 25.21 ? 1    ALA B O   1 
ATOM   4455 C CB  . ALA B  1 2   ? 27.954  -27.699 23.990  1.00 25.70 ? 1    ALA B CB  1 
ATOM   4456 N N   . ALA B  1 3   ? 27.225  -28.192 27.162  1.00 25.38 ? 2    ALA B N   1 
ATOM   4457 C CA  . ALA B  1 3   ? 26.223  -28.375 28.220  1.00 25.27 ? 2    ALA B CA  1 
ATOM   4458 C C   . ALA B  1 3   ? 24.770  -28.343 27.741  1.00 25.43 ? 2    ALA B C   1 
ATOM   4459 O O   . ALA B  1 3   ? 23.980  -29.229 28.078  1.00 25.35 ? 2    ALA B O   1 
ATOM   4460 C CB  . ALA B  1 3   ? 26.440  -27.362 29.350  1.00 25.69 ? 2    ALA B CB  1 
ATOM   4461 N N   . LEU B  1 4   ? 24.406  -27.332 26.951  1.00 24.53 ? 3    LEU B N   1 
ATOM   4462 C CA  . LEU B  1 4   ? 23.024  -27.210 26.502  1.00 23.78 ? 3    LEU B CA  1 
ATOM   4463 C C   . LEU B  1 4   ? 22.524  -28.427 25.697  1.00 23.72 ? 3    LEU B C   1 
ATOM   4464 O O   . LEU B  1 4   ? 21.409  -28.915 25.917  1.00 23.94 ? 3    LEU B O   1 
ATOM   4465 C CB  . LEU B  1 4   ? 22.817  -25.906 25.700  1.00 23.27 ? 3    LEU B CB  1 
ATOM   4466 C CG  . LEU B  1 4   ? 21.382  -25.646 25.211  1.00 23.27 ? 3    LEU B CG  1 
ATOM   4467 C CD1 . LEU B  1 4   ? 20.345  -25.490 26.337  1.00 22.56 ? 3    LEU B CD1 1 
ATOM   4468 C CD2 . LEU B  1 4   ? 21.331  -24.421 24.288  1.00 21.99 ? 3    LEU B CD2 1 
ATOM   4469 N N   . THR B  1 5   ? 23.346  -28.918 24.775  1.00 24.15 ? 4    THR B N   1 
ATOM   4470 C CA  . THR B  1 5   ? 22.939  -30.010 23.886  1.00 25.01 ? 4    THR B CA  1 
ATOM   4471 C C   . THR B  1 5   ? 22.844  -31.345 24.640  1.00 24.87 ? 4    THR B C   1 
ATOM   4472 O O   . THR B  1 5   ? 22.112  -32.249 24.223  1.00 24.51 ? 4    THR B O   1 
ATOM   4473 C CB  . THR B  1 5   ? 23.906  -30.143 22.686  1.00 24.78 ? 4    THR B CB  1 
ATOM   4474 O OG1 A THR B  1 5   ? 24.300  -28.842 22.235  0.30 24.60 ? 4    THR B OG1 1 
ATOM   4475 O OG1 B THR B  1 5   ? 25.215  -29.717 23.067  0.70 27.23 ? 4    THR B OG1 1 
ATOM   4476 C CG2 A THR B  1 5   ? 23.193  -30.735 21.482  0.30 25.19 ? 4    THR B CG2 1 
ATOM   4477 C CG2 B THR B  1 5   ? 23.511  -29.159 21.582  0.70 26.21 ? 4    THR B CG2 1 
ATOM   4478 N N   . ARG B  1 6   ? 23.567  -31.438 25.753  1.00 25.51 ? 5    ARG B N   1 
ATOM   4479 C CA  . ARG B  1 6   ? 23.584  -32.660 26.566  1.00 26.23 ? 5    ARG B CA  1 
ATOM   4480 C C   . ARG B  1 6   ? 22.490  -32.637 27.633  1.00 26.15 ? 5    ARG B C   1 
ATOM   4481 O O   . ARG B  1 6   ? 22.247  -33.644 28.312  1.00 26.10 ? 5    ARG B O   1 
ATOM   4482 C CB  . ARG B  1 6   ? 24.961  -32.856 27.209  1.00 26.30 ? 5    ARG B CB  1 
ATOM   4483 C CG  . ARG B  1 6   ? 26.041  -33.272 26.228  1.00 29.25 ? 5    ARG B CG  1 
ATOM   4484 C CD  . ARG B  1 6   ? 27.438  -33.353 26.805  1.00 34.30 ? 5    ARG B CD  1 
ATOM   4485 N NE  . ARG B  1 6   ? 28.383  -33.892 25.825  1.00 38.71 ? 5    ARG B NE  1 
ATOM   4486 C CZ  . ARG B  1 6   ? 29.041  -35.044 25.955  1.00 41.38 ? 5    ARG B CZ  1 
ATOM   4487 N NH1 . ARG B  1 6   ? 28.876  -35.803 27.036  1.00 42.86 ? 5    ARG B NH1 1 
ATOM   4488 N NH2 . ARG B  1 6   ? 29.869  -35.439 24.997  1.00 42.83 ? 5    ARG B NH2 1 
ATOM   4489 N N   . ASN B  1 7   ? 21.816  -31.499 27.755  1.00 26.05 ? 6    ASN B N   1 
ATOM   4490 C CA  . ASN B  1 7   ? 20.749  -31.321 28.733  1.00 26.36 ? 6    ASN B CA  1 
ATOM   4491 C C   . ASN B  1 7   ? 19.450  -32.009 28.287  1.00 26.38 ? 6    ASN B C   1 
ATOM   4492 O O   . ASN B  1 7   ? 18.978  -31.777 27.172  1.00 26.33 ? 6    ASN B O   1 
ATOM   4493 C CB  . ASN B  1 7   ? 20.553  -29.822 28.998  1.00 26.03 ? 6    ASN B CB  1 
ATOM   4494 C CG  . ASN B  1 7   ? 19.477  -29.537 30.015  1.00 25.57 ? 6    ASN B CG  1 
ATOM   4495 O OD1 . ASN B  1 7   ? 18.309  -29.764 29.756  1.00 24.97 ? 6    ASN B OD1 1 
ATOM   4496 N ND2 . ASN B  1 7   ? 19.868  -29.016 31.176  1.00 25.30 ? 6    ASN B ND2 1 
ATOM   4497 N N   . PRO B  1 8   ? 18.878  -32.874 29.141  1.00 26.41 ? 7    PRO B N   1 
ATOM   4498 C CA  . PRO B  1 8   ? 17.654  -33.616 28.788  1.00 26.74 ? 7    PRO B CA  1 
ATOM   4499 C C   . PRO B  1 8   ? 16.408  -32.745 28.572  1.00 26.69 ? 7    PRO B C   1 
ATOM   4500 O O   . PRO B  1 8   ? 15.548  -33.125 27.767  1.00 27.40 ? 7    PRO B O   1 
ATOM   4501 C CB  . PRO B  1 8   ? 17.431  -34.548 29.995  1.00 26.92 ? 7    PRO B CB  1 
ATOM   4502 C CG  . PRO B  1 8   ? 18.692  -34.506 30.770  1.00 27.13 ? 7    PRO B CG  1 
ATOM   4503 C CD  . PRO B  1 8   ? 19.363  -33.207 30.493  1.00 26.64 ? 7    PRO B CD  1 
ATOM   4504 N N   . GLN B  1 9   ? 16.305  -31.621 29.283  1.00 26.90 ? 8    GLN B N   1 
ATOM   4505 C CA  . GLN B  1 9   ? 15.183  -30.695 29.099  1.00 26.99 ? 8    GLN B CA  1 
ATOM   4506 C C   . GLN B  1 9   ? 15.261  -30.077 27.695  1.00 26.80 ? 8    GLN B C   1 
ATOM   4507 O O   . GLN B  1 9   ? 14.228  -29.866 27.055  1.00 26.58 ? 8    GLN B O   1 
ATOM   4508 C CB  . GLN B  1 9   ? 15.160  -29.600 30.178  1.00 26.88 ? 8    GLN B CB  1 
ATOM   4509 C CG  . GLN B  1 9   ? 14.583  -30.033 31.550  1.00 28.35 ? 8    GLN B CG  1 
ATOM   4510 C CD  . GLN B  1 9   ? 15.328  -31.216 32.179  1.00 28.17 ? 8    GLN B CD  1 
ATOM   4511 O OE1 . GLN B  1 9   ? 14.723  -32.263 32.459  1.00 30.58 ? 8    GLN B OE1 1 
ATOM   4512 N NE2 . GLN B  1 9   ? 16.633  -31.060 32.390  1.00 27.07 ? 8    GLN B NE2 1 
ATOM   4513 N N   . PHE B  1 10  ? 16.482  -29.823 27.219  1.00 26.74 ? 9    PHE B N   1 
ATOM   4514 C CA  . PHE B  1 10  ? 16.675  -29.277 25.868  1.00 26.54 ? 9    PHE B CA  1 
ATOM   4515 C C   . PHE B  1 10  ? 16.348  -30.291 24.784  1.00 26.53 ? 9    PHE B C   1 
ATOM   4516 O O   . PHE B  1 10  ? 15.666  -29.971 23.796  1.00 26.07 ? 9    PHE B O   1 
ATOM   4517 C CB  . PHE B  1 10  ? 18.102  -28.760 25.655  1.00 26.28 ? 9    PHE B CB  1 
ATOM   4518 C CG  . PHE B  1 10  ? 18.335  -28.213 24.270  1.00 26.81 ? 9    PHE B CG  1 
ATOM   4519 C CD1 . PHE B  1 10  ? 17.708  -27.033 23.866  1.00 27.82 ? 9    PHE B CD1 1 
ATOM   4520 C CD2 . PHE B  1 10  ? 19.137  -28.898 23.363  1.00 27.24 ? 9    PHE B CD2 1 
ATOM   4521 C CE1 . PHE B  1 10  ? 17.898  -26.524 22.574  1.00 28.29 ? 9    PHE B CE1 1 
ATOM   4522 C CE2 . PHE B  1 10  ? 19.344  -28.399 22.068  1.00 28.40 ? 9    PHE B CE2 1 
ATOM   4523 C CZ  . PHE B  1 10  ? 18.713  -27.213 21.672  1.00 28.37 ? 9    PHE B CZ  1 
ATOM   4524 N N   . GLN B  1 11  ? 16.839  -31.517 24.962  1.00 26.70 ? 10   GLN B N   1 
ATOM   4525 C CA  . GLN B  1 11  ? 16.547  -32.584 24.012  1.00 27.20 ? 10   GLN B CA  1 
ATOM   4526 C C   . GLN B  1 11  ? 15.040  -32.844 23.920  1.00 26.82 ? 10   GLN B C   1 
ATOM   4527 O O   . GLN B  1 11  ? 14.528  -33.125 22.840  1.00 26.78 ? 10   GLN B O   1 
ATOM   4528 C CB  . GLN B  1 11  ? 17.306  -33.865 24.376  1.00 27.76 ? 10   GLN B CB  1 
ATOM   4529 C CG  . GLN B  1 11  ? 18.786  -33.846 24.008  1.00 29.52 ? 10   GLN B CG  1 
ATOM   4530 C CD  . GLN B  1 11  ? 19.610  -34.900 24.765  1.00 33.28 ? 10   GLN B CD  1 
ATOM   4531 O OE1 . GLN B  1 11  ? 20.794  -34.689 25.043  1.00 34.89 ? 10   GLN B OE1 1 
ATOM   4532 N NE2 . GLN B  1 11  ? 18.984  -36.031 25.088  1.00 35.70 ? 10   GLN B NE2 1 
ATOM   4533 N N   . LYS B  1 12  ? 14.329  -32.749 25.045  1.00 27.04 ? 11   LYS B N   1 
ATOM   4534 C CA  . LYS B  1 12  ? 12.869  -32.878 25.036  1.00 27.12 ? 11   LYS B CA  1 
ATOM   4535 C C   . LYS B  1 12  ? 12.204  -31.757 24.218  1.00 27.07 ? 11   LYS B C   1 
ATOM   4536 O O   . LYS B  1 12  ? 11.324  -32.018 23.400  1.00 26.93 ? 11   LYS B O   1 
ATOM   4537 C CB  . LYS B  1 12  ? 12.306  -32.945 26.470  1.00 27.71 ? 11   LYS B CB  1 
ATOM   4538 C CG  . LYS B  1 12  ? 10.777  -32.878 26.601  1.00 29.16 ? 11   LYS B CG  1 
ATOM   4539 C CD  . LYS B  1 12  ? 10.086  -34.109 26.031  1.00 33.44 ? 11   LYS B CD  1 
ATOM   4540 C CE  . LYS B  1 12  ? 9.080   -33.726 24.949  1.00 34.77 ? 11   LYS B CE  1 
ATOM   4541 N NZ  . LYS B  1 12  ? 9.435   -34.278 23.603  1.00 33.96 ? 11   LYS B NZ  1 
ATOM   4542 N N   . LEU B  1 13  ? 12.651  -30.524 24.428  1.00 27.13 ? 12   LEU B N   1 
ATOM   4543 C CA  . LEU B  1 13  ? 12.130  -29.373 23.689  1.00 27.40 ? 12   LEU B CA  1 
ATOM   4544 C C   . LEU B  1 13  ? 12.355  -29.541 22.188  1.00 27.42 ? 12   LEU B C   1 
ATOM   4545 O O   . LEU B  1 13  ? 11.432  -29.368 21.393  1.00 27.23 ? 12   LEU B O   1 
ATOM   4546 C CB  . LEU B  1 13  ? 12.799  -28.097 24.197  1.00 27.56 ? 12   LEU B CB  1 
ATOM   4547 C CG  . LEU B  1 13  ? 12.311  -26.723 23.748  1.00 27.71 ? 12   LEU B CG  1 
ATOM   4548 C CD1 . LEU B  1 13  ? 11.026  -26.326 24.504  1.00 26.68 ? 12   LEU B CD1 1 
ATOM   4549 C CD2 . LEU B  1 13  ? 13.428  -25.705 23.983  1.00 28.30 ? 12   LEU B CD2 1 
ATOM   4550 N N   . LEU B  1 14  ? 13.580  -29.902 21.812  1.00 27.58 ? 13   LEU B N   1 
ATOM   4551 C CA  . LEU B  1 14  ? 13.931  -30.148 20.418  1.00 28.39 ? 13   LEU B CA  1 
ATOM   4552 C C   . LEU B  1 14  ? 13.072  -31.241 19.772  1.00 28.81 ? 13   LEU B C   1 
ATOM   4553 O O   . LEU B  1 14  ? 12.575  -31.071 18.647  1.00 27.86 ? 13   LEU B O   1 
ATOM   4554 C CB  . LEU B  1 14  ? 15.419  -30.505 20.314  1.00 28.77 ? 13   LEU B CB  1 
ATOM   4555 C CG  . LEU B  1 14  ? 16.257  -30.137 19.090  1.00 30.43 ? 13   LEU B CG  1 
ATOM   4556 C CD1 . LEU B  1 14  ? 16.032  -28.695 18.619  1.00 31.11 ? 13   LEU B CD1 1 
ATOM   4557 C CD2 . LEU B  1 14  ? 17.734  -30.351 19.424  1.00 30.00 ? 13   LEU B CD2 1 
ATOM   4558 N N   . GLU B  1 15  ? 12.895  -32.362 20.480  1.00 28.99 ? 14   GLU B N   1 
ATOM   4559 C CA  . GLU B  1 15  ? 12.069  -33.462 19.977  1.00 29.71 ? 14   GLU B CA  1 
ATOM   4560 C C   . GLU B  1 15  ? 10.605  -33.035 19.815  1.00 29.04 ? 14   GLU B C   1 
ATOM   4561 O O   . GLU B  1 15  ? 9.938   -33.437 18.856  1.00 29.25 ? 14   GLU B O   1 
ATOM   4562 C CB  . GLU B  1 15  ? 12.194  -34.717 20.868  1.00 30.51 ? 14   GLU B CB  1 
ATOM   4563 C CG  . GLU B  1 15  ? 11.500  -35.958 20.319  1.00 34.50 ? 14   GLU B CG  1 
ATOM   4564 C CD  . GLU B  1 15  ? 11.769  -37.212 21.137  1.00 39.61 ? 14   GLU B CD  1 
ATOM   4565 O OE1 . GLU B  1 15  ? 12.937  -37.667 21.169  1.00 42.20 ? 14   GLU B OE1 1 
ATOM   4566 O OE2 . GLU B  1 15  ? 10.809  -37.751 21.743  1.00 42.26 ? 14   GLU B OE2 1 
ATOM   4567 N N   . TRP B  1 16  ? 10.106  -32.228 20.750  1.00 28.62 ? 15   TRP B N   1 
ATOM   4568 C CA  . TRP B  1 16  ? 8.744   -31.716 20.658  1.00 28.36 ? 15   TRP B CA  1 
ATOM   4569 C C   . TRP B  1 16  ? 8.621   -30.812 19.434  1.00 27.98 ? 15   TRP B C   1 
ATOM   4570 O O   . TRP B  1 16  ? 7.670   -30.935 18.649  1.00 27.25 ? 15   TRP B O   1 
ATOM   4571 C CB  . TRP B  1 16  ? 8.357   -30.960 21.927  1.00 28.72 ? 15   TRP B CB  1 
ATOM   4572 C CG  . TRP B  1 16  ? 6.869   -30.678 22.044  1.00 29.11 ? 15   TRP B CG  1 
ATOM   4573 C CD1 . TRP B  1 16  ? 5.949   -31.398 22.760  1.00 30.18 ? 15   TRP B CD1 1 
ATOM   4574 C CD2 . TRP B  1 16  ? 6.142   -29.611 21.422  1.00 28.73 ? 15   TRP B CD2 1 
ATOM   4575 N NE1 . TRP B  1 16  ? 4.700   -30.841 22.626  1.00 30.57 ? 15   TRP B NE1 1 
ATOM   4576 C CE2 . TRP B  1 16  ? 4.785   -29.745 21.805  1.00 29.64 ? 15   TRP B CE2 1 
ATOM   4577 C CE3 . TRP B  1 16  ? 6.501   -28.540 20.579  1.00 28.80 ? 15   TRP B CE3 1 
ATOM   4578 C CZ2 . TRP B  1 16  ? 3.790   -28.855 21.380  1.00 29.09 ? 15   TRP B CZ2 1 
ATOM   4579 C CZ3 . TRP B  1 16  ? 5.511   -27.664 20.148  1.00 28.64 ? 15   TRP B CZ3 1 
ATOM   4580 C CH2 . TRP B  1 16  ? 4.168   -27.826 20.554  1.00 28.66 ? 15   TRP B CH2 1 
ATOM   4581 N N   . HIS B  1 17  ? 9.598   -29.920 19.264  1.00 28.12 ? 16   HIS B N   1 
ATOM   4582 C CA  . HIS B  1 17  ? 9.635   -29.050 18.085  1.00 28.10 ? 16   HIS B CA  1 
ATOM   4583 C C   . HIS B  1 17  ? 9.589   -29.856 16.779  1.00 28.65 ? 16   HIS B C   1 
ATOM   4584 O O   . HIS B  1 17  ? 8.787   -29.569 15.887  1.00 28.22 ? 16   HIS B O   1 
ATOM   4585 C CB  . HIS B  1 17  ? 10.875  -28.146 18.124  1.00 28.19 ? 16   HIS B CB  1 
ATOM   4586 C CG  . HIS B  1 17  ? 10.913  -27.131 17.024  1.00 26.71 ? 16   HIS B CG  1 
ATOM   4587 N ND1 . HIS B  1 17  ? 11.433  -27.406 15.776  1.00 25.64 ? 16   HIS B ND1 1 
ATOM   4588 C CD2 . HIS B  1 17  ? 10.489  -25.846 16.982  1.00 25.80 ? 16   HIS B CD2 1 
ATOM   4589 C CE1 . HIS B  1 17  ? 11.325  -26.332 15.010  1.00 26.51 ? 16   HIS B CE1 1 
ATOM   4590 N NE2 . HIS B  1 17  ? 10.761  -25.371 15.720  1.00 25.10 ? 16   HIS B NE2 1 
ATOM   4591 N N   . ARG B  1 18  ? 10.437  -30.879 16.681  1.00 29.54 ? 17   ARG B N   1 
ATOM   4592 C CA  . ARG B  1 18  ? 10.511  -31.715 15.484  1.00 30.97 ? 17   ARG B CA  1 
ATOM   4593 C C   . ARG B  1 18  ? 9.164   -32.368 15.155  1.00 31.16 ? 17   ARG B C   1 
ATOM   4594 O O   . ARG B  1 18  ? 8.773   -32.463 13.986  1.00 31.13 ? 17   ARG B O   1 
ATOM   4595 C CB  . ARG B  1 18  ? 11.604  -32.783 15.647  1.00 31.18 ? 17   ARG B CB  1 
ATOM   4596 C CG  . ARG B  1 18  ? 12.946  -32.421 15.021  1.00 34.88 ? 17   ARG B CG  1 
ATOM   4597 C CD  . ARG B  1 18  ? 13.927  -31.719 15.972  1.00 39.42 ? 17   ARG B CD  1 
ATOM   4598 N NE  . ARG B  1 18  ? 15.310  -32.170 15.798  1.00 42.50 ? 17   ARG B NE  1 
ATOM   4599 C CZ  . ARG B  1 18  ? 15.849  -33.222 16.417  1.00 43.84 ? 17   ARG B CZ  1 
ATOM   4600 N NH1 . ARG B  1 18  ? 15.133  -33.951 17.270  1.00 44.25 ? 17   ARG B NH1 1 
ATOM   4601 N NH2 . ARG B  1 18  ? 17.116  -33.544 16.185  1.00 44.76 ? 17   ARG B NH2 1 
ATOM   4602 N N   . ALA B  1 19  ? 8.445   -32.796 16.188  1.00 32.03 ? 18   ALA B N   1 
ATOM   4603 C CA  . ALA B  1 19  ? 7.186   -33.513 15.999  1.00 32.93 ? 18   ALA B CA  1 
ATOM   4604 C C   . ALA B  1 19  ? 5.948   -32.618 15.840  1.00 33.32 ? 18   ALA B C   1 
ATOM   4605 O O   . ALA B  1 19  ? 4.998   -32.998 15.138  1.00 33.84 ? 18   ALA B O   1 
ATOM   4606 C CB  . ALA B  1 19  ? 6.970   -34.530 17.135  1.00 33.00 ? 18   ALA B CB  1 
ATOM   4607 N N   . ASN B  1 20  ? 5.960   -31.443 16.476  1.00 33.46 ? 19   ASN B N   1 
ATOM   4608 C CA  . ASN B  1 20  ? 4.751   -30.623 16.623  1.00 33.64 ? 19   ASN B CA  1 
ATOM   4609 C C   . ASN B  1 20  ? 4.782   -29.197 16.065  1.00 33.76 ? 19   ASN B C   1 
ATOM   4610 O O   . ASN B  1 20  ? 3.721   -28.606 15.852  1.00 33.48 ? 19   ASN B O   1 
ATOM   4611 C CB  . ASN B  1 20  ? 4.329   -30.559 18.101  1.00 34.14 ? 19   ASN B CB  1 
ATOM   4612 C CG  . ASN B  1 20  ? 4.082   -31.923 18.698  1.00 34.37 ? 19   ASN B CG  1 
ATOM   4613 O OD1 . ASN B  1 20  ? 4.831   -32.378 19.558  1.00 35.47 ? 19   ASN B OD1 1 
ATOM   4614 N ND2 . ASN B  1 20  ? 3.030   -32.586 18.242  1.00 34.98 ? 19   ASN B ND2 1 
ATOM   4615 N N   . SER B  1 21  ? 5.975   -28.638 15.850  1.00 33.73 ? 20   SER B N   1 
ATOM   4616 C CA  . SER B  1 21  ? 6.090   -27.215 15.489  1.00 34.43 ? 20   SER B CA  1 
ATOM   4617 C C   . SER B  1 21  ? 5.377   -26.849 14.187  1.00 34.95 ? 20   SER B C   1 
ATOM   4618 O O   . SER B  1 21  ? 4.789   -25.767 14.087  1.00 35.19 ? 20   SER B O   1 
ATOM   4619 C CB  . SER B  1 21  ? 7.555   -26.749 15.455  1.00 34.00 ? 20   SER B CB  1 
ATOM   4620 O OG  . SER B  1 21  ? 8.242   -27.263 14.326  1.00 34.13 ? 20   SER B OG  1 
ATOM   4621 N N   . ALA B  1 22  ? 5.421   -27.750 13.205  1.00 35.57 ? 21   ALA B N   1 
ATOM   4622 C CA  . ALA B  1 22  ? 4.763   -27.534 11.912  1.00 36.23 ? 21   ALA B CA  1 
ATOM   4623 C C   . ALA B  1 22  ? 3.249   -27.313 12.032  1.00 36.35 ? 21   ALA B C   1 
ATOM   4624 O O   . ALA B  1 22  ? 2.633   -26.696 11.154  1.00 36.93 ? 21   ALA B O   1 
ATOM   4625 C CB  . ALA B  1 22  ? 5.065   -28.684 10.956  1.00 36.38 ? 21   ALA B CB  1 
ATOM   4626 N N   . ASN B  1 23  ? 2.661   -27.789 13.129  1.00 36.38 ? 22   ASN B N   1 
ATOM   4627 C CA  . ASN B  1 23  ? 1.222   -27.644 13.362  1.00 36.25 ? 22   ASN B CA  1 
ATOM   4628 C C   . ASN B  1 23  ? 0.833   -26.468 14.267  1.00 35.42 ? 22   ASN B C   1 
ATOM   4629 O O   . ASN B  1 23  ? -0.347  -26.292 14.592  1.00 35.97 ? 22   ASN B O   1 
ATOM   4630 C CB  . ASN B  1 23  ? 0.620   -28.960 13.885  1.00 36.84 ? 22   ASN B CB  1 
ATOM   4631 C CG  . ASN B  1 23  ? 0.837   -30.126 12.924  1.00 38.11 ? 22   ASN B CG  1 
ATOM   4632 O OD1 . ASN B  1 23  ? 1.064   -31.258 13.349  1.00 41.32 ? 22   ASN B OD1 1 
ATOM   4633 N ND2 . ASN B  1 23  ? 0.779   -29.846 11.622  1.00 39.69 ? 22   ASN B ND2 1 
ATOM   4634 N N   . LEU B  1 24  ? 1.814   -25.665 14.671  1.00 33.99 ? 23   LEU B N   1 
ATOM   4635 C CA  . LEU B  1 24  ? 1.519   -24.467 15.443  1.00 32.70 ? 23   LEU B CA  1 
ATOM   4636 C C   . LEU B  1 24  ? 1.169   -23.342 14.484  1.00 31.87 ? 23   LEU B C   1 
ATOM   4637 O O   . LEU B  1 24  ? 1.979   -22.940 13.639  1.00 30.58 ? 23   LEU B O   1 
ATOM   4638 C CB  . LEU B  1 24  ? 2.686   -24.069 16.346  1.00 32.82 ? 23   LEU B CB  1 
ATOM   4639 C CG  . LEU B  1 24  ? 2.872   -24.812 17.672  1.00 33.05 ? 23   LEU B CG  1 
ATOM   4640 C CD1 . LEU B  1 24  ? 4.225   -24.470 18.270  1.00 32.81 ? 23   LEU B CD1 1 
ATOM   4641 C CD2 . LEU B  1 24  ? 1.757   -24.501 18.669  1.00 32.61 ? 23   LEU B CD2 1 
ATOM   4642 N N   . LYS B  1 25  ? -0.070  -22.882 14.597  1.00 31.11 ? 24   LYS B N   1 
ATOM   4643 C CA  . LYS B  1 25  ? -0.591  -21.795 13.788  1.00 30.95 ? 24   LYS B CA  1 
ATOM   4644 C C   . LYS B  1 25  ? -1.192  -20.760 14.728  1.00 30.49 ? 24   LYS B C   1 
ATOM   4645 O O   . LYS B  1 25  ? -2.122  -21.066 15.474  1.00 30.45 ? 24   LYS B O   1 
ATOM   4646 C CB  . LYS B  1 25  ? -1.655  -22.307 12.802  1.00 31.14 ? 24   LYS B CB  1 
ATOM   4647 C CG  . LYS B  1 25  ? -1.174  -23.355 11.782  1.00 32.90 ? 24   LYS B CG  1 
ATOM   4648 C CD  . LYS B  1 25  ? -0.062  -22.820 10.883  1.00 35.92 ? 24   LYS B CD  1 
ATOM   4649 C CE  . LYS B  1 25  ? 0.558   -23.920 10.028  1.00 38.22 ? 24   LYS B CE  1 
ATOM   4650 N NZ  . LYS B  1 25  ? 1.487   -23.344 9.001   1.00 40.14 ? 24   LYS B NZ  1 
ATOM   4651 N N   . LEU B  1 26  ? -0.657  -19.537 14.697  1.00 29.49 ? 25   LEU B N   1 
ATOM   4652 C CA  . LEU B  1 26  ? -1.091  -18.487 15.620  1.00 29.04 ? 25   LEU B CA  1 
ATOM   4653 C C   . LEU B  1 26  ? -2.604  -18.229 15.557  1.00 29.59 ? 25   LEU B C   1 
ATOM   4654 O O   . LEU B  1 26  ? -3.256  -18.119 16.596  1.00 29.33 ? 25   LEU B O   1 
ATOM   4655 C CB  . LEU B  1 26  ? -0.297  -17.190 15.394  1.00 28.41 ? 25   LEU B CB  1 
ATOM   4656 C CG  . LEU B  1 26  ? 1.185   -17.181 15.783  1.00 26.74 ? 25   LEU B CG  1 
ATOM   4657 C CD1 . LEU B  1 26  ? 1.904   -15.950 15.210  1.00 23.42 ? 25   LEU B CD1 1 
ATOM   4658 C CD2 . LEU B  1 26  ? 1.337   -17.224 17.302  1.00 27.13 ? 25   LEU B CD2 1 
ATOM   4659 N N   . ARG B  1 27  ? -3.147  -18.138 14.342  1.00 30.38 ? 26   ARG B N   1 
ATOM   4660 C CA  . ARG B  1 27  ? -4.591  -17.980 14.128  1.00 32.00 ? 26   ARG B CA  1 
ATOM   4661 C C   . ARG B  1 27  ? -5.395  -19.040 14.887  1.00 32.12 ? 26   ARG B C   1 
ATOM   4662 O O   . ARG B  1 27  ? -6.376  -18.715 15.562  1.00 32.15 ? 26   ARG B O   1 
ATOM   4663 C CB  . ARG B  1 27  ? -4.920  -18.059 12.633  1.00 32.35 ? 26   ARG B CB  1 
ATOM   4664 C CG  . ARG B  1 27  ? -5.612  -16.829 12.062  1.00 35.04 ? 26   ARG B CG  1 
ATOM   4665 C CD  . ARG B  1 27  ? -5.866  -16.906 10.557  1.00 37.74 ? 26   ARG B CD  1 
ATOM   4666 N NE  . ARG B  1 27  ? -7.064  -16.163 10.172  1.00 40.60 ? 26   ARG B NE  1 
ATOM   4667 C CZ  . ARG B  1 27  ? -7.154  -15.340 9.134   1.00 40.63 ? 26   ARG B CZ  1 
ATOM   4668 N NH1 . ARG B  1 27  ? -6.115  -15.135 8.336   1.00 40.00 ? 26   ARG B NH1 1 
ATOM   4669 N NH2 . ARG B  1 27  ? -8.298  -14.717 8.890   1.00 40.81 ? 26   ARG B NH2 1 
ATOM   4670 N N   . GLU B  1 28  ? -4.956  -20.294 14.791  1.00 32.65 ? 27   GLU B N   1 
ATOM   4671 C CA  . GLU B  1 28  ? -5.642  -21.411 15.438  1.00 33.13 ? 27   GLU B CA  1 
ATOM   4672 C C   . GLU B  1 28  ? -5.477  -21.389 16.951  1.00 32.87 ? 27   GLU B C   1 
ATOM   4673 O O   . GLU B  1 28  ? -6.402  -21.769 17.687  1.00 33.11 ? 27   GLU B O   1 
ATOM   4674 C CB  . GLU B  1 28  ? -5.152  -22.752 14.895  1.00 33.79 ? 27   GLU B CB  1 
ATOM   4675 C CG  . GLU B  1 28  ? -5.400  -22.952 13.410  1.00 35.54 ? 27   GLU B CG  1 
ATOM   4676 C CD  . GLU B  1 28  ? -4.740  -24.208 12.868  1.00 38.34 ? 27   GLU B CD  1 
ATOM   4677 O OE1 . GLU B  1 28  ? -4.740  -24.372 11.632  1.00 39.20 ? 27   GLU B OE1 1 
ATOM   4678 O OE2 . GLU B  1 28  ? -4.227  -25.033 13.667  1.00 39.87 ? 27   GLU B OE2 1 
ATOM   4679 N N   . LEU B  1 29  ? -4.308  -20.952 17.415  1.00 31.84 ? 28   LEU B N   1 
ATOM   4680 C CA  . LEU B  1 29  ? -4.041  -20.864 18.849  1.00 31.07 ? 28   LEU B CA  1 
ATOM   4681 C C   . LEU B  1 29  ? -4.972  -19.859 19.523  1.00 31.26 ? 28   LEU B C   1 
ATOM   4682 O O   . LEU B  1 29  ? -5.430  -20.088 20.643  1.00 30.89 ? 28   LEU B O   1 
ATOM   4683 C CB  . LEU B  1 29  ? -2.572  -20.517 19.133  1.00 31.04 ? 28   LEU B CB  1 
ATOM   4684 C CG  . LEU B  1 29  ? -1.519  -21.610 18.885  1.00 30.40 ? 28   LEU B CG  1 
ATOM   4685 C CD1 . LEU B  1 29  ? -0.103  -21.021 18.916  1.00 28.01 ? 28   LEU B CD1 1 
ATOM   4686 C CD2 . LEU B  1 29  ? -1.635  -22.763 19.876  1.00 30.30 ? 28   LEU B CD2 1 
ATOM   4687 N N   . PHE B  1 30  ? -5.249  -18.752 18.837  1.00 31.50 ? 29   PHE B N   1 
ATOM   4688 C CA  . PHE B  1 30  ? -6.133  -17.720 19.367  1.00 31.92 ? 29   PHE B CA  1 
ATOM   4689 C C   . PHE B  1 30  ? -7.604  -18.147 19.273  1.00 33.16 ? 29   PHE B C   1 
ATOM   4690 O O   . PHE B  1 30  ? -8.402  -17.844 20.167  1.00 33.17 ? 29   PHE B O   1 
ATOM   4691 C CB  . PHE B  1 30  ? -5.896  -16.378 18.661  1.00 31.30 ? 29   PHE B CB  1 
ATOM   4692 C CG  . PHE B  1 30  ? -4.777  -15.567 19.270  1.00 29.03 ? 29   PHE B CG  1 
ATOM   4693 C CD1 . PHE B  1 30  ? -3.477  -15.677 18.781  1.00 28.74 ? 29   PHE B CD1 1 
ATOM   4694 C CD2 . PHE B  1 30  ? -5.019  -14.713 20.343  1.00 26.69 ? 29   PHE B CD2 1 
ATOM   4695 C CE1 . PHE B  1 30  ? -2.427  -14.943 19.353  1.00 27.59 ? 29   PHE B CE1 1 
ATOM   4696 C CE2 . PHE B  1 30  ? -3.988  -13.974 20.923  1.00 27.13 ? 29   PHE B CE2 1 
ATOM   4697 C CZ  . PHE B  1 30  ? -2.684  -14.084 20.426  1.00 26.62 ? 29   PHE B CZ  1 
ATOM   4698 N N   . GLU B  1 31  ? -7.942  -18.845 18.192  1.00 34.52 ? 30   GLU B N   1 
ATOM   4699 C CA  . GLU B  1 31  ? -9.304  -19.338 17.971  1.00 35.93 ? 30   GLU B CA  1 
ATOM   4700 C C   . GLU B  1 31  ? -9.718  -20.371 19.020  1.00 35.92 ? 30   GLU B C   1 
ATOM   4701 O O   . GLU B  1 31  ? -10.857 -20.357 19.491  1.00 36.21 ? 30   GLU B O   1 
ATOM   4702 C CB  . GLU B  1 31  ? -9.436  -19.922 16.564  1.00 36.34 ? 30   GLU B CB  1 
ATOM   4703 C CG  . GLU B  1 31  ? -10.585 -19.342 15.747  1.00 39.80 ? 30   GLU B CG  1 
ATOM   4704 C CD  . GLU B  1 31  ? -10.125 -18.516 14.553  1.00 43.68 ? 30   GLU B CD  1 
ATOM   4705 O OE1 . GLU B  1 31  ? -10.501 -17.320 14.484  1.00 45.36 ? 30   GLU B OE1 1 
ATOM   4706 O OE2 . GLU B  1 31  ? -9.405  -19.058 13.672  1.00 44.54 ? 30   GLU B OE2 1 
ATOM   4707 N N   . ALA B  1 32  ? -8.787  -21.246 19.396  1.00 35.99 ? 31   ALA B N   1 
ATOM   4708 C CA  . ALA B  1 32  ? -9.058  -22.314 20.360  1.00 35.75 ? 31   ALA B CA  1 
ATOM   4709 C C   . ALA B  1 32  ? -9.110  -21.859 21.823  1.00 36.02 ? 31   ALA B C   1 
ATOM   4710 O O   . ALA B  1 32  ? -9.728  -22.529 22.658  1.00 36.15 ? 31   ALA B O   1 
ATOM   4711 C CB  . ALA B  1 32  ? -8.046  -23.432 20.199  1.00 35.84 ? 31   ALA B CB  1 
ATOM   4712 N N   . ASP B  1 33  ? -8.473  -20.727 22.130  1.00 35.52 ? 32   ASP B N   1 
ATOM   4713 C CA  . ASP B  1 33  ? -8.308  -20.278 23.510  1.00 35.11 ? 32   ASP B CA  1 
ATOM   4714 C C   . ASP B  1 33  ? -8.593  -18.779 23.695  1.00 35.02 ? 32   ASP B C   1 
ATOM   4715 O O   . ASP B  1 33  ? -7.702  -17.943 23.504  1.00 34.28 ? 32   ASP B O   1 
ATOM   4716 C CB  . ASP B  1 33  ? -6.898  -20.646 24.014  1.00 35.17 ? 32   ASP B CB  1 
ATOM   4717 C CG  . ASP B  1 33  ? -6.560  -20.019 25.355  1.00 35.89 ? 32   ASP B CG  1 
ATOM   4718 O OD1 . ASP B  1 33  ? -7.493  -19.689 26.120  1.00 35.55 ? 32   ASP B OD1 1 
ATOM   4719 O OD2 . ASP B  1 33  ? -5.378  -19.825 25.730  1.00 35.88 ? 32   ASP B OD2 1 
ATOM   4720 N N   . PRO B  1 34  ? -9.825  -18.442 24.084  1.00 34.75 ? 33   PRO B N   1 
ATOM   4721 C CA  . PRO B  1 34  ? -10.200 -17.048 24.391  1.00 34.26 ? 33   PRO B CA  1 
ATOM   4722 C C   . PRO B  1 34  ? -9.406  -16.389 25.537  1.00 33.67 ? 33   PRO B C   1 
ATOM   4723 O O   . PRO B  1 34  ? -9.337  -15.161 25.608  1.00 33.63 ? 33   PRO B O   1 
ATOM   4724 C CB  . PRO B  1 34  ? -11.687 -17.164 24.758  1.00 34.76 ? 33   PRO B CB  1 
ATOM   4725 C CG  . PRO B  1 34  ? -12.142 -18.427 24.052  1.00 35.18 ? 33   PRO B CG  1 
ATOM   4726 C CD  . PRO B  1 34  ? -10.973 -19.365 24.215  1.00 34.92 ? 33   PRO B CD  1 
ATOM   4727 N N   . GLU B  1 35  ? -8.804  -17.182 26.414  1.00 32.72 ? 34   GLU B N   1 
ATOM   4728 C CA  . GLU B  1 35  ? -8.021  -16.632 27.512  1.00 32.43 ? 34   GLU B CA  1 
ATOM   4729 C C   . GLU B  1 35  ? -6.543  -16.427 27.120  1.00 30.91 ? 34   GLU B C   1 
ATOM   4730 O O   . GLU B  1 35  ? -5.699  -16.195 27.984  1.00 30.93 ? 34   GLU B O   1 
ATOM   4731 C CB  . GLU B  1 35  ? -8.108  -17.547 28.742  1.00 32.63 ? 34   GLU B CB  1 
ATOM   4732 C CG  . GLU B  1 35  ? -9.468  -17.597 29.433  1.00 35.23 ? 34   GLU B CG  1 
ATOM   4733 C CD  . GLU B  1 35  ? -9.814  -16.342 30.227  1.00 38.16 ? 34   GLU B CD  1 
ATOM   4734 O OE1 . GLU B  1 35  ? -8.891  -15.629 30.693  1.00 39.24 ? 34   GLU B OE1 1 
ATOM   4735 O OE2 . GLU B  1 35  ? -11.028 -16.062 30.396  1.00 38.97 ? 34   GLU B OE2 1 
ATOM   4736 N N   . ARG B  1 36  ? -6.233  -16.523 25.829  1.00 29.30 ? 35   ARG B N   1 
ATOM   4737 C CA  . ARG B  1 36  ? -4.829  -16.553 25.406  1.00 27.63 ? 35   ARG B CA  1 
ATOM   4738 C C   . ARG B  1 36  ? -4.042  -15.309 25.810  1.00 26.99 ? 35   ARG B C   1 
ATOM   4739 O O   . ARG B  1 36  ? -2.963  -15.424 26.392  1.00 26.45 ? 35   ARG B O   1 
ATOM   4740 C CB  . ARG B  1 36  ? -4.672  -16.838 23.906  1.00 27.46 ? 35   ARG B CB  1 
ATOM   4741 C CG  . ARG B  1 36  ? -3.194  -17.031 23.513  1.00 26.09 ? 35   ARG B CG  1 
ATOM   4742 C CD  . ARG B  1 36  ? -2.957  -17.563 22.111  1.00 26.67 ? 35   ARG B CD  1 
ATOM   4743 N NE  . ARG B  1 36  ? -1.520  -17.571 21.813  1.00 25.65 ? 35   ARG B NE  1 
ATOM   4744 C CZ  . ARG B  1 36  ? -0.699  -18.591 22.068  1.00 26.92 ? 35   ARG B CZ  1 
ATOM   4745 N NH1 . ARG B  1 36  ? -1.158  -19.718 22.622  1.00 24.80 ? 35   ARG B NH1 1 
ATOM   4746 N NH2 . ARG B  1 36  ? 0.592   -18.488 21.775  1.00 25.18 ? 35   ARG B NH2 1 
ATOM   4747 N N   . PHE B  1 37  ? -4.575  -14.127 25.509  1.00 26.81 ? 36   PHE B N   1 
ATOM   4748 C CA  . PHE B  1 37  ? -3.904  -12.893 25.926  1.00 25.66 ? 36   PHE B CA  1 
ATOM   4749 C C   . PHE B  1 37  ? -3.694  -12.863 27.439  1.00 25.90 ? 36   PHE B C   1 
ATOM   4750 O O   . PHE B  1 37  ? -2.604  -12.557 27.913  1.00 25.48 ? 36   PHE B O   1 
ATOM   4751 C CB  . PHE B  1 37  ? -4.644  -11.637 25.440  1.00 25.36 ? 36   PHE B CB  1 
ATOM   4752 C CG  . PHE B  1 37  ? -4.167  -10.366 26.090  1.00 24.92 ? 36   PHE B CG  1 
ATOM   4753 C CD1 . PHE B  1 37  ? -3.001  -9.728  25.652  1.00 23.71 ? 36   PHE B CD1 1 
ATOM   4754 C CD2 . PHE B  1 37  ? -4.858  -9.816  27.164  1.00 24.60 ? 36   PHE B CD2 1 
ATOM   4755 C CE1 . PHE B  1 37  ? -2.546  -8.562  26.274  1.00 23.62 ? 36   PHE B CE1 1 
ATOM   4756 C CE2 . PHE B  1 37  ? -4.417  -8.641  27.794  1.00 23.81 ? 36   PHE B CE2 1 
ATOM   4757 C CZ  . PHE B  1 37  ? -3.261  -8.007  27.347  1.00 24.40 ? 36   PHE B CZ  1 
ATOM   4758 N N   . ASN B  1 38  ? -4.732  -13.223 28.193  1.00 26.08 ? 37   ASN B N   1 
ATOM   4759 C CA  . ASN B  1 38  ? -4.653  -13.208 29.650  1.00 26.77 ? 37   ASN B CA  1 
ATOM   4760 C C   . ASN B  1 38  ? -3.542  -14.098 30.197  1.00 26.59 ? 37   ASN B C   1 
ATOM   4761 O O   . ASN B  1 38  ? -2.834  -13.717 31.128  1.00 27.59 ? 37   ASN B O   1 
ATOM   4762 C CB  . ASN B  1 38  ? -5.995  -13.616 30.260  1.00 27.01 ? 37   ASN B CB  1 
ATOM   4763 C CG  . ASN B  1 38  ? -7.008  -12.494 30.230  1.00 28.91 ? 37   ASN B CG  1 
ATOM   4764 O OD1 . ASN B  1 38  ? -6.657  -11.315 30.352  1.00 31.91 ? 37   ASN B OD1 1 
ATOM   4765 N ND2 . ASN B  1 38  ? -8.278  -12.849 30.069  1.00 32.13 ? 37   ASN B ND2 1 
ATOM   4766 N N   . ASN B  1 39  ? -3.387  -15.270 29.601  1.00 26.78 ? 38   ASN B N   1 
ATOM   4767 C CA  . ASN B  1 39  ? -2.467  -16.268 30.119  1.00 27.41 ? 38   ASN B CA  1 
ATOM   4768 C C   . ASN B  1 39  ? -1.061  -16.174 29.554  1.00 26.55 ? 38   ASN B C   1 
ATOM   4769 O O   . ASN B  1 39  ? -0.147  -16.798 30.078  1.00 27.16 ? 38   ASN B O   1 
ATOM   4770 C CB  . ASN B  1 39  ? -3.032  -17.669 29.905  1.00 27.99 ? 38   ASN B CB  1 
ATOM   4771 C CG  . ASN B  1 39  ? -4.242  -17.950 30.790  1.00 29.93 ? 38   ASN B CG  1 
ATOM   4772 O OD1 . ASN B  1 39  ? -4.347  -17.441 31.913  1.00 31.52 ? 38   ASN B OD1 1 
ATOM   4773 N ND2 . ASN B  1 39  ? -5.159  -18.738 30.281  1.00 31.29 ? 38   ASN B ND2 1 
ATOM   4774 N N   . PHE B  1 40  ? -0.887  -15.377 28.496  1.00 25.56 ? 39   PHE B N   1 
ATOM   4775 C CA  . PHE B  1 40  ? 0.419   -15.245 27.851  1.00 24.19 ? 39   PHE B CA  1 
ATOM   4776 C C   . PHE B  1 40  ? 0.879   -13.784 27.798  1.00 23.85 ? 39   PHE B C   1 
ATOM   4777 O O   . PHE B  1 40  ? 1.431   -13.326 26.789  1.00 22.62 ? 39   PHE B O   1 
ATOM   4778 C CB  . PHE B  1 40  ? 0.395   -15.872 26.451  1.00 24.31 ? 39   PHE B CB  1 
ATOM   4779 C CG  . PHE B  1 40  ? 0.250   -17.372 26.457  1.00 24.40 ? 39   PHE B CG  1 
ATOM   4780 C CD1 . PHE B  1 40  ? -1.005  -17.964 26.579  1.00 25.80 ? 39   PHE B CD1 1 
ATOM   4781 C CD2 . PHE B  1 40  ? 1.364   -18.192 26.343  1.00 24.13 ? 39   PHE B CD2 1 
ATOM   4782 C CE1 . PHE B  1 40  ? -1.148  -19.352 26.594  1.00 26.10 ? 39   PHE B CE1 1 
ATOM   4783 C CE2 . PHE B  1 40  ? 1.232   -19.592 26.352  1.00 25.07 ? 39   PHE B CE2 1 
ATOM   4784 C CZ  . PHE B  1 40  ? -0.028  -20.170 26.477  1.00 26.17 ? 39   PHE B CZ  1 
ATOM   4785 N N   . SER B  1 41  ? 0.650   -13.064 28.900  1.00 22.96 ? 40   SER B N   1 
ATOM   4786 C CA  . SER B  1 41  ? 1.107   -11.684 29.077  1.00 23.38 ? 40   SER B CA  1 
ATOM   4787 C C   . SER B  1 41  ? 1.343   -11.353 30.546  1.00 24.23 ? 40   SER B C   1 
ATOM   4788 O O   . SER B  1 41  ? 0.777   -12.001 31.440  1.00 24.63 ? 40   SER B O   1 
ATOM   4789 C CB  . SER B  1 41  ? 0.103   -10.685 28.484  1.00 23.24 ? 40   SER B CB  1 
ATOM   4790 O OG  . SER B  1 41  ? -1.101  -10.635 29.245  1.00 23.71 ? 40   SER B OG  1 
ATOM   4791 N N   . LEU B  1 42  ? 2.181   -10.347 30.777  1.00 23.66 ? 41   LEU B N   1 
ATOM   4792 C CA  . LEU B  1 42  ? 2.489   -9.855  32.112  1.00 24.15 ? 41   LEU B CA  1 
ATOM   4793 C C   . LEU B  1 42  ? 2.251   -8.353  32.161  1.00 24.48 ? 41   LEU B C   1 
ATOM   4794 O O   . LEU B  1 42  ? 2.863   -7.591  31.398  1.00 24.35 ? 41   LEU B O   1 
ATOM   4795 C CB  . LEU B  1 42  ? 3.945   -10.145 32.478  1.00 24.22 ? 41   LEU B CB  1 
ATOM   4796 C CG  . LEU B  1 42  ? 4.522   -11.548 32.341  1.00 26.02 ? 41   LEU B CG  1 
ATOM   4797 C CD1 . LEU B  1 42  ? 6.006   -11.507 32.693  1.00 26.84 ? 41   LEU B CD1 1 
ATOM   4798 C CD2 . LEU B  1 42  ? 3.776   -12.559 33.220  1.00 27.25 ? 41   LEU B CD2 1 
ATOM   4799 N N   . ASN B  1 43  ? 1.361   -7.932  33.058  1.00 24.48 ? 42   ASN B N   1 
ATOM   4800 C CA  . ASN B  1 43  ? 1.056   -6.527  33.268  1.00 24.44 ? 42   ASN B CA  1 
ATOM   4801 C C   . ASN B  1 43  ? 1.743   -6.083  34.547  1.00 24.69 ? 42   ASN B C   1 
ATOM   4802 O O   . ASN B  1 43  ? 1.259   -6.354  35.655  1.00 24.94 ? 42   ASN B O   1 
ATOM   4803 C CB  . ASN B  1 43  ? -0.471  -6.309  33.331  1.00 24.49 ? 42   ASN B CB  1 
ATOM   4804 C CG  . ASN B  1 43  ? -0.881  -4.828  33.265  1.00 24.76 ? 42   ASN B CG  1 
ATOM   4805 O OD1 . ASN B  1 43  ? -1.921  -4.495  32.689  1.00 28.69 ? 42   ASN B OD1 1 
ATOM   4806 N ND2 . ASN B  1 43  ? -0.087  -3.946  33.868  1.00 23.01 ? 42   ASN B ND2 1 
ATOM   4807 N N   . LEU B  1 44  ? 2.881   -5.413  34.394  1.00 24.21 ? 43   LEU B N   1 
ATOM   4808 C CA  . LEU B  1 44  ? 3.715   -5.023  35.529  1.00 24.38 ? 43   LEU B CA  1 
ATOM   4809 C C   . LEU B  1 44  ? 3.351   -3.626  35.996  1.00 24.69 ? 43   LEU B C   1 
ATOM   4810 O O   . LEU B  1 44  ? 3.424   -2.660  35.228  1.00 25.11 ? 43   LEU B O   1 
ATOM   4811 C CB  . LEU B  1 44  ? 5.213   -5.108  35.175  1.00 24.27 ? 43   LEU B CB  1 
ATOM   4812 C CG  . LEU B  1 44  ? 5.657   -6.380  34.441  1.00 24.27 ? 43   LEU B CG  1 
ATOM   4813 C CD1 . LEU B  1 44  ? 7.144   -6.335  34.108  1.00 23.96 ? 43   LEU B CD1 1 
ATOM   4814 C CD2 . LEU B  1 44  ? 5.337   -7.617  35.271  1.00 26.66 ? 43   LEU B CD2 1 
ATOM   4815 N N   . ASN B  1 45  ? 2.922   -3.524  37.252  1.00 24.85 ? 44   ASN B N   1 
ATOM   4816 C CA  . ASN B  1 45  ? 2.680   -2.236  37.880  1.00 25.29 ? 44   ASN B CA  1 
ATOM   4817 C C   . ASN B  1 45  ? 3.908   -1.831  38.698  1.00 25.36 ? 44   ASN B C   1 
ATOM   4818 O O   . ASN B  1 45  ? 4.187   -2.438  39.724  1.00 25.14 ? 44   ASN B O   1 
ATOM   4819 C CB  . ASN B  1 45  ? 1.420   -2.316  38.765  1.00 25.86 ? 44   ASN B CB  1 
ATOM   4820 C CG  . ASN B  1 45  ? 0.988   -0.957  39.316  1.00 27.51 ? 44   ASN B CG  1 
ATOM   4821 O OD1 . ASN B  1 45  ? -0.086  -0.833  39.924  1.00 30.22 ? 44   ASN B OD1 1 
ATOM   4822 N ND2 . ASN B  1 45  ? 1.798   0.064   39.092  1.00 25.92 ? 44   ASN B ND2 1 
ATOM   4823 N N   . THR B  1 46  ? 4.651   -0.823  38.233  1.00 25.01 ? 45   THR B N   1 
ATOM   4824 C CA  . THR B  1 46  ? 5.872   -0.374  38.926  1.00 24.88 ? 45   THR B CA  1 
ATOM   4825 C C   . THR B  1 46  ? 5.617   0.680   40.010  1.00 25.83 ? 45   THR B C   1 
ATOM   4826 O O   . THR B  1 46  ? 6.559   1.089   40.709  1.00 25.97 ? 45   THR B O   1 
ATOM   4827 C CB  . THR B  1 46  ? 6.880   0.245   37.932  1.00 25.01 ? 45   THR B CB  1 
ATOM   4828 O OG1 . THR B  1 46  ? 6.359   1.496   37.452  1.00 23.18 ? 45   THR B OG1 1 
ATOM   4829 C CG2 . THR B  1 46  ? 7.055   -0.624  36.682  1.00 23.34 ? 45   THR B CG2 1 
ATOM   4830 N N   . ASN B  1 47  ? 4.367   1.132   40.111  1.00 26.83 ? 46   ASN B N   1 
ATOM   4831 C CA  . ASN B  1 47  ? 3.958   2.302   40.908  1.00 27.80 ? 46   ASN B CA  1 
ATOM   4832 C C   . ASN B  1 47  ? 4.373   3.649   40.282  1.00 27.77 ? 46   ASN B C   1 
ATOM   4833 O O   . ASN B  1 47  ? 3.985   4.723   40.756  1.00 27.82 ? 46   ASN B O   1 
ATOM   4834 C CB  . ASN B  1 47  ? 4.393   2.176   42.384  1.00 28.67 ? 46   ASN B CB  1 
ATOM   4835 C CG  . ASN B  1 47  ? 3.460   2.916   43.343  1.00 30.79 ? 46   ASN B CG  1 
ATOM   4836 O OD1 . ASN B  1 47  ? 2.300   3.215   43.020  1.00 33.34 ? 46   ASN B OD1 1 
ATOM   4837 N ND2 . ASN B  1 47  ? 3.976   3.232   44.534  1.00 33.51 ? 46   ASN B ND2 1 
ATOM   4838 N N   . HIS B  1 48  ? 5.135   3.577   39.189  1.00 27.23 ? 47   HIS B N   1 
ATOM   4839 C CA  . HIS B  1 48  ? 5.500   4.753   38.401  1.00 27.05 ? 47   HIS B CA  1 
ATOM   4840 C C   . HIS B  1 48  ? 5.144   4.546   36.928  1.00 26.40 ? 47   HIS B C   1 
ATOM   4841 O O   . HIS B  1 48  ? 5.856   5.015   36.037  1.00 26.41 ? 47   HIS B O   1 
ATOM   4842 C CB  . HIS B  1 48  ? 6.988   5.058   38.561  1.00 27.26 ? 47   HIS B CB  1 
ATOM   4843 C CG  . HIS B  1 48  ? 7.391   5.316   39.981  1.00 30.16 ? 47   HIS B CG  1 
ATOM   4844 N ND1 . HIS B  1 48  ? 7.094   6.495   40.634  1.00 33.36 ? 47   HIS B ND1 1 
ATOM   4845 C CD2 . HIS B  1 48  ? 8.035   4.538   40.883  1.00 31.12 ? 47   HIS B CD2 1 
ATOM   4846 C CE1 . HIS B  1 48  ? 7.555   6.439   41.871  1.00 33.26 ? 47   HIS B CE1 1 
ATOM   4847 N NE2 . HIS B  1 48  ? 8.140   5.267   42.045  1.00 33.39 ? 47   HIS B NE2 1 
ATOM   4848 N N   . GLY B  1 49  ? 4.021   3.871   36.699  1.00 25.75 ? 48   GLY B N   1 
ATOM   4849 C CA  . GLY B  1 49  ? 3.593   3.466   35.367  1.00 25.31 ? 48   GLY B CA  1 
ATOM   4850 C C   . GLY B  1 49  ? 3.549   1.956   35.211  1.00 24.63 ? 48   GLY B C   1 
ATOM   4851 O O   . GLY B  1 49  ? 4.158   1.218   35.999  1.00 25.12 ? 48   GLY B O   1 
ATOM   4852 N N   . HIS B  1 50  ? 2.827   1.489   34.190  1.00 23.94 ? 49   HIS B N   1 
ATOM   4853 C CA  . HIS B  1 50  ? 2.706   0.058   33.912  1.00 23.60 ? 49   HIS B CA  1 
ATOM   4854 C C   . HIS B  1 50  ? 3.552   -0.332  32.703  1.00 22.74 ? 49   HIS B C   1 
ATOM   4855 O O   . HIS B  1 50  ? 3.741   0.481   31.801  1.00 22.42 ? 49   HIS B O   1 
ATOM   4856 C CB  . HIS B  1 50  ? 1.248   -0.325  33.645  1.00 24.22 ? 49   HIS B CB  1 
ATOM   4857 C CG  . HIS B  1 50  ? 0.395   -0.411  34.879  1.00 25.98 ? 49   HIS B CG  1 
ATOM   4858 N ND1 . HIS B  1 50  ? -0.025  0.702   35.575  1.00 28.52 ? 49   HIS B ND1 1 
ATOM   4859 C CD2 . HIS B  1 50  ? -0.144  -1.477  35.516  1.00 27.20 ? 49   HIS B CD2 1 
ATOM   4860 C CE1 . HIS B  1 50  ? -0.777  0.326   36.595  1.00 28.51 ? 49   HIS B CE1 1 
ATOM   4861 N NE2 . HIS B  1 50  ? -0.869  -0.991  36.579  1.00 28.95 ? 49   HIS B NE2 1 
ATOM   4862 N N   . ILE B  1 51  ? 4.086   -1.551  32.720  1.00 21.76 ? 50   ILE B N   1 
ATOM   4863 C CA  . ILE B  1 51  ? 4.759   -2.140  31.555  1.00 20.95 ? 50   ILE B CA  1 
ATOM   4864 C C   . ILE B  1 51  ? 4.055   -3.455  31.228  1.00 20.73 ? 50   ILE B C   1 
ATOM   4865 O O   . ILE B  1 51  ? 4.101   -4.405  32.014  1.00 20.60 ? 50   ILE B O   1 
ATOM   4866 C CB  . ILE B  1 51  ? 6.283   -2.369  31.835  1.00 21.28 ? 50   ILE B CB  1 
ATOM   4867 C CG1 . ILE B  1 51  ? 6.976   -1.054  32.204  1.00 20.75 ? 50   ILE B CG1 1 
ATOM   4868 C CG2 . ILE B  1 51  ? 6.984   -3.061  30.626  1.00 20.59 ? 50   ILE B CG2 1 
ATOM   4869 C CD1 . ILE B  1 51  ? 8.366   -1.222  32.831  1.00 22.59 ? 50   ILE B CD1 1 
ATOM   4870 N N   . LEU B  1 52  ? 3.408   -3.508  30.064  1.00 19.02 ? 51   LEU B N   1 
ATOM   4871 C CA  . LEU B  1 52  ? 2.738   -4.715  29.600  1.00 19.76 ? 51   LEU B CA  1 
ATOM   4872 C C   . LEU B  1 52  ? 3.636   -5.480  28.636  1.00 19.98 ? 51   LEU B C   1 
ATOM   4873 O O   . LEU B  1 52  ? 4.012   -4.959  27.580  1.00 20.00 ? 51   LEU B O   1 
ATOM   4874 C CB  . LEU B  1 52  ? 1.397   -4.364  28.936  1.00 19.37 ? 51   LEU B CB  1 
ATOM   4875 C CG  . LEU B  1 52  ? 0.639   -5.477  28.203  1.00 19.69 ? 51   LEU B CG  1 
ATOM   4876 C CD1 . LEU B  1 52  ? 0.290   -6.633  29.157  1.00 20.55 ? 51   LEU B CD1 1 
ATOM   4877 C CD2 . LEU B  1 52  ? -0.618  -4.919  27.549  1.00 21.25 ? 51   LEU B CD2 1 
ATOM   4878 N N   . VAL B  1 53  ? 4.008   -6.698  29.023  1.00 20.00 ? 52   VAL B N   1 
ATOM   4879 C CA  . VAL B  1 53  ? 4.791   -7.578  28.161  1.00 20.09 ? 52   VAL B CA  1 
ATOM   4880 C C   . VAL B  1 53  ? 3.839   -8.630  27.592  1.00 20.48 ? 52   VAL B C   1 
ATOM   4881 O O   . VAL B  1 53  ? 3.512   -9.614  28.261  1.00 20.19 ? 52   VAL B O   1 
ATOM   4882 C CB  . VAL B  1 53  ? 5.974   -8.216  28.927  1.00 20.31 ? 52   VAL B CB  1 
ATOM   4883 C CG1 . VAL B  1 53  ? 6.826   -9.101  28.010  1.00 19.57 ? 52   VAL B CG1 1 
ATOM   4884 C CG2 . VAL B  1 53  ? 6.849   -7.131  29.589  1.00 20.03 ? 52   VAL B CG2 1 
ATOM   4885 N N   . ASP B  1 54  ? 3.358   -8.385  26.371  1.00 18.76 ? 53   ASP B N   1 
ATOM   4886 C CA  . ASP B  1 54  ? 2.402   -9.287  25.732  1.00 18.71 ? 53   ASP B CA  1 
ATOM   4887 C C   . ASP B  1 54  ? 3.140   -10.232 24.803  1.00 19.10 ? 53   ASP B C   1 
ATOM   4888 O O   . ASP B  1 54  ? 3.554   -9.835  23.707  1.00 18.88 ? 53   ASP B O   1 
ATOM   4889 C CB  . ASP B  1 54  ? 1.324   -8.495  24.981  1.00 18.02 ? 53   ASP B CB  1 
ATOM   4890 C CG  . ASP B  1 54  ? 0.380   -9.386  24.169  1.00 18.19 ? 53   ASP B CG  1 
ATOM   4891 O OD1 . ASP B  1 54  ? 0.453   -10.631 24.253  1.00 18.43 ? 53   ASP B OD1 1 
ATOM   4892 O OD2 . ASP B  1 54  ? -0.497  -8.905  23.428  1.00 19.33 ? 53   ASP B OD2 1 
ATOM   4893 N N   . TYR B  1 55  ? 3.316   -11.478 25.241  1.00 18.60 ? 54   TYR B N   1 
ATOM   4894 C CA  . TYR B  1 55  ? 4.009   -12.489 24.430  1.00 18.73 ? 54   TYR B CA  1 
ATOM   4895 C C   . TYR B  1 55  ? 3.059   -13.515 23.789  1.00 18.62 ? 54   TYR B C   1 
ATOM   4896 O O   . TYR B  1 55  ? 3.478   -14.597 23.371  1.00 18.00 ? 54   TYR B O   1 
ATOM   4897 C CB  . TYR B  1 55  ? 5.143   -13.155 25.233  1.00 18.88 ? 54   TYR B CB  1 
ATOM   4898 C CG  . TYR B  1 55  ? 4.714   -13.864 26.505  1.00 19.32 ? 54   TYR B CG  1 
ATOM   4899 C CD1 . TYR B  1 55  ? 4.485   -15.239 26.505  1.00 20.25 ? 54   TYR B CD1 1 
ATOM   4900 C CD2 . TYR B  1 55  ? 4.525   -13.154 27.693  1.00 21.59 ? 54   TYR B CD2 1 
ATOM   4901 C CE1 . TYR B  1 55  ? 4.088   -15.902 27.668  1.00 22.31 ? 54   TYR B CE1 1 
ATOM   4902 C CE2 . TYR B  1 55  ? 4.121   -13.808 28.867  1.00 21.90 ? 54   TYR B CE2 1 
ATOM   4903 C CZ  . TYR B  1 55  ? 3.911   -15.179 28.842  1.00 22.42 ? 54   TYR B CZ  1 
ATOM   4904 O OH  . TYR B  1 55  ? 3.488   -15.824 29.995  1.00 22.92 ? 54   TYR B OH  1 
ATOM   4905 N N   . SER B  1 56  ? 1.781   -13.148 23.691  1.00 18.47 ? 55   SER B N   1 
ATOM   4906 C CA  . SER B  1 56  ? 0.749   -14.070 23.248  1.00 18.77 ? 55   SER B CA  1 
ATOM   4907 C C   . SER B  1 56  ? 0.808   -14.361 21.754  1.00 18.16 ? 55   SER B C   1 
ATOM   4908 O O   . SER B  1 56  ? 0.381   -15.415 21.319  1.00 19.20 ? 55   SER B O   1 
ATOM   4909 C CB  . SER B  1 56  ? -0.648  -13.596 23.691  1.00 18.95 ? 55   SER B CB  1 
ATOM   4910 O OG  . SER B  1 56  ? -1.049  -12.408 23.024  1.00 19.73 ? 55   SER B OG  1 
ATOM   4911 N N   . LYS B  1 57  ? 1.380   -13.448 20.971  1.00 18.29 ? 56   LYS B N   1 
ATOM   4912 C CA  . LYS B  1 57  ? 1.503   -13.688 19.533  1.00 18.02 ? 56   LYS B CA  1 
ATOM   4913 C C   . LYS B  1 57  ? 2.768   -14.476 19.175  1.00 18.90 ? 56   LYS B C   1 
ATOM   4914 O O   . LYS B  1 57  ? 3.345   -14.275 18.106  1.00 19.22 ? 56   LYS B O   1 
ATOM   4915 C CB  . LYS B  1 57  ? 1.437   -12.373 18.752  1.00 17.62 ? 56   LYS B CB  1 
ATOM   4916 C CG  . LYS B  1 57  ? 0.120   -11.604 18.889  1.00 18.04 ? 56   LYS B CG  1 
ATOM   4917 C CD  . LYS B  1 57  ? 0.000   -10.577 17.756  1.00 15.20 ? 56   LYS B CD  1 
ATOM   4918 C CE  . LYS B  1 57  ? -1.096  -9.551  17.963  1.00 16.69 ? 56   LYS B CE  1 
ATOM   4919 N NZ  . LYS B  1 57  ? -0.777  -8.481  18.957  1.00 16.94 ? 56   LYS B NZ  1 
ATOM   4920 N N   . ASN B  1 58  ? 3.166   -15.399 20.055  1.00 18.99 ? 57   ASN B N   1 
ATOM   4921 C CA  . ASN B  1 58  ? 4.310   -16.267 19.814  1.00 19.32 ? 57   ASN B CA  1 
ATOM   4922 C C   . ASN B  1 58  ? 3.873   -17.710 19.523  1.00 19.93 ? 57   ASN B C   1 
ATOM   4923 O O   . ASN B  1 58  ? 2.767   -18.122 19.890  1.00 20.08 ? 57   ASN B O   1 
ATOM   4924 C CB  . ASN B  1 58  ? 5.258   -16.227 21.016  1.00 19.03 ? 57   ASN B CB  1 
ATOM   4925 C CG  . ASN B  1 58  ? 6.161   -14.993 21.008  1.00 19.55 ? 57   ASN B CG  1 
ATOM   4926 O OD1 . ASN B  1 58  ? 7.044   -14.872 20.160  1.00 19.53 ? 57   ASN B OD1 1 
ATOM   4927 N ND2 . ASN B  1 58  ? 5.954   -14.087 21.969  1.00 17.52 ? 57   ASN B ND2 1 
ATOM   4928 N N   . LEU B  1 59  ? 4.740   -18.462 18.850  1.00 20.28 ? 58   LEU B N   1 
ATOM   4929 C CA  . LEU B  1 59  ? 4.457   -19.856 18.483  1.00 20.98 ? 58   LEU B CA  1 
ATOM   4930 C C   . LEU B  1 59  ? 4.705   -20.794 19.659  1.00 21.14 ? 58   LEU B C   1 
ATOM   4931 O O   . LEU B  1 59  ? 5.598   -21.658 19.628  1.00 21.91 ? 58   LEU B O   1 
ATOM   4932 C CB  . LEU B  1 59  ? 5.265   -20.266 17.240  1.00 20.66 ? 58   LEU B CB  1 
ATOM   4933 C CG  . LEU B  1 59  ? 4.806   -19.598 15.938  1.00 20.62 ? 58   LEU B CG  1 
ATOM   4934 C CD1 . LEU B  1 59  ? 5.958   -19.578 14.944  1.00 21.46 ? 58   LEU B CD1 1 
ATOM   4935 C CD2 . LEU B  1 59  ? 3.575   -20.324 15.350  1.00 21.74 ? 58   LEU B CD2 1 
ATOM   4936 N N   . VAL B  1 60  ? 3.904   -20.598 20.704  1.00 22.02 ? 59   VAL B N   1 
ATOM   4937 C CA  . VAL B  1 60  ? 4.019   -21.346 21.951  1.00 22.09 ? 59   VAL B CA  1 
ATOM   4938 C C   . VAL B  1 60  ? 2.632   -21.701 22.491  1.00 23.01 ? 59   VAL B C   1 
ATOM   4939 O O   . VAL B  1 60  ? 1.637   -21.047 22.175  1.00 23.60 ? 59   VAL B O   1 
ATOM   4940 C CB  . VAL B  1 60  ? 4.819   -20.558 23.042  1.00 21.80 ? 59   VAL B CB  1 
ATOM   4941 C CG1 . VAL B  1 60  ? 6.253   -20.251 22.573  1.00 21.21 ? 59   VAL B CG1 1 
ATOM   4942 C CG2 . VAL B  1 60  ? 4.106   -19.274 23.455  1.00 22.31 ? 59   VAL B CG2 1 
ATOM   4943 N N   . ASN B  1 61  ? 2.578   -22.750 23.303  1.00 23.89 ? 60   ASN B N   1 
ATOM   4944 C CA  . ASN B  1 61  ? 1.367   -23.057 24.071  1.00 24.85 ? 60   ASN B CA  1 
ATOM   4945 C C   . ASN B  1 61  ? 1.757   -23.324 25.520  1.00 25.04 ? 60   ASN B C   1 
ATOM   4946 O O   . ASN B  1 61  ? 2.904   -23.095 25.902  1.00 25.13 ? 60   ASN B O   1 
ATOM   4947 C CB  . ASN B  1 61  ? 0.596   -24.235 23.455  1.00 25.15 ? 60   ASN B CB  1 
ATOM   4948 C CG  . ASN B  1 61  ? 1.439   -25.506 23.350  1.00 25.32 ? 60   ASN B CG  1 
ATOM   4949 O OD1 . ASN B  1 61  ? 2.464   -25.647 24.008  1.00 25.44 ? 60   ASN B OD1 1 
ATOM   4950 N ND2 . ASN B  1 61  ? 0.997   -26.436 22.525  1.00 27.67 ? 60   ASN B ND2 1 
ATOM   4951 N N   . LYS B  1 62  ? 0.816   -23.823 26.321  1.00 25.70 ? 61   LYS B N   1 
ATOM   4952 C CA  . LYS B  1 62  ? 1.090   -24.114 27.725  1.00 26.55 ? 61   LYS B CA  1 
ATOM   4953 C C   . LYS B  1 62  ? 2.254   -25.091 27.892  1.00 26.03 ? 61   LYS B C   1 
ATOM   4954 O O   . LYS B  1 62  ? 3.160   -24.834 28.683  1.00 26.07 ? 61   LYS B O   1 
ATOM   4955 C CB  . LYS B  1 62  ? -0.167  -24.640 28.439  1.00 26.94 ? 61   LYS B CB  1 
ATOM   4956 C CG  . LYS B  1 62  ? -0.084  -24.570 29.966  1.00 30.04 ? 61   LYS B CG  1 
ATOM   4957 C CD  . LYS B  1 62  ? -1.315  -25.189 30.627  1.00 33.61 ? 61   LYS B CD  1 
ATOM   4958 C CE  . LYS B  1 62  ? -1.109  -25.370 32.128  1.00 36.81 ? 61   LYS B CE  1 
ATOM   4959 N NZ  . LYS B  1 62  ? -2.397  -25.670 32.831  1.00 39.96 ? 61   LYS B NZ  1 
ATOM   4960 N N   . GLU B  1 63  ? 2.225   -26.192 27.139  1.00 26.94 ? 62   GLU B N   1 
ATOM   4961 C CA  . GLU B  1 63  ? 3.264   -27.212 27.212  1.00 27.22 ? 62   GLU B CA  1 
ATOM   4962 C C   . GLU B  1 63  ? 4.650   -26.644 26.849  1.00 26.55 ? 62   GLU B C   1 
ATOM   4963 O O   . GLU B  1 63  ? 5.631   -26.904 27.544  1.00 26.88 ? 62   GLU B O   1 
ATOM   4964 C CB  . GLU B  1 63  ? 2.900   -28.432 26.346  1.00 27.43 ? 62   GLU B CB  1 
ATOM   4965 C CG  . GLU B  1 63  ? 3.924   -29.564 26.404  1.00 30.54 ? 62   GLU B CG  1 
ATOM   4966 C CD  . GLU B  1 63  ? 3.452   -30.864 25.767  1.00 34.28 ? 62   GLU B CD  1 
ATOM   4967 O OE1 . GLU B  1 63  ? 4.203   -31.869 25.873  1.00 36.46 ? 62   GLU B OE1 1 
ATOM   4968 O OE2 . GLU B  1 63  ? 2.349   -30.897 25.163  1.00 36.38 ? 62   GLU B OE2 1 
ATOM   4969 N N   . VAL B  1 64  ? 4.722   -25.845 25.787  1.00 25.61 ? 63   VAL B N   1 
ATOM   4970 C CA  . VAL B  1 64  ? 6.006   -25.252 25.383  1.00 24.69 ? 63   VAL B CA  1 
ATOM   4971 C C   . VAL B  1 64  ? 6.623   -24.339 26.457  1.00 23.97 ? 63   VAL B C   1 
ATOM   4972 O O   . VAL B  1 64  ? 7.821   -24.441 26.740  1.00 23.93 ? 63   VAL B O   1 
ATOM   4973 C CB  . VAL B  1 64  ? 5.901   -24.519 24.010  1.00 24.53 ? 63   VAL B CB  1 
ATOM   4974 C CG1 . VAL B  1 64  ? 7.220   -23.792 23.675  1.00 24.38 ? 63   VAL B CG1 1 
ATOM   4975 C CG2 . VAL B  1 64  ? 5.547   -25.502 22.914  1.00 25.47 ? 63   VAL B CG2 1 
ATOM   4976 N N   . MET B  1 65  ? 5.820   -23.456 27.051  1.00 23.65 ? 64   MET B N   1 
ATOM   4977 C CA  . MET B  1 65  ? 6.326   -22.558 28.089  1.00 24.33 ? 64   MET B CA  1 
ATOM   4978 C C   . MET B  1 65  ? 6.823   -23.332 29.301  1.00 24.64 ? 64   MET B C   1 
ATOM   4979 O O   . MET B  1 65  ? 7.856   -22.988 29.897  1.00 24.58 ? 64   MET B O   1 
ATOM   4980 C CB  . MET B  1 65  ? 5.277   -21.526 28.498  1.00 23.77 ? 64   MET B CB  1 
ATOM   4981 C CG  . MET B  1 65  ? 4.864   -20.589 27.377  1.00 24.58 ? 64   MET B CG  1 
ATOM   4982 S SD  . MET B  1 65  ? 6.262   -19.704 26.585  1.00 24.24 ? 64   MET B SD  1 
ATOM   4983 C CE  . MET B  1 65  ? 6.946   -18.867 27.955  1.00 22.69 ? 64   MET B CE  1 
ATOM   4984 N N   . GLN B  1 66  ? 6.095   -24.396 29.632  1.00 25.43 ? 65   GLN B N   1 
ATOM   4985 C CA  . GLN B  1 66  ? 6.466   -25.281 30.727  1.00 25.44 ? 65   GLN B CA  1 
ATOM   4986 C C   . GLN B  1 66  ? 7.813   -25.938 30.463  1.00 24.81 ? 65   GLN B C   1 
ATOM   4987 O O   . GLN B  1 66  ? 8.688   -25.948 31.340  1.00 24.62 ? 65   GLN B O   1 
ATOM   4988 C CB  . GLN B  1 66  ? 5.380   -26.343 30.943  1.00 26.15 ? 65   GLN B CB  1 
ATOM   4989 C CG  . GLN B  1 66  ? 4.201   -25.843 31.774  1.00 29.09 ? 65   GLN B CG  1 
ATOM   4990 C CD  . GLN B  1 66  ? 3.183   -26.933 32.088  1.00 33.43 ? 65   GLN B CD  1 
ATOM   4991 O OE1 . GLN B  1 66  ? 2.894   -27.800 31.250  1.00 35.41 ? 65   GLN B OE1 1 
ATOM   4992 N NE2 . GLN B  1 66  ? 2.625   -26.879 33.287  1.00 35.03 ? 65   GLN B NE2 1 
ATOM   4993 N N   . MET B  1 67  ? 7.988   -26.456 29.248  1.00 24.36 ? 66   MET B N   1 
ATOM   4994 C CA  . MET B  1 67  ? 9.244   -27.077 28.847  1.00 23.83 ? 66   MET B CA  1 
ATOM   4995 C C   . MET B  1 67  ? 10.390  -26.067 28.877  1.00 23.82 ? 66   MET B C   1 
ATOM   4996 O O   . MET B  1 67  ? 11.511  -26.407 29.264  1.00 23.90 ? 66   MET B O   1 
ATOM   4997 C CB  . MET B  1 67  ? 9.129   -27.699 27.458  1.00 24.00 ? 66   MET B CB  1 
ATOM   4998 C CG  . MET B  1 67  ? 8.317   -29.010 27.406  1.00 25.41 ? 66   MET B CG  1 
ATOM   4999 S SD  . MET B  1 67  ? 8.421   -29.865 25.812  1.00 31.33 ? 66   MET B SD  1 
ATOM   5000 C CE  . MET B  1 67  ? 7.610   -28.669 24.751  1.00 29.87 ? 66   MET B CE  1 
ATOM   5001 N N   . LEU B  1 68  ? 10.097  -24.831 28.469  1.00 23.46 ? 67   LEU B N   1 
ATOM   5002 C CA  . LEU B  1 68  ? 11.098  -23.764 28.468  1.00 23.56 ? 67   LEU B CA  1 
ATOM   5003 C C   . LEU B  1 68  ? 11.546  -23.342 29.875  1.00 22.99 ? 67   LEU B C   1 
ATOM   5004 O O   . LEU B  1 68  ? 12.738  -23.219 30.140  1.00 23.22 ? 67   LEU B O   1 
ATOM   5005 C CB  . LEU B  1 68  ? 10.595  -22.547 27.666  1.00 23.53 ? 67   LEU B CB  1 
ATOM   5006 C CG  . LEU B  1 68  ? 10.566  -22.664 26.140  1.00 23.57 ? 67   LEU B CG  1 
ATOM   5007 C CD1 . LEU B  1 68  ? 9.785   -21.505 25.560  1.00 23.69 ? 67   LEU B CD1 1 
ATOM   5008 C CD2 . LEU B  1 68  ? 11.976  -22.703 25.544  1.00 23.36 ? 67   LEU B CD2 1 
ATOM   5009 N N   . VAL B  1 69  ? 10.586  -23.122 30.768  1.00 23.28 ? 68   VAL B N   1 
ATOM   5010 C CA  . VAL B  1 69  ? 10.876  -22.783 32.161  1.00 23.39 ? 68   VAL B CA  1 
ATOM   5011 C C   . VAL B  1 69  ? 11.673  -23.916 32.832  1.00 23.76 ? 68   VAL B C   1 
ATOM   5012 O O   . VAL B  1 69  ? 12.598  -23.656 33.606  1.00 23.12 ? 68   VAL B O   1 
ATOM   5013 C CB  . VAL B  1 69  ? 9.580   -22.457 32.938  1.00 23.59 ? 68   VAL B CB  1 
ATOM   5014 C CG1 . VAL B  1 69  ? 9.864   -22.314 34.424  1.00 23.98 ? 68   VAL B CG1 1 
ATOM   5015 C CG2 . VAL B  1 69  ? 8.939   -21.165 32.391  1.00 24.25 ? 68   VAL B CG2 1 
ATOM   5016 N N   . GLU B  1 70  ? 11.333  -25.163 32.507  1.00 24.31 ? 69   GLU B N   1 
ATOM   5017 C CA  . GLU B  1 70  ? 12.056  -26.305 33.069  1.00 25.10 ? 69   GLU B CA  1 
ATOM   5018 C C   . GLU B  1 70  ? 13.519  -26.313 32.633  1.00 24.74 ? 69   GLU B C   1 
ATOM   5019 O O   . GLU B  1 70  ? 14.414  -26.575 33.446  1.00 24.96 ? 69   GLU B O   1 
ATOM   5020 C CB  . GLU B  1 70  ? 11.361  -27.637 32.743  1.00 25.64 ? 69   GLU B CB  1 
ATOM   5021 C CG  . GLU B  1 70  ? 10.048  -27.851 33.486  1.00 30.01 ? 69   GLU B CG  1 
ATOM   5022 C CD  . GLU B  1 70  ? 10.204  -27.783 35.002  1.00 36.49 ? 69   GLU B CD  1 
ATOM   5023 O OE1 . GLU B  1 70  ? 9.777   -26.767 35.611  1.00 39.26 ? 69   GLU B OE1 1 
ATOM   5024 O OE2 . GLU B  1 70  ? 10.765  -28.741 35.586  1.00 39.02 ? 69   GLU B OE2 1 
ATOM   5025 N N   . LEU B  1 71  ? 13.760  -25.974 31.364  1.00 24.09 ? 70   LEU B N   1 
ATOM   5026 C CA  . LEU B  1 71  ? 15.110  -25.867 30.823  1.00 23.50 ? 70   LEU B CA  1 
ATOM   5027 C C   . LEU B  1 71  ? 15.901  -24.780 31.548  1.00 23.24 ? 70   LEU B C   1 
ATOM   5028 O O   . LEU B  1 71  ? 17.068  -24.978 31.892  1.00 23.22 ? 70   LEU B O   1 
ATOM   5029 C CB  . LEU B  1 71  ? 15.067  -25.581 29.313  1.00 23.33 ? 70   LEU B CB  1 
ATOM   5030 C CG  . LEU B  1 71  ? 16.413  -25.477 28.586  1.00 23.62 ? 70   LEU B CG  1 
ATOM   5031 C CD1 . LEU B  1 71  ? 17.237  -26.771 28.699  1.00 24.00 ? 70   LEU B CD1 1 
ATOM   5032 C CD2 . LEU B  1 71  ? 16.210  -25.091 27.117  1.00 23.89 ? 70   LEU B CD2 1 
ATOM   5033 N N   . ALA B  1 72  ? 15.274  -23.628 31.787  1.00 23.03 ? 71   ALA B N   1 
ATOM   5034 C CA  . ALA B  1 72  ? 15.947  -22.554 32.502  1.00 23.60 ? 71   ALA B CA  1 
ATOM   5035 C C   . ALA B  1 72  ? 16.377  -23.029 33.894  1.00 23.76 ? 71   ALA B C   1 
ATOM   5036 O O   . ALA B  1 72  ? 17.498  -22.774 34.332  1.00 23.59 ? 71   ALA B O   1 
ATOM   5037 C CB  . ALA B  1 72  ? 15.051  -21.328 32.602  1.00 23.42 ? 71   ALA B CB  1 
ATOM   5038 N N   . LYS B  1 73  ? 15.475  -23.729 34.579  1.00 24.06 ? 72   LYS B N   1 
ATOM   5039 C CA  . LYS B  1 73  ? 15.782  -24.247 35.916  1.00 24.24 ? 72   LYS B CA  1 
ATOM   5040 C C   . LYS B  1 73  ? 16.974  -25.212 35.884  1.00 23.78 ? 72   LYS B C   1 
ATOM   5041 O O   . LYS B  1 73  ? 17.935  -25.054 36.648  1.00 23.98 ? 72   LYS B O   1 
ATOM   5042 C CB  . LYS B  1 73  ? 14.532  -24.908 36.512  1.00 24.63 ? 72   LYS B CB  1 
ATOM   5043 C CG  . LYS B  1 73  ? 13.550  -23.888 37.085  1.00 26.21 ? 72   LYS B CG  1 
ATOM   5044 C CD  . LYS B  1 73  ? 12.478  -24.533 37.957  1.00 29.87 ? 72   LYS B CD  1 
ATOM   5045 C CE  . LYS B  1 73  ? 11.405  -23.519 38.342  1.00 32.55 ? 72   LYS B CE  1 
ATOM   5046 N NZ  . LYS B  1 73  ? 10.039  -24.129 38.322  1.00 35.14 ? 72   LYS B NZ  1 
ATOM   5047 N N   . SER B  1 74  ? 16.928  -26.167 34.956  1.00 23.88 ? 73   SER B N   1 
ATOM   5048 C CA  . SER B  1 74  ? 17.937  -27.218 34.865  1.00 23.97 ? 73   SER B CA  1 
ATOM   5049 C C   . SER B  1 74  ? 19.232  -26.761 34.191  1.00 23.61 ? 73   SER B C   1 
ATOM   5050 O O   . SER B  1 74  ? 20.197  -27.519 34.118  1.00 23.77 ? 73   SER B O   1 
ATOM   5051 C CB  . SER B  1 74  ? 17.359  -28.466 34.194  1.00 24.52 ? 73   SER B CB  1 
ATOM   5052 O OG  . SER B  1 74  ? 17.246  -28.323 32.791  1.00 24.84 ? 73   SER B OG  1 
ATOM   5053 N N   . ARG B  1 75  ? 19.254  -25.513 33.710  1.00 23.39 ? 74   ARG B N   1 
ATOM   5054 C CA  . ARG B  1 75  ? 20.498  -24.920 33.225  1.00 23.17 ? 74   ARG B CA  1 
ATOM   5055 C C   . ARG B  1 75  ? 21.130  -24.006 34.292  1.00 23.23 ? 74   ARG B C   1 
ATOM   5056 O O   . ARG B  1 75  ? 22.193  -23.418 34.078  1.00 23.24 ? 74   ARG B O   1 
ATOM   5057 C CB  . ARG B  1 75  ? 20.279  -24.196 31.874  1.00 22.82 ? 74   ARG B CB  1 
ATOM   5058 C CG  . ARG B  1 75  ? 20.082  -25.151 30.667  1.00 22.28 ? 74   ARG B CG  1 
ATOM   5059 C CD  . ARG B  1 75  ? 21.347  -25.879 30.180  1.00 21.42 ? 74   ARG B CD  1 
ATOM   5060 N NE  . ARG B  1 75  ? 22.488  -24.963 30.170  1.00 23.03 ? 74   ARG B NE  1 
ATOM   5061 C CZ  . ARG B  1 75  ? 23.582  -25.081 30.908  1.00 23.47 ? 74   ARG B CZ  1 
ATOM   5062 N NH1 . ARG B  1 75  ? 23.745  -26.119 31.732  1.00 23.90 ? 74   ARG B NH1 1 
ATOM   5063 N NH2 . ARG B  1 75  ? 24.524  -24.150 30.826  1.00 24.30 ? 74   ARG B NH2 1 
ATOM   5064 N N   . GLY B  1 76  ? 20.483  -23.923 35.456  1.00 23.59 ? 75   GLY B N   1 
ATOM   5065 C CA  . GLY B  1 76  ? 21.035  -23.217 36.602  1.00 23.50 ? 75   GLY B CA  1 
ATOM   5066 C C   . GLY B  1 76  ? 20.779  -21.722 36.680  1.00 23.90 ? 75   GLY B C   1 
ATOM   5067 O O   . GLY B  1 76  ? 21.490  -21.008 37.387  1.00 23.45 ? 75   GLY B O   1 
ATOM   5068 N N   . VAL B  1 77  ? 19.755  -21.252 35.968  1.00 23.81 ? 76   VAL B N   1 
ATOM   5069 C CA  . VAL B  1 77  ? 19.467  -19.818 35.867  1.00 24.16 ? 76   VAL B CA  1 
ATOM   5070 C C   . VAL B  1 77  ? 19.241  -19.149 37.224  1.00 24.36 ? 76   VAL B C   1 
ATOM   5071 O O   . VAL B  1 77  ? 19.762  -18.055 37.469  1.00 24.11 ? 76   VAL B O   1 
ATOM   5072 C CB  . VAL B  1 77  ? 18.288  -19.541 34.884  1.00 23.71 ? 76   VAL B CB  1 
ATOM   5073 C CG1 . VAL B  1 77  ? 17.769  -18.096 35.005  1.00 24.64 ? 76   VAL B CG1 1 
ATOM   5074 C CG2 . VAL B  1 77  ? 18.722  -19.841 33.450  1.00 25.02 ? 76   VAL B CG2 1 
ATOM   5075 N N   . GLU B  1 78  ? 18.511  -19.820 38.116  1.00 24.54 ? 77   GLU B N   1 
ATOM   5076 C CA  . GLU B  1 78  ? 18.230  -19.250 39.436  1.00 24.99 ? 77   GLU B CA  1 
ATOM   5077 C C   . GLU B  1 78  ? 19.494  -19.056 40.281  1.00 24.60 ? 77   GLU B C   1 
ATOM   5078 O O   . GLU B  1 78  ? 19.677  -17.993 40.879  1.00 24.43 ? 77   GLU B O   1 
ATOM   5079 C CB  . GLU B  1 78  ? 17.136  -20.047 40.172  1.00 25.44 ? 77   GLU B CB  1 
ATOM   5080 C CG  . GLU B  1 78  ? 15.790  -19.991 39.447  1.00 28.25 ? 77   GLU B CG  1 
ATOM   5081 C CD  . GLU B  1 78  ? 14.604  -20.362 40.319  1.00 32.59 ? 77   GLU B CD  1 
ATOM   5082 O OE1 . GLU B  1 78  ? 14.364  -21.568 40.510  1.00 34.39 ? 77   GLU B OE1 1 
ATOM   5083 O OE2 . GLU B  1 78  ? 13.892  -19.443 40.796  1.00 35.83 ? 77   GLU B OE2 1 
ATOM   5084 N N   . ALA B  1 79  ? 20.365  -20.067 40.304  1.00 24.72 ? 78   ALA B N   1 
ATOM   5085 C CA  . ALA B  1 79  ? 21.614  -19.999 41.069  1.00 24.90 ? 78   ALA B CA  1 
ATOM   5086 C C   . ALA B  1 79  ? 22.591  -18.977 40.493  1.00 25.45 ? 78   ALA B C   1 
ATOM   5087 O O   . ALA B  1 79  ? 23.223  -18.220 41.237  1.00 25.35 ? 78   ALA B O   1 
ATOM   5088 C CB  . ALA B  1 79  ? 22.271  -21.385 41.171  1.00 24.72 ? 78   ALA B CB  1 
ATOM   5089 N N   . ALA B  1 80  ? 22.702  -18.944 39.162  1.00 25.65 ? 79   ALA B N   1 
ATOM   5090 C CA  . ALA B  1 80  ? 23.590  -17.987 38.498  1.00 25.79 ? 79   ALA B CA  1 
ATOM   5091 C C   . ALA B  1 80  ? 23.193  -16.541 38.776  1.00 25.50 ? 79   ALA B C   1 
ATOM   5092 O O   . ALA B  1 80  ? 24.058  -15.689 39.002  1.00 26.03 ? 79   ALA B O   1 
ATOM   5093 C CB  . ALA B  1 80  ? 23.633  -18.253 36.993  1.00 25.48 ? 79   ALA B CB  1 
ATOM   5094 N N   . ARG B  1 81  ? 21.886  -16.269 38.756  1.00 25.33 ? 80   ARG B N   1 
ATOM   5095 C CA  . ARG B  1 81  ? 21.358  -14.932 39.029  1.00 25.87 ? 80   ARG B CA  1 
ATOM   5096 C C   . ARG B  1 81  ? 21.736  -14.465 40.429  1.00 26.41 ? 80   ARG B C   1 
ATOM   5097 O O   . ARG B  1 81  ? 22.210  -13.347 40.622  1.00 26.49 ? 80   ARG B O   1 
ATOM   5098 C CB  . ARG B  1 81  ? 19.838  -14.912 38.857  1.00 25.87 ? 80   ARG B CB  1 
ATOM   5099 C CG  . ARG B  1 81  ? 19.171  -13.601 39.265  1.00 25.75 ? 80   ARG B CG  1 
ATOM   5100 C CD  . ARG B  1 81  ? 17.691  -13.737 39.585  1.00 27.57 ? 80   ARG B CD  1 
ATOM   5101 N NE  . ARG B  1 81  ? 17.474  -14.786 40.582  1.00 28.34 ? 80   ARG B NE  1 
ATOM   5102 C CZ  . ARG B  1 81  ? 16.350  -15.470 40.748  1.00 28.31 ? 80   ARG B CZ  1 
ATOM   5103 N NH1 . ARG B  1 81  ? 15.289  -15.225 39.996  1.00 28.97 ? 80   ARG B NH1 1 
ATOM   5104 N NH2 . ARG B  1 81  ? 16.295  -16.414 41.684  1.00 29.31 ? 80   ARG B NH2 1 
ATOM   5105 N N   . ASP B  1 82  ? 21.524  -15.343 41.406  1.00 26.83 ? 81   ASP B N   1 
ATOM   5106 C CA  . ASP B  1 82  ? 21.866  -15.043 42.791  1.00 27.92 ? 81   ASP B CA  1 
ATOM   5107 C C   . ASP B  1 82  ? 23.355  -14.760 42.945  1.00 27.76 ? 81   ASP B C   1 
ATOM   5108 O O   . ASP B  1 82  ? 23.740  -13.868 43.693  1.00 27.62 ? 81   ASP B O   1 
ATOM   5109 C CB  . ASP B  1 82  ? 21.419  -16.187 43.710  1.00 28.57 ? 81   ASP B CB  1 
ATOM   5110 C CG  . ASP B  1 82  ? 19.895  -16.311 43.801  1.00 30.78 ? 81   ASP B CG  1 
ATOM   5111 O OD1 . ASP B  1 82  ? 19.159  -15.579 43.092  1.00 31.68 ? 81   ASP B OD1 1 
ATOM   5112 O OD2 . ASP B  1 82  ? 19.336  -17.132 44.556  1.00 33.20 ? 81   ASP B OD2 1 
ATOM   5113 N N   . ASN B  1 83  ? 24.176  -15.501 42.202  1.00 27.59 ? 82   ASN B N   1 
ATOM   5114 C CA  . ASN B  1 83  ? 25.619  -15.300 42.198  1.00 27.99 ? 82   ASN B CA  1 
ATOM   5115 C C   . ASN B  1 83  ? 26.028  -13.937 41.634  1.00 27.74 ? 82   ASN B C   1 
ATOM   5116 O O   . ASN B  1 83  ? 26.948  -13.295 42.146  1.00 27.61 ? 82   ASN B O   1 
ATOM   5117 C CB  . ASN B  1 83  ? 26.311  -16.430 41.432  1.00 28.50 ? 82   ASN B CB  1 
ATOM   5118 C CG  . ASN B  1 83  ? 26.288  -17.759 42.184  1.00 30.01 ? 82   ASN B CG  1 
ATOM   5119 O OD1 . ASN B  1 83  ? 26.632  -18.790 41.617  1.00 34.63 ? 82   ASN B OD1 1 
ATOM   5120 N ND2 . ASN B  1 83  ? 25.887  -17.737 43.458  1.00 32.19 ? 82   ASN B ND2 1 
ATOM   5121 N N   . MET B  1 84  ? 25.341  -13.485 40.586  1.00 27.44 ? 83   MET B N   1 
ATOM   5122 C CA  . MET B  1 84  ? 25.590  -12.141 40.082  1.00 27.29 ? 83   MET B CA  1 
ATOM   5123 C C   . MET B  1 84  ? 25.284  -11.087 41.142  1.00 27.11 ? 83   MET B C   1 
ATOM   5124 O O   . MET B  1 84  ? 26.118  -10.222 41.425  1.00 26.78 ? 83   MET B O   1 
ATOM   5125 C CB  . MET B  1 84  ? 24.782  -11.854 38.817  1.00 27.47 ? 83   MET B CB  1 
ATOM   5126 C CG  . MET B  1 84  ? 25.089  -10.482 38.237  1.00 27.71 ? 83   MET B CG  1 
ATOM   5127 S SD  . MET B  1 84  ? 24.406  -10.191 36.559  1.00 29.40 ? 83   MET B SD  1 
ATOM   5128 C CE  . MET B  1 84  ? 22.815  -9.833  36.985  1.00 26.19 ? 83   MET B CE  1 
ATOM   5129 N N   . PHE B  1 85  ? 24.095  -11.183 41.735  1.00 27.32 ? 84   PHE B N   1 
ATOM   5130 C CA  . PHE B  1 85  ? 23.604  -10.187 42.675  1.00 27.48 ? 84   PHE B CA  1 
ATOM   5131 C C   . PHE B  1 85  ? 24.444  -10.114 43.956  1.00 27.71 ? 84   PHE B C   1 
ATOM   5132 O O   . PHE B  1 85  ? 24.526  -9.061  44.587  1.00 27.75 ? 84   PHE B O   1 
ATOM   5133 C CB  . PHE B  1 85  ? 22.128  -10.452 43.013  1.00 27.67 ? 84   PHE B CB  1 
ATOM   5134 C CG  . PHE B  1 85  ? 21.153  -9.813  42.041  1.00 27.54 ? 84   PHE B CG  1 
ATOM   5135 C CD1 . PHE B  1 85  ? 20.919  -10.382 40.794  1.00 28.19 ? 84   PHE B CD1 1 
ATOM   5136 C CD2 . PHE B  1 85  ? 20.472  -8.659  42.388  1.00 27.58 ? 84   PHE B CD2 1 
ATOM   5137 C CE1 . PHE B  1 85  ? 20.019  -9.792  39.899  1.00 27.26 ? 84   PHE B CE1 1 
ATOM   5138 C CE2 . PHE B  1 85  ? 19.571  -8.058  41.509  1.00 28.20 ? 84   PHE B CE2 1 
ATOM   5139 C CZ  . PHE B  1 85  ? 19.342  -8.629  40.260  1.00 27.30 ? 84   PHE B CZ  1 
ATOM   5140 N N   . SER B  1 86  ? 25.084  -11.222 44.309  1.00 28.18 ? 85   SER B N   1 
ATOM   5141 C CA  . SER B  1 86  ? 25.832  -11.298 45.563  1.00 28.89 ? 85   SER B CA  1 
ATOM   5142 C C   . SER B  1 86  ? 27.299  -10.879 45.437  1.00 29.23 ? 85   SER B C   1 
ATOM   5143 O O   . SER B  1 86  ? 28.014  -10.787 46.444  1.00 28.96 ? 85   SER B O   1 
ATOM   5144 C CB  . SER B  1 86  ? 25.720  -12.704 46.146  1.00 29.01 ? 85   SER B CB  1 
ATOM   5145 O OG  . SER B  1 86  ? 26.574  -13.601 45.466  1.00 30.38 ? 85   SER B OG  1 
ATOM   5146 N N   . GLY B  1 87  ? 27.753  -10.621 44.209  1.00 28.83 ? 86   GLY B N   1 
ATOM   5147 C CA  . GLY B  1 87  ? 29.118  -10.180 43.981  1.00 29.13 ? 86   GLY B CA  1 
ATOM   5148 C C   . GLY B  1 87  ? 30.115  -11.289 43.682  1.00 29.40 ? 86   GLY B C   1 
ATOM   5149 O O   . GLY B  1 87  ? 31.330  -11.047 43.685  1.00 29.54 ? 86   GLY B O   1 
ATOM   5150 N N   . SER B  1 88  ? 29.617  -12.498 43.423  1.00 29.46 ? 87   SER B N   1 
ATOM   5151 C CA  . SER B  1 88  ? 30.460  -13.607 42.987  1.00 29.98 ? 87   SER B CA  1 
ATOM   5152 C C   . SER B  1 88  ? 31.152  -13.263 41.668  1.00 30.42 ? 87   SER B C   1 
ATOM   5153 O O   . SER B  1 88  ? 30.596  -12.533 40.834  1.00 30.03 ? 87   SER B O   1 
ATOM   5154 C CB  . SER B  1 88  ? 29.630  -14.880 42.814  1.00 29.94 ? 87   SER B CB  1 
ATOM   5155 O OG  A SER B  1 88  ? 30.451  -15.998 42.524  0.50 30.18 ? 87   SER B OG  1 
ATOM   5156 O OG  B SER B  1 88  ? 29.050  -15.301 44.035  0.50 30.11 ? 87   SER B OG  1 
ATOM   5157 N N   . LYS B  1 89  ? 32.353  -13.803 41.481  1.00 30.63 ? 88   LYS B N   1 
ATOM   5158 C CA  . LYS B  1 89  ? 33.159  -13.522 40.292  1.00 30.62 ? 88   LYS B CA  1 
ATOM   5159 C C   . LYS B  1 89  ? 32.730  -14.352 39.068  1.00 30.15 ? 88   LYS B C   1 
ATOM   5160 O O   . LYS B  1 89  ? 33.467  -15.210 38.578  1.00 29.93 ? 88   LYS B O   1 
ATOM   5161 C CB  . LYS B  1 89  ? 34.655  -13.669 40.621  1.00 30.93 ? 88   LYS B CB  1 
ATOM   5162 C CG  . LYS B  1 89  ? 35.155  -12.551 41.529  1.00 32.01 ? 88   LYS B CG  1 
ATOM   5163 C CD  . LYS B  1 89  ? 36.567  -12.775 42.039  1.00 34.33 ? 88   LYS B CD  1 
ATOM   5164 C CE  . LYS B  1 89  ? 36.907  -11.708 43.076  1.00 35.56 ? 88   LYS B CE  1 
ATOM   5165 N NZ  . LYS B  1 89  ? 38.283  -11.865 43.645  1.00 37.69 ? 88   LYS B NZ  1 
ATOM   5166 N N   . ILE B  1 90  ? 31.524  -14.072 38.576  1.00 29.52 ? 89   ILE B N   1 
ATOM   5167 C CA  . ILE B  1 90  ? 30.918  -14.858 37.499  1.00 29.11 ? 89   ILE B CA  1 
ATOM   5168 C C   . ILE B  1 90  ? 31.483  -14.580 36.091  1.00 28.63 ? 89   ILE B C   1 
ATOM   5169 O O   . ILE B  1 90  ? 31.236  -15.354 35.160  1.00 28.63 ? 89   ILE B O   1 
ATOM   5170 C CB  . ILE B  1 90  ? 29.370  -14.733 37.511  1.00 29.05 ? 89   ILE B CB  1 
ATOM   5171 C CG1 . ILE B  1 90  ? 28.925  -13.302 37.190  1.00 28.86 ? 89   ILE B CG1 1 
ATOM   5172 C CG2 . ILE B  1 90  ? 28.791  -15.219 38.847  1.00 29.47 ? 89   ILE B CG2 1 
ATOM   5173 C CD1 . ILE B  1 90  ? 27.529  -13.218 36.539  1.00 29.95 ? 89   ILE B CD1 1 
ATOM   5174 N N   . ASN B  1 91  ? 32.208  -13.472 35.943  1.00 28.40 ? 90   ASN B N   1 
ATOM   5175 C CA  . ASN B  1 91  ? 33.003  -13.204 34.739  1.00 27.99 ? 90   ASN B CA  1 
ATOM   5176 C C   . ASN B  1 91  ? 34.276  -14.048 34.886  1.00 28.64 ? 90   ASN B C   1 
ATOM   5177 O O   . ASN B  1 91  ? 35.320  -13.566 35.329  1.00 28.82 ? 90   ASN B O   1 
ATOM   5178 C CB  . ASN B  1 91  ? 33.277  -11.691 34.628  1.00 27.62 ? 90   ASN B CB  1 
ATOM   5179 C CG  . ASN B  1 91  ? 34.156  -11.296 33.426  1.00 26.82 ? 90   ASN B CG  1 
ATOM   5180 O OD1 . ASN B  1 91  ? 34.397  -10.105 33.209  1.00 28.38 ? 90   ASN B OD1 1 
ATOM   5181 N ND2 . ASN B  1 91  ? 34.651  -12.266 32.681  1.00 25.98 ? 90   ASN B ND2 1 
ATOM   5182 N N   . TYR B  1 92  ? 34.164  -15.324 34.529  1.00 28.95 ? 91   TYR B N   1 
ATOM   5183 C CA  . TYR B  1 92  ? 35.169  -16.322 34.907  1.00 29.71 ? 91   TYR B CA  1 
ATOM   5184 C C   . TYR B  1 92  ? 36.473  -16.314 34.097  1.00 29.84 ? 91   TYR B C   1 
ATOM   5185 O O   . TYR B  1 92  ? 37.490  -16.829 34.563  1.00 30.53 ? 91   TYR B O   1 
ATOM   5186 C CB  . TYR B  1 92  ? 34.556  -17.730 34.958  1.00 29.85 ? 91   TYR B CB  1 
ATOM   5187 C CG  . TYR B  1 92  ? 33.740  -18.147 33.743  1.00 29.96 ? 91   TYR B CG  1 
ATOM   5188 C CD1 . TYR B  1 92  ? 34.365  -18.654 32.602  1.00 30.59 ? 91   TYR B CD1 1 
ATOM   5189 C CD2 . TYR B  1 92  ? 32.343  -18.058 33.751  1.00 30.19 ? 91   TYR B CD2 1 
ATOM   5190 C CE1 . TYR B  1 92  ? 33.632  -19.053 31.498  1.00 30.57 ? 91   TYR B CE1 1 
ATOM   5191 C CE2 . TYR B  1 92  ? 31.592  -18.454 32.644  1.00 30.50 ? 91   TYR B CE2 1 
ATOM   5192 C CZ  . TYR B  1 92  ? 32.241  -18.946 31.522  1.00 30.52 ? 91   TYR B CZ  1 
ATOM   5193 O OH  . TYR B  1 92  ? 31.505  -19.339 30.426  1.00 32.16 ? 91   TYR B OH  1 
ATOM   5194 N N   . THR B  1 93  ? 36.466  -15.748 32.890  1.00 29.85 ? 92   THR B N   1 
ATOM   5195 C CA  . THR B  1 93  ? 37.711  -15.700 32.118  1.00 28.72 ? 92   THR B CA  1 
ATOM   5196 C C   . THR B  1 93  ? 38.603  -14.544 32.580  1.00 29.24 ? 92   THR B C   1 
ATOM   5197 O O   . THR B  1 93  ? 39.826  -14.608 32.443  1.00 29.55 ? 92   THR B O   1 
ATOM   5198 C CB  . THR B  1 93  ? 37.462  -15.615 30.601  1.00 28.73 ? 92   THR B CB  1 
ATOM   5199 O OG1 . THR B  1 93  ? 36.686  -14.449 30.320  1.00 26.50 ? 92   THR B OG1 1 
ATOM   5200 C CG2 . THR B  1 93  ? 36.603  -16.777 30.109  1.00 27.76 ? 92   THR B CG2 1 
ATOM   5201 N N   . GLU B  1 94  ? 37.993  -13.487 33.117  1.00 29.38 ? 93   GLU B N   1 
ATOM   5202 C CA  . GLU B  1 94  ? 38.750  -12.344 33.637  1.00 29.94 ? 93   GLU B CA  1 
ATOM   5203 C C   . GLU B  1 94  ? 38.822  -12.340 35.178  1.00 30.22 ? 93   GLU B C   1 
ATOM   5204 O O   . GLU B  1 94  ? 39.409  -11.427 35.774  1.00 30.40 ? 93   GLU B O   1 
ATOM   5205 C CB  . GLU B  1 94  ? 38.169  -11.021 33.111  1.00 30.33 ? 93   GLU B CB  1 
ATOM   5206 C CG  . GLU B  1 94  ? 38.181  -10.896 31.588  1.00 31.43 ? 93   GLU B CG  1 
ATOM   5207 C CD  . GLU B  1 94  ? 37.604  -9.582  31.083  1.00 33.40 ? 93   GLU B CD  1 
ATOM   5208 O OE1 . GLU B  1 94  ? 36.488  -9.211  31.489  1.00 33.64 ? 93   GLU B OE1 1 
ATOM   5209 O OE2 . GLU B  1 94  ? 38.264  -8.912  30.262  1.00 35.85 ? 93   GLU B OE2 1 
ATOM   5210 N N   . ASP B  1 95  ? 38.234  -13.363 35.803  1.00 30.40 ? 94   ASP B N   1 
ATOM   5211 C CA  . ASP B  1 95  ? 38.097  -13.450 37.268  1.00 30.88 ? 94   ASP B CA  1 
ATOM   5212 C C   . ASP B  1 95  ? 37.568  -12.145 37.888  1.00 30.41 ? 94   ASP B C   1 
ATOM   5213 O O   . ASP B  1 95  ? 38.240  -11.495 38.698  1.00 30.98 ? 94   ASP B O   1 
ATOM   5214 C CB  . ASP B  1 95  ? 39.418  -13.906 37.919  1.00 31.46 ? 94   ASP B CB  1 
ATOM   5215 C CG  . ASP B  1 95  ? 39.263  -14.256 39.400  1.00 33.54 ? 94   ASP B CG  1 
ATOM   5216 O OD1 . ASP B  1 95  ? 38.204  -14.791 39.802  1.00 35.59 ? 94   ASP B OD1 1 
ATOM   5217 O OD2 . ASP B  1 95  ? 40.160  -14.024 40.243  1.00 37.20 ? 94   ASP B OD2 1 
ATOM   5218 N N   . ARG B  1 96  ? 36.356  -11.761 37.489  1.00 29.43 ? 95   ARG B N   1 
ATOM   5219 C CA  . ARG B  1 96  ? 35.769  -10.484 37.886  1.00 28.77 ? 95   ARG B CA  1 
ATOM   5220 C C   . ARG B  1 96  ? 34.317  -10.642 38.323  1.00 27.88 ? 95   ARG B C   1 
ATOM   5221 O O   . ARG B  1 96  ? 33.604  -11.522 37.834  1.00 27.73 ? 95   ARG B O   1 
ATOM   5222 C CB  . ARG B  1 96  ? 35.810  -9.495  36.721  1.00 28.77 ? 95   ARG B CB  1 
ATOM   5223 C CG  . ARG B  1 96  ? 37.141  -8.805  36.485  1.00 30.19 ? 95   ARG B CG  1 
ATOM   5224 C CD  . ARG B  1 96  ? 37.070  -7.761  35.372  1.00 31.74 ? 95   ARG B CD  1 
ATOM   5225 N NE  . ARG B  1 96  ? 38.390  -7.331  34.923  1.00 34.85 ? 95   ARG B NE  1 
ATOM   5226 C CZ  . ARG B  1 96  ? 38.610  -6.582  33.845  1.00 35.42 ? 95   ARG B CZ  1 
ATOM   5227 N NH1 . ARG B  1 96  ? 37.597  -6.165  33.090  1.00 36.37 ? 95   ARG B NH1 1 
ATOM   5228 N NH2 . ARG B  1 96  ? 39.851  -6.241  33.523  1.00 36.74 ? 95   ARG B NH2 1 
ATOM   5229 N N   . ALA B  1 97  ? 33.886  -9.783  39.243  1.00 27.25 ? 96   ALA B N   1 
ATOM   5230 C CA  . ALA B  1 97  ? 32.476  -9.679  39.587  1.00 26.38 ? 96   ALA B CA  1 
ATOM   5231 C C   . ALA B  1 97  ? 31.738  -8.999  38.424  1.00 25.77 ? 96   ALA B C   1 
ATOM   5232 O O   . ALA B  1 97  ? 32.379  -8.430  37.524  1.00 25.65 ? 96   ALA B O   1 
ATOM   5233 C CB  . ALA B  1 97  ? 32.298  -8.896  40.882  1.00 27.36 ? 96   ALA B CB  1 
ATOM   5234 N N   . VAL B  1 98  ? 30.409  -9.063  38.445  1.00 24.40 ? 97   VAL B N   1 
ATOM   5235 C CA  . VAL B  1 98  ? 29.566  -8.404  37.425  1.00 23.83 ? 97   VAL B CA  1 
ATOM   5236 C C   . VAL B  1 98  ? 28.451  -7.647  38.151  1.00 23.55 ? 97   VAL B C   1 
ATOM   5237 O O   . VAL B  1 98  ? 27.441  -8.240  38.544  1.00 24.31 ? 97   VAL B O   1 
ATOM   5238 C CB  . VAL B  1 98  ? 28.974  -9.445  36.456  1.00 23.59 ? 97   VAL B CB  1 
ATOM   5239 C CG1 . VAL B  1 98  ? 28.028  -8.777  35.457  1.00 24.16 ? 97   VAL B CG1 1 
ATOM   5240 C CG2 . VAL B  1 98  ? 30.086  -10.191 35.731  1.00 23.64 ? 97   VAL B CG2 1 
ATOM   5241 N N   . LEU B  1 99  ? 28.639  -6.343  38.339  1.00 23.28 ? 98   LEU B N   1 
ATOM   5242 C CA  . LEU B  1 99  ? 27.819  -5.594  39.293  1.00 23.25 ? 98   LEU B CA  1 
ATOM   5243 C C   . LEU B  1 99  ? 27.233  -4.277  38.799  1.00 23.17 ? 98   LEU B C   1 
ATOM   5244 O O   . LEU B  1 99  ? 27.212  -3.272  39.527  1.00 22.57 ? 98   LEU B O   1 
ATOM   5245 C CB  . LEU B  1 99  ? 28.604  -5.376  40.600  1.00 23.47 ? 98   LEU B CB  1 
ATOM   5246 C CG  . LEU B  1 99  ? 28.736  -6.615  41.504  1.00 23.88 ? 98   LEU B CG  1 
ATOM   5247 C CD1 . LEU B  1 99  ? 29.532  -6.237  42.733  1.00 23.86 ? 98   LEU B CD1 1 
ATOM   5248 C CD2 . LEU B  1 99  ? 27.393  -7.216  41.920  1.00 24.20 ? 98   LEU B CD2 1 
ATOM   5249 N N   . HIS B  1 100 ? 26.719  -4.278  37.569  1.00 22.70 ? 99   HIS B N   1 
ATOM   5250 C CA  . HIS B  1 100 ? 25.923  -3.133  37.138  1.00 22.63 ? 99   HIS B CA  1 
ATOM   5251 C C   . HIS B  1 100 ? 24.704  -2.945  38.069  1.00 22.78 ? 99   HIS B C   1 
ATOM   5252 O O   . HIS B  1 100 ? 24.245  -1.823  38.270  1.00 22.60 ? 99   HIS B O   1 
ATOM   5253 C CB  . HIS B  1 100 ? 25.535  -3.207  35.639  1.00 22.26 ? 99   HIS B CB  1 
ATOM   5254 C CG  . HIS B  1 100 ? 25.172  -4.578  35.159  1.00 21.37 ? 99   HIS B CG  1 
ATOM   5255 N ND1 . HIS B  1 100 ? 26.117  -5.542  34.876  1.00 20.44 ? 99   HIS B ND1 1 
ATOM   5256 C CD2 . HIS B  1 100 ? 23.967  -5.143  34.904  1.00 19.34 ? 99   HIS B CD2 1 
ATOM   5257 C CE1 . HIS B  1 100 ? 25.508  -6.650  34.484  1.00 20.23 ? 99   HIS B CE1 1 
ATOM   5258 N NE2 . HIS B  1 100 ? 24.202  -6.433  34.491  1.00 19.77 ? 99   HIS B NE2 1 
ATOM   5259 N N   . VAL B  1 101 ? 24.233  -4.033  38.687  1.00 23.30 ? 100  VAL B N   1 
ATOM   5260 C CA  . VAL B  1 101 ? 23.112  -3.933  39.633  1.00 23.73 ? 100  VAL B CA  1 
ATOM   5261 C C   . VAL B  1 101 ? 23.467  -3.109  40.887  1.00 23.70 ? 100  VAL B C   1 
ATOM   5262 O O   . VAL B  1 101 ? 22.590  -2.471  41.472  1.00 24.50 ? 100  VAL B O   1 
ATOM   5263 C CB  . VAL B  1 101 ? 22.502  -5.308  40.022  1.00 23.58 ? 100  VAL B CB  1 
ATOM   5264 C CG1 . VAL B  1 101 ? 21.892  -6.011  38.799  1.00 23.96 ? 100  VAL B CG1 1 
ATOM   5265 C CG2 . VAL B  1 101 ? 23.525  -6.208  40.723  1.00 23.92 ? 100  VAL B CG2 1 
ATOM   5266 N N   . ALA B  1 102 ? 24.744  -3.108  41.272  1.00 24.17 ? 101  ALA B N   1 
ATOM   5267 C CA  . ALA B  1 102 ? 25.204  -2.296  42.408  1.00 24.10 ? 101  ALA B CA  1 
ATOM   5268 C C   . ALA B  1 102 ? 25.148  -0.810  42.095  1.00 24.07 ? 101  ALA B C   1 
ATOM   5269 O O   . ALA B  1 102 ? 24.839  0.012   42.962  1.00 23.86 ? 101  ALA B O   1 
ATOM   5270 C CB  . ALA B  1 102 ? 26.618  -2.692  42.828  1.00 24.04 ? 101  ALA B CB  1 
ATOM   5271 N N   . LEU B  1 103 ? 25.431  -0.459  40.840  1.00 23.58 ? 102  LEU B N   1 
ATOM   5272 C CA  . LEU B  1 103 ? 25.436  0.938   40.429  1.00 23.81 ? 102  LEU B CA  1 
ATOM   5273 C C   . LEU B  1 103 ? 24.100  1.644   40.662  1.00 23.61 ? 102  LEU B C   1 
ATOM   5274 O O   . LEU B  1 103 ? 24.066  2.843   40.905  1.00 23.90 ? 102  LEU B O   1 
ATOM   5275 C CB  . LEU B  1 103 ? 25.832  1.061   38.951  1.00 22.99 ? 102  LEU B CB  1 
ATOM   5276 C CG  . LEU B  1 103 ? 27.217  0.542   38.561  1.00 24.07 ? 102  LEU B CG  1 
ATOM   5277 C CD1 . LEU B  1 103 ? 27.340  0.559   37.043  1.00 22.64 ? 102  LEU B CD1 1 
ATOM   5278 C CD2 . LEU B  1 103 ? 28.319  1.390   39.187  1.00 23.30 ? 102  LEU B CD2 1 
ATOM   5279 N N   . ARG B  1 104 ? 23.014  0.888   40.563  1.00 24.46 ? 103  ARG B N   1 
ATOM   5280 C CA  . ARG B  1 104 ? 21.672  1.429   40.729  1.00 24.91 ? 103  ARG B CA  1 
ATOM   5281 C C   . ARG B  1 104 ? 20.974  0.813   41.939  1.00 25.85 ? 103  ARG B C   1 
ATOM   5282 O O   . ARG B  1 104 ? 19.749  0.844   42.016  1.00 26.07 ? 103  ARG B O   1 
ATOM   5283 C CB  . ARG B  1 104 ? 20.829  1.166   39.467  1.00 24.55 ? 103  ARG B CB  1 
ATOM   5284 C CG  . ARG B  1 104 ? 20.687  -0.316  39.107  1.00 23.46 ? 103  ARG B CG  1 
ATOM   5285 C CD  . ARG B  1 104 ? 21.266  -0.697  37.732  1.00 22.63 ? 103  ARG B CD  1 
ATOM   5286 N NE  . ARG B  1 104 ? 20.782  -2.002  37.289  1.00 20.82 ? 103  ARG B NE  1 
ATOM   5287 C CZ  . ARG B  1 104 ? 21.054  -2.558  36.103  1.00 21.05 ? 103  ARG B CZ  1 
ATOM   5288 N NH1 . ARG B  1 104 ? 21.843  -1.928  35.235  1.00 20.84 ? 103  ARG B NH1 1 
ATOM   5289 N NH2 . ARG B  1 104 ? 20.538  -3.741  35.783  1.00 20.50 ? 103  ARG B NH2 1 
ATOM   5290 N N   . ASN B  1 105 ? 21.751  0.243   42.863  1.00 27.08 ? 104  ASN B N   1 
ATOM   5291 C CA  . ASN B  1 105 ? 21.206  -0.380  44.076  1.00 28.17 ? 104  ASN B CA  1 
ATOM   5292 C C   . ASN B  1 105 ? 20.694  0.680   45.065  1.00 28.98 ? 104  ASN B C   1 
ATOM   5293 O O   . ASN B  1 105 ? 21.370  1.033   46.043  1.00 28.83 ? 104  ASN B O   1 
ATOM   5294 C CB  . ASN B  1 105 ? 22.252  -1.321  44.705  1.00 28.20 ? 104  ASN B CB  1 
ATOM   5295 C CG  . ASN B  1 105 ? 21.770  -1.983  46.004  1.00 29.06 ? 104  ASN B CG  1 
ATOM   5296 O OD1 . ASN B  1 105 ? 20.573  -2.173  46.224  1.00 31.43 ? 104  ASN B OD1 1 
ATOM   5297 N ND2 . ASN B  1 105 ? 22.715  -2.326  46.870  1.00 29.15 ? 104  ASN B ND2 1 
ATOM   5298 N N   . ARG B  1 106 ? 19.492  1.190   44.793  1.00 29.79 ? 105  ARG B N   1 
ATOM   5299 C CA  . ARG B  1 106 ? 18.916  2.289   45.568  1.00 31.23 ? 105  ARG B CA  1 
ATOM   5300 C C   . ARG B  1 106 ? 18.608  1.904   47.018  1.00 32.08 ? 105  ARG B C   1 
ATOM   5301 O O   . ARG B  1 106 ? 18.539  2.779   47.882  1.00 32.67 ? 105  ARG B O   1 
ATOM   5302 C CB  . ARG B  1 106 ? 17.639  2.821   44.904  1.00 31.31 ? 105  ARG B CB  1 
ATOM   5303 C CG  . ARG B  1 106 ? 17.766  3.202   43.423  1.00 31.62 ? 105  ARG B CG  1 
ATOM   5304 C CD  . ARG B  1 106 ? 18.861  4.212   43.121  1.00 32.38 ? 105  ARG B CD  1 
ATOM   5305 N NE  . ARG B  1 106 ? 18.555  5.541   43.645  1.00 34.38 ? 105  ARG B NE  1 
ATOM   5306 C CZ  . ARG B  1 106 ? 19.444  6.514   43.813  1.00 34.54 ? 105  ARG B CZ  1 
ATOM   5307 N NH1 . ARG B  1 106 ? 20.718  6.326   43.500  1.00 34.68 ? 105  ARG B NH1 1 
ATOM   5308 N NH2 . ARG B  1 106 ? 19.057  7.690   44.293  1.00 35.64 ? 105  ARG B NH2 1 
ATOM   5309 N N   . SER B  1 107 ? 18.417  0.606   47.260  1.00 32.60 ? 106  SER B N   1 
ATOM   5310 C CA  . SER B  1 107 ? 18.149  0.058   48.596  1.00 33.67 ? 106  SER B CA  1 
ATOM   5311 C C   . SER B  1 107 ? 19.361  0.150   49.534  1.00 33.72 ? 106  SER B C   1 
ATOM   5312 O O   . SER B  1 107 ? 19.218  0.106   50.770  1.00 33.56 ? 106  SER B O   1 
ATOM   5313 C CB  . SER B  1 107 ? 17.692  -1.398  48.483  1.00 33.63 ? 106  SER B CB  1 
ATOM   5314 O OG  . SER B  1 107 ? 18.794  -2.301  48.555  1.00 35.05 ? 106  SER B OG  1 
ATOM   5315 N N   . ASN B  1 108 ? 20.549  0.256   48.935  1.00 33.49 ? 107  ASN B N   1 
ATOM   5316 C CA  . ASN B  1 108 ? 21.830  0.321   49.650  1.00 33.66 ? 107  ASN B CA  1 
ATOM   5317 C C   . ASN B  1 108 ? 22.175  -0.907  50.510  1.00 33.73 ? 107  ASN B C   1 
ATOM   5318 O O   . ASN B  1 108 ? 23.101  -0.864  51.318  1.00 33.87 ? 107  ASN B O   1 
ATOM   5319 C CB  . ASN B  1 108 ? 21.978  1.644   50.431  1.00 33.54 ? 107  ASN B CB  1 
ATOM   5320 C CG  . ASN B  1 108 ? 22.320  2.830   49.527  1.00 33.58 ? 107  ASN B CG  1 
ATOM   5321 O OD1 . ASN B  1 108 ? 23.090  2.701   48.575  1.00 34.64 ? 107  ASN B OD1 1 
ATOM   5322 N ND2 . ASN B  1 108 ? 21.749  3.990   49.826  1.00 33.40 ? 107  ASN B ND2 1 
ATOM   5323 N N   . THR B  1 109 ? 21.460  -2.011  50.300  1.00 33.80 ? 108  THR B N   1 
ATOM   5324 C CA  . THR B  1 109 ? 21.828  -3.292  50.888  1.00 34.18 ? 108  THR B CA  1 
ATOM   5325 C C   . THR B  1 109 ? 23.261  -3.633  50.456  1.00 34.09 ? 108  THR B C   1 
ATOM   5326 O O   . THR B  1 109 ? 23.560  -3.643  49.262  1.00 34.39 ? 108  THR B O   1 
ATOM   5327 C CB  . THR B  1 109 ? 20.830  -4.391  50.455  1.00 34.34 ? 108  THR B CB  1 
ATOM   5328 O OG1 . THR B  1 109 ? 19.501  -3.999  50.827  1.00 34.98 ? 108  THR B OG1 1 
ATOM   5329 C CG2 . THR B  1 109 ? 21.045  -5.678  51.251  1.00 34.61 ? 108  THR B CG2 1 
ATOM   5330 N N   . PRO B  1 110 ? 24.158  -3.867  51.415  1.00 33.93 ? 109  PRO B N   1 
ATOM   5331 C CA  . PRO B  1 110 ? 25.561  -4.162  51.093  1.00 33.50 ? 109  PRO B CA  1 
ATOM   5332 C C   . PRO B  1 110 ? 25.738  -5.245  50.022  1.00 33.21 ? 109  PRO B C   1 
ATOM   5333 O O   . PRO B  1 110 ? 25.055  -6.273  50.032  1.00 33.03 ? 109  PRO B O   1 
ATOM   5334 C CB  . PRO B  1 110 ? 26.132  -4.624  52.433  1.00 33.92 ? 109  PRO B CB  1 
ATOM   5335 C CG  . PRO B  1 110 ? 25.324  -3.859  53.438  1.00 33.91 ? 109  PRO B CG  1 
ATOM   5336 C CD  . PRO B  1 110 ? 23.924  -3.841  52.874  1.00 34.16 ? 109  PRO B CD  1 
ATOM   5337 N N   . ILE B  1 111 ? 26.639  -4.978  49.083  1.00 32.45 ? 110  ILE B N   1 
ATOM   5338 C CA  . ILE B  1 111 ? 27.055  -5.958  48.096  1.00 32.37 ? 110  ILE B CA  1 
ATOM   5339 C C   . ILE B  1 111 ? 28.573  -6.014  48.170  1.00 32.33 ? 110  ILE B C   1 
ATOM   5340 O O   . ILE B  1 111 ? 29.255  -5.004  47.959  1.00 31.64 ? 110  ILE B O   1 
ATOM   5341 C CB  . ILE B  1 111 ? 26.576  -5.567  46.666  1.00 32.53 ? 110  ILE B CB  1 
ATOM   5342 C CG1 . ILE B  1 111 ? 25.052  -5.393  46.621  1.00 32.72 ? 110  ILE B CG1 1 
ATOM   5343 C CG2 . ILE B  1 111 ? 27.041  -6.608  45.655  1.00 31.73 ? 110  ILE B CG2 1 
ATOM   5344 C CD1 . ILE B  1 111 ? 24.517  -4.821  45.309  1.00 33.64 ? 110  ILE B CD1 1 
ATOM   5345 N N   . LYS B  1 112 ? 29.098  -7.191  48.483  1.00 33.00 ? 111  LYS B N   1 
ATOM   5346 C CA  . LYS B  1 112 ? 30.523  -7.317  48.779  1.00 34.04 ? 111  LYS B CA  1 
ATOM   5347 C C   . LYS B  1 112 ? 31.345  -7.921  47.655  1.00 34.30 ? 111  LYS B C   1 
ATOM   5348 O O   . LYS B  1 112 ? 30.974  -8.945  47.071  1.00 34.28 ? 111  LYS B O   1 
ATOM   5349 C CB  . LYS B  1 112 ? 30.737  -8.135  50.055  1.00 34.01 ? 111  LYS B CB  1 
ATOM   5350 C CG  . LYS B  1 112 ? 30.413  -7.393  51.333  1.00 35.59 ? 111  LYS B CG  1 
ATOM   5351 C CD  . LYS B  1 112 ? 30.748  -8.258  52.551  1.00 37.51 ? 111  LYS B CD  1 
ATOM   5352 C CE  . LYS B  1 112 ? 30.005  -7.784  53.792  1.00 39.58 ? 111  LYS B CE  1 
ATOM   5353 N NZ  . LYS B  1 112 ? 28.536  -8.019  53.685  1.00 42.48 ? 111  LYS B NZ  1 
ATOM   5354 N N   . VAL B  1 113 ? 32.473  -7.274  47.374  1.00 35.04 ? 112  VAL B N   1 
ATOM   5355 C CA  . VAL B  1 113 ? 33.506  -7.822  46.500  1.00 35.77 ? 112  VAL B CA  1 
ATOM   5356 C C   . VAL B  1 113 ? 34.799  -7.874  47.307  1.00 36.30 ? 112  VAL B C   1 
ATOM   5357 O O   . VAL B  1 113 ? 35.233  -6.855  47.858  1.00 36.28 ? 112  VAL B O   1 
ATOM   5358 C CB  . VAL B  1 113 ? 33.711  -6.957  45.234  1.00 35.88 ? 112  VAL B CB  1 
ATOM   5359 C CG1 . VAL B  1 113 ? 34.830  -7.523  44.356  1.00 36.42 ? 112  VAL B CG1 1 
ATOM   5360 C CG2 . VAL B  1 113 ? 32.436  -6.883  44.446  1.00 35.61 ? 112  VAL B CG2 1 
ATOM   5361 N N   . ASP B  1 114 ? 35.400  -9.061  47.364  1.00 37.05 ? 113  ASP B N   1 
ATOM   5362 C CA  . ASP B  1 114 ? 36.582  -9.321  48.195  1.00 37.88 ? 113  ASP B CA  1 
ATOM   5363 C C   . ASP B  1 114 ? 36.325  -8.910  49.653  1.00 38.09 ? 113  ASP B C   1 
ATOM   5364 O O   . ASP B  1 114 ? 37.187  -8.314  50.308  1.00 38.67 ? 113  ASP B O   1 
ATOM   5365 C CB  . ASP B  1 114 ? 37.834  -8.618  47.631  1.00 37.98 ? 113  ASP B CB  1 
ATOM   5366 C CG  . ASP B  1 114 ? 38.132  -9.002  46.180  1.00 38.37 ? 113  ASP B CG  1 
ATOM   5367 O OD1 . ASP B  1 114 ? 38.064  -10.206 45.841  1.00 37.41 ? 113  ASP B OD1 1 
ATOM   5368 O OD2 . ASP B  1 114 ? 38.453  -8.157  45.315  1.00 39.02 ? 113  ASP B OD2 1 
ATOM   5369 N N   . GLY B  1 115 ? 35.120  -9.210  50.135  1.00 38.09 ? 114  GLY B N   1 
ATOM   5370 C CA  . GLY B  1 115 ? 34.728  -8.937  51.509  1.00 37.95 ? 114  GLY B CA  1 
ATOM   5371 C C   . GLY B  1 115 ? 34.445  -7.485  51.863  1.00 37.64 ? 114  GLY B C   1 
ATOM   5372 O O   . GLY B  1 115 ? 34.180  -7.172  53.034  1.00 38.22 ? 114  GLY B O   1 
ATOM   5373 N N   . LYS B  1 116 ? 34.505  -6.595  50.876  1.00 36.91 ? 115  LYS B N   1 
ATOM   5374 C CA  . LYS B  1 116 ? 34.244  -5.177  51.113  1.00 36.12 ? 115  LYS B CA  1 
ATOM   5375 C C   . LYS B  1 116 ? 32.987  -4.727  50.379  1.00 35.31 ? 115  LYS B C   1 
ATOM   5376 O O   . LYS B  1 116 ? 32.815  -5.032  49.198  1.00 34.96 ? 115  LYS B O   1 
ATOM   5377 C CB  . LYS B  1 116 ? 35.450  -4.321  50.689  1.00 36.73 ? 115  LYS B CB  1 
ATOM   5378 C CG  . LYS B  1 116 ? 35.339  -2.842  51.076  1.00 38.70 ? 115  LYS B CG  1 
ATOM   5379 C CD  . LYS B  1 116 ? 36.705  -2.147  51.124  1.00 42.45 ? 115  LYS B CD  1 
ATOM   5380 C CE  . LYS B  1 116 ? 37.308  -2.187  52.529  1.00 44.16 ? 115  LYS B CE  1 
ATOM   5381 N NZ  . LYS B  1 116 ? 38.756  -1.801  52.530  1.00 46.30 ? 115  LYS B NZ  1 
ATOM   5382 N N   . ASP B  1 117 ? 32.120  -4.007  51.093  1.00 34.06 ? 116  ASP B N   1 
ATOM   5383 C CA  . ASP B  1 117 ? 30.896  -3.432  50.531  1.00 32.94 ? 116  ASP B CA  1 
ATOM   5384 C C   . ASP B  1 117 ? 31.234  -2.351  49.500  1.00 32.25 ? 116  ASP B C   1 
ATOM   5385 O O   . ASP B  1 117 ? 32.014  -1.431  49.776  1.00 31.83 ? 116  ASP B O   1 
ATOM   5386 C CB  . ASP B  1 117 ? 30.024  -2.863  51.660  1.00 32.74 ? 116  ASP B CB  1 
ATOM   5387 C CG  . ASP B  1 117 ? 28.700  -2.278  51.168  1.00 33.04 ? 116  ASP B CG  1 
ATOM   5388 O OD1 . ASP B  1 117 ? 28.312  -2.490  49.991  1.00 31.93 ? 116  ASP B OD1 1 
ATOM   5389 O OD2 . ASP B  1 117 ? 27.963  -1.589  51.905  1.00 31.98 ? 116  ASP B OD2 1 
ATOM   5390 N N   . VAL B  1 118 ? 30.652  -2.473  48.309  1.00 31.22 ? 117  VAL B N   1 
ATOM   5391 C CA  . VAL B  1 118 ? 30.918  -1.516  47.224  1.00 30.75 ? 117  VAL B CA  1 
ATOM   5392 C C   . VAL B  1 118 ? 30.016  -0.278  47.248  1.00 30.13 ? 117  VAL B C   1 
ATOM   5393 O O   . VAL B  1 118 ? 30.318  0.725   46.603  1.00 30.55 ? 117  VAL B O   1 
ATOM   5394 C CB  . VAL B  1 118 ? 30.857  -2.194  45.823  1.00 30.51 ? 117  VAL B CB  1 
ATOM   5395 C CG1 . VAL B  1 118 ? 31.833  -3.367  45.759  1.00 31.27 ? 117  VAL B CG1 1 
ATOM   5396 C CG2 . VAL B  1 118 ? 29.429  -2.639  45.479  1.00 30.70 ? 117  VAL B CG2 1 
ATOM   5397 N N   . MET B  1 119 ? 28.921  -0.337  47.999  1.00 29.64 ? 118  MET B N   1 
ATOM   5398 C CA  . MET B  1 119 ? 27.958  0.763   48.013  1.00 29.35 ? 118  MET B CA  1 
ATOM   5399 C C   . MET B  1 119 ? 28.490  2.147   48.432  1.00 29.58 ? 118  MET B C   1 
ATOM   5400 O O   . MET B  1 119 ? 28.157  3.133   47.784  1.00 29.42 ? 118  MET B O   1 
ATOM   5401 C CB  . MET B  1 119 ? 26.679  0.391   48.779  1.00 29.07 ? 118  MET B CB  1 
ATOM   5402 C CG  . MET B  1 119 ? 25.869  -0.719  48.122  1.00 28.50 ? 118  MET B CG  1 
ATOM   5403 S SD  . MET B  1 119 ? 25.703  -0.549  46.290  1.00 26.54 ? 118  MET B SD  1 
ATOM   5404 C CE  . MET B  1 119 ? 24.854  0.978   46.177  1.00 24.95 ? 118  MET B CE  1 
ATOM   5405 N N   . PRO B  1 120 ? 29.300  2.250   49.497  1.00 30.13 ? 119  PRO B N   1 
ATOM   5406 C CA  . PRO B  1 120 ? 29.882  3.550   49.858  1.00 30.24 ? 119  PRO B CA  1 
ATOM   5407 C C   . PRO B  1 120 ? 30.602  4.253   48.690  1.00 30.34 ? 119  PRO B C   1 
ATOM   5408 O O   . PRO B  1 120 ? 30.402  5.466   48.502  1.00 30.45 ? 119  PRO B O   1 
ATOM   5409 C CB  . PRO B  1 120 ? 30.863  3.193   50.989  1.00 30.37 ? 119  PRO B CB  1 
ATOM   5410 C CG  . PRO B  1 120 ? 30.273  1.970   51.609  1.00 30.26 ? 119  PRO B CG  1 
ATOM   5411 C CD  . PRO B  1 120 ? 29.694  1.192   50.451  1.00 30.59 ? 119  PRO B CD  1 
ATOM   5412 N N   . GLU B  1 121 ? 31.392  3.502   47.920  1.00 30.01 ? 120  GLU B N   1 
ATOM   5413 C CA  . GLU B  1 121 ? 32.110  4.037   46.762  1.00 30.38 ? 120  GLU B CA  1 
ATOM   5414 C C   . GLU B  1 121 ? 31.185  4.396   45.589  1.00 29.57 ? 120  GLU B C   1 
ATOM   5415 O O   . GLU B  1 121 ? 31.343  5.449   44.978  1.00 29.28 ? 120  GLU B O   1 
ATOM   5416 C CB  . GLU B  1 121 ? 33.222  3.083   46.308  1.00 30.69 ? 120  GLU B CB  1 
ATOM   5417 C CG  . GLU B  1 121 ? 34.538  3.251   47.073  1.00 34.02 ? 120  GLU B CG  1 
ATOM   5418 C CD  . GLU B  1 121 ? 35.046  4.687   47.073  1.00 37.35 ? 120  GLU B CD  1 
ATOM   5419 O OE1 . GLU B  1 121 ? 34.889  5.381   48.108  1.00 38.66 ? 120  GLU B OE1 1 
ATOM   5420 O OE2 . GLU B  1 121 ? 35.595  5.125   46.034  1.00 39.19 ? 120  GLU B OE2 1 
ATOM   5421 N N   . VAL B  1 122 ? 30.215  3.529   45.300  1.00 29.08 ? 121  VAL B N   1 
ATOM   5422 C CA  . VAL B  1 122 ? 29.165  3.849   44.321  1.00 28.46 ? 121  VAL B CA  1 
ATOM   5423 C C   . VAL B  1 122 ? 28.487  5.175   44.678  1.00 28.15 ? 121  VAL B C   1 
ATOM   5424 O O   . VAL B  1 122 ? 28.286  6.037   43.818  1.00 27.94 ? 121  VAL B O   1 
ATOM   5425 C CB  . VAL B  1 122 ? 28.088  2.730   44.225  1.00 28.23 ? 121  VAL B CB  1 
ATOM   5426 C CG1 . VAL B  1 122 ? 26.869  3.194   43.421  1.00 28.84 ? 121  VAL B CG1 1 
ATOM   5427 C CG2 . VAL B  1 122 ? 28.668  1.459   43.628  1.00 28.38 ? 121  VAL B CG2 1 
ATOM   5428 N N   . ASN B  1 123 ? 28.144  5.348   45.953  1.00 28.29 ? 122  ASN B N   1 
ATOM   5429 C CA  . ASN B  1 123 ? 27.400  6.534   46.368  1.00 28.28 ? 122  ASN B CA  1 
ATOM   5430 C C   . ASN B  1 123 ? 28.229  7.812   46.408  1.00 28.08 ? 122  ASN B C   1 
ATOM   5431 O O   . ASN B  1 123 ? 27.704  8.903   46.193  1.00 27.52 ? 122  ASN B O   1 
ATOM   5432 C CB  . ASN B  1 123 ? 26.702  6.292   47.701  1.00 28.58 ? 122  ASN B CB  1 
ATOM   5433 C CG  . ASN B  1 123 ? 25.571  5.294   47.583  1.00 29.90 ? 122  ASN B CG  1 
ATOM   5434 O OD1 . ASN B  1 123 ? 24.845  5.279   46.585  1.00 31.75 ? 122  ASN B OD1 1 
ATOM   5435 N ND2 . ASN B  1 123 ? 25.429  4.436   48.585  1.00 28.63 ? 122  ASN B ND2 1 
ATOM   5436 N N   . ARG B  1 124 ? 29.525  7.657   46.666  1.00 28.13 ? 123  ARG B N   1 
ATOM   5437 C CA  . ARG B  1 124 ? 30.457  8.773   46.657  1.00 28.84 ? 123  ARG B CA  1 
ATOM   5438 C C   . ARG B  1 124 ? 30.591  9.362   45.251  1.00 28.24 ? 123  ARG B C   1 
ATOM   5439 O O   . ARG B  1 124 ? 30.496  10.584  45.070  1.00 28.25 ? 123  ARG B O   1 
ATOM   5440 C CB  . ARG B  1 124 ? 31.822  8.333   47.195  1.00 29.32 ? 123  ARG B CB  1 
ATOM   5441 C CG  . ARG B  1 124 ? 32.677  9.482   47.724  1.00 32.18 ? 123  ARG B CG  1 
ATOM   5442 C CD  . ARG B  1 124 ? 34.174  9.240   47.643  1.00 37.49 ? 123  ARG B CD  1 
ATOM   5443 N NE  . ARG B  1 124 ? 34.710  9.754   46.385  1.00 42.12 ? 123  ARG B NE  1 
ATOM   5444 C CZ  . ARG B  1 124 ? 35.344  9.022   45.476  1.00 42.92 ? 123  ARG B CZ  1 
ATOM   5445 N NH1 . ARG B  1 124 ? 35.558  7.728   45.672  1.00 43.85 ? 123  ARG B NH1 1 
ATOM   5446 N NH2 . ARG B  1 124 ? 35.776  9.597   44.366  1.00 43.64 ? 123  ARG B NH2 1 
ATOM   5447 N N   . VAL B  1 125 ? 30.790  8.493   44.256  1.00 27.78 ? 124  VAL B N   1 
ATOM   5448 C CA  . VAL B  1 125 ? 30.841  8.942   42.857  1.00 27.13 ? 124  VAL B CA  1 
ATOM   5449 C C   . VAL B  1 125 ? 29.526  9.604   42.421  1.00 26.62 ? 124  VAL B C   1 
ATOM   5450 O O   . VAL B  1 125 ? 29.548  10.636  41.760  1.00 26.57 ? 124  VAL B O   1 
ATOM   5451 C CB  . VAL B  1 125 ? 31.235  7.807   41.881  1.00 26.99 ? 124  VAL B CB  1 
ATOM   5452 C CG1 . VAL B  1 125 ? 31.208  8.305   40.433  1.00 26.90 ? 124  VAL B CG1 1 
ATOM   5453 C CG2 . VAL B  1 125 ? 32.634  7.285   42.209  1.00 27.84 ? 124  VAL B CG2 1 
ATOM   5454 N N   . LEU B  1 126 ? 28.387  9.021   42.801  1.00 26.86 ? 125  LEU B N   1 
ATOM   5455 C CA  . LEU B  1 126 ? 27.091  9.636   42.488  1.00 26.67 ? 125  LEU B CA  1 
ATOM   5456 C C   . LEU B  1 126 ? 26.947  11.025  43.108  1.00 27.32 ? 125  LEU B C   1 
ATOM   5457 O O   . LEU B  1 126 ? 26.380  11.936  42.497  1.00 26.83 ? 125  LEU B O   1 
ATOM   5458 C CB  . LEU B  1 126 ? 25.917  8.729   42.900  1.00 26.38 ? 125  LEU B CB  1 
ATOM   5459 C CG  . LEU B  1 126 ? 25.676  7.438   42.099  1.00 26.48 ? 125  LEU B CG  1 
ATOM   5460 C CD1 . LEU B  1 126 ? 24.696  6.524   42.816  1.00 25.82 ? 125  LEU B CD1 1 
ATOM   5461 C CD2 . LEU B  1 126 ? 25.174  7.738   40.676  1.00 25.72 ? 125  LEU B CD2 1 
ATOM   5462 N N   . ASP B  1 127 ? 27.454  11.180  44.331  1.00 28.19 ? 126  ASP B N   1 
ATOM   5463 C CA  . ASP B  1 127 ? 27.436  12.479  45.004  1.00 29.31 ? 126  ASP B CA  1 
ATOM   5464 C C   . ASP B  1 127 ? 28.292  13.513  44.280  1.00 28.87 ? 126  ASP B C   1 
ATOM   5465 O O   . ASP B  1 127 ? 27.891  14.664  44.141  1.00 28.81 ? 126  ASP B O   1 
ATOM   5466 C CB  . ASP B  1 127 ? 27.908  12.334  46.448  1.00 30.09 ? 126  ASP B CB  1 
ATOM   5467 C CG  . ASP B  1 127 ? 26.844  11.737  47.353  1.00 32.28 ? 126  ASP B CG  1 
ATOM   5468 O OD1 . ASP B  1 127 ? 27.216  11.186  48.412  1.00 35.64 ? 126  ASP B OD1 1 
ATOM   5469 O OD2 . ASP B  1 127 ? 25.619  11.778  47.105  1.00 34.49 ? 126  ASP B OD2 1 
ATOM   5470 N N   . LYS B  1 128 ? 29.470  13.094  43.831  1.00 28.94 ? 127  LYS B N   1 
ATOM   5471 C CA  . LYS B  1 128 ? 30.339  13.940  43.013  1.00 29.53 ? 127  LYS B CA  1 
ATOM   5472 C C   . LYS B  1 128 ? 29.677  14.333  41.686  1.00 28.72 ? 127  LYS B C   1 
ATOM   5473 O O   . LYS B  1 128 ? 29.773  15.485  41.254  1.00 28.88 ? 127  LYS B O   1 
ATOM   5474 C CB  . LYS B  1 128 ? 31.674  13.235  42.757  1.00 29.79 ? 127  LYS B CB  1 
ATOM   5475 C CG  . LYS B  1 128 ? 32.860  14.179  42.682  1.00 33.33 ? 127  LYS B CG  1 
ATOM   5476 C CD  . LYS B  1 128 ? 33.228  14.498  41.249  1.00 37.11 ? 127  LYS B CD  1 
ATOM   5477 C CE  . LYS B  1 128 ? 34.536  15.274  41.195  1.00 37.93 ? 127  LYS B CE  1 
ATOM   5478 N NZ  . LYS B  1 128 ? 34.369  16.647  40.627  1.00 39.04 ? 127  LYS B NZ  1 
ATOM   5479 N N   . MET B  1 129 ? 29.010  13.373  41.044  1.00 28.41 ? 128  MET B N   1 
ATOM   5480 C CA  . MET B  1 129 ? 28.231  13.644  39.826  1.00 27.80 ? 128  MET B CA  1 
ATOM   5481 C C   . MET B  1 129 ? 27.167  14.731  40.059  1.00 27.32 ? 128  MET B C   1 
ATOM   5482 O O   . MET B  1 129 ? 27.054  15.674  39.282  1.00 26.64 ? 128  MET B O   1 
ATOM   5483 C CB  . MET B  1 129 ? 27.569  12.361  39.299  1.00 27.95 ? 128  MET B CB  1 
ATOM   5484 C CG  . MET B  1 129 ? 28.545  11.286  38.810  1.00 28.72 ? 128  MET B CG  1 
ATOM   5485 S SD  . MET B  1 129 ? 27.756  9.717   38.289  1.00 30.84 ? 128  MET B SD  1 
ATOM   5486 C CE  . MET B  1 129 ? 26.639  10.335  36.997  1.00 29.81 ? 128  MET B CE  1 
ATOM   5487 N N   . LYS B  1 130 ? 26.394  14.588  41.136  1.00 27.47 ? 129  LYS B N   1 
ATOM   5488 C CA  . LYS B  1 130 ? 25.405  15.589  41.549  1.00 27.39 ? 129  LYS B CA  1 
ATOM   5489 C C   . LYS B  1 130 ? 26.014  16.996  41.687  1.00 27.18 ? 129  LYS B C   1 
ATOM   5490 O O   . LYS B  1 130 ? 25.468  17.968  41.159  1.00 26.61 ? 129  LYS B O   1 
ATOM   5491 C CB  . LYS B  1 130 ? 24.733  15.162  42.869  1.00 27.52 ? 129  LYS B CB  1 
ATOM   5492 C CG  . LYS B  1 130 ? 23.481  15.970  43.235  1.00 28.91 ? 129  LYS B CG  1 
ATOM   5493 C CD  . LYS B  1 130 ? 22.769  15.359  44.431  1.00 30.47 ? 129  LYS B CD  1 
ATOM   5494 C CE  . LYS B  1 130 ? 22.042  16.409  45.249  1.00 33.25 ? 129  LYS B CE  1 
ATOM   5495 N NZ  . LYS B  1 130 ? 20.846  15.829  45.932  1.00 35.48 ? 129  LYS B NZ  1 
ATOM   5496 N N   . SER B  1 131 ? 27.153  17.089  42.370  1.00 27.49 ? 130  SER B N   1 
ATOM   5497 C CA  . SER B  1 131 ? 27.849  18.369  42.572  1.00 27.58 ? 130  SER B CA  1 
ATOM   5498 C C   . SER B  1 131 ? 28.260  18.986  41.232  1.00 27.62 ? 130  SER B C   1 
ATOM   5499 O O   . SER B  1 131 ? 28.041  20.176  40.968  1.00 26.84 ? 130  SER B O   1 
ATOM   5500 C CB  . SER B  1 131 ? 29.085  18.172  43.470  1.00 28.15 ? 130  SER B CB  1 
ATOM   5501 O OG  A SER B  1 131 ? 28.736  17.608  44.728  0.50 28.31 ? 130  SER B OG  1 
ATOM   5502 O OG  B SER B  1 131 ? 29.777  19.388  43.670  0.50 27.82 ? 130  SER B OG  1 
ATOM   5503 N N   . PHE B  1 132 ? 28.849  18.147  40.388  1.00 27.76 ? 131  PHE B N   1 
ATOM   5504 C CA  . PHE B  1 132 ? 29.251  18.535  39.051  1.00 28.16 ? 131  PHE B CA  1 
ATOM   5505 C C   . PHE B  1 132 ? 28.070  19.080  38.239  1.00 27.58 ? 131  PHE B C   1 
ATOM   5506 O O   . PHE B  1 132 ? 28.165  20.145  37.633  1.00 27.11 ? 131  PHE B O   1 
ATOM   5507 C CB  . PHE B  1 132 ? 29.897  17.338  38.358  1.00 28.54 ? 131  PHE B CB  1 
ATOM   5508 C CG  . PHE B  1 132 ? 30.748  17.710  37.200  1.00 31.84 ? 131  PHE B CG  1 
ATOM   5509 C CD1 . PHE B  1 132 ? 32.095  18.007  37.380  1.00 34.58 ? 131  PHE B CD1 1 
ATOM   5510 C CD2 . PHE B  1 132 ? 30.206  17.770  35.914  1.00 34.71 ? 131  PHE B CD2 1 
ATOM   5511 C CE1 . PHE B  1 132 ? 32.894  18.358  36.293  1.00 36.18 ? 131  PHE B CE1 1 
ATOM   5512 C CE2 . PHE B  1 132 ? 30.996  18.123  34.821  1.00 35.36 ? 131  PHE B CE2 1 
ATOM   5513 C CZ  . PHE B  1 132 ? 32.343  18.420  35.013  1.00 36.80 ? 131  PHE B CZ  1 
ATOM   5514 N N   . CYS B  1 133 ? 26.952  18.358  38.255  1.00 27.33 ? 132  CYS B N   1 
ATOM   5515 C CA  . CYS B  1 133 ? 25.730  18.820  37.604  1.00 27.31 ? 132  CYS B CA  1 
ATOM   5516 C C   . CYS B  1 133 ? 25.217  20.178  38.095  1.00 27.24 ? 132  CYS B C   1 
ATOM   5517 O O   . CYS B  1 133 ? 24.844  21.021  37.282  1.00 26.57 ? 132  CYS B O   1 
ATOM   5518 C CB  . CYS B  1 133 ? 24.638  17.763  37.711  1.00 27.40 ? 132  CYS B CB  1 
ATOM   5519 S SG  . CYS B  1 133 ? 25.036  16.314  36.711  1.00 29.59 ? 132  CYS B SG  1 
ATOM   5520 N N   . GLN B  1 134 ? 25.185  20.386  39.414  1.00 27.08 ? 133  GLN B N   1 
ATOM   5521 C CA  . GLN B  1 134 ? 24.811  21.695  39.964  1.00 27.12 ? 133  GLN B CA  1 
ATOM   5522 C C   . GLN B  1 134 ? 25.714  22.797  39.404  1.00 26.59 ? 133  GLN B C   1 
ATOM   5523 O O   . GLN B  1 134 ? 25.233  23.851  39.005  1.00 27.08 ? 133  GLN B O   1 
ATOM   5524 C CB  . GLN B  1 134 ? 24.879  21.705  41.498  1.00 27.79 ? 133  GLN B CB  1 
ATOM   5525 C CG  . GLN B  1 134 ? 24.371  23.023  42.167  1.00 28.84 ? 133  GLN B CG  1 
ATOM   5526 C CD  . GLN B  1 134 ? 25.394  24.167  42.142  1.00 30.11 ? 133  GLN B CD  1 
ATOM   5527 O OE1 . GLN B  1 134 ? 26.596  23.941  42.315  1.00 31.04 ? 133  GLN B OE1 1 
ATOM   5528 N NE2 . GLN B  1 134 ? 24.915  25.390  41.924  1.00 31.66 ? 133  GLN B NE2 1 
ATOM   5529 N N   . ARG B  1 135 ? 27.015  22.547  39.389  1.00 26.13 ? 134  ARG B N   1 
ATOM   5530 C CA  . ARG B  1 135 ? 27.981  23.570  38.990  1.00 25.98 ? 134  ARG B CA  1 
ATOM   5531 C C   . ARG B  1 135 ? 27.808  23.958  37.527  1.00 25.70 ? 134  ARG B C   1 
ATOM   5532 O O   . ARG B  1 135 ? 27.724  25.132  37.195  1.00 25.02 ? 134  ARG B O   1 
ATOM   5533 C CB  . ARG B  1 135 ? 29.408  23.101  39.269  1.00 26.18 ? 134  ARG B CB  1 
ATOM   5534 C CG  . ARG B  1 135 ? 29.803  23.179  40.747  1.00 27.13 ? 134  ARG B CG  1 
ATOM   5535 C CD  . ARG B  1 135 ? 30.822  24.284  41.077  1.00 27.96 ? 134  ARG B CD  1 
ATOM   5536 N NE  . ARG B  1 135 ? 32.058  24.130  40.306  1.00 28.44 ? 134  ARG B NE  1 
ATOM   5537 C CZ  . ARG B  1 135 ? 32.768  25.130  39.790  1.00 29.75 ? 134  ARG B CZ  1 
ATOM   5538 N NH1 . ARG B  1 135 ? 32.410  26.401  39.985  1.00 28.32 ? 134  ARG B NH1 1 
ATOM   5539 N NH2 . ARG B  1 135 ? 33.866  24.857  39.088  1.00 29.76 ? 134  ARG B NH2 1 
ATOM   5540 N N   . VAL B  1 136 ? 27.719  22.957  36.657  1.00 25.50 ? 135  VAL B N   1 
ATOM   5541 C CA  . VAL B  1 136 ? 27.609  23.223  35.226  1.00 25.97 ? 135  VAL B CA  1 
ATOM   5542 C C   . VAL B  1 136 ? 26.238  23.802  34.842  1.00 25.80 ? 135  VAL B C   1 
ATOM   5543 O O   . VAL B  1 136 ? 26.163  24.829  34.165  1.00 25.31 ? 135  VAL B O   1 
ATOM   5544 C CB  . VAL B  1 136 ? 27.929  21.963  34.383  1.00 25.84 ? 135  VAL B CB  1 
ATOM   5545 C CG1 . VAL B  1 136 ? 27.667  22.222  32.905  1.00 27.57 ? 135  VAL B CG1 1 
ATOM   5546 C CG2 . VAL B  1 136 ? 29.385  21.505  34.607  1.00 25.62 ? 135  VAL B CG2 1 
ATOM   5547 N N   . ARG B  1 137 ? 25.161  23.141  35.273  1.00 25.83 ? 136  ARG B N   1 
ATOM   5548 C CA  . ARG B  1 137 ? 23.803  23.536  34.901  1.00 26.56 ? 136  ARG B CA  1 
ATOM   5549 C C   . ARG B  1 137 ? 23.390  24.922  35.418  1.00 27.04 ? 136  ARG B C   1 
ATOM   5550 O O   . ARG B  1 137 ? 22.640  25.631  34.751  1.00 27.62 ? 136  ARG B O   1 
ATOM   5551 C CB  . ARG B  1 137 ? 22.784  22.466  35.328  1.00 26.21 ? 136  ARG B CB  1 
ATOM   5552 C CG  . ARG B  1 137 ? 22.926  21.138  34.556  1.00 26.57 ? 136  ARG B CG  1 
ATOM   5553 C CD  . ARG B  1 137 ? 22.084  19.999  35.104  1.00 23.79 ? 136  ARG B CD  1 
ATOM   5554 N NE  . ARG B  1 137 ? 20.661  20.341  35.189  1.00 25.88 ? 136  ARG B NE  1 
ATOM   5555 C CZ  . ARG B  1 137 ? 19.786  20.182  34.191  1.00 27.02 ? 136  ARG B CZ  1 
ATOM   5556 N NH1 . ARG B  1 137 ? 20.182  19.699  33.021  1.00 26.83 ? 136  ARG B NH1 1 
ATOM   5557 N NH2 . ARG B  1 137 ? 18.513  20.509  34.366  1.00 27.21 ? 136  ARG B NH2 1 
ATOM   5558 N N   . SER B  1 138 ? 23.891  25.305  36.591  1.00 27.62 ? 137  SER B N   1 
ATOM   5559 C CA  . SER B  1 138 ? 23.556  26.599  37.193  1.00 27.59 ? 137  SER B CA  1 
ATOM   5560 C C   . SER B  1 138 ? 24.238  27.763  36.475  1.00 27.88 ? 137  SER B C   1 
ATOM   5561 O O   . SER B  1 138 ? 23.756  28.905  36.514  1.00 28.10 ? 137  SER B O   1 
ATOM   5562 C CB  . SER B  1 138 ? 23.947  26.609  38.673  1.00 27.38 ? 137  SER B CB  1 
ATOM   5563 O OG  . SER B  1 138 ? 25.356  26.552  38.824  1.00 27.07 ? 137  SER B OG  1 
ATOM   5564 N N   . GLY B  1 139 ? 25.358  27.463  35.818  1.00 27.37 ? 138  GLY B N   1 
ATOM   5565 C CA  . GLY B  1 139 ? 26.171  28.482  35.178  1.00 27.29 ? 138  GLY B CA  1 
ATOM   5566 C C   . GLY B  1 139 ? 27.342  28.899  36.054  1.00 26.44 ? 138  GLY B C   1 
ATOM   5567 O O   . GLY B  1 139 ? 28.136  29.743  35.659  1.00 27.09 ? 138  GLY B O   1 
ATOM   5568 N N   . ASP B  1 140 ? 27.471  28.296  37.230  1.00 26.36 ? 139  ASP B N   1 
ATOM   5569 C CA  . ASP B  1 140 ? 28.559  28.645  38.149  1.00 26.09 ? 139  ASP B CA  1 
ATOM   5570 C C   . ASP B  1 140 ? 29.940  28.169  37.691  1.00 25.70 ? 139  ASP B C   1 
ATOM   5571 O O   . ASP B  1 140 ? 30.950  28.788  38.023  1.00 25.22 ? 139  ASP B O   1 
ATOM   5572 C CB  . ASP B  1 140 ? 28.262  28.132  39.555  1.00 26.04 ? 139  ASP B CB  1 
ATOM   5573 C CG  . ASP B  1 140 ? 27.096  28.859  40.203  1.00 27.03 ? 139  ASP B CG  1 
ATOM   5574 O OD1 . ASP B  1 140 ? 26.685  29.928  39.689  1.00 27.35 ? 139  ASP B OD1 1 
ATOM   5575 O OD2 . ASP B  1 140 ? 26.523  28.425  41.228  1.00 27.28 ? 139  ASP B OD2 1 
ATOM   5576 N N   . TRP B  1 141 ? 29.984  27.064  36.942  1.00 24.97 ? 140  TRP B N   1 
ATOM   5577 C CA  . TRP B  1 141 ? 31.230  26.599  36.330  1.00 24.51 ? 140  TRP B CA  1 
ATOM   5578 C C   . TRP B  1 141 ? 31.531  27.472  35.130  1.00 24.29 ? 140  TRP B C   1 
ATOM   5579 O O   . TRP B  1 141 ? 30.759  27.494  34.171  1.00 24.48 ? 140  TRP B O   1 
ATOM   5580 C CB  . TRP B  1 141 ? 31.095  25.139  35.866  1.00 24.29 ? 140  TRP B CB  1 
ATOM   5581 C CG  . TRP B  1 141 ? 32.351  24.554  35.251  1.00 23.25 ? 140  TRP B CG  1 
ATOM   5582 C CD1 . TRP B  1 141 ? 33.022  25.003  34.139  1.00 24.47 ? 140  TRP B CD1 1 
ATOM   5583 C CD2 . TRP B  1 141 ? 33.063  23.407  35.705  1.00 25.20 ? 140  TRP B CD2 1 
ATOM   5584 N NE1 . TRP B  1 141 ? 34.111  24.205  33.888  1.00 24.90 ? 140  TRP B NE1 1 
ATOM   5585 C CE2 . TRP B  1 141 ? 34.162  23.216  34.834  1.00 25.89 ? 140  TRP B CE2 1 
ATOM   5586 C CE3 . TRP B  1 141 ? 32.890  22.513  36.768  1.00 25.60 ? 140  TRP B CE3 1 
ATOM   5587 C CZ2 . TRP B  1 141 ? 35.080  22.169  34.994  1.00 27.66 ? 140  TRP B CZ2 1 
ATOM   5588 C CZ3 . TRP B  1 141 ? 33.810  21.478  36.936  1.00 27.00 ? 140  TRP B CZ3 1 
ATOM   5589 C CH2 . TRP B  1 141 ? 34.889  21.312  36.044  1.00 27.47 ? 140  TRP B CH2 1 
ATOM   5590 N N   . LYS B  1 142 ? 32.655  28.183  35.181  1.00 23.94 ? 141  LYS B N   1 
ATOM   5591 C CA  . LYS B  1 142 ? 33.009  29.129  34.124  1.00 23.37 ? 141  LYS B CA  1 
ATOM   5592 C C   . LYS B  1 142 ? 34.113  28.617  33.220  1.00 22.97 ? 141  LYS B C   1 
ATOM   5593 O O   . LYS B  1 142 ? 35.023  27.925  33.662  1.00 22.49 ? 141  LYS B O   1 
ATOM   5594 C CB  . LYS B  1 142 ? 33.449  30.480  34.702  1.00 23.48 ? 141  LYS B CB  1 
ATOM   5595 C CG  . LYS B  1 142 ? 32.454  31.125  35.671  1.00 23.79 ? 141  LYS B CG  1 
ATOM   5596 C CD  . LYS B  1 142 ? 31.150  31.495  35.027  1.00 24.32 ? 141  LYS B CD  1 
ATOM   5597 C CE  . LYS B  1 142 ? 30.171  32.029  36.073  1.00 26.65 ? 141  LYS B CE  1 
ATOM   5598 N NZ  . LYS B  1 142 ? 28.901  32.449  35.427  1.00 28.95 ? 141  LYS B NZ  1 
ATOM   5599 N N   . GLY B  1 143 ? 34.034  28.999  31.947  1.00 23.24 ? 142  GLY B N   1 
ATOM   5600 C CA  . GLY B  1 143 ? 35.108  28.724  31.011  1.00 23.67 ? 142  GLY B CA  1 
ATOM   5601 C C   . GLY B  1 143 ? 36.260  29.697  31.203  1.00 24.66 ? 142  GLY B C   1 
ATOM   5602 O O   . GLY B  1 143 ? 36.177  30.605  32.049  1.00 24.65 ? 142  GLY B O   1 
ATOM   5603 N N   . TYR B  1 144 ? 37.318  29.543  30.401  1.00 24.57 ? 143  TYR B N   1 
ATOM   5604 C CA  . TYR B  1 144 ? 38.563  30.312  30.577  1.00 25.28 ? 143  TYR B CA  1 
ATOM   5605 C C   . TYR B  1 144 ? 38.421  31.835  30.412  1.00 25.58 ? 143  TYR B C   1 
ATOM   5606 O O   . TYR B  1 144 ? 39.279  32.592  30.887  1.00 25.99 ? 143  TYR B O   1 
ATOM   5607 C CB  . TYR B  1 144 ? 39.714  29.742  29.705  1.00 24.93 ? 143  TYR B CB  1 
ATOM   5608 C CG  . TYR B  1 144 ? 39.680  30.167  28.255  1.00 25.98 ? 143  TYR B CG  1 
ATOM   5609 C CD1 . TYR B  1 144 ? 40.500  31.193  27.788  1.00 25.97 ? 143  TYR B CD1 1 
ATOM   5610 C CD2 . TYR B  1 144 ? 38.818  29.540  27.344  1.00 25.76 ? 143  TYR B CD2 1 
ATOM   5611 C CE1 . TYR B  1 144 ? 40.457  31.600  26.447  1.00 27.98 ? 143  TYR B CE1 1 
ATOM   5612 C CE2 . TYR B  1 144 ? 38.774  29.930  26.015  1.00 27.10 ? 143  TYR B CE2 1 
ATOM   5613 C CZ  . TYR B  1 144 ? 39.589  30.954  25.569  1.00 27.37 ? 143  TYR B CZ  1 
ATOM   5614 O OH  . TYR B  1 144 ? 39.526  31.335  24.246  1.00 27.12 ? 143  TYR B OH  1 
ATOM   5615 N N   . THR B  1 145 ? 37.358  32.280  29.746  1.00 25.41 ? 144  THR B N   1 
ATOM   5616 C CA  . THR B  1 145 ? 37.065  33.711  29.645  1.00 25.56 ? 144  THR B CA  1 
ATOM   5617 C C   . THR B  1 145 ? 35.975  34.164  30.616  1.00 25.25 ? 144  THR B C   1 
ATOM   5618 O O   . THR B  1 145 ? 35.508  35.302  30.548  1.00 25.36 ? 144  THR B O   1 
ATOM   5619 C CB  . THR B  1 145 ? 36.703  34.114  28.200  1.00 25.53 ? 144  THR B CB  1 
ATOM   5620 O OG1 . THR B  1 145 ? 35.551  33.382  27.761  1.00 25.99 ? 144  THR B OG1 1 
ATOM   5621 C CG2 . THR B  1 145 ? 37.812  33.711  27.238  1.00 26.57 ? 144  THR B CG2 1 
ATOM   5622 N N   . GLY B  1 146 ? 35.573  33.269  31.516  1.00 24.80 ? 145  GLY B N   1 
ATOM   5623 C CA  . GLY B  1 146 ? 34.603  33.596  32.550  1.00 25.04 ? 145  GLY B CA  1 
ATOM   5624 C C   . GLY B  1 146 ? 33.138  33.403  32.193  1.00 25.02 ? 145  GLY B C   1 
ATOM   5625 O O   . GLY B  1 146 ? 32.265  33.866  32.925  1.00 24.39 ? 145  GLY B O   1 
ATOM   5626 N N   . LYS B  1 147 ? 32.865  32.712  31.081  1.00 24.11 ? 146  LYS B N   1 
ATOM   5627 C CA  . LYS B  1 147 ? 31.491  32.484  30.606  1.00 24.22 ? 146  LYS B CA  1 
ATOM   5628 C C   . LYS B  1 147 ? 30.930  31.117  31.023  1.00 23.88 ? 146  LYS B C   1 
ATOM   5629 O O   . LYS B  1 147 ? 31.691  30.162  31.215  1.00 23.77 ? 146  LYS B O   1 
ATOM   5630 C CB  . LYS B  1 147 ? 31.423  32.620  29.074  1.00 24.39 ? 146  LYS B CB  1 
ATOM   5631 C CG  . LYS B  1 147 ? 31.696  34.027  28.568  1.00 25.80 ? 146  LYS B CG  1 
ATOM   5632 C CD  . LYS B  1 147 ? 31.954  34.033  27.062  1.00 28.74 ? 146  LYS B CD  1 
ATOM   5633 C CE  . LYS B  1 147 ? 31.840  35.435  26.509  1.00 31.75 ? 146  LYS B CE  1 
ATOM   5634 N NZ  . LYS B  1 147 ? 32.215  35.527  25.069  1.00 34.72 ? 146  LYS B NZ  1 
ATOM   5635 N N   . SER B  1 148 ? 29.607  31.028  31.170  1.00 23.62 ? 147  SER B N   1 
ATOM   5636 C CA  . SER B  1 148 ? 28.940  29.754  31.478  1.00 23.89 ? 147  SER B CA  1 
ATOM   5637 C C   . SER B  1 148 ? 29.049  28.774  30.307  1.00 23.31 ? 147  SER B C   1 
ATOM   5638 O O   . SER B  1 148 ? 29.128  29.198  29.154  1.00 23.15 ? 147  SER B O   1 
ATOM   5639 C CB  . SER B  1 148 ? 27.465  29.961  31.819  1.00 24.26 ? 147  SER B CB  1 
ATOM   5640 O OG  . SER B  1 148 ? 27.329  30.831  32.934  1.00 26.04 ? 147  SER B OG  1 
ATOM   5641 N N   . ILE B  1 149 ? 29.032  27.487  30.636  1.00 23.04 ? 148  ILE B N   1 
ATOM   5642 C CA  . ILE B  1 149 ? 29.124  26.404  29.659  1.00 22.73 ? 148  ILE B CA  1 
ATOM   5643 C C   . ILE B  1 149 ? 27.776  26.220  28.965  1.00 22.29 ? 148  ILE B C   1 
ATOM   5644 O O   . ILE B  1 149 ? 26.730  26.138  29.623  1.00 22.84 ? 148  ILE B O   1 
ATOM   5645 C CB  . ILE B  1 149 ? 29.563  25.089  30.356  1.00 22.48 ? 148  ILE B CB  1 
ATOM   5646 C CG1 . ILE B  1 149 ? 30.962  25.216  30.998  1.00 22.34 ? 148  ILE B CG1 1 
ATOM   5647 C CG2 . ILE B  1 149 ? 29.439  23.863  29.402  1.00 22.49 ? 148  ILE B CG2 1 
ATOM   5648 C CD1 . ILE B  1 149 ? 32.134  25.591  30.069  1.00 21.79 ? 148  ILE B CD1 1 
ATOM   5649 N N   . THR B  1 150 ? 27.813  26.135  27.631  1.00 22.39 ? 149  THR B N   1 
ATOM   5650 C CA  . THR B  1 150 ? 26.605  25.961  26.830  1.00 21.79 ? 149  THR B CA  1 
ATOM   5651 C C   . THR B  1 150 ? 26.582  24.610  26.124  1.00 21.56 ? 149  THR B C   1 
ATOM   5652 O O   . THR B  1 150 ? 25.525  24.150  25.674  1.00 21.40 ? 149  THR B O   1 
ATOM   5653 C CB  . THR B  1 150 ? 26.468  27.075  25.769  1.00 22.24 ? 149  THR B CB  1 
ATOM   5654 O OG1 . THR B  1 150 ? 27.646  27.116  24.952  1.00 22.42 ? 149  THR B OG1 1 
ATOM   5655 C CG2 . THR B  1 150 ? 26.395  28.486  26.416  1.00 22.67 ? 149  THR B CG2 1 
ATOM   5656 N N   . ASP B  1 151 ? 27.749  23.990  26.028  1.00 21.34 ? 150  ASP B N   1 
ATOM   5657 C CA  . ASP B  1 151 ? 27.901  22.750  25.260  1.00 21.59 ? 150  ASP B CA  1 
ATOM   5658 C C   . ASP B  1 151 ? 28.747  21.732  25.993  1.00 20.91 ? 150  ASP B C   1 
ATOM   5659 O O   . ASP B  1 151 ? 29.828  22.061  26.515  1.00 22.13 ? 150  ASP B O   1 
ATOM   5660 C CB  . ASP B  1 151 ? 28.538  23.047  23.909  1.00 21.09 ? 150  ASP B CB  1 
ATOM   5661 C CG  . ASP B  1 151 ? 27.634  23.836  23.007  1.00 23.01 ? 150  ASP B CG  1 
ATOM   5662 O OD1 . ASP B  1 151 ? 27.725  25.091  22.999  1.00 24.36 ? 150  ASP B OD1 1 
ATOM   5663 O OD2 . ASP B  1 151 ? 26.794  23.280  22.264  1.00 23.04 ? 150  ASP B OD2 1 
ATOM   5664 N N   . ILE B  1 152 ? 28.251  20.497  26.024  1.00 20.05 ? 151  ILE B N   1 
ATOM   5665 C CA  . ILE B  1 152 ? 28.975  19.357  26.586  1.00 19.96 ? 151  ILE B CA  1 
ATOM   5666 C C   . ILE B  1 152 ? 29.312  18.390  25.451  1.00 20.16 ? 151  ILE B C   1 
ATOM   5667 O O   . ILE B  1 152 ? 28.443  18.079  24.629  1.00 19.71 ? 151  ILE B O   1 
ATOM   5668 C CB  . ILE B  1 152 ? 28.101  18.639  27.649  1.00 20.82 ? 151  ILE B CB  1 
ATOM   5669 C CG1 . ILE B  1 152 ? 27.637  19.619  28.747  1.00 22.43 ? 151  ILE B CG1 1 
ATOM   5670 C CG2 . ILE B  1 152 ? 28.804  17.400  28.195  1.00 20.85 ? 151  ILE B CG2 1 
ATOM   5671 C CD1 . ILE B  1 152 ? 28.729  20.222  29.551  1.00 22.75 ? 151  ILE B CD1 1 
ATOM   5672 N N   . ILE B  1 153 ? 30.563  17.934  25.402  1.00 19.28 ? 152  ILE B N   1 
ATOM   5673 C CA  . ILE B  1 153 ? 31.000  17.004  24.352  1.00 19.28 ? 152  ILE B CA  1 
ATOM   5674 C C   . ILE B  1 153 ? 31.555  15.741  24.984  1.00 19.36 ? 152  ILE B C   1 
ATOM   5675 O O   . ILE B  1 153 ? 32.610  15.765  25.608  1.00 19.29 ? 152  ILE B O   1 
ATOM   5676 C CB  . ILE B  1 153 ? 32.053  17.656  23.431  1.00 18.97 ? 152  ILE B CB  1 
ATOM   5677 C CG1 . ILE B  1 153 ? 31.528  18.953  22.827  1.00 20.01 ? 152  ILE B CG1 1 
ATOM   5678 C CG2 . ILE B  1 153 ? 32.420  16.698  22.283  1.00 18.93 ? 152  ILE B CG2 1 
ATOM   5679 C CD1 . ILE B  1 153 ? 31.890  20.239  23.629  1.00 20.76 ? 152  ILE B CD1 1 
ATOM   5680 N N   . ASN B  1 154 ? 30.820  14.642  24.839  1.00 19.29 ? 153  ASN B N   1 
ATOM   5681 C CA  . ASN B  1 154 ? 31.278  13.331  25.278  1.00 19.68 ? 153  ASN B CA  1 
ATOM   5682 C C   . ASN B  1 154 ? 32.181  12.707  24.220  1.00 19.94 ? 153  ASN B C   1 
ATOM   5683 O O   . ASN B  1 154 ? 31.777  12.578  23.051  1.00 20.24 ? 153  ASN B O   1 
ATOM   5684 C CB  . ASN B  1 154 ? 30.080  12.407  25.538  1.00 19.67 ? 153  ASN B CB  1 
ATOM   5685 C CG  . ASN B  1 154 ? 30.468  11.127  26.263  1.00 22.03 ? 153  ASN B CG  1 
ATOM   5686 O OD1 . ASN B  1 154 ? 30.558  10.044  25.657  1.00 23.94 ? 153  ASN B OD1 1 
ATOM   5687 N ND2 . ASN B  1 154 ? 30.682  11.230  27.562  1.00 20.17 ? 153  ASN B ND2 1 
ATOM   5688 N N   . ILE B  1 155 ? 33.395  12.348  24.613  1.00 19.30 ? 154  ILE B N   1 
ATOM   5689 C CA  . ILE B  1 155 ? 34.318  11.669  23.699  1.00 19.81 ? 154  ILE B CA  1 
ATOM   5690 C C   . ILE B  1 155 ? 34.568  10.271  24.240  1.00 20.46 ? 154  ILE B C   1 
ATOM   5691 O O   . ILE B  1 155 ? 35.097  10.095  25.348  1.00 20.58 ? 154  ILE B O   1 
ATOM   5692 C CB  . ILE B  1 155 ? 35.658  12.452  23.516  1.00 19.58 ? 154  ILE B CB  1 
ATOM   5693 C CG1 . ILE B  1 155 ? 35.415  13.870  22.973  1.00 20.36 ? 154  ILE B CG1 1 
ATOM   5694 C CG2 . ILE B  1 155 ? 36.631  11.643  22.597  1.00 20.58 ? 154  ILE B CG2 1 
ATOM   5695 C CD1 . ILE B  1 155 ? 36.703  14.672  22.683  1.00 20.85 ? 154  ILE B CD1 1 
ATOM   5696 N N   . GLY B  1 156 ? 34.183  9.266   23.454  1.00 20.48 ? 155  GLY B N   1 
ATOM   5697 C CA  . GLY B  1 156 ? 34.284  7.879   23.879  1.00 21.00 ? 155  GLY B CA  1 
ATOM   5698 C C   . GLY B  1 156 ? 33.779  6.943   22.794  1.00 21.46 ? 155  GLY B C   1 
ATOM   5699 O O   . GLY B  1 156 ? 33.181  7.408   21.835  1.00 21.88 ? 155  GLY B O   1 
ATOM   5700 N N   . ILE B  1 157 ? 34.030  5.649   22.952  1.00 22.50 ? 156  ILE B N   1 
ATOM   5701 C CA  . ILE B  1 157 ? 33.634  4.647   21.956  1.00 23.74 ? 156  ILE B CA  1 
ATOM   5702 C C   . ILE B  1 157 ? 32.919  3.475   22.613  1.00 23.13 ? 156  ILE B C   1 
ATOM   5703 O O   . ILE B  1 157 ? 33.112  3.217   23.804  1.00 22.81 ? 156  ILE B O   1 
ATOM   5704 C CB  . ILE B  1 157 ? 34.858  4.144   21.141  1.00 24.71 ? 156  ILE B CB  1 
ATOM   5705 C CG1 . ILE B  1 157 ? 35.856  3.412   22.038  1.00 27.15 ? 156  ILE B CG1 1 
ATOM   5706 C CG2 . ILE B  1 157 ? 35.512  5.276   20.384  1.00 26.94 ? 156  ILE B CG2 1 
ATOM   5707 C CD1 . ILE B  1 157 ? 37.126  2.918   21.318  1.00 31.50 ? 156  ILE B CD1 1 
ATOM   5708 N N   . GLY B  1 158 ? 32.094  2.772   21.832  1.00 22.40 ? 157  GLY B N   1 
ATOM   5709 C CA  . GLY B  1 158 ? 31.393  1.595   22.304  1.00 22.32 ? 157  GLY B CA  1 
ATOM   5710 C C   . GLY B  1 158 ? 30.559  1.917   23.525  1.00 22.65 ? 157  GLY B C   1 
ATOM   5711 O O   . GLY B  1 158 ? 29.701  2.798   23.491  1.00 21.70 ? 157  GLY B O   1 
ATOM   5712 N N   . GLY B  1 159 ? 30.838  1.207   24.610  1.00 23.13 ? 158  GLY B N   1 
ATOM   5713 C CA  . GLY B  1 159 ? 30.104  1.391   25.855  1.00 23.75 ? 158  GLY B CA  1 
ATOM   5714 C C   . GLY B  1 159 ? 30.261  2.771   26.481  1.00 23.38 ? 158  GLY B C   1 
ATOM   5715 O O   . GLY B  1 159 ? 29.460  3.160   27.321  1.00 23.98 ? 158  GLY B O   1 
ATOM   5716 N N   . SER B  1 160 ? 31.295  3.509   26.092  1.00 23.26 ? 159  SER B N   1 
ATOM   5717 C CA  . SER B  1 160 ? 31.465  4.883   26.578  1.00 23.28 ? 159  SER B CA  1 
ATOM   5718 C C   . SER B  1 160 ? 30.715  5.909   25.719  1.00 22.67 ? 159  SER B C   1 
ATOM   5719 O O   . SER B  1 160 ? 30.790  7.106   25.990  1.00 23.70 ? 159  SER B O   1 
ATOM   5720 C CB  . SER B  1 160 ? 32.950  5.253   26.661  1.00 22.85 ? 159  SER B CB  1 
ATOM   5721 O OG  . SER B  1 160 ? 33.624  4.423   27.603  1.00 25.59 ? 159  SER B OG  1 
ATOM   5722 N N   . ASP B  1 161 ? 30.007  5.438   24.685  1.00 21.56 ? 160  ASP B N   1 
ATOM   5723 C CA  . ASP B  1 161 ? 29.326  6.311   23.731  1.00 20.19 ? 160  ASP B CA  1 
ATOM   5724 C C   . ASP B  1 161 ? 27.835  5.944   23.554  1.00 19.44 ? 160  ASP B C   1 
ATOM   5725 O O   . ASP B  1 161 ? 26.957  6.803   23.705  1.00 18.70 ? 160  ASP B O   1 
ATOM   5726 C CB  . ASP B  1 161 ? 30.062  6.276   22.377  1.00 20.19 ? 160  ASP B CB  1 
ATOM   5727 C CG  . ASP B  1 161 ? 29.227  6.832   21.230  1.00 20.40 ? 160  ASP B CG  1 
ATOM   5728 O OD1 . ASP B  1 161 ? 29.067  8.064   21.140  1.00 20.51 ? 160  ASP B OD1 1 
ATOM   5729 O OD2 . ASP B  1 161 ? 28.705  6.097   20.351  1.00 23.25 ? 160  ASP B OD2 1 
ATOM   5730 N N   . LEU B  1 162 ? 27.562  4.676   23.246  1.00 18.94 ? 161  LEU B N   1 
ATOM   5731 C CA  . LEU B  1 162 ? 26.206  4.261   22.857  1.00 18.79 ? 161  LEU B CA  1 
ATOM   5732 C C   . LEU B  1 162 ? 25.126  4.526   23.908  1.00 18.42 ? 161  LEU B C   1 
ATOM   5733 O O   . LEU B  1 162 ? 24.023  4.956   23.568  1.00 17.79 ? 161  LEU B O   1 
ATOM   5734 C CB  . LEU B  1 162 ? 26.193  2.781   22.460  1.00 19.61 ? 161  LEU B CB  1 
ATOM   5735 C CG  . LEU B  1 162 ? 26.960  2.392   21.198  1.00 21.03 ? 161  LEU B CG  1 
ATOM   5736 C CD1 . LEU B  1 162 ? 26.857  0.883   20.963  1.00 22.17 ? 161  LEU B CD1 1 
ATOM   5737 C CD2 . LEU B  1 162 ? 26.450  3.153   19.968  1.00 23.07 ? 161  LEU B CD2 1 
ATOM   5738 N N   . GLY B  1 163 ? 25.442  4.230   25.169  1.00 17.50 ? 162  GLY B N   1 
ATOM   5739 C CA  . GLY B  1 163 ? 24.504  4.407   26.272  1.00 18.56 ? 162  GLY B CA  1 
ATOM   5740 C C   . GLY B  1 163 ? 24.108  5.851   26.484  1.00 17.84 ? 162  GLY B C   1 
ATOM   5741 O O   . GLY B  1 163 ? 22.914  6.188   26.397  1.00 18.47 ? 162  GLY B O   1 
ATOM   5742 N N   . PRO B  1 164 ? 25.078  6.719   26.783  1.00 17.82 ? 163  PRO B N   1 
ATOM   5743 C CA  . PRO B  1 164 ? 24.793  8.155   26.917  1.00 17.73 ? 163  PRO B CA  1 
ATOM   5744 C C   . PRO B  1 164 ? 24.094  8.772   25.693  1.00 17.10 ? 163  PRO B C   1 
ATOM   5745 O O   . PRO B  1 164 ? 23.173  9.574   25.859  1.00 16.75 ? 163  PRO B O   1 
ATOM   5746 C CB  . PRO B  1 164 ? 26.181  8.777   27.151  1.00 17.93 ? 163  PRO B CB  1 
ATOM   5747 C CG  . PRO B  1 164 ? 27.010  7.670   27.675  1.00 17.67 ? 163  PRO B CG  1 
ATOM   5748 C CD  . PRO B  1 164 ? 26.491  6.393   27.054  1.00 17.59 ? 163  PRO B CD  1 
ATOM   5749 N N   . LEU B  1 165 ? 24.494  8.385   24.480  1.00 16.83 ? 164  LEU B N   1 
ATOM   5750 C CA  . LEU B  1 165 ? 23.811  8.866   23.289  1.00 16.99 ? 164  LEU B CA  1 
ATOM   5751 C C   . LEU B  1 165 ? 22.351  8.404   23.253  1.00 16.06 ? 164  LEU B C   1 
ATOM   5752 O O   . LEU B  1 165 ? 21.449  9.214   23.071  1.00 16.73 ? 164  LEU B O   1 
ATOM   5753 C CB  . LEU B  1 165 ? 24.556  8.416   22.019  1.00 16.94 ? 164  LEU B CB  1 
ATOM   5754 C CG  A LEU B  1 165 ? 24.257  9.153   20.702  0.35 17.20 ? 164  LEU B CG  1 
ATOM   5755 C CG  B LEU B  1 165 ? 23.901  8.708   20.663  0.65 17.61 ? 164  LEU B CG  1 
ATOM   5756 C CD1 A LEU B  1 165 ? 25.420  9.015   19.726  0.35 17.62 ? 164  LEU B CD1 1 
ATOM   5757 C CD1 B LEU B  1 165 ? 23.682  10.196  20.479  0.65 16.67 ? 164  LEU B CD1 1 
ATOM   5758 C CD2 A LEU B  1 165 ? 22.983  8.639   20.058  0.35 17.11 ? 164  LEU B CD2 1 
ATOM   5759 C CD2 B LEU B  1 165 ? 24.769  8.147   19.540  0.65 19.11 ? 164  LEU B CD2 1 
ATOM   5760 N N   . MET B  1 166 ? 22.127  7.101   23.414  1.00 16.48 ? 165  MET B N   1 
ATOM   5761 C CA  . MET B  1 166 ? 20.768  6.567   23.281  1.00 15.79 ? 165  MET B CA  1 
ATOM   5762 C C   . MET B  1 166 ? 19.836  7.167   24.344  1.00 16.85 ? 165  MET B C   1 
ATOM   5763 O O   . MET B  1 166 ? 18.690  7.542   24.054  1.00 16.68 ? 165  MET B O   1 
ATOM   5764 C CB  . MET B  1 166 ? 20.777  5.033   23.302  1.00 15.94 ? 165  MET B CB  1 
ATOM   5765 C CG  . MET B  1 166 ? 19.390  4.369   23.232  1.00 16.26 ? 165  MET B CG  1 
ATOM   5766 S SD  . MET B  1 166 ? 18.546  4.275   24.849  1.00 19.91 ? 165  MET B SD  1 
ATOM   5767 C CE  . MET B  1 166 ? 19.220  2.736   25.397  1.00 22.05 ? 165  MET B CE  1 
ATOM   5768 N N   . VAL B  1 167 ? 20.350  7.304   25.565  1.00 16.56 ? 166  VAL B N   1 
ATOM   5769 C CA  . VAL B  1 167 ? 19.522  7.806   26.667  1.00 17.13 ? 166  VAL B CA  1 
ATOM   5770 C C   . VAL B  1 167 ? 19.219  9.306   26.548  1.00 17.51 ? 166  VAL B C   1 
ATOM   5771 O O   . VAL B  1 167 ? 18.070  9.724   26.748  1.00 16.92 ? 166  VAL B O   1 
ATOM   5772 C CB  . VAL B  1 167 ? 20.131  7.444   28.047  1.00 17.28 ? 166  VAL B CB  1 
ATOM   5773 C CG1 . VAL B  1 167 ? 19.339  8.097   29.186  1.00 18.73 ? 166  VAL B CG1 1 
ATOM   5774 C CG2 . VAL B  1 167 ? 20.166  5.950   28.220  1.00 16.89 ? 166  VAL B CG2 1 
ATOM   5775 N N   . THR B  1 168 ? 20.227  10.125  26.222  1.00 17.22 ? 167  THR B N   1 
ATOM   5776 C CA  . THR B  1 168 ? 19.958  11.555  25.983  1.00 17.14 ? 167  THR B CA  1 
ATOM   5777 C C   . THR B  1 168 ? 18.993  11.805  24.816  1.00 17.22 ? 167  THR B C   1 
ATOM   5778 O O   . THR B  1 168 ? 18.186  12.728  24.869  1.00 17.34 ? 167  THR B O   1 
ATOM   5779 C CB  . THR B  1 168 ? 21.230  12.424  25.814  1.00 17.39 ? 167  THR B CB  1 
ATOM   5780 O OG1 . THR B  1 168 ? 22.040  11.937  24.727  1.00 17.62 ? 167  THR B OG1 1 
ATOM   5781 C CG2 . THR B  1 168 ? 22.136  12.352  27.066  1.00 17.79 ? 167  THR B CG2 1 
ATOM   5782 N N   . GLU B  1 169 ? 19.074  10.969  23.774  1.00 17.23 ? 168  GLU B N   1 
ATOM   5783 C CA  . GLU B  1 169 ? 18.123  11.041  22.664  1.00 17.62 ? 168  GLU B CA  1 
ATOM   5784 C C   . GLU B  1 169 ? 16.708  10.665  23.122  1.00 16.99 ? 168  GLU B C   1 
ATOM   5785 O O   . GLU B  1 169 ? 15.733  11.364  22.770  1.00 17.54 ? 168  GLU B O   1 
ATOM   5786 C CB  . GLU B  1 169 ? 18.575  10.142  21.500  1.00 16.96 ? 168  GLU B CB  1 
ATOM   5787 C CG  . GLU B  1 169 ? 19.744  10.710  20.690  1.00 17.47 ? 168  GLU B CG  1 
ATOM   5788 C CD  . GLU B  1 169 ? 19.408  12.048  20.034  1.00 20.88 ? 168  GLU B CD  1 
ATOM   5789 O OE1 . GLU B  1 169 ? 20.054  13.058  20.378  1.00 20.78 ? 168  GLU B OE1 1 
ATOM   5790 O OE2 . GLU B  1 169 ? 18.481  12.106  19.198  1.00 18.89 ? 168  GLU B OE2 1 
ATOM   5791 N N   . ALA B  1 170 ? 16.605  9.588   23.906  1.00 16.91 ? 169  ALA B N   1 
ATOM   5792 C CA  . ALA B  1 170 ? 15.311  9.085   24.381  1.00 17.32 ? 169  ALA B CA  1 
ATOM   5793 C C   . ALA B  1 170 ? 14.650  10.025  25.395  1.00 17.41 ? 169  ALA B C   1 
ATOM   5794 O O   . ALA B  1 170 ? 13.416  10.093  25.463  1.00 17.47 ? 169  ALA B O   1 
ATOM   5795 C CB  . ALA B  1 170 ? 15.458  7.675   24.983  1.00 17.22 ? 169  ALA B CB  1 
ATOM   5796 N N   . LEU B  1 171 ? 15.468  10.742  26.171  1.00 18.22 ? 170  LEU B N   1 
ATOM   5797 C CA  . LEU B  1 171 ? 14.956  11.598  27.251  1.00 19.41 ? 170  LEU B CA  1 
ATOM   5798 C C   . LEU B  1 171 ? 15.076  13.086  26.923  1.00 19.95 ? 170  LEU B C   1 
ATOM   5799 O O   . LEU B  1 171 ? 15.087  13.944  27.822  1.00 20.21 ? 170  LEU B O   1 
ATOM   5800 C CB  . LEU B  1 171 ? 15.671  11.249  28.569  1.00 19.41 ? 170  LEU B CB  1 
ATOM   5801 C CG  . LEU B  1 171 ? 15.456  9.827   29.106  1.00 18.76 ? 170  LEU B CG  1 
ATOM   5802 C CD1 . LEU B  1 171 ? 16.123  9.702   30.488  1.00 18.93 ? 170  LEU B CD1 1 
ATOM   5803 C CD2 . LEU B  1 171 ? 13.971  9.471   29.224  1.00 18.57 ? 170  LEU B CD2 1 
ATOM   5804 N N   . LYS B  1 172 ? 15.145  13.398  25.630  1.00 20.30 ? 171  LYS B N   1 
ATOM   5805 C CA  . LYS B  1 172 ? 15.270  14.775  25.151  1.00 21.40 ? 171  LYS B CA  1 
ATOM   5806 C C   . LYS B  1 172 ? 14.272  15.793  25.762  1.00 21.70 ? 171  LYS B C   1 
ATOM   5807 O O   . LYS B  1 172 ? 14.691  16.916  26.069  1.00 21.93 ? 171  LYS B O   1 
ATOM   5808 C CB  . LYS B  1 172 ? 15.268  14.815  23.606  1.00 21.46 ? 171  LYS B CB  1 
ATOM   5809 C CG  . LYS B  1 172 ? 15.682  16.164  22.968  1.00 23.65 ? 171  LYS B CG  1 
ATOM   5810 C CD  . LYS B  1 172 ? 17.169  16.508  23.212  1.00 24.35 ? 171  LYS B CD  1 
ATOM   5811 C CE  . LYS B  1 172 ? 18.139  15.421  22.741  1.00 24.39 ? 171  LYS B CE  1 
ATOM   5812 N NZ  . LYS B  1 172 ? 19.554  15.801  23.113  1.00 25.32 ? 171  LYS B NZ  1 
ATOM   5813 N N   . PRO B  1 173 ? 12.990  15.435  25.947  1.00 22.46 ? 172  PRO B N   1 
ATOM   5814 C CA  . PRO B  1 173 ? 12.021  16.344  26.601  1.00 23.59 ? 172  PRO B CA  1 
ATOM   5815 C C   . PRO B  1 173 ? 12.382  16.749  28.035  1.00 24.38 ? 172  PRO B C   1 
ATOM   5816 O O   . PRO B  1 173 ? 11.855  17.756  28.529  1.00 25.77 ? 172  PRO B O   1 
ATOM   5817 C CB  . PRO B  1 173 ? 10.725  15.522  26.635  1.00 23.78 ? 172  PRO B CB  1 
ATOM   5818 C CG  . PRO B  1 173 ? 10.876  14.507  25.588  1.00 22.94 ? 172  PRO B CG  1 
ATOM   5819 C CD  . PRO B  1 173 ? 12.339  14.181  25.513  1.00 21.92 ? 172  PRO B CD  1 
ATOM   5820 N N   . TYR B  1 174 ? 13.245  15.983  28.692  1.00 24.66 ? 173  TYR B N   1 
ATOM   5821 C CA  . TYR B  1 174 ? 13.596  16.222  30.091  1.00 25.11 ? 173  TYR B CA  1 
ATOM   5822 C C   . TYR B  1 174 ? 14.854  17.084  30.224  1.00 25.95 ? 173  TYR B C   1 
ATOM   5823 O O   . TYR B  1 174 ? 15.407  17.228  31.317  1.00 26.69 ? 173  TYR B O   1 
ATOM   5824 C CB  . TYR B  1 174 ? 13.736  14.883  30.826  1.00 24.78 ? 173  TYR B CB  1 
ATOM   5825 C CG  . TYR B  1 174 ? 12.449  14.097  30.817  1.00 24.12 ? 173  TYR B CG  1 
ATOM   5826 C CD1 . TYR B  1 174 ? 12.206  13.117  29.849  1.00 21.54 ? 173  TYR B CD1 1 
ATOM   5827 C CD2 . TYR B  1 174 ? 11.443  14.365  31.745  1.00 22.96 ? 173  TYR B CD2 1 
ATOM   5828 C CE1 . TYR B  1 174 ? 11.002  12.409  29.820  1.00 22.57 ? 173  TYR B CE1 1 
ATOM   5829 C CE2 . TYR B  1 174 ? 10.237  13.665  31.724  1.00 23.23 ? 173  TYR B CE2 1 
ATOM   5830 C CZ  . TYR B  1 174 ? 10.020  12.693  30.762  1.00 22.21 ? 173  TYR B CZ  1 
ATOM   5831 O OH  . TYR B  1 174 ? 8.828   12.013  30.753  1.00 22.36 ? 173  TYR B OH  1 
ATOM   5832 N N   . SER B  1 175 ? 15.274  17.674  29.108  1.00 26.42 ? 174  SER B N   1 
ATOM   5833 C CA  . SER B  1 175 ? 16.541  18.396  29.022  1.00 27.41 ? 174  SER B CA  1 
ATOM   5834 C C   . SER B  1 175 ? 16.367  19.917  29.064  1.00 28.06 ? 174  SER B C   1 
ATOM   5835 O O   . SER B  1 175 ? 17.319  20.658  28.803  1.00 27.78 ? 174  SER B O   1 
ATOM   5836 C CB  . SER B  1 175 ? 17.314  17.982  27.764  1.00 27.44 ? 174  SER B CB  1 
ATOM   5837 O OG  . SER B  1 175 ? 16.731  18.513  26.577  1.00 27.54 ? 174  SER B OG  1 
ATOM   5838 N N   . LYS B  1 176 ? 15.163  20.385  29.399  1.00 29.26 ? 175  LYS B N   1 
ATOM   5839 C CA  . LYS B  1 176 ? 14.917  21.829  29.465  1.00 30.67 ? 175  LYS B CA  1 
ATOM   5840 C C   . LYS B  1 176 ? 15.867  22.483  30.456  1.00 30.23 ? 175  LYS B C   1 
ATOM   5841 O O   . LYS B  1 176 ? 16.061  21.980  31.568  1.00 30.85 ? 175  LYS B O   1 
ATOM   5842 C CB  . LYS B  1 176 ? 13.465  22.133  29.851  1.00 31.33 ? 175  LYS B CB  1 
ATOM   5843 C CG  . LYS B  1 176 ? 12.809  23.213  28.994  1.00 34.04 ? 175  LYS B CG  1 
ATOM   5844 C CD  . LYS B  1 176 ? 12.935  24.586  29.642  1.00 37.73 ? 175  LYS B CD  1 
ATOM   5845 C CE  . LYS B  1 176 ? 11.576  25.264  29.784  1.00 39.47 ? 175  LYS B CE  1 
ATOM   5846 N NZ  . LYS B  1 176 ? 11.536  26.182  30.969  1.00 41.09 ? 175  LYS B NZ  1 
ATOM   5847 N N   . GLY B  1 177 ? 16.486  23.585  30.037  1.00 30.84 ? 176  GLY B N   1 
ATOM   5848 C CA  . GLY B  1 177 ? 17.441  24.288  30.884  1.00 30.35 ? 176  GLY B CA  1 
ATOM   5849 C C   . GLY B  1 177 ? 18.842  23.693  30.957  1.00 30.05 ? 176  GLY B C   1 
ATOM   5850 O O   . GLY B  1 177 ? 19.718  24.244  31.643  1.00 30.29 ? 176  GLY B O   1 
ATOM   5851 N N   . GLY B  1 178 ? 19.061  22.572  30.261  1.00 28.77 ? 177  GLY B N   1 
ATOM   5852 C CA  . GLY B  1 178 ? 20.353  21.915  30.250  1.00 26.75 ? 177  GLY B CA  1 
ATOM   5853 C C   . GLY B  1 178 ? 21.215  22.359  29.083  1.00 25.56 ? 177  GLY B C   1 
ATOM   5854 O O   . GLY B  1 178 ? 20.704  22.920  28.119  1.00 25.82 ? 177  GLY B O   1 
ATOM   5855 N N   . PRO B  1 179 ? 22.522  22.112  29.160  1.00 24.55 ? 178  PRO B N   1 
ATOM   5856 C CA  . PRO B  1 179 ? 23.424  22.454  28.055  1.00 23.88 ? 178  PRO B CA  1 
ATOM   5857 C C   . PRO B  1 179 ? 23.194  21.474  26.909  1.00 23.12 ? 178  PRO B C   1 
ATOM   5858 O O   . PRO B  1 179 ? 22.741  20.356  27.170  1.00 23.01 ? 178  PRO B O   1 
ATOM   5859 C CB  . PRO B  1 179 ? 24.819  22.238  28.656  1.00 23.69 ? 178  PRO B CB  1 
ATOM   5860 C CG  . PRO B  1 179 ? 24.626  21.249  29.760  1.00 24.45 ? 178  PRO B CG  1 
ATOM   5861 C CD  . PRO B  1 179 ? 23.228  21.462  30.276  1.00 24.19 ? 178  PRO B CD  1 
ATOM   5862 N N   . ARG B  1 180 ? 23.490  21.897  25.683  1.00 22.67 ? 179  ARG B N   1 
ATOM   5863 C CA  . ARG B  1 180 ? 23.476  20.988  24.530  1.00 22.22 ? 179  ARG B CA  1 
ATOM   5864 C C   . ARG B  1 180 ? 24.505  19.890  24.708  1.00 21.69 ? 179  ARG B C   1 
ATOM   5865 O O   . ARG B  1 180 ? 25.548  20.107  25.321  1.00 22.24 ? 179  ARG B O   1 
ATOM   5866 C CB  . ARG B  1 180 ? 23.792  21.747  23.244  1.00 22.30 ? 179  ARG B CB  1 
ATOM   5867 C CG  . ARG B  1 180 ? 22.752  22.772  22.830  1.00 24.00 ? 179  ARG B CG  1 
ATOM   5868 C CD  . ARG B  1 180 ? 23.165  23.592  21.612  1.00 27.72 ? 179  ARG B CD  1 
ATOM   5869 N NE  . ARG B  1 180 ? 24.232  24.546  21.923  1.00 30.59 ? 179  ARG B NE  1 
ATOM   5870 C CZ  . ARG B  1 180 ? 24.037  25.841  22.158  1.00 32.61 ? 179  ARG B CZ  1 
ATOM   5871 N NH1 . ARG B  1 180 ? 22.806  26.351  22.125  1.00 33.79 ? 179  ARG B NH1 1 
ATOM   5872 N NH2 . ARG B  1 180 ? 25.068  26.630  22.434  1.00 31.96 ? 179  ARG B NH2 1 
ATOM   5873 N N   . VAL B  1 181 ? 24.218  18.701  24.173  1.00 20.56 ? 180  VAL B N   1 
ATOM   5874 C CA  . VAL B  1 181 ? 25.131  17.580  24.304  1.00 20.38 ? 180  VAL B CA  1 
ATOM   5875 C C   . VAL B  1 181 ? 25.498  17.031  22.928  1.00 20.27 ? 180  VAL B C   1 
ATOM   5876 O O   . VAL B  1 181 ? 24.642  16.920  22.045  1.00 19.86 ? 180  VAL B O   1 
ATOM   5877 C CB  . VAL B  1 181 ? 24.595  16.478  25.286  1.00 20.25 ? 180  VAL B CB  1 
ATOM   5878 C CG1 . VAL B  1 181 ? 23.298  15.802  24.751  1.00 20.56 ? 180  VAL B CG1 1 
ATOM   5879 C CG2 . VAL B  1 181 ? 25.668  15.461  25.591  1.00 22.14 ? 180  VAL B CG2 1 
ATOM   5880 N N   . TRP B  1 182 ? 26.781  16.720  22.768  1.00 19.96 ? 181  TRP B N   1 
ATOM   5881 C CA  . TRP B  1 182 ? 27.359  16.228  21.516  1.00 19.89 ? 181  TRP B CA  1 
ATOM   5882 C C   . TRP B  1 182 ? 28.132  14.949  21.829  1.00 19.71 ? 181  TRP B C   1 
ATOM   5883 O O   . TRP B  1 182 ? 28.700  14.809  22.935  1.00 18.53 ? 181  TRP B O   1 
ATOM   5884 C CB  . TRP B  1 182 ? 28.329  17.263  20.936  1.00 20.28 ? 181  TRP B CB  1 
ATOM   5885 C CG  . TRP B  1 182 ? 27.754  18.624  20.739  1.00 21.63 ? 181  TRP B CG  1 
ATOM   5886 C CD1 . TRP B  1 182 ? 27.439  19.545  21.716  1.00 22.04 ? 181  TRP B CD1 1 
ATOM   5887 C CD2 . TRP B  1 182 ? 27.444  19.251  19.490  1.00 24.86 ? 181  TRP B CD2 1 
ATOM   5888 N NE1 . TRP B  1 182 ? 26.937  20.689  21.143  1.00 22.05 ? 181  TRP B NE1 1 
ATOM   5889 C CE2 . TRP B  1 182 ? 26.934  20.540  19.778  1.00 25.62 ? 181  TRP B CE2 1 
ATOM   5890 C CE3 . TRP B  1 182 ? 27.547  18.856  18.142  1.00 28.23 ? 181  TRP B CE3 1 
ATOM   5891 C CZ2 . TRP B  1 182 ? 26.523  21.432  18.770  1.00 27.42 ? 181  TRP B CZ2 1 
ATOM   5892 C CZ3 . TRP B  1 182 ? 27.141  19.745  17.142  1.00 28.50 ? 181  TRP B CZ3 1 
ATOM   5893 C CH2 . TRP B  1 182 ? 26.641  21.017  17.460  1.00 28.81 ? 181  TRP B CH2 1 
ATOM   5894 N N   . PHE B  1 183 ? 28.146  14.016  20.872  1.00 18.79 ? 182  PHE B N   1 
ATOM   5895 C CA  . PHE B  1 183 ? 28.866  12.749  21.019  1.00 19.25 ? 182  PHE B CA  1 
ATOM   5896 C C   . PHE B  1 183 ? 29.863  12.552  19.889  1.00 19.64 ? 182  PHE B C   1 
ATOM   5897 O O   . PHE B  1 183 ? 29.499  12.571  18.705  1.00 21.27 ? 182  PHE B O   1 
ATOM   5898 C CB  . PHE B  1 183 ? 27.883  11.570  21.128  1.00 18.80 ? 182  PHE B CB  1 
ATOM   5899 C CG  . PHE B  1 183 ? 27.018  11.659  22.342  1.00 18.95 ? 182  PHE B CG  1 
ATOM   5900 C CD1 . PHE B  1 183 ? 25.830  12.386  22.306  1.00 19.35 ? 182  PHE B CD1 1 
ATOM   5901 C CD2 . PHE B  1 183 ? 27.429  11.077  23.536  1.00 20.33 ? 182  PHE B CD2 1 
ATOM   5902 C CE1 . PHE B  1 183 ? 25.041  12.507  23.442  1.00 20.19 ? 182  PHE B CE1 1 
ATOM   5903 C CE2 . PHE B  1 183 ? 26.656  11.200  24.686  1.00 20.46 ? 182  PHE B CE2 1 
ATOM   5904 C CZ  . PHE B  1 183 ? 25.463  11.922  24.638  1.00 19.98 ? 182  PHE B CZ  1 
ATOM   5905 N N   . VAL B  1 184 ? 31.129  12.394  20.264  1.00 19.52 ? 183  VAL B N   1 
ATOM   5906 C CA  . VAL B  1 184 ? 32.198  12.139  19.301  1.00 18.82 ? 183  VAL B CA  1 
ATOM   5907 C C   . VAL B  1 184 ? 32.735  10.753  19.617  1.00 19.10 ? 183  VAL B C   1 
ATOM   5908 O O   . VAL B  1 184 ? 33.125  10.489  20.752  1.00 19.28 ? 183  VAL B O   1 
ATOM   5909 C CB  . VAL B  1 184 ? 33.329  13.184  19.425  1.00 19.21 ? 183  VAL B CB  1 
ATOM   5910 C CG1 . VAL B  1 184 ? 34.542  12.783  18.553  1.00 19.71 ? 183  VAL B CG1 1 
ATOM   5911 C CG2 . VAL B  1 184 ? 32.819  14.586  19.054  1.00 19.62 ? 183  VAL B CG2 1 
ATOM   5912 N N   . SER B  1 185 ? 32.775  9.864   18.623  1.00 18.19 ? 184  SER B N   1 
ATOM   5913 C CA  . SER B  1 185 ? 33.157  8.484   18.882  1.00 18.20 ? 184  SER B CA  1 
ATOM   5914 C C   . SER B  1 185 ? 34.073  7.922   17.799  1.00 17.57 ? 184  SER B C   1 
ATOM   5915 O O   . SER B  1 185 ? 35.072  7.279   18.103  1.00 18.30 ? 184  SER B O   1 
ATOM   5916 C CB  . SER B  1 185 ? 31.906  7.588   19.006  1.00 18.51 ? 184  SER B CB  1 
ATOM   5917 O OG  . SER B  1 185 ? 31.035  7.784   17.889  1.00 20.79 ? 184  SER B OG  1 
ATOM   5918 N N   . ASN B  1 186 ? 33.714  8.143   16.536  1.00 16.66 ? 185  ASN B N   1 
ATOM   5919 C CA  . ASN B  1 186 ? 34.498  7.580   15.432  1.00 15.71 ? 185  ASN B CA  1 
ATOM   5920 C C   . ASN B  1 186 ? 35.913  8.163   15.416  1.00 16.10 ? 185  ASN B C   1 
ATOM   5921 O O   . ASN B  1 186 ? 36.083  9.335   15.717  1.00 15.47 ? 185  ASN B O   1 
ATOM   5922 C CB  . ASN B  1 186 ? 33.806  7.844   14.094  1.00 16.04 ? 185  ASN B CB  1 
ATOM   5923 C CG  . ASN B  1 186 ? 34.167  6.804   13.044  1.00 13.38 ? 185  ASN B CG  1 
ATOM   5924 O OD1 . ASN B  1 186 ? 35.272  6.237   13.065  1.00 15.17 ? 185  ASN B OD1 1 
ATOM   5925 N ND2 . ASN B  1 186 ? 33.246  6.556   12.105  1.00 13.94 ? 185  ASN B ND2 1 
ATOM   5926 N N   . ILE B  1 187 ? 36.914  7.346   15.077  1.00 16.12 ? 186  ILE B N   1 
ATOM   5927 C CA  . ILE B  1 187 ? 38.248  7.901   14.803  1.00 15.96 ? 186  ILE B CA  1 
ATOM   5928 C C   . ILE B  1 187 ? 38.243  8.744   13.527  1.00 15.90 ? 186  ILE B C   1 
ATOM   5929 O O   . ILE B  1 187 ? 38.999  9.716   13.404  1.00 15.08 ? 186  ILE B O   1 
ATOM   5930 C CB  . ILE B  1 187 ? 39.371  6.792   14.786  1.00 16.27 ? 186  ILE B CB  1 
ATOM   5931 C CG1 . ILE B  1 187 ? 40.780  7.420   14.706  1.00 16.83 ? 186  ILE B CG1 1 
ATOM   5932 C CG2 . ILE B  1 187 ? 39.201  5.828   13.579  1.00 16.33 ? 186  ILE B CG2 1 
ATOM   5933 C CD1 . ILE B  1 187 ? 41.092  8.465   15.788  1.00 17.74 ? 186  ILE B CD1 1 
ATOM   5934 N N   . ASP B  1 188 ? 37.377  8.380   12.579  1.00 14.72 ? 187  ASP B N   1 
ATOM   5935 C CA  . ASP B  1 188 ? 37.210  9.159   11.362  1.00 14.78 ? 187  ASP B CA  1 
ATOM   5936 C C   . ASP B  1 188 ? 37.175  10.648  11.743  1.00 14.79 ? 187  ASP B C   1 
ATOM   5937 O O   . ASP B  1 188 ? 36.304  11.086  12.499  1.00 14.96 ? 187  ASP B O   1 
ATOM   5938 C CB  . ASP B  1 188 ? 35.906  8.748   10.664  1.00 14.87 ? 187  ASP B CB  1 
ATOM   5939 C CG  . ASP B  1 188 ? 35.668  9.493   9.353   1.00 16.39 ? 187  ASP B CG  1 
ATOM   5940 O OD1 . ASP B  1 188 ? 34.635  9.212   8.706   1.00 16.37 ? 187  ASP B OD1 1 
ATOM   5941 O OD2 . ASP B  1 188 ? 36.417  10.403  8.910   1.00 16.49 ? 187  ASP B OD2 1 
ATOM   5942 N N   . GLY B  1 189 ? 38.124  11.412  11.218  1.00 14.22 ? 188  GLY B N   1 
ATOM   5943 C CA  . GLY B  1 189 ? 38.296  12.805  11.613  1.00 15.36 ? 188  GLY B CA  1 
ATOM   5944 C C   . GLY B  1 189 ? 37.122  13.705  11.256  1.00 15.48 ? 188  GLY B C   1 
ATOM   5945 O O   . GLY B  1 189 ? 36.985  14.791  11.804  1.00 16.68 ? 188  GLY B O   1 
ATOM   5946 N N   . THR B  1 190 ? 36.261  13.252  10.355  1.00 15.11 ? 189  THR B N   1 
ATOM   5947 C CA  . THR B  1 190 ? 34.982  13.923  10.125  1.00 15.57 ? 189  THR B CA  1 
ATOM   5948 C C   . THR B  1 190 ? 34.211  14.164  11.414  1.00 15.55 ? 189  THR B C   1 
ATOM   5949 O O   . THR B  1 190 ? 33.563  15.214  11.550  1.00 15.57 ? 189  THR B O   1 
ATOM   5950 C CB  . THR B  1 190 ? 34.134  13.044  9.214   1.00 15.08 ? 189  THR B CB  1 
ATOM   5951 O OG1 . THR B  1 190 ? 34.700  13.093  7.903   1.00 15.90 ? 189  THR B OG1 1 
ATOM   5952 C CG2 . THR B  1 190 ? 32.680  13.588  9.092   1.00 16.39 ? 189  THR B CG2 1 
ATOM   5953 N N   . HIS B  1 191 ? 34.246  13.177  12.321  1.00 15.68 ? 190  HIS B N   1 
ATOM   5954 C CA  . HIS B  1 191 ? 33.374  13.191  13.504  1.00 16.66 ? 190  HIS B CA  1 
ATOM   5955 C C   . HIS B  1 191 ? 33.746  14.355  14.424  1.00 17.16 ? 190  HIS B C   1 
ATOM   5956 O O   . HIS B  1 191 ? 32.892  15.207  14.716  1.00 17.16 ? 190  HIS B O   1 
ATOM   5957 C CB  . HIS B  1 191 ? 33.367  11.837  14.248  1.00 16.72 ? 190  HIS B CB  1 
ATOM   5958 C CG  . HIS B  1 191 ? 32.066  11.513  14.931  1.00 16.91 ? 190  HIS B CG  1 
ATOM   5959 N ND1 . HIS B  1 191 ? 30.930  12.288  14.812  1.00 18.56 ? 190  HIS B ND1 1 
ATOM   5960 C CD2 . HIS B  1 191 ? 31.729  10.480  15.736  1.00 17.25 ? 190  HIS B CD2 1 
ATOM   5961 C CE1 . HIS B  1 191 ? 29.949  11.741  15.514  1.00 15.17 ? 190  HIS B CE1 1 
ATOM   5962 N NE2 . HIS B  1 191 ? 30.407  10.639  16.077  1.00 21.62 ? 190  HIS B NE2 1 
ATOM   5963 N N   . ILE B  1 192 ? 35.015  14.427  14.827  1.00 16.87 ? 191  ILE B N   1 
ATOM   5964 C CA  . ILE B  1 192 ? 35.468  15.565  15.639  1.00 17.96 ? 191  ILE B CA  1 
ATOM   5965 C C   . ILE B  1 192 ? 35.457  16.884  14.866  1.00 18.28 ? 191  ILE B C   1 
ATOM   5966 O O   . ILE B  1 192 ? 35.073  17.921  15.422  1.00 18.24 ? 191  ILE B O   1 
ATOM   5967 C CB  . ILE B  1 192 ? 36.847  15.288  16.304  1.00 17.86 ? 191  ILE B CB  1 
ATOM   5968 C CG1 . ILE B  1 192 ? 37.164  16.351  17.365  1.00 18.70 ? 191  ILE B CG1 1 
ATOM   5969 C CG2 . ILE B  1 192 ? 37.993  15.265  15.282  1.00 18.05 ? 191  ILE B CG2 1 
ATOM   5970 C CD1 A ILE B  1 192 ? 36.164  16.431  18.478  0.50 15.12 ? 191  ILE B CD1 1 
ATOM   5971 C CD1 B ILE B  1 192 ? 37.701  15.803  18.666  0.50 18.47 ? 191  ILE B CD1 1 
ATOM   5972 N N   . ALA B  1 193 ? 35.864  16.864  13.594  1.00 18.26 ? 192  ALA B N   1 
ATOM   5973 C CA  . ALA B  1 193 ? 35.963  18.114  12.830  1.00 18.59 ? 192  ALA B CA  1 
ATOM   5974 C C   . ALA B  1 193 ? 34.614  18.814  12.686  1.00 19.81 ? 192  ALA B C   1 
ATOM   5975 O O   . ALA B  1 193 ? 34.495  20.025  12.926  1.00 20.51 ? 192  ALA B O   1 
ATOM   5976 C CB  . ALA B  1 193 ? 36.610  17.879  11.455  1.00 18.38 ? 192  ALA B CB  1 
ATOM   5977 N N   . LYS B  1 194 ? 33.581  18.063  12.325  1.00 20.32 ? 193  LYS B N   1 
ATOM   5978 C CA  . LYS B  1 194 ? 32.289  18.680  12.112  1.00 22.12 ? 193  LYS B CA  1 
ATOM   5979 C C   . LYS B  1 194 ? 31.636  19.090  13.449  1.00 22.40 ? 193  LYS B C   1 
ATOM   5980 O O   . LYS B  1 194 ? 30.854  20.032  13.489  1.00 23.11 ? 193  LYS B O   1 
ATOM   5981 C CB  . LYS B  1 194 ? 31.406  17.794  11.236  1.00 22.12 ? 193  LYS B CB  1 
ATOM   5982 C CG  . LYS B  1 194 ? 30.789  16.599  11.896  1.00 25.29 ? 193  LYS B CG  1 
ATOM   5983 C CD  . LYS B  1 194 ? 29.835  15.880  10.930  1.00 30.43 ? 193  LYS B CD  1 
ATOM   5984 C CE  . LYS B  1 194 ? 29.716  14.399  11.261  1.00 32.72 ? 193  LYS B CE  1 
ATOM   5985 N NZ  . LYS B  1 194 ? 28.363  14.048  11.746  1.00 34.76 ? 193  LYS B NZ  1 
ATOM   5986 N N   . THR B  1 195 ? 31.998  18.407  14.535  1.00 22.54 ? 194  THR B N   1 
ATOM   5987 C CA  . THR B  1 195 ? 31.543  18.796  15.872  1.00 23.33 ? 194  THR B CA  1 
ATOM   5988 C C   . THR B  1 195 ? 32.181  20.113  16.318  1.00 23.67 ? 194  THR B C   1 
ATOM   5989 O O   . THR B  1 195 ? 31.462  21.046  16.707  1.00 24.03 ? 194  THR B O   1 
ATOM   5990 C CB  . THR B  1 195 ? 31.820  17.680  16.889  1.00 23.23 ? 194  THR B CB  1 
ATOM   5991 O OG1 . THR B  1 195 ? 31.194  16.463  16.446  1.00 22.56 ? 194  THR B OG1 1 
ATOM   5992 C CG2 . THR B  1 195 ? 31.126  17.990  18.236  1.00 23.93 ? 194  THR B CG2 1 
ATOM   5993 N N   . LEU B  1 196 ? 33.510  20.198  16.231  1.00 24.06 ? 195  LEU B N   1 
ATOM   5994 C CA  . LEU B  1 196 ? 34.258  21.399  16.648  1.00 24.82 ? 195  LEU B CA  1 
ATOM   5995 C C   . LEU B  1 196 ? 33.908  22.650  15.823  1.00 25.56 ? 195  LEU B C   1 
ATOM   5996 O O   . LEU B  1 196 ? 33.971  23.774  16.336  1.00 25.30 ? 195  LEU B O   1 
ATOM   5997 C CB  . LEU B  1 196 ? 35.771  21.155  16.621  1.00 24.93 ? 195  LEU B CB  1 
ATOM   5998 C CG  . LEU B  1 196 ? 36.424  20.093  17.528  1.00 25.46 ? 195  LEU B CG  1 
ATOM   5999 C CD1 . LEU B  1 196 ? 37.904  19.977  17.213  1.00 24.87 ? 195  LEU B CD1 1 
ATOM   6000 C CD2 . LEU B  1 196 ? 36.217  20.358  19.009  1.00 25.30 ? 195  LEU B CD2 1 
ATOM   6001 N N   . ALA B  1 197 ? 33.532  22.465  14.557  1.00 25.93 ? 196  ALA B N   1 
ATOM   6002 C CA  . ALA B  1 197 ? 33.167  23.599  13.701  1.00 26.86 ? 196  ALA B CA  1 
ATOM   6003 C C   . ALA B  1 197 ? 31.946  24.383  14.207  1.00 27.41 ? 196  ALA B C   1 
ATOM   6004 O O   . ALA B  1 197 ? 31.779  25.556  13.858  1.00 28.37 ? 196  ALA B O   1 
ATOM   6005 C CB  . ALA B  1 197 ? 32.935  23.129  12.265  1.00 27.07 ? 196  ALA B CB  1 
ATOM   6006 N N   . SER B  1 198 ? 31.104  23.730  15.008  1.00 27.94 ? 197  SER B N   1 
ATOM   6007 C CA  . SER B  1 198 ? 29.865  24.319  15.520  1.00 29.06 ? 197  SER B CA  1 
ATOM   6008 C C   . SER B  1 198 ? 30.000  24.854  16.958  1.00 28.54 ? 197  SER B C   1 
ATOM   6009 O O   . SER B  1 198 ? 28.995  25.245  17.580  1.00 29.47 ? 197  SER B O   1 
ATOM   6010 C CB  . SER B  1 198 ? 28.716  23.301  15.448  1.00 29.59 ? 197  SER B CB  1 
ATOM   6011 O OG  . SER B  1 198 ? 28.908  22.353  14.403  1.00 33.19 ? 197  SER B OG  1 
ATOM   6012 N N   . LEU B  1 199 ? 31.234  24.904  17.464  1.00 27.61 ? 198  LEU B N   1 
ATOM   6013 C CA  . LEU B  1 199 ? 31.495  25.126  18.890  1.00 27.23 ? 198  LEU B CA  1 
ATOM   6014 C C   . LEU B  1 199 ? 32.409  26.324  19.172  1.00 26.31 ? 198  LEU B C   1 
ATOM   6015 O O   . LEU B  1 199 ? 33.248  26.692  18.347  1.00 25.43 ? 198  LEU B O   1 
ATOM   6016 C CB  . LEU B  1 199 ? 32.151  23.881  19.492  1.00 27.40 ? 198  LEU B CB  1 
ATOM   6017 C CG  . LEU B  1 199 ? 31.400  22.844  20.331  1.00 29.81 ? 198  LEU B CG  1 
ATOM   6018 C CD1 . LEU B  1 199 ? 29.901  22.795  20.083  1.00 29.71 ? 198  LEU B CD1 1 
ATOM   6019 C CD2 . LEU B  1 199 ? 32.048  21.470  20.160  1.00 30.15 ? 198  LEU B CD2 1 
ATOM   6020 N N   . SER B  1 200 ? 32.241  26.914  20.355  1.00 25.89 ? 199  SER B N   1 
ATOM   6021 C CA  . SER B  1 200 ? 33.187  27.910  20.870  1.00 25.85 ? 199  SER B CA  1 
ATOM   6022 C C   . SER B  1 200 ? 34.054  27.333  21.996  1.00 24.84 ? 199  SER B C   1 
ATOM   6023 O O   . SER B  1 200 ? 33.535  26.735  22.941  1.00 24.98 ? 199  SER B O   1 
ATOM   6024 C CB  . SER B  1 200 ? 32.450  29.143  21.393  1.00 26.29 ? 199  SER B CB  1 
ATOM   6025 O OG  . SER B  1 200 ? 33.388  30.055  21.952  1.00 27.06 ? 199  SER B OG  1 
ATOM   6026 N N   . PRO B  1 201 ? 35.372  27.512  21.913  1.00 24.44 ? 200  PRO B N   1 
ATOM   6027 C CA  . PRO B  1 201 ? 36.274  27.031  22.970  1.00 24.24 ? 200  PRO B CA  1 
ATOM   6028 C C   . PRO B  1 201 ? 35.954  27.664  24.335  1.00 24.04 ? 200  PRO B C   1 
ATOM   6029 O O   . PRO B  1 201 ? 36.241  27.064  25.370  1.00 24.04 ? 200  PRO B O   1 
ATOM   6030 C CB  . PRO B  1 201 ? 37.645  27.491  22.491  1.00 24.21 ? 200  PRO B CB  1 
ATOM   6031 C CG  . PRO B  1 201 ? 37.487  27.618  20.992  1.00 24.34 ? 200  PRO B CG  1 
ATOM   6032 C CD  . PRO B  1 201 ? 36.110  28.165  20.813  1.00 24.66 ? 200  PRO B CD  1 
ATOM   6033 N N   . GLU B  1 202 ? 35.357  28.850  24.311  1.00 24.36 ? 201  GLU B N   1 
ATOM   6034 C CA  . GLU B  1 202 ? 35.041  29.578  25.540  1.00 24.55 ? 201  GLU B CA  1 
ATOM   6035 C C   . GLU B  1 202 ? 33.923  28.935  26.358  1.00 23.99 ? 201  GLU B C   1 
ATOM   6036 O O   . GLU B  1 202 ? 33.879  29.091  27.582  1.00 24.04 ? 201  GLU B O   1 
ATOM   6037 C CB  . GLU B  1 202 ? 34.680  31.028  25.221  1.00 24.66 ? 201  GLU B CB  1 
ATOM   6038 C CG  . GLU B  1 202 ? 35.791  31.802  24.525  1.00 28.09 ? 201  GLU B CG  1 
ATOM   6039 C CD  . GLU B  1 202 ? 35.395  33.238  24.222  1.00 31.92 ? 201  GLU B CD  1 
ATOM   6040 O OE1 . GLU B  1 202 ? 34.914  33.941  25.145  1.00 33.59 ? 201  GLU B OE1 1 
ATOM   6041 O OE2 . GLU B  1 202 ? 35.566  33.672  23.059  1.00 33.73 ? 201  GLU B OE2 1 
ATOM   6042 N N   . THR B  1 203 ? 33.026  28.201  25.692  1.00 23.39 ? 202  THR B N   1 
ATOM   6043 C CA  . THR B  1 203 ? 31.807  27.709  26.344  1.00 22.35 ? 202  THR B CA  1 
ATOM   6044 C C   . THR B  1 203 ? 31.574  26.200  26.185  1.00 22.01 ? 202  THR B C   1 
ATOM   6045 O O   . THR B  1 203 ? 30.490  25.701  26.495  1.00 21.31 ? 202  THR B O   1 
ATOM   6046 C CB  . THR B  1 203 ? 30.578  28.507  25.854  1.00 22.29 ? 202  THR B CB  1 
ATOM   6047 O OG1 . THR B  1 203 ? 30.518  28.476  24.419  1.00 24.45 ? 202  THR B OG1 1 
ATOM   6048 C CG2 . THR B  1 203 ? 30.721  30.020  26.182  1.00 22.60 ? 202  THR B CG2 1 
ATOM   6049 N N   . SER B  1 204 ? 32.603  25.476  25.752  1.00 21.24 ? 203  SER B N   1 
ATOM   6050 C CA  . SER B  1 204 ? 32.503  24.024  25.561  1.00 22.06 ? 203  SER B CA  1 
ATOM   6051 C C   . SER B  1 204 ? 33.257  23.240  26.625  1.00 21.96 ? 203  SER B C   1 
ATOM   6052 O O   . SER B  1 204 ? 34.414  23.537  26.924  1.00 22.38 ? 203  SER B O   1 
ATOM   6053 C CB  . SER B  1 204 ? 33.031  23.632  24.174  1.00 22.00 ? 203  SER B CB  1 
ATOM   6054 O OG  . SER B  1 204 ? 32.232  24.201  23.158  1.00 21.85 ? 203  SER B OG  1 
ATOM   6055 N N   . LEU B  1 205 ? 32.596  22.224  27.175  1.00 21.87 ? 204  LEU B N   1 
ATOM   6056 C CA  . LEU B  1 205 ? 33.183  21.313  28.153  1.00 22.43 ? 204  LEU B CA  1 
ATOM   6057 C C   . LEU B  1 205 ? 33.276  19.912  27.555  1.00 22.23 ? 204  LEU B C   1 
ATOM   6058 O O   . LEU B  1 205 ? 32.251  19.342  27.143  1.00 21.90 ? 204  LEU B O   1 
ATOM   6059 C CB  . LEU B  1 205 ? 32.300  21.246  29.398  1.00 23.08 ? 204  LEU B CB  1 
ATOM   6060 C CG  . LEU B  1 205 ? 32.869  21.103  30.816  1.00 25.98 ? 204  LEU B CG  1 
ATOM   6061 C CD1 . LEU B  1 205 ? 31.810  20.523  31.760  1.00 26.15 ? 204  LEU B CD1 1 
ATOM   6062 C CD2 . LEU B  1 205 ? 34.169  20.337  30.925  1.00 27.74 ? 204  LEU B CD2 1 
ATOM   6063 N N   . PHE B  1 206 ? 34.487  19.359  27.551  1.00 21.46 ? 205  PHE B N   1 
ATOM   6064 C CA  . PHE B  1 206 ? 34.745  18.016  27.035  1.00 21.97 ? 205  PHE B CA  1 
ATOM   6065 C C   . PHE B  1 206 ? 34.784  16.972  28.157  1.00 21.90 ? 205  PHE B C   1 
ATOM   6066 O O   . PHE B  1 206 ? 35.430  17.176  29.196  1.00 22.62 ? 205  PHE B O   1 
ATOM   6067 C CB  . PHE B  1 206 ? 36.053  18.013  26.226  1.00 21.51 ? 205  PHE B CB  1 
ATOM   6068 C CG  . PHE B  1 206 ? 36.006  18.876  24.990  1.00 22.55 ? 205  PHE B CG  1 
ATOM   6069 C CD1 . PHE B  1 206 ? 36.439  20.203  25.019  1.00 22.26 ? 205  PHE B CD1 1 
ATOM   6070 C CD2 . PHE B  1 206 ? 35.553  18.350  23.781  1.00 21.97 ? 205  PHE B CD2 1 
ATOM   6071 C CE1 . PHE B  1 206 ? 36.401  20.998  23.879  1.00 24.04 ? 205  PHE B CE1 1 
ATOM   6072 C CE2 . PHE B  1 206 ? 35.501  19.132  22.636  1.00 22.48 ? 205  PHE B CE2 1 
ATOM   6073 C CZ  . PHE B  1 206 ? 35.931  20.458  22.674  1.00 22.38 ? 205  PHE B CZ  1 
ATOM   6074 N N   . ILE B  1 207 ? 34.066  15.865  27.955  1.00 21.81 ? 206  ILE B N   1 
ATOM   6075 C CA  . ILE B  1 207 ? 34.087  14.734  28.878  1.00 21.94 ? 206  ILE B CA  1 
ATOM   6076 C C   . ILE B  1 207 ? 34.800  13.585  28.178  1.00 22.48 ? 206  ILE B C   1 
ATOM   6077 O O   . ILE B  1 207 ? 34.288  13.058  27.180  1.00 22.15 ? 206  ILE B O   1 
ATOM   6078 C CB  . ILE B  1 207 ? 32.655  14.287  29.247  1.00 22.28 ? 206  ILE B CB  1 
ATOM   6079 C CG1 . ILE B  1 207 ? 31.875  15.431  29.891  1.00 22.13 ? 206  ILE B CG1 1 
ATOM   6080 C CG2 . ILE B  1 207 ? 32.695  13.047  30.146  1.00 22.68 ? 206  ILE B CG2 1 
ATOM   6081 C CD1 . ILE B  1 207 ? 30.407  15.148  30.031  1.00 25.00 ? 206  ILE B CD1 1 
ATOM   6082 N N   . ILE B  1 208 ? 35.966  13.194  28.686  1.00 22.36 ? 207  ILE B N   1 
ATOM   6083 C CA  . ILE B  1 208 ? 36.735  12.101  28.075  1.00 23.04 ? 207  ILE B CA  1 
ATOM   6084 C C   . ILE B  1 208 ? 36.418  10.795  28.784  1.00 24.17 ? 207  ILE B C   1 
ATOM   6085 O O   . ILE B  1 208 ? 36.792  10.600  29.939  1.00 23.79 ? 207  ILE B O   1 
ATOM   6086 C CB  . ILE B  1 208 ? 38.266  12.396  28.074  1.00 22.84 ? 207  ILE B CB  1 
ATOM   6087 C CG1 . ILE B  1 208 ? 38.565  13.849  27.651  1.00 22.34 ? 207  ILE B CG1 1 
ATOM   6088 C CG2 . ILE B  1 208 ? 39.006  11.415  27.165  1.00 21.95 ? 207  ILE B CG2 1 
ATOM   6089 C CD1 . ILE B  1 208 ? 38.000  14.293  26.306  1.00 22.35 ? 207  ILE B CD1 1 
ATOM   6090 N N   . ALA B  1 209 ? 35.703  9.905   28.097  1.00 25.39 ? 208  ALA B N   1 
ATOM   6091 C CA  . ALA B  1 209 ? 35.184  8.701   28.738  1.00 27.27 ? 208  ALA B CA  1 
ATOM   6092 C C   . ALA B  1 209 ? 35.964  7.461   28.322  1.00 29.08 ? 208  ALA B C   1 
ATOM   6093 O O   . ALA B  1 209 ? 35.876  7.023   27.162  1.00 29.19 ? 208  ALA B O   1 
ATOM   6094 C CB  . ALA B  1 209 ? 33.699  8.533   28.427  1.00 27.04 ? 208  ALA B CB  1 
ATOM   6095 N N   . SER B  1 210 ? 36.728  6.917   29.275  1.00 31.19 ? 209  SER B N   1 
ATOM   6096 C CA  . SER B  1 210 ? 37.580  5.734   29.064  1.00 33.26 ? 209  SER B CA  1 
ATOM   6097 C C   . SER B  1 210 ? 38.316  5.287   30.336  1.00 34.10 ? 209  SER B C   1 
ATOM   6098 O O   . SER B  1 210 ? 39.124  6.039   30.894  1.00 34.86 ? 209  SER B O   1 
ATOM   6099 C CB  . SER B  1 210 ? 38.622  6.009   27.982  1.00 32.90 ? 209  SER B CB  1 
ATOM   6100 O OG  . SER B  1 210 ? 39.591  4.976   27.928  1.00 34.82 ? 209  SER B OG  1 
ATOM   6101 N N   . LYS B  1 211 ? 38.073  4.040   30.732  1.00 35.67 ? 210  LYS B N   1 
ATOM   6102 C CA  . LYS B  1 211 ? 38.741  3.365   31.861  1.00 36.63 ? 210  LYS B CA  1 
ATOM   6103 C C   . LYS B  1 211 ? 40.263  3.576   31.963  1.00 37.23 ? 210  LYS B C   1 
ATOM   6104 O O   . LYS B  1 211 ? 40.756  4.103   32.969  1.00 37.82 ? 210  LYS B O   1 
ATOM   6105 C CB  . LYS B  1 211 ? 38.455  1.858   31.792  1.00 36.63 ? 210  LYS B CB  1 
ATOM   6106 C CG  . LYS B  1 211 ? 37.482  1.309   32.830  1.00 38.43 ? 210  LYS B CG  1 
ATOM   6107 C CD  . LYS B  1 211 ? 36.739  0.068   32.297  1.00 39.07 ? 210  LYS B CD  1 
ATOM   6108 C CE  . LYS B  1 211 ? 36.107  -0.754  33.427  1.00 40.19 ? 210  LYS B CE  1 
ATOM   6109 N NZ  . LYS B  1 211 ? 35.773  -2.144  33.012  1.00 40.09 ? 210  LYS B NZ  1 
ATOM   6110 N N   . THR B  1 212 ? 41.005  3.156   30.935  1.00 37.30 ? 211  THR B N   1 
ATOM   6111 C CA  . THR B  1 212 ? 42.470  3.189   30.973  1.00 37.29 ? 211  THR B CA  1 
ATOM   6112 C C   . THR B  1 212 ? 43.035  4.570   30.681  1.00 37.32 ? 211  THR B C   1 
ATOM   6113 O O   . THR B  1 212 ? 44.193  4.859   31.022  1.00 37.19 ? 211  THR B O   1 
ATOM   6114 C CB  . THR B  1 212 ? 43.069  2.198   29.955  1.00 37.65 ? 211  THR B CB  1 
ATOM   6115 O OG1 . THR B  1 212 ? 42.560  2.492   28.644  1.00 38.76 ? 211  THR B OG1 1 
ATOM   6116 C CG2 . THR B  1 212 ? 42.606  0.766   30.232  1.00 37.82 ? 211  THR B CG2 1 
ATOM   6117 N N   . PHE B  1 213 ? 42.225  5.412   30.035  1.00 36.70 ? 212  PHE B N   1 
ATOM   6118 C CA  . PHE B  1 213 ? 42.697  6.673   29.465  1.00 36.38 ? 212  PHE B CA  1 
ATOM   6119 C C   . PHE B  1 213 ? 43.865  6.457   28.483  1.00 36.25 ? 212  PHE B C   1 
ATOM   6120 O O   . PHE B  1 213 ? 44.750  7.318   28.355  1.00 36.24 ? 212  PHE B O   1 
ATOM   6121 C CB  . PHE B  1 213 ? 43.066  7.679   30.565  1.00 36.28 ? 212  PHE B CB  1 
ATOM   6122 C CG  . PHE B  1 213 ? 42.575  9.070   30.300  1.00 34.96 ? 212  PHE B CG  1 
ATOM   6123 C CD1 . PHE B  1 213 ? 41.217  9.371   30.385  1.00 34.55 ? 212  PHE B CD1 1 
ATOM   6124 C CD2 . PHE B  1 213 ? 43.468  10.078  29.966  1.00 34.68 ? 212  PHE B CD2 1 
ATOM   6125 C CE1 . PHE B  1 213 ? 40.764  10.649  30.138  1.00 33.03 ? 212  PHE B CE1 1 
ATOM   6126 C CE2 . PHE B  1 213 ? 43.023  11.371  29.721  1.00 34.96 ? 212  PHE B CE2 1 
ATOM   6127 C CZ  . PHE B  1 213 ? 41.662  11.655  29.805  1.00 34.86 ? 212  PHE B CZ  1 
ATOM   6128 N N   . THR B  1 214 ? 43.853  5.302   27.811  1.00 35.91 ? 213  THR B N   1 
ATOM   6129 C CA  . THR B  1 214 ? 44.799  4.972   26.725  1.00 36.00 ? 213  THR B CA  1 
ATOM   6130 C C   . THR B  1 214 ? 44.122  4.414   25.449  1.00 35.58 ? 213  THR B C   1 
ATOM   6131 O O   . THR B  1 214 ? 44.806  4.097   24.471  1.00 36.05 ? 213  THR B O   1 
ATOM   6132 C CB  . THR B  1 214 ? 45.939  4.007   27.206  1.00 36.01 ? 213  THR B CB  1 
ATOM   6133 O OG1 . THR B  1 214 ? 45.381  2.743   27.600  1.00 36.88 ? 213  THR B OG1 1 
ATOM   6134 C CG2 . THR B  1 214 ? 46.625  4.530   28.475  1.00 36.47 ? 213  THR B CG2 1 
ATOM   6135 N N   . THR B  1 215 ? 42.791  4.297   25.457  1.00 34.77 ? 214  THR B N   1 
ATOM   6136 C CA  . THR B  1 215 ? 42.018  3.798   24.305  1.00 33.23 ? 214  THR B CA  1 
ATOM   6137 C C   . THR B  1 215 ? 42.312  4.636   23.050  1.00 32.04 ? 214  THR B C   1 
ATOM   6138 O O   . THR B  1 215 ? 42.097  5.847   23.069  1.00 31.60 ? 214  THR B O   1 
ATOM   6139 C CB  . THR B  1 215 ? 40.507  3.886   24.615  1.00 34.00 ? 214  THR B CB  1 
ATOM   6140 O OG1 . THR B  1 215 ? 40.245  3.409   25.942  1.00 34.44 ? 214  THR B OG1 1 
ATOM   6141 C CG2 . THR B  1 215 ? 39.723  2.936   23.736  1.00 33.41 ? 214  THR B CG2 1 
ATOM   6142 N N   . GLN B  1 216 ? 42.774  4.007   21.960  1.00 30.39 ? 215  GLN B N   1 
ATOM   6143 C CA  . GLN B  1 216 ? 43.352  4.784   20.842  1.00 28.36 ? 215  GLN B CA  1 
ATOM   6144 C C   . GLN B  1 216 ? 42.420  5.825   20.211  1.00 26.93 ? 215  GLN B C   1 
ATOM   6145 O O   . GLN B  1 216 ? 42.799  6.987   20.076  1.00 25.72 ? 215  GLN B O   1 
ATOM   6146 C CB  . GLN B  1 216 ? 43.966  3.903   19.742  1.00 28.76 ? 215  GLN B CB  1 
ATOM   6147 C CG  . GLN B  1 216 ? 44.705  4.759   18.679  1.00 28.89 ? 215  GLN B CG  1 
ATOM   6148 C CD  . GLN B  1 216 ? 45.362  3.973   17.550  1.00 29.78 ? 215  GLN B CD  1 
ATOM   6149 O OE1 . GLN B  1 216 ? 46.407  4.381   17.047  1.00 32.14 ? 215  GLN B OE1 1 
ATOM   6150 N NE2 . GLN B  1 216 ? 44.737  2.891   17.122  1.00 29.43 ? 215  GLN B NE2 1 
ATOM   6151 N N   . GLU B  1 217 ? 41.220  5.407   19.823  1.00 25.29 ? 216  GLU B N   1 
ATOM   6152 C CA  . GLU B  1 217 ? 40.275  6.318   19.185  1.00 24.62 ? 216  GLU B CA  1 
ATOM   6153 C C   . GLU B  1 217 ? 39.927  7.501   20.089  1.00 23.29 ? 216  GLU B C   1 
ATOM   6154 O O   . GLU B  1 217 ? 39.930  8.648   19.648  1.00 22.55 ? 216  GLU B O   1 
ATOM   6155 C CB  . GLU B  1 217 ? 39.000  5.577   18.784  1.00 25.12 ? 216  GLU B CB  1 
ATOM   6156 C CG  . GLU B  1 217 ? 39.212  4.644   17.596  1.00 27.70 ? 216  GLU B CG  1 
ATOM   6157 C CD  . GLU B  1 217 ? 39.097  3.192   17.980  1.00 30.33 ? 216  GLU B CD  1 
ATOM   6158 O OE1 . GLU B  1 217 ? 38.463  2.439   17.213  1.00 32.37 ? 216  GLU B OE1 1 
ATOM   6159 O OE2 . GLU B  1 217 ? 39.625  2.812   19.051  1.00 31.02 ? 216  GLU B OE2 1 
ATOM   6160 N N   . THR B  1 218 ? 39.640  7.190   21.347  1.00 22.42 ? 217  THR B N   1 
ATOM   6161 C CA  . THR B  1 218 ? 39.193  8.167   22.338  1.00 21.87 ? 217  THR B CA  1 
ATOM   6162 C C   . THR B  1 218 ? 40.292  9.154   22.716  1.00 21.75 ? 217  THR B C   1 
ATOM   6163 O O   . THR B  1 218 ? 40.077  10.362  22.700  1.00 21.67 ? 217  THR B O   1 
ATOM   6164 C CB  . THR B  1 218 ? 38.680  7.424   23.576  1.00 22.06 ? 217  THR B CB  1 
ATOM   6165 O OG1 . THR B  1 218 ? 37.536  6.657   23.203  1.00 22.62 ? 217  THR B OG1 1 
ATOM   6166 C CG2 . THR B  1 218 ? 38.125  8.388   24.613  1.00 22.69 ? 217  THR B CG2 1 
ATOM   6167 N N   . ILE B  1 219 ? 41.472  8.633   23.033  1.00 22.08 ? 218  ILE B N   1 
ATOM   6168 C CA  . ILE B  1 219 ? 42.600  9.504   23.363  1.00 22.26 ? 218  ILE B CA  1 
ATOM   6169 C C   . ILE B  1 219 ? 43.053  10.359  22.177  1.00 21.46 ? 218  ILE B C   1 
ATOM   6170 O O   . ILE B  1 219 ? 43.359  11.537  22.345  1.00 20.73 ? 218  ILE B O   1 
ATOM   6171 C CB  . ILE B  1 219 ? 43.758  8.701   24.001  1.00 22.82 ? 218  ILE B CB  1 
ATOM   6172 C CG1 . ILE B  1 219 ? 43.283  8.007   25.285  1.00 24.87 ? 218  ILE B CG1 1 
ATOM   6173 C CG2 . ILE B  1 219 ? 44.951  9.610   24.317  1.00 24.53 ? 218  ILE B CG2 1 
ATOM   6174 C CD1 . ILE B  1 219 ? 42.601  8.937   26.312  1.00 26.71 ? 218  ILE B CD1 1 
ATOM   6175 N N   . THR B  1 220 ? 43.057  9.788   20.972  1.00 20.14 ? 219  THR B N   1 
ATOM   6176 C CA  . THR B  1 220 ? 43.364  10.585  19.780  1.00 19.37 ? 219  THR B CA  1 
ATOM   6177 C C   . THR B  1 220 ? 42.361  11.723  19.564  1.00 18.65 ? 219  THR B C   1 
ATOM   6178 O O   . THR B  1 220 ? 42.755  12.856  19.299  1.00 18.55 ? 219  THR B O   1 
ATOM   6179 C CB  . THR B  1 220 ? 43.434  9.687   18.542  1.00 19.17 ? 219  THR B CB  1 
ATOM   6180 O OG1 . THR B  1 220 ? 44.451  8.694   18.745  1.00 21.30 ? 219  THR B OG1 1 
ATOM   6181 C CG2 . THR B  1 220 ? 43.910  10.476  17.327  1.00 19.05 ? 219  THR B CG2 1 
ATOM   6182 N N   . ASN B  1 221 ? 41.065  11.413  19.653  1.00 18.32 ? 220  ASN B N   1 
ATOM   6183 C CA  . ASN B  1 221 ? 40.031  12.445  19.576  1.00 18.30 ? 220  ASN B CA  1 
ATOM   6184 C C   . ASN B  1 221 ? 40.188  13.516  20.678  1.00 19.33 ? 220  ASN B C   1 
ATOM   6185 O O   . ASN B  1 221 ? 40.021  14.706  20.420  1.00 19.52 ? 220  ASN B O   1 
ATOM   6186 C CB  . ASN B  1 221 ? 38.629  11.811  19.653  1.00 18.50 ? 220  ASN B CB  1 
ATOM   6187 C CG  . ASN B  1 221 ? 38.106  11.361  18.296  1.00 17.35 ? 220  ASN B CG  1 
ATOM   6188 O OD1 . ASN B  1 221 ? 38.366  11.984  17.273  1.00 18.11 ? 220  ASN B OD1 1 
ATOM   6189 N ND2 . ASN B  1 221 ? 37.345  10.269  18.295  1.00 17.01 ? 220  ASN B ND2 1 
ATOM   6190 N N   . ALA B  1 222 ? 40.493  13.058  21.888  1.00 19.92 ? 221  ALA B N   1 
ATOM   6191 C CA  . ALA B  1 222 ? 40.665  13.954  23.035  1.00 20.64 ? 221  ALA B CA  1 
ATOM   6192 C C   . ALA B  1 222 ? 41.861  14.881  22.833  1.00 20.84 ? 221  ALA B C   1 
ATOM   6193 O O   . ALA B  1 222 ? 41.788  16.080  23.154  1.00 21.00 ? 221  ALA B O   1 
ATOM   6194 C CB  . ALA B  1 222 ? 40.799  13.157  24.307  1.00 20.60 ? 221  ALA B CB  1 
ATOM   6195 N N   . GLU B  1 223 ? 42.944  14.344  22.266  1.00 21.45 ? 222  GLU B N   1 
ATOM   6196 C CA  . GLU B  1 223 ? 44.128  15.157  21.966  1.00 21.81 ? 222  GLU B CA  1 
ATOM   6197 C C   . GLU B  1 223 ? 43.875  16.184  20.863  1.00 21.93 ? 222  GLU B C   1 
ATOM   6198 O O   . GLU B  1 223 ? 44.373  17.312  20.918  1.00 21.48 ? 222  GLU B O   1 
ATOM   6199 C CB  . GLU B  1 223 ? 45.354  14.267  21.688  1.00 22.57 ? 222  GLU B CB  1 
ATOM   6200 C CG  . GLU B  1 223 ? 45.793  13.537  22.959  1.00 25.82 ? 222  GLU B CG  1 
ATOM   6201 C CD  . GLU B  1 223 ? 47.033  12.668  22.840  1.00 30.80 ? 222  GLU B CD  1 
ATOM   6202 O OE1 . GLU B  1 223 ? 47.701  12.469  23.883  1.00 33.97 ? 222  GLU B OE1 1 
ATOM   6203 O OE2 . GLU B  1 223 ? 47.336  12.154  21.751  1.00 33.66 ? 222  GLU B OE2 1 
ATOM   6204 N N   . THR B  1 224 ? 43.081  15.805  19.862  1.00 20.57 ? 223  THR B N   1 
ATOM   6205 C CA  . THR B  1 224 ? 42.667  16.741  18.843  1.00 20.71 ? 223  THR B CA  1 
ATOM   6206 C C   . THR B  1 224 ? 41.809  17.878  19.428  1.00 20.86 ? 223  THR B C   1 
ATOM   6207 O O   . THR B  1 224 ? 41.982  19.033  19.057  1.00 20.78 ? 223  THR B O   1 
ATOM   6208 C CB  . THR B  1 224 ? 41.946  15.958  17.724  1.00 20.59 ? 223  THR B CB  1 
ATOM   6209 O OG1 . THR B  1 224 ? 42.915  15.097  17.107  1.00 20.66 ? 223  THR B OG1 1 
ATOM   6210 C CG2 . THR B  1 224 ? 41.471  16.882  16.612  1.00 21.78 ? 223  THR B CG2 1 
ATOM   6211 N N   . ALA B  1 225 ? 40.900  17.547  20.346  1.00 20.87 ? 224  ALA B N   1 
ATOM   6212 C CA  . ALA B  1 225 ? 40.057  18.565  20.976  1.00 21.13 ? 224  ALA B CA  1 
ATOM   6213 C C   . ALA B  1 225 ? 40.909  19.534  21.815  1.00 21.85 ? 224  ALA B C   1 
ATOM   6214 O O   . ALA B  1 225 ? 40.658  20.733  21.835  1.00 22.19 ? 224  ALA B O   1 
ATOM   6215 C CB  . ALA B  1 225 ? 38.973  17.923  21.840  1.00 21.02 ? 224  ALA B CB  1 
ATOM   6216 N N   . LYS B  1 226 ? 41.927  18.999  22.466  1.00 22.59 ? 225  LYS B N   1 
ATOM   6217 C CA  . LYS B  1 226 ? 42.824  19.819  23.292  1.00 23.36 ? 225  LYS B CA  1 
ATOM   6218 C C   . LYS B  1 226 ? 43.636  20.793  22.429  1.00 23.83 ? 225  LYS B C   1 
ATOM   6219 O O   . LYS B  1 226 ? 43.795  21.973  22.774  1.00 23.62 ? 225  LYS B O   1 
ATOM   6220 C CB  . LYS B  1 226 ? 43.713  18.911  24.152  1.00 23.26 ? 225  LYS B CB  1 
ATOM   6221 C CG  . LYS B  1 226 ? 44.708  19.645  25.073  1.00 24.19 ? 225  LYS B CG  1 
ATOM   6222 C CD  . LYS B  1 226 ? 45.063  18.796  26.275  1.00 28.30 ? 225  LYS B CD  1 
ATOM   6223 C CE  . LYS B  1 226 ? 46.046  17.698  25.918  1.00 30.08 ? 225  LYS B CE  1 
ATOM   6224 N NZ  . LYS B  1 226 ? 47.156  17.621  26.920  1.00 32.27 ? 225  LYS B NZ  1 
ATOM   6225 N N   . GLU B  1 227 ? 44.125  20.308  21.291  1.00 24.37 ? 226  GLU B N   1 
ATOM   6226 C CA  . GLU B  1 227 ? 44.835  21.151  20.325  1.00 25.08 ? 226  GLU B CA  1 
ATOM   6227 C C   . GLU B  1 227 ? 44.004  22.326  19.785  1.00 24.89 ? 226  GLU B C   1 
ATOM   6228 O O   . GLU B  1 227 ? 44.502  23.451  19.712  1.00 24.98 ? 226  GLU B O   1 
ATOM   6229 C CB  . GLU B  1 227 ? 45.351  20.288  19.172  1.00 25.72 ? 226  GLU B CB  1 
ATOM   6230 C CG  . GLU B  1 227 ? 46.397  20.942  18.287  1.00 29.37 ? 226  GLU B CG  1 
ATOM   6231 C CD  . GLU B  1 227 ? 46.870  19.996  17.188  1.00 34.22 ? 226  GLU B CD  1 
ATOM   6232 O OE1 . GLU B  1 227 ? 46.277  20.011  16.094  1.00 35.70 ? 226  GLU B OE1 1 
ATOM   6233 O OE2 . GLU B  1 227 ? 47.824  19.230  17.420  1.00 37.75 ? 226  GLU B OE2 1 
ATOM   6234 N N   . TRP B  1 228 ? 42.750  22.057  19.414  1.00 23.76 ? 227  TRP B N   1 
ATOM   6235 C CA  . TRP B  1 228 ? 41.802  23.070  18.951  1.00 24.20 ? 227  TRP B CA  1 
ATOM   6236 C C   . TRP B  1 228 ? 41.532  24.077  20.073  1.00 24.37 ? 227  TRP B C   1 
ATOM   6237 O O   . TRP B  1 228 ? 41.509  25.288  19.836  1.00 24.26 ? 227  TRP B O   1 
ATOM   6238 C CB  . TRP B  1 228 ? 40.507  22.375  18.500  1.00 23.64 ? 227  TRP B CB  1 
ATOM   6239 C CG  . TRP B  1 228 ? 39.269  23.213  18.283  1.00 23.86 ? 227  TRP B CG  1 
ATOM   6240 C CD1 . TRP B  1 228 ? 38.856  23.789  17.116  1.00 23.28 ? 227  TRP B CD1 1 
ATOM   6241 C CD2 . TRP B  1 228 ? 38.237  23.482  19.243  1.00 23.04 ? 227  TRP B CD2 1 
ATOM   6242 N NE1 . TRP B  1 228 ? 37.653  24.430  17.296  1.00 24.55 ? 227  TRP B NE1 1 
ATOM   6243 C CE2 . TRP B  1 228 ? 37.247  24.248  18.595  1.00 23.76 ? 227  TRP B CE2 1 
ATOM   6244 C CE3 . TRP B  1 228 ? 38.054  23.154  20.603  1.00 22.71 ? 227  TRP B CE3 1 
ATOM   6245 C CZ2 . TRP B  1 228 ? 36.096  24.701  19.250  1.00 24.33 ? 227  TRP B CZ2 1 
ATOM   6246 C CZ3 . TRP B  1 228 ? 36.907  23.606  21.253  1.00 22.40 ? 227  TRP B CZ3 1 
ATOM   6247 C CH2 . TRP B  1 228 ? 35.940  24.362  20.577  1.00 23.51 ? 227  TRP B CH2 1 
ATOM   6248 N N   . PHE B  1 229 ? 41.352  23.560  21.283  1.00 25.10 ? 228  PHE B N   1 
ATOM   6249 C CA  . PHE B  1 229 ? 41.099  24.407  22.444  1.00 26.01 ? 228  PHE B CA  1 
ATOM   6250 C C   . PHE B  1 229 ? 42.269  25.359  22.719  1.00 26.81 ? 228  PHE B C   1 
ATOM   6251 O O   . PHE B  1 229 ? 42.060  26.554  22.959  1.00 27.14 ? 228  PHE B O   1 
ATOM   6252 C CB  . PHE B  1 229 ? 40.796  23.566  23.689  1.00 25.53 ? 228  PHE B CB  1 
ATOM   6253 C CG  . PHE B  1 229 ? 40.704  24.382  24.939  1.00 26.13 ? 228  PHE B CG  1 
ATOM   6254 C CD1 . PHE B  1 229 ? 39.571  25.151  25.193  1.00 26.70 ? 228  PHE B CD1 1 
ATOM   6255 C CD2 . PHE B  1 229 ? 41.766  24.417  25.837  1.00 27.52 ? 228  PHE B CD2 1 
ATOM   6256 C CE1 . PHE B  1 229 ? 39.486  25.939  26.340  1.00 26.81 ? 228  PHE B CE1 1 
ATOM   6257 C CE2 . PHE B  1 229 ? 41.689  25.202  26.997  1.00 27.69 ? 228  PHE B CE2 1 
ATOM   6258 C CZ  . PHE B  1 229 ? 40.548  25.956  27.241  1.00 26.94 ? 228  PHE B CZ  1 
ATOM   6259 N N   . LEU B  1 230 ? 43.486  24.827  22.682  1.00 27.80 ? 229  LEU B N   1 
ATOM   6260 C CA  . LEU B  1 230 ? 44.681  25.614  23.004  1.00 28.90 ? 229  LEU B CA  1 
ATOM   6261 C C   . LEU B  1 230 ? 45.033  26.647  21.936  1.00 29.86 ? 229  LEU B C   1 
ATOM   6262 O O   . LEU B  1 230 ? 45.705  27.638  22.240  1.00 30.03 ? 229  LEU B O   1 
ATOM   6263 C CB  . LEU B  1 230 ? 45.880  24.706  23.315  1.00 28.51 ? 229  LEU B CB  1 
ATOM   6264 C CG  . LEU B  1 230 ? 45.822  23.949  24.642  1.00 28.94 ? 229  LEU B CG  1 
ATOM   6265 C CD1 . LEU B  1 230 ? 47.015  23.010  24.809  1.00 28.65 ? 229  LEU B CD1 1 
ATOM   6266 C CD2 . LEU B  1 230 ? 45.707  24.915  25.826  1.00 30.31 ? 229  LEU B CD2 1 
ATOM   6267 N N   . GLU B  1 231 ? 44.566  26.449  20.700  1.00 30.50 ? 230  GLU B N   1 
ATOM   6268 C CA  . GLU B  1 231 ? 44.758  27.467  19.661  1.00 31.68 ? 230  GLU B CA  1 
ATOM   6269 C C   . GLU B  1 231 ? 44.065  28.783  20.045  1.00 31.72 ? 230  GLU B C   1 
ATOM   6270 O O   . GLU B  1 231 ? 44.566  29.868  19.743  1.00 31.38 ? 230  GLU B O   1 
ATOM   6271 C CB  . GLU B  1 231 ? 44.262  26.981  18.291  1.00 32.35 ? 230  GLU B CB  1 
ATOM   6272 C CG  . GLU B  1 231 ? 44.302  28.052  17.204  1.00 36.02 ? 230  GLU B CG  1 
ATOM   6273 C CD  . GLU B  1 231 ? 43.843  27.552  15.846  1.00 40.88 ? 230  GLU B CD  1 
ATOM   6274 O OE1 . GLU B  1 231 ? 44.713  27.337  14.967  1.00 43.13 ? 230  GLU B OE1 1 
ATOM   6275 O OE2 . GLU B  1 231 ? 42.612  27.381  15.654  1.00 43.25 ? 230  GLU B OE2 1 
ATOM   6276 N N   . ALA B  1 232 ? 42.916  28.670  20.705  1.00 31.67 ? 231  ALA B N   1 
ATOM   6277 C CA  . ALA B  1 232 ? 42.165  29.835  21.151  1.00 32.30 ? 231  ALA B CA  1 
ATOM   6278 C C   . ALA B  1 232 ? 42.635  30.305  22.531  1.00 32.69 ? 231  ALA B C   1 
ATOM   6279 O O   . ALA B  1 232 ? 42.860  31.503  22.744  1.00 32.48 ? 231  ALA B O   1 
ATOM   6280 C CB  . ALA B  1 232 ? 40.662  29.524  21.167  1.00 32.19 ? 231  ALA B CB  1 
ATOM   6281 N N   . ALA B  1 233 ? 42.791  29.359  23.456  1.00 33.15 ? 232  ALA B N   1 
ATOM   6282 C CA  . ALA B  1 233 ? 43.086  29.675  24.853  1.00 34.19 ? 232  ALA B CA  1 
ATOM   6283 C C   . ALA B  1 233 ? 44.537  30.080  25.091  1.00 35.00 ? 232  ALA B C   1 
ATOM   6284 O O   . ALA B  1 233 ? 44.804  30.952  25.927  1.00 35.05 ? 232  ALA B O   1 
ATOM   6285 C CB  . ALA B  1 233 ? 42.710  28.514  25.751  1.00 34.00 ? 232  ALA B CB  1 
ATOM   6286 N N   . LYS B  1 234 ? 45.460  29.437  24.372  1.00 35.85 ? 233  LYS B N   1 
ATOM   6287 C CA  . LYS B  1 234 ? 46.902  29.749  24.421  1.00 37.04 ? 233  LYS B CA  1 
ATOM   6288 C C   . LYS B  1 234 ? 47.529  29.612  25.815  1.00 37.46 ? 233  LYS B C   1 
ATOM   6289 O O   . LYS B  1 234 ? 48.589  30.185  26.080  1.00 38.02 ? 233  LYS B O   1 
ATOM   6290 C CB  . LYS B  1 234 ? 47.186  31.146  23.842  1.00 37.22 ? 233  LYS B CB  1 
ATOM   6291 C CG  . LYS B  1 234 ? 46.965  31.272  22.338  1.00 38.51 ? 233  LYS B CG  1 
ATOM   6292 C CD  . LYS B  1 234 ? 46.150  32.521  21.998  1.00 41.00 ? 233  LYS B CD  1 
ATOM   6293 C CE  . LYS B  1 234 ? 46.285  32.893  20.526  1.00 42.11 ? 233  LYS B CE  1 
ATOM   6294 N NZ  . LYS B  1 234 ? 45.437  34.078  20.165  1.00 43.36 ? 233  LYS B NZ  1 
ATOM   6295 N N   . ASP B  1 235 ? 46.877  28.858  26.699  1.00 37.59 ? 234  ASP B N   1 
ATOM   6296 C CA  . ASP B  1 235 ? 47.342  28.687  28.076  1.00 37.71 ? 234  ASP B CA  1 
ATOM   6297 C C   . ASP B  1 235 ? 47.047  27.281  28.616  1.00 37.38 ? 234  ASP B C   1 
ATOM   6298 O O   . ASP B  1 235 ? 45.888  26.943  28.859  1.00 37.25 ? 234  ASP B O   1 
ATOM   6299 C CB  . ASP B  1 235 ? 46.732  29.769  28.986  1.00 38.08 ? 234  ASP B CB  1 
ATOM   6300 C CG  . ASP B  1 235 ? 46.944  29.488  30.474  1.00 39.71 ? 234  ASP B CG  1 
ATOM   6301 O OD1 . ASP B  1 235 ? 46.075  29.877  31.285  1.00 42.66 ? 234  ASP B OD1 1 
ATOM   6302 O OD2 . ASP B  1 235 ? 47.938  28.892  30.936  1.00 40.91 ? 234  ASP B OD2 1 
ATOM   6303 N N   . PRO B  1 236 ? 48.097  26.474  28.797  1.00 36.95 ? 235  PRO B N   1 
ATOM   6304 C CA  . PRO B  1 236 ? 47.978  25.085  29.279  1.00 36.82 ? 235  PRO B CA  1 
ATOM   6305 C C   . PRO B  1 236 ? 47.152  24.893  30.548  1.00 36.36 ? 235  PRO B C   1 
ATOM   6306 O O   . PRO B  1 236 ? 46.487  23.860  30.688  1.00 36.32 ? 235  PRO B O   1 
ATOM   6307 C CB  . PRO B  1 236 ? 49.435  24.680  29.544  1.00 36.79 ? 235  PRO B CB  1 
ATOM   6308 C CG  . PRO B  1 236 ? 50.228  25.521  28.621  1.00 37.28 ? 235  PRO B CG  1 
ATOM   6309 C CD  . PRO B  1 236 ? 49.495  26.827  28.492  1.00 37.18 ? 235  PRO B CD  1 
ATOM   6310 N N   . SER B  1 237 ? 47.185  25.865  31.455  1.00 35.64 ? 236  SER B N   1 
ATOM   6311 C CA  . SER B  1 237 ? 46.424  25.768  32.702  1.00 35.23 ? 236  SER B CA  1 
ATOM   6312 C C   . SER B  1 237 ? 44.901  25.898  32.507  1.00 34.45 ? 236  SER B C   1 
ATOM   6313 O O   . SER B  1 237 ? 44.129  25.534  33.400  1.00 34.80 ? 236  SER B O   1 
ATOM   6314 C CB  . SER B  1 237 ? 46.929  26.796  33.721  1.00 35.35 ? 236  SER B CB  1 
ATOM   6315 O OG  . SER B  1 237 ? 46.756  28.115  33.234  1.00 36.26 ? 236  SER B OG  1 
ATOM   6316 N N   . ALA B  1 238 ? 44.479  26.402  31.347  1.00 33.51 ? 237  ALA B N   1 
ATOM   6317 C CA  . ALA B  1 238 ? 43.052  26.571  31.039  1.00 32.18 ? 237  ALA B CA  1 
ATOM   6318 C C   . ALA B  1 238 ? 42.351  25.251  30.677  1.00 31.42 ? 237  ALA B C   1 
ATOM   6319 O O   . ALA B  1 238 ? 41.119  25.180  30.687  1.00 30.98 ? 237  ALA B O   1 
ATOM   6320 C CB  . ALA B  1 238 ? 42.852  27.608  29.936  1.00 32.31 ? 237  ALA B CB  1 
ATOM   6321 N N   . VAL B  1 239 ? 43.138  24.212  30.385  1.00 30.55 ? 238  VAL B N   1 
ATOM   6322 C CA  . VAL B  1 239 ? 42.606  22.885  30.045  1.00 29.45 ? 238  VAL B CA  1 
ATOM   6323 C C   . VAL B  1 239 ? 41.717  22.336  31.168  1.00 29.24 ? 238  VAL B C   1 
ATOM   6324 O O   . VAL B  1 239 ? 40.661  21.752  30.906  1.00 28.36 ? 238  VAL B O   1 
ATOM   6325 C CB  . VAL B  1 239 ? 43.757  21.890  29.669  1.00 29.83 ? 238  VAL B CB  1 
ATOM   6326 C CG1 . VAL B  1 239 ? 43.281  20.432  29.645  1.00 29.42 ? 238  VAL B CG1 1 
ATOM   6327 C CG2 . VAL B  1 239 ? 44.367  22.262  28.326  1.00 29.51 ? 238  VAL B CG2 1 
ATOM   6328 N N   . ALA B  1 240 ? 42.125  22.571  32.417  1.00 28.14 ? 239  ALA B N   1 
ATOM   6329 C CA  . ALA B  1 240 ? 41.408  22.049  33.588  1.00 27.74 ? 239  ALA B CA  1 
ATOM   6330 C C   . ALA B  1 240 ? 39.978  22.587  33.732  1.00 27.02 ? 239  ALA B C   1 
ATOM   6331 O O   . ALA B  1 240 ? 39.151  21.992  34.430  1.00 27.05 ? 239  ALA B O   1 
ATOM   6332 C CB  . ALA B  1 240 ? 42.219  22.309  34.874  1.00 27.91 ? 239  ALA B CB  1 
ATOM   6333 N N   . LYS B  1 241 ? 39.684  23.705  33.078  1.00 26.59 ? 240  LYS B N   1 
ATOM   6334 C CA  . LYS B  1 241 ? 38.339  24.272  33.117  1.00 26.37 ? 240  LYS B CA  1 
ATOM   6335 C C   . LYS B  1 241 ? 37.423  23.718  32.022  1.00 26.00 ? 240  LYS B C   1 
ATOM   6336 O O   . LYS B  1 241 ? 36.222  23.998  32.028  1.00 25.79 ? 240  LYS B O   1 
ATOM   6337 C CB  . LYS B  1 241 ? 38.384  25.797  33.012  1.00 26.98 ? 240  LYS B CB  1 
ATOM   6338 C CG  . LYS B  1 241 ? 39.288  26.490  34.034  1.00 28.06 ? 240  LYS B CG  1 
ATOM   6339 C CD  . LYS B  1 241 ? 39.225  27.993  33.862  1.00 31.31 ? 240  LYS B CD  1 
ATOM   6340 C CE  . LYS B  1 241 ? 40.291  28.688  34.685  1.00 32.87 ? 240  LYS B CE  1 
ATOM   6341 N NZ  . LYS B  1 241 ? 40.134  30.156  34.580  1.00 33.20 ? 240  LYS B NZ  1 
ATOM   6342 N N   . HIS B  1 242 ? 37.994  22.956  31.085  1.00 24.74 ? 241  HIS B N   1 
ATOM   6343 C CA  . HIS B  1 242 ? 37.266  22.536  29.885  1.00 24.29 ? 241  HIS B CA  1 
ATOM   6344 C C   . HIS B  1 242 ? 37.354  21.046  29.582  1.00 24.00 ? 241  HIS B C   1 
ATOM   6345 O O   . HIS B  1 242 ? 36.780  20.592  28.592  1.00 23.54 ? 241  HIS B O   1 
ATOM   6346 C CB  . HIS B  1 242 ? 37.744  23.345  28.673  1.00 23.99 ? 241  HIS B CB  1 
ATOM   6347 C CG  . HIS B  1 242 ? 37.346  24.784  28.725  1.00 23.78 ? 241  HIS B CG  1 
ATOM   6348 N ND1 . HIS B  1 242 ? 36.164  25.248  28.195  1.00 23.02 ? 241  HIS B ND1 1 
ATOM   6349 C CD2 . HIS B  1 242 ? 37.962  25.863  29.272  1.00 23.81 ? 241  HIS B CD2 1 
ATOM   6350 C CE1 . HIS B  1 242 ? 36.075  26.552  28.394  1.00 23.44 ? 241  HIS B CE1 1 
ATOM   6351 N NE2 . HIS B  1 242 ? 37.155  26.948  29.045  1.00 22.81 ? 241  HIS B NE2 1 
ATOM   6352 N N   . PHE B  1 243 ? 38.077  20.299  30.413  1.00 23.62 ? 242  PHE B N   1 
ATOM   6353 C CA  . PHE B  1 243 ? 38.229  18.851  30.239  1.00 23.69 ? 242  PHE B CA  1 
ATOM   6354 C C   . PHE B  1 243 ? 38.053  18.120  31.560  1.00 23.70 ? 242  PHE B C   1 
ATOM   6355 O O   . PHE B  1 243 ? 38.683  18.476  32.567  1.00 24.29 ? 242  PHE B O   1 
ATOM   6356 C CB  . PHE B  1 243 ? 39.598  18.504  29.638  1.00 23.48 ? 242  PHE B CB  1 
ATOM   6357 C CG  . PHE B  1 243 ? 39.739  18.880  28.197  1.00 22.77 ? 242  PHE B CG  1 
ATOM   6358 C CD1 . PHE B  1 243 ? 39.996  20.197  27.825  1.00 20.51 ? 242  PHE B CD1 1 
ATOM   6359 C CD2 . PHE B  1 243 ? 39.630  17.907  27.203  1.00 23.11 ? 242  PHE B CD2 1 
ATOM   6360 C CE1 . PHE B  1 243 ? 40.123  20.558  26.495  1.00 22.87 ? 242  PHE B CE1 1 
ATOM   6361 C CE2 . PHE B  1 243 ? 39.758  18.252  25.875  1.00 22.68 ? 242  PHE B CE2 1 
ATOM   6362 C CZ  . PHE B  1 243 ? 40.004  19.579  25.509  1.00 22.44 ? 242  PHE B CZ  1 
ATOM   6363 N N   . VAL B  1 244 ? 37.181  17.115  31.559  1.00 23.46 ? 243  VAL B N   1 
ATOM   6364 C CA  . VAL B  1 244 ? 37.013  16.204  32.695  1.00 23.19 ? 243  VAL B CA  1 
ATOM   6365 C C   . VAL B  1 244 ? 37.139  14.756  32.209  1.00 23.98 ? 243  VAL B C   1 
ATOM   6366 O O   . VAL B  1 244 ? 37.003  14.491  31.002  1.00 23.37 ? 243  VAL B O   1 
ATOM   6367 C CB  . VAL B  1 244 ? 35.663  16.436  33.461  1.00 23.54 ? 243  VAL B CB  1 
ATOM   6368 C CG1 . VAL B  1 244 ? 35.513  17.901  33.884  1.00 23.47 ? 243  VAL B CG1 1 
ATOM   6369 C CG2 . VAL B  1 244 ? 34.465  15.995  32.641  1.00 22.65 ? 243  VAL B CG2 1 
ATOM   6370 N N   . ALA B  1 245 ? 37.401  13.832  33.135  1.00 23.82 ? 244  ALA B N   1 
ATOM   6371 C CA  . ALA B  1 245 ? 37.639  12.428  32.801  1.00 24.71 ? 244  ALA B CA  1 
ATOM   6372 C C   . ALA B  1 245 ? 36.720  11.469  33.551  1.00 25.25 ? 244  ALA B C   1 
ATOM   6373 O O   . ALA B  1 245 ? 36.378  11.701  34.703  1.00 24.95 ? 244  ALA B O   1 
ATOM   6374 C CB  . ALA B  1 245 ? 39.090  12.060  33.061  1.00 24.64 ? 244  ALA B CB  1 
ATOM   6375 N N   . LEU B  1 246 ? 36.306  10.406  32.864  1.00 25.68 ? 245  LEU B N   1 
ATOM   6376 C CA  . LEU B  1 246 ? 35.620  9.271   33.475  1.00 26.70 ? 245  LEU B CA  1 
ATOM   6377 C C   . LEU B  1 246 ? 36.573  8.084   33.301  1.00 28.84 ? 245  LEU B C   1 
ATOM   6378 O O   . LEU B  1 246 ? 36.619  7.466   32.228  1.00 28.61 ? 245  LEU B O   1 
ATOM   6379 C CB  . LEU B  1 246 ? 34.257  9.016   32.806  1.00 26.03 ? 245  LEU B CB  1 
ATOM   6380 C CG  . LEU B  1 246 ? 33.387  10.254  32.537  1.00 24.59 ? 245  LEU B CG  1 
ATOM   6381 C CD1 . LEU B  1 246 ? 32.103  9.883   31.811  1.00 24.41 ? 245  LEU B CD1 1 
ATOM   6382 C CD2 . LEU B  1 246 ? 33.066  11.048  33.825  1.00 24.80 ? 245  LEU B CD2 1 
ATOM   6383 N N   . SER B  1 247 ? 37.341  7.798   34.361  1.00 31.09 ? 246  SER B N   1 
ATOM   6384 C CA  . SER B  1 247 ? 38.568  6.980   34.298  1.00 33.30 ? 246  SER B CA  1 
ATOM   6385 C C   . SER B  1 247 ? 39.097  6.618   35.712  1.00 34.84 ? 246  SER B C   1 
ATOM   6386 O O   . SER B  1 247 ? 38.595  7.142   36.718  1.00 35.74 ? 246  SER B O   1 
ATOM   6387 C CB  . SER B  1 247 ? 39.652  7.748   33.536  1.00 32.98 ? 246  SER B CB  1 
ATOM   6388 O OG  . SER B  1 247 ? 40.845  6.991   33.408  1.00 34.07 ? 246  SER B OG  1 
ATOM   6389 N N   . THR B  1 248 ? 40.081  5.714   35.791  1.00 36.16 ? 247  THR B N   1 
ATOM   6390 C CA  . THR B  1 248 ? 40.808  5.457   37.049  1.00 37.50 ? 247  THR B CA  1 
ATOM   6391 C C   . THR B  1 248 ? 42.308  5.778   36.949  1.00 38.23 ? 247  THR B C   1 
ATOM   6392 O O   . THR B  1 248 ? 43.020  5.787   37.960  1.00 38.42 ? 247  THR B O   1 
ATOM   6393 C CB  . THR B  1 248 ? 40.625  3.995   37.561  1.00 37.26 ? 247  THR B CB  1 
ATOM   6394 O OG1 . THR B  1 248 ? 40.797  3.064   36.485  1.00 37.39 ? 247  THR B OG1 1 
ATOM   6395 C CG2 . THR B  1 248 ? 39.204  3.746   38.043  1.00 38.21 ? 247  THR B CG2 1 
ATOM   6396 N N   . ASN B  1 249 ? 42.783  6.041   35.735  1.00 39.15 ? 248  ASN B N   1 
ATOM   6397 C CA  . ASN B  1 249 ? 44.202  6.298   35.518  1.00 40.35 ? 248  ASN B CA  1 
ATOM   6398 C C   . ASN B  1 249 ? 44.638  7.718   35.899  1.00 40.78 ? 248  ASN B C   1 
ATOM   6399 O O   . ASN B  1 249 ? 44.805  8.590   35.038  1.00 40.88 ? 248  ASN B O   1 
ATOM   6400 C CB  . ASN B  1 249 ? 44.590  5.977   34.075  1.00 40.57 ? 248  ASN B CB  1 
ATOM   6401 C CG  . ASN B  1 249 ? 46.085  5.811   33.899  1.00 41.42 ? 248  ASN B CG  1 
ATOM   6402 O OD1 . ASN B  1 249 ? 46.884  6.512   34.528  1.00 41.91 ? 248  ASN B OD1 1 
ATOM   6403 N ND2 . ASN B  1 249 ? 46.473  4.883   33.033  1.00 42.20 ? 248  ASN B ND2 1 
ATOM   6404 N N   . THR B  1 250 ? 44.857  7.924   37.193  1.00 40.97 ? 249  THR B N   1 
ATOM   6405 C CA  . THR B  1 250 ? 45.158  9.246   37.745  1.00 41.63 ? 249  THR B CA  1 
ATOM   6406 C C   . THR B  1 250 ? 46.321  9.978   37.050  1.00 41.88 ? 249  THR B C   1 
ATOM   6407 O O   . THR B  1 250 ? 46.198  11.161  36.711  1.00 41.96 ? 249  THR B O   1 
ATOM   6408 C CB  . THR B  1 250 ? 45.386  9.135   39.277  1.00 41.61 ? 249  THR B CB  1 
ATOM   6409 O OG1 . THR B  1 250 ? 44.223  8.557   39.885  1.00 41.30 ? 249  THR B OG1 1 
ATOM   6410 C CG2 . THR B  1 250 ? 45.472  10.515  39.924  1.00 41.86 ? 249  THR B CG2 1 
ATOM   6411 N N   . ALA B  1 251 ? 47.425  9.269   36.820  1.00 42.21 ? 250  ALA B N   1 
ATOM   6412 C CA  . ALA B  1 251 ? 48.615  9.868   36.209  1.00 42.41 ? 250  ALA B CA  1 
ATOM   6413 C C   . ALA B  1 251 ? 48.365  10.377  34.780  1.00 42.48 ? 250  ALA B C   1 
ATOM   6414 O O   . ALA B  1 251 ? 48.703  11.515  34.454  1.00 42.58 ? 250  ALA B O   1 
ATOM   6415 C CB  . ALA B  1 251 ? 49.799  8.887   36.248  1.00 42.31 ? 250  ALA B CB  1 
ATOM   6416 N N   . LYS B  1 252 ? 47.759  9.537   33.944  1.00 42.56 ? 251  LYS B N   1 
ATOM   6417 C CA  . LYS B  1 252 ? 47.479  9.894   32.550  1.00 42.82 ? 251  LYS B CA  1 
ATOM   6418 C C   . LYS B  1 252 ? 46.526  11.091  32.439  1.00 42.51 ? 251  LYS B C   1 
ATOM   6419 O O   . LYS B  1 252 ? 46.726  11.974  31.594  1.00 42.21 ? 251  LYS B O   1 
ATOM   6420 C CB  . LYS B  1 252 ? 46.930  8.689   31.771  1.00 42.81 ? 251  LYS B CB  1 
ATOM   6421 C CG  . LYS B  1 252 ? 47.956  7.568   31.545  1.00 43.93 ? 251  LYS B CG  1 
ATOM   6422 C CD  . LYS B  1 252 ? 48.999  7.917   30.483  1.00 45.09 ? 251  LYS B CD  1 
ATOM   6423 C CE  . LYS B  1 252 ? 49.561  6.663   29.829  1.00 45.73 ? 251  LYS B CE  1 
ATOM   6424 N NZ  . LYS B  1 252 ? 50.915  6.307   30.346  1.00 46.54 ? 251  LYS B NZ  1 
ATOM   6425 N N   . VAL B  1 253 ? 45.514  11.107  33.310  1.00 42.09 ? 252  VAL B N   1 
ATOM   6426 C CA  . VAL B  1 253 ? 44.552  12.199  33.407  1.00 41.97 ? 252  VAL B CA  1 
ATOM   6427 C C   . VAL B  1 253 ? 45.263  13.498  33.800  1.00 42.39 ? 252  VAL B C   1 
ATOM   6428 O O   . VAL B  1 253 ? 45.000  14.566  33.217  1.00 42.04 ? 252  VAL B O   1 
ATOM   6429 C CB  . VAL B  1 253 ? 43.407  11.859  34.423  1.00 42.19 ? 252  VAL B CB  1 
ATOM   6430 C CG1 . VAL B  1 253 ? 42.414  13.006  34.557  1.00 41.55 ? 252  VAL B CG1 1 
ATOM   6431 C CG2 . VAL B  1 253 ? 42.671  10.585  34.018  1.00 41.46 ? 252  VAL B CG2 1 
ATOM   6432 N N   . LYS B  1 254 ? 46.171  13.397  34.775  1.00 42.56 ? 253  LYS B N   1 
ATOM   6433 C CA  . LYS B  1 254 ? 46.973  14.541  35.218  1.00 43.08 ? 253  LYS B CA  1 
ATOM   6434 C C   . LYS B  1 254 ? 47.898  15.045  34.108  1.00 43.00 ? 253  LYS B C   1 
ATOM   6435 O O   . LYS B  1 254 ? 47.999  16.258  33.891  1.00 43.10 ? 253  LYS B O   1 
ATOM   6436 C CB  . LYS B  1 254 ? 47.779  14.201  36.485  1.00 43.27 ? 253  LYS B CB  1 
ATOM   6437 C CG  . LYS B  1 254 ? 46.970  14.275  37.787  1.00 44.66 ? 253  LYS B CG  1 
ATOM   6438 C CD  . LYS B  1 254 ? 47.848  14.576  39.005  1.00 46.92 ? 253  LYS B CD  1 
ATOM   6439 C CE  . LYS B  1 254 ? 47.697  13.500  40.082  1.00 48.08 ? 253  LYS B CE  1 
ATOM   6440 N NZ  . LYS B  1 254 ? 47.247  14.036  41.410  1.00 48.96 ? 253  LYS B NZ  1 
ATOM   6441 N N   . GLU B  1 255 ? 48.548  14.116  33.399  1.00 42.93 ? 254  GLU B N   1 
ATOM   6442 C CA  . GLU B  1 255 ? 49.447  14.462  32.287  1.00 42.96 ? 254  GLU B CA  1 
ATOM   6443 C C   . GLU B  1 255 ? 48.718  15.144  31.126  1.00 42.39 ? 254  GLU B C   1 
ATOM   6444 O O   . GLU B  1 255 ? 49.299  15.982  30.423  1.00 41.86 ? 254  GLU B O   1 
ATOM   6445 C CB  . GLU B  1 255 ? 50.194  13.227  31.772  1.00 43.47 ? 254  GLU B CB  1 
ATOM   6446 C CG  . GLU B  1 255 ? 51.685  13.462  31.547  1.00 45.60 ? 254  GLU B CG  1 
ATOM   6447 C CD  . GLU B  1 255 ? 52.267  12.569  30.462  1.00 48.62 ? 254  GLU B CD  1 
ATOM   6448 O OE1 . GLU B  1 255 ? 52.706  13.107  29.416  1.00 49.99 ? 254  GLU B OE1 1 
ATOM   6449 O OE2 . GLU B  1 255 ? 52.287  11.328  30.655  1.00 50.36 ? 254  GLU B OE2 1 
ATOM   6450 N N   . PHE B  1 256 ? 47.449  14.776  30.939  1.00 41.68 ? 255  PHE B N   1 
ATOM   6451 C CA  . PHE B  1 256 ? 46.595  15.388  29.929  1.00 41.36 ? 255  PHE B CA  1 
ATOM   6452 C C   . PHE B  1 256 ? 46.354  16.867  30.256  1.00 41.21 ? 255  PHE B C   1 
ATOM   6453 O O   . PHE B  1 256 ? 46.200  17.696  29.355  1.00 41.01 ? 255  PHE B O   1 
ATOM   6454 C CB  . PHE B  1 256 ? 45.270  14.623  29.834  1.00 41.51 ? 255  PHE B CB  1 
ATOM   6455 C CG  . PHE B  1 256 ? 44.471  14.931  28.596  1.00 41.14 ? 255  PHE B CG  1 
ATOM   6456 C CD1 . PHE B  1 256 ? 44.660  14.195  27.425  1.00 40.93 ? 255  PHE B CD1 1 
ATOM   6457 C CD2 . PHE B  1 256 ? 43.525  15.958  28.602  1.00 40.36 ? 255  PHE B CD2 1 
ATOM   6458 C CE1 . PHE B  1 256 ? 43.920  14.482  26.277  1.00 39.76 ? 255  PHE B CE1 1 
ATOM   6459 C CE2 . PHE B  1 256 ? 42.782  16.254  27.461  1.00 40.40 ? 255  PHE B CE2 1 
ATOM   6460 C CZ  . PHE B  1 256 ? 42.983  15.517  26.293  1.00 39.39 ? 255  PHE B CZ  1 
ATOM   6461 N N   . GLY B  1 257 ? 46.341  17.191  31.548  1.00 40.94 ? 256  GLY B N   1 
ATOM   6462 C CA  . GLY B  1 257 ? 46.084  18.546  32.006  1.00 40.96 ? 256  GLY B CA  1 
ATOM   6463 C C   . GLY B  1 257 ? 44.782  18.679  32.772  1.00 40.89 ? 256  GLY B C   1 
ATOM   6464 O O   . GLY B  1 257 ? 44.356  19.791  33.096  1.00 41.02 ? 256  GLY B O   1 
ATOM   6465 N N   . ILE B  1 258 ? 44.154  17.544  33.066  1.00 41.04 ? 257  ILE B N   1 
ATOM   6466 C CA  . ILE B  1 258 ? 42.885  17.521  33.787  1.00 40.88 ? 257  ILE B CA  1 
ATOM   6467 C C   . ILE B  1 258 ? 43.129  17.491  35.294  1.00 41.25 ? 257  ILE B C   1 
ATOM   6468 O O   . ILE B  1 258 ? 43.868  16.638  35.802  1.00 41.78 ? 257  ILE B O   1 
ATOM   6469 C CB  . ILE B  1 258 ? 42.006  16.307  33.347  1.00 40.99 ? 257  ILE B CB  1 
ATOM   6470 C CG1 . ILE B  1 258 ? 41.741  16.345  31.835  1.00 40.07 ? 257  ILE B CG1 1 
ATOM   6471 C CG2 . ILE B  1 258 ? 40.689  16.258  34.147  1.00 40.47 ? 257  ILE B CG2 1 
ATOM   6472 C CD1 . ILE B  1 258 ? 41.083  15.077  31.277  1.00 39.02 ? 257  ILE B CD1 1 
ATOM   6473 N N   . ASP B  1 259 ? 42.512  18.436  35.995  1.00 41.15 ? 258  ASP B N   1 
ATOM   6474 C CA  . ASP B  1 259 ? 42.499  18.438  37.453  1.00 41.20 ? 258  ASP B CA  1 
ATOM   6475 C C   . ASP B  1 259 ? 41.993  17.067  37.934  1.00 40.83 ? 258  ASP B C   1 
ATOM   6476 O O   . ASP B  1 259 ? 40.872  16.670  37.600  1.00 40.90 ? 258  ASP B O   1 
ATOM   6477 C CB  . ASP B  1 259 ? 41.594  19.572  37.958  1.00 41.39 ? 258  ASP B CB  1 
ATOM   6478 C CG  . ASP B  1 259 ? 41.809  19.897  39.429  1.00 42.30 ? 258  ASP B CG  1 
ATOM   6479 O OD1 . ASP B  1 259 ? 41.985  18.963  40.241  1.00 42.89 ? 258  ASP B OD1 1 
ATOM   6480 O OD2 . ASP B  1 259 ? 41.804  21.070  39.867  1.00 44.14 ? 258  ASP B OD2 1 
ATOM   6481 N N   . PRO B  1 260 ? 42.814  16.338  38.695  1.00 40.57 ? 259  PRO B N   1 
ATOM   6482 C CA  . PRO B  1 260 ? 42.422  15.011  39.204  1.00 39.89 ? 259  PRO B CA  1 
ATOM   6483 C C   . PRO B  1 260 ? 41.156  15.045  40.071  1.00 39.42 ? 259  PRO B C   1 
ATOM   6484 O O   . PRO B  1 260 ? 40.568  13.992  40.334  1.00 39.30 ? 259  PRO B O   1 
ATOM   6485 C CB  . PRO B  1 260 ? 43.638  14.571  40.034  1.00 40.10 ? 259  PRO B CB  1 
ATOM   6486 C CG  . PRO B  1 260 ? 44.399  15.831  40.307  1.00 40.46 ? 259  PRO B CG  1 
ATOM   6487 C CD  . PRO B  1 260 ? 44.173  16.722  39.128  1.00 40.55 ? 259  PRO B CD  1 
ATOM   6488 N N   . GLN B  1 261 ? 40.753  16.240  40.503  1.00 38.52 ? 260  GLN B N   1 
ATOM   6489 C CA  . GLN B  1 261 ? 39.465  16.448  41.156  1.00 38.39 ? 260  GLN B CA  1 
ATOM   6490 C C   . GLN B  1 261 ? 38.324  16.148  40.184  1.00 37.57 ? 260  GLN B C   1 
ATOM   6491 O O   . GLN B  1 261 ? 37.256  15.690  40.591  1.00 37.65 ? 260  GLN B O   1 
ATOM   6492 C CB  . GLN B  1 261 ? 39.342  17.895  41.630  1.00 38.78 ? 260  GLN B CB  1 
ATOM   6493 C CG  . GLN B  1 261 ? 38.345  18.098  42.755  1.00 40.85 ? 260  GLN B CG  1 
ATOM   6494 C CD  . GLN B  1 261 ? 38.079  19.563  43.032  1.00 43.49 ? 260  GLN B CD  1 
ATOM   6495 O OE1 . GLN B  1 261 ? 38.972  20.294  43.482  1.00 44.93 ? 260  GLN B OE1 1 
ATOM   6496 N NE2 . GLN B  1 261 ? 36.854  20.001  42.765  1.00 44.09 ? 260  GLN B NE2 1 
ATOM   6497 N N   . ASN B  1 262 ? 38.571  16.420  38.904  1.00 36.53 ? 261  ASN B N   1 
ATOM   6498 C CA  . ASN B  1 262 ? 37.580  16.223  37.845  1.00 36.02 ? 261  ASN B CA  1 
ATOM   6499 C C   . ASN B  1 262 ? 37.718  14.886  37.123  1.00 35.46 ? 261  ASN B C   1 
ATOM   6500 O O   . ASN B  1 262 ? 37.419  14.785  35.932  1.00 35.04 ? 261  ASN B O   1 
ATOM   6501 C CB  . ASN B  1 262 ? 37.643  17.374  36.836  1.00 35.99 ? 261  ASN B CB  1 
ATOM   6502 C CG  . ASN B  1 262 ? 37.476  18.727  37.491  1.00 36.12 ? 261  ASN B CG  1 
ATOM   6503 O OD1 . ASN B  1 262 ? 38.274  19.634  37.273  1.00 37.00 ? 261  ASN B OD1 1 
ATOM   6504 N ND2 . ASN B  1 262 ? 36.434  18.866  38.302  1.00 35.24 ? 261  ASN B ND2 1 
ATOM   6505 N N   . MET B  1 263 ? 38.186  13.876  37.850  1.00 34.73 ? 262  MET B N   1 
ATOM   6506 C CA  . MET B  1 263 ? 38.124  12.500  37.383  1.00 34.42 ? 262  MET B CA  1 
ATOM   6507 C C   . MET B  1 263 ? 37.069  11.761  38.200  1.00 34.18 ? 262  MET B C   1 
ATOM   6508 O O   . MET B  1 263 ? 37.148  11.710  39.428  1.00 34.19 ? 262  MET B O   1 
ATOM   6509 C CB  . MET B  1 263 ? 39.488  11.817  37.487  1.00 34.55 ? 262  MET B CB  1 
ATOM   6510 C CG  . MET B  1 263 ? 39.492  10.349  37.077  1.00 34.49 ? 262  MET B CG  1 
ATOM   6511 S SD  . MET B  1 263 ? 41.087  9.525   37.315  1.00 36.32 ? 262  MET B SD  1 
ATOM   6512 C CE  . MET B  1 263 ? 40.857  8.777   38.963  1.00 35.11 ? 262  MET B CE  1 
ATOM   6513 N N   . LEU B  1 264 ? 36.076  11.200  37.510  1.00 33.31 ? 263  LEU B N   1 
ATOM   6514 C CA  . LEU B  1 264 ? 35.023  10.423  38.163  1.00 32.92 ? 263  LEU B CA  1 
ATOM   6515 C C   . LEU B  1 264 ? 35.293  8.948   37.897  1.00 32.85 ? 263  LEU B C   1 
ATOM   6516 O O   . LEU B  1 264 ? 35.444  8.538   36.736  1.00 32.17 ? 263  LEU B O   1 
ATOM   6517 C CB  . LEU B  1 264 ? 33.641  10.819  37.627  1.00 33.24 ? 263  LEU B CB  1 
ATOM   6518 C CG  . LEU B  1 264 ? 33.059  12.221  37.839  1.00 33.58 ? 263  LEU B CG  1 
ATOM   6519 C CD1 . LEU B  1 264 ? 33.822  13.295  37.067  1.00 35.23 ? 263  LEU B CD1 1 
ATOM   6520 C CD2 . LEU B  1 264 ? 31.608  12.237  37.421  1.00 34.71 ? 263  LEU B CD2 1 
ATOM   6521 N N   . GLU B  1 265 ? 35.366  8.152   38.963  1.00 32.21 ? 264  GLU B N   1 
ATOM   6522 C CA  . GLU B  1 265 ? 35.814  6.764   38.844  1.00 32.53 ? 264  GLU B CA  1 
ATOM   6523 C C   . GLU B  1 265 ? 34.682  5.751   38.676  1.00 31.74 ? 264  GLU B C   1 
ATOM   6524 O O   . GLU B  1 265 ? 33.551  6.005   39.078  1.00 31.35 ? 264  GLU B O   1 
ATOM   6525 C CB  . GLU B  1 265 ? 36.716  6.367   40.033  1.00 32.89 ? 264  GLU B CB  1 
ATOM   6526 C CG  . GLU B  1 265 ? 36.234  6.828   41.399  1.00 35.41 ? 264  GLU B CG  1 
ATOM   6527 C CD  . GLU B  1 265 ? 36.672  8.245   41.734  1.00 37.61 ? 264  GLU B CD  1 
ATOM   6528 O OE1 . GLU B  1 265 ? 35.830  9.172   41.635  1.00 37.68 ? 264  GLU B OE1 1 
ATOM   6529 O OE2 . GLU B  1 265 ? 37.858  8.438   42.100  1.00 40.43 ? 264  GLU B OE2 1 
ATOM   6530 N N   . PHE B  1 266 ? 35.005  4.626   38.043  1.00 31.48 ? 265  PHE B N   1 
ATOM   6531 C CA  . PHE B  1 266 ? 34.209  3.403   38.131  1.00 31.29 ? 265  PHE B CA  1 
ATOM   6532 C C   . PHE B  1 266 ? 35.126  2.180   38.245  1.00 31.03 ? 265  PHE B C   1 
ATOM   6533 O O   . PHE B  1 266 ? 36.340  2.332   38.376  1.00 31.55 ? 265  PHE B O   1 
ATOM   6534 C CB  . PHE B  1 266 ? 33.137  3.278   37.027  1.00 31.29 ? 265  PHE B CB  1 
ATOM   6535 C CG  . PHE B  1 266 ? 33.660  3.364   35.618  1.00 31.40 ? 265  PHE B CG  1 
ATOM   6536 C CD1 . PHE B  1 266 ? 33.597  2.255   34.777  1.00 31.25 ? 265  PHE B CD1 1 
ATOM   6537 C CD2 . PHE B  1 266 ? 34.141  4.565   35.103  1.00 31.34 ? 265  PHE B CD2 1 
ATOM   6538 C CE1 . PHE B  1 266 ? 34.050  2.331   33.463  1.00 31.56 ? 265  PHE B CE1 1 
ATOM   6539 C CE2 . PHE B  1 266 ? 34.601  4.649   33.788  1.00 32.40 ? 265  PHE B CE2 1 
ATOM   6540 C CZ  . PHE B  1 266 ? 34.550  3.525   32.966  1.00 31.88 ? 265  PHE B CZ  1 
ATOM   6541 N N   . TRP B  1 267 ? 34.556  0.976   38.217  1.00 30.76 ? 266  TRP B N   1 
ATOM   6542 C CA  . TRP B  1 267 ? 35.271  -0.215  38.678  1.00 30.02 ? 266  TRP B CA  1 
ATOM   6543 C C   . TRP B  1 267 ? 35.282  -1.345  37.651  1.00 29.83 ? 266  TRP B C   1 
ATOM   6544 O O   . TRP B  1 267 ? 34.534  -1.303  36.680  1.00 29.33 ? 266  TRP B O   1 
ATOM   6545 C CB  . TRP B  1 267 ? 34.699  -0.659  40.039  1.00 30.19 ? 266  TRP B CB  1 
ATOM   6546 C CG  . TRP B  1 267 ? 34.674  0.514   40.988  1.00 30.98 ? 266  TRP B CG  1 
ATOM   6547 C CD1 . TRP B  1 267 ? 35.693  0.926   41.805  1.00 31.55 ? 266  TRP B CD1 1 
ATOM   6548 C CD2 . TRP B  1 267 ? 33.616  1.469   41.163  1.00 31.62 ? 266  TRP B CD2 1 
ATOM   6549 N NE1 . TRP B  1 267 ? 35.327  2.063   42.487  1.00 31.68 ? 266  TRP B NE1 1 
ATOM   6550 C CE2 . TRP B  1 267 ? 34.061  2.424   42.109  1.00 32.02 ? 266  TRP B CE2 1 
ATOM   6551 C CE3 . TRP B  1 267 ? 32.329  1.621   40.614  1.00 31.77 ? 266  TRP B CE3 1 
ATOM   6552 C CZ2 . TRP B  1 267 ? 33.268  3.502   42.526  1.00 32.98 ? 266  TRP B CZ2 1 
ATOM   6553 C CZ3 . TRP B  1 267 ? 31.544  2.698   41.026  1.00 32.45 ? 266  TRP B CZ3 1 
ATOM   6554 C CH2 . TRP B  1 267 ? 32.017  3.622   41.977  1.00 32.49 ? 266  TRP B CH2 1 
ATOM   6555 N N   . ASP B  1 268 ? 36.145  -2.338  37.854  1.00 29.37 ? 267  ASP B N   1 
ATOM   6556 C CA  . ASP B  1 268 ? 36.327  -3.394  36.856  1.00 29.29 ? 267  ASP B CA  1 
ATOM   6557 C C   . ASP B  1 268 ? 35.111  -4.316  36.718  1.00 28.63 ? 267  ASP B C   1 
ATOM   6558 O O   . ASP B  1 268 ? 34.958  -5.003  35.700  1.00 28.89 ? 267  ASP B O   1 
ATOM   6559 C CB  . ASP B  1 268 ? 37.646  -4.170  37.062  1.00 29.65 ? 267  ASP B CB  1 
ATOM   6560 C CG  . ASP B  1 268 ? 37.675  -5.000  38.350  1.00 31.58 ? 267  ASP B CG  1 
ATOM   6561 O OD1 . ASP B  1 268 ? 38.739  -5.602  38.625  1.00 33.53 ? 267  ASP B OD1 1 
ATOM   6562 O OD2 . ASP B  1 268 ? 36.722  -5.130  39.145  1.00 34.15 ? 267  ASP B OD2 1 
ATOM   6563 N N   . TRP B  1 269 ? 34.236  -4.310  37.726  1.00 27.62 ? 268  TRP B N   1 
ATOM   6564 C CA  . TRP B  1 269 ? 32.998  -5.091  37.669  1.00 26.91 ? 268  TRP B CA  1 
ATOM   6565 C C   . TRP B  1 269 ? 31.861  -4.336  36.955  1.00 26.12 ? 268  TRP B C   1 
ATOM   6566 O O   . TRP B  1 269 ? 30.726  -4.828  36.878  1.00 26.13 ? 268  TRP B O   1 
ATOM   6567 C CB  . TRP B  1 269 ? 32.565  -5.590  39.063  1.00 26.98 ? 268  TRP B CB  1 
ATOM   6568 C CG  . TRP B  1 269 ? 32.792  -4.631  40.203  1.00 27.51 ? 268  TRP B CG  1 
ATOM   6569 C CD1 . TRP B  1 269 ? 33.811  -4.668  41.126  1.00 27.43 ? 268  TRP B CD1 1 
ATOM   6570 C CD2 . TRP B  1 269 ? 31.981  -3.506  40.556  1.00 28.42 ? 268  TRP B CD2 1 
ATOM   6571 N NE1 . TRP B  1 269 ? 33.683  -3.628  42.016  1.00 27.49 ? 268  TRP B NE1 1 
ATOM   6572 C CE2 . TRP B  1 269 ? 32.566  -2.902  41.695  1.00 27.83 ? 268  TRP B CE2 1 
ATOM   6573 C CE3 . TRP B  1 269 ? 30.817  -2.937  40.021  1.00 27.65 ? 268  TRP B CE3 1 
ATOM   6574 C CZ2 . TRP B  1 269 ? 32.028  -1.762  42.305  1.00 28.61 ? 268  TRP B CZ2 1 
ATOM   6575 C CZ3 . TRP B  1 269 ? 30.277  -1.806  40.632  1.00 29.43 ? 268  TRP B CZ3 1 
ATOM   6576 C CH2 . TRP B  1 269 ? 30.880  -1.235  41.765  1.00 29.21 ? 268  TRP B CH2 1 
ATOM   6577 N N   . VAL B  1 270 ? 32.186  -3.156  36.428  1.00 24.92 ? 269  VAL B N   1 
ATOM   6578 C CA  . VAL B  1 270 ? 31.297  -2.424  35.518  1.00 24.11 ? 269  VAL B CA  1 
ATOM   6579 C C   . VAL B  1 270 ? 31.757  -2.655  34.073  1.00 23.65 ? 269  VAL B C   1 
ATOM   6580 O O   . VAL B  1 270 ? 32.750  -2.066  33.635  1.00 23.95 ? 269  VAL B O   1 
ATOM   6581 C CB  . VAL B  1 270 ? 31.278  -0.899  35.810  1.00 23.67 ? 269  VAL B CB  1 
ATOM   6582 C CG1 . VAL B  1 270 ? 30.280  -0.167  34.879  1.00 23.78 ? 269  VAL B CG1 1 
ATOM   6583 C CG2 . VAL B  1 270 ? 30.945  -0.616  37.284  1.00 24.61 ? 269  VAL B CG2 1 
ATOM   6584 N N   . GLY B  1 271 ? 31.048  -3.525  33.355  1.00 23.16 ? 270  GLY B N   1 
ATOM   6585 C CA  . GLY B  1 271 ? 31.314  -3.748  31.935  1.00 22.68 ? 270  GLY B CA  1 
ATOM   6586 C C   . GLY B  1 271 ? 30.977  -2.514  31.112  1.00 22.02 ? 270  GLY B C   1 
ATOM   6587 O O   . GLY B  1 271 ? 30.035  -1.789  31.433  1.00 21.79 ? 270  GLY B O   1 
ATOM   6588 N N   . GLY B  1 272 ? 31.750  -2.254  30.057  1.00 21.50 ? 271  GLY B N   1 
ATOM   6589 C CA  . GLY B  1 272 ? 31.515  -1.069  29.246  1.00 21.63 ? 271  GLY B CA  1 
ATOM   6590 C C   . GLY B  1 272 ? 30.096  -0.991  28.711  1.00 21.06 ? 271  GLY B C   1 
ATOM   6591 O O   . GLY B  1 272 ? 29.430  0.044   28.795  1.00 21.33 ? 271  GLY B O   1 
ATOM   6592 N N   . ARG B  1 273 ? 29.614  -2.115  28.193  1.00 20.94 ? 272  ARG B N   1 
ATOM   6593 C CA  . ARG B  1 273 ? 28.266  -2.181  27.639  1.00 20.11 ? 272  ARG B CA  1 
ATOM   6594 C C   . ARG B  1 273 ? 27.168  -2.269  28.703  1.00 20.33 ? 272  ARG B C   1 
ATOM   6595 O O   . ARG B  1 273 ? 25.985  -2.392  28.364  1.00 20.51 ? 272  ARG B O   1 
ATOM   6596 C CB  . ARG B  1 273 ? 28.155  -3.321  26.621  1.00 19.97 ? 272  ARG B CB  1 
ATOM   6597 C CG  . ARG B  1 273 ? 28.411  -4.713  27.161  1.00 19.77 ? 272  ARG B CG  1 
ATOM   6598 C CD  . ARG B  1 273 ? 28.653  -5.760  26.062  1.00 19.64 ? 272  ARG B CD  1 
ATOM   6599 N NE  . ARG B  1 273 ? 29.037  -7.047  26.646  1.00 18.95 ? 272  ARG B NE  1 
ATOM   6600 C CZ  . ARG B  1 273 ? 30.295  -7.469  26.790  1.00 19.52 ? 272  ARG B CZ  1 
ATOM   6601 N NH1 . ARG B  1 273 ? 31.317  -6.728  26.365  1.00 19.66 ? 272  ARG B NH1 1 
ATOM   6602 N NH2 . ARG B  1 273 ? 30.529  -8.650  27.356  1.00 17.49 ? 272  ARG B NH2 1 
ATOM   6603 N N   . TYR B  1 274 ? 27.571  -2.166  29.972  1.00 20.07 ? 273  TYR B N   1 
ATOM   6604 C CA  . TYR B  1 274 ? 26.650  -2.073  31.121  1.00 20.42 ? 273  TYR B CA  1 
ATOM   6605 C C   . TYR B  1 274 ? 26.987  -0.857  31.991  1.00 20.93 ? 273  TYR B C   1 
ATOM   6606 O O   . TYR B  1 274 ? 26.696  -0.851  33.192  1.00 21.47 ? 273  TYR B O   1 
ATOM   6607 C CB  . TYR B  1 274 ? 26.711  -3.349  31.976  1.00 19.92 ? 273  TYR B CB  1 
ATOM   6608 C CG  . TYR B  1 274 ? 26.351  -4.616  31.249  1.00 19.55 ? 273  TYR B CG  1 
ATOM   6609 C CD1 . TYR B  1 274 ? 27.336  -5.416  30.662  1.00 19.69 ? 273  TYR B CD1 1 
ATOM   6610 C CD2 . TYR B  1 274 ? 25.015  -5.024  31.136  1.00 19.69 ? 273  TYR B CD2 1 
ATOM   6611 C CE1 . TYR B  1 274 ? 26.995  -6.601  29.985  1.00 18.96 ? 273  TYR B CE1 1 
ATOM   6612 C CE2 . TYR B  1 274 ? 24.668  -6.198  30.464  1.00 19.48 ? 273  TYR B CE2 1 
ATOM   6613 C CZ  . TYR B  1 274 ? 25.658  -6.978  29.886  1.00 19.73 ? 273  TYR B CZ  1 
ATOM   6614 O OH  . TYR B  1 274 ? 25.316  -8.132  29.211  1.00 20.93 ? 273  TYR B OH  1 
ATOM   6615 N N   . SER B  1 275 ? 27.587  0.166   31.381  1.00 20.84 ? 274  SER B N   1 
ATOM   6616 C CA  . SER B  1 275 ? 28.227  1.255   32.122  1.00 20.84 ? 274  SER B CA  1 
ATOM   6617 C C   . SER B  1 275 ? 27.480  2.593   32.235  1.00 20.53 ? 274  SER B C   1 
ATOM   6618 O O   . SER B  1 275 ? 27.900  3.464   33.001  1.00 20.78 ? 274  SER B O   1 
ATOM   6619 C CB  . SER B  1 275 ? 29.640  1.502   31.578  1.00 20.97 ? 274  SER B CB  1 
ATOM   6620 O OG  . SER B  1 275 ? 29.602  2.226   30.357  1.00 21.82 ? 274  SER B OG  1 
ATOM   6621 N N   . LEU B  1 276 ? 26.393  2.788   31.484  1.00 19.85 ? 275  LEU B N   1 
ATOM   6622 C CA  . LEU B  1 276 ? 25.713  4.082   31.508  1.00 19.85 ? 275  LEU B CA  1 
ATOM   6623 C C   . LEU B  1 276 ? 25.210  4.469   32.910  1.00 19.68 ? 275  LEU B C   1 
ATOM   6624 O O   . LEU B  1 276 ? 25.000  5.647   33.182  1.00 20.28 ? 275  LEU B O   1 
ATOM   6625 C CB  . LEU B  1 276 ? 24.563  4.123   30.487  1.00 19.09 ? 275  LEU B CB  1 
ATOM   6626 C CG  . LEU B  1 276 ? 23.290  3.313   30.734  1.00 20.17 ? 275  LEU B CG  1 
ATOM   6627 C CD1 . LEU B  1 276 ? 22.296  4.107   31.596  1.00 20.63 ? 275  LEU B CD1 1 
ATOM   6628 C CD2 . LEU B  1 276 ? 22.653  2.975   29.366  1.00 19.94 ? 275  LEU B CD2 1 
ATOM   6629 N N   . TRP B  1 277 ? 25.060  3.466   33.774  1.00 20.13 ? 276  TRP B N   1 
ATOM   6630 C CA  . TRP B  1 277 ? 24.543  3.618   35.140  1.00 20.56 ? 276  TRP B CA  1 
ATOM   6631 C C   . TRP B  1 277 ? 25.594  4.165   36.101  1.00 20.96 ? 276  TRP B C   1 
ATOM   6632 O O   . TRP B  1 277 ? 25.261  4.554   37.230  1.00 21.15 ? 276  TRP B O   1 
ATOM   6633 C CB  . TRP B  1 277 ? 24.043  2.264   35.669  1.00 20.89 ? 276  TRP B CB  1 
ATOM   6634 C CG  . TRP B  1 277 ? 23.302  1.442   34.642  1.00 20.90 ? 276  TRP B CG  1 
ATOM   6635 C CD1 . TRP B  1 277 ? 23.794  0.410   33.888  1.00 20.62 ? 276  TRP B CD1 1 
ATOM   6636 C CD2 . TRP B  1 277 ? 21.937  1.600   34.257  1.00 20.71 ? 276  TRP B CD2 1 
ATOM   6637 N NE1 . TRP B  1 277 ? 22.816  -0.080  33.050  1.00 19.96 ? 276  TRP B NE1 1 
ATOM   6638 C CE2 . TRP B  1 277 ? 21.664  0.630   33.263  1.00 20.80 ? 276  TRP B CE2 1 
ATOM   6639 C CE3 . TRP B  1 277 ? 20.908  2.470   34.649  1.00 21.18 ? 276  TRP B CE3 1 
ATOM   6640 C CZ2 . TRP B  1 277 ? 20.413  0.503   32.664  1.00 21.91 ? 276  TRP B CZ2 1 
ATOM   6641 C CZ3 . TRP B  1 277 ? 19.661  2.342   34.059  1.00 23.10 ? 276  TRP B CZ3 1 
ATOM   6642 C CH2 . TRP B  1 277 ? 19.426  1.365   33.076  1.00 22.19 ? 276  TRP B CH2 1 
ATOM   6643 N N   . SER B  1 278 ? 26.846  4.185   35.640  1.00 21.02 ? 277  SER B N   1 
ATOM   6644 C CA  . SER B  1 278 ? 28.019  4.590   36.429  1.00 21.33 ? 277  SER B CA  1 
ATOM   6645 C C   . SER B  1 278 ? 28.394  6.056   36.184  1.00 21.13 ? 277  SER B C   1 
ATOM   6646 O O   . SER B  1 278 ? 27.585  6.834   35.683  1.00 21.46 ? 277  SER B O   1 
ATOM   6647 C CB  . SER B  1 278 ? 29.198  3.659   36.095  1.00 21.39 ? 277  SER B CB  1 
ATOM   6648 O OG  . SER B  1 278 ? 29.817  3.971   34.848  1.00 20.74 ? 277  SER B OG  1 
ATOM   6649 N N   . ALA B  1 279 ? 29.622  6.427   36.550  1.00 21.05 ? 278  ALA B N   1 
ATOM   6650 C CA  . ALA B  1 279 ? 30.200  7.709   36.164  1.00 20.71 ? 278  ALA B CA  1 
ATOM   6651 C C   . ALA B  1 279 ? 30.020  8.000   34.670  1.00 20.21 ? 278  ALA B C   1 
ATOM   6652 O O   . ALA B  1 279 ? 29.916  9.155   34.271  1.00 20.07 ? 278  ALA B O   1 
ATOM   6653 C CB  . ALA B  1 279 ? 31.691  7.746   36.525  1.00 20.79 ? 278  ALA B CB  1 
ATOM   6654 N N   . ILE B  1 280 ? 30.000  6.936   33.862  1.00 20.68 ? 279  ILE B N   1 
ATOM   6655 C CA  . ILE B  1 280 ? 29.863  7.059   32.405  1.00 21.08 ? 279  ILE B CA  1 
ATOM   6656 C C   . ILE B  1 280 ? 28.577  7.809   32.010  1.00 20.58 ? 279  ILE B C   1 
ATOM   6657 O O   . ILE B  1 280 ? 28.509  8.457   30.958  1.00 21.44 ? 279  ILE B O   1 
ATOM   6658 C CB  . ILE B  1 280 ? 29.929  5.653   31.759  1.00 21.17 ? 279  ILE B CB  1 
ATOM   6659 C CG1 . ILE B  1 280 ? 31.350  5.078   31.867  1.00 21.57 ? 279  ILE B CG1 1 
ATOM   6660 C CG2 . ILE B  1 280 ? 29.418  5.664   30.282  1.00 20.89 ? 279  ILE B CG2 1 
ATOM   6661 C CD1 . ILE B  1 280 ? 32.392  5.843   31.066  1.00 23.20 ? 279  ILE B CD1 1 
ATOM   6662 N N   . GLY B  1 281 ? 27.568  7.752   32.873  1.00 20.38 ? 280  GLY B N   1 
ATOM   6663 C CA  . GLY B  1 281 ? 26.350  8.502   32.652  1.00 19.91 ? 280  GLY B CA  1 
ATOM   6664 C C   . GLY B  1 281 ? 26.366  9.991   32.942  1.00 20.12 ? 280  GLY B C   1 
ATOM   6665 O O   . GLY B  1 281 ? 25.313  10.617  32.901  1.00 20.50 ? 280  GLY B O   1 
ATOM   6666 N N   . LEU B  1 282 ? 27.539  10.568  33.225  1.00 20.15 ? 281  LEU B N   1 
ATOM   6667 C CA  . LEU B  1 282 ? 27.641  12.011  33.494  1.00 20.12 ? 281  LEU B CA  1 
ATOM   6668 C C   . LEU B  1 282 ? 26.964  12.915  32.455  1.00 20.38 ? 281  LEU B C   1 
ATOM   6669 O O   . LEU B  1 282 ? 26.245  13.859  32.807  1.00 20.00 ? 281  LEU B O   1 
ATOM   6670 C CB  . LEU B  1 282 ? 29.111  12.428  33.696  1.00 20.43 ? 281  LEU B CB  1 
ATOM   6671 C CG  . LEU B  1 282 ? 29.353  13.905  34.063  1.00 21.44 ? 281  LEU B CG  1 
ATOM   6672 C CD1 . LEU B  1 282 ? 28.623  14.376  35.355  1.00 22.19 ? 281  LEU B CD1 1 
ATOM   6673 C CD2 . LEU B  1 282 ? 30.849  14.178  34.152  1.00 23.11 ? 281  LEU B CD2 1 
ATOM   6674 N N   . SER B  1 283 ? 27.172  12.632  31.168  1.00 20.21 ? 282  SER B N   1 
ATOM   6675 C CA  . SER B  1 283 ? 26.551  13.471  30.145  1.00 20.07 ? 282  SER B CA  1 
ATOM   6676 C C   . SER B  1 283 ? 25.019  13.405  30.176  1.00 19.59 ? 282  SER B C   1 
ATOM   6677 O O   . SER B  1 283 ? 24.363  14.387  29.840  1.00 19.16 ? 282  SER B O   1 
ATOM   6678 C CB  . SER B  1 283 ? 27.078  13.136  28.747  1.00 20.26 ? 282  SER B CB  1 
ATOM   6679 O OG  . SER B  1 283 ? 26.812  11.781  28.420  1.00 21.14 ? 282  SER B OG  1 
ATOM   6680 N N   . ILE B  1 284 ? 24.463  12.250  30.571  1.00 19.59 ? 283  ILE B N   1 
ATOM   6681 C CA  . ILE B  1 284 ? 23.013  12.122  30.771  1.00 19.89 ? 283  ILE B CA  1 
ATOM   6682 C C   . ILE B  1 284 ? 22.591  13.066  31.908  1.00 20.00 ? 283  ILE B C   1 
ATOM   6683 O O   . ILE B  1 284 ? 21.697  13.886  31.742  1.00 20.21 ? 283  ILE B O   1 
ATOM   6684 C CB  . ILE B  1 284 ? 22.604  10.666  31.111  1.00 19.65 ? 283  ILE B CB  1 
ATOM   6685 C CG1 . ILE B  1 284 ? 22.983  9.698   29.973  1.00 19.62 ? 283  ILE B CG1 1 
ATOM   6686 C CG2 . ILE B  1 284 ? 21.081  10.581  31.468  1.00 19.66 ? 283  ILE B CG2 1 
ATOM   6687 C CD1 . ILE B  1 284 ? 22.936  8.217   30.369  1.00 18.89 ? 283  ILE B CD1 1 
ATOM   6688 N N   . ALA B  1 285 ? 23.267  12.950  33.044  1.00 20.36 ? 284  ALA B N   1 
ATOM   6689 C CA  . ALA B  1 285 ? 22.900  13.756  34.219  1.00 20.82 ? 284  ALA B CA  1 
ATOM   6690 C C   . ALA B  1 285 ? 23.072  15.256  33.965  1.00 21.29 ? 284  ALA B C   1 
ATOM   6691 O O   . ALA B  1 285 ? 22.274  16.066  34.442  1.00 21.34 ? 284  ALA B O   1 
ATOM   6692 C CB  . ALA B  1 285 ? 23.681  13.311  35.429  1.00 20.65 ? 284  ALA B CB  1 
ATOM   6693 N N   . LEU B  1 286 ? 24.090  15.630  33.187  1.00 21.43 ? 285  LEU B N   1 
ATOM   6694 C CA  . LEU B  1 286 ? 24.289  17.040  32.848  1.00 21.64 ? 285  LEU B CA  1 
ATOM   6695 C C   . LEU B  1 286 ? 23.180  17.531  31.934  1.00 22.02 ? 285  LEU B C   1 
ATOM   6696 O O   . LEU B  1 286 ? 22.707  18.658  32.058  1.00 22.29 ? 285  LEU B O   1 
ATOM   6697 C CB  . LEU B  1 286 ? 25.645  17.272  32.177  1.00 21.65 ? 285  LEU B CB  1 
ATOM   6698 C CG  . LEU B  1 286 ? 26.889  17.207  33.069  1.00 22.10 ? 285  LEU B CG  1 
ATOM   6699 C CD1 . LEU B  1 286 ? 28.164  17.058  32.246  1.00 24.22 ? 285  LEU B CD1 1 
ATOM   6700 C CD2 . LEU B  1 286 ? 26.978  18.471  33.921  1.00 22.24 ? 285  LEU B CD2 1 
ATOM   6701 N N   . HIS B  1 287 ? 22.744  16.669  31.019  1.00 21.57 ? 286  HIS B N   1 
ATOM   6702 C CA  . HIS B  1 287 ? 21.733  17.059  30.039  1.00 21.95 ? 286  HIS B CA  1 
ATOM   6703 C C   . HIS B  1 287 ? 20.319  17.184  30.617  1.00 22.63 ? 286  HIS B C   1 
ATOM   6704 O O   . HIS B  1 287 ? 19.654  18.187  30.370  1.00 23.35 ? 286  HIS B O   1 
ATOM   6705 C CB  . HIS B  1 287 ? 21.749  16.072  28.860  1.00 21.78 ? 286  HIS B CB  1 
ATOM   6706 C CG  . HIS B  1 287 ? 21.011  16.547  27.644  1.00 21.67 ? 286  HIS B CG  1 
ATOM   6707 N ND1 . HIS B  1 287 ? 21.239  17.770  27.053  1.00 22.46 ? 286  HIS B ND1 1 
ATOM   6708 C CD2 . HIS B  1 287 ? 20.088  15.923  26.872  1.00 21.97 ? 286  HIS B CD2 1 
ATOM   6709 C CE1 . HIS B  1 287 ? 20.469  17.893  25.986  1.00 22.19 ? 286  HIS B CE1 1 
ATOM   6710 N NE2 . HIS B  1 287 ? 19.758  16.784  25.857  1.00 20.93 ? 286  HIS B NE2 1 
ATOM   6711 N N   . VAL B  1 288 ? 19.884  16.190  31.397  1.00 23.11 ? 287  VAL B N   1 
ATOM   6712 C CA  . VAL B  1 288 ? 18.511  16.149  31.936  1.00 23.41 ? 287  VAL B CA  1 
ATOM   6713 C C   . VAL B  1 288 ? 18.414  16.453  33.436  1.00 23.92 ? 287  VAL B C   1 
ATOM   6714 O O   . VAL B  1 288 ? 17.319  16.497  34.000  1.00 24.09 ? 287  VAL B O   1 
ATOM   6715 C CB  . VAL B  1 288 ? 17.801  14.784  31.658  1.00 23.39 ? 287  VAL B CB  1 
ATOM   6716 C CG1 . VAL B  1 288 ? 17.625  14.553  30.162  1.00 23.48 ? 287  VAL B CG1 1 
ATOM   6717 C CG2 . VAL B  1 288 ? 18.550  13.625  32.312  1.00 22.56 ? 287  VAL B CG2 1 
ATOM   6718 N N   . GLY B  1 289 ? 19.558  16.661  34.079  1.00 23.77 ? 288  GLY B N   1 
ATOM   6719 C CA  . GLY B  1 289 ? 19.576  16.911  35.511  1.00 24.23 ? 288  GLY B CA  1 
ATOM   6720 C C   . GLY B  1 289 ? 19.771  15.640  36.309  1.00 24.68 ? 288  GLY B C   1 
ATOM   6721 O O   . GLY B  1 289 ? 19.378  14.545  35.883  1.00 24.37 ? 288  GLY B O   1 
ATOM   6722 N N   . PHE B  1 290 ? 20.392  15.778  37.477  1.00 24.64 ? 289  PHE B N   1 
ATOM   6723 C CA  . PHE B  1 290 ? 20.707  14.625  38.315  1.00 25.33 ? 289  PHE B CA  1 
ATOM   6724 C C   . PHE B  1 290 ? 19.462  13.913  38.836  1.00 25.34 ? 289  PHE B C   1 
ATOM   6725 O O   . PHE B  1 290 ? 19.479  12.692  39.014  1.00 25.77 ? 289  PHE B O   1 
ATOM   6726 C CB  . PHE B  1 290 ? 21.624  15.021  39.484  1.00 25.66 ? 289  PHE B CB  1 
ATOM   6727 C CG  . PHE B  1 290 ? 22.202  13.844  40.216  1.00 26.49 ? 289  PHE B CG  1 
ATOM   6728 C CD1 . PHE B  1 290 ? 23.250  13.109  39.666  1.00 26.49 ? 289  PHE B CD1 1 
ATOM   6729 C CD2 . PHE B  1 290 ? 21.682  13.451  41.448  1.00 26.76 ? 289  PHE B CD2 1 
ATOM   6730 C CE1 . PHE B  1 290 ? 23.781  12.005  40.324  1.00 27.63 ? 289  PHE B CE1 1 
ATOM   6731 C CE2 . PHE B  1 290 ? 22.215  12.349  42.125  1.00 28.46 ? 289  PHE B CE2 1 
ATOM   6732 C CZ  . PHE B  1 290 ? 23.263  11.621  41.561  1.00 28.16 ? 289  PHE B CZ  1 
ATOM   6733 N N   . ASP B  1 291 ? 18.390  14.670  39.069  1.00 26.05 ? 290  ASP B N   1 
ATOM   6734 C CA  . ASP B  1 291 ? 17.140  14.096  39.571  1.00 26.70 ? 290  ASP B CA  1 
ATOM   6735 C C   . ASP B  1 291 ? 16.543  13.075  38.596  1.00 25.77 ? 290  ASP B C   1 
ATOM   6736 O O   . ASP B  1 291 ? 16.113  11.992  38.998  1.00 25.90 ? 290  ASP B O   1 
ATOM   6737 C CB  . ASP B  1 291 ? 16.121  15.191  39.910  1.00 27.87 ? 290  ASP B CB  1 
ATOM   6738 C CG  . ASP B  1 291 ? 15.706  16.026  38.703  1.00 30.53 ? 290  ASP B CG  1 
ATOM   6739 O OD1 . ASP B  1 291 ? 14.559  16.531  38.724  1.00 35.62 ? 290  ASP B OD1 1 
ATOM   6740 O OD2 . ASP B  1 291 ? 16.424  16.245  37.682  1.00 34.59 ? 290  ASP B OD2 1 
ATOM   6741 N N   . HIS B  1 292 ? 16.533  13.431  37.315  1.00 25.08 ? 291  HIS B N   1 
ATOM   6742 C CA  . HIS B  1 292 ? 16.078  12.522  36.266  1.00 24.60 ? 291  HIS B CA  1 
ATOM   6743 C C   . HIS B  1 292 ? 17.032  11.344  36.074  1.00 24.29 ? 291  HIS B C   1 
ATOM   6744 O O   . HIS B  1 292 ? 16.591  10.231  35.784  1.00 23.46 ? 291  HIS B O   1 
ATOM   6745 C CB  . HIS B  1 292 ? 15.877  13.285  34.960  1.00 24.53 ? 291  HIS B CB  1 
ATOM   6746 C CG  . HIS B  1 292 ? 14.680  14.184  34.965  1.00 25.03 ? 291  HIS B CG  1 
ATOM   6747 N ND1 . HIS B  1 292 ? 14.686  15.432  34.387  1.00 25.41 ? 291  HIS B ND1 1 
ATOM   6748 C CD2 . HIS B  1 292 ? 13.436  14.013  35.477  1.00 25.22 ? 291  HIS B CD2 1 
ATOM   6749 C CE1 . HIS B  1 292 ? 13.503  15.998  34.543  1.00 25.03 ? 291  HIS B CE1 1 
ATOM   6750 N NE2 . HIS B  1 292 ? 12.725  15.155  35.196  1.00 26.83 ? 291  HIS B NE2 1 
ATOM   6751 N N   . PHE B  1 293 ? 18.335  11.577  36.242  1.00 23.90 ? 292  PHE B N   1 
ATOM   6752 C CA  . PHE B  1 293 ? 19.296  10.474  36.239  1.00 23.53 ? 292  PHE B CA  1 
ATOM   6753 C C   . PHE B  1 293 ? 19.007  9.491   37.377  1.00 23.63 ? 292  PHE B C   1 
ATOM   6754 O O   . PHE B  1 293 ? 19.078  8.267   37.198  1.00 23.56 ? 292  PHE B O   1 
ATOM   6755 C CB  . PHE B  1 293 ? 20.745  10.985  36.297  1.00 23.73 ? 292  PHE B CB  1 
ATOM   6756 C CG  . PHE B  1 293 ? 21.786  9.898   36.145  1.00 23.62 ? 292  PHE B CG  1 
ATOM   6757 C CD1 . PHE B  1 293 ? 21.972  9.247   34.924  1.00 23.30 ? 292  PHE B CD1 1 
ATOM   6758 C CD2 . PHE B  1 293 ? 22.592  9.536   37.224  1.00 23.63 ? 292  PHE B CD2 1 
ATOM   6759 C CE1 . PHE B  1 293 ? 22.945  8.253   34.784  1.00 22.92 ? 292  PHE B CE1 1 
ATOM   6760 C CE2 . PHE B  1 293 ? 23.563  8.545   37.099  1.00 24.57 ? 292  PHE B CE2 1 
ATOM   6761 C CZ  . PHE B  1 293 ? 23.743  7.895   35.878  1.00 22.74 ? 292  PHE B CZ  1 
ATOM   6762 N N   . GLU B  1 294 ? 18.679  10.026  38.555  1.00 23.64 ? 293  GLU B N   1 
ATOM   6763 C CA  . GLU B  1 294 ? 18.325  9.183   39.696  1.00 23.90 ? 293  GLU B CA  1 
ATOM   6764 C C   . GLU B  1 294 ? 17.078  8.349   39.407  1.00 23.22 ? 293  GLU B C   1 
ATOM   6765 O O   . GLU B  1 294 ? 16.992  7.186   39.819  1.00 23.29 ? 293  GLU B O   1 
ATOM   6766 C CB  . GLU B  1 294 ? 18.105  10.034  40.949  1.00 24.09 ? 293  GLU B CB  1 
ATOM   6767 C CG  . GLU B  1 294 ? 19.405  10.427  41.644  1.00 27.20 ? 293  GLU B CG  1 
ATOM   6768 C CD  . GLU B  1 294 ? 19.191  10.976  43.050  1.00 30.48 ? 293  GLU B CD  1 
ATOM   6769 O OE1 . GLU B  1 294 ? 18.306  11.833  43.244  1.00 31.88 ? 293  GLU B OE1 1 
ATOM   6770 O OE2 . GLU B  1 294 ? 19.927  10.549  43.960  1.00 31.94 ? 293  GLU B OE2 1 
ATOM   6771 N N   . GLN B  1 295 ? 16.126  8.946   38.695  1.00 23.08 ? 294  GLN B N   1 
ATOM   6772 C CA  . GLN B  1 295 ? 14.906  8.246   38.288  1.00 23.10 ? 294  GLN B CA  1 
ATOM   6773 C C   . GLN B  1 295 ? 15.219  7.079   37.338  1.00 22.80 ? 294  GLN B C   1 
ATOM   6774 O O   . GLN B  1 295 ? 14.664  5.991   37.487  1.00 22.09 ? 294  GLN B O   1 
ATOM   6775 C CB  . GLN B  1 295 ? 13.891  9.223   37.674  1.00 23.84 ? 294  GLN B CB  1 
ATOM   6776 C CG  . GLN B  1 295 ? 13.265  10.187  38.701  1.00 25.69 ? 294  GLN B CG  1 
ATOM   6777 C CD  . GLN B  1 295 ? 12.641  11.434  38.084  1.00 27.81 ? 294  GLN B CD  1 
ATOM   6778 O OE1 . GLN B  1 295 ? 12.182  11.430  36.923  1.00 27.30 ? 294  GLN B OE1 1 
ATOM   6779 N NE2 . GLN B  1 295 ? 12.613  12.515  38.864  1.00 28.76 ? 294  GLN B NE2 1 
ATOM   6780 N N   . LEU B  1 296 ? 16.137  7.312   36.396  1.00 22.18 ? 295  LEU B N   1 
ATOM   6781 C CA  . LEU B  1 296 ? 16.640  6.258   35.508  1.00 22.34 ? 295  LEU B CA  1 
ATOM   6782 C C   . LEU B  1 296 ? 17.214  5.074   36.294  1.00 22.20 ? 295  LEU B C   1 
ATOM   6783 O O   . LEU B  1 296 ? 16.890  3.911   36.013  1.00 22.17 ? 295  LEU B O   1 
ATOM   6784 C CB  . LEU B  1 296 ? 17.695  6.842   34.549  1.00 21.81 ? 295  LEU B CB  1 
ATOM   6785 C CG  . LEU B  1 296 ? 18.306  5.970   33.439  1.00 22.41 ? 295  LEU B CG  1 
ATOM   6786 C CD1 . LEU B  1 296 ? 17.316  5.764   32.301  1.00 21.69 ? 295  LEU B CD1 1 
ATOM   6787 C CD2 . LEU B  1 296 ? 19.604  6.587   32.900  1.00 22.94 ? 295  LEU B CD2 1 
ATOM   6788 N N   . LEU B  1 297 ? 18.047  5.375   37.296  1.00 21.96 ? 296  LEU B N   1 
ATOM   6789 C CA  . LEU B  1 297 ? 18.640  4.341   38.140  1.00 22.41 ? 296  LEU B CA  1 
ATOM   6790 C C   . LEU B  1 297 ? 17.560  3.598   38.907  1.00 22.19 ? 296  LEU B C   1 
ATOM   6791 O O   . LEU B  1 297 ? 17.619  2.379   39.057  1.00 21.91 ? 296  LEU B O   1 
ATOM   6792 C CB  . LEU B  1 297 ? 19.664  4.933   39.118  1.00 23.05 ? 296  LEU B CB  1 
ATOM   6793 C CG  . LEU B  1 297 ? 20.902  5.608   38.518  1.00 24.81 ? 296  LEU B CG  1 
ATOM   6794 C CD1 . LEU B  1 297 ? 21.644  6.396   39.599  1.00 25.85 ? 296  LEU B CD1 1 
ATOM   6795 C CD2 . LEU B  1 297 ? 21.824  4.582   37.898  1.00 25.57 ? 296  LEU B CD2 1 
ATOM   6796 N N   . SER B  1 298 ? 16.551  4.336   39.366  1.00 22.19 ? 297  SER B N   1 
ATOM   6797 C CA  . SER B  1 298 ? 15.506  3.738   40.185  1.00 22.09 ? 297  SER B CA  1 
ATOM   6798 C C   . SER B  1 298 ? 14.624  2.777   39.380  1.00 22.38 ? 297  SER B C   1 
ATOM   6799 O O   . SER B  1 298 ? 14.212  1.735   39.890  1.00 21.85 ? 297  SER B O   1 
ATOM   6800 C CB  . SER B  1 298 ? 14.673  4.824   40.876  1.00 22.11 ? 297  SER B CB  1 
ATOM   6801 O OG  A SER B  1 298 ? 15.480  5.538   41.796  0.50 22.14 ? 297  SER B OG  1 
ATOM   6802 O OG  B SER B  1 298 ? 13.589  4.243   41.581  0.50 23.24 ? 297  SER B OG  1 
ATOM   6803 N N   . GLY B  1 299 ? 14.366  3.122   38.114  1.00 21.54 ? 298  GLY B N   1 
ATOM   6804 C CA  . GLY B  1 299 ? 13.656  2.235   37.199  1.00 21.28 ? 298  GLY B CA  1 
ATOM   6805 C C   . GLY B  1 299 ? 14.387  0.925   36.973  1.00 21.18 ? 298  GLY B C   1 
ATOM   6806 O O   . GLY B  1 299 ? 13.790  -0.157  37.022  1.00 21.01 ? 298  GLY B O   1 
ATOM   6807 N N   . ALA B  1 300 ? 15.695  1.008   36.739  1.00 20.99 ? 299  ALA B N   1 
ATOM   6808 C CA  . ALA B  1 300 ? 16.509  -0.196  36.613  1.00 21.26 ? 299  ALA B CA  1 
ATOM   6809 C C   . ALA B  1 300 ? 16.466  -1.022  37.896  1.00 21.39 ? 299  ALA B C   1 
ATOM   6810 O O   . ALA B  1 300 ? 16.349  -2.247  37.852  1.00 21.12 ? 299  ALA B O   1 
ATOM   6811 C CB  . ALA B  1 300 ? 17.945  0.157   36.231  1.00 21.04 ? 299  ALA B CB  1 
ATOM   6812 N N   . HIS B  1 301 ? 16.531  -0.336  39.036  1.00 22.07 ? 300  HIS B N   1 
ATOM   6813 C CA  . HIS B  1 301 ? 16.493  -1.018  40.331  1.00 22.69 ? 300  HIS B CA  1 
ATOM   6814 C C   . HIS B  1 301 ? 15.183  -1.797  40.525  1.00 22.62 ? 300  HIS B C   1 
ATOM   6815 O O   . HIS B  1 301 ? 15.193  -2.926  41.030  1.00 22.91 ? 300  HIS B O   1 
ATOM   6816 C CB  . HIS B  1 301 ? 16.690  -0.016  41.475  1.00 22.79 ? 300  HIS B CB  1 
ATOM   6817 C CG  . HIS B  1 301 ? 16.802  -0.662  42.820  1.00 24.19 ? 300  HIS B CG  1 
ATOM   6818 N ND1 . HIS B  1 301 ? 17.768  -1.599  43.117  1.00 26.93 ? 300  HIS B ND1 1 
ATOM   6819 C CD2 . HIS B  1 301 ? 16.051  -0.528  43.941  1.00 27.17 ? 300  HIS B CD2 1 
ATOM   6820 C CE1 . HIS B  1 301 ? 17.614  -2.009  44.365  1.00 27.79 ? 300  HIS B CE1 1 
ATOM   6821 N NE2 . HIS B  1 301 ? 16.583  -1.370  44.888  1.00 27.45 ? 300  HIS B NE2 1 
ATOM   6822 N N   . TRP B  1 302 ? 14.069  -1.203  40.099  1.00 22.45 ? 301  TRP B N   1 
ATOM   6823 C CA  . TRP B  1 302 ? 12.776  -1.877  40.149  1.00 22.19 ? 301  TRP B CA  1 
ATOM   6824 C C   . TRP B  1 302 ? 12.812  -3.187  39.342  1.00 22.19 ? 301  TRP B C   1 
ATOM   6825 O O   . TRP B  1 302 ? 12.359  -4.234  39.812  1.00 21.67 ? 301  TRP B O   1 
ATOM   6826 C CB  . TRP B  1 302 ? 11.646  -0.950  39.659  1.00 21.98 ? 301  TRP B CB  1 
ATOM   6827 C CG  . TRP B  1 302 ? 10.308  -1.552  39.891  1.00 23.60 ? 301  TRP B CG  1 
ATOM   6828 C CD1 . TRP B  1 302 ? 9.468   -1.318  40.954  1.00 24.98 ? 301  TRP B CD1 1 
ATOM   6829 C CD2 . TRP B  1 302 ? 9.656   -2.530  39.073  1.00 23.65 ? 301  TRP B CD2 1 
ATOM   6830 N NE1 . TRP B  1 302 ? 8.336   -2.092  40.840  1.00 24.95 ? 301  TRP B NE1 1 
ATOM   6831 C CE2 . TRP B  1 302 ? 8.426   -2.848  39.694  1.00 25.68 ? 301  TRP B CE2 1 
ATOM   6832 C CE3 . TRP B  1 302 ? 9.991   -3.185  37.871  1.00 24.65 ? 301  TRP B CE3 1 
ATOM   6833 C CZ2 . TRP B  1 302 ? 7.525   -3.775  39.145  1.00 25.12 ? 301  TRP B CZ2 1 
ATOM   6834 C CZ3 . TRP B  1 302 ? 9.109   -4.113  37.341  1.00 23.92 ? 301  TRP B CZ3 1 
ATOM   6835 C CH2 . TRP B  1 302 ? 7.889   -4.396  37.974  1.00 25.55 ? 301  TRP B CH2 1 
ATOM   6836 N N   . MET B  1 303 ? 13.350  -3.130  38.123  1.00 21.52 ? 302  MET B N   1 
ATOM   6837 C CA  . MET B  1 303 ? 13.430  -4.313  37.267  1.00 21.33 ? 302  MET B CA  1 
ATOM   6838 C C   . MET B  1 303 ? 14.406  -5.364  37.808  1.00 21.53 ? 302  MET B C   1 
ATOM   6839 O O   . MET B  1 303 ? 14.185  -6.573  37.646  1.00 21.50 ? 302  MET B O   1 
ATOM   6840 C CB  . MET B  1 303 ? 13.818  -3.902  35.835  1.00 21.23 ? 302  MET B CB  1 
ATOM   6841 C CG  . MET B  1 303 ? 13.766  -5.033  34.797  1.00 20.21 ? 302  MET B CG  1 
ATOM   6842 S SD  . MET B  1 303 ? 12.160  -5.849  34.635  1.00 20.81 ? 302  MET B SD  1 
ATOM   6843 C CE  . MET B  1 303 ? 11.097  -4.532  34.051  1.00 20.16 ? 302  MET B CE  1 
ATOM   6844 N N   . ASP B  1 304 ? 15.485  -4.898  38.441  1.00 21.68 ? 303  ASP B N   1 
ATOM   6845 C CA  . ASP B  1 304 ? 16.438  -5.789  39.117  1.00 22.58 ? 303  ASP B CA  1 
ATOM   6846 C C   . ASP B  1 304 ? 15.717  -6.614  40.183  1.00 22.72 ? 303  ASP B C   1 
ATOM   6847 O O   . ASP B  1 304 ? 15.892  -7.831  40.260  1.00 22.44 ? 303  ASP B O   1 
ATOM   6848 C CB  . ASP B  1 304 ? 17.562  -5.002  39.793  1.00 22.68 ? 303  ASP B CB  1 
ATOM   6849 C CG  . ASP B  1 304 ? 18.481  -4.310  38.810  1.00 23.70 ? 303  ASP B CG  1 
ATOM   6850 O OD1 . ASP B  1 304 ? 18.518  -4.716  37.629  1.00 23.39 ? 303  ASP B OD1 1 
ATOM   6851 O OD2 . ASP B  1 304 ? 19.214  -3.355  39.157  1.00 24.00 ? 303  ASP B OD2 1 
ATOM   6852 N N   . GLN B  1 305 ? 14.912  -5.935  41.003  1.00 23.29 ? 304  GLN B N   1 
ATOM   6853 C CA  . GLN B  1 305 ? 14.127  -6.615  42.045  1.00 23.55 ? 304  GLN B CA  1 
ATOM   6854 C C   . GLN B  1 305 ? 13.073  -7.569  41.478  1.00 23.46 ? 304  GLN B C   1 
ATOM   6855 O O   . GLN B  1 305 ? 12.912  -8.682  41.990  1.00 23.03 ? 304  GLN B O   1 
ATOM   6856 C CB  A GLN B  1 305 ? 13.502  -5.570  42.967  0.70 23.79 ? 304  GLN B CB  1 
ATOM   6857 C CB  B GLN B  1 305 ? 13.482  -5.646  43.060  0.30 23.68 ? 304  GLN B CB  1 
ATOM   6858 C CG  A GLN B  1 305 ? 14.531  -4.863  43.863  0.70 24.62 ? 304  GLN B CG  1 
ATOM   6859 C CG  B GLN B  1 305 ? 12.799  -4.411  42.485  0.30 24.16 ? 304  GLN B CG  1 
ATOM   6860 C CD  A GLN B  1 305 ? 15.317  -5.846  44.721  0.70 24.94 ? 304  GLN B CD  1 
ATOM   6861 C CD  B GLN B  1 305 ? 11.306  -4.302  42.796  0.30 24.80 ? 304  GLN B CD  1 
ATOM   6862 O OE1 A GLN B  1 305 ? 14.739  -6.557  45.536  0.70 26.30 ? 304  GLN B OE1 1 
ATOM   6863 O OE1 B GLN B  1 305 ? 10.464  -4.739  42.006  0.30 24.17 ? 304  GLN B OE1 1 
ATOM   6864 N NE2 A GLN B  1 305 ? 16.627  -5.909  44.515  0.70 26.42 ? 304  GLN B NE2 1 
ATOM   6865 N NE2 B GLN B  1 305 ? 10.978  -3.682  43.926  0.30 25.54 ? 304  GLN B NE2 1 
ATOM   6866 N N   . HIS B  1 306 ? 12.386  -7.165  40.400  1.00 22.47 ? 305  HIS B N   1 
ATOM   6867 C CA  . HIS B  1 306 ? 11.469  -8.062  39.692  1.00 21.91 ? 305  HIS B CA  1 
ATOM   6868 C C   . HIS B  1 306 ? 12.186  -9.354  39.248  1.00 21.86 ? 305  HIS B C   1 
ATOM   6869 O O   . HIS B  1 306 ? 11.696  -10.475 39.457  1.00 21.10 ? 305  HIS B O   1 
ATOM   6870 C CB  . HIS B  1 306 ? 10.813  -7.340  38.490  1.00 21.35 ? 305  HIS B CB  1 
ATOM   6871 C CG  . HIS B  1 306 ? 10.021  -8.247  37.596  1.00 21.82 ? 305  HIS B CG  1 
ATOM   6872 N ND1 . HIS B  1 306 ? 8.706   -8.583  37.845  1.00 21.48 ? 305  HIS B ND1 1 
ATOM   6873 C CD2 . HIS B  1 306 ? 10.366  -8.901  36.459  1.00 20.42 ? 305  HIS B CD2 1 
ATOM   6874 C CE1 . HIS B  1 306 ? 8.281   -9.413  36.907  1.00 22.69 ? 305  HIS B CE1 1 
ATOM   6875 N NE2 . HIS B  1 306 ? 9.272   -9.628  36.059  1.00 21.47 ? 305  HIS B NE2 1 
ATOM   6876 N N   . PHE B  1 307 ? 13.355  -9.194  38.637  1.00 21.48 ? 306  PHE B N   1 
ATOM   6877 C CA  . PHE B  1 307 ? 14.152  -10.318 38.150  1.00 21.85 ? 306  PHE B CA  1 
ATOM   6878 C C   . PHE B  1 307 ? 14.610  -11.230 39.298  1.00 22.57 ? 306  PHE B C   1 
ATOM   6879 O O   . PHE B  1 307 ? 14.553  -12.460 39.200  1.00 22.60 ? 306  PHE B O   1 
ATOM   6880 C CB  . PHE B  1 307 ? 15.369  -9.766  37.386  1.00 21.07 ? 306  PHE B CB  1 
ATOM   6881 C CG  . PHE B  1 307 ? 16.284  -10.819 36.834  1.00 21.17 ? 306  PHE B CG  1 
ATOM   6882 C CD1 . PHE B  1 307 ? 15.780  -11.967 36.211  1.00 21.81 ? 306  PHE B CD1 1 
ATOM   6883 C CD2 . PHE B  1 307 ? 17.667  -10.658 36.924  1.00 20.35 ? 306  PHE B CD2 1 
ATOM   6884 C CE1 . PHE B  1 307 ? 16.641  -12.939 35.696  1.00 23.18 ? 306  PHE B CE1 1 
ATOM   6885 C CE2 . PHE B  1 307 ? 18.533  -11.619 36.403  1.00 20.79 ? 306  PHE B CE2 1 
ATOM   6886 C CZ  . PHE B  1 307 ? 18.019  -12.767 35.789  1.00 21.59 ? 306  PHE B CZ  1 
ATOM   6887 N N   . LEU B  1 308 ? 15.032  -10.602 40.387  1.00 23.62 ? 307  LEU B N   1 
ATOM   6888 C CA  . LEU B  1 308 ? 15.562  -11.333 41.537  1.00 24.29 ? 307  LEU B CA  1 
ATOM   6889 C C   . LEU B  1 308 ? 14.486  -12.127 42.280  1.00 25.05 ? 307  LEU B C   1 
ATOM   6890 O O   . LEU B  1 308 ? 14.725  -13.260 42.689  1.00 25.16 ? 307  LEU B O   1 
ATOM   6891 C CB  . LEU B  1 308 ? 16.244  -10.361 42.501  1.00 24.38 ? 307  LEU B CB  1 
ATOM   6892 C CG  . LEU B  1 308 ? 17.024  -10.953 43.680  1.00 24.96 ? 307  LEU B CG  1 
ATOM   6893 C CD1 . LEU B  1 308 ? 18.262  -11.707 43.204  1.00 23.61 ? 307  LEU B CD1 1 
ATOM   6894 C CD2 . LEU B  1 308 ? 17.376  -9.858  44.687  1.00 25.68 ? 307  LEU B CD2 1 
ATOM   6895 N N   . LYS B  1 309 ? 13.304  -11.536 42.435  1.00 26.03 ? 308  LYS B N   1 
ATOM   6896 C CA  . LYS B  1 309 ? 12.293  -12.062 43.363  1.00 26.51 ? 308  LYS B CA  1 
ATOM   6897 C C   . LYS B  1 309 ? 11.159  -12.878 42.735  1.00 26.92 ? 308  LYS B C   1 
ATOM   6898 O O   . LYS B  1 309 ? 10.415  -13.552 43.448  1.00 27.24 ? 308  LYS B O   1 
ATOM   6899 C CB  . LYS B  1 309 ? 11.682  -10.908 44.147  1.00 26.76 ? 308  LYS B CB  1 
ATOM   6900 C CG  . LYS B  1 309 ? 12.643  -10.190 45.091  1.00 28.61 ? 308  LYS B CG  1 
ATOM   6901 C CD  . LYS B  1 309 ? 12.011  -8.937  45.690  1.00 33.49 ? 308  LYS B CD  1 
ATOM   6902 C CE  . LYS B  1 309 ? 10.524  -9.112  45.979  1.00 35.87 ? 308  LYS B CE  1 
ATOM   6903 N NZ  . LYS B  1 309 ? 9.937   -7.876  46.579  1.00 39.73 ? 308  LYS B NZ  1 
ATOM   6904 N N   . THR B  1 310 ? 11.002  -12.808 41.415  1.00 26.11 ? 309  THR B N   1 
ATOM   6905 C CA  . THR B  1 310 ? 9.826   -13.383 40.752  1.00 25.71 ? 309  THR B CA  1 
ATOM   6906 C C   . THR B  1 310 ? 10.053  -14.814 40.259  1.00 25.90 ? 309  THR B C   1 
ATOM   6907 O O   . THR B  1 310 ? 11.078  -15.092 39.628  1.00 26.34 ? 309  THR B O   1 
ATOM   6908 C CB  . THR B  1 310 ? 9.390   -12.468 39.578  1.00 25.61 ? 309  THR B CB  1 
ATOM   6909 O OG1 . THR B  1 310 ? 9.179   -11.139 40.063  1.00 24.07 ? 309  THR B OG1 1 
ATOM   6910 C CG2 . THR B  1 310 ? 8.030   -12.858 39.044  1.00 25.16 ? 309  THR B CG2 1 
ATOM   6911 N N   . PRO B  1 311 ? 9.109   -15.725 40.533  1.00 26.09 ? 310  PRO B N   1 
ATOM   6912 C CA  . PRO B  1 311 ? 9.190   -17.095 40.005  1.00 26.18 ? 310  PRO B CA  1 
ATOM   6913 C C   . PRO B  1 311 ? 9.330   -17.057 38.480  1.00 26.51 ? 310  PRO B C   1 
ATOM   6914 O O   . PRO B  1 311 ? 8.680   -16.217 37.859  1.00 26.42 ? 310  PRO B O   1 
ATOM   6915 C CB  . PRO B  1 311 ? 7.828   -17.695 40.374  1.00 26.18 ? 310  PRO B CB  1 
ATOM   6916 C CG  . PRO B  1 311 ? 7.392   -16.923 41.573  1.00 26.08 ? 310  PRO B CG  1 
ATOM   6917 C CD  . PRO B  1 311 ? 7.892   -15.524 41.342  1.00 26.39 ? 310  PRO B CD  1 
ATOM   6918 N N   . LEU B  1 312 ? 10.132  -17.958 37.916  1.00 27.00 ? 311  LEU B N   1 
ATOM   6919 C CA  . LEU B  1 312 ? 10.519  -17.911 36.496  1.00 27.26 ? 311  LEU B CA  1 
ATOM   6920 C C   . LEU B  1 312 ? 9.360   -17.807 35.510  1.00 27.64 ? 311  LEU B C   1 
ATOM   6921 O O   . LEU B  1 312 ? 9.454   -17.091 34.511  1.00 27.36 ? 311  LEU B O   1 
ATOM   6922 C CB  . LEU B  1 312 ? 11.413  -19.093 36.124  1.00 27.36 ? 311  LEU B CB  1 
ATOM   6923 C CG  . LEU B  1 312 ? 12.738  -19.266 36.865  1.00 27.57 ? 311  LEU B CG  1 
ATOM   6924 C CD1 . LEU B  1 312 ? 13.572  -20.326 36.170  1.00 28.92 ? 311  LEU B CD1 1 
ATOM   6925 C CD2 . LEU B  1 312 ? 13.532  -17.970 37.007  1.00 28.81 ? 311  LEU B CD2 1 
ATOM   6926 N N   . GLU B  1 313 ? 8.271   -18.515 35.799  1.00 27.47 ? 312  GLU B N   1 
ATOM   6927 C CA  . GLU B  1 313 ? 7.147   -18.621 34.869  1.00 27.37 ? 312  GLU B CA  1 
ATOM   6928 C C   . GLU B  1 313 ? 6.370   -17.306 34.675  1.00 26.54 ? 312  GLU B C   1 
ATOM   6929 O O   . GLU B  1 313 ? 5.546   -17.198 33.757  1.00 26.73 ? 312  GLU B O   1 
ATOM   6930 C CB  . GLU B  1 313 ? 6.218   -19.772 35.296  1.00 28.11 ? 312  GLU B CB  1 
ATOM   6931 C CG  . GLU B  1 313 ? 5.474   -19.511 36.600  1.00 29.59 ? 312  GLU B CG  1 
ATOM   6932 C CD  . GLU B  1 313 ? 6.219   -19.968 37.850  1.00 32.76 ? 312  GLU B CD  1 
ATOM   6933 O OE1 . GLU B  1 313 ? 5.591   -19.905 38.929  1.00 37.30 ? 312  GLU B OE1 1 
ATOM   6934 O OE2 . GLU B  1 313 ? 7.407   -20.383 37.783  1.00 32.52 ? 312  GLU B OE2 1 
ATOM   6935 N N   . LYS B  1 314 ? 6.638   -16.310 35.520  1.00 25.73 ? 313  LYS B N   1 
ATOM   6936 C CA  . LYS B  1 314 ? 6.038   -14.976 35.363  1.00 25.31 ? 313  LYS B CA  1 
ATOM   6937 C C   . LYS B  1 314 ? 7.064   -13.829 35.503  1.00 23.89 ? 313  LYS B C   1 
ATOM   6938 O O   . LYS B  1 314 ? 6.727   -12.710 35.917  1.00 23.35 ? 313  LYS B O   1 
ATOM   6939 C CB  . LYS B  1 314 ? 4.840   -14.795 36.315  1.00 26.36 ? 313  LYS B CB  1 
ATOM   6940 C CG  . LYS B  1 314 ? 5.173   -14.898 37.805  1.00 28.63 ? 313  LYS B CG  1 
ATOM   6941 C CD  . LYS B  1 314 ? 3.967   -14.467 38.658  1.00 31.94 ? 313  LYS B CD  1 
ATOM   6942 C CE  . LYS B  1 314 ? 4.037   -15.047 40.064  1.00 34.17 ? 313  LYS B CE  1 
ATOM   6943 N NZ  . LYS B  1 314 ? 2.788   -14.738 40.835  1.00 36.64 ? 313  LYS B NZ  1 
ATOM   6944 N N   . ASN B  1 315 ? 8.304   -14.137 35.125  1.00 23.06 ? 314  ASN B N   1 
ATOM   6945 C CA  . ASN B  1 315 ? 9.470   -13.263 35.278  1.00 22.41 ? 314  ASN B CA  1 
ATOM   6946 C C   . ASN B  1 315 ? 9.812   -12.689 33.892  1.00 22.21 ? 314  ASN B C   1 
ATOM   6947 O O   . ASN B  1 315 ? 10.294  -13.427 33.029  1.00 22.50 ? 314  ASN B O   1 
ATOM   6948 C CB  . ASN B  1 315 ? 10.637  -14.108 35.832  1.00 22.03 ? 314  ASN B CB  1 
ATOM   6949 C CG  . ASN B  1 315 ? 11.838  -13.279 36.260  1.00 22.86 ? 314  ASN B CG  1 
ATOM   6950 O OD1 . ASN B  1 315 ? 12.335  -12.424 35.508  1.00 21.96 ? 314  ASN B OD1 1 
ATOM   6951 N ND2 . ASN B  1 315 ? 12.337  -13.543 37.470  1.00 22.59 ? 314  ASN B ND2 1 
ATOM   6952 N N   . ALA B  1 316 ? 9.542   -11.398 33.682  1.00 22.01 ? 315  ALA B N   1 
ATOM   6953 C CA  . ALA B  1 316 ? 9.606   -10.794 32.325  1.00 21.38 ? 315  ALA B CA  1 
ATOM   6954 C C   . ALA B  1 316 ? 10.910  -11.057 31.544  1.00 21.04 ? 315  ALA B C   1 
ATOM   6955 O O   . ALA B  1 316 ? 10.834  -11.598 30.432  1.00 20.22 ? 315  ALA B O   1 
ATOM   6956 C CB  . ALA B  1 316 ? 9.237   -9.306  32.326  1.00 21.27 ? 315  ALA B CB  1 
ATOM   6957 N N   . PRO B  1 317 ? 12.086  -10.698 32.078  1.00 20.87 ? 316  PRO B N   1 
ATOM   6958 C CA  . PRO B  1 317 ? 13.330  -10.961 31.337  1.00 20.56 ? 316  PRO B CA  1 
ATOM   6959 C C   . PRO B  1 317 ? 13.597  -12.446 31.106  1.00 20.08 ? 316  PRO B C   1 
ATOM   6960 O O   . PRO B  1 317 ? 14.197  -12.785 30.099  1.00 19.35 ? 316  PRO B O   1 
ATOM   6961 C CB  . PRO B  1 317 ? 14.427  -10.333 32.207  1.00 20.27 ? 316  PRO B CB  1 
ATOM   6962 C CG  . PRO B  1 317 ? 13.833  -10.223 33.587  1.00 21.17 ? 316  PRO B CG  1 
ATOM   6963 C CD  . PRO B  1 317 ? 12.355  -10.008 33.359  1.00 20.70 ? 316  PRO B CD  1 
ATOM   6964 N N   . VAL B  1 318 ? 13.168  -13.319 32.020  1.00 19.61 ? 317  VAL B N   1 
ATOM   6965 C CA  . VAL B  1 318 ? 13.321  -14.751 31.823  1.00 19.97 ? 317  VAL B CA  1 
ATOM   6966 C C   . VAL B  1 318 ? 12.470  -15.243 30.642  1.00 18.96 ? 317  VAL B C   1 
ATOM   6967 O O   . VAL B  1 318 ? 12.950  -15.995 29.782  1.00 19.67 ? 317  VAL B O   1 
ATOM   6968 C CB  . VAL B  1 318 ? 13.006  -15.531 33.121  1.00 19.88 ? 317  VAL B CB  1 
ATOM   6969 C CG1 . VAL B  1 318 ? 13.053  -17.014 32.874  1.00 20.30 ? 317  VAL B CG1 1 
ATOM   6970 C CG2 . VAL B  1 318 ? 14.010  -15.120 34.226  1.00 20.30 ? 317  VAL B CG2 1 
ATOM   6971 N N   . LEU B  1 319 ? 11.207  -14.823 30.608  1.00 18.99 ? 318  LEU B N   1 
ATOM   6972 C CA  . LEU B  1 319 ? 10.306  -15.215 29.519  1.00 19.13 ? 318  LEU B CA  1 
ATOM   6973 C C   . LEU B  1 319 ? 10.798  -14.710 28.147  1.00 18.53 ? 318  LEU B C   1 
ATOM   6974 O O   . LEU B  1 319 ? 10.772  -15.453 27.162  1.00 17.99 ? 318  LEU B O   1 
ATOM   6975 C CB  . LEU B  1 319 ? 8.871   -14.754 29.812  1.00 19.82 ? 318  LEU B CB  1 
ATOM   6976 C CG  . LEU B  1 319 ? 8.211   -15.427 31.036  1.00 21.33 ? 318  LEU B CG  1 
ATOM   6977 C CD1 . LEU B  1 319 ? 6.815   -14.891 31.251  1.00 23.17 ? 318  LEU B CD1 1 
ATOM   6978 C CD2 . LEU B  1 319 ? 8.170   -16.948 30.899  1.00 22.88 ? 318  LEU B CD2 1 
ATOM   6979 N N   . LEU B  1 320 ? 11.257  -13.460 28.091  1.00 18.24 ? 319  LEU B N   1 
ATOM   6980 C CA  . LEU B  1 320 ? 11.824  -12.935 26.841  1.00 18.21 ? 319  LEU B CA  1 
ATOM   6981 C C   . LEU B  1 320 ? 13.024  -13.764 26.405  1.00 17.94 ? 319  LEU B C   1 
ATOM   6982 O O   . LEU B  1 320 ? 13.189  -14.064 25.210  1.00 17.90 ? 319  LEU B O   1 
ATOM   6983 C CB  . LEU B  1 320 ? 12.229  -11.469 26.979  1.00 17.85 ? 319  LEU B CB  1 
ATOM   6984 C CG  . LEU B  1 320 ? 11.088  -10.465 27.163  1.00 19.99 ? 319  LEU B CG  1 
ATOM   6985 C CD1 . LEU B  1 320 ? 11.658  -9.054  27.334  1.00 20.42 ? 319  LEU B CD1 1 
ATOM   6986 C CD2 . LEU B  1 320 ? 10.074  -10.526 26.007  1.00 18.30 ? 319  LEU B CD2 1 
ATOM   6987 N N   . ALA B  1 321 ? 13.862  -14.137 27.372  1.00 17.67 ? 320  ALA B N   1 
ATOM   6988 C CA  . ALA B  1 321 ? 15.034  -14.948 27.083  1.00 18.04 ? 320  ALA B CA  1 
ATOM   6989 C C   . ALA B  1 321 ? 14.638  -16.307 26.544  1.00 18.01 ? 320  ALA B C   1 
ATOM   6990 O O   . ALA B  1 321 ? 15.227  -16.813 25.581  1.00 18.50 ? 320  ALA B O   1 
ATOM   6991 C CB  . ALA B  1 321 ? 15.872  -15.121 28.352  1.00 17.71 ? 320  ALA B CB  1 
ATOM   6992 N N   . LEU B  1 322 ? 13.634  -16.910 27.182  1.00 18.80 ? 321  LEU B N   1 
ATOM   6993 C CA  . LEU B  1 322 ? 13.171  -18.226 26.778  1.00 19.36 ? 321  LEU B CA  1 
ATOM   6994 C C   . LEU B  1 322 ? 12.574  -18.269 25.380  1.00 18.57 ? 321  LEU B C   1 
ATOM   6995 O O   . LEU B  1 322 ? 12.854  -19.190 24.629  1.00 19.27 ? 321  LEU B O   1 
ATOM   6996 C CB  . LEU B  1 322 ? 12.181  -18.793 27.801  1.00 19.84 ? 321  LEU B CB  1 
ATOM   6997 C CG  . LEU B  1 322 ? 12.849  -19.144 29.134  1.00 20.78 ? 321  LEU B CG  1 
ATOM   6998 C CD1 . LEU B  1 322 ? 11.784  -19.493 30.190  1.00 22.54 ? 321  LEU B CD1 1 
ATOM   6999 C CD2 . LEU B  1 322 ? 13.864  -20.262 28.971  1.00 20.82 ? 321  LEU B CD2 1 
ATOM   7000 N N   . LEU B  1 323 ? 11.740  -17.285 25.047  1.00 18.80 ? 322  LEU B N   1 
ATOM   7001 C CA  . LEU B  1 323 ? 11.197  -17.197 23.702  1.00 18.11 ? 322  LEU B CA  1 
ATOM   7002 C C   . LEU B  1 323 ? 12.336  -17.069 22.688  1.00 18.54 ? 322  LEU B C   1 
ATOM   7003 O O   . LEU B  1 323 ? 12.300  -17.692 21.633  1.00 17.76 ? 322  LEU B O   1 
ATOM   7004 C CB  . LEU B  1 323 ? 10.213  -16.030 23.596  1.00 18.47 ? 322  LEU B CB  1 
ATOM   7005 C CG  . LEU B  1 323 ? 8.952   -16.167 24.475  1.00 18.60 ? 322  LEU B CG  1 
ATOM   7006 C CD1 . LEU B  1 323 ? 8.309   -14.811 24.770  1.00 18.46 ? 322  LEU B CD1 1 
ATOM   7007 C CD2 . LEU B  1 323 ? 7.957   -17.117 23.838  1.00 19.98 ? 322  LEU B CD2 1 
ATOM   7008 N N   . GLY B  1 324 ? 13.350  -16.277 23.016  1.00 18.44 ? 323  GLY B N   1 
ATOM   7009 C CA  . GLY B  1 324 ? 14.526  -16.172 22.163  1.00 19.23 ? 323  GLY B CA  1 
ATOM   7010 C C   . GLY B  1 324 ? 15.235  -17.508 21.938  1.00 19.64 ? 323  GLY B C   1 
ATOM   7011 O O   . GLY B  1 324 ? 15.599  -17.830 20.813  1.00 19.58 ? 323  GLY B O   1 
ATOM   7012 N N   . ILE B  1 325 ? 15.438  -18.286 23.008  1.00 19.78 ? 324  ILE B N   1 
ATOM   7013 C CA  . ILE B  1 325 ? 16.057  -19.621 22.900  1.00 20.34 ? 324  ILE B CA  1 
ATOM   7014 C C   . ILE B  1 325 ? 15.256  -20.544 21.959  1.00 19.26 ? 324  ILE B C   1 
ATOM   7015 O O   . ILE B  1 325 ? 15.821  -21.282 21.156  1.00 19.33 ? 324  ILE B O   1 
ATOM   7016 C CB  . ILE B  1 325 ? 16.179  -20.278 24.315  1.00 20.50 ? 324  ILE B CB  1 
ATOM   7017 C CG1 . ILE B  1 325 ? 17.156  -19.501 25.216  1.00 22.44 ? 324  ILE B CG1 1 
ATOM   7018 C CG2 . ILE B  1 325 ? 16.545  -21.774 24.217  1.00 22.05 ? 324  ILE B CG2 1 
ATOM   7019 C CD1 . ILE B  1 325 ? 18.583  -19.500 24.749  1.00 23.41 ? 324  ILE B CD1 1 
ATOM   7020 N N   . TRP B  1 326 ? 13.936  -20.499 22.090  1.00 18.66 ? 325  TRP B N   1 
ATOM   7021 C CA  . TRP B  1 326 ? 13.027  -21.279 21.255  1.00 18.16 ? 325  TRP B CA  1 
ATOM   7022 C C   . TRP B  1 326 ? 13.231  -20.936 19.773  1.00 18.22 ? 325  TRP B C   1 
ATOM   7023 O O   . TRP B  1 326 ? 13.402  -21.829 18.944  1.00 18.11 ? 325  TRP B O   1 
ATOM   7024 C CB  . TRP B  1 326 ? 11.605  -20.985 21.735  1.00 17.75 ? 325  TRP B CB  1 
ATOM   7025 C CG  . TRP B  1 326 ? 10.444  -21.599 21.024  1.00 19.09 ? 325  TRP B CG  1 
ATOM   7026 C CD1 . TRP B  1 326 ? 9.431   -20.925 20.417  1.00 20.35 ? 325  TRP B CD1 1 
ATOM   7027 C CD2 . TRP B  1 326 ? 10.114  -22.998 20.914  1.00 20.29 ? 325  TRP B CD2 1 
ATOM   7028 N NE1 . TRP B  1 326 ? 8.493   -21.801 19.928  1.00 20.52 ? 325  TRP B NE1 1 
ATOM   7029 C CE2 . TRP B  1 326 ? 8.889   -23.083 20.214  1.00 20.53 ? 325  TRP B CE2 1 
ATOM   7030 C CE3 . TRP B  1 326 ? 10.737  -24.184 21.327  1.00 19.90 ? 325  TRP B CE3 1 
ATOM   7031 C CZ2 . TRP B  1 326 ? 8.272   -24.310 19.906  1.00 21.75 ? 325  TRP B CZ2 1 
ATOM   7032 C CZ3 . TRP B  1 326 ? 10.119  -25.405 21.029  1.00 21.77 ? 325  TRP B CZ3 1 
ATOM   7033 C CH2 . TRP B  1 326 ? 8.908   -25.454 20.311  1.00 20.52 ? 325  TRP B CH2 1 
ATOM   7034 N N   . TYR B  1 327 ? 13.282  -19.643 19.447  1.00 17.61 ? 326  TYR B N   1 
ATOM   7035 C CA  . TYR B  1 327 ? 13.476  -19.245 18.045  1.00 18.04 ? 326  TYR B CA  1 
ATOM   7036 C C   . TYR B  1 327 ? 14.889  -19.482 17.524  1.00 17.92 ? 326  TYR B C   1 
ATOM   7037 O O   . TYR B  1 327 ? 15.069  -19.846 16.350  1.00 17.84 ? 326  TYR B O   1 
ATOM   7038 C CB  . TYR B  1 327 ? 13.037  -17.798 17.805  1.00 17.50 ? 326  TYR B CB  1 
ATOM   7039 C CG  . TYR B  1 327 ? 11.560  -17.605 18.046  1.00 17.07 ? 326  TYR B CG  1 
ATOM   7040 C CD1 . TYR B  1 327 ? 10.609  -18.401 17.384  1.00 17.85 ? 326  TYR B CD1 1 
ATOM   7041 C CD2 . TYR B  1 327 ? 11.105  -16.657 18.959  1.00 18.78 ? 326  TYR B CD2 1 
ATOM   7042 C CE1 . TYR B  1 327 ? 9.242   -18.249 17.616  1.00 17.58 ? 326  TYR B CE1 1 
ATOM   7043 C CE2 . TYR B  1 327 ? 9.740   -16.494 19.211  1.00 17.84 ? 326  TYR B CE2 1 
ATOM   7044 C CZ  . TYR B  1 327 ? 8.817   -17.289 18.537  1.00 18.42 ? 326  TYR B CZ  1 
ATOM   7045 O OH  . TYR B  1 327 ? 7.485   -17.123 18.788  1.00 18.18 ? 326  TYR B OH  1 
ATOM   7046 N N   . ILE B  1 328 ? 15.877  -19.273 18.390  1.00 17.34 ? 327  ILE B N   1 
ATOM   7047 C CA  . ILE B  1 328 ? 17.288  -19.454 18.021  1.00 17.53 ? 327  ILE B CA  1 
ATOM   7048 C C   . ILE B  1 328 ? 17.683  -20.928 17.893  1.00 18.51 ? 327  ILE B C   1 
ATOM   7049 O O   . ILE B  1 328 ? 18.203  -21.358 16.858  1.00 18.35 ? 327  ILE B O   1 
ATOM   7050 C CB  . ILE B  1 328 ? 18.234  -18.709 19.018  1.00 17.31 ? 327  ILE B CB  1 
ATOM   7051 C CG1 . ILE B  1 328 ? 18.071  -17.188 18.856  1.00 16.75 ? 327  ILE B CG1 1 
ATOM   7052 C CG2 . ILE B  1 328 ? 19.708  -19.135 18.814  1.00 17.67 ? 327  ILE B CG2 1 
ATOM   7053 C CD1 . ILE B  1 328 ? 18.678  -16.344 19.984  1.00 17.96 ? 327  ILE B CD1 1 
ATOM   7054 N N   . ASN B  1 329 ? 17.435  -21.700 18.949  1.00 18.81 ? 328  ASN B N   1 
ATOM   7055 C CA  . ASN B  1 329 ? 17.959  -23.055 19.015  1.00 19.62 ? 328  ASN B CA  1 
ATOM   7056 C C   . ASN B  1 329 ? 17.020  -24.140 18.493  1.00 20.37 ? 328  ASN B C   1 
ATOM   7057 O O   . ASN B  1 329 ? 17.454  -25.275 18.285  1.00 20.82 ? 328  ASN B O   1 
ATOM   7058 C CB  . ASN B  1 329 ? 18.357  -23.368 20.455  1.00 19.27 ? 328  ASN B CB  1 
ATOM   7059 C CG  . ASN B  1 329 ? 19.489  -22.508 20.941  1.00 17.24 ? 328  ASN B CG  1 
ATOM   7060 O OD1 . ASN B  1 329 ? 19.342  -21.765 21.905  1.00 18.63 ? 328  ASN B OD1 1 
ATOM   7061 N ND2 . ASN B  1 329 ? 20.652  -22.631 20.298  1.00 18.03 ? 328  ASN B ND2 1 
ATOM   7062 N N   . CYS B  1 330 ? 15.742  -23.816 18.322  1.00 20.43 ? 329  CYS B N   1 
ATOM   7063 C CA  . CYS B  1 330 ? 14.787  -24.786 17.783  1.00 21.52 ? 329  CYS B CA  1 
ATOM   7064 C C   . CYS B  1 330 ? 14.366  -24.418 16.365  1.00 21.77 ? 329  CYS B C   1 
ATOM   7065 O O   . CYS B  1 330 ? 14.364  -25.266 15.475  1.00 22.92 ? 329  CYS B O   1 
ATOM   7066 C CB  . CYS B  1 330 ? 13.582  -24.980 18.731  1.00 21.26 ? 329  CYS B CB  1 
ATOM   7067 S SG  . CYS B  1 330 ? 14.053  -25.687 20.349  1.00 25.19 ? 329  CYS B SG  1 
ATOM   7068 N N   . TYR B  1 331 ? 14.036  -23.147 16.136  1.00 21.07 ? 330  TYR B N   1 
ATOM   7069 C CA  . TYR B  1 331 ? 13.667  -22.707 14.783  1.00 20.21 ? 330  TYR B CA  1 
ATOM   7070 C C   . TYR B  1 331 ? 14.850  -22.261 13.900  1.00 20.12 ? 330  TYR B C   1 
ATOM   7071 O O   . TYR B  1 331 ? 14.704  -22.172 12.675  1.00 21.40 ? 330  TYR B O   1 
ATOM   7072 C CB  . TYR B  1 331 ? 12.649  -21.569 14.860  1.00 20.00 ? 330  TYR B CB  1 
ATOM   7073 C CG  . TYR B  1 331 ? 11.214  -21.984 15.131  1.00 19.84 ? 330  TYR B CG  1 
ATOM   7074 C CD1 . TYR B  1 331 ? 10.703  -21.934 16.422  1.00 21.37 ? 330  TYR B CD1 1 
ATOM   7075 C CD2 . TYR B  1 331 ? 10.361  -22.385 14.090  1.00 20.05 ? 330  TYR B CD2 1 
ATOM   7076 C CE1 . TYR B  1 331 ? 9.386   -22.291 16.689  1.00 22.08 ? 330  TYR B CE1 1 
ATOM   7077 C CE2 . TYR B  1 331 ? 9.044   -22.735 14.344  1.00 21.75 ? 330  TYR B CE2 1 
ATOM   7078 C CZ  . TYR B  1 331 ? 8.570   -22.682 15.655  1.00 22.45 ? 330  TYR B CZ  1 
ATOM   7079 O OH  . TYR B  1 331 ? 7.271   -23.024 15.929  1.00 25.53 ? 330  TYR B OH  1 
ATOM   7080 N N   . GLY B  1 332 ? 15.996  -21.961 14.512  1.00 19.55 ? 331  GLY B N   1 
ATOM   7081 C CA  . GLY B  1 332 ? 17.189  -21.550 13.785  1.00 18.86 ? 331  GLY B CA  1 
ATOM   7082 C C   . GLY B  1 332 ? 17.223  -20.125 13.245  1.00 19.16 ? 331  GLY B C   1 
ATOM   7083 O O   . GLY B  1 332 ? 17.968  -19.853 12.300  1.00 18.90 ? 331  GLY B O   1 
ATOM   7084 N N   . CYS B  1 333 ? 16.434  -19.228 13.835  1.00 18.54 ? 332  CYS B N   1 
ATOM   7085 C CA  . CYS B  1 333 ? 16.414  -17.818 13.406  1.00 17.88 ? 332  CYS B CA  1 
ATOM   7086 C C   . CYS B  1 333 ? 17.688  -17.081 13.790  1.00 17.66 ? 332  CYS B C   1 
ATOM   7087 O O   . CYS B  1 333 ? 18.017  -16.993 14.984  1.00 18.60 ? 332  CYS B O   1 
ATOM   7088 C CB  . CYS B  1 333 ? 15.225  -17.074 14.025  1.00 17.89 ? 332  CYS B CB  1 
ATOM   7089 S SG  . CYS B  1 333 ? 13.605  -17.806 13.712  1.00 18.51 ? 332  CYS B SG  1 
ATOM   7090 N N   . GLU B  1 334 ? 18.373  -16.509 12.797  1.00 16.60 ? 333  GLU B N   1 
ATOM   7091 C CA  . GLU B  1 334 ? 19.639  -15.807 13.023  1.00 16.56 ? 333  GLU B CA  1 
ATOM   7092 C C   . GLU B  1 334 ? 19.484  -14.456 13.711  1.00 15.34 ? 333  GLU B C   1 
ATOM   7093 O O   . GLU B  1 334 ? 20.428  -13.985 14.335  1.00 15.14 ? 333  GLU B O   1 
ATOM   7094 C CB  . GLU B  1 334 ? 20.404  -15.554 11.705  1.00 16.32 ? 333  GLU B CB  1 
ATOM   7095 C CG  . GLU B  1 334 ? 21.052  -16.775 11.059  1.00 17.75 ? 333  GLU B CG  1 
ATOM   7096 C CD  . GLU B  1 334 ? 22.019  -16.378 9.945   1.00 18.47 ? 333  GLU B CD  1 
ATOM   7097 O OE1 . GLU B  1 334 ? 22.551  -15.256 10.012  1.00 20.87 ? 333  GLU B OE1 1 
ATOM   7098 O OE2 . GLU B  1 334 ? 22.232  -17.177 8.996   1.00 20.01 ? 333  GLU B OE2 1 
ATOM   7099 N N   . THR B  1 335 ? 18.326  -13.809 13.537  1.00 15.59 ? 334  THR B N   1 
ATOM   7100 C CA  . THR B  1 335 ? 18.190  -12.395 13.915  1.00 15.26 ? 334  THR B CA  1 
ATOM   7101 C C   . THR B  1 335 ? 17.052  -12.128 14.887  1.00 15.51 ? 334  THR B C   1 
ATOM   7102 O O   . THR B  1 335 ? 16.148  -12.946 15.066  1.00 15.98 ? 334  THR B O   1 
ATOM   7103 C CB  . THR B  1 335 ? 18.040  -11.428 12.685  1.00 15.34 ? 334  THR B CB  1 
ATOM   7104 O OG1 . THR B  1 335 ? 16.683  -11.427 12.196  1.00 15.24 ? 334  THR B OG1 1 
ATOM   7105 C CG2 . THR B  1 335 ? 18.920  -11.850 11.513  1.00 15.63 ? 334  THR B CG2 1 
ATOM   7106 N N   . HIS B  1 336 ? 17.128  -10.959 15.509  1.00 15.66 ? 335  HIS B N   1 
ATOM   7107 C CA  . HIS B  1 336 ? 16.087  -10.481 16.419  1.00 15.68 ? 335  HIS B CA  1 
ATOM   7108 C C   . HIS B  1 336 ? 15.904  -8.987  16.142  1.00 14.87 ? 335  HIS B C   1 
ATOM   7109 O O   . HIS B  1 336 ? 16.858  -8.228  16.229  1.00 15.49 ? 335  HIS B O   1 
ATOM   7110 C CB  . HIS B  1 336 ? 16.523  -10.709 17.875  1.00 16.66 ? 335  HIS B CB  1 
ATOM   7111 C CG  . HIS B  1 336 ? 15.505  -10.273 18.877  1.00 17.19 ? 335  HIS B CG  1 
ATOM   7112 N ND1 . HIS B  1 336 ? 14.404  -11.034 19.202  1.00 20.42 ? 335  HIS B ND1 1 
ATOM   7113 C CD2 . HIS B  1 336 ? 15.418  -9.144  19.617  1.00 20.09 ? 335  HIS B CD2 1 
ATOM   7114 C CE1 . HIS B  1 336 ? 13.668  -10.380 20.087  1.00 19.61 ? 335  HIS B CE1 1 
ATOM   7115 N NE2 . HIS B  1 336 ? 14.267  -9.233  20.361  1.00 19.04 ? 335  HIS B NE2 1 
ATOM   7116 N N   . ALA B  1 337 ? 14.693  -8.575  15.782  1.00 14.85 ? 336  ALA B N   1 
ATOM   7117 C CA  . ALA B  1 337 ? 14.445  -7.164  15.437  1.00 15.03 ? 336  ALA B CA  1 
ATOM   7118 C C   . ALA B  1 337 ? 13.818  -6.414  16.601  1.00 15.29 ? 336  ALA B C   1 
ATOM   7119 O O   . ALA B  1 337 ? 12.877  -6.908  17.227  1.00 15.54 ? 336  ALA B O   1 
ATOM   7120 C CB  . ALA B  1 337 ? 13.579  -7.041  14.167  1.00 16.42 ? 336  ALA B CB  1 
ATOM   7121 N N   . LEU B  1 338 ? 14.361  -5.229  16.888  1.00 14.42 ? 337  LEU B N   1 
ATOM   7122 C CA  . LEU B  1 338 ? 13.814  -4.312  17.879  1.00 14.57 ? 337  LEU B CA  1 
ATOM   7123 C C   . LEU B  1 338 ? 13.206  -3.131  17.143  1.00 14.06 ? 337  LEU B C   1 
ATOM   7124 O O   . LEU B  1 338 ? 13.923  -2.376  16.473  1.00 14.25 ? 337  LEU B O   1 
ATOM   7125 C CB  . LEU B  1 338 ? 14.931  -3.817  18.814  1.00 15.26 ? 337  LEU B CB  1 
ATOM   7126 C CG  . LEU B  1 338 ? 15.216  -4.430  20.191  1.00 21.08 ? 337  LEU B CG  1 
ATOM   7127 C CD1 . LEU B  1 338 ? 14.578  -5.778  20.540  1.00 20.66 ? 337  LEU B CD1 1 
ATOM   7128 C CD2 . LEU B  1 338 ? 16.704  -4.392  20.535  1.00 18.50 ? 337  LEU B CD2 1 
ATOM   7129 N N   . LEU B  1 339 ? 11.896  -2.956  17.308  1.00 13.42 ? 338  LEU B N   1 
ATOM   7130 C CA  . LEU B  1 339 ? 11.127  -1.995  16.500  1.00 13.60 ? 338  LEU B CA  1 
ATOM   7131 C C   . LEU B  1 339 ? 10.333  -1.056  17.412  1.00 13.78 ? 338  LEU B C   1 
ATOM   7132 O O   . LEU B  1 339 ? 9.139   -1.254  17.650  1.00 14.28 ? 338  LEU B O   1 
ATOM   7133 C CB  . LEU B  1 339 ? 10.209  -2.738  15.502  1.00 13.86 ? 338  LEU B CB  1 
ATOM   7134 C CG  . LEU B  1 339 ? 10.895  -3.727  14.535  1.00 13.42 ? 338  LEU B CG  1 
ATOM   7135 C CD1 . LEU B  1 339 ? 9.841   -4.585  13.824  1.00 13.75 ? 338  LEU B CD1 1 
ATOM   7136 C CD2 . LEU B  1 339 ? 11.838  -3.030  13.518  1.00 13.59 ? 338  LEU B CD2 1 
ATOM   7137 N N   . PRO B  1 340 ? 10.989  -0.024  17.933  1.00 14.13 ? 339  PRO B N   1 
ATOM   7138 C CA  . PRO B  1 340 ? 10.276  0.911   18.811  1.00 13.94 ? 339  PRO B CA  1 
ATOM   7139 C C   . PRO B  1 340 ? 9.467   1.938   18.018  1.00 13.67 ? 339  PRO B C   1 
ATOM   7140 O O   . PRO B  1 340 ? 10.029  2.573   17.130  1.00 14.13 ? 339  PRO B O   1 
ATOM   7141 C CB  . PRO B  1 340 ? 11.405  1.590   19.608  1.00 14.11 ? 339  PRO B CB  1 
ATOM   7142 C CG  . PRO B  1 340 ? 12.649  1.445   18.774  1.00 15.66 ? 339  PRO B CG  1 
ATOM   7143 C CD  . PRO B  1 340 ? 12.416  0.324   17.759  1.00 14.69 ? 339  PRO B CD  1 
ATOM   7144 N N   . TYR B  1 341 ? 8.184   2.101   18.348  1.00 13.10 ? 340  TYR B N   1 
ATOM   7145 C CA  . TYR B  1 341 ? 7.314   3.058   17.670  1.00 13.47 ? 340  TYR B CA  1 
ATOM   7146 C C   . TYR B  1 341 ? 7.431   4.411   18.380  1.00 14.05 ? 340  TYR B C   1 
ATOM   7147 O O   . TYR B  1 341 ? 6.489   4.911   18.985  1.00 14.34 ? 340  TYR B O   1 
ATOM   7148 C CB  . TYR B  1 341 ? 5.880   2.501   17.599  1.00 13.43 ? 340  TYR B CB  1 
ATOM   7149 C CG  . TYR B  1 341 ? 5.706   1.622   16.377  1.00 14.29 ? 340  TYR B CG  1 
ATOM   7150 C CD1 . TYR B  1 341 ? 6.508   0.490   16.196  1.00 12.33 ? 340  TYR B CD1 1 
ATOM   7151 C CD2 . TYR B  1 341 ? 4.768   1.934   15.398  1.00 15.03 ? 340  TYR B CD2 1 
ATOM   7152 C CE1 . TYR B  1 341 ? 6.377   -0.307  15.045  1.00 13.38 ? 340  TYR B CE1 1 
ATOM   7153 C CE2 . TYR B  1 341 ? 4.645   1.157   14.260  1.00 14.55 ? 340  TYR B CE2 1 
ATOM   7154 C CZ  . TYR B  1 341 ? 5.450   0.032   14.099  1.00 14.33 ? 340  TYR B CZ  1 
ATOM   7155 O OH  . TYR B  1 341 ? 5.341   -0.757  12.974  1.00 13.18 ? 340  TYR B OH  1 
ATOM   7156 N N   . ASP B  1 342 ? 8.633   4.971   18.288  1.00 13.68 ? 341  ASP B N   1 
ATOM   7157 C CA  . ASP B  1 342 ? 9.018   6.141   19.060  1.00 14.61 ? 341  ASP B CA  1 
ATOM   7158 C C   . ASP B  1 342 ? 10.288  6.721   18.460  1.00 14.27 ? 341  ASP B C   1 
ATOM   7159 O O   . ASP B  1 342 ? 11.355  6.099   18.481  1.00 14.22 ? 341  ASP B O   1 
ATOM   7160 C CB  . ASP B  1 342 ? 9.212   5.767   20.540  1.00 15.02 ? 341  ASP B CB  1 
ATOM   7161 C CG  . ASP B  1 342 ? 9.428   6.975   21.409  1.00 17.90 ? 341  ASP B CG  1 
ATOM   7162 O OD1 . ASP B  1 342 ? 8.435   7.587   21.880  1.00 18.56 ? 341  ASP B OD1 1 
ATOM   7163 O OD2 . ASP B  1 342 ? 10.565  7.416   21.639  1.00 20.79 ? 341  ASP B OD2 1 
ATOM   7164 N N   . GLN B  1 343 ? 10.161  7.915   17.902  1.00 14.71 ? 342  GLN B N   1 
ATOM   7165 C CA  . GLN B  1 343 ? 11.301  8.595   17.305  1.00 16.07 ? 342  GLN B CA  1 
ATOM   7166 C C   . GLN B  1 343 ? 12.401  8.923   18.328  1.00 15.60 ? 342  GLN B C   1 
ATOM   7167 O O   . GLN B  1 343 ? 13.596  8.838   18.025  1.00 16.03 ? 342  GLN B O   1 
ATOM   7168 C CB  . GLN B  1 343 ? 10.824  9.853   16.565  1.00 16.44 ? 342  GLN B CB  1 
ATOM   7169 C CG  . GLN B  1 343 ? 11.853  10.460  15.621  1.00 20.73 ? 342  GLN B CG  1 
ATOM   7170 C CD  . GLN B  1 343 ? 12.261  9.547   14.470  1.00 21.85 ? 342  GLN B CD  1 
ATOM   7171 O OE1 . GLN B  1 343 ? 11.499  8.673   14.006  1.00 20.78 ? 342  GLN B OE1 1 
ATOM   7172 N NE2 . GLN B  1 343 ? 13.489  9.743   14.004  1.00 25.10 ? 342  GLN B NE2 1 
ATOM   7173 N N   . TYR B  1 344 ? 12.020  9.265   19.552  1.00 15.96 ? 343  TYR B N   1 
ATOM   7174 C CA  . TYR B  1 344 ? 13.033  9.488   20.583  1.00 15.94 ? 343  TYR B CA  1 
ATOM   7175 C C   . TYR B  1 344 ? 13.894  8.240   20.870  1.00 15.97 ? 343  TYR B C   1 
ATOM   7176 O O   . TYR B  1 344 ? 15.068  8.372   21.221  1.00 15.43 ? 343  TYR B O   1 
ATOM   7177 C CB  . TYR B  1 344 ? 12.378  9.991   21.876  1.00 15.27 ? 343  TYR B CB  1 
ATOM   7178 C CG  . TYR B  1 344 ? 12.003  11.459  21.873  1.00 17.34 ? 343  TYR B CG  1 
ATOM   7179 C CD1 . TYR B  1 344 ? 10.740  11.882  22.306  1.00 15.68 ? 343  TYR B CD1 1 
ATOM   7180 C CD2 . TYR B  1 344 ? 12.925  12.431  21.497  1.00 17.59 ? 343  TYR B CD2 1 
ATOM   7181 C CE1 . TYR B  1 344 ? 10.406  13.247  22.341  1.00 16.08 ? 343  TYR B CE1 1 
ATOM   7182 C CE2 . TYR B  1 344 ? 12.602  13.789  21.528  1.00 18.88 ? 343  TYR B CE2 1 
ATOM   7183 C CZ  . TYR B  1 344 ? 11.346  14.192  21.949  1.00 18.28 ? 343  TYR B CZ  1 
ATOM   7184 O OH  . TYR B  1 344 ? 11.042  15.547  21.970  1.00 19.47 ? 343  TYR B OH  1 
ATOM   7185 N N   . MET B  1 345 ? 13.314  7.049   20.696  1.00 15.47 ? 344  MET B N   1 
ATOM   7186 C CA  . MET B  1 345 ? 14.027  5.774   20.860  1.00 15.48 ? 344  MET B CA  1 
ATOM   7187 C C   . MET B  1 345 ? 14.824  5.330   19.606  1.00 15.57 ? 344  MET B C   1 
ATOM   7188 O O   . MET B  1 345 ? 15.139  4.148   19.449  1.00 15.74 ? 344  MET B O   1 
ATOM   7189 C CB  . MET B  1 345 ? 13.031  4.680   21.271  1.00 16.02 ? 344  MET B CB  1 
ATOM   7190 C CG  . MET B  1 345 ? 12.518  4.820   22.701  1.00 16.89 ? 344  MET B CG  1 
ATOM   7191 S SD  . MET B  1 345 ? 11.267  3.609   23.100  1.00 18.19 ? 344  MET B SD  1 
ATOM   7192 C CE  . MET B  1 345 ? 12.270  2.216   23.620  1.00 19.37 ? 344  MET B CE  1 
ATOM   7193 N N   . HIS B  1 346 ? 15.174  6.270   18.736  1.00 16.20 ? 345  HIS B N   1 
ATOM   7194 C CA  . HIS B  1 346 ? 15.796  5.902   17.453  1.00 16.26 ? 345  HIS B CA  1 
ATOM   7195 C C   . HIS B  1 346 ? 17.168  5.219   17.543  1.00 17.24 ? 345  HIS B C   1 
ATOM   7196 O O   . HIS B  1 346 ? 17.614  4.603   16.571  1.00 17.18 ? 345  HIS B O   1 
ATOM   7197 C CB  . HIS B  1 346 ? 15.801  7.095   16.487  1.00 16.62 ? 345  HIS B CB  1 
ATOM   7198 C CG  . HIS B  1 346 ? 16.855  8.118   16.771  1.00 16.10 ? 345  HIS B CG  1 
ATOM   7199 N ND1 . HIS B  1 346 ? 16.792  8.994   17.837  1.00 17.75 ? 345  HIS B ND1 1 
ATOM   7200 C CD2 . HIS B  1 346 ? 17.983  8.434   16.095  1.00 15.96 ? 345  HIS B CD2 1 
ATOM   7201 C CE1 . HIS B  1 346 ? 17.852  9.786   17.817  1.00 14.58 ? 345  HIS B CE1 1 
ATOM   7202 N NE2 . HIS B  1 346 ? 18.593  9.460   16.775  1.00 19.61 ? 345  HIS B NE2 1 
ATOM   7203 N N   . ARG B  1 347 ? 17.833  5.325   18.695  1.00 16.12 ? 346  ARG B N   1 
ATOM   7204 C CA  . ARG B  1 347 ? 19.132  4.676   18.919  1.00 17.60 ? 346  ARG B CA  1 
ATOM   7205 C C   . ARG B  1 347 ? 19.079  3.466   19.867  1.00 16.86 ? 346  ARG B C   1 
ATOM   7206 O O   . ARG B  1 347 ? 20.122  2.904   20.235  1.00 17.59 ? 346  ARG B O   1 
ATOM   7207 C CB  . ARG B  1 347 ? 20.173  5.695   19.399  1.00 17.63 ? 346  ARG B CB  1 
ATOM   7208 C CG  . ARG B  1 347 ? 20.619  6.724   18.345  1.00 19.96 ? 346  ARG B CG  1 
ATOM   7209 C CD  . ARG B  1 347 ? 21.804  6.254   17.484  1.00 26.61 ? 346  ARG B CD  1 
ATOM   7210 N NE  . ARG B  1 347 ? 21.285  5.679   16.267  1.00 27.27 ? 346  ARG B NE  1 
ATOM   7211 C CZ  . ARG B  1 347 ? 21.909  4.837   15.455  1.00 25.42 ? 346  ARG B CZ  1 
ATOM   7212 N NH1 . ARG B  1 347 ? 23.150  4.411   15.683  1.00 24.61 ? 346  ARG B NH1 1 
ATOM   7213 N NH2 . ARG B  1 347 ? 21.255  4.418   14.380  1.00 26.17 ? 346  ARG B NH2 1 
ATOM   7214 N N   . PHE B  1 348 ? 17.865  3.041   20.216  1.00 16.88 ? 347  PHE B N   1 
ATOM   7215 C CA  . PHE B  1 348 ? 17.632  1.894   21.097  1.00 17.64 ? 347  PHE B CA  1 
ATOM   7216 C C   . PHE B  1 348 ? 18.163  0.576   20.525  1.00 17.79 ? 347  PHE B C   1 
ATOM   7217 O O   . PHE B  1 348 ? 18.863  -0.177  21.218  1.00 17.21 ? 347  PHE B O   1 
ATOM   7218 C CB  . PHE B  1 348 ? 16.130  1.802   21.417  1.00 17.23 ? 347  PHE B CB  1 
ATOM   7219 C CG  . PHE B  1 348 ? 15.781  0.852   22.544  1.00 19.45 ? 347  PHE B CG  1 
ATOM   7220 C CD1 . PHE B  1 348 ? 15.897  1.257   23.883  1.00 18.12 ? 347  PHE B CD1 1 
ATOM   7221 C CD2 . PHE B  1 348 ? 15.274  -0.416  22.271  1.00 19.31 ? 347  PHE B CD2 1 
ATOM   7222 C CE1 . PHE B  1 348 ? 15.550  0.393   24.944  1.00 20.15 ? 347  PHE B CE1 1 
ATOM   7223 C CE2 . PHE B  1 348 ? 14.929  -1.292  23.321  1.00 20.42 ? 347  PHE B CE2 1 
ATOM   7224 C CZ  . PHE B  1 348 ? 15.066  -0.877  24.663  1.00 21.12 ? 347  PHE B CZ  1 
ATOM   7225 N N   . ALA B  1 349 ? 17.857  0.310   19.255  1.00 17.58 ? 348  ALA B N   1 
ATOM   7226 C CA  . ALA B  1 349 ? 18.344  -0.907  18.582  1.00 17.93 ? 348  ALA B CA  1 
ATOM   7227 C C   . ALA B  1 349 ? 19.871  -0.958  18.476  1.00 17.14 ? 348  ALA B C   1 
ATOM   7228 O O   . ALA B  1 349 ? 20.491  -1.999  18.726  1.00 17.57 ? 348  ALA B O   1 
ATOM   7229 C CB  . ALA B  1 349 ? 17.696  -1.056  17.196  1.00 18.83 ? 348  ALA B CB  1 
ATOM   7230 N N   . ALA B  1 350 ? 20.478  0.169   18.094  1.00 16.65 ? 349  ALA B N   1 
ATOM   7231 C CA  . ALA B  1 350 ? 21.931  0.268   17.981  1.00 16.82 ? 349  ALA B CA  1 
ATOM   7232 C C   . ALA B  1 350 ? 22.609  -0.010  19.323  1.00 16.63 ? 349  ALA B C   1 
ATOM   7233 O O   . ALA B  1 350 ? 23.670  -0.630  19.375  1.00 17.01 ? 349  ALA B O   1 
ATOM   7234 C CB  . ALA B  1 350 ? 22.344  1.644   17.444  1.00 17.34 ? 349  ALA B CB  1 
ATOM   7235 N N   . TYR B  1 351 ? 21.995  0.477   20.402  1.00 16.78 ? 350  TYR B N   1 
ATOM   7236 C CA  . TYR B  1 351 ? 22.519  0.217   21.741  1.00 17.31 ? 350  TYR B CA  1 
ATOM   7237 C C   . TYR B  1 351 ? 22.537  -1.274  22.053  1.00 17.94 ? 350  TYR B C   1 
ATOM   7238 O O   . TYR B  1 351 ? 23.525  -1.809  22.595  1.00 18.18 ? 350  TYR B O   1 
ATOM   7239 C CB  . TYR B  1 351 ? 21.686  0.959   22.790  1.00 17.63 ? 350  TYR B CB  1 
ATOM   7240 C CG  . TYR B  1 351 ? 22.168  0.691   24.193  1.00 17.98 ? 350  TYR B CG  1 
ATOM   7241 C CD1 . TYR B  1 351 ? 23.303  1.336   24.696  1.00 18.05 ? 350  TYR B CD1 1 
ATOM   7242 C CD2 . TYR B  1 351 ? 21.508  -0.224  25.005  1.00 18.14 ? 350  TYR B CD2 1 
ATOM   7243 C CE1 . TYR B  1 351 ? 23.753  1.072   25.997  1.00 18.24 ? 350  TYR B CE1 1 
ATOM   7244 C CE2 . TYR B  1 351 ? 21.955  -0.495  26.302  1.00 18.59 ? 350  TYR B CE2 1 
ATOM   7245 C CZ  . TYR B  1 351 ? 23.074  0.168   26.780  1.00 18.74 ? 350  TYR B CZ  1 
ATOM   7246 O OH  . TYR B  1 351 ? 23.517  -0.085  28.055  1.00 21.08 ? 350  TYR B OH  1 
ATOM   7247 N N   . PHE B  1 352 ? 21.436  -1.950  21.744  1.00 17.94 ? 351  PHE B N   1 
ATOM   7248 C CA  . PHE B  1 352 ? 21.379  -3.373  22.053  1.00 18.33 ? 351  PHE B CA  1 
ATOM   7249 C C   . PHE B  1 352 ? 22.141  -4.258  21.083  1.00 18.89 ? 351  PHE B C   1 
ATOM   7250 O O   . PHE B  1 352 ? 22.379  -5.432  21.384  1.00 18.75 ? 351  PHE B O   1 
ATOM   7251 C CB  . PHE B  1 352 ? 19.944  -3.818  22.389  1.00 17.76 ? 351  PHE B CB  1 
ATOM   7252 C CG  . PHE B  1 352 ? 19.575  -3.518  23.818  1.00 18.92 ? 351  PHE B CG  1 
ATOM   7253 C CD1 . PHE B  1 352 ? 18.648  -2.528  24.126  1.00 20.53 ? 351  PHE B CD1 1 
ATOM   7254 C CD2 . PHE B  1 352 ? 20.240  -4.175  24.864  1.00 19.39 ? 351  PHE B CD2 1 
ATOM   7255 C CE1 . PHE B  1 352 ? 18.349  -2.227  25.449  1.00 19.43 ? 351  PHE B CE1 1 
ATOM   7256 C CE2 . PHE B  1 352 ? 19.947  -3.873  26.182  1.00 18.69 ? 351  PHE B CE2 1 
ATOM   7257 C CZ  . PHE B  1 352 ? 19.001  -2.894  26.474  1.00 19.90 ? 351  PHE B CZ  1 
ATOM   7258 N N   . GLN B  1 353 ? 22.583  -3.696  19.952  1.00 19.21 ? 352  GLN B N   1 
ATOM   7259 C CA  . GLN B  1 353 ? 23.602  -4.379  19.146  1.00 19.72 ? 352  GLN B CA  1 
ATOM   7260 C C   . GLN B  1 353 ? 24.839  -4.648  19.960  1.00 20.98 ? 352  GLN B C   1 
ATOM   7261 O O   . GLN B  1 353 ? 25.316  -5.786  19.961  1.00 21.74 ? 352  GLN B O   1 
ATOM   7262 C CB  . GLN B  1 353 ? 23.953  -3.610  17.871  1.00 19.80 ? 352  GLN B CB  1 
ATOM   7263 C CG  . GLN B  1 353 ? 22.846  -3.750  16.844  1.00 19.38 ? 352  GLN B CG  1 
ATOM   7264 C CD  . GLN B  1 353 ? 23.177  -3.084  15.524  1.00 20.00 ? 352  GLN B CD  1 
ATOM   7265 O OE1 . GLN B  1 353 ? 23.854  -2.048  15.488  1.00 19.97 ? 352  GLN B OE1 1 
ATOM   7266 N NE2 . GLN B  1 353 ? 22.674  -3.663  14.433  1.00 16.73 ? 352  GLN B NE2 1 
ATOM   7267 N N   . GLN B  1 354 ? 25.347  -3.646  20.695  1.00 20.77 ? 353  GLN B N   1 
ATOM   7268 C CA  . GLN B  1 354 ? 26.461  -3.919  21.607  1.00 20.79 ? 353  GLN B CA  1 
ATOM   7269 C C   . GLN B  1 354 ? 26.035  -4.774  22.789  1.00 20.33 ? 353  GLN B C   1 
ATOM   7270 O O   . GLN B  1 354 ? 26.660  -5.795  23.066  1.00 20.07 ? 353  GLN B O   1 
ATOM   7271 C CB  . GLN B  1 354 ? 27.181  -2.662  22.126  1.00 21.00 ? 353  GLN B CB  1 
ATOM   7272 C CG  . GLN B  1 354 ? 28.460  -3.066  22.875  1.00 22.22 ? 353  GLN B CG  1 
ATOM   7273 C CD  . GLN B  1 354 ? 29.308  -1.923  23.422  1.00 24.49 ? 353  GLN B CD  1 
ATOM   7274 O OE1 . GLN B  1 354 ? 30.452  -2.155  23.858  1.00 26.67 ? 353  GLN B OE1 1 
ATOM   7275 N NE2 . GLN B  1 354 ? 28.773  -0.718  23.421  1.00 23.32 ? 353  GLN B NE2 1 
ATOM   7276 N N   . GLY B  1 355 ? 24.961  -4.368  23.468  1.00 19.48 ? 354  GLY B N   1 
ATOM   7277 C CA  . GLY B  1 355 ? 24.540  -5.041  24.687  1.00 18.96 ? 354  GLY B CA  1 
ATOM   7278 C C   . GLY B  1 355 ? 24.332  -6.534  24.491  1.00 18.86 ? 354  GLY B C   1 
ATOM   7279 O O   . GLY B  1 355 ? 24.814  -7.359  25.278  1.00 18.55 ? 354  GLY B O   1 
ATOM   7280 N N   . ASP B  1 356 ? 23.639  -6.891  23.417  1.00 17.57 ? 355  ASP B N   1 
ATOM   7281 C CA  . ASP B  1 356 ? 23.365  -8.277  23.102  1.00 17.31 ? 355  ASP B CA  1 
ATOM   7282 C C   . ASP B  1 356 ? 24.528  -8.964  22.369  1.00 17.17 ? 355  ASP B C   1 
ATOM   7283 O O   . ASP B  1 356 ? 25.025  -10.022 22.818  1.00 18.22 ? 355  ASP B O   1 
ATOM   7284 C CB  . ASP B  1 356 ? 22.066  -8.353  22.278  1.00 17.38 ? 355  ASP B CB  1 
ATOM   7285 C CG  . ASP B  1 356 ? 21.399  -9.704  22.328  1.00 17.04 ? 355  ASP B CG  1 
ATOM   7286 O OD1 . ASP B  1 356 ? 22.081  -10.755 22.363  1.00 18.42 ? 355  ASP B OD1 1 
ATOM   7287 O OD2 . ASP B  1 356 ? 20.154  -9.809  22.292  1.00 19.47 ? 355  ASP B OD2 1 
ATOM   7288 N N   . MET B  1 357 ? 24.952  -8.391  21.236  1.00 16.64 ? 356  MET B N   1 
ATOM   7289 C CA  . MET B  1 357 ? 25.890  -9.091  20.357  1.00 16.65 ? 356  MET B CA  1 
ATOM   7290 C C   . MET B  1 357 ? 27.295  -9.226  20.934  1.00 16.05 ? 356  MET B C   1 
ATOM   7291 O O   . MET B  1 357 ? 27.945  -10.262 20.743  1.00 16.57 ? 356  MET B O   1 
ATOM   7292 C CB  . MET B  1 357 ? 25.923  -8.466  18.961  1.00 16.32 ? 356  MET B CB  1 
ATOM   7293 C CG  . MET B  1 357 ? 24.599  -8.614  18.250  1.00 14.76 ? 356  MET B CG  1 
ATOM   7294 S SD  . MET B  1 357 ? 24.478  -7.692  16.702  1.00 16.05 ? 356  MET B SD  1 
ATOM   7295 C CE  . MET B  1 357 ? 25.468  -8.685  15.624  1.00 15.48 ? 356  MET B CE  1 
ATOM   7296 N N   . GLU B  1 358 ? 27.769  -8.203  21.639  1.00 16.82 ? 357  GLU B N   1 
ATOM   7297 C CA  . GLU B  1 358 ? 29.120  -8.288  22.213  1.00 17.28 ? 357  GLU B CA  1 
ATOM   7298 C C   . GLU B  1 358 ? 29.099  -9.165  23.476  1.00 18.19 ? 357  GLU B C   1 
ATOM   7299 O O   . GLU B  1 358 ? 30.122  -9.755  23.858  1.00 19.03 ? 357  GLU B O   1 
ATOM   7300 C CB  . GLU B  1 358 ? 29.694  -6.902  22.516  1.00 17.40 ? 357  GLU B CB  1 
ATOM   7301 C CG  . GLU B  1 358 ? 31.185  -6.935  22.826  1.00 18.68 ? 357  GLU B CG  1 
ATOM   7302 C CD  . GLU B  1 358 ? 31.783  -5.567  23.041  1.00 21.50 ? 357  GLU B CD  1 
ATOM   7303 O OE1 . GLU B  1 358 ? 32.507  -5.081  22.143  1.00 25.61 ? 357  GLU B OE1 1 
ATOM   7304 O OE2 . GLU B  1 358 ? 31.527  -4.967  24.113  1.00 22.69 ? 357  GLU B OE2 1 
ATOM   7305 N N   . SER B  1 359 ? 27.932  -9.255  24.113  1.00 17.91 ? 358  SER B N   1 
ATOM   7306 C CA  . SER B  1 359 ? 27.765  -10.137 25.273  1.00 18.15 ? 358  SER B CA  1 
ATOM   7307 C C   . SER B  1 359 ? 27.720  -11.596 24.846  1.00 18.26 ? 358  SER B C   1 
ATOM   7308 O O   . SER B  1 359 ? 28.484  -12.439 25.354  1.00 18.08 ? 358  SER B O   1 
ATOM   7309 C CB  . SER B  1 359 ? 26.478  -9.789  26.041  1.00 17.47 ? 358  SER B CB  1 
ATOM   7310 O OG  . SER B  1 359 ? 26.610  -8.565  26.758  1.00 18.05 ? 358  SER B OG  1 
ATOM   7311 N N   . ASN B  1 360 ? 26.816  -11.912 23.917  1.00 17.52 ? 359  ASN B N   1 
ATOM   7312 C CA  . ASN B  1 360 ? 26.484  -13.300 23.632  1.00 17.49 ? 359  ASN B CA  1 
ATOM   7313 C C   . ASN B  1 360 ? 26.947  -13.851 22.283  1.00 16.96 ? 359  ASN B C   1 
ATOM   7314 O O   . ASN B  1 360 ? 26.635  -14.989 21.943  1.00 16.88 ? 359  ASN B O   1 
ATOM   7315 C CB  . ASN B  1 360 ? 24.987  -13.559 23.854  1.00 17.56 ? 359  ASN B CB  1 
ATOM   7316 C CG  . ASN B  1 360 ? 24.590  -13.484 25.319  1.00 18.36 ? 359  ASN B CG  1 
ATOM   7317 O OD1 . ASN B  1 360 ? 25.448  -13.457 26.204  1.00 21.04 ? 359  ASN B OD1 1 
ATOM   7318 N ND2 . ASN B  1 360 ? 23.278  -13.435 25.584  1.00 17.42 ? 359  ASN B ND2 1 
ATOM   7319 N N   . GLY B  1 361 ? 27.703  -13.046 21.543  1.00 17.08 ? 360  GLY B N   1 
ATOM   7320 C CA  . GLY B  1 361 ? 28.369  -13.514 20.343  1.00 17.61 ? 360  GLY B CA  1 
ATOM   7321 C C   . GLY B  1 361 ? 29.633  -14.277 20.679  1.00 18.06 ? 360  GLY B C   1 
ATOM   7322 O O   . GLY B  1 361 ? 30.743  -13.784 20.456  1.00 17.32 ? 360  GLY B O   1 
ATOM   7323 N N   . LYS B  1 362 ? 29.431  -15.488 21.194  1.00 18.43 ? 361  LYS B N   1 
ATOM   7324 C CA  . LYS B  1 362 ? 30.474  -16.292 21.833  1.00 18.78 ? 361  LYS B CA  1 
ATOM   7325 C C   . LYS B  1 362 ? 30.392  -17.737 21.370  1.00 19.44 ? 361  LYS B C   1 
ATOM   7326 O O   . LYS B  1 362 ? 29.355  -18.187 20.868  1.00 19.66 ? 361  LYS B O   1 
ATOM   7327 C CB  . LYS B  1 362 ? 30.269  -16.242 23.356  1.00 18.59 ? 361  LYS B CB  1 
ATOM   7328 C CG  . LYS B  1 362 ? 30.340  -14.843 23.983  1.00 17.27 ? 361  LYS B CG  1 
ATOM   7329 C CD  . LYS B  1 362 ? 31.771  -14.288 24.030  1.00 16.92 ? 361  LYS B CD  1 
ATOM   7330 C CE  . LYS B  1 362 ? 31.808  -12.792 24.264  1.00 16.48 ? 361  LYS B CE  1 
ATOM   7331 N NZ  . LYS B  1 362 ? 31.253  -12.356 25.593  1.00 17.51 ? 361  LYS B NZ  1 
ATOM   7332 N N   . TYR B  1 363 ? 31.482  -18.490 21.538  1.00 20.01 ? 362  TYR B N   1 
ATOM   7333 C CA  . TYR B  1 363 ? 31.468  -19.894 21.117  1.00 20.32 ? 362  TYR B CA  1 
ATOM   7334 C C   . TYR B  1 363 ? 32.191  -20.900 22.028  1.00 20.65 ? 362  TYR B C   1 
ATOM   7335 O O   . TYR B  1 363 ? 32.199  -22.090 21.725  1.00 20.85 ? 362  TYR B O   1 
ATOM   7336 C CB  . TYR B  1 363 ? 31.945  -20.044 19.658  1.00 19.63 ? 362  TYR B CB  1 
ATOM   7337 C CG  . TYR B  1 363 ? 33.454  -20.038 19.437  1.00 20.42 ? 362  TYR B CG  1 
ATOM   7338 C CD1 . TYR B  1 363 ? 34.083  -21.147 18.879  1.00 21.00 ? 362  TYR B CD1 1 
ATOM   7339 C CD2 . TYR B  1 363 ? 34.248  -18.928 19.778  1.00 18.36 ? 362  TYR B CD2 1 
ATOM   7340 C CE1 . TYR B  1 363 ? 35.462  -21.164 18.655  1.00 22.21 ? 362  TYR B CE1 1 
ATOM   7341 C CE2 . TYR B  1 363 ? 35.643  -18.941 19.562  1.00 20.17 ? 362  TYR B CE2 1 
ATOM   7342 C CZ  . TYR B  1 363 ? 36.231  -20.071 19.006  1.00 20.77 ? 362  TYR B CZ  1 
ATOM   7343 O OH  . TYR B  1 363 ? 37.588  -20.133 18.775  1.00 24.12 ? 362  TYR B OH  1 
ATOM   7344 N N   . ILE B  1 364 ? 32.805  -20.419 23.101  1.00 21.36 ? 363  ILE B N   1 
ATOM   7345 C CA  . ILE B  1 364 ? 33.457  -21.300 24.070  1.00 22.28 ? 363  ILE B CA  1 
ATOM   7346 C C   . ILE B  1 364 ? 32.660  -21.301 25.370  1.00 22.94 ? 363  ILE B C   1 
ATOM   7347 O O   . ILE B  1 364 ? 32.328  -20.241 25.908  1.00 23.29 ? 363  ILE B O   1 
ATOM   7348 C CB  . ILE B  1 364 ? 34.906  -20.843 24.339  1.00 22.71 ? 363  ILE B CB  1 
ATOM   7349 C CG1 . ILE B  1 364 ? 35.718  -20.717 23.029  1.00 21.46 ? 363  ILE B CG1 1 
ATOM   7350 C CG2 . ILE B  1 364 ? 35.608  -21.779 25.374  1.00 22.79 ? 363  ILE B CG2 1 
ATOM   7351 C CD1 . ILE B  1 364 ? 35.754  -21.978 22.168  1.00 23.29 ? 363  ILE B CD1 1 
ATOM   7352 N N   . THR B  1 365 ? 32.374  -22.498 25.877  1.00 23.91 ? 364  THR B N   1 
ATOM   7353 C CA  . THR B  1 365 ? 31.622  -22.646 27.118  1.00 25.32 ? 364  THR B CA  1 
ATOM   7354 C C   . THR B  1 365 ? 32.542  -22.630 28.337  1.00 26.44 ? 364  THR B C   1 
ATOM   7355 O O   . THR B  1 365 ? 33.769  -22.674 28.207  1.00 26.46 ? 364  THR B O   1 
ATOM   7356 C CB  . THR B  1 365 ? 30.813  -23.958 27.130  1.00 25.38 ? 364  THR B CB  1 
ATOM   7357 O OG1 . THR B  1 365 ? 31.716  -25.073 27.229  1.00 25.82 ? 364  THR B OG1 1 
ATOM   7358 C CG2 . THR B  1 365 ? 30.051  -24.188 25.814  1.00 25.53 ? 364  THR B CG2 1 
ATOM   7359 N N   . LYS B  1 366 ? 31.914  -22.597 29.510  1.00 27.67 ? 365  LYS B N   1 
ATOM   7360 C CA  . LYS B  1 366 ? 32.577  -22.636 30.814  1.00 29.26 ? 365  LYS B CA  1 
ATOM   7361 C C   . LYS B  1 366 ? 33.607  -23.774 30.952  1.00 29.90 ? 365  LYS B C   1 
ATOM   7362 O O   . LYS B  1 366 ? 34.642  -23.598 31.609  1.00 30.43 ? 365  LYS B O   1 
ATOM   7363 C CB  . LYS B  1 366 ? 31.507  -22.739 31.906  1.00 29.36 ? 365  LYS B CB  1 
ATOM   7364 C CG  . LYS B  1 366 ? 32.028  -22.631 33.340  1.00 31.37 ? 365  LYS B CG  1 
ATOM   7365 C CD  . LYS B  1 366 ? 30.998  -21.970 34.263  1.00 32.88 ? 365  LYS B CD  1 
ATOM   7366 C CE  . LYS B  1 366 ? 29.829  -22.905 34.579  1.00 35.37 ? 365  LYS B CE  1 
ATOM   7367 N NZ  . LYS B  1 366 ? 28.972  -22.359 35.683  1.00 37.01 ? 365  LYS B NZ  1 
ATOM   7368 N N   . SER B  1 367 ? 33.326  -24.918 30.326  1.00 30.14 ? 366  SER B N   1 
ATOM   7369 C CA  . SER B  1 367 ? 34.219  -26.082 30.360  1.00 30.64 ? 366  SER B CA  1 
ATOM   7370 C C   . SER B  1 367 ? 35.409  -25.968 29.393  1.00 30.83 ? 366  SER B C   1 
ATOM   7371 O O   . SER B  1 367 ? 36.367  -26.756 29.479  1.00 31.08 ? 366  SER B O   1 
ATOM   7372 C CB  . SER B  1 367 ? 33.432  -27.366 30.075  1.00 30.52 ? 366  SER B CB  1 
ATOM   7373 O OG  . SER B  1 367 ? 33.132  -27.499 28.688  1.00 32.17 ? 366  SER B OG  1 
ATOM   7374 N N   . GLY B  1 368 ? 35.347  -24.995 28.483  1.00 30.22 ? 367  GLY B N   1 
ATOM   7375 C CA  . GLY B  1 368 ? 36.366  -24.831 27.455  1.00 29.54 ? 367  GLY B CA  1 
ATOM   7376 C C   . GLY B  1 368 ? 36.000  -25.480 26.133  1.00 29.43 ? 367  GLY B C   1 
ATOM   7377 O O   . GLY B  1 368 ? 36.709  -25.303 25.133  1.00 29.68 ? 367  GLY B O   1 
ATOM   7378 N N   . ALA B  1 369 ? 34.901  -26.235 26.128  1.00 28.96 ? 368  ALA B N   1 
ATOM   7379 C CA  . ALA B  1 369 ? 34.401  -26.888 24.922  1.00 28.34 ? 368  ALA B CA  1 
ATOM   7380 C C   . ALA B  1 369 ? 33.781  -25.855 23.981  1.00 27.65 ? 368  ALA B C   1 
ATOM   7381 O O   . ALA B  1 369 ? 33.283  -24.829 24.436  1.00 27.75 ? 368  ALA B O   1 
ATOM   7382 C CB  . ALA B  1 369 ? 33.374  -27.943 25.272  1.00 28.92 ? 368  ALA B CB  1 
ATOM   7383 N N   . ARG B  1 370 ? 33.827  -26.145 22.684  1.00 26.59 ? 369  ARG B N   1 
ATOM   7384 C CA  . ARG B  1 370 ? 33.184  -25.330 21.652  1.00 26.08 ? 369  ARG B CA  1 
ATOM   7385 C C   . ARG B  1 370 ? 31.699  -25.673 21.607  1.00 25.53 ? 369  ARG B C   1 
ATOM   7386 O O   . ARG B  1 370 ? 31.324  -26.845 21.671  1.00 25.52 ? 369  ARG B O   1 
ATOM   7387 C CB  A ARG B  1 370 ? 33.826  -25.567 20.282  0.35 25.89 ? 369  ARG B CB  1 
ATOM   7388 C CB  B ARG B  1 370 ? 33.828  -25.638 20.294  0.65 26.08 ? 369  ARG B CB  1 
ATOM   7389 C CG  A ARG B  1 370 ? 35.249  -25.023 20.139  0.35 25.85 ? 369  ARG B CG  1 
ATOM   7390 C CG  B ARG B  1 370 ? 33.600  -24.609 19.202  0.65 27.84 ? 369  ARG B CG  1 
ATOM   7391 C CD  A ARG B  1 370 ? 35.978  -25.463 18.864  0.35 26.92 ? 369  ARG B CD  1 
ATOM   7392 C CD  B ARG B  1 370 ? 33.525  -25.209 17.804  0.65 29.95 ? 369  ARG B CD  1 
ATOM   7393 N NE  A ARG B  1 370 ? 35.552  -26.784 18.397  0.35 27.93 ? 369  ARG B NE  1 
ATOM   7394 N NE  B ARG B  1 370 ? 33.302  -24.221 16.742  0.65 32.33 ? 369  ARG B NE  1 
ATOM   7395 C CZ  A ARG B  1 370 ? 36.218  -27.541 17.532  0.35 28.15 ? 369  ARG B CZ  1 
ATOM   7396 C CZ  B ARG B  1 370 ? 32.220  -23.449 16.626  0.65 32.83 ? 369  ARG B CZ  1 
ATOM   7397 N NH1 A ARG B  1 370 ? 37.369  -27.131 17.016  0.35 28.73 ? 369  ARG B NH1 1 
ATOM   7398 N NH1 B ARG B  1 370 ? 31.238  -23.517 17.516  0.65 31.54 ? 369  ARG B NH1 1 
ATOM   7399 N NH2 A ARG B  1 370 ? 35.729  -28.722 17.182  0.35 28.35 ? 369  ARG B NH2 1 
ATOM   7400 N NH2 B ARG B  1 370 ? 32.125  -22.594 15.616  0.65 33.66 ? 369  ARG B NH2 1 
ATOM   7401 N N   . VAL B  1 371 ? 30.846  -24.652 21.505  1.00 24.46 ? 370  VAL B N   1 
ATOM   7402 C CA  . VAL B  1 371 ? 29.413  -24.888 21.347  1.00 23.49 ? 370  VAL B CA  1 
ATOM   7403 C C   . VAL B  1 371 ? 29.140  -25.683 20.063  1.00 23.49 ? 370  VAL B C   1 
ATOM   7404 O O   . VAL B  1 371 ? 29.847  -25.538 19.056  1.00 24.04 ? 370  VAL B O   1 
ATOM   7405 C CB  . VAL B  1 371 ? 28.596  -23.563 21.351  1.00 23.11 ? 370  VAL B CB  1 
ATOM   7406 C CG1 . VAL B  1 371 ? 28.773  -22.807 22.651  1.00 22.32 ? 370  VAL B CG1 1 
ATOM   7407 C CG2 . VAL B  1 371 ? 28.995  -22.659 20.173  1.00 22.62 ? 370  VAL B CG2 1 
ATOM   7408 N N   . ASP B  1 372 ? 28.143  -26.555 20.116  1.00 22.55 ? 371  ASP B N   1 
ATOM   7409 C CA  . ASP B  1 372 ? 27.687  -27.262 18.932  1.00 22.63 ? 371  ASP B CA  1 
ATOM   7410 C C   . ASP B  1 372 ? 26.241  -26.871 18.699  1.00 21.77 ? 371  ASP B C   1 
ATOM   7411 O O   . ASP B  1 372 ? 25.431  -27.675 18.254  1.00 21.91 ? 371  ASP B O   1 
ATOM   7412 C CB  . ASP B  1 372 ? 27.861  -28.786 19.074  1.00 23.49 ? 371  ASP B CB  1 
ATOM   7413 C CG  . ASP B  1 372 ? 27.113  -29.363 20.269  1.00 25.85 ? 371  ASP B CG  1 
ATOM   7414 O OD1 . ASP B  1 372 ? 26.643  -28.589 21.130  1.00 27.35 ? 371  ASP B OD1 1 
ATOM   7415 O OD2 . ASP B  1 372 ? 26.951  -30.595 20.432  1.00 28.36 ? 371  ASP B OD2 1 
ATOM   7416 N N   . HIS B  1 373 ? 25.948  -25.607 19.001  1.00 20.62 ? 372  HIS B N   1 
ATOM   7417 C CA  . HIS B  1 373 ? 24.607  -25.023 18.866  1.00 20.23 ? 372  HIS B CA  1 
ATOM   7418 C C   . HIS B  1 373 ? 24.783  -23.528 18.668  1.00 19.64 ? 372  HIS B C   1 
ATOM   7419 O O   . HIS B  1 373 ? 25.872  -22.977 18.886  1.00 19.20 ? 372  HIS B O   1 
ATOM   7420 C CB  . HIS B  1 373 ? 23.763  -25.272 20.127  1.00 20.33 ? 372  HIS B CB  1 
ATOM   7421 C CG  . HIS B  1 373 ? 24.423  -24.835 21.403  1.00 20.59 ? 372  HIS B CG  1 
ATOM   7422 N ND1 . HIS B  1 373 ? 24.383  -23.538 21.863  1.00 20.11 ? 372  HIS B ND1 1 
ATOM   7423 C CD2 . HIS B  1 373 ? 25.139  -25.533 22.321  1.00 20.28 ? 372  HIS B CD2 1 
ATOM   7424 C CE1 . HIS B  1 373 ? 25.051  -23.448 23.000  1.00 21.71 ? 372  HIS B CE1 1 
ATOM   7425 N NE2 . HIS B  1 373 ? 25.515  -24.649 23.305  1.00 20.92 ? 372  HIS B NE2 1 
ATOM   7426 N N   . GLN B  1 374 ? 23.709  -22.861 18.256  1.00 19.83 ? 373  GLN B N   1 
ATOM   7427 C CA  . GLN B  1 374 ? 23.767  -21.421 18.059  1.00 19.37 ? 373  GLN B CA  1 
ATOM   7428 C C   . GLN B  1 374 ? 23.825  -20.665 19.379  1.00 18.94 ? 373  GLN B C   1 
ATOM   7429 O O   . GLN B  1 374 ? 23.291  -21.133 20.400  1.00 18.94 ? 373  GLN B O   1 
ATOM   7430 C CB  . GLN B  1 374 ? 22.548  -20.955 17.266  1.00 18.96 ? 373  GLN B CB  1 
ATOM   7431 C CG  . GLN B  1 374 ? 22.576  -21.360 15.785  1.00 20.65 ? 373  GLN B CG  1 
ATOM   7432 C CD  . GLN B  1 374 ? 23.723  -20.705 15.017  1.00 20.87 ? 373  GLN B CD  1 
ATOM   7433 O OE1 . GLN B  1 374 ? 24.425  -21.372 14.241  1.00 27.12 ? 373  GLN B OE1 1 
ATOM   7434 N NE2 . GLN B  1 374 ? 23.924  -19.420 15.234  1.00 19.49 ? 373  GLN B NE2 1 
ATOM   7435 N N   . THR B  1 375 ? 24.468  -19.497 19.356  1.00 18.10 ? 374  THR B N   1 
ATOM   7436 C CA  . THR B  1 375 ? 24.382  -18.552 20.482  1.00 17.48 ? 374  THR B CA  1 
ATOM   7437 C C   . THR B  1 375 ? 23.682  -17.243 20.046  1.00 17.51 ? 374  THR B C   1 
ATOM   7438 O O   . THR B  1 375 ? 22.689  -17.298 19.318  1.00 17.72 ? 374  THR B O   1 
ATOM   7439 C CB  . THR B  1 375 ? 25.769  -18.297 21.158  1.00 17.96 ? 374  THR B CB  1 
ATOM   7440 O OG1 . THR B  1 375 ? 26.726  -17.824 20.194  1.00 18.28 ? 374  THR B OG1 1 
ATOM   7441 C CG2 . THR B  1 375 ? 26.371  -19.621 21.698  1.00 17.50 ? 374  THR B CG2 1 
ATOM   7442 N N   . GLY B  1 376 ? 24.205  -16.094 20.462  1.00 17.25 ? 375  GLY B N   1 
ATOM   7443 C CA  . GLY B  1 376 ? 23.519  -14.819 20.315  1.00 16.84 ? 375  GLY B CA  1 
ATOM   7444 C C   . GLY B  1 376 ? 23.097  -14.464 18.891  1.00 17.08 ? 375  GLY B C   1 
ATOM   7445 O O   . GLY B  1 376 ? 23.797  -14.769 17.929  1.00 17.47 ? 375  GLY B O   1 
ATOM   7446 N N   . PRO B  1 377 ? 21.936  -13.832 18.748  1.00 16.72 ? 376  PRO B N   1 
ATOM   7447 C CA  . PRO B  1 377 ? 21.450  -13.430 17.427  1.00 16.21 ? 376  PRO B CA  1 
ATOM   7448 C C   . PRO B  1 377 ? 22.035  -12.106 16.976  1.00 15.17 ? 376  PRO B C   1 
ATOM   7449 O O   . PRO B  1 377 ? 22.615  -11.356 17.778  1.00 15.56 ? 376  PRO B O   1 
ATOM   7450 C CB  . PRO B  1 377 ? 19.943  -13.251 17.660  1.00 16.43 ? 376  PRO B CB  1 
ATOM   7451 C CG  . PRO B  1 377 ? 19.876  -12.747 19.086  1.00 16.80 ? 376  PRO B CG  1 
ATOM   7452 C CD  . PRO B  1 377 ? 20.989  -13.470 19.819  1.00 16.58 ? 376  PRO B CD  1 
ATOM   7453 N N   . ILE B  1 378 ? 21.881  -11.839 15.679  1.00 14.93 ? 377  ILE B N   1 
ATOM   7454 C CA  . ILE B  1 378 ? 22.108  -10.508 15.115  1.00 14.47 ? 377  ILE B CA  1 
ATOM   7455 C C   . ILE B  1 378 ? 20.899  -9.623  15.418  1.00 14.28 ? 377  ILE B C   1 
ATOM   7456 O O   . ILE B  1 378 ? 19.774  -9.950  15.059  1.00 15.25 ? 377  ILE B O   1 
ATOM   7457 C CB  . ILE B  1 378 ? 22.349  -10.632 13.593  1.00 13.86 ? 377  ILE B CB  1 
ATOM   7458 C CG1 . ILE B  1 378 ? 23.631  -11.436 13.312  1.00 17.15 ? 377  ILE B CG1 1 
ATOM   7459 C CG2 . ILE B  1 378 ? 22.384  -9.243  12.896  1.00 14.28 ? 377  ILE B CG2 1 
ATOM   7460 C CD1 . ILE B  1 378 ? 23.622  -12.081 11.914  1.00 16.57 ? 377  ILE B CD1 1 
ATOM   7461 N N   . VAL B  1 379 ? 21.141  -8.517  16.105  1.00 14.40 ? 378  VAL B N   1 
ATOM   7462 C CA  . VAL B  1 379 ? 20.088  -7.587  16.522  1.00 14.33 ? 378  VAL B CA  1 
ATOM   7463 C C   . VAL B  1 379 ? 20.075  -6.413  15.549  1.00 13.93 ? 378  VAL B C   1 
ATOM   7464 O O   . VAL B  1 379 ? 21.127  -5.941  15.139  1.00 13.55 ? 378  VAL B O   1 
ATOM   7465 C CB  . VAL B  1 379 ? 20.347  -7.090  17.978  1.00 15.03 ? 378  VAL B CB  1 
ATOM   7466 C CG1 . VAL B  1 379 ? 19.366  -5.960  18.386  1.00 15.46 ? 378  VAL B CG1 1 
ATOM   7467 C CG2 . VAL B  1 379 ? 20.251  -8.284  18.932  1.00 16.26 ? 378  VAL B CG2 1 
ATOM   7468 N N   . TRP B  1 380 ? 18.886  -5.977  15.151  1.00 14.12 ? 379  TRP B N   1 
ATOM   7469 C CA  . TRP B  1 380 ? 18.765  -4.873  14.197  1.00 13.45 ? 379  TRP B CA  1 
ATOM   7470 C C   . TRP B  1 380 ? 17.401  -4.205  14.348  1.00 13.93 ? 379  TRP B C   1 
ATOM   7471 O O   . TRP B  1 380 ? 16.537  -4.711  15.060  1.00 14.32 ? 379  TRP B O   1 
ATOM   7472 C CB  . TRP B  1 380 ? 18.979  -5.388  12.762  1.00 13.30 ? 379  TRP B CB  1 
ATOM   7473 C CG  . TRP B  1 380 ? 17.967  -6.389  12.315  1.00 13.20 ? 379  TRP B CG  1 
ATOM   7474 C CD1 . TRP B  1 380 ? 17.861  -7.697  12.705  1.00 14.94 ? 379  TRP B CD1 1 
ATOM   7475 C CD2 . TRP B  1 380 ? 16.896  -6.157  11.393  1.00 14.35 ? 379  TRP B CD2 1 
ATOM   7476 N NE1 . TRP B  1 380 ? 16.786  -8.291  12.086  1.00 13.67 ? 379  TRP B NE1 1 
ATOM   7477 C CE2 . TRP B  1 380 ? 16.179  -7.370  11.267  1.00 15.56 ? 379  TRP B CE2 1 
ATOM   7478 C CE3 . TRP B  1 380 ? 16.475  -5.043  10.650  1.00 14.59 ? 379  TRP B CE3 1 
ATOM   7479 C CZ2 . TRP B  1 380 ? 15.066  -7.505  10.434  1.00 14.34 ? 379  TRP B CZ2 1 
ATOM   7480 C CZ3 . TRP B  1 380 ? 15.357  -5.177  9.809   1.00 13.73 ? 379  TRP B CZ3 1 
ATOM   7481 C CH2 . TRP B  1 380 ? 14.668  -6.395  9.713   1.00 14.48 ? 379  TRP B CH2 1 
ATOM   7482 N N   . GLY B  1 381 ? 17.206  -3.060  13.698  1.00 14.49 ? 380  GLY B N   1 
ATOM   7483 C CA  . GLY B  1 381 ? 15.875  -2.461  13.648  1.00 14.02 ? 380  GLY B CA  1 
ATOM   7484 C C   . GLY B  1 381 ? 15.907  -0.974  13.405  1.00 14.29 ? 380  GLY B C   1 
ATOM   7485 O O   . GLY B  1 381 ? 16.950  -0.322  13.531  1.00 15.23 ? 380  GLY B O   1 
ATOM   7486 N N   . GLU B  1 382 ? 14.747  -0.438  13.034  1.00 13.88 ? 381  GLU B N   1 
ATOM   7487 C CA  . GLU B  1 382 ? 14.542  1.011   12.917  1.00 15.00 ? 381  GLU B CA  1 
ATOM   7488 C C   . GLU B  1 382 ? 13.200  1.349   13.571  1.00 14.50 ? 381  GLU B C   1 
ATOM   7489 O O   . GLU B  1 382 ? 12.322  0.467   13.700  1.00 14.43 ? 381  GLU B O   1 
ATOM   7490 C CB  . GLU B  1 382 ? 14.526  1.429   11.429  1.00 15.03 ? 381  GLU B CB  1 
ATOM   7491 C CG  . GLU B  1 382 ? 15.899  1.460   10.751  1.00 17.15 ? 381  GLU B CG  1 
ATOM   7492 C CD  . GLU B  1 382 ? 16.803  2.613   11.215  1.00 18.48 ? 381  GLU B CD  1 
ATOM   7493 O OE1 . GLU B  1 382 ? 16.326  3.663   11.681  1.00 22.92 ? 381  GLU B OE1 1 
ATOM   7494 O OE2 . GLU B  1 382 ? 18.009  2.480   11.084  1.00 22.49 ? 381  GLU B OE2 1 
ATOM   7495 N N   . PRO B  1 383 ? 13.002  2.597   13.999  1.00 14.36 ? 382  PRO B N   1 
ATOM   7496 C CA  . PRO B  1 383 ? 11.719  2.960   14.625  1.00 14.97 ? 382  PRO B CA  1 
ATOM   7497 C C   . PRO B  1 383 ? 10.531  2.859   13.674  1.00 15.42 ? 382  PRO B C   1 
ATOM   7498 O O   . PRO B  1 383 ? 10.693  3.075   12.464  1.00 15.76 ? 382  PRO B O   1 
ATOM   7499 C CB  . PRO B  1 383 ? 11.932  4.407   15.105  1.00 15.65 ? 382  PRO B CB  1 
ATOM   7500 C CG  . PRO B  1 383 ? 13.138  4.900   14.384  1.00 16.16 ? 382  PRO B CG  1 
ATOM   7501 C CD  . PRO B  1 383 ? 13.952  3.726   13.955  1.00 14.38 ? 382  PRO B CD  1 
ATOM   7502 N N   . GLY B  1 384 ? 9.375   2.485   14.222  1.00 14.74 ? 383  GLY B N   1 
ATOM   7503 C CA  . GLY B  1 384 ? 8.107   2.542   13.518  1.00 14.64 ? 383  GLY B CA  1 
ATOM   7504 C C   . GLY B  1 384 ? 7.591   3.974   13.580  1.00 14.54 ? 383  GLY B C   1 
ATOM   7505 O O   . GLY B  1 384 ? 7.861   4.660   14.552  1.00 14.19 ? 383  GLY B O   1 
ATOM   7506 N N   . THR B  1 385 ? 6.862   4.445   12.565  1.00 14.63 ? 384  THR B N   1 
ATOM   7507 C CA  . THR B  1 385 ? 6.440   3.627   11.405  1.00 14.41 ? 384  THR B CA  1 
ATOM   7508 C C   . THR B  1 385 ? 7.423   3.535   10.236  1.00 15.16 ? 384  THR B C   1 
ATOM   7509 O O   . THR B  1 385 ? 7.112   2.870   9.249   1.00 15.23 ? 384  THR B O   1 
ATOM   7510 C CB  . THR B  1 385 ? 5.105   4.162   10.801  1.00 14.68 ? 384  THR B CB  1 
ATOM   7511 O OG1 . THR B  1 385 ? 5.300   5.521   10.358  1.00 14.43 ? 384  THR B OG1 1 
ATOM   7512 C CG2 . THR B  1 385 ? 3.993   4.230   11.845  1.00 14.79 ? 384  THR B CG2 1 
ATOM   7513 N N   . ASN B  1 386 ? 8.582   4.186   10.331  1.00 15.53 ? 385  ASN B N   1 
ATOM   7514 C CA  . ASN B  1 386 ? 9.524   4.242   9.201   1.00 16.45 ? 385  ASN B CA  1 
ATOM   7515 C C   . ASN B  1 386 ? 9.860   2.880   8.621   1.00 16.85 ? 385  ASN B C   1 
ATOM   7516 O O   . ASN B  1 386 ? 9.856   2.699   7.405   1.00 16.76 ? 385  ASN B O   1 
ATOM   7517 C CB  . ASN B  1 386 ? 10.803  4.975   9.595   1.00 16.64 ? 385  ASN B CB  1 
ATOM   7518 C CG  . ASN B  1 386 ? 10.552  6.439   9.862   1.00 18.52 ? 385  ASN B CG  1 
ATOM   7519 O OD1 . ASN B  1 386 ? 10.885  7.306   9.049   1.00 22.74 ? 385  ASN B OD1 1 
ATOM   7520 N ND2 . ASN B  1 386 ? 9.931   6.718   10.977  1.00 18.46 ? 385  ASN B ND2 1 
ATOM   7521 N N   . GLY B  1 387 ? 10.131  1.918   9.494   1.00 16.15 ? 386  GLY B N   1 
ATOM   7522 C CA  . GLY B  1 387 ? 10.484  0.581   9.038   1.00 16.49 ? 386  GLY B CA  1 
ATOM   7523 C C   . GLY B  1 387 ? 9.452   -0.058  8.135   1.00 16.53 ? 386  GLY B C   1 
ATOM   7524 O O   . GLY B  1 387 ? 9.802   -0.825  7.224   1.00 16.10 ? 386  GLY B O   1 
ATOM   7525 N N   . GLN B  1 388 ? 8.172   0.259   8.356   1.00 15.84 ? 387  GLN B N   1 
ATOM   7526 C CA  . GLN B  1 388 ? 7.100   -0.243  7.498   1.00 15.74 ? 387  GLN B CA  1 
ATOM   7527 C C   . GLN B  1 388 ? 7.306   0.091   6.036   1.00 16.74 ? 387  GLN B C   1 
ATOM   7528 O O   . GLN B  1 388 ? 6.877   -0.668  5.174   1.00 17.87 ? 387  GLN B O   1 
ATOM   7529 C CB  . GLN B  1 388 ? 5.727   0.314   7.900   1.00 15.52 ? 387  GLN B CB  1 
ATOM   7530 C CG  . GLN B  1 388 ? 5.292   -0.109  9.265   1.00 15.99 ? 387  GLN B CG  1 
ATOM   7531 C CD  . GLN B  1 388 ? 4.089   0.652   9.792   1.00 14.58 ? 387  GLN B CD  1 
ATOM   7532 O OE1 . GLN B  1 388 ? 3.286   1.245   9.036   1.00 18.40 ? 387  GLN B OE1 1 
ATOM   7533 N NE2 . GLN B  1 388 ? 3.939   0.624   11.109  1.00 11.36 ? 387  GLN B NE2 1 
ATOM   7534 N N   . HIS B  1 389 ? 7.943   1.237   5.784   1.00 16.48 ? 388  HIS B N   1 
ATOM   7535 C CA  . HIS B  1 389 ? 8.170   1.725   4.417   1.00 17.29 ? 388  HIS B CA  1 
ATOM   7536 C C   . HIS B  1 389 ? 9.580   1.440   3.922   1.00 17.71 ? 388  HIS B C   1 
ATOM   7537 O O   . HIS B  1 389 ? 9.987   1.949   2.865   1.00 18.99 ? 388  HIS B O   1 
ATOM   7538 C CB  . HIS B  1 389 ? 7.885   3.232   4.347   1.00 17.82 ? 388  HIS B CB  1 
ATOM   7539 C CG  . HIS B  1 389 ? 6.514   3.606   4.807   1.00 17.98 ? 388  HIS B CG  1 
ATOM   7540 N ND1 . HIS B  1 389 ? 5.481   3.863   3.933   1.00 19.05 ? 388  HIS B ND1 1 
ATOM   7541 C CD2 . HIS B  1 389 ? 6.006   3.774   6.051   1.00 19.08 ? 388  HIS B CD2 1 
ATOM   7542 C CE1 . HIS B  1 389 ? 4.389   4.162   4.617   1.00 17.59 ? 388  HIS B CE1 1 
ATOM   7543 N NE2 . HIS B  1 389 ? 4.680   4.112   5.908   1.00 18.47 ? 388  HIS B NE2 1 
ATOM   7544 N N   . ALA B  1 390 ? 10.326  0.632   4.676   1.00 17.16 ? 389  ALA B N   1 
ATOM   7545 C CA  . ALA B  1 390 ? 11.672  0.226   4.283   1.00 16.65 ? 389  ALA B CA  1 
ATOM   7546 C C   . ALA B  1 390 ? 11.813  -1.279  4.125   1.00 16.67 ? 389  ALA B C   1 
ATOM   7547 O O   . ALA B  1 390 ? 12.127  -1.742  3.035   1.00 17.89 ? 389  ALA B O   1 
ATOM   7548 C CB  . ALA B  1 390 ? 12.715  0.753   5.283   1.00 16.80 ? 389  ALA B CB  1 
ATOM   7549 N N   . PHE B  1 391 ? 11.647  -2.037  5.215   1.00 15.17 ? 390  PHE B N   1 
ATOM   7550 C CA  . PHE B  1 391 ? 11.981  -3.455  5.191   1.00 14.38 ? 390  PHE B CA  1 
ATOM   7551 C C   . PHE B  1 391 ? 10.850  -4.402  5.595   1.00 13.93 ? 390  PHE B C   1 
ATOM   7552 O O   . PHE B  1 391 ? 11.019  -5.621  5.526   1.00 13.85 ? 390  PHE B O   1 
ATOM   7553 C CB  . PHE B  1 391 ? 13.252  -3.742  6.029   1.00 14.19 ? 390  PHE B CB  1 
ATOM   7554 C CG  . PHE B  1 391 ? 13.179  -3.204  7.432   1.00 14.84 ? 390  PHE B CG  1 
ATOM   7555 C CD1 . PHE B  1 391 ? 12.494  -3.889  8.423   1.00 13.44 ? 390  PHE B CD1 1 
ATOM   7556 C CD2 . PHE B  1 391 ? 13.783  -1.987  7.746   1.00 15.35 ? 390  PHE B CD2 1 
ATOM   7557 C CE1 . PHE B  1 391 ? 12.395  -3.372  9.722   1.00 14.67 ? 390  PHE B CE1 1 
ATOM   7558 C CE2 . PHE B  1 391 ? 13.703  -1.464  9.029   1.00 15.60 ? 390  PHE B CE2 1 
ATOM   7559 C CZ  . PHE B  1 391 ? 13.017  -2.162  10.029  1.00 14.54 ? 390  PHE B CZ  1 
ATOM   7560 N N   . TYR B  1 392 ? 9.695   -3.869  6.006   1.00 13.94 ? 391  TYR B N   1 
ATOM   7561 C CA  . TYR B  1 392 ? 8.645   -4.787  6.461   1.00 13.64 ? 391  TYR B CA  1 
ATOM   7562 C C   . TYR B  1 392 ? 8.116   -5.650  5.317   1.00 13.78 ? 391  TYR B C   1 
ATOM   7563 O O   . TYR B  1 392 ? 7.555   -6.704  5.576   1.00 14.72 ? 391  TYR B O   1 
ATOM   7564 C CB  . TYR B  1 392 ? 7.470   -4.063  7.092   1.00 12.66 ? 391  TYR B CB  1 
ATOM   7565 C CG  . TYR B  1 392 ? 7.604   -3.586  8.528   1.00 13.28 ? 391  TYR B CG  1 
ATOM   7566 C CD1 . TYR B  1 392 ? 8.826   -3.177  9.067   1.00 13.56 ? 391  TYR B CD1 1 
ATOM   7567 C CD2 . TYR B  1 392 ? 6.477   -3.486  9.328   1.00 14.08 ? 391  TYR B CD2 1 
ATOM   7568 C CE1 . TYR B  1 392 ? 8.914   -2.670  10.398  1.00 12.60 ? 391  TYR B CE1 1 
ATOM   7569 C CE2 . TYR B  1 392 ? 6.553   -2.999  10.656  1.00 13.30 ? 391  TYR B CE2 1 
ATOM   7570 C CZ  . TYR B  1 392 ? 7.768   -2.566  11.165  1.00 13.49 ? 391  TYR B CZ  1 
ATOM   7571 O OH  . TYR B  1 392 ? 7.860   -2.044  12.454  1.00 14.86 ? 391  TYR B OH  1 
ATOM   7572 N N   . GLN B  1 393 ? 8.317   -5.213  4.065   1.00 13.18 ? 392  GLN B N   1 
ATOM   7573 C CA  . GLN B  1 393 ? 7.998   -6.073  2.907   1.00 13.19 ? 392  GLN B CA  1 
ATOM   7574 C C   . GLN B  1 393 ? 8.621   -7.455  3.082   1.00 13.31 ? 392  GLN B C   1 
ATOM   7575 O O   . GLN B  1 393 ? 7.950   -8.482  2.889   1.00 13.91 ? 392  GLN B O   1 
ATOM   7576 C CB  . GLN B  1 393 ? 8.474   -5.427  1.597   1.00 13.63 ? 392  GLN B CB  1 
ATOM   7577 C CG  . GLN B  1 393 ? 8.606   -6.393  0.385   1.00 11.87 ? 392  GLN B CG  1 
ATOM   7578 C CD  . GLN B  1 393 ? 7.255   -6.866  -0.155  1.00 10.59 ? 392  GLN B CD  1 
ATOM   7579 O OE1 . GLN B  1 393 ? 6.349   -6.057  -0.328  1.00 13.67 ? 392  GLN B OE1 1 
ATOM   7580 N NE2 . GLN B  1 393 ? 7.111   -8.193  -0.366  1.00 11.03 ? 392  GLN B NE2 1 
ATOM   7581 N N   . LEU B  1 394 ? 9.888   -7.497  3.510   1.00 12.36 ? 393  LEU B N   1 
ATOM   7582 C CA  . LEU B  1 394 ? 10.586  -8.767  3.664   1.00 13.03 ? 393  LEU B CA  1 
ATOM   7583 C C   . LEU B  1 394 ? 10.097  -9.521  4.918   1.00 13.12 ? 393  LEU B C   1 
ATOM   7584 O O   . LEU B  1 394 ? 10.004  -10.757 4.892   1.00 14.01 ? 393  LEU B O   1 
ATOM   7585 C CB  . LEU B  1 394 ? 12.110  -8.536  3.701   1.00 13.59 ? 393  LEU B CB  1 
ATOM   7586 C CG  . LEU B  1 394 ? 13.004  -9.785  3.782   1.00 12.38 ? 393  LEU B CG  1 
ATOM   7587 C CD1 . LEU B  1 394 ? 14.330  -9.500  3.062   1.00 13.07 ? 393  LEU B CD1 1 
ATOM   7588 C CD2 . LEU B  1 394 ? 13.295  -10.237 5.248   1.00 15.50 ? 393  LEU B CD2 1 
ATOM   7589 N N   . ILE B  1 395 ? 9.780   -8.793  5.992   1.00 13.32 ? 394  ILE B N   1 
ATOM   7590 C CA  . ILE B  1 395 ? 9.235   -9.449  7.193   1.00 13.13 ? 394  ILE B CA  1 
ATOM   7591 C C   . ILE B  1 395 ? 7.903   -10.149 6.870   1.00 13.93 ? 394  ILE B C   1 
ATOM   7592 O O   . ILE B  1 395 ? 7.670   -11.276 7.327   1.00 14.23 ? 394  ILE B O   1 
ATOM   7593 C CB  . ILE B  1 395 ? 9.077   -8.475  8.371   1.00 13.29 ? 394  ILE B CB  1 
ATOM   7594 C CG1 . ILE B  1 395 ? 10.416  -7.756  8.643   1.00 13.47 ? 394  ILE B CG1 1 
ATOM   7595 C CG2 . ILE B  1 395 ? 8.604   -9.266  9.615   1.00 13.36 ? 394  ILE B CG2 1 
ATOM   7596 C CD1 . ILE B  1 395 ? 10.358  -6.759  9.833   1.00 15.17 ? 394  ILE B CD1 1 
ATOM   7597 N N   . HIS B  1 396 ? 7.061   -9.505  6.051   1.00 13.81 ? 395  HIS B N   1 
ATOM   7598 C CA  . HIS B  1 396 ? 5.737   -10.051 5.720   1.00 14.33 ? 395  HIS B CA  1 
ATOM   7599 C C   . HIS B  1 396 ? 5.755   -11.130 4.637   1.00 14.82 ? 395  HIS B C   1 
ATOM   7600 O O   . HIS B  1 396 ? 4.937   -12.059 4.701   1.00 15.05 ? 395  HIS B O   1 
ATOM   7601 C CB  . HIS B  1 396 ? 4.780   -8.932  5.260   1.00 14.75 ? 395  HIS B CB  1 
ATOM   7602 C CG  . HIS B  1 396 ? 4.248   -8.078  6.368   1.00 15.55 ? 395  HIS B CG  1 
ATOM   7603 N ND1 . HIS B  1 396 ? 3.225   -8.484  7.199   1.00 15.02 ? 395  HIS B ND1 1 
ATOM   7604 C CD2 . HIS B  1 396 ? 4.581   -6.823  6.765   1.00 16.58 ? 395  HIS B CD2 1 
ATOM   7605 C CE1 . HIS B  1 396 ? 2.962   -7.527  8.071   1.00 16.31 ? 395  HIS B CE1 1 
ATOM   7606 N NE2 . HIS B  1 396 ? 3.777   -6.513  7.840   1.00 17.20 ? 395  HIS B NE2 1 
ATOM   7607 N N   . GLN B  1 397 ? 6.628   -10.982 3.621   1.00 14.36 ? 396  GLN B N   1 
ATOM   7608 C CA  . GLN B  1 397 ? 6.540   -11.805 2.401   1.00 14.75 ? 396  GLN B CA  1 
ATOM   7609 C C   . GLN B  1 397 ? 7.880   -12.346 1.882   1.00 15.28 ? 396  GLN B C   1 
ATOM   7610 O O   . GLN B  1 397 ? 7.974   -12.803 0.730   1.00 16.49 ? 396  GLN B O   1 
ATOM   7611 C CB  . GLN B  1 397 ? 5.851   -11.018 1.280   1.00 14.41 ? 396  GLN B CB  1 
ATOM   7612 C CG  . GLN B  1 397 ? 4.338   -10.842 1.464   1.00 14.02 ? 396  GLN B CG  1 
ATOM   7613 C CD  . GLN B  1 397 ? 3.684   -10.330 0.192   1.00 14.28 ? 396  GLN B CD  1 
ATOM   7614 O OE1 . GLN B  1 397 ? 4.286   -9.532  -0.546  1.00 14.95 ? 396  GLN B OE1 1 
ATOM   7615 N NE2 . GLN B  1 397 ? 2.470   -10.821 -0.100  1.00 15.95 ? 396  GLN B NE2 1 
ATOM   7616 N N   . GLY B  1 398 ? 8.918   -12.281 2.710   1.00 14.61 ? 397  GLY B N   1 
ATOM   7617 C CA  . GLY B  1 398 ? 10.201  -12.898 2.361   1.00 14.78 ? 397  GLY B CA  1 
ATOM   7618 C C   . GLY B  1 398 ? 10.277  -14.360 2.773   1.00 15.83 ? 397  GLY B C   1 
ATOM   7619 O O   . GLY B  1 398 ? 9.249   -15.006 2.998   1.00 16.04 ? 397  GLY B O   1 
ATOM   7620 N N   . THR B  1 399 ? 11.502  -14.869 2.917   1.00 16.09 ? 398  THR B N   1 
ATOM   7621 C CA  . THR B  1 399 ? 11.727  -16.287 3.230   1.00 16.58 ? 398  THR B CA  1 
ATOM   7622 C C   . THR B  1 399 ? 12.445  -16.490 4.557   1.00 17.20 ? 398  THR B C   1 
ATOM   7623 O O   . THR B  1 399 ? 12.967  -17.583 4.824   1.00 18.69 ? 398  THR B O   1 
ATOM   7624 C CB  . THR B  1 399 ? 12.536  -16.982 2.123   1.00 15.82 ? 398  THR B CB  1 
ATOM   7625 O OG1 . THR B  1 399 ? 13.779  -16.289 1.926   1.00 15.66 ? 398  THR B OG1 1 
ATOM   7626 C CG2 . THR B  1 399 ? 11.832  -16.877 0.792   1.00 16.15 ? 398  THR B CG2 1 
ATOM   7627 N N   . LYS B  1 400 ? 12.435  -15.461 5.399   1.00 17.91 ? 399  LYS B N   1 
ATOM   7628 C CA  . LYS B  1 400 ? 13.089  -15.498 6.705   1.00 18.04 ? 399  LYS B CA  1 
ATOM   7629 C C   . LYS B  1 400 ? 12.059  -15.431 7.820   1.00 16.94 ? 399  LYS B C   1 
ATOM   7630 O O   . LYS B  1 400 ? 11.086  -14.663 7.736   1.00 17.40 ? 399  LYS B O   1 
ATOM   7631 C CB  . LYS B  1 400 ? 14.033  -14.291 6.852   1.00 18.48 ? 399  LYS B CB  1 
ATOM   7632 C CG  . LYS B  1 400 ? 15.491  -14.522 6.450   1.00 19.73 ? 399  LYS B CG  1 
ATOM   7633 C CD  . LYS B  1 400 ? 15.706  -14.217 4.982   1.00 20.57 ? 399  LYS B CD  1 
ATOM   7634 C CE  . LYS B  1 400 ? 17.133  -14.491 4.577   1.00 19.31 ? 399  LYS B CE  1 
ATOM   7635 N NZ  . LYS B  1 400 ? 17.194  -14.810 3.103   1.00 17.51 ? 399  LYS B NZ  1 
ATOM   7636 N N   . MET B  1 401 ? 12.288  -16.222 8.870   1.00 16.28 ? 400  MET B N   1 
ATOM   7637 C CA  . MET B  1 401 ? 11.557  -16.062 10.130  1.00 16.24 ? 400  MET B CA  1 
ATOM   7638 C C   . MET B  1 401 ? 12.347  -15.098 11.034  1.00 15.44 ? 400  MET B C   1 
ATOM   7639 O O   . MET B  1 401 ? 13.542  -15.299 11.284  1.00 14.98 ? 400  MET B O   1 
ATOM   7640 C CB  . MET B  1 401 ? 11.321  -17.421 10.785  1.00 16.68 ? 400  MET B CB  1 
ATOM   7641 C CG  . MET B  1 401 ? 10.641  -17.358 12.131  1.00 16.73 ? 400  MET B CG  1 
ATOM   7642 S SD  . MET B  1 401 ? 10.435  -19.038 12.749  1.00 21.83 ? 400  MET B SD  1 
ATOM   7643 C CE  . MET B  1 401 ? 9.454   -18.686 14.013  1.00 20.94 ? 400  MET B CE  1 
ATOM   7644 N N   . ILE B  1 402 ? 11.674  -14.029 11.466  1.00 15.58 ? 401  ILE B N   1 
ATOM   7645 C CA  . ILE B  1 402 ? 12.310  -12.921 12.194  1.00 15.14 ? 401  ILE B CA  1 
ATOM   7646 C C   . ILE B  1 402 ? 11.487  -12.546 13.439  1.00 15.46 ? 401  ILE B C   1 
ATOM   7647 O O   . ILE B  1 402 ? 10.528  -11.771 13.332  1.00 14.98 ? 401  ILE B O   1 
ATOM   7648 C CB  . ILE B  1 402 ? 12.442  -11.675 11.253  1.00 15.03 ? 401  ILE B CB  1 
ATOM   7649 C CG1 . ILE B  1 402 ? 13.183  -12.009 9.943   1.00 15.51 ? 401  ILE B CG1 1 
ATOM   7650 C CG2 . ILE B  1 402 ? 13.146  -10.514 11.961  1.00 13.09 ? 401  ILE B CG2 1 
ATOM   7651 C CD1 . ILE B  1 402 ? 13.011  -10.954 8.833   1.00 17.28 ? 401  ILE B CD1 1 
ATOM   7652 N N   . PRO B  1 403 ? 11.854  -13.058 14.621  1.00 14.75 ? 402  PRO B N   1 
ATOM   7653 C CA  . PRO B  1 403 ? 11.160  -12.639 15.847  1.00 15.58 ? 402  PRO B CA  1 
ATOM   7654 C C   . PRO B  1 403 ? 11.338  -11.126 15.980  1.00 14.86 ? 402  PRO B C   1 
ATOM   7655 O O   . PRO B  1 403 ? 12.467  -10.636 15.816  1.00 14.86 ? 402  PRO B O   1 
ATOM   7656 C CB  . PRO B  1 403 ? 11.922  -13.362 16.961  1.00 15.51 ? 402  PRO B CB  1 
ATOM   7657 C CG  . PRO B  1 403 ? 12.618  -14.508 16.284  1.00 16.51 ? 402  PRO B CG  1 
ATOM   7658 C CD  . PRO B  1 403 ? 12.957  -14.003 14.891  1.00 15.31 ? 402  PRO B CD  1 
ATOM   7659 N N   . CYS B  1 404 ? 10.249  -10.404 16.240  1.00 14.87 ? 403  CYS B N   1 
ATOM   7660 C CA  . CYS B  1 404 ? 10.298  -8.951  16.412  1.00 14.65 ? 403  CYS B CA  1 
ATOM   7661 C C   . CYS B  1 404 ? 9.719   -8.524  17.759  1.00 14.52 ? 403  CYS B C   1 
ATOM   7662 O O   . CYS B  1 404 ? 8.665   -9.029  18.161  1.00 15.76 ? 403  CYS B O   1 
ATOM   7663 C CB  . CYS B  1 404 ? 9.442   -8.273  15.349  1.00 14.61 ? 403  CYS B CB  1 
ATOM   7664 S SG  . CYS B  1 404 ? 9.972   -8.459  13.637  1.00 16.39 ? 403  CYS B SG  1 
ATOM   7665 N N   . ASP B  1 405 ? 10.393  -7.595  18.443  1.00 14.11 ? 404  ASP B N   1 
ATOM   7666 C CA  . ASP B  1 405 ? 9.790   -6.886  19.584  1.00 14.35 ? 404  ASP B CA  1 
ATOM   7667 C C   . ASP B  1 405 ? 9.318   -5.501  19.150  1.00 14.20 ? 404  ASP B C   1 
ATOM   7668 O O   . ASP B  1 405 ? 10.129  -4.667  18.766  1.00 14.65 ? 404  ASP B O   1 
ATOM   7669 C CB  . ASP B  1 405 ? 10.798  -6.679  20.712  1.00 13.82 ? 404  ASP B CB  1 
ATOM   7670 C CG  . ASP B  1 405 ? 11.240  -7.969  21.376  1.00 16.05 ? 404  ASP B CG  1 
ATOM   7671 O OD1 . ASP B  1 405 ? 10.704  -9.060  21.104  1.00 15.37 ? 404  ASP B OD1 1 
ATOM   7672 O OD2 . ASP B  1 405 ? 12.173  -7.973  22.196  1.00 18.50 ? 404  ASP B OD2 1 
ATOM   7673 N N   . PHE B  1 406 ? 8.008   -5.264  19.248  1.00 14.16 ? 405  PHE B N   1 
ATOM   7674 C CA  . PHE B  1 406 ? 7.382   -3.982  18.978  1.00 14.31 ? 405  PHE B CA  1 
ATOM   7675 C C   . PHE B  1 406 ? 7.214   -3.254  20.317  1.00 15.12 ? 405  PHE B C   1 
ATOM   7676 O O   . PHE B  1 406 ? 6.644   -3.819  21.245  1.00 16.08 ? 405  PHE B O   1 
ATOM   7677 C CB  . PHE B  1 406 ? 6.000   -4.224  18.334  1.00 14.97 ? 405  PHE B CB  1 
ATOM   7678 C CG  . PHE B  1 406 ? 6.040   -4.534  16.847  1.00 14.41 ? 405  PHE B CG  1 
ATOM   7679 C CD1 . PHE B  1 406 ? 6.537   -5.750  16.374  1.00 13.67 ? 405  PHE B CD1 1 
ATOM   7680 C CD2 . PHE B  1 406 ? 5.550   -3.604  15.926  1.00 14.47 ? 405  PHE B CD2 1 
ATOM   7681 C CE1 . PHE B  1 406 ? 6.563   -6.041  14.991  1.00 13.89 ? 405  PHE B CE1 1 
ATOM   7682 C CE2 . PHE B  1 406 ? 5.568   -3.866  14.543  1.00 13.34 ? 405  PHE B CE2 1 
ATOM   7683 C CZ  . PHE B  1 406 ? 6.065   -5.094  14.075  1.00 12.58 ? 405  PHE B CZ  1 
ATOM   7684 N N   . LEU B  1 407 ? 7.716   -2.026  20.425  1.00 15.14 ? 406  LEU B N   1 
ATOM   7685 C CA  . LEU B  1 407 ? 7.639   -1.255  21.677  1.00 15.37 ? 406  LEU B CA  1 
ATOM   7686 C C   . LEU B  1 407 ? 6.947   0.097   21.456  1.00 15.67 ? 406  LEU B C   1 
ATOM   7687 O O   . LEU B  1 407 ? 7.165   0.742   20.423  1.00 16.07 ? 406  LEU B O   1 
ATOM   7688 C CB  . LEU B  1 407 ? 9.047   -1.026  22.250  1.00 15.04 ? 406  LEU B CB  1 
ATOM   7689 C CG  . LEU B  1 407 ? 9.913   -2.275  22.488  1.00 16.45 ? 406  LEU B CG  1 
ATOM   7690 C CD1 . LEU B  1 407 ? 10.931  -2.430  21.352  1.00 16.19 ? 406  LEU B CD1 1 
ATOM   7691 C CD2 . LEU B  1 407 ? 10.627  -2.180  23.833  1.00 16.65 ? 406  LEU B CD2 1 
ATOM   7692 N N   . ILE B  1 408 ? 6.123   0.545   22.405  1.00 14.99 ? 407  ILE B N   1 
ATOM   7693 C CA  . ILE B  1 408 ? 5.497   1.883   22.294  1.00 15.39 ? 407  ILE B CA  1 
ATOM   7694 C C   . ILE B  1 408 ? 5.047   2.424   23.658  1.00 15.95 ? 407  ILE B C   1 
ATOM   7695 O O   . ILE B  1 408 ? 4.530   1.643   24.468  1.00 15.90 ? 407  ILE B O   1 
ATOM   7696 C CB  . ILE B  1 408 ? 4.273   1.870   21.310  1.00 14.97 ? 407  ILE B CB  1 
ATOM   7697 C CG1 . ILE B  1 408 ? 3.964   3.283   20.772  1.00 15.02 ? 407  ILE B CG1 1 
ATOM   7698 C CG2 . ILE B  1 408 ? 3.023   1.193   21.941  1.00 16.32 ? 407  ILE B CG2 1 
ATOM   7699 C CD1 . ILE B  1 408 ? 2.895   3.320   19.666  1.00 16.10 ? 407  ILE B CD1 1 
ATOM   7700 N N   . PRO B  1 409 ? 5.183   3.734   23.891  1.00 15.89 ? 408  PRO B N   1 
ATOM   7701 C CA  . PRO B  1 409 ? 4.478   4.372   25.014  1.00 16.33 ? 408  PRO B CA  1 
ATOM   7702 C C   . PRO B  1 409 ? 3.026   4.733   24.674  1.00 16.73 ? 408  PRO B C   1 
ATOM   7703 O O   . PRO B  1 409 ? 2.691   5.167   23.552  1.00 16.25 ? 408  PRO B O   1 
ATOM   7704 C CB  . PRO B  1 409 ? 5.281   5.643   25.259  1.00 16.28 ? 408  PRO B CB  1 
ATOM   7705 C CG  . PRO B  1 409 ? 5.760   6.043   23.847  1.00 15.54 ? 408  PRO B CG  1 
ATOM   7706 C CD  . PRO B  1 409 ? 6.022   4.706   23.144  1.00 15.88 ? 408  PRO B CD  1 
ATOM   7707 N N   . VAL B  1 410 ? 2.143   4.554   25.651  1.00 16.41 ? 409  VAL B N   1 
ATOM   7708 C CA  . VAL B  1 410 ? 0.736   4.925   25.468  1.00 17.03 ? 409  VAL B CA  1 
ATOM   7709 C C   . VAL B  1 410 ? 0.590   6.447   25.348  1.00 17.13 ? 409  VAL B C   1 
ATOM   7710 O O   . VAL B  1 410 ? -0.164  6.946   24.512  1.00 16.71 ? 409  VAL B O   1 
ATOM   7711 C CB  . VAL B  1 410 ? -0.138  4.410   26.642  1.00 16.70 ? 409  VAL B CB  1 
ATOM   7712 C CG1 . VAL B  1 410 ? -1.558  5.007   26.575  1.00 16.74 ? 409  VAL B CG1 1 
ATOM   7713 C CG2 . VAL B  1 410 ? -0.189  2.899   26.652  1.00 17.25 ? 409  VAL B CG2 1 
ATOM   7714 N N   . GLN B  1 411 ? 1.315   7.175   26.191  1.00 17.23 ? 410  GLN B N   1 
ATOM   7715 C CA  . GLN B  1 411 ? 1.259   8.635   26.210  1.00 17.86 ? 410  GLN B CA  1 
ATOM   7716 C C   . GLN B  1 411 ? 2.460   9.208   25.479  1.00 17.82 ? 410  GLN B C   1 
ATOM   7717 O O   . GLN B  1 411 ? 3.590   8.826   25.752  1.00 18.14 ? 410  GLN B O   1 
ATOM   7718 C CB  . GLN B  1 411 ? 1.254   9.130   27.661  1.00 18.29 ? 410  GLN B CB  1 
ATOM   7719 C CG  . GLN B  1 411 ? 0.063   8.599   28.482  1.00 17.75 ? 410  GLN B CG  1 
ATOM   7720 C CD  . GLN B  1 411 ? 0.043   9.116   29.916  1.00 20.96 ? 410  GLN B CD  1 
ATOM   7721 O OE1 . GLN B  1 411 ? 0.731   10.078  30.242  1.00 21.55 ? 410  GLN B OE1 1 
ATOM   7722 N NE2 . GLN B  1 411 ? -0.763  8.482   30.763  1.00 21.84 ? 410  GLN B NE2 1 
ATOM   7723 N N   . THR B  1 412 ? 2.204   10.131  24.561  1.00 17.60 ? 411  THR B N   1 
ATOM   7724 C CA  . THR B  1 412 ? 3.270   10.805  23.831  1.00 18.39 ? 411  THR B CA  1 
ATOM   7725 C C   . THR B  1 412 ? 3.777   12.044  24.564  1.00 18.73 ? 411  THR B C   1 
ATOM   7726 O O   . THR B  1 412 ? 3.032   12.697  25.317  1.00 18.72 ? 411  THR B O   1 
ATOM   7727 C CB  . THR B  1 412 ? 2.821   11.143  22.383  1.00 18.27 ? 411  THR B CB  1 
ATOM   7728 O OG1 . THR B  1 412 ? 3.849   11.883  21.713  1.00 18.07 ? 411  THR B OG1 1 
ATOM   7729 C CG2 . THR B  1 412 ? 1.627   12.105  22.360  1.00 18.07 ? 411  THR B CG2 1 
ATOM   7730 N N   . GLN B  1 413 ? 5.047   12.367  24.341  1.00 18.35 ? 412  GLN B N   1 
ATOM   7731 C CA  . GLN B  1 413 ? 5.612   13.616  24.838  1.00 19.21 ? 412  GLN B CA  1 
ATOM   7732 C C   . GLN B  1 413 ? 5.075   14.831  24.061  1.00 19.43 ? 412  GLN B C   1 
ATOM   7733 O O   . GLN B  1 413 ? 5.209   15.980  24.514  1.00 20.83 ? 412  GLN B O   1 
ATOM   7734 C CB  . GLN B  1 413 ? 7.146   13.552  24.813  1.00 18.52 ? 412  GLN B CB  1 
ATOM   7735 C CG  . GLN B  1 413 ? 7.737   12.384  25.615  1.00 19.58 ? 412  GLN B CG  1 
ATOM   7736 C CD  . GLN B  1 413 ? 7.775   12.649  27.115  1.00 21.28 ? 412  GLN B CD  1 
ATOM   7737 O OE1 . GLN B  1 413 ? 7.602   13.787  27.543  1.00 22.43 ? 412  GLN B OE1 1 
ATOM   7738 N NE2 . GLN B  1 413 ? 8.018   11.606  27.907  1.00 21.57 ? 412  GLN B NE2 1 
ATOM   7739 N N   . HIS B  1 414 ? 4.475   14.576  22.894  1.00 19.81 ? 413  HIS B N   1 
ATOM   7740 C CA  . HIS B  1 414 ? 4.061   15.646  21.971  1.00 20.39 ? 413  HIS B CA  1 
ATOM   7741 C C   . HIS B  1 414 ? 2.650   15.427  21.405  1.00 20.22 ? 413  HIS B C   1 
ATOM   7742 O O   . HIS B  1 414 ? 2.504   15.048  20.234  1.00 19.92 ? 413  HIS B O   1 
ATOM   7743 C CB  . HIS B  1 414 ? 5.094   15.790  20.822  1.00 20.40 ? 413  HIS B CB  1 
ATOM   7744 C CG  . HIS B  1 414 ? 6.459   16.180  21.296  1.00 22.19 ? 413  HIS B CG  1 
ATOM   7745 N ND1 . HIS B  1 414 ? 6.786   17.478  21.632  1.00 23.82 ? 413  HIS B ND1 1 
ATOM   7746 C CD2 . HIS B  1 414 ? 7.564   15.437  21.543  1.00 22.50 ? 413  HIS B CD2 1 
ATOM   7747 C CE1 . HIS B  1 414 ? 8.044   17.518  22.041  1.00 24.23 ? 413  HIS B CE1 1 
ATOM   7748 N NE2 . HIS B  1 414 ? 8.536   16.292  22.001  1.00 23.22 ? 413  HIS B NE2 1 
ATOM   7749 N N   . PRO B  1 415 ? 1.608   15.664  22.218  1.00 20.06 ? 414  PRO B N   1 
ATOM   7750 C CA  . PRO B  1 415 ? 0.235   15.342  21.803  1.00 20.27 ? 414  PRO B CA  1 
ATOM   7751 C C   . PRO B  1 415 ? -0.356  16.397  20.861  1.00 20.44 ? 414  PRO B C   1 
ATOM   7752 O O   . PRO B  1 415 ? -1.452  16.927  21.095  1.00 21.37 ? 414  PRO B O   1 
ATOM   7753 C CB  . PRO B  1 415 ? -0.523  15.272  23.129  1.00 20.20 ? 414  PRO B CB  1 
ATOM   7754 C CG  . PRO B  1 415 ? 0.193   16.242  24.020  1.00 20.64 ? 414  PRO B CG  1 
ATOM   7755 C CD  . PRO B  1 415 ? 1.654   16.216  23.587  1.00 20.79 ? 414  PRO B CD  1 
ATOM   7756 N N   . ILE B  1 416 ? 0.364   16.673  19.779  1.00 20.29 ? 415  ILE B N   1 
ATOM   7757 C CA  . ILE B  1 416 ? -0.075  17.673  18.805  1.00 19.93 ? 415  ILE B CA  1 
ATOM   7758 C C   . ILE B  1 416 ? -1.370  17.274  18.104  1.00 20.21 ? 415  ILE B C   1 
ATOM   7759 O O   . ILE B  1 416 ? -1.728  16.096  18.042  1.00 19.74 ? 415  ILE B O   1 
ATOM   7760 C CB  . ILE B  1 416 ? 1.031   17.975  17.757  1.00 19.29 ? 415  ILE B CB  1 
ATOM   7761 C CG1 . ILE B  1 416 ? 1.387   16.717  16.945  1.00 19.30 ? 415  ILE B CG1 1 
ATOM   7762 C CG2 . ILE B  1 416 ? 2.233   18.598  18.442  1.00 20.01 ? 415  ILE B CG2 1 
ATOM   7763 C CD1 . ILE B  1 416 ? 2.341   16.978  15.787  1.00 19.79 ? 415  ILE B CD1 1 
ATOM   7764 N N   . ARG B  1 417 ? -2.050  18.272  17.540  1.00 20.93 ? 416  ARG B N   1 
ATOM   7765 C CA  . ARG B  1 417 ? -3.315  18.059  16.826  1.00 21.85 ? 416  ARG B CA  1 
ATOM   7766 C C   . ARG B  1 417 ? -4.288  17.211  17.655  1.00 21.74 ? 416  ARG B C   1 
ATOM   7767 O O   . ARG B  1 417 ? -4.894  16.265  17.140  1.00 21.41 ? 416  ARG B O   1 
ATOM   7768 C CB  . ARG B  1 417 ? -3.113  17.422  15.432  1.00 22.28 ? 416  ARG B CB  1 
ATOM   7769 C CG  . ARG B  1 417 ? -2.068  18.079  14.515  1.00 24.92 ? 416  ARG B CG  1 
ATOM   7770 C CD  . ARG B  1 417 ? -2.601  18.971  13.375  1.00 24.37 ? 416  ARG B CD  1 
ATOM   7771 N NE  . ARG B  1 417 ? -3.844  18.529  12.729  1.00 25.93 ? 416  ARG B NE  1 
ATOM   7772 C CZ  . ARG B  1 417 ? -3.920  17.830  11.589  1.00 25.26 ? 416  ARG B CZ  1 
ATOM   7773 N NH1 . ARG B  1 417 ? -2.825  17.434  10.935  1.00 24.58 ? 416  ARG B NH1 1 
ATOM   7774 N NH2 . ARG B  1 417 ? -5.113  17.512  11.098  1.00 27.17 ? 416  ARG B NH2 1 
ATOM   7775 N N   . LYS B  1 418 ? -4.428  17.565  18.931  1.00 22.49 ? 417  LYS B N   1 
ATOM   7776 C CA  . LYS B  1 418 ? -5.308  16.856  19.880  1.00 22.99 ? 417  LYS B CA  1 
ATOM   7777 C C   . LYS B  1 418 ? -5.115  15.338  19.851  1.00 22.22 ? 417  LYS B C   1 
ATOM   7778 O O   . LYS B  1 418 ? -6.072  14.563  20.008  1.00 22.64 ? 417  LYS B O   1 
ATOM   7779 C CB  . LYS B  1 418 ? -6.782  17.224  19.664  1.00 23.59 ? 417  LYS B CB  1 
ATOM   7780 C CG  . LYS B  1 418 ? -7.100  18.704  19.848  1.00 27.76 ? 417  LYS B CG  1 
ATOM   7781 C CD  . LYS B  1 418 ? -7.607  19.319  18.545  1.00 33.25 ? 417  LYS B CD  1 
ATOM   7782 C CE  . LYS B  1 418 ? -9.079  19.006  18.302  1.00 35.53 ? 417  LYS B CE  1 
ATOM   7783 N NZ  . LYS B  1 418 ? -9.906  20.246  18.293  1.00 38.68 ? 417  LYS B NZ  1 
ATOM   7784 N N   . GLY B  1 419 ? -3.867  14.929  19.645  1.00 20.51 ? 418  GLY B N   1 
ATOM   7785 C CA  . GLY B  1 419 ? -3.486  13.528  19.730  1.00 20.08 ? 418  GLY B CA  1 
ATOM   7786 C C   . GLY B  1 419 ? -3.599  12.731  18.449  1.00 19.15 ? 418  GLY B C   1 
ATOM   7787 O O   . GLY B  1 419 ? -3.465  11.509  18.486  1.00 18.36 ? 418  GLY B O   1 
ATOM   7788 N N   . LEU B  1 420 ? -3.851  13.403  17.330  1.00 18.37 ? 419  LEU B N   1 
ATOM   7789 C CA  . LEU B  1 420 ? -4.083  12.718  16.052  1.00 17.54 ? 419  LEU B CA  1 
ATOM   7790 C C   . LEU B  1 420 ? -2.877  11.890  15.596  1.00 16.42 ? 419  LEU B C   1 
ATOM   7791 O O   . LEU B  1 420 ? -3.044  10.741  15.154  1.00 16.23 ? 419  LEU B O   1 
ATOM   7792 C CB  . LEU B  1 420 ? -4.468  13.712  14.943  1.00 18.55 ? 419  LEU B CB  1 
ATOM   7793 C CG  . LEU B  1 420 ? -4.581  13.155  13.505  1.00 19.87 ? 419  LEU B CG  1 
ATOM   7794 C CD1 . LEU B  1 420 ? -5.713  12.140  13.361  1.00 21.39 ? 419  LEU B CD1 1 
ATOM   7795 C CD2 . LEU B  1 420 ? -4.695  14.269  12.443  1.00 21.90 ? 419  LEU B CD2 1 
ATOM   7796 N N   . HIS B  1 421 ? -1.692  12.487  15.665  1.00 14.95 ? 420  HIS B N   1 
ATOM   7797 C CA  . HIS B  1 421 ? -0.476  11.778  15.276  1.00 15.08 ? 420  HIS B CA  1 
ATOM   7798 C C   . HIS B  1 421 ? -0.285  10.504  16.096  1.00 15.39 ? 420  HIS B C   1 
ATOM   7799 O O   . HIS B  1 421 ? 0.048   9.436   15.545  1.00 15.02 ? 420  HIS B O   1 
ATOM   7800 C CB  . HIS B  1 421 ? 0.759   12.691  15.398  1.00 15.14 ? 420  HIS B CB  1 
ATOM   7801 C CG  . HIS B  1 421 ? 0.971   13.621  14.232  1.00 16.40 ? 420  HIS B CG  1 
ATOM   7802 N ND1 . HIS B  1 421 ? 0.130   14.675  13.929  1.00 17.89 ? 420  HIS B ND1 1 
ATOM   7803 C CD2 . HIS B  1 421 ? 1.971   13.672  13.315  1.00 14.10 ? 420  HIS B CD2 1 
ATOM   7804 C CE1 . HIS B  1 421 ? 0.594   15.320  12.869  1.00 14.57 ? 420  HIS B CE1 1 
ATOM   7805 N NE2 . HIS B  1 421 ? 1.719   14.741  12.489  1.00 17.49 ? 420  HIS B NE2 1 
ATOM   7806 N N   . HIS B  1 422 ? -0.482  10.595  17.410  1.00 15.00 ? 421  HIS B N   1 
ATOM   7807 C CA  . HIS B  1 422 ? -0.246  9.433   18.272  1.00 15.40 ? 421  HIS B CA  1 
ATOM   7808 C C   . HIS B  1 422 ? -1.293  8.344   18.095  1.00 15.55 ? 421  HIS B C   1 
ATOM   7809 O O   . HIS B  1 422 ? -1.001  7.149   18.222  1.00 15.35 ? 421  HIS B O   1 
ATOM   7810 C CB  . HIS B  1 422 ? -0.098  9.832   19.750  1.00 16.08 ? 421  HIS B CB  1 
ATOM   7811 C CG  . HIS B  1 422 ? 0.695   8.850   20.550  1.00 16.12 ? 421  HIS B CG  1 
ATOM   7812 N ND1 . HIS B  1 422 ? 1.988   8.499   20.224  1.00 16.07 ? 421  HIS B ND1 1 
ATOM   7813 C CD2 . HIS B  1 422 ? 0.370   8.121   21.646  1.00 16.10 ? 421  HIS B CD2 1 
ATOM   7814 C CE1 . HIS B  1 422 ? 2.434   7.609   21.093  1.00 16.94 ? 421  HIS B CE1 1 
ATOM   7815 N NE2 . HIS B  1 422 ? 1.469   7.354   21.962  1.00 16.28 ? 421  HIS B NE2 1 
ATOM   7816 N N   . LYS B  1 423 ? -2.521  8.762   17.799  1.00 15.72 ? 422  LYS B N   1 
ATOM   7817 C CA  . LYS B  1 423 ? -3.601  7.835   17.523  1.00 15.61 ? 422  LYS B CA  1 
ATOM   7818 C C   . LYS B  1 423 ? -3.207  6.985   16.296  1.00 15.74 ? 422  LYS B C   1 
ATOM   7819 O O   . LYS B  1 423 ? -3.299  5.754   16.316  1.00 15.49 ? 422  LYS B O   1 
ATOM   7820 C CB  . LYS B  1 423 ? -4.890  8.623   17.262  1.00 16.15 ? 422  LYS B CB  1 
ATOM   7821 C CG  . LYS B  1 423 ? -6.057  7.748   16.843  1.00 18.21 ? 422  LYS B CG  1 
ATOM   7822 C CD  . LYS B  1 423 ? -7.334  8.553   16.712  1.00 23.04 ? 422  LYS B CD  1 
ATOM   7823 C CE  . LYS B  1 423 ? -7.510  9.127   15.317  1.00 27.30 ? 422  LYS B CE  1 
ATOM   7824 N NZ  . LYS B  1 423 ? -8.745  9.958   15.289  1.00 30.14 ? 422  LYS B NZ  1 
ATOM   7825 N N   . ILE B  1 424 ? -2.716  7.651   15.252  1.00 15.34 ? 423  ILE B N   1 
ATOM   7826 C CA  . ILE B  1 424 ? -2.257  6.964   14.045  1.00 15.01 ? 423  ILE B CA  1 
ATOM   7827 C C   . ILE B  1 424 ? -1.065  6.040   14.315  1.00 14.83 ? 423  ILE B C   1 
ATOM   7828 O O   . ILE B  1 424 ? -1.032  4.900   13.814  1.00 14.58 ? 423  ILE B O   1 
ATOM   7829 C CB  . ILE B  1 424 ? -1.961  7.975   12.888  1.00 15.62 ? 423  ILE B CB  1 
ATOM   7830 C CG1 . ILE B  1 424 ? -3.256  8.668   12.462  1.00 15.54 ? 423  ILE B CG1 1 
ATOM   7831 C CG2 . ILE B  1 424 ? -1.370  7.256   11.661  1.00 15.91 ? 423  ILE B CG2 1 
ATOM   7832 C CD1 . ILE B  1 424 ? -3.044  9.970   11.669  1.00 18.17 ? 423  ILE B CD1 1 
ATOM   7833 N N   . LEU B  1 425 ? -0.108  6.524   15.107  1.00 13.79 ? 424  LEU B N   1 
ATOM   7834 C CA  . LEU B  1 425 ? 1.066   5.728   15.472  1.00 14.24 ? 424  LEU B CA  1 
ATOM   7835 C C   . LEU B  1 425 ? 0.641   4.438   16.192  1.00 14.15 ? 424  LEU B C   1 
ATOM   7836 O O   . LEU B  1 425 ? 1.123   3.334   15.874  1.00 13.99 ? 424  LEU B O   1 
ATOM   7837 C CB  . LEU B  1 425 ? 2.027   6.553   16.339  1.00 13.22 ? 424  LEU B CB  1 
ATOM   7838 C CG  . LEU B  1 425 ? 3.387   5.928   16.663  1.00 13.17 ? 424  LEU B CG  1 
ATOM   7839 C CD1 . LEU B  1 425 ? 4.260   5.788   15.415  1.00 13.92 ? 424  LEU B CD1 1 
ATOM   7840 C CD2 . LEU B  1 425 ? 4.102   6.780   17.728  1.00 12.62 ? 424  LEU B CD2 1 
ATOM   7841 N N   . LEU B  1 426 ? -0.262  4.574   17.168  1.00 14.26 ? 425  LEU B N   1 
ATOM   7842 C CA  . LEU B  1 426 ? -0.758  3.404   17.929  1.00 14.33 ? 425  LEU B CA  1 
ATOM   7843 C C   . LEU B  1 426 ? -1.491  2.425   17.024  1.00 14.73 ? 425  LEU B C   1 
ATOM   7844 O O   . LEU B  1 426 ? -1.303  1.210   17.133  1.00 14.49 ? 425  LEU B O   1 
ATOM   7845 C CB  . LEU B  1 426 ? -1.673  3.834   19.088  1.00 14.81 ? 425  LEU B CB  1 
ATOM   7846 C CG  . LEU B  1 426 ? -1.011  4.471   20.318  1.00 14.88 ? 425  LEU B CG  1 
ATOM   7847 C CD1 . LEU B  1 426 ? -2.055  5.330   21.053  1.00 16.32 ? 425  LEU B CD1 1 
ATOM   7848 C CD2 . LEU B  1 426 ? -0.429  3.423   21.257  1.00 16.83 ? 425  LEU B CD2 1 
ATOM   7849 N N   . ALA B  1 427 ? -2.331  2.952   16.138  1.00 14.25 ? 426  ALA B N   1 
ATOM   7850 C CA  . ALA B  1 427 ? -3.078  2.107   15.204  1.00 14.76 ? 426  ALA B CA  1 
ATOM   7851 C C   . ALA B  1 427 ? -2.144  1.262   14.325  1.00 14.92 ? 426  ALA B C   1 
ATOM   7852 O O   . ALA B  1 427 ? -2.394  0.087   14.097  1.00 14.64 ? 426  ALA B O   1 
ATOM   7853 C CB  . ALA B  1 427 ? -4.011  2.958   14.355  1.00 14.44 ? 426  ALA B CB  1 
ATOM   7854 N N   . ASN B  1 428 ? -1.056  1.864   13.846  1.00 14.46 ? 427  ASN B N   1 
ATOM   7855 C CA  . ASN B  1 428 ? -0.046  1.123   13.087  1.00 14.07 ? 427  ASN B CA  1 
ATOM   7856 C C   . ASN B  1 428 ? 0.691   0.062   13.915  1.00 14.45 ? 427  ASN B C   1 
ATOM   7857 O O   . ASN B  1 428 ? 0.920   -1.062  13.453  1.00 14.91 ? 427  ASN B O   1 
ATOM   7858 C CB  . ASN B  1 428 ? 0.966   2.104   12.476  1.00 14.34 ? 427  ASN B CB  1 
ATOM   7859 C CG  . ASN B  1 428 ? 0.457   2.743   11.199  1.00 16.14 ? 427  ASN B CG  1 
ATOM   7860 O OD1 . ASN B  1 428 ? 0.643   2.209   10.119  1.00 16.27 ? 427  ASN B OD1 1 
ATOM   7861 N ND2 . ASN B  1 428 ? -0.192  3.904   11.318  1.00 18.92 ? 427  ASN B ND2 1 
ATOM   7862 N N   . PHE B  1 429 ? 1.062   0.432   15.137  1.00 13.57 ? 428  PHE B N   1 
ATOM   7863 C CA  . PHE B  1 429 ? 1.735   -0.464  16.071  1.00 14.21 ? 428  PHE B CA  1 
ATOM   7864 C C   . PHE B  1 429 ? 0.910   -1.744  16.274  1.00 13.89 ? 428  PHE B C   1 
ATOM   7865 O O   . PHE B  1 429 ? 1.443   -2.867  16.228  1.00 14.99 ? 428  PHE B O   1 
ATOM   7866 C CB  . PHE B  1 429 ? 1.891   0.264   17.421  1.00 14.11 ? 428  PHE B CB  1 
ATOM   7867 C CG  . PHE B  1 429 ? 2.407   -0.606  18.528  1.00 14.80 ? 428  PHE B CG  1 
ATOM   7868 C CD1 . PHE B  1 429 ? 3.767   -0.710  18.777  1.00 16.73 ? 428  PHE B CD1 1 
ATOM   7869 C CD2 . PHE B  1 429 ? 1.522   -1.305  19.352  1.00 15.20 ? 428  PHE B CD2 1 
ATOM   7870 C CE1 . PHE B  1 429 ? 4.256   -1.504  19.819  1.00 16.58 ? 428  PHE B CE1 1 
ATOM   7871 C CE2 . PHE B  1 429 ? 2.003   -2.111  20.392  1.00 16.95 ? 428  PHE B CE2 1 
ATOM   7872 C CZ  . PHE B  1 429 ? 3.382   -2.209  20.624  1.00 17.12 ? 428  PHE B CZ  1 
ATOM   7873 N N   . LEU B  1 430 ? -0.380  -1.546  16.516  1.00 14.39 ? 429  LEU B N   1 
ATOM   7874 C CA  . LEU B  1 430 ? -1.307  -2.642  16.772  1.00 14.91 ? 429  LEU B CA  1 
ATOM   7875 C C   . LEU B  1 430 ? -1.552  -3.460  15.508  1.00 14.95 ? 429  LEU B C   1 
ATOM   7876 O O   . LEU B  1 430 ? -1.539  -4.698  15.551  1.00 15.54 ? 429  LEU B O   1 
ATOM   7877 C CB  . LEU B  1 430 ? -2.635  -2.096  17.340  1.00 14.67 ? 429  LEU B CB  1 
ATOM   7878 C CG  . LEU B  1 430 ? -2.575  -1.452  18.736  1.00 15.45 ? 429  LEU B CG  1 
ATOM   7879 C CD1 . LEU B  1 430 ? -3.776  -0.531  18.956  1.00 16.47 ? 429  LEU B CD1 1 
ATOM   7880 C CD2 . LEU B  1 430 ? -2.491  -2.526  19.847  1.00 15.83 ? 429  LEU B CD2 1 
ATOM   7881 N N   . ALA B  1 431 ? -1.737  -2.762  14.391  1.00 15.38 ? 430  ALA B N   1 
ATOM   7882 C CA  . ALA B  1 431 ? -2.079  -3.387  13.110  1.00 15.65 ? 430  ALA B CA  1 
ATOM   7883 C C   . ALA B  1 431 ? -0.973  -4.247  12.552  1.00 15.61 ? 430  ALA B C   1 
ATOM   7884 O O   . ALA B  1 431 ? -1.238  -5.274  11.936  1.00 15.62 ? 430  ALA B O   1 
ATOM   7885 C CB  . ALA B  1 431 ? -2.443  -2.334  12.091  1.00 16.07 ? 430  ALA B CB  1 
ATOM   7886 N N   . GLN B  1 432 ? 0.274   -3.829  12.747  1.00 15.24 ? 431  GLN B N   1 
ATOM   7887 C CA  . GLN B  1 432 ? 1.384   -4.603  12.179  1.00 15.07 ? 431  GLN B CA  1 
ATOM   7888 C C   . GLN B  1 432 ? 1.557   -5.978  12.819  1.00 15.57 ? 431  GLN B C   1 
ATOM   7889 O O   . GLN B  1 432 ? 1.809   -6.953  12.116  1.00 15.44 ? 431  GLN B O   1 
ATOM   7890 C CB  . GLN B  1 432 ? 2.694   -3.811  12.239  1.00 15.58 ? 431  GLN B CB  1 
ATOM   7891 C CG  . GLN B  1 432 ? 2.761   -2.675  11.209  1.00 16.37 ? 431  GLN B CG  1 
ATOM   7892 C CD  . GLN B  1 432 ? 2.884   -3.164  9.776   1.00 16.59 ? 431  GLN B CD  1 
ATOM   7893 O OE1 . GLN B  1 432 ? 3.381   -4.266  9.529   1.00 16.42 ? 431  GLN B OE1 1 
ATOM   7894 N NE2 . GLN B  1 432 ? 2.442   -2.335  8.831   1.00 14.92 ? 431  GLN B NE2 1 
ATOM   7895 N N   . THR B  1 433 ? 1.451   -6.070  14.149  1.00 15.39 ? 432  THR B N   1 
ATOM   7896 C CA  . THR B  1 433 ? 1.551   -7.384  14.783  1.00 15.68 ? 432  THR B CA  1 
ATOM   7897 C C   . THR B  1 433 ? 0.341   -8.258  14.474  1.00 15.95 ? 432  THR B C   1 
ATOM   7898 O O   . THR B  1 433 ? 0.485   -9.469  14.283  1.00 16.12 ? 432  THR B O   1 
ATOM   7899 C CB  . THR B  1 433 ? 1.771   -7.283  16.316  1.00 16.03 ? 432  THR B CB  1 
ATOM   7900 O OG1 . THR B  1 433 ? 0.642   -6.648  16.926  1.00 17.22 ? 432  THR B OG1 1 
ATOM   7901 C CG2 . THR B  1 433 ? 2.966   -6.364  16.635  1.00 15.82 ? 432  THR B CG2 1 
ATOM   7902 N N   . GLU B  1 434 ? -0.837  -7.633  14.397  1.00 15.79 ? 433  GLU B N   1 
ATOM   7903 C CA  . GLU B  1 434 ? -2.044  -8.338  13.964  1.00 16.34 ? 433  GLU B CA  1 
ATOM   7904 C C   . GLU B  1 434 ? -1.853  -8.914  12.559  1.00 15.59 ? 433  GLU B C   1 
ATOM   7905 O O   . GLU B  1 434 ? -2.165  -10.095 12.324  1.00 15.87 ? 433  GLU B O   1 
ATOM   7906 C CB  . GLU B  1 434 ? -3.254  -7.405  14.015  1.00 16.26 ? 433  GLU B CB  1 
ATOM   7907 C CG  . GLU B  1 434 ? -4.574  -8.143  13.786  1.00 17.73 ? 433  GLU B CG  1 
ATOM   7908 C CD  . GLU B  1 434 ? -5.774  -7.226  13.645  1.00 20.14 ? 433  GLU B CD  1 
ATOM   7909 O OE1 . GLU B  1 434 ? -5.607  -6.016  13.376  1.00 20.97 ? 433  GLU B OE1 1 
ATOM   7910 O OE2 . GLU B  1 434 ? -6.912  -7.728  13.810  1.00 23.09 ? 433  GLU B OE2 1 
ATOM   7911 N N   . ALA B  1 435 ? -1.328  -8.088  11.644  1.00 15.66 ? 434  ALA B N   1 
ATOM   7912 C CA  . ALA B  1 435 ? -1.088  -8.503  10.254  1.00 14.69 ? 434  ALA B CA  1 
ATOM   7913 C C   . ALA B  1 435 ? -0.080  -9.645  10.134  1.00 15.26 ? 434  ALA B C   1 
ATOM   7914 O O   . ALA B  1 435 ? -0.293  -10.605 9.366   1.00 14.68 ? 434  ALA B O   1 
ATOM   7915 C CB  . ALA B  1 435 ? -0.633  -7.305  9.404   1.00 15.21 ? 434  ALA B CB  1 
ATOM   7916 N N   . LEU B  1 436 ? 1.025   -9.522  10.872  1.00 15.17 ? 435  LEU B N   1 
ATOM   7917 C CA  . LEU B  1 436 ? 2.066   -10.548 10.905  1.00 14.80 ? 435  LEU B CA  1 
ATOM   7918 C C   . LEU B  1 436 ? 1.500   -11.864 11.406  1.00 16.23 ? 435  LEU B C   1 
ATOM   7919 O O   . LEU B  1 436 ? 1.842   -12.925 10.894  1.00 16.66 ? 435  LEU B O   1 
ATOM   7920 C CB  . LEU B  1 436 ? 3.238   -10.080 11.782  1.00 15.40 ? 435  LEU B CB  1 
ATOM   7921 C CG  . LEU B  1 436 ? 4.136   -9.037  11.094  1.00 13.90 ? 435  LEU B CG  1 
ATOM   7922 C CD1 . LEU B  1 436 ? 5.007   -8.353  12.155  1.00 16.04 ? 435  LEU B CD1 1 
ATOM   7923 C CD2 . LEU B  1 436 ? 4.991   -9.645  9.977   1.00 16.79 ? 435  LEU B CD2 1 
ATOM   7924 N N   . MET B  1 437 ? 0.599   -11.789 12.382  1.00 16.12 ? 436  MET B N   1 
ATOM   7925 C CA  . MET B  1 437 ? -0.019  -13.008 12.922  1.00 17.92 ? 436  MET B CA  1 
ATOM   7926 C C   . MET B  1 437 ? -1.012  -13.644 11.934  1.00 18.08 ? 436  MET B C   1 
ATOM   7927 O O   . MET B  1 437 ? -0.957  -14.849 11.660  1.00 17.93 ? 436  MET B O   1 
ATOM   7928 C CB  . MET B  1 437 ? -0.733  -12.708 14.239  1.00 18.23 ? 436  MET B CB  1 
ATOM   7929 C CG  A MET B  1 437 ? -1.175  -13.929 15.012  0.35 17.39 ? 436  MET B CG  1 
ATOM   7930 C CG  B MET B  1 437 ? -1.736  -13.810 14.587  0.65 21.47 ? 436  MET B CG  1 
ATOM   7931 S SD  A MET B  1 437 ? -2.881  -14.372 14.631  0.35 15.62 ? 436  MET B SD  1 
ATOM   7932 S SD  B MET B  1 437 ? -2.049  -14.066 16.317  0.65 25.42 ? 436  MET B SD  1 
ATOM   7933 C CE  A MET B  1 437 ? -3.770  -13.120 15.541  0.35 15.24 ? 436  MET B CE  1 
ATOM   7934 C CE  B MET B  1 437 ? -2.994  -12.612 16.671  0.65 24.53 ? 436  MET B CE  1 
ATOM   7935 N N   . LYS B  1 438 ? -1.908  -12.822 11.399  1.00 18.69 ? 437  LYS B N   1 
ATOM   7936 C CA  . LYS B  1 438 ? -3.111  -13.322 10.743  1.00 19.67 ? 437  LYS B CA  1 
ATOM   7937 C C   . LYS B  1 438 ? -2.893  -13.556 9.253   1.00 18.97 ? 437  LYS B C   1 
ATOM   7938 O O   . LYS B  1 438 ? -3.465  -14.495 8.667   1.00 19.15 ? 437  LYS B O   1 
ATOM   7939 C CB  . LYS B  1 438 ? -4.244  -12.320 11.004  1.00 21.09 ? 437  LYS B CB  1 
ATOM   7940 C CG  . LYS B  1 438 ? -5.361  -12.264 10.013  1.00 25.76 ? 437  LYS B CG  1 
ATOM   7941 C CD  . LYS B  1 438 ? -6.384  -11.241 10.478  1.00 29.97 ? 437  LYS B CD  1 
ATOM   7942 C CE  . LYS B  1 438 ? -7.800  -11.716 10.203  1.00 31.90 ? 437  LYS B CE  1 
ATOM   7943 N NZ  . LYS B  1 438 ? -8.803  -10.982 11.021  1.00 33.75 ? 437  LYS B NZ  1 
ATOM   7944 N N   . GLY B  1 439 ? -2.063  -12.717 8.634   1.00 17.54 ? 438  GLY B N   1 
ATOM   7945 C CA  . GLY B  1 439 ? -1.906  -12.766 7.183   1.00 16.64 ? 438  GLY B CA  1 
ATOM   7946 C C   . GLY B  1 439 ? -3.200  -12.425 6.446   1.00 16.27 ? 438  GLY B C   1 
ATOM   7947 O O   . GLY B  1 439 ? -4.102  -11.787 6.997   1.00 17.12 ? 438  GLY B O   1 
ATOM   7948 N N   . LYS B  1 440 ? -3.281  -12.874 5.194   1.00 15.76 ? 439  LYS B N   1 
ATOM   7949 C CA  . LYS B  1 440 ? -4.424  -12.624 4.326   1.00 16.37 ? 439  LYS B CA  1 
ATOM   7950 C C   . LYS B  1 440 ? -4.583  -13.840 3.435   1.00 16.12 ? 439  LYS B C   1 
ATOM   7951 O O   . LYS B  1 440 ? -3.709  -14.165 2.637   1.00 17.01 ? 439  LYS B O   1 
ATOM   7952 C CB  . LYS B  1 440 ? -4.249  -11.353 3.476   1.00 16.69 ? 439  LYS B CB  1 
ATOM   7953 C CG  . LYS B  1 440 ? -5.501  -11.005 2.640   1.00 17.09 ? 439  LYS B CG  1 
ATOM   7954 C CD  . LYS B  1 440 ? -5.205  -9.965  1.559   1.00 17.88 ? 439  LYS B CD  1 
ATOM   7955 C CE  . LYS B  1 440 ? -5.026  -8.579  2.207   1.00 16.94 ? 439  LYS B CE  1 
ATOM   7956 N NZ  . LYS B  1 440 ? -4.932  -7.477  1.202   1.00 18.42 ? 439  LYS B NZ  1 
ATOM   7957 N N   . LEU B  1 441 ? -5.725  -14.496 3.577   1.00 16.16 ? 440  LEU B N   1 
ATOM   7958 C CA  . LEU B  1 441 ? -6.011  -15.760 2.903   1.00 16.80 ? 440  LEU B CA  1 
ATOM   7959 C C   . LEU B  1 441 ? -6.331  -15.545 1.424   1.00 16.31 ? 440  LEU B C   1 
ATOM   7960 O O   . LEU B  1 441 ? -6.786  -14.460 1.043   1.00 15.68 ? 440  LEU B O   1 
ATOM   7961 C CB  . LEU B  1 441 ? -7.235  -16.365 3.598   1.00 17.15 ? 440  LEU B CB  1 
ATOM   7962 C CG  . LEU B  1 441 ? -7.148  -17.440 4.701   1.00 21.96 ? 440  LEU B CG  1 
ATOM   7963 C CD1 . LEU B  1 441 ? -5.767  -17.978 5.054   1.00 23.32 ? 440  LEU B CD1 1 
ATOM   7964 C CD2 . LEU B  1 441 ? -8.016  -17.202 5.950   1.00 22.97 ? 440  LEU B CD2 1 
ATOM   7965 N N   . PRO B  1 442 ? -6.130  -16.566 0.586   1.00 15.70 ? 441  PRO B N   1 
ATOM   7966 C CA  . PRO B  1 442 ? -6.533  -16.488 -0.824  1.00 16.20 ? 441  PRO B CA  1 
ATOM   7967 C C   . PRO B  1 442 ? -7.983  -16.000 -1.002  1.00 16.45 ? 441  PRO B C   1 
ATOM   7968 O O   . PRO B  1 442 ? -8.216  -15.177 -1.886  1.00 16.39 ? 441  PRO B O   1 
ATOM   7969 C CB  . PRO B  1 442 ? -6.383  -17.936 -1.310  1.00 16.14 ? 441  PRO B CB  1 
ATOM   7970 C CG  . PRO B  1 442 ? -5.262  -18.480 -0.442  1.00 15.91 ? 441  PRO B CG  1 
ATOM   7971 C CD  . PRO B  1 442 ? -5.478  -17.853 0.898   1.00 16.34 ? 441  PRO B CD  1 
ATOM   7972 N N   . GLU B  1 443 ? -8.908  -16.495 -0.180  1.00 17.00 ? 442  GLU B N   1 
ATOM   7973 C CA  . GLU B  1 443 ? -10.308 -16.077 -0.238  1.00 17.17 ? 442  GLU B CA  1 
ATOM   7974 C C   . GLU B  1 443 ? -10.519 -14.589 0.058   1.00 17.67 ? 442  GLU B C   1 
ATOM   7975 O O   . GLU B  1 443 ? -11.388 -13.953 -0.558  1.00 18.87 ? 442  GLU B O   1 
ATOM   7976 C CB  . GLU B  1 443 ? -11.212 -16.988 0.620   1.00 17.44 ? 442  GLU B CB  1 
ATOM   7977 C CG  . GLU B  1 443 ? -10.800 -17.189 2.076   1.00 18.93 ? 442  GLU B CG  1 
ATOM   7978 C CD  . GLU B  1 443 ? -9.903  -18.412 2.335   1.00 17.66 ? 442  GLU B CD  1 
ATOM   7979 O OE1 . GLU B  1 443 ? -10.025 -19.001 3.432   1.00 20.43 ? 442  GLU B OE1 1 
ATOM   7980 O OE2 . GLU B  1 443 ? -9.045  -18.769 1.484   1.00 16.78 ? 442  GLU B OE2 1 
ATOM   7981 N N   . GLU B  1 444 ? -9.695  -14.029 0.951   1.00 17.00 ? 443  GLU B N   1 
ATOM   7982 C CA  . GLU B  1 444 ? -9.758  -12.600 1.238   1.00 16.94 ? 443  GLU B CA  1 
ATOM   7983 C C   . GLU B  1 444 ? -9.162  -11.763 0.085   1.00 16.78 ? 443  GLU B C   1 
ATOM   7984 O O   . GLU B  1 444 ? -9.782  -10.780 -0.374  1.00 16.66 ? 443  GLU B O   1 
ATOM   7985 C CB  . GLU B  1 444 ? -9.081  -12.317 2.599   1.00 17.05 ? 443  GLU B CB  1 
ATOM   7986 C CG  . GLU B  1 444 ? -9.752  -13.015 3.779   1.00 19.88 ? 443  GLU B CG  1 
ATOM   7987 C CD  . GLU B  1 444 ? -8.965  -12.938 5.091   1.00 25.27 ? 443  GLU B CD  1 
ATOM   7988 O OE1 . GLU B  1 444 ? -9.596  -12.647 6.132   1.00 29.69 ? 443  GLU B OE1 1 
ATOM   7989 O OE2 . GLU B  1 444 ? -7.734  -13.183 5.116   1.00 22.18 ? 443  GLU B OE2 1 
ATOM   7990 N N   . ALA B  1 445 ? -7.978  -12.154 -0.402  1.00 16.52 ? 444  ALA B N   1 
ATOM   7991 C CA  . ALA B  1 445 ? -7.354  -11.469 -1.543  1.00 16.55 ? 444  ALA B CA  1 
ATOM   7992 C C   . ALA B  1 445 ? -8.212  -11.530 -2.797  1.00 17.55 ? 444  ALA B C   1 
ATOM   7993 O O   . ALA B  1 445 ? -8.269  -10.572 -3.556  1.00 17.47 ? 444  ALA B O   1 
ATOM   7994 C CB  . ALA B  1 445 ? -5.938  -12.009 -1.816  1.00 16.46 ? 444  ALA B CB  1 
ATOM   7995 N N   . ARG B  1 446 ? -8.865  -12.677 -3.014  1.00 17.77 ? 445  ARG B N   1 
ATOM   7996 C CA  . ARG B  1 446 ? -9.691  -12.857 -4.198  1.00 18.77 ? 445  ARG B CA  1 
ATOM   7997 C C   . ARG B  1 446 ? -10.831 -11.839 -4.238  1.00 18.21 ? 445  ARG B C   1 
ATOM   7998 O O   . ARG B  1 446 ? -11.096 -11.264 -5.277  1.00 19.82 ? 445  ARG B O   1 
ATOM   7999 C CB  . ARG B  1 446 ? -10.227 -14.292 -4.250  1.00 18.58 ? 445  ARG B CB  1 
ATOM   8000 C CG  . ARG B  1 446 ? -11.311 -14.532 -5.271  1.00 24.27 ? 445  ARG B CG  1 
ATOM   8001 C CD  . ARG B  1 446 ? -11.803 -15.979 -5.279  1.00 25.63 ? 445  ARG B CD  1 
ATOM   8002 N NE  . ARG B  1 446 ? -10.815 -16.762 -5.981  1.00 32.56 ? 445  ARG B NE  1 
ATOM   8003 C CZ  . ARG B  1 446 ? -10.809 -16.950 -7.284  1.00 30.60 ? 445  ARG B CZ  1 
ATOM   8004 N NH1 . ARG B  1 446 ? -11.768 -16.441 -8.036  1.00 32.55 ? 445  ARG B NH1 1 
ATOM   8005 N NH2 . ARG B  1 446 ? -9.836  -17.643 -7.829  1.00 30.39 ? 445  ARG B NH2 1 
ATOM   8006 N N   . LYS B  1 447 ? -11.489 -11.605 -3.105  1.00 18.96 ? 446  LYS B N   1 
ATOM   8007 C CA  . LYS B  1 447 ? -12.609 -10.655 -3.055  1.00 18.69 ? 446  LYS B CA  1 
ATOM   8008 C C   . LYS B  1 447 ? -12.113 -9.237  -3.349  1.00 19.36 ? 446  LYS B C   1 
ATOM   8009 O O   . LYS B  1 447 ? -12.827 -8.439  -3.945  1.00 19.84 ? 446  LYS B O   1 
ATOM   8010 C CB  . LYS B  1 447 ? -13.287 -10.677 -1.682  1.00 19.62 ? 446  LYS B CB  1 
ATOM   8011 C CG  . LYS B  1 447 ? -14.192 -11.906 -1.428  1.00 21.71 ? 446  LYS B CG  1 
ATOM   8012 C CD  . LYS B  1 447 ? -14.219 -12.249 0.059   1.00 26.80 ? 446  LYS B CD  1 
ATOM   8013 C CE  . LYS B  1 447 ? -15.513 -11.815 0.709   1.00 28.79 ? 446  LYS B CE  1 
ATOM   8014 N NZ  . LYS B  1 447 ? -15.463 -11.982 2.197   1.00 29.80 ? 446  LYS B NZ  1 
ATOM   8015 N N   . GLU B  1 448 ? -10.883 -8.928  -2.941  1.00 18.87 ? 447  GLU B N   1 
ATOM   8016 C CA  . GLU B  1 448 ? -10.308 -7.607  -3.218  1.00 19.31 ? 447  GLU B CA  1 
ATOM   8017 C C   . GLU B  1 448 ? -10.052 -7.408  -4.715  1.00 19.18 ? 447  GLU B C   1 
ATOM   8018 O O   . GLU B  1 448 ? -10.336 -6.339  -5.277  1.00 20.38 ? 447  GLU B O   1 
ATOM   8019 C CB  . GLU B  1 448 ? -9.022  -7.412  -2.400  1.00 18.35 ? 447  GLU B CB  1 
ATOM   8020 C CG  . GLU B  1 448 ? -9.300  -7.316  -0.901  1.00 19.44 ? 447  GLU B CG  1 
ATOM   8021 C CD  . GLU B  1 448 ? -8.044  -7.207  -0.057  1.00 21.04 ? 447  GLU B CD  1 
ATOM   8022 O OE1 . GLU B  1 448 ? -8.165  -6.867  1.141   1.00 25.48 ? 447  GLU B OE1 1 
ATOM   8023 O OE2 . GLU B  1 448 ? -6.951  -7.474  -0.585  1.00 23.89 ? 447  GLU B OE2 1 
ATOM   8024 N N   . LEU B  1 449 ? -9.514  -8.438  -5.356  1.00 20.06 ? 448  LEU B N   1 
ATOM   8025 C CA  . LEU B  1 449 ? -9.248  -8.380  -6.781  1.00 20.96 ? 448  LEU B CA  1 
ATOM   8026 C C   . LEU B  1 449 ? -10.558 -8.329  -7.568  1.00 22.26 ? 448  LEU B C   1 
ATOM   8027 O O   . LEU B  1 449 ? -10.644 -7.615  -8.565  1.00 22.37 ? 448  LEU B O   1 
ATOM   8028 C CB  . LEU B  1 449 ? -8.354  -9.553  -7.221  1.00 20.86 ? 448  LEU B CB  1 
ATOM   8029 C CG  . LEU B  1 449 ? -6.934  -9.486  -6.631  1.00 19.40 ? 448  LEU B CG  1 
ATOM   8030 C CD1 . LEU B  1 449 ? -6.279  -10.865 -6.650  1.00 19.00 ? 448  LEU B CD1 1 
ATOM   8031 C CD2 . LEU B  1 449 ? -6.036  -8.455  -7.350  1.00 21.04 ? 448  LEU B CD2 1 
ATOM   8032 N N   . GLN B  1 450 ? -11.569 -9.062  -7.106  1.00 23.59 ? 449  GLN B N   1 
ATOM   8033 C CA  . GLN B  1 450 ? -12.898 -9.015  -7.738  1.00 25.25 ? 449  GLN B CA  1 
ATOM   8034 C C   . GLN B  1 450 ? -13.517 -7.619  -7.670  1.00 25.58 ? 449  GLN B C   1 
ATOM   8035 O O   . GLN B  1 450 ? -14.068 -7.129  -8.668  1.00 25.55 ? 449  GLN B O   1 
ATOM   8036 C CB  A GLN B  1 450 ? -13.852 -10.039 -7.109  0.35 25.05 ? 449  GLN B CB  1 
ATOM   8037 C CB  B GLN B  1 450 ? -13.815 -10.062 -7.121  0.65 25.61 ? 449  GLN B CB  1 
ATOM   8038 C CG  A GLN B  1 450 ? -15.342 -9.730  -7.395  0.35 26.12 ? 449  GLN B CG  1 
ATOM   8039 C CG  B GLN B  1 450 ? -13.214 -11.444 -7.164  0.65 29.55 ? 449  GLN B CG  1 
ATOM   8040 C CD  A GLN B  1 450 ? -16.278 -10.768 -6.802  0.35 27.20 ? 449  GLN B CD  1 
ATOM   8041 C CD  B GLN B  1 450 ? -14.233 -12.519 -7.357  0.65 33.35 ? 449  GLN B CD  1 
ATOM   8042 O OE1 A GLN B  1 450 ? -16.776 -11.639 -7.513  0.35 27.21 ? 449  GLN B OE1 1 
ATOM   8043 O OE1 B GLN B  1 450 ? -14.574 -12.871 -8.491  0.65 37.05 ? 449  GLN B OE1 1 
ATOM   8044 N NE2 A GLN B  1 450 ? -16.538 -10.661 -5.504  0.35 27.24 ? 449  GLN B NE2 1 
ATOM   8045 N NE2 B GLN B  1 450 ? -14.717 -13.067 -6.257  0.65 35.00 ? 449  GLN B NE2 1 
ATOM   8046 N N   . ALA B  1 451 ? -13.401 -6.974  -6.509  1.00 25.77 ? 450  ALA B N   1 
ATOM   8047 C CA  . ALA B  1 451 ? -13.948 -5.632  -6.317  1.00 26.94 ? 450  ALA B CA  1 
ATOM   8048 C C   . ALA B  1 451 ? -13.204 -4.602  -7.163  1.00 27.96 ? 450  ALA B C   1 
ATOM   8049 O O   . ALA B  1 451 ? -13.798 -3.610  -7.619  1.00 28.63 ? 450  ALA B O   1 
ATOM   8050 C CB  . ALA B  1 451 ? -13.918 -5.239  -4.855  1.00 26.37 ? 450  ALA B CB  1 
ATOM   8051 N N   . ALA B  1 452 ? -11.916 -4.850  -7.390  1.00 28.40 ? 451  ALA B N   1 
ATOM   8052 C CA  . ALA B  1 452 ? -11.088 -3.972  -8.215  1.00 29.49 ? 451  ALA B CA  1 
ATOM   8053 C C   . ALA B  1 452 ? -11.419 -4.112  -9.707  1.00 30.23 ? 451  ALA B C   1 
ATOM   8054 O O   . ALA B  1 452 ? -10.917 -3.348  -10.529 1.00 30.99 ? 451  ALA B O   1 
ATOM   8055 C CB  . ALA B  1 452 ? -9.611  -4.242  -7.967  1.00 29.20 ? 451  ALA B CB  1 
ATOM   8056 N N   . GLY B  1 453 ? -12.261 -5.086  -10.047 1.00 30.75 ? 452  GLY B N   1 
ATOM   8057 C CA  . GLY B  1 453 ? -12.700 -5.289  -11.421 1.00 31.59 ? 452  GLY B CA  1 
ATOM   8058 C C   . GLY B  1 453 ? -11.684 -5.979  -12.313 1.00 32.30 ? 452  GLY B C   1 
ATOM   8059 O O   . GLY B  1 453 ? -11.708 -5.813  -13.535 1.00 31.99 ? 452  GLY B O   1 
ATOM   8060 N N   . LYS B  1 454 ? -10.783 -6.750  -11.708 1.00 32.61 ? 453  LYS B N   1 
ATOM   8061 C CA  . LYS B  1 454 ? -9.780  -7.489  -12.466 1.00 33.05 ? 453  LYS B CA  1 
ATOM   8062 C C   . LYS B  1 454 ? -10.430 -8.570  -13.308 1.00 33.55 ? 453  LYS B C   1 
ATOM   8063 O O   . LYS B  1 454 ? -11.390 -9.214  -12.878 1.00 33.29 ? 453  LYS B O   1 
ATOM   8064 C CB  . LYS B  1 454 ? -8.730  -8.119  -11.536 1.00 32.96 ? 453  LYS B CB  1 
ATOM   8065 C CG  . LYS B  1 454 ? -7.939  -7.114  -10.705 1.00 33.57 ? 453  LYS B CG  1 
ATOM   8066 C CD  . LYS B  1 454 ? -7.002  -6.289  -11.563 1.00 33.72 ? 453  LYS B CD  1 
ATOM   8067 C CE  . LYS B  1 454 ? -6.127  -5.379  -10.719 1.00 35.73 ? 453  LYS B CE  1 
ATOM   8068 N NZ  . LYS B  1 454 ? -5.596  -4.234  -11.513 1.00 37.11 ? 453  LYS B NZ  1 
ATOM   8069 N N   . SER B  1 455 ? -9.897  -8.752  -14.515 1.00 34.52 ? 454  SER B N   1 
ATOM   8070 C CA  . SER B  1 455 ? -10.308 -9.829  -15.409 1.00 35.24 ? 454  SER B CA  1 
ATOM   8071 C C   . SER B  1 455 ? -9.969  -11.189 -14.798 1.00 35.64 ? 454  SER B C   1 
ATOM   8072 O O   . SER B  1 455 ? -9.051  -11.285 -13.981 1.00 35.67 ? 454  SER B O   1 
ATOM   8073 C CB  . SER B  1 455 ? -9.610  -9.676  -16.766 1.00 35.18 ? 454  SER B CB  1 
ATOM   8074 O OG  . SER B  1 455 ? -8.215  -9.917  -16.665 1.00 35.27 ? 454  SER B OG  1 
ATOM   8075 N N   . PRO B  1 456 ? -10.712 -12.235 -15.161 1.00 35.98 ? 455  PRO B N   1 
ATOM   8076 C CA  . PRO B  1 456 ? -10.331 -13.612 -14.815 1.00 35.95 ? 455  PRO B CA  1 
ATOM   8077 C C   . PRO B  1 456 ? -8.827  -13.901 -14.928 1.00 35.87 ? 455  PRO B C   1 
ATOM   8078 O O   . PRO B  1 456 ? -8.274  -14.488 -13.998 1.00 35.96 ? 455  PRO B O   1 
ATOM   8079 C CB  . PRO B  1 456 ? -11.102 -14.449 -15.845 1.00 36.06 ? 455  PRO B CB  1 
ATOM   8080 C CG  . PRO B  1 456 ? -12.328 -13.642 -16.133 1.00 36.10 ? 455  PRO B CG  1 
ATOM   8081 C CD  . PRO B  1 456 ? -11.994 -12.192 -15.893 1.00 36.28 ? 455  PRO B CD  1 
ATOM   8082 N N   . GLU B  1 457 ? -8.186  -13.498 -16.026 1.00 35.81 ? 456  GLU B N   1 
ATOM   8083 C CA  . GLU B  1 457 ? -6.767  -13.812 -16.250 1.00 36.14 ? 456  GLU B CA  1 
ATOM   8084 C C   . GLU B  1 457 ? -5.849  -13.014 -15.328 1.00 35.14 ? 456  GLU B C   1 
ATOM   8085 O O   . GLU B  1 457 ? -4.921  -13.576 -14.734 1.00 35.68 ? 456  GLU B O   1 
ATOM   8086 C CB  . GLU B  1 457 ? -6.352  -13.597 -17.716 1.00 36.76 ? 456  GLU B CB  1 
ATOM   8087 C CG  . GLU B  1 457 ? -7.197  -14.314 -18.765 1.00 39.40 ? 456  GLU B CG  1 
ATOM   8088 C CD  . GLU B  1 457 ? -7.392  -15.799 -18.487 1.00 42.83 ? 456  GLU B CD  1 
ATOM   8089 O OE1 . GLU B  1 457 ? -8.475  -16.170 -17.974 1.00 44.12 ? 456  GLU B OE1 1 
ATOM   8090 O OE2 . GLU B  1 457 ? -6.470  -16.597 -18.792 1.00 44.45 ? 456  GLU B OE2 1 
ATOM   8091 N N   . ASP B  1 458 ? -6.118  -11.713 -15.210 1.00 33.85 ? 457  ASP B N   1 
ATOM   8092 C CA  . ASP B  1 458 ? -5.350  -10.833 -14.328 1.00 32.51 ? 457  ASP B CA  1 
ATOM   8093 C C   . ASP B  1 458 ? -5.506  -11.233 -12.854 1.00 30.89 ? 457  ASP B C   1 
ATOM   8094 O O   . ASP B  1 458 ? -4.523  -11.243 -12.100 1.00 30.40 ? 457  ASP B O   1 
ATOM   8095 C CB  . ASP B  1 458 ? -5.772  -9.377  -14.525 1.00 33.05 ? 457  ASP B CB  1 
ATOM   8096 C CG  . ASP B  1 458 ? -5.191  -8.758  -15.790 1.00 35.18 ? 457  ASP B CG  1 
ATOM   8097 O OD1 . ASP B  1 458 ? -5.511  -7.580  -16.065 1.00 36.37 ? 457  ASP B OD1 1 
ATOM   8098 O OD2 . ASP B  1 458 ? -4.414  -9.358  -16.564 1.00 38.23 ? 457  ASP B OD2 1 
ATOM   8099 N N   . LEU B  1 459 ? -6.733  -11.566 -12.452 1.00 28.81 ? 458  LEU B N   1 
ATOM   8100 C CA  . LEU B  1 459 ? -6.994  -12.041 -11.089 1.00 27.59 ? 458  LEU B CA  1 
ATOM   8101 C C   . LEU B  1 459 ? -6.146  -13.268 -10.767 1.00 27.30 ? 458  LEU B C   1 
ATOM   8102 O O   . LEU B  1 459 ? -5.500  -13.318 -9.723  1.00 25.84 ? 458  LEU B O   1 
ATOM   8103 C CB  . LEU B  1 459 ? -8.479  -12.370 -10.881 1.00 27.43 ? 458  LEU B CB  1 
ATOM   8104 C CG  . LEU B  1 459 ? -8.929  -12.670 -9.443  1.00 26.65 ? 458  LEU B CG  1 
ATOM   8105 C CD1 . LEU B  1 459 ? -10.357 -12.182 -9.214  1.00 26.66 ? 458  LEU B CD1 1 
ATOM   8106 C CD2 . LEU B  1 459 ? -8.808  -14.161 -9.102  1.00 27.67 ? 458  LEU B CD2 1 
ATOM   8107 N N   . GLU B  1 460 ? -6.144  -14.250 -11.672 1.00 27.24 ? 459  GLU B N   1 
ATOM   8108 C CA  . GLU B  1 460 ? -5.437  -15.508 -11.448 1.00 28.10 ? 459  GLU B CA  1 
ATOM   8109 C C   . GLU B  1 460 ? -3.940  -15.271 -11.281 1.00 27.07 ? 459  GLU B C   1 
ATOM   8110 O O   . GLU B  1 460 ? -3.314  -15.848 -10.394 1.00 26.68 ? 459  GLU B O   1 
ATOM   8111 C CB  . GLU B  1 460 ? -5.725  -16.509 -12.585 1.00 28.76 ? 459  GLU B CB  1 
ATOM   8112 C CG  . GLU B  1 460 ? -4.729  -17.653 -12.711 1.00 33.63 ? 459  GLU B CG  1 
ATOM   8113 C CD  . GLU B  1 460 ? -5.338  -19.013 -12.402 1.00 39.63 ? 459  GLU B CD  1 
ATOM   8114 O OE1 . GLU B  1 460 ? -5.536  -19.802 -13.357 1.00 41.14 ? 459  GLU B OE1 1 
ATOM   8115 O OE2 . GLU B  1 460 ? -5.615  -19.303 -11.207 1.00 41.80 ? 459  GLU B OE2 1 
ATOM   8116 N N   . LYS B  1 461 ? -3.391  -14.392 -12.117 1.00 26.75 ? 460  LYS B N   1 
ATOM   8117 C CA  . LYS B  1 461 ? -1.960  -14.093 -12.114 1.00 26.62 ? 460  LYS B CA  1 
ATOM   8118 C C   . LYS B  1 461 ? -1.525  -13.306 -10.869 1.00 25.16 ? 460  LYS B C   1 
ATOM   8119 O O   . LYS B  1 461 ? -0.436  -13.538 -10.337 1.00 25.25 ? 460  LYS B O   1 
ATOM   8120 C CB  . LYS B  1 461 ? -1.558  -13.359 -13.399 1.00 27.61 ? 460  LYS B CB  1 
ATOM   8121 C CG  . LYS B  1 461 ? -1.740  -14.218 -14.662 1.00 30.90 ? 460  LYS B CG  1 
ATOM   8122 C CD  . LYS B  1 461 ? -1.066  -13.612 -15.891 1.00 35.96 ? 460  LYS B CD  1 
ATOM   8123 C CE  . LYS B  1 461 ? -0.764  -14.674 -16.946 1.00 37.62 ? 460  LYS B CE  1 
ATOM   8124 N NZ  . LYS B  1 461 ? -1.121  -14.193 -18.317 1.00 40.23 ? 460  LYS B NZ  1 
ATOM   8125 N N   . LEU B  1 462 ? -2.381  -12.399 -10.399 1.00 23.35 ? 461  LEU B N   1 
ATOM   8126 C CA  . LEU B  1 462 ? -2.015  -11.533 -9.267  1.00 21.17 ? 461  LEU B CA  1 
ATOM   8127 C C   . LEU B  1 462 ? -2.241  -12.208 -7.919  1.00 20.16 ? 461  LEU B C   1 
ATOM   8128 O O   . LEU B  1 462 ? -1.556  -11.900 -6.927  1.00 19.41 ? 461  LEU B O   1 
ATOM   8129 C CB  . LEU B  1 462 ? -2.801  -10.223 -9.307  1.00 21.37 ? 461  LEU B CB  1 
ATOM   8130 C CG  . LEU B  1 462 ? -2.409  -9.174  -10.346 1.00 23.29 ? 461  LEU B CG  1 
ATOM   8131 C CD1 . LEU B  1 462 ? -3.426  -8.042  -10.303 1.00 25.24 ? 461  LEU B CD1 1 
ATOM   8132 C CD2 . LEU B  1 462 ? -1.005  -8.640  -10.042 1.00 24.26 ? 461  LEU B CD2 1 
ATOM   8133 N N   . LEU B  1 463 ? -3.192  -13.137 -7.880  1.00 18.13 ? 462  LEU B N   1 
ATOM   8134 C CA  . LEU B  1 463 ? -3.632  -13.706 -6.619  1.00 17.08 ? 462  LEU B CA  1 
ATOM   8135 C C   . LEU B  1 463 ? -2.491  -14.158 -5.676  1.00 17.86 ? 462  LEU B C   1 
ATOM   8136 O O   . LEU B  1 463 ? -2.461  -13.717 -4.535  1.00 18.48 ? 462  LEU B O   1 
ATOM   8137 C CB  . LEU B  1 463 ? -4.671  -14.832 -6.845  1.00 16.71 ? 462  LEU B CB  1 
ATOM   8138 C CG  . LEU B  1 463 ? -5.342  -15.368 -5.582  1.00 15.78 ? 462  LEU B CG  1 
ATOM   8139 C CD1 . LEU B  1 463 ? -6.087  -14.270 -4.787  1.00 19.16 ? 462  LEU B CD1 1 
ATOM   8140 C CD2 . LEU B  1 463 ? -6.288  -16.514 -5.912  1.00 17.29 ? 462  LEU B CD2 1 
ATOM   8141 N N   . PRO B  1 464 ? -1.565  -15.015 -6.108  1.00 17.93 ? 463  PRO B N   1 
ATOM   8142 C CA  . PRO B  1 464 ? -0.543  -15.490 -5.168  1.00 17.51 ? 463  PRO B CA  1 
ATOM   8143 C C   . PRO B  1 464 ? 0.347   -14.345 -4.634  1.00 17.50 ? 463  PRO B C   1 
ATOM   8144 O O   . PRO B  1 464 ? 0.763   -14.432 -3.474  1.00 16.71 ? 463  PRO B O   1 
ATOM   8145 C CB  . PRO B  1 464 ? 0.270   -16.500 -5.988  1.00 17.96 ? 463  PRO B CB  1 
ATOM   8146 C CG  . PRO B  1 464 ? -0.023  -16.181 -7.397  1.00 18.62 ? 463  PRO B CG  1 
ATOM   8147 C CD  . PRO B  1 464 ? -1.418  -15.631 -7.447  1.00 18.26 ? 463  PRO B CD  1 
ATOM   8148 N N   . HIS B  1 465 ? 0.540   -13.286 -5.419  1.00 16.91 ? 464  HIS B N   1 
ATOM   8149 C CA  . HIS B  1 465 ? 1.344   -12.142 -4.970  1.00 17.68 ? 464  HIS B CA  1 
ATOM   8150 C C   . HIS B  1 465 ? 0.677   -11.345 -3.853  1.00 17.54 ? 464  HIS B C   1 
ATOM   8151 O O   . HIS B  1 465 ? 1.372   -10.642 -3.101  1.00 17.62 ? 464  HIS B O   1 
ATOM   8152 C CB  . HIS B  1 465 ? 1.646   -11.197 -6.143  1.00 18.01 ? 464  HIS B CB  1 
ATOM   8153 C CG  . HIS B  1 465 ? 2.477   -11.825 -7.214  1.00 19.07 ? 464  HIS B CG  1 
ATOM   8154 N ND1 . HIS B  1 465 ? 3.856   -11.825 -7.182  1.00 19.40 ? 464  HIS B ND1 1 
ATOM   8155 C CD2 . HIS B  1 465 ? 2.124   -12.470 -8.355  1.00 18.64 ? 464  HIS B CD2 1 
ATOM   8156 C CE1 . HIS B  1 465 ? 4.317   -12.442 -8.256  1.00 20.57 ? 464  HIS B CE1 1 
ATOM   8157 N NE2 . HIS B  1 465 ? 3.289   -12.853 -8.978  1.00 19.86 ? 464  HIS B NE2 1 
ATOM   8158 N N   . LYS B  1 466 ? -0.650  -11.455 -3.748  1.00 17.22 ? 465  LYS B N   1 
ATOM   8159 C CA  . LYS B  1 466 ? -1.449  -10.699 -2.785  1.00 17.64 ? 465  LYS B CA  1 
ATOM   8160 C C   . LYS B  1 466 ? -1.701  -11.438 -1.467  1.00 17.14 ? 465  LYS B C   1 
ATOM   8161 O O   . LYS B  1 466 ? -2.226  -10.860 -0.532  1.00 17.41 ? 465  LYS B O   1 
ATOM   8162 C CB  . LYS B  1 466 ? -2.807  -10.316 -3.414  1.00 18.09 ? 465  LYS B CB  1 
ATOM   8163 C CG  A LYS B  1 466 ? -2.740  -9.215  -4.478  0.35 18.90 ? 465  LYS B CG  1 
ATOM   8164 C CG  B LYS B  1 466 ? -2.689  -9.584  -4.734  0.65 19.90 ? 465  LYS B CG  1 
ATOM   8165 C CD  A LYS B  1 466 ? -3.364  -7.896  -4.011  0.35 20.37 ? 465  LYS B CD  1 
ATOM   8166 C CD  B LYS B  1 466 ? -2.235  -8.157  -4.544  0.65 21.73 ? 465  LYS B CD  1 
ATOM   8167 C CE  A LYS B  1 466 ? -4.870  -8.001  -3.767  0.35 21.47 ? 465  LYS B CE  1 
ATOM   8168 C CE  B LYS B  1 466 ? -2.320  -7.389  -5.851  0.65 22.77 ? 465  LYS B CE  1 
ATOM   8169 N NZ  A LYS B  1 466 ? -5.264  -7.177  -2.591  0.35 22.31 ? 465  LYS B NZ  1 
ATOM   8170 N NZ  B LYS B  1 466 ? -3.106  -6.141  -5.680  0.65 23.28 ? 465  LYS B NZ  1 
ATOM   8171 N N   . VAL B  1 467 ? -1.339  -12.721 -1.415  1.00 16.49 ? 466  VAL B N   1 
ATOM   8172 C CA  . VAL B  1 467 ? -1.569  -13.540 -0.239  1.00 16.23 ? 466  VAL B CA  1 
ATOM   8173 C C   . VAL B  1 467 ? -0.457  -13.296 0.782   1.00 15.98 ? 466  VAL B C   1 
ATOM   8174 O O   . VAL B  1 467 ? 0.706   -13.183 0.411   1.00 16.63 ? 466  VAL B O   1 
ATOM   8175 C CB  . VAL B  1 467 ? -1.682  -15.031 -0.643  1.00 16.47 ? 466  VAL B CB  1 
ATOM   8176 C CG1 . VAL B  1 467 ? -1.580  -15.973 0.596   1.00 16.05 ? 466  VAL B CG1 1 
ATOM   8177 C CG2 . VAL B  1 467 ? -2.990  -15.246 -1.371  1.00 17.25 ? 466  VAL B CG2 1 
ATOM   8178 N N   . PHE B  1 468 ? -0.833  -13.196 2.059   1.00 16.20 ? 467  PHE B N   1 
ATOM   8179 C CA  . PHE B  1 468 ? 0.124   -13.077 3.160   1.00 16.41 ? 467  PHE B CA  1 
ATOM   8180 C C   . PHE B  1 468 ? 0.002   -14.367 3.971   1.00 16.46 ? 467  PHE B C   1 
ATOM   8181 O O   . PHE B  1 468 ? -1.069  -14.654 4.513   1.00 16.17 ? 467  PHE B O   1 
ATOM   8182 C CB  . PHE B  1 468 ? -0.201  -11.870 4.070   1.00 16.28 ? 467  PHE B CB  1 
ATOM   8183 C CG  . PHE B  1 468 ? 0.097   -10.502 3.458   1.00 16.89 ? 467  PHE B CG  1 
ATOM   8184 C CD1 . PHE B  1 468 ? -0.607  -10.037 2.331   1.00 17.55 ? 467  PHE B CD1 1 
ATOM   8185 C CD2 . PHE B  1 468 ? 1.055   -9.670  4.040   1.00 18.47 ? 467  PHE B CD2 1 
ATOM   8186 C CE1 . PHE B  1 468 ? -0.344  -8.768  1.780   1.00 17.34 ? 467  PHE B CE1 1 
ATOM   8187 C CE2 . PHE B  1 468 ? 1.331   -8.404  3.517   1.00 17.44 ? 467  PHE B CE2 1 
ATOM   8188 C CZ  . PHE B  1 468 ? 0.646   -7.945  2.388   1.00 18.60 ? 467  PHE B CZ  1 
ATOM   8189 N N   . GLU B  1 469 ? 1.084   -15.137 4.060   1.00 16.63 ? 468  GLU B N   1 
ATOM   8190 C CA  . GLU B  1 469 ? 1.037   -16.409 4.784   1.00 16.92 ? 468  GLU B CA  1 
ATOM   8191 C C   . GLU B  1 469 ? 0.819   -16.252 6.284   1.00 16.95 ? 468  GLU B C   1 
ATOM   8192 O O   . GLU B  1 469 ? 0.269   -17.145 6.940   1.00 17.60 ? 468  GLU B O   1 
ATOM   8193 C CB  . GLU B  1 469 ? 2.273   -17.258 4.471   1.00 17.88 ? 468  GLU B CB  1 
ATOM   8194 C CG  . GLU B  1 469 ? 2.230   -17.764 3.036   1.00 19.25 ? 468  GLU B CG  1 
ATOM   8195 C CD  . GLU B  1 469 ? 3.407   -18.654 2.665   1.00 23.93 ? 468  GLU B CD  1 
ATOM   8196 O OE1 . GLU B  1 469 ? 4.511   -18.447 3.210   1.00 24.74 ? 468  GLU B OE1 1 
ATOM   8197 O OE2 . GLU B  1 469 ? 3.234   -19.540 1.783   1.00 26.27 ? 468  GLU B OE2 1 
ATOM   8198 N N   . GLY B  1 470 ? 1.264   -15.128 6.832   1.00 16.69 ? 469  GLY B N   1 
ATOM   8199 C CA  . GLY B  1 470 ? 1.111   -14.867 8.256   1.00 16.66 ? 469  GLY B CA  1 
ATOM   8200 C C   . GLY B  1 470 ? 1.898   -15.837 9.111   1.00 16.44 ? 469  GLY B C   1 
ATOM   8201 O O   . GLY B  1 470 ? 2.950   -16.333 8.687   1.00 16.52 ? 469  GLY B O   1 
ATOM   8202 N N   . ASN B  1 471 ? 1.413   -16.075 10.334  1.00 16.72 ? 470  ASN B N   1 
ATOM   8203 C CA  . ASN B  1 471 ? 2.110   -16.929 11.318  1.00 17.96 ? 470  ASN B CA  1 
ATOM   8204 C C   . ASN B  1 471 ? 3.506   -16.420 11.722  1.00 17.88 ? 470  ASN B C   1 
ATOM   8205 O O   . ASN B  1 471 ? 4.396   -17.206 12.056  1.00 19.09 ? 470  ASN B O   1 
ATOM   8206 C CB  . ASN B  1 471 ? 2.187   -18.385 10.812  1.00 18.13 ? 470  ASN B CB  1 
ATOM   8207 C CG  . ASN B  1 471 ? 2.106   -19.415 11.931  1.00 20.34 ? 470  ASN B CG  1 
ATOM   8208 O OD1 . ASN B  1 471 ? 1.496   -19.179 12.987  1.00 21.79 ? 470  ASN B OD1 1 
ATOM   8209 N ND2 . ASN B  1 471 ? 2.743   -20.564 11.708  1.00 22.28 ? 470  ASN B ND2 1 
ATOM   8210 N N   . ARG B  1 472 ? 3.681   -15.101 11.704  1.00 17.40 ? 471  ARG B N   1 
ATOM   8211 C CA  . ARG B  1 472 ? 4.959   -14.475 12.037  1.00 17.59 ? 471  ARG B CA  1 
ATOM   8212 C C   . ARG B  1 472 ? 4.861   -13.914 13.449  1.00 16.91 ? 471  ARG B C   1 
ATOM   8213 O O   . ARG B  1 472 ? 4.030   -13.036 13.700  1.00 16.84 ? 471  ARG B O   1 
ATOM   8214 C CB  . ARG B  1 472 ? 5.305   -13.411 10.997  1.00 17.77 ? 471  ARG B CB  1 
ATOM   8215 C CG  . ARG B  1 472 ? 5.728   -14.061 9.672   1.00 19.77 ? 471  ARG B CG  1 
ATOM   8216 C CD  . ARG B  1 472 ? 5.257   -13.380 8.437   1.00 19.79 ? 471  ARG B CD  1 
ATOM   8217 N NE  . ARG B  1 472 ? 6.126   -13.641 7.279   1.00 19.09 ? 471  ARG B NE  1 
ATOM   8218 C CZ  . ARG B  1 472 ? 5.983   -14.659 6.440   1.00 19.75 ? 471  ARG B CZ  1 
ATOM   8219 N NH1 . ARG B  1 472 ? 4.990   -15.535 6.605   1.00 19.87 ? 471  ARG B NH1 1 
ATOM   8220 N NH2 . ARG B  1 472 ? 6.820   -14.798 5.412   1.00 18.89 ? 471  ARG B NH2 1 
ATOM   8221 N N   . PRO B  1 473 ? 5.675   -14.440 14.379  1.00 16.29 ? 472  PRO B N   1 
ATOM   8222 C CA  . PRO B  1 473 ? 5.521   -14.122 15.804  1.00 16.31 ? 472  PRO B CA  1 
ATOM   8223 C C   . PRO B  1 473 ? 6.139   -12.804 16.259  1.00 16.46 ? 472  PRO B C   1 
ATOM   8224 O O   . PRO B  1 473 ? 7.199   -12.394 15.778  1.00 17.13 ? 472  PRO B O   1 
ATOM   8225 C CB  . PRO B  1 473 ? 6.247   -15.280 16.493  1.00 16.56 ? 472  PRO B CB  1 
ATOM   8226 C CG  . PRO B  1 473 ? 7.358   -15.632 15.528  1.00 16.98 ? 472  PRO B CG  1 
ATOM   8227 C CD  . PRO B  1 473 ? 6.775   -15.402 14.158  1.00 16.68 ? 472  PRO B CD  1 
ATOM   8228 N N   . THR B  1 474 ? 5.479   -12.176 17.225  1.00 16.79 ? 473  THR B N   1 
ATOM   8229 C CA  . THR B  1 474 ? 5.960   -10.921 17.813  1.00 16.10 ? 473  THR B CA  1 
ATOM   8230 C C   . THR B  1 474 ? 5.735   -10.881 19.315  1.00 16.37 ? 473  THR B C   1 
ATOM   8231 O O   . THR B  1 474 ? 4.876   -11.600 19.846  1.00 16.56 ? 473  THR B O   1 
ATOM   8232 C CB  . THR B  1 474 ? 5.241   -9.709  17.223  1.00 16.61 ? 473  THR B CB  1 
ATOM   8233 O OG1 . THR B  1 474 ? 3.829   -9.839  17.419  1.00 16.88 ? 473  THR B OG1 1 
ATOM   8234 C CG2 . THR B  1 474 ? 5.420   -9.635  15.699  1.00 16.27 ? 473  THR B CG2 1 
ATOM   8235 N N   . ASN B  1 475 ? 6.493   -10.002 19.956  1.00 16.02 ? 474  ASN B N   1 
ATOM   8236 C CA  . ASN B  1 475 ? 6.199   -9.491  21.290  1.00 15.98 ? 474  ASN B CA  1 
ATOM   8237 C C   . ASN B  1 475 ? 5.737   -8.047  21.130  1.00 16.10 ? 474  ASN B C   1 
ATOM   8238 O O   . ASN B  1 475 ? 6.259   -7.315  20.264  1.00 15.92 ? 474  ASN B O   1 
ATOM   8239 C CB  . ASN B  1 475 ? 7.453   -9.492  22.176  1.00 16.28 ? 474  ASN B CB  1 
ATOM   8240 C CG  . ASN B  1 475 ? 7.901   -10.892 22.561  1.00 17.72 ? 474  ASN B CG  1 
ATOM   8241 O OD1 . ASN B  1 475 ? 7.071   -11.765 22.859  1.00 16.85 ? 474  ASN B OD1 1 
ATOM   8242 N ND2 . ASN B  1 475 ? 9.215   -11.121 22.537  1.00 17.96 ? 474  ASN B ND2 1 
ATOM   8243 N N   . SER B  1 476 ? 4.756   -7.644  21.939  1.00 15.85 ? 475  SER B N   1 
ATOM   8244 C CA  . SER B  1 476 ? 4.367   -6.244  22.046  1.00 15.96 ? 475  SER B CA  1 
ATOM   8245 C C   . SER B  1 476 ? 4.650   -5.769  23.468  1.00 16.71 ? 475  SER B C   1 
ATOM   8246 O O   . SER B  1 476 ? 4.152   -6.350  24.433  1.00 17.11 ? 475  SER B O   1 
ATOM   8247 C CB  . SER B  1 476 ? 2.880   -6.049  21.682  1.00 16.28 ? 475  SER B CB  1 
ATOM   8248 O OG  . SER B  1 476 ? 2.655   -6.180  20.266  1.00 16.60 ? 475  SER B OG  1 
ATOM   8249 N N   . ILE B  1 477 ? 5.478   -4.740  23.594  1.00 15.95 ? 476  ILE B N   1 
ATOM   8250 C CA  . ILE B  1 477 ? 5.842   -4.200  24.897  1.00 17.35 ? 476  ILE B CA  1 
ATOM   8251 C C   . ILE B  1 477 ? 5.319   -2.775  24.928  1.00 17.49 ? 476  ILE B C   1 
ATOM   8252 O O   . ILE B  1 477 ? 5.785   -1.904  24.176  1.00 17.25 ? 476  ILE B O   1 
ATOM   8253 C CB  . ILE B  1 477 ? 7.379   -4.293  25.104  1.00 17.35 ? 476  ILE B CB  1 
ATOM   8254 C CG1 . ILE B  1 477 ? 7.820   -5.761  24.988  1.00 18.72 ? 476  ILE B CG1 1 
ATOM   8255 C CG2 . ILE B  1 477 ? 7.820   -3.647  26.452  1.00 18.94 ? 476  ILE B CG2 1 
ATOM   8256 C CD1 . ILE B  1 477 ? 9.332   -5.982  24.799  1.00 19.62 ? 476  ILE B CD1 1 
ATOM   8257 N N   . VAL B  1 478 ? 4.299   -2.558  25.756  1.00 17.22 ? 477  VAL B N   1 
ATOM   8258 C CA  . VAL B  1 478 ? 3.601   -1.278  25.830  1.00 17.41 ? 477  VAL B CA  1 
ATOM   8259 C C   . VAL B  1 478 ? 3.738   -0.738  27.252  1.00 18.05 ? 477  VAL B C   1 
ATOM   8260 O O   . VAL B  1 478 ? 3.594   -1.491  28.221  1.00 19.13 ? 477  VAL B O   1 
ATOM   8261 C CB  . VAL B  1 478 ? 2.096   -1.431  25.437  1.00 16.96 ? 477  VAL B CB  1 
ATOM   8262 C CG1 . VAL B  1 478 ? 1.388   -0.095  25.352  1.00 17.15 ? 477  VAL B CG1 1 
ATOM   8263 C CG2 . VAL B  1 478 ? 1.952   -2.189  24.114  1.00 17.46 ? 477  VAL B CG2 1 
ATOM   8264 N N   . PHE B  1 479 ? 4.001   0.562   27.370  1.00 18.17 ? 478  PHE B N   1 
ATOM   8265 C CA  . PHE B  1 479 ? 4.234   1.181   28.668  1.00 18.45 ? 478  PHE B CA  1 
ATOM   8266 C C   . PHE B  1 479 ? 3.548   2.539   28.774  1.00 18.99 ? 478  PHE B C   1 
ATOM   8267 O O   . PHE B  1 479 ? 3.323   3.213   27.769  1.00 18.05 ? 478  PHE B O   1 
ATOM   8268 C CB  . PHE B  1 479 ? 5.747   1.255   28.965  1.00 18.79 ? 478  PHE B CB  1 
ATOM   8269 C CG  . PHE B  1 479 ? 6.597   1.524   27.742  1.00 18.48 ? 478  PHE B CG  1 
ATOM   8270 C CD1 . PHE B  1 479 ? 6.971   2.826   27.408  1.00 17.49 ? 478  PHE B CD1 1 
ATOM   8271 C CD2 . PHE B  1 479 ? 7.031   0.467   26.940  1.00 18.41 ? 478  PHE B CD2 1 
ATOM   8272 C CE1 . PHE B  1 479 ? 7.754   3.065   26.266  1.00 19.76 ? 478  PHE B CE1 1 
ATOM   8273 C CE2 . PHE B  1 479 ? 7.817   0.700   25.806  1.00 18.60 ? 478  PHE B CE2 1 
ATOM   8274 C CZ  . PHE B  1 479 ? 8.167   1.990   25.472  1.00 18.65 ? 478  PHE B CZ  1 
ATOM   8275 N N   . THR B  1 480 ? 3.214   2.962   29.991  1.00 18.96 ? 479  THR B N   1 
ATOM   8276 C CA  . THR B  1 480 ? 2.421   4.181   30.175  1.00 18.91 ? 479  THR B CA  1 
ATOM   8277 C C   . THR B  1 480 ? 2.984   5.416   29.441  1.00 17.89 ? 479  THR B C   1 
ATOM   8278 O O   . THR B  1 480 ? 2.263   6.134   28.732  1.00 18.08 ? 479  THR B O   1 
ATOM   8279 C CB  . THR B  1 480 ? 2.248   4.463   31.686  1.00 19.50 ? 479  THR B CB  1 
ATOM   8280 O OG1 . THR B  1 480 ? 1.621   3.322   32.293  1.00 20.47 ? 479  THR B OG1 1 
ATOM   8281 C CG2 . THR B  1 480 ? 1.250   5.605   31.899  1.00 20.27 ? 479  THR B CG2 1 
ATOM   8282 N N   . LYS B  1 481 ? 4.276   5.647   29.624  1.00 18.05 ? 480  LYS B N   1 
ATOM   8283 C CA  . LYS B  1 481 ? 4.948   6.818   29.073  1.00 18.71 ? 480  LYS B CA  1 
ATOM   8284 C C   . LYS B  1 481 ? 6.442   6.538   29.144  1.00 18.45 ? 480  LYS B C   1 
ATOM   8285 O O   . LYS B  1 481 ? 6.905   5.843   30.051  1.00 19.03 ? 480  LYS B O   1 
ATOM   8286 C CB  . LYS B  1 481 ? 4.621   8.069   29.915  1.00 18.27 ? 480  LYS B CB  1 
ATOM   8287 C CG  . LYS B  1 481 ? 5.019   9.398   29.280  1.00 20.31 ? 480  LYS B CG  1 
ATOM   8288 C CD  . LYS B  1 481 ? 4.375   10.612  29.966  1.00 23.17 ? 480  LYS B CD  1 
ATOM   8289 C CE  . LYS B  1 481 ? 4.572   11.872  29.120  1.00 24.49 ? 480  LYS B CE  1 
ATOM   8290 N NZ  . LYS B  1 481 ? 3.955   13.097  29.747  1.00 25.55 ? 480  LYS B NZ  1 
ATOM   8291 N N   . LEU B  1 482 ? 7.197   7.067   28.188  1.00 18.31 ? 481  LEU B N   1 
ATOM   8292 C CA  . LEU B  1 482 ? 8.647   6.910   28.241  1.00 18.74 ? 481  LEU B CA  1 
ATOM   8293 C C   . LEU B  1 482 ? 9.292   8.012   29.099  1.00 18.62 ? 481  LEU B C   1 
ATOM   8294 O O   . LEU B  1 482 ? 9.804   9.017   28.605  1.00 19.16 ? 481  LEU B O   1 
ATOM   8295 C CB  . LEU B  1 482 ? 9.264   6.808   26.845  1.00 18.66 ? 481  LEU B CB  1 
ATOM   8296 C CG  . LEU B  1 482 ? 10.750  6.414   26.853  1.00 19.41 ? 481  LEU B CG  1 
ATOM   8297 C CD1 . LEU B  1 482 ? 10.983  4.948   27.276  1.00 20.24 ? 481  LEU B CD1 1 
ATOM   8298 C CD2 . LEU B  1 482 ? 11.368  6.704   25.487  1.00 21.17 ? 481  LEU B CD2 1 
ATOM   8299 N N   . THR B  1 483 ? 9.219   7.795   30.409  1.00 18.64 ? 482  THR B N   1 
ATOM   8300 C CA  . THR B  1 483 ? 9.852   8.646   31.410  1.00 18.45 ? 482  THR B CA  1 
ATOM   8301 C C   . THR B  1 483 ? 11.251  8.099   31.675  1.00 18.39 ? 482  THR B C   1 
ATOM   8302 O O   . THR B  1 483 ? 11.560  6.967   31.284  1.00 18.52 ? 482  THR B O   1 
ATOM   8303 C CB  . THR B  1 483 ? 9.042   8.565   32.733  1.00 18.34 ? 482  THR B CB  1 
ATOM   8304 O OG1 . THR B  1 483 ? 9.006   7.200   33.181  1.00 18.78 ? 482  THR B OG1 1 
ATOM   8305 C CG2 . THR B  1 483 ? 7.574   8.945   32.506  1.00 19.75 ? 482  THR B CG2 1 
ATOM   8306 N N   . PRO B  1 484 ? 12.095  8.865   32.378  1.00 18.48 ? 483  PRO B N   1 
ATOM   8307 C CA  . PRO B  1 484 ? 13.389  8.343   32.826  1.00 18.30 ? 483  PRO B CA  1 
ATOM   8308 C C   . PRO B  1 484 ? 13.248  7.015   33.576  1.00 18.45 ? 483  PRO B C   1 
ATOM   8309 O O   . PRO B  1 484 ? 13.995  6.075   33.285  1.00 18.57 ? 483  PRO B O   1 
ATOM   8310 C CB  . PRO B  1 484 ? 13.914  9.461   33.742  1.00 17.97 ? 483  PRO B CB  1 
ATOM   8311 C CG  . PRO B  1 484 ? 13.319  10.690  33.187  1.00 17.42 ? 483  PRO B CG  1 
ATOM   8312 C CD  . PRO B  1 484 ? 11.904  10.276  32.777  1.00 18.54 ? 483  PRO B CD  1 
ATOM   8313 N N   . PHE B  1 485 ? 12.309  6.927   34.527  1.00 18.90 ? 484  PHE B N   1 
ATOM   8314 C CA  . PHE B  1 485 ? 12.106  5.710   35.309  1.00 19.04 ? 484  PHE B CA  1 
ATOM   8315 C C   . PHE B  1 485 ? 11.765  4.511   34.422  1.00 18.70 ? 484  PHE B C   1 
ATOM   8316 O O   . PHE B  1 485 ? 12.367  3.438   34.536  1.00 18.65 ? 484  PHE B O   1 
ATOM   8317 C CB  . PHE B  1 485 ? 10.988  5.921   36.343  1.00 19.97 ? 484  PHE B CB  1 
ATOM   8318 C CG  . PHE B  1 485 ? 10.727  4.727   37.230  1.00 19.98 ? 484  PHE B CG  1 
ATOM   8319 C CD1 . PHE B  1 485 ? 11.290  4.650   38.508  1.00 22.02 ? 484  PHE B CD1 1 
ATOM   8320 C CD2 . PHE B  1 485 ? 9.882   3.691   36.806  1.00 22.54 ? 484  PHE B CD2 1 
ATOM   8321 C CE1 . PHE B  1 485 ? 11.052  3.556   39.328  1.00 22.50 ? 484  PHE B CE1 1 
ATOM   8322 C CE2 . PHE B  1 485 ? 9.639   2.585   37.625  1.00 23.49 ? 484  PHE B CE2 1 
ATOM   8323 C CZ  . PHE B  1 485 ? 10.229  2.528   38.899  1.00 22.64 ? 484  PHE B CZ  1 
ATOM   8324 N N   . ILE B  1 486 ? 10.783  4.696   33.547  1.00 18.03 ? 485  ILE B N   1 
ATOM   8325 C CA  . ILE B  1 486 ? 10.333  3.594   32.685  1.00 17.90 ? 485  ILE B CA  1 
ATOM   8326 C C   . ILE B  1 486 ? 11.441  3.164   31.709  1.00 17.37 ? 485  ILE B C   1 
ATOM   8327 O O   . ILE B  1 486 ? 11.657  1.965   31.528  1.00 17.27 ? 485  ILE B O   1 
ATOM   8328 C CB  . ILE B  1 486 ? 9.008   3.941   31.958  1.00 18.14 ? 485  ILE B CB  1 
ATOM   8329 C CG1 . ILE B  1 486 ? 7.843   4.078   32.963  1.00 19.85 ? 485  ILE B CG1 1 
ATOM   8330 C CG2 . ILE B  1 486 ? 8.685   2.905   30.856  1.00 18.57 ? 485  ILE B CG2 1 
ATOM   8331 C CD1 . ILE B  1 486 ? 7.294   2.766   33.483  1.00 22.64 ? 485  ILE B CD1 1 
ATOM   8332 N N   . LEU B  1 487 ? 12.152  4.132   31.124  1.00 17.87 ? 486  LEU B N   1 
ATOM   8333 C CA  . LEU B  1 487 ? 13.326  3.805   30.297  1.00 17.88 ? 486  LEU B CA  1 
ATOM   8334 C C   . LEU B  1 487 ? 14.347  2.948   31.060  1.00 18.19 ? 486  LEU B C   1 
ATOM   8335 O O   . LEU B  1 487 ? 14.833  1.943   30.532  1.00 18.10 ? 486  LEU B O   1 
ATOM   8336 C CB  . LEU B  1 487 ? 13.976  5.069   29.694  1.00 18.44 ? 486  LEU B CB  1 
ATOM   8337 C CG  . LEU B  1 487 ? 15.209  4.811   28.808  1.00 19.45 ? 486  LEU B CG  1 
ATOM   8338 C CD1 . LEU B  1 487 ? 14.863  4.000   27.547  1.00 20.17 ? 486  LEU B CD1 1 
ATOM   8339 C CD2 . LEU B  1 487 ? 15.848  6.106   28.408  1.00 19.27 ? 486  LEU B CD2 1 
ATOM   8340 N N   . GLY B  1 488 ? 14.676  3.343   32.293  1.00 17.85 ? 487  GLY B N   1 
ATOM   8341 C CA  . GLY B  1 488 ? 15.577  2.550   33.114  1.00 17.88 ? 487  GLY B CA  1 
ATOM   8342 C C   . GLY B  1 488 ? 15.125  1.105   33.278  1.00 17.49 ? 487  GLY B C   1 
ATOM   8343 O O   . GLY B  1 488 ? 15.916  0.162   33.133  1.00 17.94 ? 487  GLY B O   1 
ATOM   8344 N N   . ALA B  1 489 ? 13.836  0.926   33.574  1.00 18.00 ? 488  ALA B N   1 
ATOM   8345 C CA  . ALA B  1 489 ? 13.243  -0.406  33.682  1.00 17.75 ? 488  ALA B CA  1 
ATOM   8346 C C   . ALA B  1 489 ? 13.381  -1.220  32.394  1.00 17.69 ? 488  ALA B C   1 
ATOM   8347 O O   . ALA B  1 489 ? 13.764  -2.382  32.430  1.00 18.12 ? 488  ALA B O   1 
ATOM   8348 C CB  . ALA B  1 489 ? 11.786  -0.302  34.104  1.00 17.92 ? 488  ALA B CB  1 
ATOM   8349 N N   . LEU B  1 490 ? 13.109  -0.584  31.258  1.00 17.45 ? 489  LEU B N   1 
ATOM   8350 C CA  . LEU B  1 490 ? 13.213  -1.258  29.971  1.00 17.30 ? 489  LEU B CA  1 
ATOM   8351 C C   . LEU B  1 490 ? 14.642  -1.706  29.639  1.00 16.56 ? 489  LEU B C   1 
ATOM   8352 O O   . LEU B  1 490 ? 14.843  -2.839  29.171  1.00 17.25 ? 489  LEU B O   1 
ATOM   8353 C CB  . LEU B  1 490 ? 12.654  -0.361  28.863  1.00 16.86 ? 489  LEU B CB  1 
ATOM   8354 C CG  . LEU B  1 490 ? 11.138  -0.114  28.874  1.00 18.21 ? 489  LEU B CG  1 
ATOM   8355 C CD1 . LEU B  1 490 ? 10.818  0.990   27.877  1.00 19.14 ? 489  LEU B CD1 1 
ATOM   8356 C CD2 . LEU B  1 490 ? 10.326  -1.367  28.557  1.00 18.02 ? 489  LEU B CD2 1 
ATOM   8357 N N   . ILE B  1 491 ? 15.626  -0.832  29.869  1.00 16.84 ? 490  ILE B N   1 
ATOM   8358 C CA  . ILE B  1 491 ? 17.021  -1.192  29.590  1.00 16.77 ? 490  ILE B CA  1 
ATOM   8359 C C   . ILE B  1 491 ? 17.440  -2.371  30.466  1.00 16.89 ? 490  ILE B C   1 
ATOM   8360 O O   . ILE B  1 491 ? 17.999  -3.358  29.975  1.00 16.64 ? 490  ILE B O   1 
ATOM   8361 C CB  . ILE B  1 491 ? 17.977  0.034   29.751  1.00 16.31 ? 490  ILE B CB  1 
ATOM   8362 C CG1 . ILE B  1 491 ? 17.573  1.154   28.785  1.00 17.51 ? 490  ILE B CG1 1 
ATOM   8363 C CG2 . ILE B  1 491 ? 19.437  -0.359  29.488  1.00 16.31 ? 490  ILE B CG2 1 
ATOM   8364 C CD1 . ILE B  1 491 ? 18.193  2.509   29.106  1.00 17.40 ? 490  ILE B CD1 1 
ATOM   8365 N N   . ALA B  1 492 ? 17.117  -2.291  31.761  1.00 17.48 ? 491  ALA B N   1 
ATOM   8366 C CA  . ALA B  1 492 ? 17.468  -3.374  32.681  1.00 17.82 ? 491  ALA B CA  1 
ATOM   8367 C C   . ALA B  1 492 ? 16.827  -4.708  32.307  1.00 17.69 ? 491  ALA B C   1 
ATOM   8368 O O   . ALA B  1 492 ? 17.434  -5.760  32.486  1.00 18.42 ? 491  ALA B O   1 
ATOM   8369 C CB  . ALA B  1 492 ? 17.111  -2.999  34.116  1.00 17.79 ? 491  ALA B CB  1 
ATOM   8370 N N   . MET B  1 493 ? 15.591  -4.654  31.811  1.00 17.99 ? 492  MET B N   1 
ATOM   8371 C CA  . MET B  1 493 ? 14.870  -5.842  31.376  1.00 17.78 ? 492  MET B CA  1 
ATOM   8372 C C   . MET B  1 493 ? 15.638  -6.579  30.295  1.00 17.39 ? 492  MET B C   1 
ATOM   8373 O O   . MET B  1 493 ? 15.788  -7.792  30.352  1.00 17.65 ? 492  MET B O   1 
ATOM   8374 C CB  . MET B  1 493 ? 13.480  -5.468  30.857  1.00 17.85 ? 492  MET B CB  1 
ATOM   8375 C CG  . MET B  1 493 ? 12.620  -6.678  30.498  1.00 18.00 ? 492  MET B CG  1 
ATOM   8376 S SD  . MET B  1 493 ? 10.934  -6.195  30.114  1.00 21.96 ? 492  MET B SD  1 
ATOM   8377 C CE  . MET B  1 493 ? 11.177  -5.350  28.533  1.00 21.49 ? 492  MET B CE  1 
ATOM   8378 N N   . TYR B  1 494 ? 16.145  -5.833  29.314  1.00 16.87 ? 493  TYR B N   1 
ATOM   8379 C CA  . TYR B  1 494 ? 16.894  -6.460  28.238  1.00 17.26 ? 493  TYR B CA  1 
ATOM   8380 C C   . TYR B  1 494 ? 18.276  -6.908  28.695  1.00 17.26 ? 493  TYR B C   1 
ATOM   8381 O O   . TYR B  1 494 ? 18.763  -7.931  28.227  1.00 17.07 ? 493  TYR B O   1 
ATOM   8382 C CB  . TYR B  1 494 ? 16.978  -5.530  27.022  1.00 17.24 ? 493  TYR B CB  1 
ATOM   8383 C CG  . TYR B  1 494 ? 15.766  -5.584  26.124  1.00 17.33 ? 493  TYR B CG  1 
ATOM   8384 C CD1 . TYR B  1 494 ? 14.823  -4.558  26.139  1.00 18.61 ? 493  TYR B CD1 1 
ATOM   8385 C CD2 . TYR B  1 494 ? 15.563  -6.650  25.256  1.00 18.15 ? 493  TYR B CD2 1 
ATOM   8386 C CE1 . TYR B  1 494 ? 13.701  -4.598  25.312  1.00 18.92 ? 493  TYR B CE1 1 
ATOM   8387 C CE2 . TYR B  1 494 ? 14.439  -6.705  24.414  1.00 18.57 ? 493  TYR B CE2 1 
ATOM   8388 C CZ  . TYR B  1 494 ? 13.511  -5.664  24.458  1.00 18.60 ? 493  TYR B CZ  1 
ATOM   8389 O OH  . TYR B  1 494 ? 12.407  -5.677  23.630  1.00 18.68 ? 493  TYR B OH  1 
ATOM   8390 N N   . GLU B  1 495 ? 18.903  -6.156  29.606  1.00 17.33 ? 494  GLU B N   1 
ATOM   8391 C CA  . GLU B  1 495 ? 20.152  -6.610  30.245  1.00 18.06 ? 494  GLU B CA  1 
ATOM   8392 C C   . GLU B  1 495 ? 19.962  -7.995  30.867  1.00 18.20 ? 494  GLU B C   1 
ATOM   8393 O O   . GLU B  1 495 ? 20.771  -8.905  30.651  1.00 18.33 ? 494  GLU B O   1 
ATOM   8394 C CB  . GLU B  1 495 ? 20.619  -5.630  31.333  1.00 18.16 ? 494  GLU B CB  1 
ATOM   8395 C CG  . GLU B  1 495 ? 21.151  -4.313  30.790  1.00 18.95 ? 494  GLU B CG  1 
ATOM   8396 C CD  . GLU B  1 495 ? 21.632  -3.347  31.855  1.00 20.32 ? 494  GLU B CD  1 
ATOM   8397 O OE1 . GLU B  1 495 ? 21.161  -3.407  33.024  1.00 22.92 ? 494  GLU B OE1 1 
ATOM   8398 O OE2 . GLU B  1 495 ? 22.465  -2.491  31.515  1.00 18.75 ? 494  GLU B OE2 1 
ATOM   8399 N N   . HIS B  1 496 ? 18.884  -8.167  31.622  1.00 18.39 ? 495  HIS B N   1 
ATOM   8400 C CA  . HIS B  1 496 ? 18.664  -9.463  32.261  1.00 18.53 ? 495  HIS B CA  1 
ATOM   8401 C C   . HIS B  1 496 ? 18.234  -10.582 31.300  1.00 18.38 ? 495  HIS B C   1 
ATOM   8402 O O   . HIS B  1 496 ? 18.600  -11.733 31.500  1.00 19.13 ? 495  HIS B O   1 
ATOM   8403 C CB  . HIS B  1 496 ? 17.739  -9.318  33.466  1.00 18.56 ? 495  HIS B CB  1 
ATOM   8404 C CG  . HIS B  1 496 ? 18.328  -8.471  34.552  1.00 18.56 ? 495  HIS B CG  1 
ATOM   8405 N ND1 . HIS B  1 496 ? 19.667  -8.516  34.886  1.00 19.85 ? 495  HIS B ND1 1 
ATOM   8406 C CD2 . HIS B  1 496 ? 17.767  -7.542  35.359  1.00 20.29 ? 495  HIS B CD2 1 
ATOM   8407 C CE1 . HIS B  1 496 ? 19.900  -7.655  35.861  1.00 20.88 ? 495  HIS B CE1 1 
ATOM   8408 N NE2 . HIS B  1 496 ? 18.762  -7.060  36.171  1.00 19.32 ? 495  HIS B NE2 1 
ATOM   8409 N N   . LYS B  1 497 ? 17.508  -10.246 30.221  1.00 17.50 ? 496  LYS B N   1 
ATOM   8410 C CA  . LYS B  1 497 ? 17.248  -11.213 29.152  1.00 17.24 ? 496  LYS B CA  1 
ATOM   8411 C C   . LYS B  1 497 ? 18.560  -11.778 28.591  1.00 16.92 ? 496  LYS B C   1 
ATOM   8412 O O   . LYS B  1 497 ? 18.697  -12.990 28.407  1.00 16.60 ? 496  LYS B O   1 
ATOM   8413 C CB  . LYS B  1 497 ? 16.459  -10.539 28.010  1.00 16.95 ? 496  LYS B CB  1 
ATOM   8414 C CG  . LYS B  1 497 ? 16.235  -11.470 26.805  1.00 17.58 ? 496  LYS B CG  1 
ATOM   8415 C CD  . LYS B  1 497 ? 15.900  -10.699 25.510  1.00 17.72 ? 496  LYS B CD  1 
ATOM   8416 C CE  . LYS B  1 497 ? 15.803  -11.669 24.324  1.00 19.43 ? 496  LYS B CE  1 
ATOM   8417 N NZ  . LYS B  1 497 ? 15.609  -10.973 22.985  1.00 18.50 ? 496  LYS B NZ  1 
ATOM   8418 N N   . ILE B  1 498 ? 19.511  -10.890 28.313  1.00 17.31 ? 497  ILE B N   1 
ATOM   8419 C CA  . ILE B  1 498 ? 20.811  -11.264 27.780  1.00 18.10 ? 497  ILE B CA  1 
ATOM   8420 C C   . ILE B  1 498 ? 21.545  -12.194 28.739  1.00 18.74 ? 497  ILE B C   1 
ATOM   8421 O O   . ILE B  1 498 ? 22.115  -13.204 28.315  1.00 18.80 ? 497  ILE B O   1 
ATOM   8422 C CB  . ILE B  1 498 ? 21.635  -9.982  27.472  1.00 18.00 ? 497  ILE B CB  1 
ATOM   8423 C CG1 . ILE B  1 498 ? 21.052  -9.318  26.211  1.00 17.86 ? 497  ILE B CG1 1 
ATOM   8424 C CG2 . ILE B  1 498 ? 23.128  -10.293 27.281  1.00 19.44 ? 497  ILE B CG2 1 
ATOM   8425 C CD1 . ILE B  1 498 ? 21.296  -7.828  26.114  1.00 19.66 ? 497  ILE B CD1 1 
ATOM   8426 N N   . PHE B  1 499 ? 21.486  -11.848 30.023  1.00 18.72 ? 498  PHE B N   1 
ATOM   8427 C CA  . PHE B  1 499 ? 22.134  -12.639 31.071  1.00 19.74 ? 498  PHE B CA  1 
ATOM   8428 C C   . PHE B  1 499 ? 21.580  -14.066 31.096  1.00 19.26 ? 498  PHE B C   1 
ATOM   8429 O O   . PHE B  1 499 ? 22.345  -15.039 31.122  1.00 19.43 ? 498  PHE B O   1 
ATOM   8430 C CB  . PHE B  1 499 ? 21.949  -11.963 32.433  1.00 19.52 ? 498  PHE B CB  1 
ATOM   8431 C CG  . PHE B  1 499 ? 22.325  -12.844 33.605  1.00 21.76 ? 498  PHE B CG  1 
ATOM   8432 C CD1 . PHE B  1 499 ? 23.651  -13.000 33.962  1.00 23.00 ? 498  PHE B CD1 1 
ATOM   8433 C CD2 . PHE B  1 499 ? 21.348  -13.534 34.314  1.00 25.43 ? 498  PHE B CD2 1 
ATOM   8434 C CE1 . PHE B  1 499 ? 24.014  -13.826 35.042  1.00 24.70 ? 498  PHE B CE1 1 
ATOM   8435 C CE2 . PHE B  1 499 ? 21.697  -14.366 35.388  1.00 26.09 ? 498  PHE B CE2 1 
ATOM   8436 C CZ  . PHE B  1 499 ? 23.039  -14.495 35.747  1.00 25.85 ? 498  PHE B CZ  1 
ATOM   8437 N N   . VAL B  1 500 ? 20.256  -14.194 31.075  1.00 19.16 ? 499  VAL B N   1 
ATOM   8438 C CA  . VAL B  1 500 ? 19.615  -15.513 31.112  1.00 18.99 ? 499  VAL B CA  1 
ATOM   8439 C C   . VAL B  1 500 ? 20.021  -16.383 29.918  1.00 19.07 ? 499  VAL B C   1 
ATOM   8440 O O   . VAL B  1 500 ? 20.390  -17.543 30.085  1.00 18.95 ? 499  VAL B O   1 
ATOM   8441 C CB  . VAL B  1 500 ? 18.086  -15.412 31.246  1.00 19.15 ? 499  VAL B CB  1 
ATOM   8442 C CG1 . VAL B  1 500 ? 17.434  -16.776 31.090  1.00 17.68 ? 499  VAL B CG1 1 
ATOM   8443 C CG2 . VAL B  1 500 ? 17.721  -14.771 32.595  1.00 20.14 ? 499  VAL B CG2 1 
ATOM   8444 N N   . GLN B  1 501 ? 19.991  -15.819 28.707  1.00 18.71 ? 500  GLN B N   1 
ATOM   8445 C CA  . GLN B  1 501 ? 20.413  -16.581 27.534  1.00 18.21 ? 500  GLN B CA  1 
ATOM   8446 C C   . GLN B  1 501 ? 21.862  -17.078 27.623  1.00 17.93 ? 500  GLN B C   1 
ATOM   8447 O O   . GLN B  1 501 ? 22.153  -18.228 27.276  1.00 18.19 ? 500  GLN B O   1 
ATOM   8448 C CB  . GLN B  1 501 ? 20.170  -15.772 26.239  1.00 18.50 ? 500  GLN B CB  1 
ATOM   8449 C CG  . GLN B  1 501 ? 18.721  -15.394 26.074  1.00 18.14 ? 500  GLN B CG  1 
ATOM   8450 C CD  . GLN B  1 501 ? 18.430  -14.694 24.747  1.00 18.86 ? 500  GLN B CD  1 
ATOM   8451 O OE1 . GLN B  1 501 ? 19.194  -13.838 24.316  1.00 19.48 ? 500  GLN B OE1 1 
ATOM   8452 N NE2 . GLN B  1 501 ? 17.314  -15.035 24.133  1.00 18.19 ? 500  GLN B NE2 1 
ATOM   8453 N N   . GLY B  1 502 ? 22.760  -16.211 28.089  1.00 18.10 ? 501  GLY B N   1 
ATOM   8454 C CA  . GLY B  1 502 ? 24.163  -16.551 28.240  1.00 18.28 ? 501  GLY B CA  1 
ATOM   8455 C C   . GLY B  1 502 ? 24.340  -17.748 29.164  1.00 18.67 ? 501  GLY B C   1 
ATOM   8456 O O   . GLY B  1 502 ? 25.098  -18.674 28.839  1.00 18.96 ? 501  GLY B O   1 
ATOM   8457 N N   . ILE B  1 503 ? 23.644  -17.729 30.305  1.00 19.34 ? 502  ILE B N   1 
ATOM   8458 C CA  . ILE B  1 503 ? 23.707  -18.857 31.262  1.00 19.92 ? 502  ILE B CA  1 
ATOM   8459 C C   . ILE B  1 503 ? 23.245  -20.159 30.613  1.00 20.42 ? 502  ILE B C   1 
ATOM   8460 O O   . ILE B  1 503 ? 23.902  -21.206 30.741  1.00 20.96 ? 502  ILE B O   1 
ATOM   8461 C CB  . ILE B  1 503 ? 22.908  -18.558 32.597  1.00 19.73 ? 502  ILE B CB  1 
ATOM   8462 C CG1 . ILE B  1 503 ? 23.500  -17.362 33.357  1.00 19.89 ? 502  ILE B CG1 1 
ATOM   8463 C CG2 . ILE B  1 503 ? 22.842  -19.824 33.514  1.00 19.93 ? 502  ILE B CG2 1 
ATOM   8464 C CD1 . ILE B  1 503 ? 25.028  -17.439 33.619  1.00 22.59 ? 502  ILE B CD1 1 
ATOM   8465 N N   . MET B  1 504 ? 22.128  -20.098 29.891  1.00 20.26 ? 503  MET B N   1 
ATOM   8466 C CA  . MET B  1 504 ? 21.578  -21.274 29.243  1.00 21.01 ? 503  MET B CA  1 
ATOM   8467 C C   . MET B  1 504 ? 22.498  -21.839 28.151  1.00 21.02 ? 503  MET B C   1 
ATOM   8468 O O   . MET B  1 504 ? 22.604  -23.059 27.988  1.00 20.85 ? 503  MET B O   1 
ATOM   8469 C CB  . MET B  1 504 ? 20.155  -21.008 28.750  1.00 21.08 ? 503  MET B CB  1 
ATOM   8470 C CG  . MET B  1 504 ? 19.176  -20.742 29.904  1.00 23.07 ? 503  MET B CG  1 
ATOM   8471 S SD  . MET B  1 504 ? 17.530  -20.249 29.402  1.00 24.53 ? 503  MET B SD  1 
ATOM   8472 C CE  . MET B  1 504 ? 16.904  -21.761 28.734  1.00 25.81 ? 503  MET B CE  1 
ATOM   8473 N N   . TRP B  1 505 ? 23.203  -20.958 27.443  1.00 20.91 ? 504  TRP B N   1 
ATOM   8474 C CA  . TRP B  1 505 ? 24.201  -21.393 26.468  1.00 21.18 ? 504  TRP B CA  1 
ATOM   8475 C C   . TRP B  1 505 ? 25.536  -21.827 27.099  1.00 21.28 ? 504  TRP B C   1 
ATOM   8476 O O   . TRP B  1 505 ? 26.408  -22.344 26.397  1.00 21.98 ? 504  TRP B O   1 
ATOM   8477 C CB  . TRP B  1 505 ? 24.449  -20.308 25.401  1.00 20.70 ? 504  TRP B CB  1 
ATOM   8478 C CG  . TRP B  1 505 ? 23.286  -20.104 24.462  1.00 19.70 ? 504  TRP B CG  1 
ATOM   8479 C CD1 . TRP B  1 505 ? 22.478  -21.061 23.932  1.00 20.01 ? 504  TRP B CD1 1 
ATOM   8480 C CD2 . TRP B  1 505 ? 22.783  -18.844 23.973  1.00 19.06 ? 504  TRP B CD2 1 
ATOM   8481 N NE1 . TRP B  1 505 ? 21.515  -20.487 23.135  1.00 19.93 ? 504  TRP B NE1 1 
ATOM   8482 C CE2 . TRP B  1 505 ? 21.677  -19.127 23.143  1.00 19.06 ? 504  TRP B CE2 1 
ATOM   8483 C CE3 . TRP B  1 505 ? 23.168  -17.507 24.146  1.00 18.98 ? 504  TRP B CE3 1 
ATOM   8484 C CZ2 . TRP B  1 505 ? 20.938  -18.117 22.488  1.00 18.19 ? 504  TRP B CZ2 1 
ATOM   8485 C CZ3 . TRP B  1 505 ? 22.440  -16.498 23.507  1.00 18.14 ? 504  TRP B CZ3 1 
ATOM   8486 C CH2 . TRP B  1 505 ? 21.350  -16.812 22.669  1.00 18.03 ? 504  TRP B CH2 1 
ATOM   8487 N N   . ASP B  1 506 ? 25.701  -21.606 28.402  1.00 22.40 ? 505  ASP B N   1 
ATOM   8488 C CA  . ASP B  1 506 ? 26.941  -21.962 29.124  1.00 22.72 ? 505  ASP B CA  1 
ATOM   8489 C C   . ASP B  1 506 ? 28.138  -21.090 28.702  1.00 22.55 ? 505  ASP B C   1 
ATOM   8490 O O   . ASP B  1 506 ? 29.294  -21.530 28.761  1.00 23.16 ? 505  ASP B O   1 
ATOM   8491 C CB  . ASP B  1 506 ? 27.271  -23.462 28.945  1.00 22.98 ? 505  ASP B CB  1 
ATOM   8492 C CG  . ASP B  1 506 ? 27.958  -24.081 30.175  1.00 24.88 ? 505  ASP B CG  1 
ATOM   8493 O OD1 . ASP B  1 506 ? 27.532  -23.811 31.317  1.00 26.91 ? 505  ASP B OD1 1 
ATOM   8494 O OD2 . ASP B  1 506 ? 28.937  -24.855 30.092  1.00 25.52 ? 505  ASP B OD2 1 
ATOM   8495 N N   . ILE B  1 507 ? 27.866  -19.852 28.280  1.00 22.23 ? 506  ILE B N   1 
ATOM   8496 C CA  . ILE B  1 507 ? 28.926  -18.947 27.832  1.00 22.38 ? 506  ILE B CA  1 
ATOM   8497 C C   . ILE B  1 507 ? 29.110  -17.795 28.803  1.00 21.82 ? 506  ILE B C   1 
ATOM   8498 O O   . ILE B  1 507 ? 28.315  -17.631 29.732  1.00 22.72 ? 506  ILE B O   1 
ATOM   8499 C CB  . ILE B  1 507 ? 28.640  -18.407 26.402  1.00 22.70 ? 506  ILE B CB  1 
ATOM   8500 C CG1 . ILE B  1 507 ? 27.258  -17.743 26.359  1.00 23.14 ? 506  ILE B CG1 1 
ATOM   8501 C CG2 . ILE B  1 507 ? 28.766  -19.521 25.368  1.00 22.66 ? 506  ILE B CG2 1 
ATOM   8502 C CD1 . ILE B  1 507 ? 27.116  -16.606 25.374  1.00 26.82 ? 506  ILE B CD1 1 
ATOM   8503 N N   . ASN B  1 508 ? 30.160  -17.009 28.590  1.00 21.14 ? 507  ASN B N   1 
ATOM   8504 C CA  . ASN B  1 508 ? 30.433  -15.845 29.412  1.00 20.12 ? 507  ASN B CA  1 
ATOM   8505 C C   . ASN B  1 508 ? 29.905  -14.587 28.732  1.00 20.21 ? 507  ASN B C   1 
ATOM   8506 O O   . ASN B  1 508 ? 30.494  -14.112 27.757  1.00 20.45 ? 507  ASN B O   1 
ATOM   8507 C CB  . ASN B  1 508 ? 31.940  -15.715 29.651  1.00 20.08 ? 507  ASN B CB  1 
ATOM   8508 C CG  . ASN B  1 508 ? 32.286  -14.674 30.698  1.00 20.37 ? 507  ASN B CG  1 
ATOM   8509 O OD1 . ASN B  1 508 ? 31.413  -13.960 31.237  1.00 22.37 ? 507  ASN B OD1 1 
ATOM   8510 N ND2 . ASN B  1 508 ? 33.583  -14.570 30.996  1.00 22.33 ? 507  ASN B ND2 1 
ATOM   8511 N N   . SER B  1 509 ? 28.798  -14.062 29.248  1.00 19.65 ? 508  SER B N   1 
ATOM   8512 C CA  . SER B  1 509 ? 28.190  -12.847 28.695  1.00 19.61 ? 508  SER B CA  1 
ATOM   8513 C C   . SER B  1 509 ? 29.005  -11.572 28.946  1.00 19.76 ? 508  SER B C   1 
ATOM   8514 O O   . SER B  1 509 ? 28.656  -10.483 28.445  1.00 19.37 ? 508  SER B O   1 
ATOM   8515 C CB  . SER B  1 509 ? 26.771  -12.666 29.250  1.00 19.38 ? 508  SER B CB  1 
ATOM   8516 O OG  . SER B  1 509 ? 25.923  -13.713 28.838  1.00 19.42 ? 508  SER B OG  1 
ATOM   8517 N N   . PHE B  1 510 ? 30.094  -11.679 29.715  1.00 19.57 ? 509  PHE B N   1 
ATOM   8518 C CA  . PHE B  1 510 ? 30.710  -10.488 30.289  1.00 20.02 ? 509  PHE B CA  1 
ATOM   8519 C C   . PHE B  1 510 ? 32.147  -10.186 29.893  1.00 19.46 ? 509  PHE B C   1 
ATOM   8520 O O   . PHE B  1 510 ? 32.674  -9.155  30.280  1.00 20.20 ? 509  PHE B O   1 
ATOM   8521 C CB  . PHE B  1 510 ? 30.512  -10.493 31.808  1.00 20.39 ? 509  PHE B CB  1 
ATOM   8522 C CG  . PHE B  1 510 ? 29.067  -10.598 32.197  1.00 20.28 ? 509  PHE B CG  1 
ATOM   8523 C CD1 . PHE B  1 510 ? 28.534  -11.798 32.660  1.00 20.00 ? 509  PHE B CD1 1 
ATOM   8524 C CD2 . PHE B  1 510 ? 28.218  -9.513  32.018  1.00 20.14 ? 509  PHE B CD2 1 
ATOM   8525 C CE1 . PHE B  1 510 ? 27.177  -11.899 32.981  1.00 20.34 ? 509  PHE B CE1 1 
ATOM   8526 C CE2 . PHE B  1 510 ? 26.863  -9.602  32.340  1.00 20.87 ? 509  PHE B CE2 1 
ATOM   8527 C CZ  . PHE B  1 510 ? 26.342  -10.800 32.823  1.00 20.19 ? 509  PHE B CZ  1 
ATOM   8528 N N   . ASP B  1 511 ? 32.747  -11.063 29.091  1.00 19.74 ? 510  ASP B N   1 
ATOM   8529 C CA  . ASP B  1 511 ? 34.051  -10.776 28.486  1.00 20.09 ? 510  ASP B CA  1 
ATOM   8530 C C   . ASP B  1 511 ? 33.916  -10.353 27.007  1.00 20.28 ? 510  ASP B C   1 
ATOM   8531 O O   . ASP B  1 511 ? 32.802  -10.230 26.493  1.00 19.95 ? 510  ASP B O   1 
ATOM   8532 C CB  . ASP B  1 511 ? 35.024  -11.967 28.684  1.00 20.63 ? 510  ASP B CB  1 
ATOM   8533 C CG  . ASP B  1 511 ? 34.552  -13.259 28.011  1.00 21.78 ? 510  ASP B CG  1 
ATOM   8534 O OD1 . ASP B  1 511 ? 33.633  -13.220 27.153  1.00 21.73 ? 510  ASP B OD1 1 
ATOM   8535 O OD2 . ASP B  1 511 ? 35.073  -14.371 28.258  1.00 22.09 ? 510  ASP B OD2 1 
ATOM   8536 N N   . GLN B  1 512 ? 35.042  -10.099 26.342  1.00 20.25 ? 511  GLN B N   1 
ATOM   8537 C CA  . GLN B  1 512 ? 35.045  -9.712  24.920  1.00 20.34 ? 511  GLN B CA  1 
ATOM   8538 C C   . GLN B  1 512 ? 36.416  -9.961  24.284  1.00 20.39 ? 511  GLN B C   1 
ATOM   8539 O O   . GLN B  1 512 ? 37.069  -9.032  23.793  1.00 20.31 ? 511  GLN B O   1 
ATOM   8540 C CB  . GLN B  1 512 ? 34.574  -8.258  24.721  1.00 20.28 ? 511  GLN B CB  1 
ATOM   8541 C CG  . GLN B  1 512 ? 35.349  -7.179  25.486  1.00 20.50 ? 511  GLN B CG  1 
ATOM   8542 C CD  . GLN B  1 512 ? 35.031  -7.135  26.980  1.00 23.87 ? 511  GLN B CD  1 
ATOM   8543 O OE1 . GLN B  1 512 ? 33.871  -7.275  27.383  1.00 22.80 ? 511  GLN B OE1 1 
ATOM   8544 N NE2 . GLN B  1 512 ? 36.068  -6.949  27.802  1.00 24.89 ? 511  GLN B NE2 1 
ATOM   8545 N N   . TRP B  1 513 ? 36.850  -11.218 24.323  1.00 20.88 ? 512  TRP B N   1 
ATOM   8546 C CA  . TRP B  1 513 ? 38.168  -11.599 23.814  1.00 21.56 ? 512  TRP B CA  1 
ATOM   8547 C C   . TRP B  1 513 ? 38.230  -11.493 22.295  1.00 21.73 ? 512  TRP B C   1 
ATOM   8548 O O   . TRP B  1 513 ? 39.317  -11.450 21.717  1.00 22.39 ? 512  TRP B O   1 
ATOM   8549 C CB  . TRP B  1 513 ? 38.531  -13.026 24.256  1.00 21.77 ? 512  TRP B CB  1 
ATOM   8550 C CG  . TRP B  1 513 ? 38.713  -13.128 25.744  1.00 23.73 ? 512  TRP B CG  1 
ATOM   8551 C CD1 . TRP B  1 513 ? 37.927  -13.811 26.619  1.00 24.89 ? 512  TRP B CD1 1 
ATOM   8552 C CD2 . TRP B  1 513 ? 39.744  -12.511 26.524  1.00 25.19 ? 512  TRP B CD2 1 
ATOM   8553 N NE1 . TRP B  1 513 ? 38.405  -13.663 27.901  1.00 24.96 ? 512  TRP B NE1 1 
ATOM   8554 C CE2 . TRP B  1 513 ? 39.517  -12.864 27.872  1.00 26.12 ? 512  TRP B CE2 1 
ATOM   8555 C CE3 . TRP B  1 513 ? 40.840  -11.686 26.221  1.00 26.76 ? 512  TRP B CE3 1 
ATOM   8556 C CZ2 . TRP B  1 513 ? 40.353  -12.431 28.919  1.00 27.90 ? 512  TRP B CZ2 1 
ATOM   8557 C CZ3 . TRP B  1 513 ? 41.674  -11.254 27.263  1.00 28.42 ? 512  TRP B CZ3 1 
ATOM   8558 C CH2 . TRP B  1 513 ? 41.420  -11.630 28.591  1.00 28.56 ? 512  TRP B CH2 1 
ATOM   8559 N N   . GLY B  1 514 ? 37.060  -11.407 21.664  1.00 21.46 ? 513  GLY B N   1 
ATOM   8560 C CA  . GLY B  1 514 ? 36.978  -11.379 20.207  1.00 21.28 ? 513  GLY B CA  1 
ATOM   8561 C C   . GLY B  1 514 ? 37.334  -10.058 19.544  1.00 22.03 ? 513  GLY B C   1 
ATOM   8562 O O   . GLY B  1 514 ? 37.412  -9.989  18.317  1.00 22.81 ? 513  GLY B O   1 
ATOM   8563 N N   . VAL B  1 515 ? 37.543  -9.006  20.326  1.00 22.37 ? 514  VAL B N   1 
ATOM   8564 C CA  . VAL B  1 515 ? 37.966  -7.732  19.742  1.00 23.23 ? 514  VAL B CA  1 
ATOM   8565 C C   . VAL B  1 515 ? 39.493  -7.613  19.664  1.00 22.98 ? 514  VAL B C   1 
ATOM   8566 O O   . VAL B  1 515 ? 40.010  -6.665  19.081  1.00 22.99 ? 514  VAL B O   1 
ATOM   8567 C CB  . VAL B  1 515 ? 37.370  -6.497  20.481  1.00 24.02 ? 514  VAL B CB  1 
ATOM   8568 C CG1 . VAL B  1 515 ? 35.838  -6.582  20.541  1.00 24.65 ? 514  VAL B CG1 1 
ATOM   8569 C CG2 . VAL B  1 515 ? 37.966  -6.350  21.879  1.00 24.88 ? 514  VAL B CG2 1 
ATOM   8570 N N   . GLU B  1 516 ? 40.214  -8.578  20.242  1.00 22.76 ? 515  GLU B N   1 
ATOM   8571 C CA  . GLU B  1 516 ? 41.668  -8.450  20.397  1.00 22.82 ? 515  GLU B CA  1 
ATOM   8572 C C   . GLU B  1 516 ? 42.457  -8.561  19.084  1.00 22.36 ? 515  GLU B C   1 
ATOM   8573 O O   . GLU B  1 516 ? 43.365  -7.759  18.857  1.00 22.75 ? 515  GLU B O   1 
ATOM   8574 C CB  A GLU B  1 516 ? 42.192  -9.418  21.466  0.20 22.67 ? 515  GLU B CB  1 
ATOM   8575 C CB  B GLU B  1 516 ? 42.195  -9.470  21.430  0.80 23.06 ? 515  GLU B CB  1 
ATOM   8576 C CG  A GLU B  1 516 ? 42.256  -8.825  22.872  0.20 22.81 ? 515  GLU B CG  1 
ATOM   8577 C CG  B GLU B  1 516 ? 43.684  -9.375  21.735  0.80 25.87 ? 515  GLU B CG  1 
ATOM   8578 C CD  A GLU B  1 516 ? 41.101  -7.886  23.194  0.20 23.17 ? 515  GLU B CD  1 
ATOM   8579 C CD  B GLU B  1 516 ? 44.055  -9.850  23.137  0.80 28.61 ? 515  GLU B CD  1 
ATOM   8580 O OE1 A GLU B  1 516 ? 41.267  -6.655  23.034  0.20 23.51 ? 515  GLU B OE1 1 
ATOM   8581 O OE1 B GLU B  1 516 ? 45.014  -9.284  23.707  0.80 30.40 ? 515  GLU B OE1 1 
ATOM   8582 O OE2 A GLU B  1 516 ? 40.026  -8.375  23.608  0.20 23.36 ? 515  GLU B OE2 1 
ATOM   8583 O OE2 B GLU B  1 516 ? 43.404  -10.777 23.670  0.80 28.79 ? 515  GLU B OE2 1 
ATOM   8584 N N   . LEU B  1 517 ? 42.098  -9.516  18.223  1.00 22.04 ? 516  LEU B N   1 
ATOM   8585 C CA  . LEU B  1 517 ? 42.855  -9.770  16.990  1.00 21.44 ? 516  LEU B CA  1 
ATOM   8586 C C   . LEU B  1 517 ? 42.877  -8.574  16.035  1.00 22.13 ? 516  LEU B C   1 
ATOM   8587 O O   . LEU B  1 517 ? 43.932  -8.221  15.490  1.00 22.04 ? 516  LEU B O   1 
ATOM   8588 C CB  . LEU B  1 517 ? 42.355  -11.033 16.265  1.00 21.56 ? 516  LEU B CB  1 
ATOM   8589 C CG  . LEU B  1 517 ? 43.101  -11.458 14.989  1.00 19.79 ? 516  LEU B CG  1 
ATOM   8590 C CD1 . LEU B  1 517 ? 44.606  -11.684 15.273  1.00 20.37 ? 516  LEU B CD1 1 
ATOM   8591 C CD2 . LEU B  1 517 ? 42.462  -12.706 14.357  1.00 19.66 ? 516  LEU B CD2 1 
ATOM   8592 N N   . GLY B  1 518 ? 41.725  -7.933  15.853  1.00 21.62 ? 517  GLY B N   1 
ATOM   8593 C CA  . GLY B  1 518 ? 41.668  -6.770  14.976  1.00 22.22 ? 517  GLY B CA  1 
ATOM   8594 C C   . GLY B  1 518 ? 42.517  -5.629  15.507  1.00 22.53 ? 517  GLY B C   1 
ATOM   8595 O O   . GLY B  1 518 ? 43.110  -4.877  14.727  1.00 22.68 ? 517  GLY B O   1 
ATOM   8596 N N   . LYS B  1 519 ? 42.578  -5.492  16.830  1.00 22.28 ? 518  LYS B N   1 
ATOM   8597 C CA  . LYS B  1 519 ? 43.370  -4.432  17.452  1.00 23.24 ? 518  LYS B CA  1 
ATOM   8598 C C   . LYS B  1 519 ? 44.863  -4.645  17.201  1.00 23.02 ? 518  LYS B C   1 
ATOM   8599 O O   . LYS B  1 519 ? 45.574  -3.699  16.865  1.00 23.21 ? 518  LYS B O   1 
ATOM   8600 C CB  . LYS B  1 519 ? 43.087  -4.345  18.951  1.00 23.84 ? 518  LYS B CB  1 
ATOM   8601 C CG  . LYS B  1 519 ? 41.814  -3.601  19.289  1.00 25.20 ? 518  LYS B CG  1 
ATOM   8602 C CD  . LYS B  1 519 ? 41.603  -3.582  20.795  1.00 28.37 ? 518  LYS B CD  1 
ATOM   8603 C CE  . LYS B  1 519 ? 40.211  -3.093  21.140  1.00 31.40 ? 518  LYS B CE  1 
ATOM   8604 N NZ  . LYS B  1 519 ? 39.974  -3.193  22.618  1.00 32.34 ? 518  LYS B NZ  1 
ATOM   8605 N N   . GLN B  1 520 ? 45.309  -5.894  17.337  1.00 23.03 ? 519  GLN B N   1 
ATOM   8606 C CA  . GLN B  1 520 ? 46.714  -6.265  17.136  1.00 23.06 ? 519  GLN B CA  1 
ATOM   8607 C C   . GLN B  1 520 ? 47.134  -6.017  15.691  1.00 22.68 ? 519  GLN B C   1 
ATOM   8608 O O   . GLN B  1 520 ? 48.194  -5.425  15.430  1.00 22.65 ? 519  GLN B O   1 
ATOM   8609 C CB  . GLN B  1 520 ? 46.952  -7.741  17.508  1.00 23.78 ? 519  GLN B CB  1 
ATOM   8610 C CG  . GLN B  1 520 ? 46.626  -8.112  18.958  1.00 25.72 ? 519  GLN B CG  1 
ATOM   8611 C CD  . GLN B  1 520 ? 46.731  -9.617  19.240  1.00 29.03 ? 519  GLN B CD  1 
ATOM   8612 O OE1 . GLN B  1 520 ? 45.988  -10.417 18.677  1.00 27.77 ? 519  GLN B OE1 1 
ATOM   8613 N NE2 . GLN B  1 520 ? 47.656  -9.995  20.119  1.00 31.91 ? 519  GLN B NE2 1 
ATOM   8614 N N   . LEU B  1 521 ? 46.296  -6.459  14.754  1.00 21.91 ? 520  LEU B N   1 
ATOM   8615 C CA  . LEU B  1 521 ? 46.613  -6.309  13.339  1.00 21.72 ? 520  LEU B CA  1 
ATOM   8616 C C   . LEU B  1 521 ? 46.600  -4.841  12.885  1.00 21.74 ? 520  LEU B C   1 
ATOM   8617 O O   . LEU B  1 521 ? 47.402  -4.457  12.034  1.00 21.10 ? 520  LEU B O   1 
ATOM   8618 C CB  . LEU B  1 521 ? 45.731  -7.217  12.455  1.00 21.74 ? 520  LEU B CB  1 
ATOM   8619 C CG  . LEU B  1 521 ? 45.818  -8.736  12.693  1.00 23.02 ? 520  LEU B CG  1 
ATOM   8620 C CD1 . LEU B  1 521 ? 45.128  -9.544  11.568  1.00 22.67 ? 520  LEU B CD1 1 
ATOM   8621 C CD2 . LEU B  1 521 ? 47.257  -9.215  12.893  1.00 23.94 ? 520  LEU B CD2 1 
ATOM   8622 N N   . ALA B  1 522 ? 45.742  -4.006  13.487  1.00 21.36 ? 521  ALA B N   1 
ATOM   8623 C CA  . ALA B  1 522 ? 45.712  -2.579  13.130  1.00 21.66 ? 521  ALA B CA  1 
ATOM   8624 C C   . ALA B  1 522 ? 46.988  -1.854  13.560  1.00 22.35 ? 521  ALA B C   1 
ATOM   8625 O O   . ALA B  1 522 ? 47.557  -1.057  12.799  1.00 21.35 ? 521  ALA B O   1 
ATOM   8626 C CB  . ALA B  1 522 ? 44.456  -1.888  13.711  1.00 21.43 ? 521  ALA B CB  1 
ATOM   8627 N N   . LYS B  1 523 ? 47.449  -2.175  14.768  1.00 23.04 ? 522  LYS B N   1 
ATOM   8628 C CA  . LYS B  1 523 ? 48.688  -1.614  15.292  1.00 24.58 ? 522  LYS B CA  1 
ATOM   8629 C C   . LYS B  1 523 ? 49.892  -1.904  14.387  1.00 24.88 ? 522  LYS B C   1 
ATOM   8630 O O   . LYS B  1 523 ? 50.761  -1.049  14.223  1.00 25.13 ? 522  LYS B O   1 
ATOM   8631 C CB  . LYS B  1 523 ? 48.932  -2.116  16.714  1.00 25.51 ? 522  LYS B CB  1 
ATOM   8632 C CG  . LYS B  1 523 ? 48.175  -1.327  17.789  1.00 28.85 ? 522  LYS B CG  1 
ATOM   8633 C CD  . LYS B  1 523 ? 48.730  -1.575  19.200  1.00 34.60 ? 522  LYS B CD  1 
ATOM   8634 C CE  . LYS B  1 523 ? 47.739  -2.354  20.078  1.00 36.73 ? 522  LYS B CE  1 
ATOM   8635 N NZ  . LYS B  1 523 ? 46.988  -1.490  21.049  1.00 38.49 ? 522  LYS B NZ  1 
ATOM   8636 N N   . LYS B  1 524 ? 49.918  -3.089  13.778  1.00 25.22 ? 523  LYS B N   1 
ATOM   8637 C CA  . LYS B  1 524 ? 50.966  -3.446  12.817  1.00 25.59 ? 523  LYS B CA  1 
ATOM   8638 C C   . LYS B  1 524 ? 50.869  -2.679  11.492  1.00 24.88 ? 523  LYS B C   1 
ATOM   8639 O O   . LYS B  1 524 ? 51.898  -2.296  10.920  1.00 25.51 ? 523  LYS B O   1 
ATOM   8640 C CB  . LYS B  1 524 ? 50.980  -4.956  12.560  1.00 26.34 ? 523  LYS B CB  1 
ATOM   8641 C CG  . LYS B  1 524 ? 51.409  -5.769  13.765  1.00 29.60 ? 523  LYS B CG  1 
ATOM   8642 C CD  . LYS B  1 524 ? 50.851  -7.190  13.711  1.00 33.73 ? 523  LYS B CD  1 
ATOM   8643 C CE  . LYS B  1 524 ? 51.921  -8.228  14.027  1.00 36.62 ? 523  LYS B CE  1 
ATOM   8644 N NZ  . LYS B  1 524 ? 51.748  -8.846  15.387  1.00 38.42 ? 523  LYS B NZ  1 
ATOM   8645 N N   . ILE B  1 525 ? 49.650  -2.459  10.996  1.00 23.10 ? 524  ILE B N   1 
ATOM   8646 C CA  . ILE B  1 525 ? 49.461  -1.805  9.694   1.00 21.71 ? 524  ILE B CA  1 
ATOM   8647 C C   . ILE B  1 525 ? 49.674  -0.286  9.749   1.00 21.95 ? 524  ILE B C   1 
ATOM   8648 O O   . ILE B  1 525 ? 50.175  0.318   8.802   1.00 21.39 ? 524  ILE B O   1 
ATOM   8649 C CB  . ILE B  1 525 ? 48.060  -2.163  9.077   1.00 20.45 ? 524  ILE B CB  1 
ATOM   8650 C CG1 . ILE B  1 525 ? 48.062  -3.613  8.571   1.00 20.75 ? 524  ILE B CG1 1 
ATOM   8651 C CG2 . ILE B  1 525 ? 47.678  -1.197  7.945   1.00 18.45 ? 524  ILE B CG2 1 
ATOM   8652 C CD1 . ILE B  1 525 ? 46.644  -4.222  8.357   1.00 21.18 ? 524  ILE B CD1 1 
ATOM   8653 N N   . GLU B  1 526 ? 49.281  0.337   10.854  1.00 22.70 ? 525  GLU B N   1 
ATOM   8654 C CA  . GLU B  1 526 ? 49.355  1.793   10.973  1.00 24.00 ? 525  GLU B CA  1 
ATOM   8655 C C   . GLU B  1 526 ? 50.682  2.437   10.477  1.00 24.39 ? 525  GLU B C   1 
ATOM   8656 O O   . GLU B  1 526 ? 50.643  3.326   9.619   1.00 24.56 ? 525  GLU B O   1 
ATOM   8657 C CB  . GLU B  1 526 ? 48.985  2.237   12.409  1.00 23.88 ? 525  GLU B CB  1 
ATOM   8658 C CG  . GLU B  1 526 ? 48.814  3.740   12.581  1.00 26.88 ? 525  GLU B CG  1 
ATOM   8659 C CD  . GLU B  1 526 ? 48.564  4.141   14.028  1.00 28.58 ? 525  GLU B CD  1 
ATOM   8660 O OE1 . GLU B  1 526 ? 48.054  3.311   14.803  1.00 30.35 ? 525  GLU B OE1 1 
ATOM   8661 O OE2 . GLU B  1 526 ? 48.888  5.295   14.388  1.00 32.69 ? 525  GLU B OE2 1 
ATOM   8662 N N   . PRO B  1 527 ? 51.835  2.015   11.002  1.00 25.13 ? 526  PRO B N   1 
ATOM   8663 C CA  . PRO B  1 527 ? 53.122  2.567   10.547  1.00 25.89 ? 526  PRO B CA  1 
ATOM   8664 C C   . PRO B  1 527 ? 53.484  2.242   9.097   1.00 26.05 ? 526  PRO B C   1 
ATOM   8665 O O   . PRO B  1 527 ? 54.245  2.994   8.483   1.00 26.75 ? 526  PRO B O   1 
ATOM   8666 C CB  . PRO B  1 527 ? 54.134  1.934   11.496  1.00 25.89 ? 526  PRO B CB  1 
ATOM   8667 C CG  . PRO B  1 527 ? 53.468  0.721   12.029  1.00 26.93 ? 526  PRO B CG  1 
ATOM   8668 C CD  . PRO B  1 527 ? 52.021  1.061   12.105  1.00 25.18 ? 526  PRO B CD  1 
ATOM   8669 N N   . GLU B  1 528 ? 52.939  1.154   8.558   1.00 25.68 ? 527  GLU B N   1 
ATOM   8670 C CA  . GLU B  1 528 ? 53.220  0.752   7.173   1.00 25.13 ? 527  GLU B CA  1 
ATOM   8671 C C   . GLU B  1 528 ? 52.601  1.673   6.126   1.00 25.40 ? 527  GLU B C   1 
ATOM   8672 O O   . GLU B  1 528 ? 53.043  1.689   4.977   1.00 24.57 ? 527  GLU B O   1 
ATOM   8673 C CB  . GLU B  1 528 ? 52.765  -0.691  6.928   1.00 25.21 ? 527  GLU B CB  1 
ATOM   8674 C CG  . GLU B  1 528 ? 53.456  -1.727  7.795   1.00 25.45 ? 527  GLU B CG  1 
ATOM   8675 C CD  . GLU B  1 528 ? 52.944  -3.139  7.550   1.00 29.32 ? 527  GLU B CD  1 
ATOM   8676 O OE1 . GLU B  1 528 ? 51.728  -3.305  7.277   1.00 28.59 ? 527  GLU B OE1 1 
ATOM   8677 O OE2 . GLU B  1 528 ? 53.764  -4.084  7.633   1.00 30.90 ? 527  GLU B OE2 1 
ATOM   8678 N N   . LEU B  1 529 ? 51.568  2.429   6.515   1.00 25.16 ? 528  LEU B N   1 
ATOM   8679 C CA  . LEU B  1 529 ? 50.870  3.303   5.579   1.00 26.90 ? 528  LEU B CA  1 
ATOM   8680 C C   . LEU B  1 529 ? 51.633  4.588   5.279   1.00 28.73 ? 528  LEU B C   1 
ATOM   8681 O O   . LEU B  1 529 ? 51.469  5.159   4.205   1.00 29.26 ? 528  LEU B O   1 
ATOM   8682 C CB  . LEU B  1 529 ? 49.464  3.636   6.102   1.00 26.38 ? 528  LEU B CB  1 
ATOM   8683 C CG  . LEU B  1 529 ? 48.528  2.428   6.287   1.00 25.21 ? 528  LEU B CG  1 
ATOM   8684 C CD1 . LEU B  1 529 ? 47.197  2.855   6.912   1.00 24.58 ? 528  LEU B CD1 1 
ATOM   8685 C CD2 . LEU B  1 529 ? 48.274  1.725   4.968   1.00 24.58 ? 528  LEU B CD2 1 
ATOM   8686 N N   . GLU B  1 530 ? 52.471  5.012   6.225   1.00 30.89 ? 529  GLU B N   1 
ATOM   8687 C CA  . GLU B  1 530 ? 53.169  6.306   6.164   1.00 33.32 ? 529  GLU B CA  1 
ATOM   8688 C C   . GLU B  1 530 ? 53.956  6.563   4.869   1.00 33.92 ? 529  GLU B C   1 
ATOM   8689 O O   . GLU B  1 530 ? 53.616  7.462   4.089   1.00 35.44 ? 529  GLU B O   1 
ATOM   8690 C CB  . GLU B  1 530 ? 54.078  6.481   7.394   1.00 33.72 ? 529  GLU B CB  1 
ATOM   8691 C CG  . GLU B  1 530 ? 53.419  7.228   8.554   1.00 36.91 ? 529  GLU B CG  1 
ATOM   8692 C CD  . GLU B  1 530 ? 53.909  6.789   9.932   1.00 40.29 ? 529  GLU B CD  1 
ATOM   8693 O OE1 . GLU B  1 530 ? 53.102  6.815   10.886  1.00 41.95 ? 529  GLU B OE1 1 
ATOM   8694 O OE2 . GLU B  1 530 ? 55.103  6.430   10.081  1.00 42.33 ? 529  GLU B OE2 1 
ATOM   8695 N N   . GLY B  1 531 ? 54.987  5.765   4.621   1.00 34.05 ? 530  GLY B N   1 
ATOM   8696 C CA  . GLY B  1 531 ? 55.916  6.074   3.547   1.00 33.42 ? 530  GLY B CA  1 
ATOM   8697 C C   . GLY B  1 531 ? 55.438  5.696   2.159   1.00 33.03 ? 530  GLY B C   1 
ATOM   8698 O O   . GLY B  1 531 ? 54.281  5.301   1.959   1.00 33.12 ? 530  GLY B O   1 
ATOM   8699 N N   . SER B  1 532 ? 56.350  5.797   1.198   1.00 32.13 ? 531  SER B N   1 
ATOM   8700 C CA  . SER B  1 532 ? 56.034  5.549   -0.203  1.00 31.52 ? 531  SER B CA  1 
ATOM   8701 C C   . SER B  1 532 ? 56.277  4.092   -0.622  1.00 30.71 ? 531  SER B C   1 
ATOM   8702 O O   . SER B  1 532 ? 55.780  3.656   -1.659  1.00 31.03 ? 531  SER B O   1 
ATOM   8703 C CB  . SER B  1 532 ? 56.832  6.496   -1.102  1.00 31.82 ? 531  SER B CB  1 
ATOM   8704 O OG  . SER B  1 532 ? 58.219  6.334   -0.881  1.00 33.48 ? 531  SER B OG  1 
ATOM   8705 N N   . SER B  1 533 ? 57.018  3.342   0.189   1.00 29.58 ? 532  SER B N   1 
ATOM   8706 C CA  . SER B  1 533 ? 57.431  1.992   -0.200  1.00 29.04 ? 532  SER B CA  1 
ATOM   8707 C C   . SER B  1 533 ? 56.275  0.981   -0.247  1.00 27.77 ? 532  SER B C   1 
ATOM   8708 O O   . SER B  1 533 ? 55.283  1.100   0.490   1.00 27.12 ? 532  SER B O   1 
ATOM   8709 C CB  . SER B  1 533 ? 58.569  1.482   0.686   1.00 29.30 ? 532  SER B CB  1 
ATOM   8710 O OG  . SER B  1 533 ? 58.137  1.317   2.022   1.00 32.75 ? 532  SER B OG  1 
ATOM   8711 N N   . ALA B  1 534 ? 56.412  0.001   -1.136  1.00 26.34 ? 533  ALA B N   1 
ATOM   8712 C CA  . ALA B  1 534 ? 55.428  -1.068  -1.258  1.00 25.08 ? 533  ALA B CA  1 
ATOM   8713 C C   . ALA B  1 534 ? 55.414  -1.940  -0.004  1.00 24.57 ? 533  ALA B C   1 
ATOM   8714 O O   . ALA B  1 534 ? 56.468  -2.264  0.548   1.00 24.83 ? 533  ALA B O   1 
ATOM   8715 C CB  . ALA B  1 534 ? 55.692  -1.908  -2.515  1.00 25.24 ? 533  ALA B CB  1 
ATOM   8716 N N   . VAL B  1 535 ? 54.215  -2.304  0.445   1.00 22.72 ? 534  VAL B N   1 
ATOM   8717 C CA  . VAL B  1 535 ? 54.056  -3.196  1.601   1.00 22.18 ? 534  VAL B CA  1 
ATOM   8718 C C   . VAL B  1 535 ? 53.785  -4.622  1.093   1.00 21.97 ? 534  VAL B C   1 
ATOM   8719 O O   . VAL B  1 535 ? 52.882  -4.838  0.274   1.00 21.55 ? 534  VAL B O   1 
ATOM   8720 C CB  . VAL B  1 535 ? 52.929  -2.687  2.549   1.00 21.75 ? 534  VAL B CB  1 
ATOM   8721 C CG1 . VAL B  1 535 ? 52.639  -3.691  3.663   1.00 22.44 ? 534  VAL B CG1 1 
ATOM   8722 C CG2 . VAL B  1 535 ? 53.309  -1.306  3.138   1.00 21.94 ? 534  VAL B CG2 1 
ATOM   8723 N N   . THR B  1 536 ? 54.603  -5.581  1.534   1.00 21.63 ? 535  THR B N   1 
ATOM   8724 C CA  . THR B  1 536 ? 54.492  -6.962  1.056   1.00 22.40 ? 535  THR B CA  1 
ATOM   8725 C C   . THR B  1 536 ? 54.389  -7.966  2.203   1.00 22.59 ? 535  THR B C   1 
ATOM   8726 O O   . THR B  1 536 ? 54.377  -9.175  1.963   1.00 23.82 ? 535  THR B O   1 
ATOM   8727 C CB  . THR B  1 536 ? 55.703  -7.351  0.171   1.00 22.66 ? 535  THR B CB  1 
ATOM   8728 O OG1 . THR B  1 536 ? 56.899  -7.235  0.951   1.00 22.74 ? 535  THR B OG1 1 
ATOM   8729 C CG2 . THR B  1 536 ? 55.892  -6.387  -1.012  1.00 22.76 ? 535  THR B CG2 1 
ATOM   8730 N N   . SER B  1 537 ? 54.279  -7.475  3.433   1.00 22.95 ? 536  SER B N   1 
ATOM   8731 C CA  . SER B  1 537 ? 54.331  -8.318  4.638   1.00 24.05 ? 536  SER B CA  1 
ATOM   8732 C C   . SER B  1 537 ? 53.037  -9.052  4.986   1.00 23.37 ? 536  SER B C   1 
ATOM   8733 O O   . SER B  1 537 ? 52.986  -9.816  5.968   1.00 24.67 ? 536  SER B O   1 
ATOM   8734 C CB  . SER B  1 537 ? 54.764  -7.483  5.848   1.00 24.36 ? 536  SER B CB  1 
ATOM   8735 O OG  . SER B  1 537 ? 53.805  -6.480  6.117   1.00 27.79 ? 536  SER B OG  1 
ATOM   8736 N N   . HIS B  1 538 ? 51.985  -8.822  4.212   1.00 21.84 ? 537  HIS B N   1 
ATOM   8737 C CA  . HIS B  1 538 ? 50.710  -9.492  4.487   1.00 20.82 ? 537  HIS B CA  1 
ATOM   8738 C C   . HIS B  1 538 ? 50.321  -10.450 3.375   1.00 20.13 ? 537  HIS B C   1 
ATOM   8739 O O   . HIS B  1 538 ? 51.109  -10.713 2.481   1.00 20.92 ? 537  HIS B O   1 
ATOM   8740 C CB  . HIS B  1 538 ? 49.602  -8.448  4.688   1.00 20.54 ? 537  HIS B CB  1 
ATOM   8741 C CG  . HIS B  1 538 ? 49.941  -7.395  5.696   1.00 21.12 ? 537  HIS B CG  1 
ATOM   8742 N ND1 . HIS B  1 538 ? 49.583  -7.496  7.022   1.00 22.27 ? 537  HIS B ND1 1 
ATOM   8743 C CD2 . HIS B  1 538 ? 50.602  -6.221  5.570   1.00 22.31 ? 537  HIS B CD2 1 
ATOM   8744 C CE1 . HIS B  1 538 ? 50.019  -6.432  7.674   1.00 22.57 ? 537  HIS B CE1 1 
ATOM   8745 N NE2 . HIS B  1 538 ? 50.640  -5.643  6.817   1.00 21.66 ? 537  HIS B NE2 1 
ATOM   8746 N N   . ASP B  1 539 ? 49.092  -10.960 3.430   1.00 19.03 ? 538  ASP B N   1 
ATOM   8747 C CA  . ASP B  1 539 ? 48.494  -11.678 2.309   1.00 18.34 ? 538  ASP B CA  1 
ATOM   8748 C C   . ASP B  1 539 ? 48.323  -10.729 1.109   1.00 17.80 ? 538  ASP B C   1 
ATOM   8749 O O   . ASP B  1 539 ? 48.375  -9.493  1.270   1.00 17.75 ? 538  ASP B O   1 
ATOM   8750 C CB  . ASP B  1 539 ? 47.131  -12.212 2.719   1.00 18.24 ? 538  ASP B CB  1 
ATOM   8751 C CG  . ASP B  1 539 ? 46.156  -11.088 3.031   1.00 17.57 ? 538  ASP B CG  1 
ATOM   8752 O OD1 . ASP B  1 539 ? 45.461  -10.624 2.105   1.00 17.15 ? 538  ASP B OD1 1 
ATOM   8753 O OD2 . ASP B  1 539 ? 46.061  -10.580 4.163   1.00 21.15 ? 538  ASP B OD2 1 
ATOM   8754 N N   . SER B  1 540 ? 48.104  -11.283 -0.086  1.00 17.60 ? 539  SER B N   1 
ATOM   8755 C CA  . SER B  1 540 ? 48.077  -10.464 -1.306  1.00 16.77 ? 539  SER B CA  1 
ATOM   8756 C C   . SER B  1 540 ? 46.927  -9.451  -1.381  1.00 16.62 ? 539  SER B C   1 
ATOM   8757 O O   . SER B  1 540 ? 47.059  -8.426  -2.046  1.00 16.01 ? 539  SER B O   1 
ATOM   8758 C CB  . SER B  1 540 ? 48.132  -11.297 -2.596  1.00 17.27 ? 539  SER B CB  1 
ATOM   8759 O OG  . SER B  1 540 ? 46.949  -12.047 -2.790  1.00 16.97 ? 539  SER B OG  1 
ATOM   8760 N N   . SER B  1 541 ? 45.810  -9.744  -0.709  1.00 16.44 ? 540  SER B N   1 
ATOM   8761 C CA  . SER B  1 541 ? 44.702  -8.779  -0.646  1.00 15.74 ? 540  SER B CA  1 
ATOM   8762 C C   . SER B  1 541 ? 45.067  -7.545  0.199   1.00 16.07 ? 540  SER B C   1 
ATOM   8763 O O   . SER B  1 541 ? 44.972  -6.399  -0.269  1.00 15.96 ? 540  SER B O   1 
ATOM   8764 C CB  . SER B  1 541 ? 43.427  -9.447  -0.109  1.00 15.47 ? 540  SER B CB  1 
ATOM   8765 O OG  . SER B  1 541 ? 42.401  -8.474  0.102   1.00 15.90 ? 540  SER B OG  1 
ATOM   8766 N N   . THR B  1 542 ? 45.486  -7.776  1.439   1.00 15.88 ? 541  THR B N   1 
ATOM   8767 C CA  . THR B  1 542 ? 45.913  -6.665  2.299   1.00 16.94 ? 541  THR B CA  1 
ATOM   8768 C C   . THR B  1 542 ? 47.007  -5.835  1.605   1.00 16.80 ? 541  THR B C   1 
ATOM   8769 O O   . THR B  1 542 ? 46.936  -4.592  1.532   1.00 17.46 ? 541  THR B O   1 
ATOM   8770 C CB  . THR B  1 542 ? 46.384  -7.207  3.649   1.00 16.90 ? 541  THR B CB  1 
ATOM   8771 O OG1 . THR B  1 542 ? 45.326  -7.967  4.248   1.00 18.51 ? 541  THR B OG1 1 
ATOM   8772 C CG2 . THR B  1 542 ? 46.670  -6.064  4.638   1.00 17.01 ? 541  THR B CG2 1 
ATOM   8773 N N   . ASN B  1 543 ? 48.003  -6.522  1.043   1.00 17.19 ? 542  ASN B N   1 
ATOM   8774 C CA  . ASN B  1 543 ? 49.046  -5.833  0.281   1.00 16.98 ? 542  ASN B CA  1 
ATOM   8775 C C   . ASN B  1 543 ? 48.488  -5.025  -0.883  1.00 16.47 ? 542  ASN B C   1 
ATOM   8776 O O   . ASN B  1 543 ? 48.919  -3.892  -1.098  1.00 16.40 ? 542  ASN B O   1 
ATOM   8777 C CB  . ASN B  1 543 ? 50.065  -6.835  -0.308  1.00 16.18 ? 542  ASN B CB  1 
ATOM   8778 C CG  . ASN B  1 543 ? 50.889  -7.591  0.743   1.00 16.42 ? 542  ASN B CG  1 
ATOM   8779 O OD1 . ASN B  1 543 ? 51.538  -8.603  0.395   1.00 18.64 ? 542  ASN B OD1 1 
ATOM   8780 N ND2 . ASN B  1 543 ? 50.895  -7.138  1.981   1.00 15.29 ? 542  ASN B ND2 1 
ATOM   8781 N N   . GLY B  1 544 ? 47.557  -5.604  -1.652  1.00 16.66 ? 543  GLY B N   1 
ATOM   8782 C CA  . GLY B  1 544 ? 47.013  -4.948  -2.832  1.00 17.07 ? 543  GLY B CA  1 
ATOM   8783 C C   . GLY B  1 544 ? 46.151  -3.743  -2.485  1.00 17.09 ? 543  GLY B C   1 
ATOM   8784 O O   . GLY B  1 544 ? 46.154  -2.732  -3.204  1.00 17.56 ? 543  GLY B O   1 
ATOM   8785 N N   . LEU B  1 545 ? 45.418  -3.865  -1.381  1.00 16.88 ? 544  LEU B N   1 
ATOM   8786 C CA  . LEU B  1 545 ? 44.584  -2.762  -0.903  1.00 16.64 ? 544  LEU B CA  1 
ATOM   8787 C C   . LEU B  1 545 ? 45.473  -1.593  -0.467  1.00 16.37 ? 544  LEU B C   1 
ATOM   8788 O O   . LEU B  1 545 ? 45.186  -0.443  -0.785  1.00 16.30 ? 544  LEU B O   1 
ATOM   8789 C CB  . LEU B  1 545 ? 43.665  -3.215  0.240   1.00 16.95 ? 544  LEU B CB  1 
ATOM   8790 C CG  . LEU B  1 545 ? 42.536  -4.182  -0.135  1.00 16.16 ? 544  LEU B CG  1 
ATOM   8791 C CD1 . LEU B  1 545 ? 41.982  -4.826  1.134   1.00 16.74 ? 544  LEU B CD1 1 
ATOM   8792 C CD2 . LEU B  1 545 ? 41.435  -3.489  -0.937  1.00 17.00 ? 544  LEU B CD2 1 
ATOM   8793 N N   . ILE B  1 546 ? 46.560  -1.900  0.238   1.00 16.04 ? 545  ILE B N   1 
ATOM   8794 C CA  . ILE B  1 546 ? 47.544  -0.869  0.645   1.00 16.39 ? 545  ILE B CA  1 
ATOM   8795 C C   . ILE B  1 546 ? 48.194  -0.199  -0.571  1.00 16.41 ? 545  ILE B C   1 
ATOM   8796 O O   . ILE B  1 546 ? 48.388  1.019   -0.577  1.00 16.82 ? 545  ILE B O   1 
ATOM   8797 C CB  . ILE B  1 546 ? 48.618  -1.438  1.619   1.00 16.32 ? 545  ILE B CB  1 
ATOM   8798 C CG1 . ILE B  1 546 ? 47.997  -1.803  2.980   1.00 16.66 ? 545  ILE B CG1 1 
ATOM   8799 C CG2 . ILE B  1 546 ? 49.770  -0.437  1.825   1.00 15.87 ? 545  ILE B CG2 1 
ATOM   8800 C CD1 . ILE B  1 546 ? 48.859  -2.714  3.892   1.00 16.85 ? 545  ILE B CD1 1 
ATOM   8801 N N   . SER B  1 547 ? 48.527  -0.989  -1.593  1.00 16.51 ? 546  SER B N   1 
ATOM   8802 C CA  . SER B  1 547 ? 49.081  -0.441  -2.840  1.00 17.31 ? 546  SER B CA  1 
ATOM   8803 C C   . SER B  1 547 ? 48.143  0.556   -3.507  1.00 17.29 ? 546  SER B C   1 
ATOM   8804 O O   . SER B  1 547 ? 48.576  1.597   -3.999  1.00 17.94 ? 546  SER B O   1 
ATOM   8805 C CB  . SER B  1 547 ? 49.406  -1.573  -3.823  1.00 17.63 ? 546  SER B CB  1 
ATOM   8806 O OG  A SER B  1 547 ? 49.994  -1.101  -5.020  0.50 17.35 ? 546  SER B OG  1 
ATOM   8807 O OG  B SER B  1 547 ? 50.621  -2.186  -3.458  0.50 19.59 ? 546  SER B OG  1 
ATOM   8808 N N   . PHE B  1 548 ? 46.857  0.230   -3.517  1.00 16.91 ? 547  PHE B N   1 
ATOM   8809 C CA  . PHE B  1 548 ? 45.838  1.114   -4.075  1.00 16.59 ? 547  PHE B CA  1 
ATOM   8810 C C   . PHE B  1 548 ? 45.737  2.426   -3.279  1.00 16.38 ? 547  PHE B C   1 
ATOM   8811 O O   . PHE B  1 548 ? 45.673  3.501   -3.867  1.00 16.59 ? 547  PHE B O   1 
ATOM   8812 C CB  . PHE B  1 548 ? 44.491  0.376   -4.130  1.00 16.18 ? 547  PHE B CB  1 
ATOM   8813 C CG  . PHE B  1 548 ? 43.374  1.167   -4.752  1.00 15.95 ? 547  PHE B CG  1 
ATOM   8814 C CD1 . PHE B  1 548 ? 43.232  1.241   -6.142  1.00 18.59 ? 547  PHE B CD1 1 
ATOM   8815 C CD2 . PHE B  1 548 ? 42.441  1.820   -3.946  1.00 14.66 ? 547  PHE B CD2 1 
ATOM   8816 C CE1 . PHE B  1 548 ? 42.175  1.974   -6.722  1.00 17.58 ? 547  PHE B CE1 1 
ATOM   8817 C CE2 . PHE B  1 548 ? 41.389  2.560   -4.525  1.00 13.97 ? 547  PHE B CE2 1 
ATOM   8818 C CZ  . PHE B  1 548 ? 41.258  2.629   -5.908  1.00 18.14 ? 547  PHE B CZ  1 
ATOM   8819 N N   . ILE B  1 549 ? 45.743  2.316   -1.950  1.00 15.72 ? 548  ILE B N   1 
ATOM   8820 C CA  . ILE B  1 549 ? 45.738  3.485   -1.059  1.00 16.15 ? 548  ILE B CA  1 
ATOM   8821 C C   . ILE B  1 549 ? 46.950  4.396   -1.337  1.00 17.04 ? 548  ILE B C   1 
ATOM   8822 O O   . ILE B  1 549 ? 46.812  5.607   -1.479  1.00 16.92 ? 548  ILE B O   1 
ATOM   8823 C CB  . ILE B  1 549 ? 45.700  3.015   0.421   1.00 16.47 ? 548  ILE B CB  1 
ATOM   8824 C CG1 . ILE B  1 549 ? 44.320  2.425   0.753   1.00 16.78 ? 548  ILE B CG1 1 
ATOM   8825 C CG2 . ILE B  1 549 ? 46.034  4.161   1.422   1.00 16.59 ? 548  ILE B CG2 1 
ATOM   8826 C CD1 . ILE B  1 549 ? 44.330  1.489   1.943   1.00 18.48 ? 548  ILE B CD1 1 
ATOM   8827 N N   . LYS B  1 550 ? 48.130  3.801   -1.438  1.00 17.67 ? 549  LYS B N   1 
ATOM   8828 C CA  . LYS B  1 550 ? 49.325  4.608   -1.646  1.00 18.30 ? 549  LYS B CA  1 
ATOM   8829 C C   . LYS B  1 550 ? 49.308  5.284   -3.015  1.00 19.57 ? 549  LYS B C   1 
ATOM   8830 O O   . LYS B  1 550 ? 49.698  6.459   -3.137  1.00 21.02 ? 549  LYS B O   1 
ATOM   8831 C CB  . LYS B  1 550 ? 50.599  3.775   -1.385  1.00 18.17 ? 549  LYS B CB  1 
ATOM   8832 C CG  . LYS B  1 550 ? 50.786  3.456   0.086   1.00 18.74 ? 549  LYS B CG  1 
ATOM   8833 C CD  . LYS B  1 550 ? 52.132  2.841   0.366   1.00 20.45 ? 549  LYS B CD  1 
ATOM   8834 C CE  . LYS B  1 550 ? 52.276  2.515   1.842   1.00 20.22 ? 549  LYS B CE  1 
ATOM   8835 N NZ  . LYS B  1 550 ? 53.702  2.576   2.319   1.00 21.35 ? 549  LYS B NZ  1 
ATOM   8836 N N   . GLN B  1 551 ? 48.799  4.589   -4.028  1.00 19.97 ? 550  GLN B N   1 
ATOM   8837 C CA  . GLN B  1 551 ? 48.683  5.177   -5.364  1.00 21.32 ? 550  GLN B CA  1 
ATOM   8838 C C   . GLN B  1 551 ? 47.627  6.284   -5.484  1.00 21.94 ? 550  GLN B C   1 
ATOM   8839 O O   . GLN B  1 551 ? 47.843  7.287   -6.193  1.00 21.94 ? 550  GLN B O   1 
ATOM   8840 C CB  . GLN B  1 551 ? 48.409  4.098   -6.400  1.00 21.88 ? 550  GLN B CB  1 
ATOM   8841 C CG  . GLN B  1 551 ? 48.425  4.610   -7.829  1.00 25.57 ? 550  GLN B CG  1 
ATOM   8842 C CD  . GLN B  1 551 ? 47.647  3.716   -8.749  1.00 30.79 ? 550  GLN B CD  1 
ATOM   8843 O OE1 . GLN B  1 551 ? 46.417  3.642   -8.659  1.00 31.55 ? 550  GLN B OE1 1 
ATOM   8844 N NE2 . GLN B  1 551 ? 48.354  3.014   -9.632  1.00 33.17 ? 550  GLN B NE2 1 
ATOM   8845 N N   . GLN B  1 552 ? 46.491  6.098   -4.808  1.00 20.70 ? 551  GLN B N   1 
ATOM   8846 C CA  . GLN B  1 552 ? 45.351  6.981   -5.000  1.00 22.00 ? 551  GLN B CA  1 
ATOM   8847 C C   . GLN B  1 552 ? 45.335  8.184   -4.071  1.00 23.48 ? 551  GLN B C   1 
ATOM   8848 O O   . GLN B  1 552 ? 44.580  9.126   -4.294  1.00 23.71 ? 551  GLN B O   1 
ATOM   8849 C CB  . GLN B  1 552 ? 44.039  6.189   -4.889  1.00 21.39 ? 551  GLN B CB  1 
ATOM   8850 C CG  . GLN B  1 552 ? 43.798  5.280   -6.098  1.00 20.92 ? 551  GLN B CG  1 
ATOM   8851 C CD  . GLN B  1 552 ? 43.636  6.057   -7.411  1.00 20.97 ? 551  GLN B CD  1 
ATOM   8852 O OE1 . GLN B  1 552 ? 42.871  7.016   -7.488  1.00 20.39 ? 551  GLN B OE1 1 
ATOM   8853 N NE2 . GLN B  1 552 ? 44.386  5.654   -8.440  1.00 23.49 ? 551  GLN B NE2 1 
ATOM   8854 N N   . ARG B  1 553 ? 46.161  8.175   -3.037  1.00 24.56 ? 552  ARG B N   1 
ATOM   8855 C CA  . ARG B  1 553 ? 46.094  9.291   -2.098  1.00 27.77 ? 552  ARG B CA  1 
ATOM   8856 C C   . ARG B  1 553 ? 46.610  10.609  -2.669  1.00 29.76 ? 552  ARG B C   1 
ATOM   8857 O O   . ARG B  1 553 ? 46.256  11.672  -2.171  1.00 30.35 ? 552  ARG B O   1 
ATOM   8858 C CB  . ARG B  1 553 ? 46.737  8.962   -0.760  1.00 27.16 ? 552  ARG B CB  1 
ATOM   8859 C CG  . ARG B  1 553 ? 48.191  8.559   -0.792  1.00 27.29 ? 552  ARG B CG  1 
ATOM   8860 C CD  . ARG B  1 553 ? 48.626  8.040   0.569   1.00 29.00 ? 552  ARG B CD  1 
ATOM   8861 N NE  . ARG B  1 553 ? 50.030  7.655   0.636   1.00 28.50 ? 552  ARG B NE  1 
ATOM   8862 C CZ  . ARG B  1 553 ? 50.542  6.924   1.615   1.00 29.24 ? 552  ARG B CZ  1 
ATOM   8863 N NH1 . ARG B  1 553 ? 51.830  6.613   1.606   1.00 29.39 ? 552  ARG B NH1 1 
ATOM   8864 N NH2 . ARG B  1 553 ? 49.768  6.491   2.603   1.00 27.29 ? 552  ARG B NH2 1 
ATOM   8865 N N   . ASP B  1 554 ? 47.397  10.511  -3.736  1.00 32.93 ? 553  ASP B N   1 
ATOM   8866 C CA  . ASP B  1 554 ? 47.990  11.660  -4.418  1.00 36.13 ? 553  ASP B CA  1 
ATOM   8867 C C   . ASP B  1 554 ? 47.075  12.277  -5.479  1.00 37.19 ? 553  ASP B C   1 
ATOM   8868 O O   . ASP B  1 554 ? 47.189  13.473  -5.765  1.00 37.83 ? 553  ASP B O   1 
ATOM   8869 C CB  . ASP B  1 554 ? 49.318  11.252  -5.077  1.00 36.69 ? 553  ASP B CB  1 
ATOM   8870 C CG  . ASP B  1 554 ? 50.444  11.067  -4.070  1.00 39.07 ? 553  ASP B CG  1 
ATOM   8871 O OD1 . ASP B  1 554 ? 50.423  11.740  -3.012  1.00 41.47 ? 553  ASP B OD1 1 
ATOM   8872 O OD2 . ASP B  1 554 ? 51.398  10.273  -4.255  1.00 41.71 ? 553  ASP B OD2 1 
ATOM   8873 N N   . THR B  1 555 ? 46.189  11.460  -6.055  1.00 38.11 ? 554  THR B N   1 
ATOM   8874 C CA  . THR B  1 555 ? 45.346  11.863  -7.187  1.00 39.41 ? 554  THR B CA  1 
ATOM   8875 C C   . THR B  1 555 ? 44.558  13.145  -6.923  1.00 40.10 ? 554  THR B C   1 
ATOM   8876 O O   . THR B  1 555 ? 43.892  13.276  -5.894  1.00 39.92 ? 554  THR B O   1 
ATOM   8877 C CB  . THR B  1 555 ? 44.370  10.723  -7.577  1.00 39.05 ? 554  THR B CB  1 
ATOM   8878 O OG1 . THR B  1 555 ? 45.112  9.533   -7.865  1.00 40.44 ? 554  THR B OG1 1 
ATOM   8879 C CG2 . THR B  1 555 ? 43.677  11.032  -8.901  1.00 39.98 ? 554  THR B CG2 1 
ATOM   8880 N N   . LYS B  1 556 ? 44.641  14.079  -7.868  1.00 41.05 ? 555  LYS B N   1 
ATOM   8881 C CA  . LYS B  1 556 ? 43.888  15.321  -7.796  1.00 42.27 ? 555  LYS B CA  1 
ATOM   8882 C C   . LYS B  1 556 ? 42.588  15.206  -8.589  1.00 42.71 ? 555  LYS B C   1 
ATOM   8883 O O   . LYS B  1 556 ? 42.609  14.931  -9.792  1.00 43.00 ? 555  LYS B O   1 
ATOM   8884 C CB  . LYS B  1 556 ? 44.730  16.488  -8.320  1.00 42.45 ? 555  LYS B CB  1 
ATOM   8885 C CG  . LYS B  1 556 ? 45.106  17.509  -7.250  1.00 43.92 ? 555  LYS B CG  1 
ATOM   8886 C CD  . LYS B  1 556 ? 46.603  17.475  -6.956  1.00 45.79 ? 555  LYS B CD  1 
ATOM   8887 C CE  . LYS B  1 556 ? 47.029  18.673  -6.111  1.00 46.42 ? 555  LYS B CE  1 
ATOM   8888 N NZ  . LYS B  1 556 ? 48.032  18.298  -5.070  1.00 47.16 ? 555  LYS B NZ  1 
ATOM   8889 N N   . LEU B  1 557 ? 41.461  15.400  -7.905  1.00 43.16 ? 556  LEU B N   1 
ATOM   8890 C CA  . LEU B  1 557 ? 40.148  15.376  -8.551  1.00 43.50 ? 556  LEU B CA  1 
ATOM   8891 C C   . LEU B  1 557 ? 39.520  16.770  -8.611  1.00 43.86 ? 556  LEU B C   1 
ATOM   8892 O O   . LEU B  1 557 ? 39.628  17.559  -7.666  1.00 44.26 ? 556  LEU B O   1 
ATOM   8893 C CB  . LEU B  1 557 ? 39.199  14.391  -7.847  1.00 43.48 ? 556  LEU B CB  1 
ATOM   8894 C CG  . LEU B  1 557 ? 39.652  12.945  -7.599  1.00 43.04 ? 556  LEU B CG  1 
ATOM   8895 C CD1 . LEU B  1 557 ? 38.675  12.245  -6.676  1.00 42.55 ? 556  LEU B CD1 1 
ATOM   8896 C CD2 . LEU B  1 557 ? 39.803  12.163  -8.906  1.00 42.95 ? 556  LEU B CD2 1 
HETATM 8897 C C1  A G6P C  2 .   ? 5.341   2.473   1.057   0.70 30.58 ? 900  G6P A C1  1 
HETATM 8898 C C2  A G6P C  2 .   ? 6.374   1.638   0.273   0.70 30.63 ? 900  G6P A C2  1 
HETATM 8899 C C3  A G6P C  2 .   ? 7.543   2.311   -0.445  0.70 30.81 ? 900  G6P A C3  1 
HETATM 8900 C C4  A G6P C  2 .   ? 7.590   3.843   -0.408  0.70 31.42 ? 900  G6P A C4  1 
HETATM 8901 C C5  A G6P C  2 .   ? 6.636   4.580   0.551   0.70 31.09 ? 900  G6P A C5  1 
HETATM 8902 C C6  A G6P C  2 .   ? 6.346   6.029   0.179   0.70 30.79 ? 900  G6P A C6  1 
HETATM 8903 O O1  A G6P C  2 .   ? 5.027   1.889   2.316   0.35 29.00 ? 900  G6P A O1  1 
HETATM 8904 O O1  B G6P C  2 .   ? 4.020   2.113   0.677   0.35 29.96 ? 900  G6P A O1  1 
HETATM 8905 O O2  A G6P C  2 .   ? 7.050   0.929   1.292   0.70 29.48 ? 900  G6P A O2  1 
HETATM 8906 O O3  A G6P C  2 .   ? 7.699   1.803   -1.758  0.70 32.22 ? 900  G6P A O3  1 
HETATM 8907 O O4  A G6P C  2 .   ? 8.917   4.366   -0.416  0.70 32.76 ? 900  G6P A O4  1 
HETATM 8908 O O5  A G6P C  2 .   ? 5.499   3.920   1.130   0.70 31.65 ? 900  G6P A O5  1 
HETATM 8909 O O6  A G6P C  2 .   ? 5.250   6.137   -0.709  0.70 27.48 ? 900  G6P A O6  1 
HETATM 8910 P P   A G6P C  2 .   ? 4.956   7.596   -1.289  0.70 27.61 ? 900  G6P A P   1 
HETATM 8911 O O1P A G6P C  2 .   ? 6.275   8.181   -1.940  0.70 26.66 ? 900  G6P A O1P 1 
HETATM 8912 O O2P A G6P C  2 .   ? 4.501   8.563   -0.112  0.70 26.53 ? 900  G6P A O2P 1 
HETATM 8913 O O3P A G6P C  2 .   ? 3.785   7.450   -2.350  0.70 26.35 ? 900  G6P A O3P 1 
HETATM 8914 C C1  B G6Q D  3 .   ? 9.301   2.164   -2.116  0.30 14.27 ? 901  G6Q A C1  1 
HETATM 8915 C C2  B G6Q D  3 .   ? 7.915   1.712   -1.626  0.30 17.26 ? 901  G6Q A C2  1 
HETATM 8916 C C3  B G6Q D  3 .   ? 7.406   2.442   -0.369  0.30 18.75 ? 901  G6Q A C3  1 
HETATM 8917 C C4  B G6Q D  3 .   ? 7.174   3.955   -0.538  0.30 19.53 ? 901  G6Q A C4  1 
HETATM 8918 C C5  B G6Q D  3 .   ? 6.630   4.625   0.734   0.30 19.68 ? 901  G6Q A C5  1 
HETATM 8919 C C6  B G6Q D  3 .   ? 6.232   6.066   0.471   0.30 18.82 ? 901  G6Q A C6  1 
HETATM 8920 O O1  B G6Q D  3 .   ? 9.587   1.809   -3.457  0.30 8.19  ? 901  G6Q A O1  1 
HETATM 8921 O O2  B G6Q D  3 .   ? 6.944   1.812   -2.663  0.30 18.34 ? 901  G6Q A O2  1 
HETATM 8922 O O3  B G6Q D  3 .   ? 8.236   2.185   0.762   0.30 20.82 ? 901  G6Q A O3  1 
HETATM 8923 O O4  B G6Q D  3 .   ? 8.360   4.616   -0.975  0.30 19.50 ? 901  G6Q A O4  1 
HETATM 8924 O O5  B G6Q D  3 .   ? 5.457   3.958   1.171   0.30 22.25 ? 901  G6Q A O5  1 
HETATM 8925 O O6  B G6Q D  3 .   ? 5.530   6.087   -0.771  0.30 14.57 ? 901  G6Q A O6  1 
HETATM 8926 P P   B G6Q D  3 .   ? 5.112   7.467   -1.465  0.30 13.78 ? 901  G6Q A P   1 
HETATM 8927 O O1P B G6Q D  3 .   ? 6.417   7.999   -1.989  0.30 13.60 ? 901  G6Q A O1P 1 
HETATM 8928 O O2P B G6Q D  3 .   ? 4.514   8.282   -0.339  0.30 13.22 ? 901  G6Q A O2P 1 
HETATM 8929 O O3P B G6Q D  3 .   ? 4.099   7.006   -2.480  0.30 13.20 ? 901  G6Q A O3P 1 
HETATM 8930 S S   . SO4 E  4 .   ? 8.420   -23.131 -12.491 1.00 42.30 ? 1001 SO4 A S   1 
HETATM 8931 O O1  . SO4 E  4 .   ? 7.102   -22.767 -11.967 1.00 41.90 ? 1001 SO4 A O1  1 
HETATM 8932 O O2  . SO4 E  4 .   ? 9.120   -21.933 -12.960 1.00 41.82 ? 1001 SO4 A O2  1 
HETATM 8933 O O3  . SO4 E  4 .   ? 8.220   -24.020 -13.644 1.00 43.70 ? 1001 SO4 A O3  1 
HETATM 8934 O O4  . SO4 E  4 .   ? 9.196   -23.831 -11.472 1.00 42.33 ? 1001 SO4 A O4  1 
HETATM 8935 S S   . SO4 F  4 .   ? 26.997  16.010  -18.490 1.00 76.17 ? 1002 SO4 A S   1 
HETATM 8936 O O1  . SO4 F  4 .   ? 27.131  14.736  -17.786 1.00 75.90 ? 1002 SO4 A O1  1 
HETATM 8937 O O2  . SO4 F  4 .   ? 26.093  16.887  -17.752 1.00 76.17 ? 1002 SO4 A O2  1 
HETATM 8938 O O3  . SO4 F  4 .   ? 26.466  15.781  -19.830 1.00 75.95 ? 1002 SO4 A O3  1 
HETATM 8939 O O4  . SO4 F  4 .   ? 28.306  16.651  -18.595 1.00 76.21 ? 1002 SO4 A O4  1 
HETATM 8940 C C1  . GOL G  5 .   ? 9.616   34.393  -5.387  1.00 29.98 ? 1021 GOL A C1  1 
HETATM 8941 O O1  . GOL G  5 .   ? 10.455  35.315  -4.730  1.00 29.84 ? 1021 GOL A O1  1 
HETATM 8942 C C2  . GOL G  5 .   ? 8.781   33.667  -4.338  1.00 30.08 ? 1021 GOL A C2  1 
HETATM 8943 O O2  . GOL G  5 .   ? 8.331   34.582  -3.359  1.00 29.49 ? 1021 GOL A O2  1 
HETATM 8944 C C3  . GOL G  5 .   ? 7.627   32.928  -5.011  1.00 32.17 ? 1021 GOL A C3  1 
HETATM 8945 O O3  . GOL G  5 .   ? 6.623   33.813  -5.471  1.00 33.78 ? 1021 GOL A O3  1 
HETATM 8946 C C1  . GOL H  5 .   ? -3.875  9.796   20.879  1.00 34.05 ? 1023 GOL A C1  1 
HETATM 8947 O O1  . GOL H  5 .   ? -3.133  10.123  22.022  1.00 38.54 ? 1023 GOL A O1  1 
HETATM 8948 C C2  . GOL H  5 .   ? -5.120  9.015   21.299  1.00 35.55 ? 1023 GOL A C2  1 
HETATM 8949 O O2  . GOL H  5 .   ? -6.094  9.228   20.304  1.00 36.39 ? 1023 GOL A O2  1 
HETATM 8950 C C3  . GOL H  5 .   ? -4.832  7.520   21.279  1.00 35.08 ? 1023 GOL A C3  1 
HETATM 8951 O O3  . GOL H  5 .   ? -5.057  6.903   22.526  1.00 34.32 ? 1023 GOL A O3  1 
HETATM 8952 C C1  . GOL I  5 .   ? 3.976   22.245  16.394  1.00 36.22 ? 1024 GOL A C1  1 
HETATM 8953 O O1  . GOL I  5 .   ? 4.403   21.660  17.606  1.00 37.04 ? 1024 GOL A O1  1 
HETATM 8954 C C2  . GOL I  5 .   ? 2.455   22.301  16.401  1.00 35.77 ? 1024 GOL A C2  1 
HETATM 8955 O O2  . GOL I  5 .   ? 2.029   23.567  15.934  1.00 36.43 ? 1024 GOL A O2  1 
HETATM 8956 C C3  . GOL I  5 .   ? 1.960   21.186  15.491  1.00 33.33 ? 1024 GOL A C3  1 
HETATM 8957 O O3  . GOL I  5 .   ? 0.562   21.095  15.548  1.00 33.40 ? 1024 GOL A O3  1 
HETATM 8958 C C1  . GOL J  5 .   ? 20.897  12.435  10.037  1.00 40.38 ? 1025 GOL A C1  1 
HETATM 8959 O O1  . GOL J  5 .   ? 20.297  11.230  10.453  1.00 41.91 ? 1025 GOL A O1  1 
HETATM 8960 C C2  . GOL J  5 .   ? 20.090  13.626  10.536  1.00 41.65 ? 1025 GOL A C2  1 
HETATM 8961 O O2  . GOL J  5 .   ? 20.967  14.554  11.136  1.00 43.78 ? 1025 GOL A O2  1 
HETATM 8962 C C3  . GOL J  5 .   ? 19.402  14.292  9.351   1.00 41.38 ? 1025 GOL A C3  1 
HETATM 8963 O O3  . GOL J  5 .   ? 18.749  15.465  9.778   1.00 42.23 ? 1025 GOL A O3  1 
HETATM 8964 C C1  . GOL K  5 .   ? 26.401  27.066  -6.096  1.00 39.99 ? 1026 GOL A C1  1 
HETATM 8965 O O1  . GOL K  5 .   ? 27.545  26.537  -6.738  1.00 41.93 ? 1026 GOL A O1  1 
HETATM 8966 C C2  . GOL K  5 .   ? 25.244  27.042  -7.080  1.00 39.69 ? 1026 GOL A C2  1 
HETATM 8967 O O2  . GOL K  5 .   ? 25.114  25.729  -7.579  1.00 41.30 ? 1026 GOL A O2  1 
HETATM 8968 C C3  . GOL K  5 .   ? 23.985  27.428  -6.325  1.00 39.09 ? 1026 GOL A C3  1 
HETATM 8969 O O3  . GOL K  5 .   ? 22.876  27.466  -7.190  1.00 38.50 ? 1026 GOL A O3  1 
HETATM 8970 C C1  . GOL L  5 .   ? 7.789   25.971  -7.193  1.00 39.60 ? 1027 GOL A C1  1 
HETATM 8971 O O1  . GOL L  5 .   ? 6.634   26.743  -6.967  1.00 40.14 ? 1027 GOL A O1  1 
HETATM 8972 C C2  . GOL L  5 .   ? 7.986   25.888  -8.698  1.00 39.45 ? 1027 GOL A C2  1 
HETATM 8973 O O2  . GOL L  5 .   ? 7.849   27.170  -9.263  1.00 40.75 ? 1027 GOL A O2  1 
HETATM 8974 C C3  . GOL L  5 .   ? 9.355   25.316  -9.023  1.00 38.69 ? 1027 GOL A C3  1 
HETATM 8975 O O3  . GOL L  5 .   ? 9.328   24.842  -10.355 1.00 38.26 ? 1027 GOL A O3  1 
HETATM 8976 C C1  . GOL M  5 .   ? 23.363  22.714  7.354   1.00 33.77 ? 1030 GOL A C1  1 
HETATM 8977 O O1  . GOL M  5 .   ? 23.988  22.660  6.099   1.00 38.07 ? 1030 GOL A O1  1 
HETATM 8978 C C2  . GOL M  5 .   ? 22.967  21.309  7.773   1.00 34.81 ? 1030 GOL A C2  1 
HETATM 8979 O O2  . GOL M  5 .   ? 22.964  21.249  9.181   1.00 39.09 ? 1030 GOL A O2  1 
HETATM 8980 C C3  . GOL M  5 .   ? 21.568  21.011  7.259   1.00 29.60 ? 1030 GOL A C3  1 
HETATM 8981 O O3  . GOL M  5 .   ? 21.213  19.684  7.526   1.00 38.70 ? 1030 GOL A O3  1 
HETATM 8982 C C1  . GOL N  5 .   ? 39.931  -15.642 -11.549 1.00 36.10 ? 1031 GOL A C1  1 
HETATM 8983 O O1  . GOL N  5 .   ? 40.287  -17.017 -11.540 1.00 38.08 ? 1031 GOL A O1  1 
HETATM 8984 C C2  . GOL N  5 .   ? 38.436  -15.385 -11.793 1.00 35.03 ? 1031 GOL A C2  1 
HETATM 8985 O O2  . GOL N  5 .   ? 37.681  -16.516 -11.463 1.00 37.30 ? 1031 GOL A O2  1 
HETATM 8986 C C3  . GOL N  5 .   ? 37.957  -14.267 -10.867 1.00 33.90 ? 1031 GOL A C3  1 
HETATM 8987 O O3  . GOL N  5 .   ? 36.548  -14.122 -10.838 1.00 27.33 ? 1031 GOL A O3  1 
HETATM 8988 C C1  . GOL O  5 .   ? -1.185  -7.210  -14.168 1.00 42.43 ? 1032 GOL A C1  1 
HETATM 8989 O O1  . GOL O  5 .   ? -0.003  -7.488  -14.893 1.00 41.78 ? 1032 GOL A O1  1 
HETATM 8990 C C2  . GOL O  5 .   ? -1.534  -5.742  -14.393 1.00 43.22 ? 1032 GOL A C2  1 
HETATM 8991 O O2  . GOL O  5 .   ? -1.994  -5.595  -15.716 1.00 45.10 ? 1032 GOL A O2  1 
HETATM 8992 C C3  . GOL O  5 .   ? -2.595  -5.280  -13.393 1.00 44.32 ? 1032 GOL A C3  1 
HETATM 8993 O O3  . GOL O  5 .   ? -3.784  -4.911  -14.080 1.00 47.21 ? 1032 GOL A O3  1 
HETATM 8994 S S   . SO4 P  4 .   ? 27.867  34.446  30.252  1.00 66.02 ? 1003 SO4 B S   1 
HETATM 8995 O O1  . SO4 P  4 .   ? 28.207  33.306  31.094  1.00 65.39 ? 1003 SO4 B O1  1 
HETATM 8996 O O2  . SO4 P  4 .   ? 26.452  34.772  30.431  1.00 65.98 ? 1003 SO4 B O2  1 
HETATM 8997 O O3  . SO4 P  4 .   ? 28.111  34.114  28.849  1.00 65.89 ? 1003 SO4 B O3  1 
HETATM 8998 O O4  . SO4 P  4 .   ? 28.696  35.596  30.623  1.00 65.60 ? 1003 SO4 B O4  1 
HETATM 8999 S S   . SO4 Q  4 .   ? 36.894  2.064   26.823  1.00 38.51 ? 1004 SO4 B S   1 
HETATM 9000 O O1  . SO4 Q  4 .   ? 37.483  3.138   26.033  1.00 36.48 ? 1004 SO4 B O1  1 
HETATM 9001 O O2  . SO4 Q  4 .   ? 36.600  0.912   25.962  1.00 38.32 ? 1004 SO4 B O2  1 
HETATM 9002 O O3  . SO4 Q  4 .   ? 35.655  2.542   27.448  1.00 37.24 ? 1004 SO4 B O3  1 
HETATM 9003 O O4  . SO4 Q  4 .   ? 37.848  1.660   27.854  1.00 39.44 ? 1004 SO4 B O4  1 
HETATM 9004 S S   . SO4 R  4 .   ? 44.621  8.360   -11.859 1.00 79.50 ? 1005 SO4 B S   1 
HETATM 9005 O O1  . SO4 R  4 .   ? 44.793  7.620   -10.612 1.00 79.08 ? 1005 SO4 B O1  1 
HETATM 9006 O O2  . SO4 R  4 .   ? 43.396  9.156   -11.800 1.00 79.35 ? 1005 SO4 B O2  1 
HETATM 9007 O O3  . SO4 R  4 .   ? 44.539  7.423   -12.978 1.00 79.21 ? 1005 SO4 B O3  1 
HETATM 9008 O O4  . SO4 R  4 .   ? 45.764  9.250   -12.048 1.00 79.51 ? 1005 SO4 B O4  1 
HETATM 9009 S S   . SO4 S  4 .   ? 18.385  21.038  37.945  1.00 56.17 ? 1006 SO4 B S   1 
HETATM 9010 O O1  . SO4 S  4 .   ? 18.015  19.622  37.959  1.00 56.03 ? 1006 SO4 B O1  1 
HETATM 9011 O O2  . SO4 S  4 .   ? 18.004  21.641  39.222  1.00 56.24 ? 1006 SO4 B O2  1 
HETATM 9012 O O3  . SO4 S  4 .   ? 17.676  21.730  36.869  1.00 55.69 ? 1006 SO4 B O3  1 
HETATM 9013 O O4  . SO4 S  4 .   ? 19.830  21.163  37.747  1.00 55.26 ? 1006 SO4 B O4  1 
HETATM 9014 S S   . SO4 T  4 .   ? 36.051  -29.080 21.595  1.00 65.34 ? 1007 SO4 B S   1 
HETATM 9015 O O1  . SO4 T  4 .   ? 36.761  -29.619 22.754  1.00 65.80 ? 1007 SO4 B O1  1 
HETATM 9016 O O2  . SO4 T  4 .   ? 34.625  -28.997 21.904  1.00 64.85 ? 1007 SO4 B O2  1 
HETATM 9017 O O3  . SO4 T  4 .   ? 36.256  -29.948 20.436  1.00 65.13 ? 1007 SO4 B O3  1 
HETATM 9018 O O4  . SO4 T  4 .   ? 36.580  -27.751 21.302  1.00 65.14 ? 1007 SO4 B O4  1 
HETATM 9019 S S   . SO4 U  4 .   ? 33.480  -0.749  25.498  1.00 58.24 ? 1008 SO4 B S   1 
HETATM 9020 O O1  . SO4 U  4 .   ? 32.069  -0.992  25.787  1.00 58.14 ? 1008 SO4 B O1  1 
HETATM 9021 O O2  . SO4 U  4 .   ? 33.922  0.440   26.226  1.00 58.83 ? 1008 SO4 B O2  1 
HETATM 9022 O O3  . SO4 U  4 .   ? 33.653  -0.536  24.062  1.00 58.52 ? 1008 SO4 B O3  1 
HETATM 9023 O O4  . SO4 U  4 .   ? 34.280  -1.896  25.943  1.00 58.70 ? 1008 SO4 B O4  1 
HETATM 9024 C C1  . BME V  6 .   ? 47.191  7.666   5.049   1.00 41.79 ? 1011 BME B C1  1 
HETATM 9025 C C2  . BME V  6 .   ? 47.473  9.149   5.274   1.00 42.33 ? 1011 BME B C2  1 
HETATM 9026 O O1  . BME V  6 .   ? 47.173  7.375   3.664   1.00 40.49 ? 1011 BME B O1  1 
HETATM 9027 S S2  . BME V  6 .   ? 46.003  10.062  5.821   1.00 43.86 ? 1011 BME B S2  1 
HETATM 9028 C C1  . GOL W  5 .   ? 18.437  -32.464 36.322  1.00 32.95 ? 1022 GOL B C1  1 
HETATM 9029 O O1  . GOL W  5 .   ? 18.590  -31.062 36.405  1.00 32.38 ? 1022 GOL B O1  1 
HETATM 9030 C C2  . GOL W  5 .   ? 17.610  -32.783 35.091  1.00 34.12 ? 1022 GOL B C2  1 
HETATM 9031 O O2  . GOL W  5 .   ? 18.298  -32.352 33.938  1.00 33.14 ? 1022 GOL B O2  1 
HETATM 9032 C C3  . GOL W  5 .   ? 17.320  -34.274 34.989  1.00 34.50 ? 1022 GOL B C3  1 
HETATM 9033 O O3  . GOL W  5 .   ? 16.162  -34.437 34.193  1.00 35.00 ? 1022 GOL B O3  1 
HETATM 9034 C C1  . GOL X  5 .   ? 41.115  21.958  13.874  1.00 41.32 ? 1028 GOL B C1  1 
HETATM 9035 O O1  . GOL X  5 .   ? 41.931  22.257  14.989  1.00 43.16 ? 1028 GOL B O1  1 
HETATM 9036 C C2  . GOL X  5 .   ? 40.312  20.695  14.181  1.00 41.53 ? 1028 GOL B C2  1 
HETATM 9037 O O2  . GOL X  5 .   ? 39.222  20.601  13.282  1.00 42.26 ? 1028 GOL B O2  1 
HETATM 9038 C C3  . GOL X  5 .   ? 41.164  19.431  14.057  1.00 40.84 ? 1028 GOL B C3  1 
HETATM 9039 O O3  . GOL X  5 .   ? 42.552  19.687  14.086  1.00 41.95 ? 1028 GOL B O3  1 
HETATM 9040 C C1  . GOL Y  5 .   ? 59.397  6.252   2.245   1.00 40.86 ? 1029 GOL B C1  1 
HETATM 9041 O O1  . GOL Y  5 .   ? 59.342  7.644   2.516   1.00 43.32 ? 1029 GOL B O1  1 
HETATM 9042 C C2  . GOL Y  5 .   ? 59.938  5.501   3.459   1.00 40.56 ? 1029 GOL B C2  1 
HETATM 9043 O O2  . GOL Y  5 .   ? 59.402  6.050   4.646   1.00 41.46 ? 1029 GOL B O2  1 
HETATM 9044 C C3  . GOL Y  5 .   ? 59.604  4.015   3.321   1.00 39.95 ? 1029 GOL B C3  1 
HETATM 9045 O O3  . GOL Y  5 .   ? 59.545  3.369   4.580   1.00 39.37 ? 1029 GOL B O3  1 
HETATM 9046 O O   . HOH Z  7 .   ? 11.690  6.740   6.185   1.00 16.40 ? 1033 HOH A O   1 
HETATM 9047 O O   . HOH Z  7 .   ? 17.523  -3.149  -9.025  1.00 15.32 ? 1034 HOH A O   1 
HETATM 9048 O O   . HOH Z  7 .   ? 5.637   13.942  12.917  1.00 14.32 ? 1035 HOH A O   1 
HETATM 9049 O O   . HOH Z  7 .   ? 15.985  1.316   6.800   1.00 17.51 ? 1036 HOH A O   1 
HETATM 9050 O O   . HOH Z  7 .   ? 11.919  13.243  4.920   1.00 16.46 ? 1037 HOH A O   1 
HETATM 9051 O O   . HOH Z  7 .   ? 22.759  3.175   8.321   1.00 18.75 ? 1038 HOH A O   1 
HETATM 9052 O O   . HOH Z  7 .   ? 24.824  8.764   4.974   1.00 13.67 ? 1039 HOH A O   1 
HETATM 9053 O O   . HOH Z  7 .   ? 27.792  -7.122  -2.113  1.00 15.57 ? 1040 HOH A O   1 
HETATM 9054 O O   . HOH Z  7 .   ? 9.107   9.947   20.099  1.00 17.10 ? 1041 HOH A O   1 
HETATM 9055 O O   . HOH Z  7 .   ? 32.511  -12.539 7.402   1.00 17.53 ? 1042 HOH A O   1 
HETATM 9056 O O   . HOH Z  7 .   ? 31.433  -0.918  11.788  1.00 17.40 ? 1043 HOH A O   1 
HETATM 9057 O O   . HOH Z  7 .   ? 35.967  11.283  0.935   1.00 16.57 ? 1044 HOH A O   1 
HETATM 9058 O O   . HOH Z  7 .   ? 36.241  7.971   5.483   1.00 17.35 ? 1045 HOH A O   1 
HETATM 9059 O O   . HOH Z  7 .   ? 8.585   -2.366  3.425   1.00 17.21 ? 1046 HOH A O   1 
HETATM 9060 O O   . HOH Z  7 .   ? 1.776   -5.261  5.487   1.00 18.05 ? 1047 HOH A O   1 
HETATM 9061 O O   . HOH Z  7 .   ? 18.709  -1.691  -11.107 1.00 16.63 ? 1048 HOH A O   1 
HETATM 9062 O O   . HOH Z  7 .   ? 23.970  -13.414 2.985   1.00 20.48 ? 1049 HOH A O   1 
HETATM 9063 O O   . HOH Z  7 .   ? 20.115  12.790  -16.557 1.00 19.29 ? 1050 HOH A O   1 
HETATM 9064 O O   . HOH Z  7 .   ? 48.396  -6.702  10.176  1.00 23.66 ? 1051 HOH A O   1 
HETATM 9065 O O   . HOH Z  7 .   ? 28.730  -9.781  -2.484  1.00 16.31 ? 1052 HOH A O   1 
HETATM 9066 O O   . HOH Z  7 .   ? 13.597  16.017  -1.660  1.00 16.06 ? 1053 HOH A O   1 
HETATM 9067 O O   . HOH Z  7 .   ? 5.557   9.947   20.712  1.00 18.92 ? 1054 HOH A O   1 
HETATM 9068 O O   . HOH Z  7 .   ? 18.786  -9.256  -2.644  1.00 18.24 ? 1055 HOH A O   1 
HETATM 9069 O O   . HOH Z  7 .   ? 18.234  2.674   -4.971  1.00 16.43 ? 1056 HOH A O   1 
HETATM 9070 O O   . HOH Z  7 .   ? 40.454  12.490  9.049   1.00 17.06 ? 1057 HOH A O   1 
HETATM 9071 O O   . HOH Z  7 .   ? 37.842  -9.303  -0.218  1.00 14.10 ? 1058 HOH A O   1 
HETATM 9072 O O   . HOH Z  7 .   ? 43.206  12.736  9.550   1.00 18.79 ? 1059 HOH A O   1 
HETATM 9073 O O   . HOH Z  7 .   ? 14.974  7.056   -1.396  1.00 15.30 ? 1060 HOH A O   1 
HETATM 9074 O O   . HOH Z  7 .   ? 38.400  -7.941  2.111   1.00 16.49 ? 1061 HOH A O   1 
HETATM 9075 O O   . HOH Z  7 .   ? 6.137   10.016  1.304   1.00 14.39 ? 1062 HOH A O   1 
HETATM 9076 O O   . HOH Z  7 .   ? 22.197  -2.079  11.796  1.00 17.35 ? 1063 HOH A O   1 
HETATM 9077 O O   . HOH Z  7 .   ? 16.368  2.411   -1.454  1.00 16.59 ? 1064 HOH A O   1 
HETATM 9078 O O   . HOH Z  7 .   ? 13.585  -12.896 1.604   1.00 13.86 ? 1065 HOH A O   1 
HETATM 9079 O O   . HOH Z  7 .   ? 10.537  0.265   -10.356 1.00 18.66 ? 1066 HOH A O   1 
HETATM 9080 O O   . HOH Z  7 .   ? 31.907  12.790  1.376   1.00 16.91 ? 1067 HOH A O   1 
HETATM 9081 O O   . HOH Z  7 .   ? 16.740  -8.477  0.707   1.00 13.88 ? 1068 HOH A O   1 
HETATM 9082 O O   . HOH Z  7 .   ? 15.466  -7.962  -10.647 1.00 18.94 ? 1069 HOH A O   1 
HETATM 9083 O O   . HOH Z  7 .   ? 38.788  -13.420 13.163  1.00 22.58 ? 1070 HOH A O   1 
HETATM 9084 O O   . HOH Z  7 .   ? 35.631  12.239  4.627   1.00 17.16 ? 1071 HOH A O   1 
HETATM 9085 O O   . HOH Z  7 .   ? 12.373  2.299   -11.093 1.00 17.27 ? 1072 HOH A O   1 
HETATM 9086 O O   . HOH Z  7 .   ? 40.068  -4.365  4.218   1.00 15.60 ? 1073 HOH A O   1 
HETATM 9087 O O   . HOH Z  7 .   ? 8.110   0.018   -11.834 1.00 19.87 ? 1074 HOH A O   1 
HETATM 9088 O O   . HOH Z  7 .   ? 16.057  1.225   -14.676 1.00 17.16 ? 1075 HOH A O   1 
HETATM 9089 O O   . HOH Z  7 .   ? 21.879  -8.856  -1.196  1.00 19.44 ? 1076 HOH A O   1 
HETATM 9090 O O   . HOH Z  7 .   ? 27.705  1.113   16.720  1.00 22.23 ? 1077 HOH A O   1 
HETATM 9091 O O   . HOH Z  7 .   ? 46.602  19.047  9.301   1.00 33.29 ? 1078 HOH A O   1 
HETATM 9092 O O   . HOH Z  7 .   ? 11.972  -0.815  -18.230 1.00 17.55 ? 1079 HOH A O   1 
HETATM 9093 O O   . HOH Z  7 .   ? 37.858  -11.491 5.256   1.00 17.43 ? 1080 HOH A O   1 
HETATM 9094 O O   . HOH Z  7 .   ? 37.413  -15.670 13.610  1.00 18.46 ? 1081 HOH A O   1 
HETATM 9095 O O   . HOH Z  7 .   ? 30.829  -14.097 11.152  1.00 21.67 ? 1082 HOH A O   1 
HETATM 9096 O O   . HOH Z  7 .   ? 24.050  -10.495 -1.136  1.00 18.18 ? 1083 HOH A O   1 
HETATM 9097 O O   . HOH Z  7 .   ? 31.354  -14.731 8.533   1.00 23.68 ? 1084 HOH A O   1 
HETATM 9098 O O   . HOH Z  7 .   ? 21.342  15.999  5.888   1.00 16.56 ? 1085 HOH A O   1 
HETATM 9099 O O   . HOH Z  7 .   ? 26.996  -23.691 -12.861 1.00 31.18 ? 1086 HOH A O   1 
HETATM 9100 O O   . HOH Z  7 .   ? 12.776  -8.533  -11.094 1.00 18.03 ? 1087 HOH A O   1 
HETATM 9101 O O   . HOH Z  7 .   ? 36.221  -17.783 16.158  1.00 22.74 ? 1088 HOH A O   1 
HETATM 9102 O O   . HOH Z  7 .   ? 6.334   -0.361  -7.699  1.00 21.18 ? 1089 HOH A O   1 
HETATM 9103 O O   . HOH Z  7 .   ? 40.201  8.461   -12.703 1.00 25.18 ? 1090 HOH A O   1 
HETATM 9104 O O   . HOH Z  7 .   ? 43.241  12.277  2.580   1.00 21.01 ? 1091 HOH A O   1 
HETATM 9105 O O   . HOH Z  7 .   ? 15.977  32.316  -0.837  1.00 15.76 ? 1092 HOH A O   1 
HETATM 9106 O O   . HOH Z  7 .   ? 33.863  11.084  2.873   1.00 15.65 ? 1093 HOH A O   1 
HETATM 9107 O O   . HOH Z  7 .   ? 19.478  -16.499 3.339   1.00 25.35 ? 1094 HOH A O   1 
HETATM 9108 O O   . HOH Z  7 .   ? 23.244  -5.581  -1.015  1.00 27.32 ? 1095 HOH A O   1 
HETATM 9109 O O   . HOH Z  7 .   ? 3.184   -3.408  -5.530  1.00 18.07 ? 1096 HOH A O   1 
HETATM 9110 O O   . HOH Z  7 .   ? -3.086  2.884   7.240   1.00 22.30 ? 1097 HOH A O   1 
HETATM 9111 O O   . HOH Z  7 .   ? 10.284  -0.341  -7.716  1.00 20.26 ? 1098 HOH A O   1 
HETATM 9112 O O   . HOH Z  7 .   ? 29.763  -9.775  1.434   1.00 24.88 ? 1099 HOH A O   1 
HETATM 9113 O O   . HOH Z  7 .   ? 13.514  28.890  9.458   1.00 23.58 ? 1100 HOH A O   1 
HETATM 9114 O O   . HOH Z  7 .   ? 31.865  -11.526 1.651   1.00 23.80 ? 1101 HOH A O   1 
HETATM 9115 O O   . HOH Z  7 .   ? 31.724  14.745  -8.338  1.00 17.99 ? 1102 HOH A O   1 
HETATM 9116 O O   . HOH Z  7 .   ? 21.819  5.673   -17.303 1.00 18.29 ? 1103 HOH A O   1 
HETATM 9117 O O   . HOH Z  7 .   ? 41.298  -19.055 6.820   1.00 25.22 ? 1104 HOH A O   1 
HETATM 9118 O O   . HOH Z  7 .   ? 5.311   2.240   -17.007 1.00 21.30 ? 1105 HOH A O   1 
HETATM 9119 O O   . HOH Z  7 .   ? 23.958  -4.953  -23.364 1.00 34.45 ? 1106 HOH A O   1 
HETATM 9120 O O   . HOH Z  7 .   ? -2.212  -6.273  17.897  1.00 20.50 ? 1107 HOH A O   1 
HETATM 9121 O O   . HOH Z  7 .   ? -4.665  12.840  8.604   1.00 36.53 ? 1108 HOH A O   1 
HETATM 9122 O O   . HOH Z  7 .   ? 18.110  -21.412 -0.488  1.00 21.81 ? 1109 HOH A O   1 
HETATM 9123 O O   . HOH Z  7 .   ? 43.654  -13.930 21.035  1.00 25.57 ? 1110 HOH A O   1 
HETATM 9124 O O   . HOH Z  7 .   ? 9.550   8.303   -3.702  1.00 17.81 ? 1111 HOH A O   1 
HETATM 9125 O O   . HOH Z  7 .   ? 33.788  -19.111 16.134  1.00 34.07 ? 1112 HOH A O   1 
HETATM 9126 O O   . HOH Z  7 .   ? 1.201   3.997   5.688   1.00 22.98 ? 1113 HOH A O   1 
HETATM 9127 O O   . HOH Z  7 .   ? 19.626  13.562  -19.137 1.00 23.61 ? 1114 HOH A O   1 
HETATM 9128 O O   . HOH Z  7 .   ? 25.412  -11.734 0.804   1.00 24.99 ? 1115 HOH A O   1 
HETATM 9129 O O   . HOH Z  7 .   ? 16.097  -14.097 11.548  1.00 15.55 ? 1116 HOH A O   1 
HETATM 9130 O O   . HOH Z  7 .   ? -0.562  5.023   3.982   1.00 23.75 ? 1117 HOH A O   1 
HETATM 9131 O O   . HOH Z  7 .   ? 14.813  4.505   -0.284  1.00 17.34 ? 1118 HOH A O   1 
HETATM 9132 O O   . HOH Z  7 .   ? 15.085  8.119   8.029   1.00 24.64 ? 1119 HOH A O   1 
HETATM 9133 O O   . HOH Z  7 .   ? 47.177  -24.809 16.412  1.00 33.27 ? 1120 HOH A O   1 
HETATM 9134 O O   . HOH Z  7 .   ? 5.967   11.605  6.445   1.00 16.25 ? 1121 HOH A O   1 
HETATM 9135 O O   . HOH Z  7 .   ? 22.000  1.235   10.194  1.00 26.70 ? 1122 HOH A O   1 
HETATM 9136 O O   . HOH Z  7 .   ? 23.113  -13.791 -19.317 1.00 35.64 ? 1123 HOH A O   1 
HETATM 9137 O O   . HOH Z  7 .   ? 5.476   -7.813  -3.768  1.00 15.75 ? 1124 HOH A O   1 
HETATM 9138 O O   . HOH Z  7 .   ? 28.824  9.516   -16.858 1.00 26.34 ? 1125 HOH A O   1 
HETATM 9139 O O   . HOH Z  7 .   ? 41.031  -3.166  13.720  1.00 20.91 ? 1126 HOH A O   1 
HETATM 9140 O O   . HOH Z  7 .   ? 47.914  -14.493 -2.495  1.00 22.29 ? 1127 HOH A O   1 
HETATM 9141 O O   . HOH Z  7 .   ? 6.186   7.692   -19.682 1.00 30.97 ? 1128 HOH A O   1 
HETATM 9142 O O   . HOH Z  7 .   ? -3.094  4.310   4.826   1.00 24.97 ? 1129 HOH A O   1 
HETATM 9143 O O   . HOH Z  7 .   ? 0.271   -0.569  9.829   1.00 19.83 ? 1130 HOH A O   1 
HETATM 9144 O O   . HOH Z  7 .   ? 23.363  7.154   12.440  1.00 32.49 ? 1131 HOH A O   1 
HETATM 9145 O O   . HOH Z  7 .   ? 18.400  -19.571 9.327   1.00 24.42 ? 1132 HOH A O   1 
HETATM 9146 O O   . HOH Z  7 .   ? 16.445  16.306  9.992   1.00 34.73 ? 1133 HOH A O   1 
HETATM 9147 O O   . HOH Z  7 .   ? 13.200  18.707  -22.479 1.00 34.01 ? 1134 HOH A O   1 
HETATM 9148 O O   . HOH Z  7 .   ? -7.064  -10.268 14.801  1.00 27.18 ? 1135 HOH A O   1 
HETATM 9149 O O   . HOH Z  7 .   ? 3.579   40.153  4.062   1.00 22.41 ? 1136 HOH A O   1 
HETATM 9150 O O   . HOH Z  7 .   ? 9.191   12.629  -22.773 1.00 32.07 ? 1137 HOH A O   1 
HETATM 9151 O O   . HOH Z  7 .   ? 13.682  10.961  8.342   1.00 21.75 ? 1138 HOH A O   1 
HETATM 9152 O O   . HOH Z  7 .   ? -1.062  -6.581  -1.488  1.00 18.30 ? 1139 HOH A O   1 
HETATM 9153 O O   . HOH Z  7 .   ? 28.076  -11.289 -0.373  1.00 23.87 ? 1140 HOH A O   1 
HETATM 9154 O O   . HOH Z  7 .   ? -10.611 -10.501 23.990  1.00 26.61 ? 1141 HOH A O   1 
HETATM 9155 O O   . HOH Z  7 .   ? -2.033  12.128  22.685  1.00 29.43 ? 1142 HOH A O   1 
HETATM 9156 O O   . HOH Z  7 .   ? 45.043  8.652   2.289   1.00 22.07 ? 1143 HOH A O   1 
HETATM 9157 O O   . HOH Z  7 .   ? 8.650   27.545  15.825  1.00 38.26 ? 1144 HOH A O   1 
HETATM 9158 O O   . HOH Z  7 .   ? 19.055  -18.499 5.083   1.00 31.89 ? 1145 HOH A O   1 
HETATM 9159 O O   . HOH Z  7 .   ? -5.277  -5.265  28.966  1.00 24.45 ? 1146 HOH A O   1 
HETATM 9160 O O   . HOH Z  7 .   ? 31.914  -29.947 1.870   1.00 36.11 ? 1147 HOH A O   1 
HETATM 9161 O O   . HOH Z  7 .   ? 13.638  2.070   -25.981 1.00 28.25 ? 1148 HOH A O   1 
HETATM 9162 O O   . HOH Z  7 .   ? 2.262   -1.498  6.035   1.00 24.32 ? 1149 HOH A O   1 
HETATM 9163 O O   . HOH Z  7 .   ? 33.867  8.891   -17.505 1.00 35.53 ? 1150 HOH A O   1 
HETATM 9164 O O   . HOH Z  7 .   ? 6.435   -12.082 -3.771  1.00 15.27 ? 1151 HOH A O   1 
HETATM 9165 O O   . HOH Z  7 .   ? -8.499  -9.438  25.412  1.00 26.24 ? 1152 HOH A O   1 
HETATM 9166 O O   . HOH Z  7 .   ? 9.737   -19.788 -11.118 1.00 20.65 ? 1153 HOH A O   1 
HETATM 9167 O O   . HOH Z  7 .   ? 0.870   -17.030 -2.154  1.00 21.20 ? 1154 HOH A O   1 
HETATM 9168 O O   . HOH Z  7 .   ? 1.099   37.190  2.998   1.00 27.28 ? 1155 HOH A O   1 
HETATM 9169 O O   . HOH Z  7 .   ? 51.496  -12.077 -3.519  1.00 25.38 ? 1156 HOH A O   1 
HETATM 9170 O O   . HOH Z  7 .   ? -0.054  22.319  13.276  1.00 28.45 ? 1157 HOH A O   1 
HETATM 9171 O O   . HOH Z  7 .   ? 0.722   37.597  5.818   1.00 26.85 ? 1158 HOH A O   1 
HETATM 9172 O O   . HOH Z  7 .   ? -15.737 -4.019  19.146  1.00 37.37 ? 1159 HOH A O   1 
HETATM 9173 O O   . HOH Z  7 .   ? 34.756  12.358  -8.642  1.00 19.31 ? 1160 HOH A O   1 
HETATM 9174 O O   . HOH Z  7 .   ? -2.896  9.806   25.974  1.00 31.38 ? 1161 HOH A O   1 
HETATM 9175 O O   . HOH Z  7 .   ? 14.772  -23.290 -14.474 1.00 25.52 ? 1162 HOH A O   1 
HETATM 9176 O O   . HOH Z  7 .   ? 13.224  -19.350 -8.570  1.00 20.16 ? 1163 HOH A O   1 
HETATM 9177 O O   . HOH Z  7 .   ? 7.426   -0.058  -23.192 1.00 34.04 ? 1164 HOH A O   1 
HETATM 9178 O O   . HOH Z  7 .   ? 31.333  2.786   -17.834 1.00 29.51 ? 1165 HOH A O   1 
HETATM 9179 O O   . HOH Z  7 .   ? 11.530  -26.013 -7.805  1.00 28.18 ? 1166 HOH A O   1 
HETATM 9180 O O   . HOH Z  7 .   ? 17.789  7.041   7.569   1.00 28.27 ? 1167 HOH A O   1 
HETATM 9181 O O   . HOH Z  7 .   ? 14.967  -17.513 9.913   1.00 23.80 ? 1168 HOH A O   1 
HETATM 9182 O O   . HOH Z  7 .   ? 35.748  -4.638  -15.636 1.00 32.42 ? 1169 HOH A O   1 
HETATM 9183 O O   . HOH Z  7 .   ? 36.079  -15.778 23.374  1.00 20.66 ? 1170 HOH A O   1 
HETATM 9184 O O   . HOH Z  7 .   ? 47.334  -16.616 4.009   1.00 26.47 ? 1171 HOH A O   1 
HETATM 9185 O O   . HOH Z  7 .   ? 11.848  28.285  -10.631 1.00 46.02 ? 1172 HOH A O   1 
HETATM 9186 O O   . HOH Z  7 .   ? 41.589  -24.283 0.757   1.00 29.83 ? 1173 HOH A O   1 
HETATM 9187 O O   . HOH Z  7 .   ? -9.574  -0.408  29.173  1.00 35.13 ? 1174 HOH A O   1 
HETATM 9188 O O   . HOH Z  7 .   ? 42.256  14.672  1.775   1.00 29.21 ? 1175 HOH A O   1 
HETATM 9189 O O   . HOH Z  7 .   ? 20.492  -13.628 -21.541 1.00 24.55 ? 1176 HOH A O   1 
HETATM 9190 O O   . HOH Z  7 .   ? 33.539  -23.181 3.161   1.00 36.00 ? 1177 HOH A O   1 
HETATM 9191 O O   . HOH Z  7 .   ? 41.334  14.821  -4.994  1.00 39.37 ? 1178 HOH A O   1 
HETATM 9192 O O   . HOH Z  7 .   ? 21.301  29.419  0.970   1.00 40.02 ? 1179 HOH A O   1 
HETATM 9193 O O   . HOH Z  7 .   ? 8.145   -11.524 -6.704  1.00 23.15 ? 1180 HOH A O   1 
HETATM 9194 O O   . HOH Z  7 .   ? 13.595  13.974  -14.086 1.00 20.24 ? 1181 HOH A O   1 
HETATM 9195 O O   . HOH Z  7 .   ? 43.264  -5.024  -8.892  1.00 24.29 ? 1182 HOH A O   1 
HETATM 9196 O O   . HOH Z  7 .   ? 30.655  -25.825 4.141   1.00 45.64 ? 1183 HOH A O   1 
HETATM 9197 O O   . HOH Z  7 .   ? 21.192  3.775   -21.842 1.00 39.02 ? 1184 HOH A O   1 
HETATM 9198 O O   . HOH Z  7 .   ? 38.722  -2.438  17.648  1.00 26.41 ? 1185 HOH A O   1 
HETATM 9199 O O   . HOH Z  7 .   ? 14.964  12.612  10.082  1.00 31.01 ? 1186 HOH A O   1 
HETATM 9200 O O   . HOH Z  7 .   ? -9.305  -15.191 17.356  1.00 33.20 ? 1187 HOH A O   1 
HETATM 9201 O O   . HOH Z  7 .   ? 2.897   28.949  13.863  1.00 29.14 ? 1188 HOH A O   1 
HETATM 9202 O O   . HOH Z  7 .   ? 33.870  -2.503  -19.433 1.00 32.47 ? 1189 HOH A O   1 
HETATM 9203 O O   . HOH Z  7 .   ? 41.964  -0.846  16.770  1.00 32.64 ? 1190 HOH A O   1 
HETATM 9204 O O   . HOH Z  7 .   ? 11.684  -7.877  -13.543 1.00 27.48 ? 1191 HOH A O   1 
HETATM 9205 O O   . HOH Z  7 .   ? 6.753   1.410   -9.616  1.00 22.62 ? 1192 HOH A O   1 
HETATM 9206 O O   . HOH Z  7 .   ? 20.944  25.725  -10.249 1.00 27.82 ? 1193 HOH A O   1 
HETATM 9207 O O   . HOH Z  7 .   ? 21.315  8.272   13.557  1.00 39.44 ? 1194 HOH A O   1 
HETATM 9208 O O   . HOH Z  7 .   ? 30.710  19.126  6.210   1.00 33.00 ? 1195 HOH A O   1 
HETATM 9209 O O   . HOH Z  7 .   ? -9.130  -1.029  6.040   1.00 28.75 ? 1196 HOH A O   1 
HETATM 9210 O O   . HOH Z  7 .   ? 15.962  6.489   -3.914  1.00 14.85 ? 1197 HOH A O   1 
HETATM 9211 O O   . HOH Z  7 .   ? 47.712  -11.489 6.170   1.00 22.21 ? 1198 HOH A O   1 
HETATM 9212 O O   . HOH Z  7 .   ? 26.612  22.441  -7.007  1.00 24.04 ? 1199 HOH A O   1 
HETATM 9213 O O   . HOH Z  7 .   ? 26.468  24.120  -1.538  1.00 27.25 ? 1200 HOH A O   1 
HETATM 9214 O O   . HOH Z  7 .   ? -1.581  -18.450 -2.273  1.00 22.38 ? 1201 HOH A O   1 
HETATM 9215 O O   . HOH Z  7 .   ? 29.198  -11.766 -20.745 1.00 27.32 ? 1202 HOH A O   1 
HETATM 9216 O O   . HOH Z  7 .   ? 15.959  -13.184 -19.051 1.00 30.24 ? 1203 HOH A O   1 
HETATM 9217 O O   . HOH Z  7 .   ? 35.923  5.290   -17.796 1.00 31.70 ? 1204 HOH A O   1 
HETATM 9218 O O   . HOH Z  7 .   ? 38.436  0.544   -15.911 1.00 35.46 ? 1205 HOH A O   1 
HETATM 9219 O O   . HOH Z  7 .   ? 44.599  12.568  4.959   1.00 26.20 ? 1206 HOH A O   1 
HETATM 9220 O O   . HOH Z  7 .   ? 24.942  24.363  -9.244  1.00 37.66 ? 1207 HOH A O   1 
HETATM 9221 O O   . HOH Z  7 .   ? -5.845  -3.035  30.741  1.00 39.16 ? 1208 HOH A O   1 
HETATM 9222 O O   . HOH Z  7 .   ? 11.503  25.967  -11.816 1.00 29.55 ? 1209 HOH A O   1 
HETATM 9223 O O   . HOH Z  7 .   ? 26.625  14.034  7.712   1.00 25.68 ? 1210 HOH A O   1 
HETATM 9224 O O   . HOH Z  7 .   ? 40.895  -4.768  -12.693 1.00 30.83 ? 1211 HOH A O   1 
HETATM 9225 O O   . HOH Z  7 .   ? 19.532  17.021  7.896   1.00 24.54 ? 1212 HOH A O   1 
HETATM 9226 O O   . HOH Z  7 .   ? 42.160  0.902   -13.557 1.00 29.83 ? 1213 HOH A O   1 
HETATM 9227 O O   . HOH Z  7 .   ? 39.525  -2.359  -15.187 1.00 35.72 ? 1214 HOH A O   1 
HETATM 9228 O O   . HOH Z  7 .   ? 16.361  -21.362 -15.551 1.00 21.92 ? 1215 HOH A O   1 
HETATM 9229 O O   . HOH Z  7 .   ? -8.911  -14.516 19.900  1.00 24.55 ? 1216 HOH A O   1 
HETATM 9230 O O   . HOH Z  7 .   ? 19.840  -21.562 1.737   1.00 24.23 ? 1217 HOH A O   1 
HETATM 9231 O O   . HOH Z  7 .   ? 49.167  -10.757 9.525   1.00 35.94 ? 1218 HOH A O   1 
HETATM 9232 O O   . HOH Z  7 .   ? 16.136  31.996  9.652   1.00 32.18 ? 1219 HOH A O   1 
HETATM 9233 O O   . HOH Z  7 .   ? 41.458  15.280  -1.230  1.00 25.59 ? 1220 HOH A O   1 
HETATM 9234 O O   . HOH Z  7 .   ? 44.424  -2.818  -8.229  1.00 30.26 ? 1221 HOH A O   1 
HETATM 9235 O O   . HOH Z  7 .   ? 23.463  3.045   -23.717 1.00 42.94 ? 1222 HOH A O   1 
HETATM 9236 O O   . HOH Z  7 .   ? -4.655  23.907  -5.002  1.00 44.31 ? 1223 HOH A O   1 
HETATM 9237 O O   . HOH Z  7 .   ? 46.953  14.005  4.905   1.00 41.03 ? 1224 HOH A O   1 
HETATM 9238 O O   . HOH Z  7 .   ? 21.046  30.271  3.968   1.00 41.52 ? 1225 HOH A O   1 
HETATM 9239 O O   . HOH Z  7 .   ? 3.915   37.505  -4.463  1.00 33.74 ? 1226 HOH A O   1 
HETATM 9240 O O   . HOH Z  7 .   ? 18.895  2.319   -22.916 1.00 42.97 ? 1227 HOH A O   1 
HETATM 9241 O O   . HOH Z  7 .   ? 5.901   7.578   -22.417 1.00 37.88 ? 1228 HOH A O   1 
HETATM 9242 O O   . HOH Z  7 .   ? 10.196  0.132   -25.312 1.00 31.94 ? 1229 HOH A O   1 
HETATM 9243 O O   . HOH Z  7 .   ? 34.026  -20.786 12.816  1.00 32.03 ? 1230 HOH A O   1 
HETATM 9244 O O   . HOH Z  7 .   ? -1.069  38.543  0.030   1.00 33.76 ? 1231 HOH A O   1 
HETATM 9245 O O   . HOH Z  7 .   ? 23.359  27.061  10.389  1.00 48.63 ? 1232 HOH A O   1 
HETATM 9246 O O   . HOH Z  7 .   ? 38.681  -23.077 29.342  1.00 44.25 ? 1233 HOH A O   1 
HETATM 9247 O O   . HOH Z  7 .   ? 4.221   -6.387  -17.812 1.00 26.97 ? 1234 HOH A O   1 
HETATM 9248 O O   . HOH Z  7 .   ? -1.069  29.292  -2.123  1.00 34.53 ? 1235 HOH A O   1 
HETATM 9249 O O   . HOH Z  7 .   ? -9.595  -5.898  11.319  1.00 37.17 ? 1236 HOH A O   1 
HETATM 9250 O O   . HOH Z  7 .   ? 34.801  -14.090 -12.704 1.00 30.54 ? 1237 HOH A O   1 
HETATM 9251 O O   . HOH Z  7 .   ? 34.610  -16.560 -13.854 1.00 33.49 ? 1238 HOH A O   1 
HETATM 9252 O O   . HOH Z  7 .   ? 33.273  20.878  5.185   1.00 40.02 ? 1239 HOH A O   1 
HETATM 9253 O O   . HOH Z  7 .   ? 21.172  -23.807 2.234   1.00 41.92 ? 1240 HOH A O   1 
HETATM 9254 O O   . HOH Z  7 .   ? 47.883  -10.842 -6.319  1.00 22.21 ? 1241 HOH A O   1 
HETATM 9255 O O   . HOH Z  7 .   ? 9.752   35.885  4.539   1.00 15.86 ? 1242 HOH A O   1 
HETATM 9256 O O   . HOH Z  7 .   ? 3.176   0.769   -6.821  1.00 28.05 ? 1243 HOH A O   1 
HETATM 9257 O O   . HOH Z  7 .   ? 45.308  11.326  1.284   1.00 28.81 ? 1244 HOH A O   1 
HETATM 9258 O O   . HOH Z  7 .   ? 49.369  -8.568  -6.327  1.00 29.80 ? 1245 HOH A O   1 
HETATM 9259 O O   . HOH Z  7 .   ? 8.391   -23.884 -6.364  1.00 29.57 ? 1246 HOH A O   1 
HETATM 9260 O O   . HOH Z  7 .   ? -4.345  24.373  7.138   1.00 35.32 ? 1247 HOH A O   1 
HETATM 9261 O O   . HOH Z  7 .   ? 28.127  -24.888 -14.872 1.00 37.19 ? 1248 HOH A O   1 
HETATM 9262 O O   . HOH Z  7 .   ? -5.832  25.147  4.800   1.00 42.54 ? 1249 HOH A O   1 
HETATM 9263 O O   . HOH Z  7 .   ? 50.190  15.187  15.882  1.00 42.62 ? 1250 HOH A O   1 
HETATM 9264 O O   . HOH Z  7 .   ? 51.325  -13.715 -1.471  1.00 46.71 ? 1251 HOH A O   1 
HETATM 9265 O O   . HOH Z  7 .   ? -3.601  21.905  7.220   1.00 29.50 ? 1252 HOH A O   1 
HETATM 9266 O O   . HOH Z  7 .   ? 16.539  34.806  8.591   1.00 27.93 ? 1253 HOH A O   1 
HETATM 9267 O O   . HOH Z  7 .   ? 25.400  -21.258 -19.061 1.00 39.46 ? 1254 HOH A O   1 
HETATM 9268 O O   . HOH Z  7 .   ? 19.799  0.191   -24.163 1.00 55.60 ? 1255 HOH A O   1 
HETATM 9269 O O   . HOH Z  7 .   ? -4.729  26.312  2.345   1.00 51.31 ? 1256 HOH A O   1 
HETATM 9270 O O   . HOH Z  7 .   ? 24.411  22.530  -14.088 1.00 42.77 ? 1257 HOH A O   1 
HETATM 9271 O O   . HOH Z  7 .   ? 16.465  35.129  5.749   1.00 18.58 ? 1258 HOH A O   1 
HETATM 9272 O O   . HOH Z  7 .   ? 50.227  -23.543 -5.189  1.00 23.71 ? 1259 HOH A O   1 
HETATM 9273 O O   . HOH Z  7 .   ? 52.885  -20.528 -5.759  1.00 25.60 ? 1260 HOH A O   1 
HETATM 9274 O O   . HOH Z  7 .   ? 5.909   2.321   -6.747  1.00 31.41 ? 1261 HOH A O   1 
HETATM 9275 O O   . HOH Z  7 .   ? -3.597  -2.166  33.108  1.00 41.43 ? 1262 HOH A O   1 
HETATM 9276 O O   . HOH Z  7 .   ? 46.574  17.245  6.242   1.00 43.56 ? 1263 HOH A O   1 
HETATM 9277 O O   . HOH Z  7 .   ? 52.718  -20.317 -3.260  1.00 23.50 ? 1264 HOH A O   1 
HETATM 9278 O O   . HOH Z  7 .   ? 51.154  -16.522 -1.566  1.00 28.28 ? 1265 HOH A O   1 
HETATM 9279 O O   . HOH Z  7 .   ? -8.430  -1.722  1.475   1.00 29.89 ? 1266 HOH A O   1 
HETATM 9280 O O   . HOH Z  7 .   ? -10.357 -3.470  24.283  1.00 39.35 ? 1267 HOH A O   1 
HETATM 9281 O O   . HOH Z  7 .   ? 13.180  -17.954 -15.809 1.00 46.91 ? 1268 HOH A O   1 
HETATM 9282 O O   . HOH Z  7 .   ? 27.413  -8.438  -20.016 1.00 35.80 ? 1269 HOH A O   1 
HETATM 9283 O O   . HOH Z  7 .   ? 20.735  28.526  6.248   1.00 27.61 ? 1270 HOH A O   1 
HETATM 9284 O O   . HOH Z  7 .   ? 30.549  -15.679 14.012  1.00 24.26 ? 1271 HOH A O   1 
HETATM 9285 O O   . HOH Z  7 .   ? 30.633  23.088  -0.357  1.00 33.02 ? 1272 HOH A O   1 
HETATM 9286 O O   . HOH Z  7 .   ? 28.330  12.234  -17.992 1.00 43.68 ? 1273 HOH A O   1 
HETATM 9287 O O   . HOH Z  7 .   ? 36.883  -18.372 -12.918 1.00 29.94 ? 1274 HOH A O   1 
HETATM 9288 O O   . HOH Z  7 .   ? 18.908  31.345  0.341   1.00 43.86 ? 1275 HOH A O   1 
HETATM 9289 O O   . HOH Z  7 .   ? -9.250  -7.088  26.577  1.00 38.36 ? 1276 HOH A O   1 
HETATM 9290 O O   . HOH Z  7 .   ? 13.822  16.829  11.140  1.00 28.26 ? 1277 HOH A O   1 
HETATM 9291 O O   . HOH Z  7 .   ? -7.664  17.750  -7.953  1.00 43.57 ? 1278 HOH A O   1 
HETATM 9292 O O   . HOH Z  7 .   ? 22.397  4.122   -19.476 1.00 26.28 ? 1279 HOH A O   1 
HETATM 9293 O O   . HOH Z  7 .   ? -0.922  20.958  17.623  1.00 25.24 ? 1280 HOH A O   1 
HETATM 9294 O O   . HOH Z  7 .   ? 15.110  40.164  1.820   1.00 27.27 ? 1281 HOH A O   1 
HETATM 9295 O O   . HOH Z  7 .   ? 25.828  2.990   6.964   1.00 17.12 ? 1282 HOH A O   1 
HETATM 9296 O O   . HOH Z  7 .   ? 23.766  4.758   11.618  1.00 28.19 ? 1283 HOH A O   1 
HETATM 9297 O O   . HOH Z  7 .   ? 2.905   4.492   1.049   1.00 42.27 ? 1284 HOH A O   1 
HETATM 9298 O O   . HOH Z  7 .   ? -0.195  4.366   1.482   1.00 32.60 ? 1285 HOH A O   1 
HETATM 9299 O O   . HOH Z  7 .   ? 23.899  18.857  9.184   1.00 54.14 ? 1286 HOH A O   1 
HETATM 9300 O O   . HOH Z  7 .   ? -0.206  5.641   8.926   1.00 32.05 ? 1287 HOH A O   1 
HETATM 9301 O O   . HOH Z  7 .   ? -8.061  0.226   3.303   1.00 46.96 ? 1288 HOH A O   1 
HETATM 9302 O O   . HOH Z  7 .   ? 26.740  7.332   13.984  1.00 37.17 ? 1289 HOH A O   1 
HETATM 9303 O O   . HOH Z  7 .   ? 29.618  1.545   18.722  1.00 23.94 ? 1290 HOH A O   1 
HETATM 9304 O O   . HOH Z  7 .   ? 18.702  9.187   11.185  1.00 45.20 ? 1291 HOH A O   1 
HETATM 9305 O O   . HOH Z  7 .   ? 22.355  -0.441  13.827  1.00 24.03 ? 1292 HOH A O   1 
HETATM 9306 O O   . HOH Z  7 .   ? 36.623  -3.100  19.797  1.00 31.31 ? 1293 HOH A O   1 
HETATM 9307 O O   . HOH Z  7 .   ? 11.466  -10.248 -14.907 1.00 45.40 ? 1294 HOH A O   1 
HETATM 9308 O O   . HOH Z  7 .   ? 15.203  -14.648 -16.428 1.00 37.11 ? 1295 HOH A O   1 
HETATM 9309 O O   . HOH Z  7 .   ? 16.115  12.785  -13.347 1.00 16.72 ? 1296 HOH A O   1 
HETATM 9310 O O   . HOH Z  7 .   ? 11.575  13.579  -12.062 1.00 17.83 ? 1297 HOH A O   1 
HETATM 9311 O O   . HOH Z  7 .   ? 20.615  17.787  -15.967 1.00 28.50 ? 1298 HOH A O   1 
HETATM 9312 O O   . HOH Z  7 .   ? 21.406  15.535  -19.780 1.00 37.61 ? 1299 HOH A O   1 
HETATM 9313 O O   . HOH Z  7 .   ? 49.430  -13.580 6.675   1.00 45.67 ? 1300 HOH A O   1 
HETATM 9314 O O   . HOH Z  7 .   ? 1.873   -19.831 -5.738  1.00 29.76 ? 1301 HOH A O   1 
HETATM 9315 O O   . HOH Z  7 .   ? -2.118  39.030  2.953   1.00 27.78 ? 1302 HOH A O   1 
HETATM 9316 O O   . HOH Z  7 .   ? 6.742   4.044   -4.290  1.00 36.97 ? 1303 HOH A O   1 
HETATM 9317 O O   . HOH Z  7 .   ? 8.627   0.912   -5.772  1.00 20.37 ? 1304 HOH A O   1 
HETATM 9318 O O   . HOH Z  7 .   ? -4.324  15.878  8.732   1.00 31.55 ? 1305 HOH A O   1 
HETATM 9319 O O   . HOH Z  7 .   ? 0.823   26.126  -5.100  1.00 28.48 ? 1306 HOH A O   1 
HETATM 9320 O O   . HOH Z  7 .   ? 42.380  -25.798 -7.172  1.00 51.04 ? 1307 HOH A O   1 
HETATM 9321 O O   . HOH Z  7 .   ? 36.093  16.991  -3.856  1.00 35.90 ? 1308 HOH A O   1 
HETATM 9322 O O   . HOH Z  7 .   ? 1.259   27.498  15.892  1.00 41.62 ? 1309 HOH A O   1 
HETATM 9323 O O   . HOH Z  7 .   ? 18.795  6.526   4.941   1.00 24.47 ? 1310 HOH A O   1 
HETATM 9324 O O   . HOH Z  7 .   ? 13.781  21.361  18.493  1.00 47.53 ? 1311 HOH A O   1 
HETATM 9325 O O   . HOH Z  7 .   ? 23.717  14.069  11.770  1.00 54.24 ? 1312 HOH A O   1 
HETATM 9326 O O   . HOH Z  7 .   ? 23.897  15.647  -20.500 1.00 40.97 ? 1313 HOH A O   1 
HETATM 9327 O O   . HOH Z  7 .   ? 43.438  -3.160  -13.744 1.00 43.51 ? 1314 HOH A O   1 
HETATM 9328 O O   . HOH Z  7 .   ? 47.813  -12.366 -12.444 1.00 39.38 ? 1315 HOH A O   1 
HETATM 9329 O O   . HOH Z  7 .   ? 0.004   5.695   -0.754  1.00 31.94 ? 1316 HOH A O   1 
HETATM 9330 O O   . HOH Z  7 .   ? 6.859   22.494  17.712  1.00 30.25 ? 1317 HOH A O   1 
HETATM 9331 O O   . HOH Z  7 .   ? 24.958  2.587   9.646   1.00 45.94 ? 1318 HOH A O   1 
HETATM 9332 O O   . HOH Z  7 .   ? 4.244   4.569   -3.296  1.00 38.24 ? 1319 HOH A O   1 
HETATM 9333 O O   . HOH Z  7 .   ? 1.895   -1.380  -2.842  1.00 41.48 ? 1320 HOH A O   1 
HETATM 9334 O O   . HOH Z  7 .   ? 8.244   6.294   -2.551  1.00 30.62 ? 1321 HOH A O   1 
HETATM 9335 O O   . HOH Z  7 .   ? -3.267  6.082   -3.574  1.00 40.66 ? 1322 HOH A O   1 
HETATM 9336 O O   . HOH Z  7 .   ? -4.517  -7.095  -13.190 1.00 64.17 ? 1323 HOH A O   1 
HETATM 9337 O O   . HOH Z  7 .   ? 22.037  25.164  -7.848  1.00 20.65 ? 1324 HOH A O   1 
HETATM 9338 O O   . HOH Z  7 .   ? 7.007   18.948  -13.448 1.00 25.77 ? 1325 HOH A O   1 
HETATM 9339 O O   . HOH Z  7 .   ? 19.049  -23.327 -2.066  1.00 32.03 ? 1326 HOH A O   1 
HETATM 9340 O O   . HOH Z  7 .   ? 7.683   -23.640 -1.738  1.00 30.77 ? 1327 HOH A O   1 
HETATM 9341 O O   . HOH Z  7 .   ? 42.450  -18.505 -10.194 1.00 35.12 ? 1328 HOH A O   1 
HETATM 9342 O O   . HOH Z  7 .   ? 42.156  -20.888 14.291  1.00 39.58 ? 1329 HOH A O   1 
HETATM 9343 O O   . HOH Z  7 .   ? 9.520   -18.125 -14.960 1.00 33.27 ? 1330 HOH A O   1 
HETATM 9344 O O   . HOH Z  7 .   ? -3.975  2.647   2.565   1.00 41.06 ? 1331 HOH A O   1 
HETATM 9345 O O   . HOH Z  7 .   ? 33.642  -17.350 -16.449 1.00 36.44 ? 1332 HOH A O   1 
HETATM 9346 O O   . HOH Z  7 .   ? -3.799  27.301  10.752  1.00 34.26 ? 1333 HOH A O   1 
HETATM 9347 O O   . HOH Z  7 .   ? 2.578   6.626   -10.297 1.00 33.83 ? 1334 HOH A O   1 
HETATM 9348 O O   . HOH Z  7 .   ? 38.456  -24.108 17.075  1.00 40.79 ? 1335 HOH A O   1 
HETATM 9349 O O   . HOH Z  7 .   ? 13.831  38.724  -4.985  1.00 29.50 ? 1336 HOH A O   1 
HETATM 9350 O O   . HOH Z  7 .   ? 27.086  4.741   14.096  1.00 35.83 ? 1337 HOH A O   1 
HETATM 9351 O O   . HOH Z  7 .   ? 9.007   9.727   -29.033 1.00 37.91 ? 1338 HOH A O   1 
HETATM 9352 O O   . HOH Z  7 .   ? 44.660  -28.722 4.134   1.00 44.18 ? 1339 HOH A O   1 
HETATM 9353 O O   . HOH Z  7 .   ? 27.366  -13.792 -22.018 1.00 43.10 ? 1340 HOH A O   1 
HETATM 9354 O O   . HOH Z  7 .   ? -3.794  13.133  -11.610 1.00 46.06 ? 1341 HOH A O   1 
HETATM 9355 O O   . HOH Z  7 .   ? 0.808   2.027   -13.767 1.00 39.30 ? 1342 HOH A O   1 
HETATM 9356 O O   . HOH Z  7 .   ? 7.182   28.115  6.253   1.00 29.96 ? 1343 HOH A O   1 
HETATM 9357 O O   . HOH Z  7 .   ? 19.502  17.988  -18.241 1.00 39.32 ? 1344 HOH A O   1 
HETATM 9358 O O   . HOH Z  7 .   ? 25.135  -20.106 7.212   1.00 36.03 ? 1345 HOH A O   1 
HETATM 9359 O O   . HOH Z  7 .   ? 34.282  17.178  -6.672  1.00 45.08 ? 1346 HOH A O   1 
HETATM 9360 O O   . HOH Z  7 .   ? 3.527   2.351   -19.090 1.00 44.43 ? 1347 HOH A O   1 
HETATM 9361 O O   . HOH Z  7 .   ? 26.534  0.802   8.213   1.00 33.97 ? 1348 HOH A O   1 
HETATM 9362 O O   . HOH Z  7 .   ? 18.056  -0.369  -4.436  1.00 38.82 ? 1349 HOH A O   1 
HETATM 9363 O O   . HOH Z  7 .   ? 19.836  34.538  8.369   1.00 37.90 ? 1350 HOH A O   1 
HETATM 9364 O O   . HOH Z  7 .   ? 2.418   -4.964  -21.199 1.00 38.15 ? 1351 HOH A O   1 
HETATM 9365 O O   . HOH Z  7 .   ? 17.470  -27.441 -4.161  1.00 36.68 ? 1352 HOH A O   1 
HETATM 9366 O O   . HOH Z  7 .   ? 0.136   0.099   -15.445 1.00 35.84 ? 1353 HOH A O   1 
HETATM 9367 O O   . HOH Z  7 .   ? 30.972  13.827  -15.287 1.00 46.04 ? 1354 HOH A O   1 
HETATM 9368 O O   . HOH Z  7 .   ? 12.741  -9.308  -19.007 1.00 40.10 ? 1355 HOH A O   1 
HETATM 9369 O O   . HOH Z  7 .   ? 1.936   4.497   -7.782  1.00 44.63 ? 1356 HOH A O   1 
HETATM 9370 O O   . HOH Z  7 .   ? 9.884   38.312  12.372  1.00 43.14 ? 1357 HOH A O   1 
HETATM 9371 O O   . HOH Z  7 .   ? 25.995  -28.015 0.820   1.00 44.59 ? 1358 HOH A O   1 
HETATM 9372 O O   . HOH Z  7 .   ? 21.957  27.687  -11.854 1.00 40.99 ? 1359 HOH A O   1 
HETATM 9373 O O   . HOH Z  7 .   ? 15.481  19.808  -21.755 1.00 37.49 ? 1360 HOH A O   1 
HETATM 9374 O O   . HOH Z  7 .   ? 33.054  20.384  -6.302  1.00 42.18 ? 1361 HOH A O   1 
HETATM 9375 O O   . HOH Z  7 .   ? 7.571   -25.870 -7.808  1.00 39.93 ? 1362 HOH A O   1 
HETATM 9376 O O   . HOH Z  7 .   ? -9.442  5.219   9.504   1.00 41.40 ? 1363 HOH A O   1 
HETATM 9377 O O   . HOH Z  7 .   ? 19.429  -8.884  -25.136 1.00 39.45 ? 1364 HOH A O   1 
HETATM 9378 O O   . HOH Z  7 .   ? 1.047   35.489  -1.446  1.00 37.92 ? 1365 HOH A O   1 
HETATM 9379 O O   . HOH Z  7 .   ? 8.852   -25.311 -0.198  1.00 40.35 ? 1366 HOH A O   1 
HETATM 9380 O O   . HOH Z  7 .   ? 34.313  14.494  -10.146 1.00 41.08 ? 1367 HOH A O   1 
HETATM 9381 O O   . HOH Z  7 .   ? 12.637  34.725  10.911  1.00 44.35 ? 1368 HOH A O   1 
HETATM 9382 O O   . HOH Z  7 .   ? 44.452  -17.022 -9.400  1.00 37.79 ? 1369 HOH A O   1 
HETATM 9383 O O   . HOH Z  7 .   ? -0.690  26.815  -2.942  1.00 41.54 ? 1370 HOH A O   1 
HETATM 9384 O O   . HOH Z  7 .   ? 47.641  -23.811 0.674   1.00 44.66 ? 1371 HOH A O   1 
HETATM 9385 O O   . HOH Z  7 .   ? 20.914  32.988  4.464   1.00 38.86 ? 1372 HOH A O   1 
HETATM 9386 O O   . HOH Z  7 .   ? 0.160   -19.350 -9.351  1.00 37.62 ? 1373 HOH A O   1 
HETATM 9387 O O   . HOH Z  7 .   ? 21.552  36.720  -5.313  1.00 39.15 ? 1374 HOH A O   1 
HETATM 9388 O O   . HOH Z  7 .   ? 16.382  11.448  -26.525 1.00 40.76 ? 1375 HOH A O   1 
HETATM 9389 O O   . HOH Z  7 .   ? 31.763  -19.172 -16.902 1.00 38.85 ? 1376 HOH A O   1 
HETATM 9390 O O   . HOH Z  7 .   ? 7.768   1.444   -26.531 1.00 46.79 ? 1377 HOH A O   1 
HETATM 9391 O O   . HOH Z  7 .   ? 26.922  3.728   16.453  1.00 49.33 ? 1378 HOH A O   1 
HETATM 9392 O O   . HOH Z  7 .   ? 0.229   -0.583  -0.301  1.00 39.52 ? 1379 HOH A O   1 
HETATM 9393 O O   . HOH Z  7 .   ? -1.303  12.895  -12.445 1.00 45.70 ? 1380 HOH A O   1 
HETATM 9394 O O   . HOH Z  7 .   ? 2.172   3.975   -17.491 1.00 44.30 ? 1381 HOH A O   1 
HETATM 9395 O O   . HOH Z  7 .   ? 7.400   -12.333 -8.979  1.00 43.08 ? 1382 HOH A O   1 
HETATM 9396 O O   . HOH Z  7 .   ? 9.165   32.875  14.001  1.00 45.77 ? 1383 HOH A O   1 
HETATM 9397 O O   . HOH Z  7 .   ? 5.404   -23.055 -14.421 1.00 37.59 ? 1384 HOH A O   1 
HETATM 9398 O O   . HOH Z  7 .   ? 19.150  32.593  2.619   1.00 37.14 ? 1385 HOH A O   1 
HETATM 9399 O O   . HOH Z  7 .   ? 52.485  -23.574 20.046  1.00 46.23 ? 1386 HOH A O   1 
HETATM 9400 O O   . HOH Z  7 .   ? 27.934  -33.574 -4.132  1.00 44.08 ? 1387 HOH A O   1 
HETATM 9401 O O   . HOH Z  7 .   ? -1.559  -4.604  -10.483 1.00 35.07 ? 1388 HOH A O   1 
HETATM 9402 O O   . HOH Z  7 .   ? 5.104   14.218  -17.689 1.00 43.89 ? 1389 HOH A O   1 
HETATM 9403 O O   . HOH Z  7 .   ? 12.055  -12.184 -12.738 1.00 42.14 ? 1390 HOH A O   1 
HETATM 9404 O O   . HOH Z  7 .   ? 26.011  22.672  5.526   1.00 37.89 ? 1391 HOH A O   1 
HETATM 9405 O O   . HOH Z  7 .   ? 36.014  1.190   -17.844 1.00 52.76 ? 1392 HOH A O   1 
HETATM 9406 O O   . HOH Z  7 .   ? 14.330  -11.218 -20.252 1.00 45.96 ? 1393 HOH A O   1 
HETATM 9407 O O   . HOH Z  7 .   ? 53.951  -23.571 22.514  1.00 52.37 ? 1394 HOH A O   1 
HETATM 9408 O O   . HOH Z  7 .   ? -5.383  26.079  9.057   1.00 43.09 ? 1395 HOH A O   1 
HETATM 9409 O O   . HOH Z  7 .   ? 24.719  -25.060 4.185   1.00 48.29 ? 1396 HOH A O   1 
HETATM 9410 O O   . HOH Z  7 .   ? 19.427  20.554  10.023  1.00 40.40 ? 1397 HOH A O   1 
HETATM 9411 O O   . HOH Z  7 .   ? 13.639  -13.883 -14.385 1.00 40.91 ? 1398 HOH A O   1 
HETATM 9412 O O   . HOH Z  7 .   ? 5.281   30.380  -7.051  1.00 43.76 ? 1399 HOH A O   1 
HETATM 9413 O O   . HOH Z  7 .   ? 34.042  -0.342  -17.103 1.00 42.37 ? 1400 HOH A O   1 
HETATM 9414 O O   . HOH Z  7 .   ? 20.312  -24.650 -18.758 1.00 45.28 ? 1401 HOH A O   1 
HETATM 9415 O O   . HOH Z  7 .   ? 6.330   -24.961 -10.292 1.00 41.21 ? 1402 HOH A O   1 
HETATM 9416 O O   . HOH Z  7 .   ? 43.434  -25.494 26.954  1.00 40.96 ? 1403 HOH A O   1 
HETATM 9417 O O   . HOH Z  7 .   ? 3.075   3.534   -5.814  1.00 42.87 ? 1404 HOH A O   1 
HETATM 9418 O O   . HOH Z  7 .   ? 21.033  31.109  7.806   1.00 39.87 ? 1405 HOH A O   1 
HETATM 9419 O O   . HOH Z  7 .   ? 27.515  -21.435 7.597   1.00 46.13 ? 1406 HOH A O   1 
HETATM 9420 O O   . HOH Z  7 .   ? 15.581  -5.255  -25.082 1.00 43.96 ? 1407 HOH A O   1 
HETATM 9421 O O   . HOH Z  7 .   ? 30.513  -18.536 -19.210 1.00 52.17 ? 1408 HOH A O   1 
HETATM 9422 O O   . HOH Z  7 .   ? 17.667  -24.390 -18.124 1.00 45.17 ? 1409 HOH A O   1 
HETATM 9423 O O   . HOH Z  7 .   ? 36.430  -6.085  16.947  1.00 43.35 ? 1410 HOH A O   1 
HETATM 9424 O O   . HOH Z  7 .   ? -0.070  4.152   35.332  1.00 38.04 ? 1411 HOH A O   1 
HETATM 9425 O O   . HOH Z  7 .   ? 23.035  16.436  9.625   1.00 46.50 ? 1412 HOH A O   1 
HETATM 9426 O O   . HOH Z  7 .   ? 31.355  10.682  -17.352 1.00 39.26 ? 1413 HOH A O   1 
HETATM 9427 O O   . HOH Z  7 .   ? 13.106  22.843  -20.308 1.00 39.77 ? 1414 HOH A O   1 
HETATM 9428 O O   . HOH Z  7 .   ? 11.825  22.941  -17.949 1.00 44.88 ? 1415 HOH A O   1 
HETATM 9429 O O   . HOH Z  7 .   ? -3.984  13.253  -0.481  1.00 40.74 ? 1416 HOH A O   1 
HETATM 9430 O O   . HOH Z  7 .   ? 3.322   11.655  -13.789 1.00 43.58 ? 1417 HOH A O   1 
HETATM 9431 O O   . HOH Z  7 .   ? 35.877  19.690  3.287   1.00 44.70 ? 1418 HOH A O   1 
HETATM 9432 O O   . HOH Z  7 .   ? 23.049  21.618  -16.572 1.00 39.81 ? 1419 HOH A O   1 
HETATM 9433 O O   . HOH Z  7 .   ? 7.376   10.404  -19.598 1.00 38.63 ? 1420 HOH A O   1 
HETATM 9434 O O   . HOH Z  7 .   ? 12.667  -12.088 -16.482 1.00 49.85 ? 1421 HOH A O   1 
HETATM 9435 O O   . HOH Z  7 .   ? -0.467  9.032   -9.706  1.00 42.84 ? 1422 HOH A O   1 
HETATM 9436 O O   . HOH Z  7 .   ? 8.499   7.054   -31.456 1.00 50.17 ? 1423 HOH A O   1 
HETATM 9437 O O   . HOH Z  7 .   ? -4.013  13.580  23.628  1.00 38.67 ? 1424 HOH A O   1 
HETATM 9438 O O   . HOH Z  7 .   ? -5.189  20.514  3.209   1.00 49.08 ? 1425 HOH A O   1 
HETATM 9439 O O   . HOH Z  7 .   ? 37.274  14.380  -11.630 1.00 49.50 ? 1426 HOH A O   1 
HETATM 9440 O O   . HOH Z  7 .   ? 19.414  35.789  -10.045 1.00 44.63 ? 1427 HOH A O   1 
HETATM 9441 O O   . HOH Z  7 .   ? 47.354  -21.743 -7.849  1.00 42.61 ? 1428 HOH A O   1 
HETATM 9442 O O   . HOH Z  7 .   ? -3.621  27.466  -0.219  1.00 45.78 ? 1429 HOH A O   1 
HETATM 9443 O O   . HOH Z  7 .   ? 18.988  25.826  13.496  1.00 50.81 ? 1430 HOH A O   1 
HETATM 9444 O O   . HOH Z  7 .   ? -0.613  37.040  -3.539  1.00 43.86 ? 1431 HOH A O   1 
HETATM 9445 O O   . HOH Z  7 .   ? -0.216  2.570   -6.524  1.00 43.74 ? 1432 HOH A O   1 
HETATM 9446 O O   . HOH Z  7 .   ? -0.777  7.485   -7.559  1.00 38.57 ? 1433 HOH A O   1 
HETATM 9447 O O   . HOH Z  7 .   ? -2.405  -0.283  -0.331  1.00 45.33 ? 1434 HOH A O   1 
HETATM 9448 O O   . HOH Z  7 .   ? 48.667  15.952  5.313   1.00 47.80 ? 1435 HOH A O   1 
HETATM 9449 O O   . HOH Z  7 .   ? -0.521  0.496   -22.125 1.00 48.42 ? 1436 HOH A O   1 
HETATM 9450 O O   . HOH Z  7 .   ? -2.059  -2.076  -17.212 1.00 52.02 ? 1437 HOH A O   1 
HETATM 9451 O O   . HOH Z  7 .   ? 7.044   -17.432 -16.184 1.00 41.28 ? 1438 HOH A O   1 
HETATM 9452 O O   . HOH Z  7 .   ? 43.413  -18.534 -5.391  1.00 28.30 ? 1439 HOH A O   1 
HETATM 9453 O O   . HOH Z  7 .   ? 43.368  -19.747 11.115  1.00 49.60 ? 1440 HOH A O   1 
HETATM 9454 O O   . HOH Z  7 .   ? 23.236  27.374  7.232   1.00 44.44 ? 1441 HOH A O   1 
HETATM 9455 O O   . HOH Z  7 .   ? -11.090 0.697   6.738   1.00 45.19 ? 1442 HOH A O   1 
HETATM 9456 O O   . HOH Z  7 .   ? 16.035  -25.207 -16.147 1.00 47.78 ? 1443 HOH A O   1 
HETATM 9457 O O   . HOH Z  7 .   ? 29.038  -30.299 -9.342  1.00 47.05 ? 1444 HOH A O   1 
HETATM 9458 O O   . HOH Z  7 .   ? 5.167   30.036  14.621  1.00 50.07 ? 1445 HOH A O   1 
HETATM 9459 O O   . HOH Z  7 .   ? 43.113  3.025   -16.896 1.00 47.64 ? 1446 HOH A O   1 
HETATM 9460 O O   . HOH Z  7 .   ? 18.302  -25.700 -2.291  1.00 47.75 ? 1447 HOH A O   1 
HETATM 9461 O O   . HOH Z  7 .   ? 29.724  -34.260 -6.792  1.00 46.25 ? 1448 HOH A O   1 
HETATM 9462 O O   . HOH Z  7 .   ? 1.462   37.123  9.386   1.00 36.74 ? 1449 HOH A O   1 
HETATM 9463 O O   . HOH Z  7 .   ? 30.919  -31.929 -7.313  1.00 39.34 ? 1450 HOH A O   1 
HETATM 9464 O O   . HOH Z  7 .   ? -5.243  -1.124  0.070   1.00 44.60 ? 1451 HOH A O   1 
HETATM 9465 O O   . HOH Z  7 .   ? 44.479  3.132   -14.586 1.00 53.06 ? 1452 HOH A O   1 
HETATM 9466 O O   . HOH Z  7 .   ? 6.718   25.655  16.756  1.00 52.08 ? 1453 HOH A O   1 
HETATM 9467 O O   . HOH Z  7 .   ? 44.750  -11.812 30.635  1.00 55.26 ? 1454 HOH A O   1 
HETATM 9468 O O   . HOH Z  7 .   ? 49.588  -18.114 -8.611  1.00 54.98 ? 1455 HOH A O   1 
HETATM 9469 O O   . HOH Z  7 .   ? 49.821  14.288  13.560  1.00 44.83 ? 1456 HOH A O   1 
HETATM 9470 O O   . HOH Z  7 .   ? 7.805   29.814  14.949  1.00 47.72 ? 1457 HOH A O   1 
HETATM 9471 O O   . HOH Z  7 .   ? 12.049  -20.813 -16.704 1.00 50.45 ? 1458 HOH A O   1 
HETATM 9472 O O   . HOH Z  7 .   ? 30.226  -10.833 -23.644 1.00 46.77 ? 1459 HOH A O   1 
HETATM 9473 O O   . HOH Z  7 .   ? -1.204  10.315  -11.826 1.00 51.84 ? 1460 HOH A O   1 
HETATM 9474 O O   . HOH Z  7 .   ? 50.087  -20.769 -7.659  1.00 47.20 ? 1461 HOH A O   1 
HETATM 9475 O O   . HOH Z  7 .   ? 39.074  16.810  -4.309  1.00 51.96 ? 1462 HOH A O   1 
HETATM 9476 O O   . HOH Z  7 .   ? 16.819  -8.690  -24.440 1.00 44.99 ? 1463 HOH A O   1 
HETATM 9477 O O   . HOH Z  7 .   ? -5.078  11.076  -9.852  1.00 46.80 ? 1464 HOH A O   1 
HETATM 9478 O O   . HOH Z  7 .   ? 18.809  -21.680 -19.496 1.00 47.04 ? 1465 HOH A O   1 
HETATM 9479 O O   . HOH Z  7 .   ? 17.264  26.626  11.928  1.00 43.71 ? 1466 HOH A O   1 
HETATM 9480 O O   . HOH Z  7 .   ? 27.677  -25.013 4.570   1.00 52.78 ? 1467 HOH A O   1 
HETATM 9481 O O   . HOH Z  7 .   ? -11.919 -6.778  25.109  1.00 51.77 ? 1468 HOH A O   1 
HETATM 9482 O O   . HOH Z  7 .   ? -5.267  0.526   2.974   1.00 39.25 ? 1469 HOH A O   1 
HETATM 9483 O O   . HOH Z  7 .   ? 31.962  -18.641 9.736   1.00 51.56 ? 1470 HOH A O   1 
HETATM 9484 O O   . HOH Z  7 .   ? 33.223  -19.517 7.570   1.00 42.82 ? 1471 HOH A O   1 
HETATM 9485 O O   . HOH Z  7 .   ? 26.429  -23.092 6.017   1.00 54.74 ? 1472 HOH A O   1 
HETATM 9486 O O   C HOH Z  7 .   ? 9.832   1.800   -3.237  0.70 46.21 ? 1473 HOH A O   1 
HETATM 9487 O O   . HOH AA 7 .   ? 29.002  -5.143  34.718  1.00 21.56 ? 1030 HOH B O   1 
HETATM 9488 O O   . HOH AA 7 .   ? 19.200  -1.922  11.682  1.00 16.55 ? 1031 HOH B O   1 
HETATM 9489 O O   . HOH AA 7 .   ? 17.371  6.720   21.389  1.00 16.24 ? 1032 HOH B O   1 
HETATM 9490 O O   . HOH AA 7 .   ? 2.736   -12.873 6.172   1.00 17.38 ? 1033 HOH B O   1 
HETATM 9491 O O   . HOH AA 7 .   ? 25.464  -0.539  17.258  1.00 19.18 ? 1034 HOH B O   1 
HETATM 9492 O O   . HOH AA 7 .   ? 20.485  -18.406 15.405  1.00 27.46 ? 1035 HOH B O   1 
HETATM 9493 O O   . HOH AA 7 .   ? 5.995   7.170   20.687  1.00 15.21 ? 1036 HOH B O   1 
HETATM 9494 O O   . HOH AA 7 .   ? 36.470  8.248   20.434  1.00 21.99 ? 1037 HOH B O   1 
HETATM 9495 O O   . HOH AA 7 .   ? 9.980   -0.020  12.093  1.00 15.31 ? 1038 HOH B O   1 
HETATM 9496 O O   . HOH AA 7 .   ? 25.174  -6.945  37.784  1.00 27.23 ? 1039 HOH B O   1 
HETATM 9497 O O   . HOH AA 7 .   ? 26.225  -25.234 25.987  1.00 20.72 ? 1040 HOH B O   1 
HETATM 9498 O O   . HOH AA 7 .   ? 3.138   10.343  18.420  1.00 15.57 ? 1041 HOH B O   1 
HETATM 9499 O O   . HOH AA 7 .   ? 37.640  -10.044 27.500  1.00 23.94 ? 1042 HOH B O   1 
HETATM 9500 O O   . HOH AA 7 .   ? -7.481  -20.887 1.004   1.00 18.12 ? 1043 HOH B O   1 
HETATM 9501 O O   . HOH AA 7 .   ? 16.378  -13.413 21.614  1.00 16.22 ? 1044 HOH B O   1 
HETATM 9502 O O   . HOH AA 7 .   ? -0.702  11.057  24.939  1.00 22.44 ? 1045 HOH B O   1 
HETATM 9503 O O   . HOH AA 7 .   ? 9.411   -12.702 8.912   1.00 19.27 ? 1046 HOH B O   1 
HETATM 9504 O O   . HOH AA 7 .   ? 1.574   -10.754 7.278   1.00 16.62 ? 1047 HOH B O   1 
HETATM 9505 O O   . HOH AA 7 .   ? 13.790  2.959   7.887   1.00 18.64 ? 1048 HOH B O   1 
HETATM 9506 O O   . HOH AA 7 .   ? 30.560  9.699   22.695  1.00 21.30 ? 1049 HOH B O   1 
HETATM 9507 O O   . HOH AA 7 .   ? 28.974  -10.331 40.550  1.00 26.90 ? 1050 HOH B O   1 
HETATM 9508 O O   . HOH AA 7 .   ? 36.911  12.240  14.877  1.00 16.19 ? 1051 HOH B O   1 
HETATM 9509 O O   . HOH AA 7 .   ? 19.902  -2.949  41.665  1.00 22.26 ? 1052 HOH B O   1 
HETATM 9510 O O   . HOH AA 7 .   ? 1.808   2.785   38.463  1.00 29.49 ? 1053 HOH B O   1 
HETATM 9511 O O   . HOH AA 7 .   ? 10.788  9.200   35.744  1.00 22.50 ? 1054 HOH B O   1 
HETATM 9512 O O   . HOH AA 7 .   ? 39.648  19.422  34.948  1.00 36.20 ? 1055 HOH B O   1 
HETATM 9513 O O   . HOH AA 7 .   ? 24.114  -14.057 8.286   1.00 15.96 ? 1056 HOH B O   1 
HETATM 9514 O O   . HOH AA 7 .   ? 29.111  10.822  29.685  1.00 21.51 ? 1057 HOH B O   1 
HETATM 9515 O O   . HOH AA 7 .   ? 15.894  1.915   17.694  1.00 17.75 ? 1058 HOH B O   1 
HETATM 9516 O O   . HOH AA 7 .   ? 26.546  -15.884 18.079  1.00 17.53 ? 1059 HOH B O   1 
HETATM 9517 O O   . HOH AA 7 .   ? 12.014  4.089   6.144   1.00 17.99 ? 1060 HOH B O   1 
HETATM 9518 O O   . HOH AA 7 .   ? 10.759  -11.527 19.510  1.00 22.45 ? 1061 HOH B O   1 
HETATM 9519 O O   . HOH AA 7 .   ? 35.867  -0.810  23.455  1.00 37.42 ? 1062 HOH B O   1 
HETATM 9520 O O   . HOH AA 7 .   ? 21.494  13.620  22.575  1.00 22.31 ? 1063 HOH B O   1 
HETATM 9521 O O   . HOH AA 7 .   ? 30.646  -7.076  33.336  1.00 23.24 ? 1064 HOH B O   1 
HETATM 9522 O O   . HOH AA 7 .   ? 35.091  -13.582 24.754  1.00 19.10 ? 1065 HOH B O   1 
HETATM 9523 O O   . HOH AA 7 .   ? -0.524  13.564  18.556  1.00 15.37 ? 1066 HOH B O   1 
HETATM 9524 O O   . HOH AA 7 .   ? 30.715  5.248   38.837  1.00 24.76 ? 1067 HOH B O   1 
HETATM 9525 O O   . HOH AA 7 .   ? 1.034   -4.608  18.558  1.00 15.31 ? 1068 HOH B O   1 
HETATM 9526 O O   . HOH AA 7 .   ? 7.819   -12.317 13.023  1.00 19.70 ? 1069 HOH B O   1 
HETATM 9527 O O   . HOH AA 7 .   ? 10.589  10.121  25.925  1.00 17.27 ? 1070 HOH B O   1 
HETATM 9528 O O   . HOH AA 7 .   ? 39.232  10.114  8.588   1.00 15.13 ? 1071 HOH B O   1 
HETATM 9529 O O   . HOH AA 7 .   ? 2.298   -8.734  19.549  1.00 19.07 ? 1072 HOH B O   1 
HETATM 9530 O O   . HOH AA 7 .   ? 17.647  -8.839  22.640  1.00 27.30 ? 1073 HOH B O   1 
HETATM 9531 O O   . HOH AA 7 .   ? 2.108   12.894  18.667  1.00 16.91 ? 1074 HOH B O   1 
HETATM 9532 O O   . HOH AA 7 .   ? -0.330  2.855   7.554   1.00 22.39 ? 1075 HOH B O   1 
HETATM 9533 O O   . HOH AA 7 .   ? 8.793   -14.080 11.148  1.00 18.43 ? 1076 HOH B O   1 
HETATM 9534 O O   . HOH AA 7 .   ? 2.729   1.247   6.288   1.00 23.86 ? 1077 HOH B O   1 
HETATM 9535 O O   . HOH AA 7 .   ? 2.517   -11.304 15.409  1.00 14.44 ? 1078 HOH B O   1 
HETATM 9536 O O   . HOH AA 7 .   ? 8.529   -12.907 18.699  1.00 22.02 ? 1079 HOH B O   1 
HETATM 9537 O O   . HOH AA 7 .   ? 2.707   -10.880 21.344  1.00 17.44 ? 1080 HOH B O   1 
HETATM 9538 O O   . HOH AA 7 .   ? 21.374  18.518  38.319  1.00 26.16 ? 1081 HOH B O   1 
HETATM 9539 O O   . HOH AA 7 .   ? 28.781  5.150   40.846  1.00 23.91 ? 1082 HOH B O   1 
HETATM 9540 O O   . HOH AA 7 .   ? 18.019  -22.704 38.299  1.00 22.84 ? 1083 HOH B O   1 
HETATM 9541 O O   . HOH AA 7 .   ? 12.898  -10.206 23.421  1.00 18.75 ? 1084 HOH B O   1 
HETATM 9542 O O   . HOH AA 7 .   ? 27.757  31.403  28.178  1.00 28.41 ? 1085 HOH B O   1 
HETATM 9543 O O   . HOH AA 7 .   ? 3.328   -18.557 29.976  1.00 30.61 ? 1086 HOH B O   1 
HETATM 9544 O O   . HOH AA 7 .   ? 25.884  1.149   29.087  1.00 21.77 ? 1087 HOH B O   1 
HETATM 9545 O O   . HOH AA 7 .   ? 25.062  -14.622 31.191  1.00 20.54 ? 1088 HOH B O   1 
HETATM 9546 O O   . HOH AA 7 .   ? 46.417  -2.452  -6.003  1.00 21.16 ? 1089 HOH B O   1 
HETATM 9547 O O   . HOH AA 7 .   ? 18.730  -12.063 22.222  1.00 19.80 ? 1090 HOH B O   1 
HETATM 9548 O O   . HOH AA 7 .   ? 9.597   -13.466 5.682   1.00 18.92 ? 1091 HOH B O   1 
HETATM 9549 O O   . HOH AA 7 .   ? 39.037  -8.867  16.433  1.00 23.47 ? 1092 HOH B O   1 
HETATM 9550 O O   . HOH AA 7 .   ? 33.387  10.734  6.894   1.00 15.91 ? 1093 HOH B O   1 
HETATM 9551 O O   . HOH AA 7 .   ? 22.807  3.889   45.704  1.00 28.73 ? 1094 HOH B O   1 
HETATM 9552 O O   . HOH AA 7 .   ? 11.813  -12.679 23.164  1.00 18.45 ? 1095 HOH B O   1 
HETATM 9553 O O   . HOH AA 7 .   ? 5.496   -23.265 14.234  1.00 31.01 ? 1096 HOH B O   1 
HETATM 9554 O O   . HOH AA 7 .   ? 34.548  31.329  29.227  1.00 25.51 ? 1097 HOH B O   1 
HETATM 9555 O O   . HOH AA 7 .   ? 27.552  -9.762  48.805  1.00 32.28 ? 1098 HOH B O   1 
HETATM 9556 O O   . HOH AA 7 .   ? 4.252   -10.392 -3.187  1.00 17.29 ? 1099 HOH B O   1 
HETATM 9557 O O   . HOH AA 7 .   ? 5.938   -10.202 -6.262  1.00 24.20 ? 1100 HOH B O   1 
HETATM 9558 O O   . HOH AA 7 .   ? 28.674  -15.713 33.992  1.00 32.00 ? 1101 HOH B O   1 
HETATM 9559 O O   . HOH AA 7 .   ? 49.232  -15.276 2.469   1.00 25.34 ? 1102 HOH B O   1 
HETATM 9560 O O   . HOH AA 7 .   ? 35.840  -7.749  40.256  1.00 31.43 ? 1103 HOH B O   1 
HETATM 9561 O O   . HOH AA 7 .   ? 21.306  -19.683 8.958   1.00 27.05 ? 1104 HOH B O   1 
HETATM 9562 O O   . HOH AA 7 .   ? 23.894  -11.726 20.330  1.00 16.21 ? 1105 HOH B O   1 
HETATM 9563 O O   . HOH AA 7 .   ? -1.335  -17.764 11.931  1.00 33.18 ? 1106 HOH B O   1 
HETATM 9564 O O   . HOH AA 7 .   ? 21.674  -13.179 23.286  1.00 20.98 ? 1107 HOH B O   1 
HETATM 9565 O O   . HOH AA 7 .   ? 28.652  8.902   18.550  1.00 25.52 ? 1108 HOH B O   1 
HETATM 9566 O O   . HOH AA 7 .   ? -3.385  -20.718 24.008  1.00 30.07 ? 1109 HOH B O   1 
HETATM 9567 O O   . HOH AA 7 .   ? 44.502  19.667  12.383  1.00 33.57 ? 1110 HOH B O   1 
HETATM 9568 O O   . HOH AA 7 .   ? 3.989   15.053  27.784  1.00 43.54 ? 1111 HOH B O   1 
HETATM 9569 O O   . HOH AA 7 .   ? 21.652  18.515  22.705  1.00 22.67 ? 1112 HOH B O   1 
HETATM 9570 O O   . HOH AA 7 .   ? 23.494  -9.227  31.046  1.00 20.02 ? 1113 HOH B O   1 
HETATM 9571 O O   C HOH AA 7 .   ? 4.573   0.699   4.049   0.70 23.49 ? 1114 HOH B O   1 
HETATM 9572 O O   . HOH AA 7 .   ? 22.167  3.885   43.052  1.00 24.79 ? 1115 HOH B O   1 
HETATM 9573 O O   . HOH AA 7 .   ? 56.485  -4.881  3.808   1.00 26.61 ? 1116 HOH B O   1 
HETATM 9574 O O   . HOH AA 7 .   ? -7.407  -13.299 27.055  1.00 26.41 ? 1117 HOH B O   1 
HETATM 9575 O O   . HOH AA 7 .   ? 30.299  26.289  22.576  1.00 30.93 ? 1118 HOH B O   1 
HETATM 9576 O O   . HOH AA 7 .   ? 23.294  -2.499  28.944  1.00 22.34 ? 1119 HOH B O   1 
HETATM 9577 O O   . HOH AA 7 .   ? 2.985   -23.010 30.929  1.00 32.84 ? 1120 HOH B O   1 
HETATM 9578 O O   . HOH AA 7 .   ? 49.235  -14.116 0.094   1.00 21.76 ? 1121 HOH B O   1 
HETATM 9579 O O   . HOH AA 7 .   ? 11.219  -19.925 39.961  1.00 32.66 ? 1122 HOH B O   1 
HETATM 9580 O O   . HOH AA 7 .   ? 49.118  -7.888  -3.878  1.00 22.84 ? 1123 HOH B O   1 
HETATM 9581 O O   . HOH AA 7 .   ? -2.870  -16.909 4.238   1.00 22.92 ? 1124 HOH B O   1 
HETATM 9582 O O   . HOH AA 7 .   ? 12.006  -29.114 28.839  1.00 31.10 ? 1125 HOH B O   1 
HETATM 9583 O O   . HOH AA 7 .   ? 6.434   9.001   26.056  1.00 18.01 ? 1126 HOH B O   1 
HETATM 9584 O O   . HOH AA 7 .   ? -2.612  -19.077 3.045   1.00 33.74 ? 1127 HOH B O   1 
HETATM 9585 O O   . HOH AA 7 .   ? 14.534  -19.971 10.619  1.00 30.60 ? 1128 HOH B O   1 
HETATM 9586 O O   . HOH AA 7 .   ? 23.274  4.019   20.766  1.00 27.84 ? 1129 HOH B O   1 
HETATM 9587 O O   . HOH AA 7 .   ? 31.747  29.652  40.512  1.00 23.90 ? 1130 HOH B O   1 
HETATM 9588 O O   . HOH AA 7 .   ? 27.620  -15.588 31.513  1.00 19.29 ? 1131 HOH B O   1 
HETATM 9589 O O   . HOH AA 7 .   ? -2.993  -8.218  -0.549  1.00 18.30 ? 1132 HOH B O   1 
HETATM 9590 O O   . HOH AA 7 .   ? -2.294  -8.837  30.911  1.00 28.20 ? 1133 HOH B O   1 
HETATM 9591 O O   . HOH AA 7 .   ? 41.693  -12.599 22.533  1.00 25.14 ? 1134 HOH B O   1 
HETATM 9592 O O   . HOH AA 7 .   ? 32.959  -8.050  34.840  1.00 27.80 ? 1135 HOH B O   1 
HETATM 9593 O O   . HOH AA 7 .   ? 34.377  -16.237 26.466  1.00 29.13 ? 1136 HOH B O   1 
HETATM 9594 O O   . HOH AA 7 .   ? 18.034  4.447   13.805  1.00 38.11 ? 1137 HOH B O   1 
HETATM 9595 O O   . HOH AA 7 .   ? 5.237   -21.817 32.376  1.00 33.24 ? 1138 HOH B O   1 
HETATM 9596 O O   . HOH AA 7 .   ? 18.915  7.047   13.873  1.00 31.15 ? 1139 HOH B O   1 
HETATM 9597 O O   . HOH AA 7 .   ? 33.604  -17.318 23.422  1.00 19.26 ? 1140 HOH B O   1 
HETATM 9598 O O   . HOH AA 7 .   ? -0.995  -4.708  36.894  1.00 38.61 ? 1141 HOH B O   1 
HETATM 9599 O O   . HOH AA 7 .   ? 6.802   -30.432 13.147  1.00 44.70 ? 1142 HOH B O   1 
HETATM 9600 O O   . HOH AA 7 .   ? 12.203  -13.629 20.501  1.00 23.47 ? 1143 HOH B O   1 
HETATM 9601 O O   . HOH AA 7 .   ? 26.239  4.539   39.894  1.00 22.53 ? 1144 HOH B O   1 
HETATM 9602 O O   . HOH AA 7 .   ? 3.385   -15.758 32.647  1.00 44.90 ? 1145 HOH B O   1 
HETATM 9603 O O   . HOH AA 7 .   ? 28.353  26.683  33.309  1.00 24.02 ? 1146 HOH B O   1 
HETATM 9604 O O   . HOH AA 7 .   ? 32.881  1.078   48.873  1.00 35.41 ? 1147 HOH B O   1 
HETATM 9605 O O   . HOH AA 7 .   ? 39.017  -5.254  17.116  1.00 27.98 ? 1148 HOH B O   1 
HETATM 9606 O O   . HOH AA 7 .   ? 0.497   12.913  26.297  1.00 27.53 ? 1149 HOH B O   1 
HETATM 9607 O O   . HOH AA 7 .   ? 12.411  19.460  30.458  1.00 31.78 ? 1150 HOH B O   1 
HETATM 9608 O O   . HOH AA 7 .   ? 3.544   -14.184 -11.409 1.00 31.67 ? 1151 HOH B O   1 
HETATM 9609 O O   . HOH AA 7 .   ? 35.536  37.337  28.931  1.00 40.32 ? 1152 HOH B O   1 
HETATM 9610 O O   . HOH AA 7 .   ? 25.118  -1.984  25.625  1.00 22.20 ? 1153 HOH B O   1 
HETATM 9611 O O   . HOH AA 7 .   ? 36.252  -22.077 29.924  1.00 49.05 ? 1154 HOH B O   1 
HETATM 9612 O O   . HOH AA 7 .   ? 21.223  -24.278 17.746  1.00 22.62 ? 1155 HOH B O   1 
HETATM 9613 O O   . HOH AA 7 .   ? 28.001  -19.655 31.794  1.00 37.88 ? 1156 HOH B O   1 
HETATM 9614 O O   . HOH AA 7 .   ? -12.961 -11.485 3.172   1.00 40.27 ? 1157 HOH B O   1 
HETATM 9615 O O   . HOH AA 7 .   ? 24.911  -22.653 34.764  1.00 30.84 ? 1158 HOH B O   1 
HETATM 9616 O O   . HOH AA 7 .   ? 16.824  19.556  32.281  1.00 35.26 ? 1159 HOH B O   1 
HETATM 9617 O O   . HOH AA 7 .   ? 26.884  0.141   25.119  1.00 26.33 ? 1160 HOH B O   1 
HETATM 9618 O O   . HOH AA 7 .   ? 48.511  -4.124  -6.689  1.00 31.33 ? 1161 HOH B O   1 
HETATM 9619 O O   . HOH AA 7 .   ? 23.595  -19.169 44.553  1.00 52.33 ? 1162 HOH B O   1 
HETATM 9620 O O   . HOH AA 7 .   ? 30.724  -29.404 22.470  1.00 38.86 ? 1163 HOH B O   1 
HETATM 9621 O O   . HOH AA 7 .   ? 1.268   12.665  29.284  1.00 26.68 ? 1164 HOH B O   1 
HETATM 9622 O O   . HOH AA 7 .   ? -7.884  -15.564 21.975  1.00 32.46 ? 1165 HOH B O   1 
HETATM 9623 O O   . HOH AA 7 .   ? 20.970  5.669   47.142  1.00 39.59 ? 1166 HOH B O   1 
HETATM 9624 O O   . HOH AA 7 .   ? 7.881   0.797   43.131  1.00 42.02 ? 1167 HOH B O   1 
HETATM 9625 O O   . HOH AA 7 .   ? -8.636  -8.257  11.748  1.00 40.30 ? 1168 HOH B O   1 
HETATM 9626 O O   . HOH AA 7 .   ? 22.068  -12.974 45.701  1.00 34.61 ? 1169 HOH B O   1 
HETATM 9627 O O   . HOH AA 7 .   ? 19.070  2.164   16.481  1.00 21.36 ? 1170 HOH B O   1 
HETATM 9628 O O   . HOH AA 7 .   ? 6.893   10.917  22.803  1.00 19.88 ? 1171 HOH B O   1 
HETATM 9629 O O   . HOH AA 7 .   ? -0.307  -27.168 25.726  1.00 33.93 ? 1172 HOH B O   1 
HETATM 9630 O O   . HOH AA 7 .   ? 47.236  0.095   -7.156  1.00 34.84 ? 1173 HOH B O   1 
HETATM 9631 O O   . HOH AA 7 .   ? -7.353  -4.363  12.263  1.00 22.52 ? 1174 HOH B O   1 
HETATM 9632 O O   . HOH AA 7 .   ? 15.861  -23.561 39.776  1.00 27.61 ? 1175 HOH B O   1 
HETATM 9633 O O   . HOH AA 7 .   ? 8.519   9.124   24.189  1.00 18.84 ? 1176 HOH B O   1 
HETATM 9634 O O   . HOH AA 7 .   ? 3.647   -14.124 3.077   1.00 18.42 ? 1177 HOH B O   1 
HETATM 9635 O O   . HOH AA 7 .   ? 27.013  2.441   26.903  1.00 26.09 ? 1178 HOH B O   1 
HETATM 9636 O O   . HOH AA 7 .   ? 19.128  -5.133  43.307  1.00 31.42 ? 1179 HOH B O   1 
HETATM 9637 O O   . HOH AA 7 .   ? 1.246   -15.564 -11.048 1.00 30.83 ? 1180 HOH B O   1 
HETATM 9638 O O   . HOH AA 7 .   ? 5.777   -15.815 2.835   1.00 24.89 ? 1181 HOH B O   1 
HETATM 9639 O O   . HOH AA 7 .   ? 47.120  9.075   18.593  1.00 41.73 ? 1182 HOH B O   1 
HETATM 9640 O O   . HOH AA 7 .   ? 19.659  -23.579 15.583  1.00 29.11 ? 1183 HOH B O   1 
HETATM 9641 O O   . HOH AA 7 .   ? 20.704  -19.737 13.087  1.00 29.86 ? 1184 HOH B O   1 
HETATM 9642 O O   . HOH AA 7 .   ? 4.745   19.692  21.165  1.00 35.93 ? 1185 HOH B O   1 
HETATM 9643 O O   . HOH AA 7 .   ? 49.962  -5.276  -4.430  1.00 35.94 ? 1186 HOH B O   1 
HETATM 9644 O O   . HOH AA 7 .   ? -4.832  -22.264 22.001  1.00 37.50 ? 1187 HOH B O   1 
HETATM 9645 O O   . HOH AA 7 .   ? 45.538  22.428  32.716  1.00 41.96 ? 1188 HOH B O   1 
HETATM 9646 O O   . HOH AA 7 .   ? -6.190  20.084  14.147  1.00 45.38 ? 1189 HOH B O   1 
HETATM 9647 O O   . HOH AA 7 .   ? 22.328  -7.982  46.067  1.00 37.04 ? 1190 HOH B O   1 
HETATM 9648 O O   . HOH AA 7 .   ? -4.146  -18.042 -8.823  1.00 28.18 ? 1191 HOH B O   1 
HETATM 9649 O O   . HOH AA 7 .   ? 20.526  -5.689  45.405  1.00 42.20 ? 1192 HOH B O   1 
HETATM 9650 O O   . HOH AA 7 .   ? -2.704  -18.943 -6.486  1.00 23.96 ? 1193 HOH B O   1 
HETATM 9651 O O   . HOH AA 7 .   ? -2.782  7.621   24.195  1.00 26.75 ? 1194 HOH B O   1 
HETATM 9652 O O   . HOH AA 7 .   ? 27.441  10.994  17.441  1.00 33.27 ? 1195 HOH B O   1 
HETATM 9653 O O   . HOH AA 7 .   ? 13.317  1.457   42.492  1.00 37.74 ? 1196 HOH B O   1 
HETATM 9654 O O   . HOH AA 7 .   ? 58.848  -5.259  1.645   1.00 37.10 ? 1197 HOH B O   1 
HETATM 9655 O O   . HOH AA 7 .   ? 40.385  33.878  23.406  1.00 45.26 ? 1198 HOH B O   1 
HETATM 9656 O O   . HOH AA 7 .   ? 36.574  22.010  12.650  1.00 35.40 ? 1199 HOH B O   1 
HETATM 9657 O O   . HOH AA 7 .   ? 0.113   -9.869  34.878  1.00 32.77 ? 1200 HOH B O   1 
HETATM 9658 O O   . HOH AA 7 .   ? 20.765  -22.887 13.045  1.00 33.58 ? 1201 HOH B O   1 
HETATM 9659 O O   . HOH AA 7 .   ? 29.029  15.275  17.466  1.00 32.70 ? 1202 HOH B O   1 
HETATM 9660 O O   . HOH AA 7 .   ? 20.804  -19.368 44.850  1.00 33.90 ? 1203 HOH B O   1 
HETATM 9661 O O   . HOH AA 7 .   ? 8.529   -8.621  48.654  1.00 41.46 ? 1204 HOH B O   1 
HETATM 9662 O O   . HOH AA 7 .   ? 48.008  15.013  25.982  1.00 44.28 ? 1205 HOH B O   1 
HETATM 9663 O O   . HOH AA 7 .   ? 5.888   -23.578 34.482  1.00 36.87 ? 1206 HOH B O   1 
HETATM 9664 O O   . HOH AA 7 .   ? -7.864  -6.598  29.054  1.00 34.61 ? 1207 HOH B O   1 
HETATM 9665 O O   . HOH AA 7 .   ? 28.549  -1.213  54.378  1.00 35.01 ? 1208 HOH B O   1 
HETATM 9666 O O   . HOH AA 7 .   ? 29.432  -14.023 46.588  1.00 41.56 ? 1209 HOH B O   1 
HETATM 9667 O O   . HOH AA 7 .   ? -15.862 -8.158  -3.625  1.00 39.34 ? 1210 HOH B O   1 
HETATM 9668 O O   . HOH AA 7 .   ? -3.273  19.748  20.306  1.00 37.02 ? 1211 HOH B O   1 
HETATM 9669 O O   . HOH AA 7 .   ? 31.972  -17.517 26.276  1.00 29.44 ? 1212 HOH B O   1 
HETATM 9670 O O   . HOH AA 7 .   ? 10.030  15.492  35.468  1.00 46.90 ? 1213 HOH B O   1 
HETATM 9671 O O   . HOH AA 7 .   ? -3.467  -6.400  30.930  1.00 32.12 ? 1214 HOH B O   1 
HETATM 9672 O O   . HOH AA 7 .   ? 27.127  12.739  14.887  1.00 43.40 ? 1215 HOH B O   1 
HETATM 9673 O O   . HOH AA 7 .   ? 23.276  14.889  20.963  1.00 35.77 ? 1216 HOH B O   1 
HETATM 9674 O O   . HOH AA 7 .   ? 20.218  3.431   52.970  1.00 40.60 ? 1217 HOH B O   1 
HETATM 9675 O O   . HOH AA 7 .   ? 22.952  25.719  25.682  1.00 34.34 ? 1218 HOH B O   1 
HETATM 9676 O O   . HOH AA 7 .   ? 27.231  11.717  12.248  1.00 42.44 ? 1219 HOH B O   1 
HETATM 9677 O O   . HOH AA 7 .   ? -8.346  -21.043 4.327   1.00 27.23 ? 1220 HOH B O   1 
HETATM 9678 O O   . HOH AA 7 .   ? 1.205   11.401  32.663  1.00 40.92 ? 1221 HOH B O   1 
HETATM 9679 O O   . HOH AA 7 .   ? 44.757  2.062   -9.221  1.00 42.03 ? 1222 HOH B O   1 
HETATM 9680 O O   . HOH AA 7 .   ? 11.859  -32.631 32.001  1.00 46.58 ? 1223 HOH B O   1 
HETATM 9681 O O   . HOH AA 7 .   ? -11.686 -18.399 5.348   1.00 33.34 ? 1224 HOH B O   1 
HETATM 9682 O O   . HOH AA 7 .   ? 27.990  12.119  9.751   1.00 39.01 ? 1225 HOH B O   1 
HETATM 9683 O O   . HOH AA 7 .   ? 59.095  0.098   -2.692  1.00 41.21 ? 1226 HOH B O   1 
HETATM 9684 O O   . HOH AA 7 .   ? 28.094  32.374  39.500  1.00 33.17 ? 1227 HOH B O   1 
HETATM 9685 O O   . HOH AA 7 .   ? 1.020   -20.147 30.234  1.00 49.49 ? 1228 HOH B O   1 
HETATM 9686 O O   . HOH AA 7 .   ? 5.343   -19.230 31.827  1.00 29.64 ? 1229 HOH B O   1 
HETATM 9687 O O   . HOH AA 7 .   ? 30.714  -11.586 47.485  1.00 42.26 ? 1230 HOH B O   1 
HETATM 9688 O O   . HOH AA 7 .   ? 6.628   -21.517 11.281  1.00 48.96 ? 1231 HOH B O   1 
HETATM 9689 O O   . HOH AA 7 .   ? 20.537  -30.265 34.515  1.00 23.16 ? 1232 HOH B O   1 
HETATM 9690 O O   . HOH AA 7 .   ? 10.463  -30.806 30.339  1.00 32.70 ? 1233 HOH B O   1 
HETATM 9691 O O   . HOH AA 7 .   ? 40.518  0.121   18.799  1.00 43.99 ? 1234 HOH B O   1 
HETATM 9692 O O   . HOH AA 7 .   ? 16.397  -14.569 44.426  1.00 42.92 ? 1235 HOH B O   1 
HETATM 9693 O O   . HOH AA 7 .   ? 12.318  17.511  23.370  1.00 31.88 ? 1236 HOH B O   1 
HETATM 9694 O O   . HOH AA 7 .   ? -2.075  -24.527 16.251  1.00 32.90 ? 1237 HOH B O   1 
HETATM 9695 O O   . HOH AA 7 .   ? 7.506   7.065   35.420  1.00 24.90 ? 1238 HOH B O   1 
HETATM 9696 O O   . HOH AA 7 .   ? 13.381  -28.541 35.134  1.00 47.24 ? 1239 HOH B O   1 
HETATM 9697 O O   . HOH AA 7 .   ? 46.071  5.357   -12.304 1.00 45.38 ? 1240 HOH B O   1 
HETATM 9698 O O   . HOH AA 7 .   ? 40.337  26.942  17.773  1.00 42.56 ? 1241 HOH B O   1 
HETATM 9699 O O   . HOH AA 7 .   ? 10.605  2.642   42.919  1.00 44.06 ? 1242 HOH B O   1 
HETATM 9700 O O   . HOH AA 7 .   ? 35.304  26.192  15.808  1.00 39.64 ? 1243 HOH B O   1 
HETATM 9701 O O   . HOH AA 7 .   ? 36.856  24.381  14.038  1.00 56.25 ? 1244 HOH B O   1 
HETATM 9702 O O   . HOH AA 7 .   ? 37.847  27.926  17.624  1.00 49.92 ? 1245 HOH B O   1 
HETATM 9703 O O   . HOH AA 7 .   ? 29.601  7.310   50.388  1.00 42.02 ? 1246 HOH B O   1 
HETATM 9704 O O   . HOH AA 7 .   ? 27.292  8.923   49.926  1.00 45.60 ? 1247 HOH B O   1 
HETATM 9705 O O   . HOH AA 7 .   ? 22.680  18.572  40.711  1.00 37.68 ? 1248 HOH B O   1 
HETATM 9706 O O   . HOH AA 7 .   ? 33.266  21.499  40.497  1.00 37.35 ? 1249 HOH B O   1 
HETATM 9707 O O   . HOH AA 7 .   ? 16.180  -36.775 32.981  1.00 43.50 ? 1250 HOH B O   1 
HETATM 9708 O O   . HOH AA 7 .   ? 35.982  20.824  40.175  1.00 46.15 ? 1251 HOH B O   1 
HETATM 9709 O O   . HOH AA 7 .   ? 36.225  5.244   25.137  1.00 23.70 ? 1252 HOH B O   1 
HETATM 9710 O O   . HOH AA 7 .   ? 32.307  2.449   29.573  1.00 27.98 ? 1253 HOH B O   1 
HETATM 9711 O O   . HOH AA 7 .   ? 38.111  1.306   36.012  1.00 51.18 ? 1254 HOH B O   1 
HETATM 9712 O O   . HOH AA 7 .   ? 36.810  10.527  6.285   1.00 17.76 ? 1255 HOH B O   1 
HETATM 9713 O O   . HOH AA 7 .   ? 28.096  26.235  42.227  1.00 30.12 ? 1256 HOH B O   1 
HETATM 9714 O O   . HOH AA 7 .   ? 19.003  0.359   10.029  1.00 23.94 ? 1257 HOH B O   1 
HETATM 9715 O O   . HOH AA 7 .   ? 14.640  4.665   9.781   1.00 33.35 ? 1258 HOH B O   1 
HETATM 9716 O O   . HOH AA 7 .   ? 27.041  5.952   18.128  1.00 30.53 ? 1259 HOH B O   1 
HETATM 9717 O O   . HOH AA 7 .   ? 22.147  9.245   44.036  1.00 35.67 ? 1260 HOH B O   1 
HETATM 9718 O O   . HOH AA 7 .   ? 29.594  34.486  33.327  1.00 37.72 ? 1261 HOH B O   1 
HETATM 9719 O O   . HOH AA 7 .   ? 30.359  3.917   19.529  1.00 25.67 ? 1262 HOH B O   1 
HETATM 9720 O O   . HOH AA 7 .   ? 24.807  12.103  13.284  1.00 59.41 ? 1263 HOH B O   1 
HETATM 9721 O O   . HOH AA 7 .   ? 57.068  3.388   3.024   1.00 55.37 ? 1264 HOH B O   1 
HETATM 9722 O O   . HOH AA 7 .   ? 16.020  12.713  20.296  1.00 31.05 ? 1265 HOH B O   1 
HETATM 9723 O O   . HOH AA 7 .   ? 33.682  1.178   28.152  1.00 49.20 ? 1266 HOH B O   1 
HETATM 9724 O O   . HOH AA 7 .   ? 20.773  2.466   12.374  1.00 33.18 ? 1267 HOH B O   1 
HETATM 9725 O O   . HOH AA 7 .   ? 49.378  17.666  15.282  1.00 56.30 ? 1268 HOH B O   1 
HETATM 9726 O O   . HOH AA 7 .   ? 39.415  21.254  10.279  1.00 46.59 ? 1269 HOH B O   1 
HETATM 9727 O O   . HOH AA 7 .   ? 17.852  11.608  13.456  1.00 50.40 ? 1270 HOH B O   1 
HETATM 9728 O O   . HOH AA 7 .   ? -3.616  16.917  22.756  1.00 40.81 ? 1271 HOH B O   1 
HETATM 9729 O O   . HOH AA 7 .   ? 45.091  -0.004  19.740  1.00 42.52 ? 1272 HOH B O   1 
HETATM 9730 O O   . HOH AA 7 .   ? 24.449  5.186   18.047  1.00 38.10 ? 1273 HOH B O   1 
HETATM 9731 O O   . HOH AA 7 .   ? 1.406   19.445  22.160  1.00 49.29 ? 1274 HOH B O   1 
HETATM 9732 O O   . HOH AA 7 .   ? 41.917  5.722   40.422  1.00 39.26 ? 1275 HOH B O   1 
HETATM 9733 O O   . HOH AA 7 .   ? 19.400  0.931   14.124  1.00 27.19 ? 1276 HOH B O   1 
HETATM 9734 O O   . HOH AA 7 .   ? 23.986  -30.680 30.370  1.00 30.30 ? 1277 HOH B O   1 
HETATM 9735 O O   . HOH AA 7 .   ? 15.322  8.325   12.226  1.00 44.92 ? 1278 HOH B O   1 
HETATM 9736 O O   . HOH AA 7 .   ? 13.873  13.646  17.252  1.00 38.73 ? 1279 HOH B O   1 
HETATM 9737 O O   . HOH AA 7 .   ? 15.165  12.007  15.379  1.00 35.79 ? 1280 HOH B O   1 
HETATM 9738 O O   . HOH AA 7 .   ? 16.557  6.185   12.825  1.00 42.87 ? 1281 HOH B O   1 
HETATM 9739 O O   . HOH AA 7 .   ? 18.536  13.941  16.883  1.00 47.75 ? 1282 HOH B O   1 
HETATM 9740 O O   . HOH AA 7 .   ? 7.299   15.042  30.243  1.00 44.09 ? 1283 HOH B O   1 
HETATM 9741 O O   . HOH AA 7 .   ? 7.147   3.086   44.830  1.00 43.30 ? 1284 HOH B O   1 
HETATM 9742 O O   . HOH AA 7 .   ? 15.931  6.486   44.950  1.00 47.03 ? 1285 HOH B O   1 
HETATM 9743 O O   . HOH AA 7 .   ? 55.862  1.646   3.964   1.00 38.88 ? 1286 HOH B O   1 
HETATM 9744 O O   . HOH AA 7 .   ? 13.538  18.098  37.010  1.00 45.33 ? 1287 HOH B O   1 
HETATM 9745 O O   . HOH AA 7 .   ? 12.391  -0.808  43.769  1.00 47.81 ? 1288 HOH B O   1 
HETATM 9746 O O   . HOH AA 7 .   ? 31.010  -7.021  30.695  1.00 22.94 ? 1289 HOH B O   1 
HETATM 9747 O O   . HOH AA 7 .   ? 34.931  -7.265  30.619  1.00 28.81 ? 1290 HOH B O   1 
HETATM 9748 O O   . HOH AA 7 .   ? 34.725  -5.914  33.086  1.00 34.39 ? 1291 HOH B O   1 
HETATM 9749 O O   . HOH AA 7 .   ? 31.815  -3.745  27.074  1.00 31.04 ? 1292 HOH B O   1 
HETATM 9750 O O   . HOH AA 7 .   ? 32.889  -5.450  29.235  1.00 36.04 ? 1293 HOH B O   1 
HETATM 9751 O O   . HOH AA 7 .   ? 36.293  -3.636  25.086  1.00 43.58 ? 1294 HOH B O   1 
HETATM 9752 O O   . HOH AA 7 .   ? 34.705  -2.600  28.769  1.00 45.39 ? 1295 HOH B O   1 
HETATM 9753 O O   . HOH AA 7 .   ? 44.692  -1.011  17.349  1.00 37.90 ? 1296 HOH B O   1 
HETATM 9754 O O   . HOH AA 7 .   ? 24.931  -17.712 8.834   1.00 26.49 ? 1297 HOH B O   1 
HETATM 9755 O O   . HOH AA 7 .   ? 5.442   -18.122 5.608   1.00 27.80 ? 1298 HOH B O   1 
HETATM 9756 O O   . HOH AA 7 .   ? 4.350   -20.832 9.485   1.00 34.88 ? 1299 HOH B O   1 
HETATM 9757 O O   . HOH AA 7 .   ? 15.065  -13.975 19.345  1.00 22.15 ? 1300 HOH B O   1 
HETATM 9758 O O   . HOH AA 7 .   ? 16.269  -15.072 16.842  1.00 22.04 ? 1301 HOH B O   1 
HETATM 9759 O O   . HOH AA 7 .   ? 54.482  -3.060  11.407  1.00 35.73 ? 1302 HOH B O   1 
HETATM 9760 O O   . HOH AA 7 .   ? 22.372  -8.438  33.573  1.00 19.94 ? 1303 HOH B O   1 
HETATM 9761 O O   . HOH AA 7 .   ? 29.712  -26.784 28.280  1.00 30.25 ? 1304 HOH B O   1 
HETATM 9762 O O   . HOH AA 7 .   ? 27.175  -31.528 23.054  1.00 34.92 ? 1305 HOH B O   1 
HETATM 9763 O O   . HOH AA 7 .   ? 43.062  -6.389  4.313   1.00 16.86 ? 1306 HOH B O   1 
HETATM 9764 O O   . HOH AA 7 .   ? 5.544   -2.303  42.179  1.00 37.55 ? 1307 HOH B O   1 
HETATM 9765 O O   . HOH AA 7 .   ? 58.014  -9.554  1.765   1.00 25.35 ? 1308 HOH B O   1 
HETATM 9766 O O   . HOH AA 7 .   ? 51.336  -9.434  -2.469  1.00 26.87 ? 1309 HOH B O   1 
HETATM 9767 O O   . HOH AA 7 .   ? 4.990   -11.194 37.266  1.00 32.09 ? 1310 HOH B O   1 
HETATM 9768 O O   . HOH AA 7 .   ? 25.624  -0.291  52.089  1.00 35.89 ? 1311 HOH B O   1 
HETATM 9769 O O   . HOH AA 7 .   ? 6.764   12.851  32.511  1.00 37.30 ? 1312 HOH B O   1 
HETATM 9770 O O   . HOH AA 7 .   ? -17.245 -7.251  -6.039  1.00 44.00 ? 1313 HOH B O   1 
HETATM 9771 O O   . HOH AA 7 .   ? -2.530  -25.666 24.797  1.00 50.33 ? 1314 HOH B O   1 
HETATM 9772 O O   . HOH AA 7 .   ? 27.909  21.932  43.688  1.00 36.48 ? 1315 HOH B O   1 
HETATM 9773 O O   . HOH AA 7 .   ? 29.976  -26.601 31.834  1.00 37.67 ? 1316 HOH B O   1 
HETATM 9774 O O   . HOH AA 7 .   ? 21.676  23.316  39.120  1.00 45.36 ? 1317 HOH B O   1 
HETATM 9775 O O   . HOH AA 7 .   ? 9.341   4.390   44.592  1.00 52.68 ? 1318 HOH B O   1 
HETATM 9776 O O   . HOH AA 7 .   ? 14.219  4.516   44.503  1.00 48.51 ? 1319 HOH B O   1 
HETATM 9777 O O   . HOH AA 7 .   ? 52.510  5.143   12.935  1.00 40.22 ? 1320 HOH B O   1 
HETATM 9778 O O   . HOH AA 7 .   ? 16.829  2.862   50.745  1.00 44.37 ? 1321 HOH B O   1 
HETATM 9779 O O   . HOH AA 7 .   ? 20.056  17.753  20.646  1.00 43.22 ? 1322 HOH B O   1 
HETATM 9780 O O   . HOH AA 7 .   ? 42.164  2.161   16.346  1.00 33.35 ? 1323 HOH B O   1 
HETATM 9781 O O   . HOH AA 7 .   ? -10.555 -3.923  -4.061  1.00 26.83 ? 1324 HOH B O   1 
HETATM 9782 O O   . HOH AA 7 .   ? 34.328  -3.214  22.294  1.00 45.07 ? 1325 HOH B O   1 
HETATM 9783 O O   . HOH AA 7 .   ? 32.566  -5.849  19.503  1.00 20.73 ? 1326 HOH B O   1 
HETATM 9784 O O   . HOH AA 7 .   ? 19.890  15.441  19.266  1.00 44.90 ? 1327 HOH B O   1 
HETATM 9785 O O   . HOH AA 7 .   ? 47.218  24.119  19.555  1.00 43.10 ? 1328 HOH B O   1 
HETATM 9786 O O   . HOH AA 7 .   ? 22.551  24.721  31.741  1.00 38.83 ? 1329 HOH B O   1 
HETATM 9787 O O   . HOH AA 7 .   ? 23.172  28.282  24.715  1.00 47.08 ? 1330 HOH B O   1 
HETATM 9788 O O   . HOH AA 7 .   ? 9.183   12.659  35.556  1.00 61.64 ? 1331 HOH B O   1 
HETATM 9789 O O   . HOH AA 7 .   ? -2.057  -23.179 25.829  1.00 27.63 ? 1332 HOH B O   1 
HETATM 9790 O O   . HOH AA 7 .   ? 52.124  -0.641  -0.833  1.00 27.96 ? 1333 HOH B O   1 
HETATM 9791 O O   . HOH AA 7 .   ? 51.170  2.057   -4.710  1.00 25.84 ? 1334 HOH B O   1 
HETATM 9792 O O   . HOH AA 7 .   ? 50.675  6.870   13.716  1.00 44.92 ? 1335 HOH B O   1 
HETATM 9793 O O   . HOH AA 7 .   ? 12.579  -29.337 14.394  1.00 37.27 ? 1336 HOH B O   1 
HETATM 9794 O O   . HOH AA 7 .   ? -14.313 -14.027 -4.419  1.00 44.82 ? 1337 HOH B O   1 
HETATM 9795 O O   . HOH AA 7 .   ? 33.577  -15.888 43.452  1.00 36.25 ? 1338 HOH B O   1 
HETATM 9796 O O   . HOH AA 7 .   ? 39.979  1.603   28.754  1.00 48.73 ? 1339 HOH B O   1 
HETATM 9797 O O   . HOH AA 7 .   ? -6.780  -10.592 6.743   1.00 30.43 ? 1340 HOH B O   1 
HETATM 9798 O O   . HOH AA 7 .   ? 52.829  0.539   -3.333  1.00 31.49 ? 1341 HOH B O   1 
HETATM 9799 O O   . HOH AA 7 .   ? 33.627  -3.791  25.236  1.00 38.00 ? 1342 HOH B O   1 
HETATM 9800 O O   . HOH AA 7 .   ? 21.240  -31.342 19.261  1.00 37.89 ? 1343 HOH B O   1 
HETATM 9801 O O   . HOH AA 7 .   ? -1.806  -19.685 0.428   1.00 30.24 ? 1344 HOH B O   1 
HETATM 9802 O O   . HOH AA 7 .   ? -10.789 -13.224 24.828  1.00 34.31 ? 1345 HOH B O   1 
HETATM 9803 O O   . HOH AA 7 .   ? 24.752  29.089  42.934  1.00 35.34 ? 1346 HOH B O   1 
HETATM 9804 O O   . HOH AA 7 .   ? 18.343  17.627  39.534  1.00 37.09 ? 1347 HOH B O   1 
HETATM 9805 O O   . HOH AA 7 .   ? -13.428 -15.117 -2.155  1.00 34.61 ? 1348 HOH B O   1 
HETATM 9806 O O   . HOH AA 7 .   ? 30.042  -30.884 27.171  1.00 38.73 ? 1349 HOH B O   1 
HETATM 9807 O O   . HOH AA 7 .   ? 38.835  -6.963  27.062  1.00 34.85 ? 1350 HOH B O   1 
HETATM 9808 O O   . HOH AA 7 .   ? 42.071  8.311   -9.628  1.00 36.55 ? 1351 HOH B O   1 
HETATM 9809 O O   . HOH AA 7 .   ? 36.344  24.412  24.918  1.00 34.65 ? 1352 HOH B O   1 
HETATM 9810 O O   . HOH AA 7 .   ? 8.533   -17.473 4.378   1.00 33.70 ? 1353 HOH B O   1 
HETATM 9811 O O   . HOH AA 7 .   ? 38.469  -22.800 19.306  1.00 37.32 ? 1354 HOH B O   1 
HETATM 9812 O O   . HOH AA 7 .   ? 7.681   -25.672 34.140  1.00 36.39 ? 1355 HOH B O   1 
HETATM 9813 O O   . HOH AA 7 .   ? 41.613  31.190  32.470  1.00 45.72 ? 1356 HOH B O   1 
HETATM 9814 O O   . HOH AA 7 .   ? 33.615  -11.635 45.464  1.00 44.28 ? 1357 HOH B O   1 
HETATM 9815 O O   . HOH AA 7 .   ? 6.247   -18.859 11.098  1.00 43.37 ? 1358 HOH B O   1 
HETATM 9816 O O   . HOH AA 7 .   ? -8.161  -6.761  -15.420 1.00 40.43 ? 1359 HOH B O   1 
HETATM 9817 O O   . HOH AA 7 .   ? 9.093   -21.391 39.730  1.00 46.13 ? 1360 HOH B O   1 
HETATM 9818 O O   . HOH AA 7 .   ? -1.882  -26.016 21.348  1.00 40.77 ? 1361 HOH B O   1 
HETATM 9819 O O   . HOH AA 7 .   ? 4.509   -2.971  5.959   1.00 31.26 ? 1362 HOH B O   1 
HETATM 9820 O O   . HOH AA 7 .   ? 27.380  31.886  25.424  1.00 38.23 ? 1363 HOH B O   1 
HETATM 9821 O O   . HOH AA 7 .   ? -7.111  -17.796 -9.444  1.00 34.82 ? 1364 HOH B O   1 
HETATM 9822 O O   . HOH AA 7 .   ? 9.664   -17.799 6.771   1.00 33.84 ? 1365 HOH B O   1 
HETATM 9823 O O   . HOH AA 7 .   ? 12.640  -22.923 10.991  1.00 42.01 ? 1366 HOH B O   1 
HETATM 9824 O O   . HOH AA 7 .   ? 27.603  -23.676 16.158  1.00 38.12 ? 1367 HOH B O   1 
HETATM 9825 O O   . HOH AA 7 .   ? 38.229  -6.315  29.829  1.00 37.83 ? 1368 HOH B O   1 
HETATM 9826 O O   . HOH AA 7 .   ? 0.770   -29.223 23.332  1.00 41.77 ? 1369 HOH B O   1 
HETATM 9827 O O   . HOH AA 7 .   ? -7.309  17.553  12.893  1.00 44.08 ? 1370 HOH B O   1 
HETATM 9828 O O   . HOH AA 7 .   ? 49.025  1.903   17.002  1.00 41.65 ? 1371 HOH B O   1 
HETATM 9829 O O   . HOH AA 7 .   ? 26.381  4.662   51.207  1.00 42.10 ? 1372 HOH B O   1 
HETATM 9830 O O   . HOH AA 7 .   ? -8.942  -8.660  2.936   1.00 40.12 ? 1373 HOH B O   1 
HETATM 9831 O O   . HOH AA 7 .   ? 33.567  -11.241 48.993  1.00 49.17 ? 1374 HOH B O   1 
HETATM 9832 O O   . HOH AA 7 .   ? 52.258  4.513   -4.935  1.00 39.16 ? 1375 HOH B O   1 
HETATM 9833 O O   . HOH AA 7 .   ? 32.255  -26.001 33.628  1.00 41.85 ? 1376 HOH B O   1 
HETATM 9834 O O   . HOH AA 7 .   ? -14.514 -15.376 -7.446  1.00 39.61 ? 1377 HOH B O   1 
HETATM 9835 O O   . HOH AA 7 .   ? 35.976  -16.394 38.580  1.00 38.99 ? 1378 HOH B O   1 
HETATM 9836 O O   . HOH AA 7 .   ? 24.949  31.139  28.590  1.00 37.93 ? 1379 HOH B O   1 
HETATM 9837 O O   . HOH AA 7 .   ? 46.240  1.474   15.062  1.00 43.09 ? 1380 HOH B O   1 
HETATM 9838 O O   . HOH AA 7 .   ? 58.575  -1.484  -4.881  1.00 41.65 ? 1381 HOH B O   1 
HETATM 9839 O O   . HOH AA 7 .   ? -11.445 -14.549 21.849  1.00 40.48 ? 1382 HOH B O   1 
HETATM 9840 O O   . HOH AA 7 .   ? -15.546 -11.983 -4.522  1.00 39.69 ? 1383 HOH B O   1 
HETATM 9841 O O   . HOH AA 7 .   ? -8.622  -23.236 16.606  1.00 45.52 ? 1384 HOH B O   1 
HETATM 9842 O O   . HOH AA 7 .   ? 31.441  -27.746 18.100  1.00 46.36 ? 1385 HOH B O   1 
HETATM 9843 O O   . HOH AA 7 .   ? 56.138  -3.384  5.893   1.00 47.58 ? 1386 HOH B O   1 
HETATM 9844 O O   . HOH AA 7 .   ? -4.205  -24.613 17.938  1.00 43.99 ? 1387 HOH B O   1 
HETATM 9845 O O   . HOH AA 7 .   ? 4.391   -30.682 29.340  1.00 52.77 ? 1388 HOH B O   1 
HETATM 9846 O O   . HOH AA 7 .   ? 50.247  -5.418  17.238  1.00 36.25 ? 1389 HOH B O   1 
HETATM 9847 O O   . HOH AA 7 .   ? -0.386  -28.698 28.015  1.00 44.94 ? 1390 HOH B O   1 
HETATM 9848 O O   . HOH AA 7 .   ? 16.680  0.789   52.382  1.00 47.57 ? 1391 HOH B O   1 
HETATM 9849 O O   . HOH AA 7 .   ? -10.950 -17.414 20.909  1.00 43.76 ? 1392 HOH B O   1 
HETATM 9850 O O   . HOH AA 7 .   ? 23.503  25.494  29.527  1.00 46.33 ? 1393 HOH B O   1 
HETATM 9851 O O   . HOH AA 7 .   ? 11.488  -25.155 11.944  1.00 43.85 ? 1394 HOH B O   1 
HETATM 9852 O O   . HOH AA 7 .   ? -9.563  -17.518 -11.498 1.00 44.68 ? 1395 HOH B O   1 
HETATM 9853 O O   . HOH AA 7 .   ? 30.167  -19.403 11.750  1.00 46.53 ? 1396 HOH B O   1 
HETATM 9854 O O   . HOH AA 7 .   ? -8.660  -11.010 27.585  1.00 41.17 ? 1397 HOH B O   1 
HETATM 9855 O O   . HOH AA 7 .   ? 49.558  17.408  28.274  1.00 47.15 ? 1398 HOH B O   1 
HETATM 9856 O O   . HOH AA 7 .   ? 42.596  0.679   21.041  1.00 42.66 ? 1399 HOH B O   1 
HETATM 9857 O O   . HOH AA 7 .   ? 14.138  -18.186 43.132  1.00 50.12 ? 1400 HOH B O   1 
HETATM 9858 O O   . HOH AA 7 .   ? 51.291  1.157   15.991  1.00 45.72 ? 1401 HOH B O   1 
HETATM 9859 O O   . HOH AA 7 .   ? -2.694  -2.796  38.595  1.00 48.30 ? 1402 HOH B O   1 
HETATM 9860 O O   . HOH AA 7 .   ? 28.305  -18.442 35.096  1.00 50.07 ? 1403 HOH B O   1 
HETATM 9861 O O   . HOH AA 7 .   ? 47.371  21.211  30.194  1.00 40.36 ? 1404 HOH B O   1 
HETATM 9862 O O   . HOH AA 7 .   ? 52.349  -3.835  -4.327  1.00 38.76 ? 1405 HOH B O   1 
HETATM 9863 O O   . HOH AA 7 .   ? 32.778  -0.703  52.215  1.00 39.09 ? 1406 HOH B O   1 
HETATM 9864 O O   . HOH AA 7 .   ? 52.770  10.015  2.755   1.00 46.30 ? 1407 HOH B O   1 
HETATM 9865 O O   . HOH AA 7 .   ? 37.562  30.973  34.258  1.00 42.76 ? 1408 HOH B O   1 
HETATM 9866 O O   . HOH AA 7 .   ? 25.703  2.433   52.373  1.00 46.29 ? 1409 HOH B O   1 
HETATM 9867 O O   . HOH AA 7 .   ? -7.143  16.526  15.348  1.00 43.01 ? 1410 HOH B O   1 
HETATM 9868 O O   . HOH AA 7 .   ? 13.036  -17.044 40.574  1.00 45.78 ? 1411 HOH B O   1 
HETATM 9869 O O   . HOH AA 7 .   ? -7.105  -16.437 32.573  1.00 47.60 ? 1412 HOH B O   1 
HETATM 9870 O O   . HOH AA 7 .   ? -9.850  -3.674  -1.462  1.00 49.39 ? 1413 HOH B O   1 
HETATM 9871 O O   . HOH AA 7 .   ? 26.561  -21.632 32.808  1.00 47.86 ? 1414 HOH B O   1 
HETATM 9872 O O   . HOH AA 7 .   ? 3.325   -19.055 7.483   1.00 39.75 ? 1415 HOH B O   1 
HETATM 9873 O O   . HOH AA 7 .   ? 38.955  -7.773  40.840  1.00 49.06 ? 1416 HOH B O   1 
HETATM 9874 O O   . HOH AA 7 .   ? 48.383  26.217  20.780  1.00 45.56 ? 1417 HOH B O   1 
HETATM 9875 O O   . HOH AA 7 .   ? 6.754   -30.899 30.323  1.00 51.85 ? 1418 HOH B O   1 
HETATM 9876 O O   . HOH AA 7 .   ? -7.807  -9.022  30.172  1.00 46.66 ? 1419 HOH B O   1 
HETATM 9877 O O   . HOH AA 7 .   ? 46.825  17.772  22.149  1.00 36.46 ? 1420 HOH B O   1 
HETATM 9878 O O   . HOH AA 7 .   ? 49.980  0.365   -7.462  1.00 53.06 ? 1421 HOH B O   1 
HETATM 9879 O O   . HOH AA 7 .   ? -7.827  -8.993  5.105   1.00 48.97 ? 1422 HOH B O   1 
HETATM 9880 O O   . HOH AA 7 .   ? 31.359  -20.268 14.085  1.00 50.86 ? 1423 HOH B O   1 
HETATM 9881 O O   . HOH AA 7 .   ? 47.567  20.292  22.371  1.00 40.00 ? 1424 HOH B O   1 
HETATM 9882 O O   . HOH AA 7 .   ? 17.057  -19.352 6.649   1.00 45.23 ? 1425 HOH B O   1 
HETATM 9883 O O   . HOH AA 7 .   ? 23.642  8.637   46.205  1.00 52.46 ? 1426 HOH B O   1 
HETATM 9884 O O   . HOH AA 7 .   ? 53.795  5.152   -2.856  1.00 45.29 ? 1427 HOH B O   1 
HETATM 9885 O O   . HOH AA 7 .   ? 15.667  10.049  10.306  1.00 44.79 ? 1428 HOH B O   1 
HETATM 9886 O O   . HOH AA 7 .   ? 17.569  -25.355 14.503  1.00 50.58 ? 1429 HOH B O   1 
HETATM 9887 O O   . HOH AA 7 .   ? 43.157  20.355  16.575  1.00 50.86 ? 1430 HOH B O   1 
HETATM 9888 O O   . HOH AA 7 .   ? -3.035  -22.013 28.059  1.00 48.63 ? 1431 HOH B O   1 
HETATM 9889 O O   . HOH AA 7 .   ? -1.320  -4.544  40.477  1.00 56.07 ? 1432 HOH B O   1 
HETATM 9890 O O   . HOH AA 7 .   ? 14.753  -18.400 7.387   1.00 48.49 ? 1433 HOH B O   1 
HETATM 9891 O O   . HOH AA 7 .   ? 32.291  -3.393  54.231  1.00 49.59 ? 1434 HOH B O   1 
HETATM 9892 O O   . HOH AA 7 .   ? 38.135  -25.871 22.828  1.00 48.31 ? 1435 HOH B O   1 
HETATM 9893 O O   . HOH AA 7 .   ? 26.621  25.231  19.612  1.00 48.79 ? 1436 HOH B O   1 
HETATM 9894 O O   . HOH AA 7 .   ? 29.735  34.260  24.117  1.00 50.95 ? 1437 HOH B O   1 
HETATM 9895 O O   . HOH AA 7 .   ? -3.356  -16.756 7.113   1.00 50.25 ? 1438 HOH B O   1 
HETATM 9896 O O   . HOH AA 7 .   ? 48.507  6.678   16.901  1.00 47.15 ? 1439 HOH B O   1 
HETATM 9897 O O   . HOH AA 7 .   ? 8.051   -17.391 8.770   1.00 52.09 ? 1440 HOH B O   1 
HETATM 9898 O O   . HOH AA 7 .   ? 19.306  24.536  36.027  1.00 52.88 ? 1441 HOH B O   1 
HETATM 9899 O O   . HOH AA 7 .   ? -4.714  -19.983 28.199  1.00 46.74 ? 1442 HOH B O   1 
HETATM 9900 O O   . HOH AA 7 .   ? 46.931  12.082  19.383  1.00 37.35 ? 1443 HOH B O   1 
HETATM 9901 O O   . HOH AA 7 .   ? 55.585  3.605   5.853   1.00 36.91 ? 1444 HOH B O   1 
HETATM 9902 O O   . HOH AA 7 .   ? 51.382  -2.893  -1.206  1.00 36.27 ? 1445 HOH B O   1 
HETATM 9903 O O   . HOH AA 7 .   ? 36.933  5.247   36.236  1.00 39.86 ? 1446 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   ALA 2   1   1   ALA ALA A . n 
A 1 3   ALA 3   2   2   ALA ALA A . n 
A 1 4   LEU 4   3   3   LEU LEU A . n 
A 1 5   THR 5   4   4   THR THR A . n 
A 1 6   ARG 6   5   5   ARG ARG A . n 
A 1 7   ASN 7   6   6   ASN ASN A . n 
A 1 8   PRO 8   7   7   PRO PRO A . n 
A 1 9   GLN 9   8   8   GLN GLN A . n 
A 1 10  PHE 10  9   9   PHE PHE A . n 
A 1 11  GLN 11  10  10  GLN GLN A . n 
A 1 12  LYS 12  11  11  LYS LYS A . n 
A 1 13  LEU 13  12  12  LEU LEU A . n 
A 1 14  LEU 14  13  13  LEU LEU A . n 
A 1 15  GLU 15  14  14  GLU GLU A . n 
A 1 16  TRP 16  15  15  TRP TRP A . n 
A 1 17  HIS 17  16  16  HIS HIS A . n 
A 1 18  ARG 18  17  17  ARG ARG A . n 
A 1 19  ALA 19  18  18  ALA ALA A . n 
A 1 20  ASN 20  19  19  ASN ASN A . n 
A 1 21  SER 21  20  20  SER SER A . n 
A 1 22  ALA 22  21  21  ALA ALA A . n 
A 1 23  ASN 23  22  22  ASN ASN A . n 
A 1 24  LEU 24  23  23  LEU LEU A . n 
A 1 25  LYS 25  24  24  LYS LYS A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  ARG 27  26  26  ARG ARG A . n 
A 1 28  GLU 28  27  27  GLU GLU A . n 
A 1 29  LEU 29  28  28  LEU LEU A . n 
A 1 30  PHE 30  29  29  PHE PHE A . n 
A 1 31  GLU 31  30  30  GLU GLU A . n 
A 1 32  ALA 32  31  31  ALA ALA A . n 
A 1 33  ASP 33  32  32  ASP ASP A . n 
A 1 34  PRO 34  33  33  PRO PRO A . n 
A 1 35  GLU 35  34  34  GLU GLU A . n 
A 1 36  ARG 36  35  35  ARG ARG A . n 
A 1 37  PHE 37  36  36  PHE PHE A . n 
A 1 38  ASN 38  37  37  ASN ASN A . n 
A 1 39  ASN 39  38  38  ASN ASN A . n 
A 1 40  PHE 40  39  39  PHE PHE A . n 
A 1 41  SER 41  40  40  SER SER A . n 
A 1 42  LEU 42  41  41  LEU LEU A . n 
A 1 43  ASN 43  42  42  ASN ASN A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  ASN 45  44  44  ASN ASN A . n 
A 1 46  THR 46  45  45  THR THR A . n 
A 1 47  ASN 47  46  46  ASN ASN A . n 
A 1 48  HIS 48  47  47  HIS HIS A . n 
A 1 49  GLY 49  48  48  GLY GLY A . n 
A 1 50  HIS 50  49  49  HIS HIS A . n 
A 1 51  ILE 51  50  50  ILE ILE A . n 
A 1 52  LEU 52  51  51  LEU LEU A . n 
A 1 53  VAL 53  52  52  VAL VAL A . n 
A 1 54  ASP 54  53  53  ASP ASP A . n 
A 1 55  TYR 55  54  54  TYR TYR A . n 
A 1 56  SER 56  55  55  SER SER A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  ASN 58  57  57  ASN ASN A . n 
A 1 59  LEU 59  58  58  LEU LEU A . n 
A 1 60  VAL 60  59  59  VAL VAL A . n 
A 1 61  ASN 61  60  60  ASN ASN A . n 
A 1 62  LYS 62  61  61  LYS LYS A . n 
A 1 63  GLU 63  62  62  GLU GLU A . n 
A 1 64  VAL 64  63  63  VAL VAL A . n 
A 1 65  MET 65  64  64  MET MET A . n 
A 1 66  GLN 66  65  65  GLN GLN A . n 
A 1 67  MET 67  66  66  MET MET A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  VAL 69  68  68  VAL VAL A . n 
A 1 70  GLU 70  69  69  GLU GLU A . n 
A 1 71  LEU 71  70  70  LEU LEU A . n 
A 1 72  ALA 72  71  71  ALA ALA A . n 
A 1 73  LYS 73  72  72  LYS LYS A . n 
A 1 74  SER 74  73  73  SER SER A . n 
A 1 75  ARG 75  74  74  ARG ARG A . n 
A 1 76  GLY 76  75  75  GLY GLY A . n 
A 1 77  VAL 77  76  76  VAL VAL A . n 
A 1 78  GLU 78  77  77  GLU GLU A . n 
A 1 79  ALA 79  78  78  ALA ALA A . n 
A 1 80  ALA 80  79  79  ALA ALA A . n 
A 1 81  ARG 81  80  80  ARG ARG A . n 
A 1 82  ASP 82  81  81  ASP ASP A . n 
A 1 83  ASN 83  82  82  ASN ASN A . n 
A 1 84  MET 84  83  83  MET MET A . n 
A 1 85  PHE 85  84  84  PHE PHE A . n 
A 1 86  SER 86  85  85  SER SER A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  SER 88  87  87  SER SER A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  ILE 90  89  89  ILE ILE A . n 
A 1 91  ASN 91  90  90  ASN ASN A . n 
A 1 92  TYR 92  91  91  TYR TYR A . n 
A 1 93  THR 93  92  92  THR THR A . n 
A 1 94  GLU 94  93  93  GLU GLU A . n 
A 1 95  ASP 95  94  94  ASP ASP A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  VAL 98  97  97  VAL VAL A . n 
A 1 99  LEU 99  98  98  LEU LEU A . n 
A 1 100 HIS 100 99  99  HIS HIS A . n 
A 1 101 VAL 101 100 100 VAL VAL A . n 
A 1 102 ALA 102 101 101 ALA ALA A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 ARG 104 103 103 ARG ARG A . n 
A 1 105 ASN 105 104 104 ASN ASN A . n 
A 1 106 ARG 106 105 105 ARG ARG A . n 
A 1 107 SER 107 106 106 SER SER A . n 
A 1 108 ASN 108 107 107 ASN ASN A . n 
A 1 109 THR 109 108 108 THR THR A . n 
A 1 110 PRO 110 109 109 PRO PRO A . n 
A 1 111 ILE 111 110 110 ILE ILE A . n 
A 1 112 LYS 112 111 111 LYS LYS A . n 
A 1 113 VAL 113 112 112 VAL VAL A . n 
A 1 114 ASP 114 113 113 ASP ASP A . n 
A 1 115 GLY 115 114 114 GLY GLY A . n 
A 1 116 LYS 116 115 115 LYS LYS A . n 
A 1 117 ASP 117 116 116 ASP ASP A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 MET 119 118 118 MET MET A . n 
A 1 120 PRO 120 119 119 PRO PRO A . n 
A 1 121 GLU 121 120 120 GLU GLU A . n 
A 1 122 VAL 122 121 121 VAL VAL A . n 
A 1 123 ASN 123 122 122 ASN ASN A . n 
A 1 124 ARG 124 123 123 ARG ARG A . n 
A 1 125 VAL 125 124 124 VAL VAL A . n 
A 1 126 LEU 126 125 125 LEU LEU A . n 
A 1 127 ASP 127 126 126 ASP ASP A . n 
A 1 128 LYS 128 127 127 LYS LYS A . n 
A 1 129 MET 129 128 128 MET MET A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 SER 131 130 130 SER SER A . n 
A 1 132 PHE 132 131 131 PHE PHE A . n 
A 1 133 CYS 133 132 132 CYS CYS A . n 
A 1 134 GLN 134 133 133 GLN GLN A . n 
A 1 135 ARG 135 134 134 ARG ARG A . n 
A 1 136 VAL 136 135 135 VAL VAL A . n 
A 1 137 ARG 137 136 136 ARG ARG A . n 
A 1 138 SER 138 137 137 SER SER A . n 
A 1 139 GLY 139 138 138 GLY GLY A . n 
A 1 140 ASP 140 139 139 ASP ASP A . n 
A 1 141 TRP 141 140 140 TRP TRP A . n 
A 1 142 LYS 142 141 141 LYS LYS A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 TYR 144 143 143 TYR TYR A . n 
A 1 145 THR 145 144 144 THR THR A . n 
A 1 146 GLY 146 145 145 GLY GLY A . n 
A 1 147 LYS 147 146 146 LYS LYS A . n 
A 1 148 SER 148 147 147 SER SER A . n 
A 1 149 ILE 149 148 148 ILE ILE A . n 
A 1 150 THR 150 149 149 THR THR A . n 
A 1 151 ASP 151 150 150 ASP ASP A . n 
A 1 152 ILE 152 151 151 ILE ILE A . n 
A 1 153 ILE 153 152 152 ILE ILE A . n 
A 1 154 ASN 154 153 153 ASN ASN A . n 
A 1 155 ILE 155 154 154 ILE ILE A . n 
A 1 156 GLY 156 155 155 GLY GLY A . n 
A 1 157 ILE 157 156 156 ILE ILE A . n 
A 1 158 GLY 158 157 157 GLY GLY A . n 
A 1 159 GLY 159 158 158 GLY GLY A . n 
A 1 160 SER 160 159 159 SER SER A . n 
A 1 161 ASP 161 160 160 ASP ASP A . n 
A 1 162 LEU 162 161 161 LEU LEU A . n 
A 1 163 GLY 163 162 162 GLY GLY A . n 
A 1 164 PRO 164 163 163 PRO PRO A . n 
A 1 165 LEU 165 164 164 LEU LEU A . n 
A 1 166 MET 166 165 165 MET MET A . n 
A 1 167 VAL 167 166 166 VAL VAL A . n 
A 1 168 THR 168 167 167 THR THR A . n 
A 1 169 GLU 169 168 168 GLU GLU A . n 
A 1 170 ALA 170 169 169 ALA ALA A . n 
A 1 171 LEU 171 170 170 LEU LEU A . n 
A 1 172 LYS 172 171 171 LYS LYS A . n 
A 1 173 PRO 173 172 172 PRO PRO A . n 
A 1 174 TYR 174 173 173 TYR TYR A . n 
A 1 175 SER 175 174 174 SER SER A . n 
A 1 176 LYS 176 175 175 LYS LYS A . n 
A 1 177 GLY 177 176 176 GLY GLY A . n 
A 1 178 GLY 178 177 177 GLY GLY A . n 
A 1 179 PRO 179 178 178 PRO PRO A . n 
A 1 180 ARG 180 179 179 ARG ARG A . n 
A 1 181 VAL 181 180 180 VAL VAL A . n 
A 1 182 TRP 182 181 181 TRP TRP A . n 
A 1 183 PHE 183 182 182 PHE PHE A . n 
A 1 184 VAL 184 183 183 VAL VAL A . n 
A 1 185 SER 185 184 184 SER SER A . n 
A 1 186 ASN 186 185 185 ASN ASN A . n 
A 1 187 ILE 187 186 186 ILE ILE A . n 
A 1 188 ASP 188 187 187 ASP ASP A . n 
A 1 189 GLY 189 188 188 GLY GLY A . n 
A 1 190 THR 190 189 189 THR THR A . n 
A 1 191 HIS 191 190 190 HIS HIS A . n 
A 1 192 ILE 192 191 191 ILE ILE A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 LYS 194 193 193 LYS LYS A . n 
A 1 195 THR 195 194 194 THR THR A . n 
A 1 196 LEU 196 195 195 LEU LEU A . n 
A 1 197 ALA 197 196 196 ALA ALA A . n 
A 1 198 SER 198 197 197 SER SER A . n 
A 1 199 LEU 199 198 198 LEU LEU A . n 
A 1 200 SER 200 199 199 SER SER A . n 
A 1 201 PRO 201 200 200 PRO PRO A . n 
A 1 202 GLU 202 201 201 GLU GLU A . n 
A 1 203 THR 203 202 202 THR THR A . n 
A 1 204 SER 204 203 203 SER SER A . n 
A 1 205 LEU 205 204 204 LEU LEU A . n 
A 1 206 PHE 206 205 205 PHE PHE A . n 
A 1 207 ILE 207 206 206 ILE ILE A . n 
A 1 208 ILE 208 207 207 ILE ILE A . n 
A 1 209 ALA 209 208 208 ALA ALA A . n 
A 1 210 SER 210 209 209 SER SER A . n 
A 1 211 LYS 211 210 210 LYS LYS A . n 
A 1 212 THR 212 211 211 THR THR A . n 
A 1 213 PHE 213 212 212 PHE PHE A . n 
A 1 214 THR 214 213 213 THR THR A . n 
A 1 215 THR 215 214 214 THR THR A . n 
A 1 216 GLN 216 215 215 GLN GLN A . n 
A 1 217 GLU 217 216 216 GLU GLU A . n 
A 1 218 THR 218 217 217 THR THR A . n 
A 1 219 ILE 219 218 218 ILE ILE A . n 
A 1 220 THR 220 219 219 THR THR A . n 
A 1 221 ASN 221 220 220 ASN ASN A . n 
A 1 222 ALA 222 221 221 ALA ALA A . n 
A 1 223 GLU 223 222 222 GLU GLU A . n 
A 1 224 THR 224 223 223 THR THR A . n 
A 1 225 ALA 225 224 224 ALA ALA A . n 
A 1 226 LYS 226 225 225 LYS LYS A . n 
A 1 227 GLU 227 226 226 GLU GLU A . n 
A 1 228 TRP 228 227 227 TRP TRP A . n 
A 1 229 PHE 229 228 228 PHE PHE A . n 
A 1 230 LEU 230 229 229 LEU LEU A . n 
A 1 231 GLU 231 230 230 GLU GLU A . n 
A 1 232 ALA 232 231 231 ALA ALA A . n 
A 1 233 ALA 233 232 232 ALA ALA A . n 
A 1 234 LYS 234 233 233 LYS LYS A . n 
A 1 235 ASP 235 234 234 ASP ASP A . n 
A 1 236 PRO 236 235 235 PRO PRO A . n 
A 1 237 SER 237 236 236 SER SER A . n 
A 1 238 ALA 238 237 237 ALA ALA A . n 
A 1 239 VAL 239 238 238 VAL VAL A . n 
A 1 240 ALA 240 239 239 ALA ALA A . n 
A 1 241 LYS 241 240 240 LYS LYS A . n 
A 1 242 HIS 242 241 241 HIS HIS A . n 
A 1 243 PHE 243 242 242 PHE PHE A . n 
A 1 244 VAL 244 243 243 VAL VAL A . n 
A 1 245 ALA 245 244 244 ALA ALA A . n 
A 1 246 LEU 246 245 245 LEU LEU A . n 
A 1 247 SER 247 246 246 SER SER A . n 
A 1 248 THR 248 247 247 THR THR A . n 
A 1 249 ASN 249 248 248 ASN ASN A . n 
A 1 250 THR 250 249 249 THR THR A . n 
A 1 251 ALA 251 250 250 ALA ALA A . n 
A 1 252 LYS 252 251 251 LYS LYS A . n 
A 1 253 VAL 253 252 252 VAL VAL A . n 
A 1 254 LYS 254 253 253 LYS LYS A . n 
A 1 255 GLU 255 254 254 GLU GLU A . n 
A 1 256 PHE 256 255 255 PHE PHE A . n 
A 1 257 GLY 257 256 256 GLY GLY A . n 
A 1 258 ILE 258 257 257 ILE ILE A . n 
A 1 259 ASP 259 258 258 ASP ASP A . n 
A 1 260 PRO 260 259 259 PRO PRO A . n 
A 1 261 GLN 261 260 260 GLN GLN A . n 
A 1 262 ASN 262 261 261 ASN ASN A . n 
A 1 263 MET 263 262 262 MET MET A . n 
A 1 264 LEU 264 263 263 LEU LEU A . n 
A 1 265 GLU 265 264 264 GLU GLU A . n 
A 1 266 PHE 266 265 265 PHE PHE A . n 
A 1 267 TRP 267 266 266 TRP TRP A . n 
A 1 268 ASP 268 267 267 ASP ASP A . n 
A 1 269 TRP 269 268 268 TRP TRP A . n 
A 1 270 VAL 270 269 269 VAL VAL A . n 
A 1 271 GLY 271 270 270 GLY GLY A . n 
A 1 272 GLY 272 271 271 GLY GLY A . n 
A 1 273 ARG 273 272 272 ARG ARG A . n 
A 1 274 TYR 274 273 273 TYR TYR A . n 
A 1 275 SER 275 274 274 SER SER A . n 
A 1 276 LEU 276 275 275 LEU LEU A . n 
A 1 277 TRP 277 276 276 TRP TRP A . n 
A 1 278 SER 278 277 277 SER SER A . n 
A 1 279 ALA 279 278 278 ALA ALA A . n 
A 1 280 ILE 280 279 279 ILE ILE A . n 
A 1 281 GLY 281 280 280 GLY GLY A . n 
A 1 282 LEU 282 281 281 LEU LEU A . n 
A 1 283 SER 283 282 282 SER SER A . n 
A 1 284 ILE 284 283 283 ILE ILE A . n 
A 1 285 ALA 285 284 284 ALA ALA A . n 
A 1 286 LEU 286 285 285 LEU LEU A . n 
A 1 287 HIS 287 286 286 HIS HIS A . n 
A 1 288 VAL 288 287 287 VAL VAL A . n 
A 1 289 GLY 289 288 288 GLY GLY A . n 
A 1 290 PHE 290 289 289 PHE PHE A . n 
A 1 291 ASP 291 290 290 ASP ASP A . n 
A 1 292 HIS 292 291 291 HIS HIS A . n 
A 1 293 PHE 293 292 292 PHE PHE A . n 
A 1 294 GLU 294 293 293 GLU GLU A . n 
A 1 295 GLN 295 294 294 GLN GLN A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 LEU 297 296 296 LEU LEU A . n 
A 1 298 SER 298 297 297 SER SER A . n 
A 1 299 GLY 299 298 298 GLY GLY A . n 
A 1 300 ALA 300 299 299 ALA ALA A . n 
A 1 301 HIS 301 300 300 HIS HIS A . n 
A 1 302 TRP 302 301 301 TRP TRP A . n 
A 1 303 MET 303 302 302 MET MET A . n 
A 1 304 ASP 304 303 303 ASP ASP A . n 
A 1 305 GLN 305 304 304 GLN GLN A . n 
A 1 306 HIS 306 305 305 HIS HIS A . n 
A 1 307 PHE 307 306 306 PHE PHE A . n 
A 1 308 LEU 308 307 307 LEU LEU A . n 
A 1 309 LYS 309 308 308 LYS LYS A . n 
A 1 310 THR 310 309 309 THR THR A . n 
A 1 311 PRO 311 310 310 PRO PRO A . n 
A 1 312 LEU 312 311 311 LEU LEU A . n 
A 1 313 GLU 313 312 312 GLU GLU A . n 
A 1 314 LYS 314 313 313 LYS LYS A . n 
A 1 315 ASN 315 314 314 ASN ASN A . n 
A 1 316 ALA 316 315 315 ALA ALA A . n 
A 1 317 PRO 317 316 316 PRO PRO A . n 
A 1 318 VAL 318 317 317 VAL VAL A . n 
A 1 319 LEU 319 318 318 LEU LEU A . n 
A 1 320 LEU 320 319 319 LEU LEU A . n 
A 1 321 ALA 321 320 320 ALA ALA A . n 
A 1 322 LEU 322 321 321 LEU LEU A . n 
A 1 323 LEU 323 322 322 LEU LEU A . n 
A 1 324 GLY 324 323 323 GLY GLY A . n 
A 1 325 ILE 325 324 324 ILE ILE A . n 
A 1 326 TRP 326 325 325 TRP TRP A . n 
A 1 327 TYR 327 326 326 TYR TYR A . n 
A 1 328 ILE 328 327 327 ILE ILE A . n 
A 1 329 ASN 329 328 328 ASN ASN A . n 
A 1 330 CYS 330 329 329 CYS CYS A . n 
A 1 331 TYR 331 330 330 TYR TYR A . n 
A 1 332 GLY 332 331 331 GLY GLY A . n 
A 1 333 CYS 333 332 332 CYS CYS A . n 
A 1 334 GLU 334 333 333 GLU GLU A . n 
A 1 335 THR 335 334 334 THR THR A . n 
A 1 336 HIS 336 335 335 HIS HIS A . n 
A 1 337 ALA 337 336 336 ALA ALA A . n 
A 1 338 LEU 338 337 337 LEU LEU A . n 
A 1 339 LEU 339 338 338 LEU LEU A . n 
A 1 340 PRO 340 339 339 PRO PRO A . n 
A 1 341 TYR 341 340 340 TYR TYR A . n 
A 1 342 ASP 342 341 341 ASP ASP A . n 
A 1 343 GLN 343 342 342 GLN GLN A . n 
A 1 344 TYR 344 343 343 TYR TYR A . n 
A 1 345 MET 345 344 344 MET MET A . n 
A 1 346 HIS 346 345 345 HIS HIS A . n 
A 1 347 ARG 347 346 346 ARG ARG A . n 
A 1 348 PHE 348 347 347 PHE PHE A . n 
A 1 349 ALA 349 348 348 ALA ALA A . n 
A 1 350 ALA 350 349 349 ALA ALA A . n 
A 1 351 TYR 351 350 350 TYR TYR A . n 
A 1 352 PHE 352 351 351 PHE PHE A . n 
A 1 353 GLN 353 352 352 GLN GLN A . n 
A 1 354 GLN 354 353 353 GLN GLN A . n 
A 1 355 GLY 355 354 354 GLY GLY A . n 
A 1 356 ASP 356 355 355 ASP ASP A . n 
A 1 357 MET 357 356 356 MET MET A . n 
A 1 358 GLU 358 357 357 GLU GLU A . n 
A 1 359 SER 359 358 358 SER SER A . n 
A 1 360 ASN 360 359 359 ASN ASN A . n 
A 1 361 GLY 361 360 360 GLY GLY A . n 
A 1 362 LYS 362 361 361 LYS LYS A . n 
A 1 363 TYR 363 362 362 TYR TYR A . n 
A 1 364 ILE 364 363 363 ILE ILE A . n 
A 1 365 THR 365 364 364 THR THR A . n 
A 1 366 LYS 366 365 365 LYS LYS A . n 
A 1 367 SER 367 366 366 SER SER A . n 
A 1 368 GLY 368 367 367 GLY GLY A . n 
A 1 369 ALA 369 368 368 ALA ALA A . n 
A 1 370 ARG 370 369 369 ARG ARG A . n 
A 1 371 VAL 371 370 370 VAL VAL A . n 
A 1 372 ASP 372 371 371 ASP ASP A . n 
A 1 373 HIS 373 372 372 HIS HIS A . n 
A 1 374 GLN 374 373 373 GLN GLN A . n 
A 1 375 THR 375 374 374 THR THR A . n 
A 1 376 GLY 376 375 375 GLY GLY A . n 
A 1 377 PRO 377 376 376 PRO PRO A . n 
A 1 378 ILE 378 377 377 ILE ILE A . n 
A 1 379 VAL 379 378 378 VAL VAL A . n 
A 1 380 TRP 380 379 379 TRP TRP A . n 
A 1 381 GLY 381 380 380 GLY GLY A . n 
A 1 382 GLU 382 381 381 GLU GLU A . n 
A 1 383 PRO 383 382 382 PRO PRO A . n 
A 1 384 GLY 384 383 383 GLY GLY A . n 
A 1 385 THR 385 384 384 THR THR A . n 
A 1 386 ASN 386 385 385 ASN ASN A . n 
A 1 387 GLY 387 386 386 GLY GLY A . n 
A 1 388 GLN 388 387 387 GLN GLN A . n 
A 1 389 HIS 389 388 388 HIS HIS A . n 
A 1 390 ALA 390 389 389 ALA ALA A . n 
A 1 391 PHE 391 390 390 PHE PHE A . n 
A 1 392 TYR 392 391 391 TYR TYR A . n 
A 1 393 GLN 393 392 392 GLN GLN A . n 
A 1 394 LEU 394 393 393 LEU LEU A . n 
A 1 395 ILE 395 394 394 ILE ILE A . n 
A 1 396 HIS 396 395 395 HIS HIS A . n 
A 1 397 GLN 397 396 396 GLN GLN A . n 
A 1 398 GLY 398 397 397 GLY GLY A . n 
A 1 399 THR 399 398 398 THR THR A . n 
A 1 400 LYS 400 399 399 LYS LYS A . n 
A 1 401 MET 401 400 400 MET MET A . n 
A 1 402 ILE 402 401 401 ILE ILE A . n 
A 1 403 PRO 403 402 402 PRO PRO A . n 
A 1 404 CYS 404 403 403 CYS CYS A . n 
A 1 405 ASP 405 404 404 ASP ASP A . n 
A 1 406 PHE 406 405 405 PHE PHE A . n 
A 1 407 LEU 407 406 406 LEU LEU A . n 
A 1 408 ILE 408 407 407 ILE ILE A . n 
A 1 409 PRO 409 408 408 PRO PRO A . n 
A 1 410 VAL 410 409 409 VAL VAL A . n 
A 1 411 GLN 411 410 410 GLN GLN A . n 
A 1 412 THR 412 411 411 THR THR A . n 
A 1 413 GLN 413 412 412 GLN GLN A . n 
A 1 414 HIS 414 413 413 HIS HIS A . n 
A 1 415 PRO 415 414 414 PRO PRO A . n 
A 1 416 ILE 416 415 415 ILE ILE A . n 
A 1 417 ARG 417 416 416 ARG ARG A . n 
A 1 418 LYS 418 417 417 LYS LYS A . n 
A 1 419 GLY 419 418 418 GLY GLY A . n 
A 1 420 LEU 420 419 419 LEU LEU A . n 
A 1 421 HIS 421 420 420 HIS HIS A . n 
A 1 422 HIS 422 421 421 HIS HIS A . n 
A 1 423 LYS 423 422 422 LYS LYS A . n 
A 1 424 ILE 424 423 423 ILE ILE A . n 
A 1 425 LEU 425 424 424 LEU LEU A . n 
A 1 426 LEU 426 425 425 LEU LEU A . n 
A 1 427 ALA 427 426 426 ALA ALA A . n 
A 1 428 ASN 428 427 427 ASN ASN A . n 
A 1 429 PHE 429 428 428 PHE PHE A . n 
A 1 430 LEU 430 429 429 LEU LEU A . n 
A 1 431 ALA 431 430 430 ALA ALA A . n 
A 1 432 GLN 432 431 431 GLN GLN A . n 
A 1 433 THR 433 432 432 THR THR A . n 
A 1 434 GLU 434 433 433 GLU GLU A . n 
A 1 435 ALA 435 434 434 ALA ALA A . n 
A 1 436 LEU 436 435 435 LEU LEU A . n 
A 1 437 MET 437 436 436 MET MET A . n 
A 1 438 LYS 438 437 437 LYS LYS A . n 
A 1 439 GLY 439 438 438 GLY GLY A . n 
A 1 440 LYS 440 439 439 LYS LYS A . n 
A 1 441 LEU 441 440 440 LEU LEU A . n 
A 1 442 PRO 442 441 441 PRO PRO A . n 
A 1 443 GLU 443 442 442 GLU GLU A . n 
A 1 444 GLU 444 443 443 GLU GLU A . n 
A 1 445 ALA 445 444 444 ALA ALA A . n 
A 1 446 ARG 446 445 445 ARG ARG A . n 
A 1 447 LYS 447 446 446 LYS LYS A . n 
A 1 448 GLU 448 447 447 GLU GLU A . n 
A 1 449 LEU 449 448 448 LEU LEU A . n 
A 1 450 GLN 450 449 449 GLN GLN A . n 
A 1 451 ALA 451 450 450 ALA ALA A . n 
A 1 452 ALA 452 451 451 ALA ALA A . n 
A 1 453 GLY 453 452 452 GLY GLY A . n 
A 1 454 LYS 454 453 453 LYS LYS A . n 
A 1 455 SER 455 454 454 SER SER A . n 
A 1 456 PRO 456 455 455 PRO PRO A . n 
A 1 457 GLU 457 456 456 GLU GLU A . n 
A 1 458 ASP 458 457 457 ASP ASP A . n 
A 1 459 LEU 459 458 458 LEU LEU A . n 
A 1 460 GLU 460 459 459 GLU GLU A . n 
A 1 461 LYS 461 460 460 LYS LYS A . n 
A 1 462 LEU 462 461 461 LEU LEU A . n 
A 1 463 LEU 463 462 462 LEU LEU A . n 
A 1 464 PRO 464 463 463 PRO PRO A . n 
A 1 465 HIS 465 464 464 HIS HIS A . n 
A 1 466 LYS 466 465 465 LYS LYS A . n 
A 1 467 VAL 467 466 466 VAL VAL A . n 
A 1 468 PHE 468 467 467 PHE PHE A . n 
A 1 469 GLU 469 468 468 GLU GLU A . n 
A 1 470 GLY 470 469 469 GLY GLY A . n 
A 1 471 ASN 471 470 470 ASN ASN A . n 
A 1 472 ARG 472 471 471 ARG ARG A . n 
A 1 473 PRO 473 472 472 PRO PRO A . n 
A 1 474 THR 474 473 473 THR THR A . n 
A 1 475 ASN 475 474 474 ASN ASN A . n 
A 1 476 SER 476 475 475 SER SER A . n 
A 1 477 ILE 477 476 476 ILE ILE A . n 
A 1 478 VAL 478 477 477 VAL VAL A . n 
A 1 479 PHE 479 478 478 PHE PHE A . n 
A 1 480 THR 480 479 479 THR THR A . n 
A 1 481 LYS 481 480 480 LYS LYS A . n 
A 1 482 LEU 482 481 481 LEU LEU A . n 
A 1 483 THR 483 482 482 THR THR A . n 
A 1 484 PRO 484 483 483 PRO PRO A . n 
A 1 485 PHE 485 484 484 PHE PHE A . n 
A 1 486 ILE 486 485 485 ILE ILE A . n 
A 1 487 LEU 487 486 486 LEU LEU A . n 
A 1 488 GLY 488 487 487 GLY GLY A . n 
A 1 489 ALA 489 488 488 ALA ALA A . n 
A 1 490 LEU 490 489 489 LEU LEU A . n 
A 1 491 ILE 491 490 490 ILE ILE A . n 
A 1 492 ALA 492 491 491 ALA ALA A . n 
A 1 493 MET 493 492 492 MET MET A . n 
A 1 494 TYR 494 493 493 TYR TYR A . n 
A 1 495 GLU 495 494 494 GLU GLU A . n 
A 1 496 HIS 496 495 495 HIS HIS A . n 
A 1 497 LYS 497 496 496 LYS LYS A . n 
A 1 498 ILE 498 497 497 ILE ILE A . n 
A 1 499 PHE 499 498 498 PHE PHE A . n 
A 1 500 VAL 500 499 499 VAL VAL A . n 
A 1 501 GLN 501 500 500 GLN GLN A . n 
A 1 502 GLY 502 501 501 GLY GLY A . n 
A 1 503 ILE 503 502 502 ILE ILE A . n 
A 1 504 MET 504 503 503 MET MET A . n 
A 1 505 TRP 505 504 504 TRP TRP A . n 
A 1 506 ASP 506 505 505 ASP ASP A . n 
A 1 507 ILE 507 506 506 ILE ILE A . n 
A 1 508 ASN 508 507 507 ASN ASN A . n 
A 1 509 SER 509 508 508 SER SER A . n 
A 1 510 PHE 510 509 509 PHE PHE A . n 
A 1 511 ASP 511 510 510 ASP ASP A . n 
A 1 512 GLN 512 511 511 GLN GLN A . n 
A 1 513 TRP 513 512 512 TRP TRP A . n 
A 1 514 GLY 514 513 513 GLY GLY A . n 
A 1 515 VAL 515 514 514 VAL VAL A . n 
A 1 516 GLU 516 515 515 GLU GLU A . n 
A 1 517 LEU 517 516 516 LEU LEU A . n 
A 1 518 GLY 518 517 517 GLY GLY A . n 
A 1 519 LYS 519 518 518 LYS LYS A . n 
A 1 520 GLN 520 519 519 GLN GLN A . n 
A 1 521 LEU 521 520 520 LEU LEU A . n 
A 1 522 ALA 522 521 521 ALA ALA A . n 
A 1 523 LYS 523 522 522 LYS LYS A . n 
A 1 524 LYS 524 523 523 LYS LYS A . n 
A 1 525 ILE 525 524 524 ILE ILE A . n 
A 1 526 GLU 526 525 525 GLU GLU A . n 
A 1 527 PRO 527 526 526 PRO PRO A . n 
A 1 528 GLU 528 527 527 GLU GLU A . n 
A 1 529 LEU 529 528 528 LEU LEU A . n 
A 1 530 GLU 530 529 529 GLU GLU A . n 
A 1 531 GLY 531 530 530 GLY GLY A . n 
A 1 532 SER 532 531 531 SER SER A . n 
A 1 533 SER 533 532 532 SER SER A . n 
A 1 534 ALA 534 533 533 ALA ALA A . n 
A 1 535 VAL 535 534 534 VAL VAL A . n 
A 1 536 THR 536 535 535 THR THR A . n 
A 1 537 SER 537 536 536 SER SER A . n 
A 1 538 HIS 538 537 537 HIS HIS A . n 
A 1 539 ASP 539 538 538 ASP ASP A . n 
A 1 540 SER 540 539 539 SER SER A . n 
A 1 541 SER 541 540 540 SER SER A . n 
A 1 542 THR 542 541 541 THR THR A . n 
A 1 543 ASN 543 542 542 ASN ASN A . n 
A 1 544 GLY 544 543 543 GLY GLY A . n 
A 1 545 LEU 545 544 544 LEU LEU A . n 
A 1 546 ILE 546 545 545 ILE ILE A . n 
A 1 547 SER 547 546 546 SER SER A . n 
A 1 548 PHE 548 547 547 PHE PHE A . n 
A 1 549 ILE 549 548 548 ILE ILE A . n 
A 1 550 LYS 550 549 549 LYS LYS A . n 
A 1 551 GLN 551 550 550 GLN GLN A . n 
A 1 552 GLN 552 551 551 GLN GLN A . n 
A 1 553 ARG 553 552 552 ARG ARG A . n 
A 1 554 ASP 554 553 553 ASP ASP A . n 
A 1 555 THR 555 554 554 THR THR A . n 
A 1 556 LYS 556 555 555 LYS LYS A . n 
A 1 557 LEU 557 556 556 LEU LEU A . n 
A 1 558 GLU 558 557 ?   ?   ?   A . n 
A 1 559 HIS 559 558 ?   ?   ?   A . n 
A 1 560 HIS 560 559 ?   ?   ?   A . n 
A 1 561 HIS 561 560 ?   ?   ?   A . n 
A 1 562 HIS 562 561 ?   ?   ?   A . n 
A 1 563 HIS 563 562 ?   ?   ?   A . n 
A 1 564 HIS 564 563 ?   ?   ?   A . n 
B 1 1   MET 1   0   ?   ?   ?   B . n 
B 1 2   ALA 2   1   1   ALA ALA B . n 
B 1 3   ALA 3   2   2   ALA ALA B . n 
B 1 4   LEU 4   3   3   LEU LEU B . n 
B 1 5   THR 5   4   4   THR THR B . n 
B 1 6   ARG 6   5   5   ARG ARG B . n 
B 1 7   ASN 7   6   6   ASN ASN B . n 
B 1 8   PRO 8   7   7   PRO PRO B . n 
B 1 9   GLN 9   8   8   GLN GLN B . n 
B 1 10  PHE 10  9   9   PHE PHE B . n 
B 1 11  GLN 11  10  10  GLN GLN B . n 
B 1 12  LYS 12  11  11  LYS LYS B . n 
B 1 13  LEU 13  12  12  LEU LEU B . n 
B 1 14  LEU 14  13  13  LEU LEU B . n 
B 1 15  GLU 15  14  14  GLU GLU B . n 
B 1 16  TRP 16  15  15  TRP TRP B . n 
B 1 17  HIS 17  16  16  HIS HIS B . n 
B 1 18  ARG 18  17  17  ARG ARG B . n 
B 1 19  ALA 19  18  18  ALA ALA B . n 
B 1 20  ASN 20  19  19  ASN ASN B . n 
B 1 21  SER 21  20  20  SER SER B . n 
B 1 22  ALA 22  21  21  ALA ALA B . n 
B 1 23  ASN 23  22  22  ASN ASN B . n 
B 1 24  LEU 24  23  23  LEU LEU B . n 
B 1 25  LYS 25  24  24  LYS LYS B . n 
B 1 26  LEU 26  25  25  LEU LEU B . n 
B 1 27  ARG 27  26  26  ARG ARG B . n 
B 1 28  GLU 28  27  27  GLU GLU B . n 
B 1 29  LEU 29  28  28  LEU LEU B . n 
B 1 30  PHE 30  29  29  PHE PHE B . n 
B 1 31  GLU 31  30  30  GLU GLU B . n 
B 1 32  ALA 32  31  31  ALA ALA B . n 
B 1 33  ASP 33  32  32  ASP ASP B . n 
B 1 34  PRO 34  33  33  PRO PRO B . n 
B 1 35  GLU 35  34  34  GLU GLU B . n 
B 1 36  ARG 36  35  35  ARG ARG B . n 
B 1 37  PHE 37  36  36  PHE PHE B . n 
B 1 38  ASN 38  37  37  ASN ASN B . n 
B 1 39  ASN 39  38  38  ASN ASN B . n 
B 1 40  PHE 40  39  39  PHE PHE B . n 
B 1 41  SER 41  40  40  SER SER B . n 
B 1 42  LEU 42  41  41  LEU LEU B . n 
B 1 43  ASN 43  42  42  ASN ASN B . n 
B 1 44  LEU 44  43  43  LEU LEU B . n 
B 1 45  ASN 45  44  44  ASN ASN B . n 
B 1 46  THR 46  45  45  THR THR B . n 
B 1 47  ASN 47  46  46  ASN ASN B . n 
B 1 48  HIS 48  47  47  HIS HIS B . n 
B 1 49  GLY 49  48  48  GLY GLY B . n 
B 1 50  HIS 50  49  49  HIS HIS B . n 
B 1 51  ILE 51  50  50  ILE ILE B . n 
B 1 52  LEU 52  51  51  LEU LEU B . n 
B 1 53  VAL 53  52  52  VAL VAL B . n 
B 1 54  ASP 54  53  53  ASP ASP B . n 
B 1 55  TYR 55  54  54  TYR TYR B . n 
B 1 56  SER 56  55  55  SER SER B . n 
B 1 57  LYS 57  56  56  LYS LYS B . n 
B 1 58  ASN 58  57  57  ASN ASN B . n 
B 1 59  LEU 59  58  58  LEU LEU B . n 
B 1 60  VAL 60  59  59  VAL VAL B . n 
B 1 61  ASN 61  60  60  ASN ASN B . n 
B 1 62  LYS 62  61  61  LYS LYS B . n 
B 1 63  GLU 63  62  62  GLU GLU B . n 
B 1 64  VAL 64  63  63  VAL VAL B . n 
B 1 65  MET 65  64  64  MET MET B . n 
B 1 66  GLN 66  65  65  GLN GLN B . n 
B 1 67  MET 67  66  66  MET MET B . n 
B 1 68  LEU 68  67  67  LEU LEU B . n 
B 1 69  VAL 69  68  68  VAL VAL B . n 
B 1 70  GLU 70  69  69  GLU GLU B . n 
B 1 71  LEU 71  70  70  LEU LEU B . n 
B 1 72  ALA 72  71  71  ALA ALA B . n 
B 1 73  LYS 73  72  72  LYS LYS B . n 
B 1 74  SER 74  73  73  SER SER B . n 
B 1 75  ARG 75  74  74  ARG ARG B . n 
B 1 76  GLY 76  75  75  GLY GLY B . n 
B 1 77  VAL 77  76  76  VAL VAL B . n 
B 1 78  GLU 78  77  77  GLU GLU B . n 
B 1 79  ALA 79  78  78  ALA ALA B . n 
B 1 80  ALA 80  79  79  ALA ALA B . n 
B 1 81  ARG 81  80  80  ARG ARG B . n 
B 1 82  ASP 82  81  81  ASP ASP B . n 
B 1 83  ASN 83  82  82  ASN ASN B . n 
B 1 84  MET 84  83  83  MET MET B . n 
B 1 85  PHE 85  84  84  PHE PHE B . n 
B 1 86  SER 86  85  85  SER SER B . n 
B 1 87  GLY 87  86  86  GLY GLY B . n 
B 1 88  SER 88  87  87  SER SER B . n 
B 1 89  LYS 89  88  88  LYS LYS B . n 
B 1 90  ILE 90  89  89  ILE ILE B . n 
B 1 91  ASN 91  90  90  ASN ASN B . n 
B 1 92  TYR 92  91  91  TYR TYR B . n 
B 1 93  THR 93  92  92  THR THR B . n 
B 1 94  GLU 94  93  93  GLU GLU B . n 
B 1 95  ASP 95  94  94  ASP ASP B . n 
B 1 96  ARG 96  95  95  ARG ARG B . n 
B 1 97  ALA 97  96  96  ALA ALA B . n 
B 1 98  VAL 98  97  97  VAL VAL B . n 
B 1 99  LEU 99  98  98  LEU LEU B . n 
B 1 100 HIS 100 99  99  HIS HIS B . n 
B 1 101 VAL 101 100 100 VAL VAL B . n 
B 1 102 ALA 102 101 101 ALA ALA B . n 
B 1 103 LEU 103 102 102 LEU LEU B . n 
B 1 104 ARG 104 103 103 ARG ARG B . n 
B 1 105 ASN 105 104 104 ASN ASN B . n 
B 1 106 ARG 106 105 105 ARG ARG B . n 
B 1 107 SER 107 106 106 SER SER B . n 
B 1 108 ASN 108 107 107 ASN ASN B . n 
B 1 109 THR 109 108 108 THR THR B . n 
B 1 110 PRO 110 109 109 PRO PRO B . n 
B 1 111 ILE 111 110 110 ILE ILE B . n 
B 1 112 LYS 112 111 111 LYS LYS B . n 
B 1 113 VAL 113 112 112 VAL VAL B . n 
B 1 114 ASP 114 113 113 ASP ASP B . n 
B 1 115 GLY 115 114 114 GLY GLY B . n 
B 1 116 LYS 116 115 115 LYS LYS B . n 
B 1 117 ASP 117 116 116 ASP ASP B . n 
B 1 118 VAL 118 117 117 VAL VAL B . n 
B 1 119 MET 119 118 118 MET MET B . n 
B 1 120 PRO 120 119 119 PRO PRO B . n 
B 1 121 GLU 121 120 120 GLU GLU B . n 
B 1 122 VAL 122 121 121 VAL VAL B . n 
B 1 123 ASN 123 122 122 ASN ASN B . n 
B 1 124 ARG 124 123 123 ARG ARG B . n 
B 1 125 VAL 125 124 124 VAL VAL B . n 
B 1 126 LEU 126 125 125 LEU LEU B . n 
B 1 127 ASP 127 126 126 ASP ASP B . n 
B 1 128 LYS 128 127 127 LYS LYS B . n 
B 1 129 MET 129 128 128 MET MET B . n 
B 1 130 LYS 130 129 129 LYS LYS B . n 
B 1 131 SER 131 130 130 SER SER B . n 
B 1 132 PHE 132 131 131 PHE PHE B . n 
B 1 133 CYS 133 132 132 CYS CYS B . n 
B 1 134 GLN 134 133 133 GLN GLN B . n 
B 1 135 ARG 135 134 134 ARG ARG B . n 
B 1 136 VAL 136 135 135 VAL VAL B . n 
B 1 137 ARG 137 136 136 ARG ARG B . n 
B 1 138 SER 138 137 137 SER SER B . n 
B 1 139 GLY 139 138 138 GLY GLY B . n 
B 1 140 ASP 140 139 139 ASP ASP B . n 
B 1 141 TRP 141 140 140 TRP TRP B . n 
B 1 142 LYS 142 141 141 LYS LYS B . n 
B 1 143 GLY 143 142 142 GLY GLY B . n 
B 1 144 TYR 144 143 143 TYR TYR B . n 
B 1 145 THR 145 144 144 THR THR B . n 
B 1 146 GLY 146 145 145 GLY GLY B . n 
B 1 147 LYS 147 146 146 LYS LYS B . n 
B 1 148 SER 148 147 147 SER SER B . n 
B 1 149 ILE 149 148 148 ILE ILE B . n 
B 1 150 THR 150 149 149 THR THR B . n 
B 1 151 ASP 151 150 150 ASP ASP B . n 
B 1 152 ILE 152 151 151 ILE ILE B . n 
B 1 153 ILE 153 152 152 ILE ILE B . n 
B 1 154 ASN 154 153 153 ASN ASN B . n 
B 1 155 ILE 155 154 154 ILE ILE B . n 
B 1 156 GLY 156 155 155 GLY GLY B . n 
B 1 157 ILE 157 156 156 ILE ILE B . n 
B 1 158 GLY 158 157 157 GLY GLY B . n 
B 1 159 GLY 159 158 158 GLY GLY B . n 
B 1 160 SER 160 159 159 SER SER B . n 
B 1 161 ASP 161 160 160 ASP ASP B . n 
B 1 162 LEU 162 161 161 LEU LEU B . n 
B 1 163 GLY 163 162 162 GLY GLY B . n 
B 1 164 PRO 164 163 163 PRO PRO B . n 
B 1 165 LEU 165 164 164 LEU LEU B . n 
B 1 166 MET 166 165 165 MET MET B . n 
B 1 167 VAL 167 166 166 VAL VAL B . n 
B 1 168 THR 168 167 167 THR THR B . n 
B 1 169 GLU 169 168 168 GLU GLU B . n 
B 1 170 ALA 170 169 169 ALA ALA B . n 
B 1 171 LEU 171 170 170 LEU LEU B . n 
B 1 172 LYS 172 171 171 LYS LYS B . n 
B 1 173 PRO 173 172 172 PRO PRO B . n 
B 1 174 TYR 174 173 173 TYR TYR B . n 
B 1 175 SER 175 174 174 SER SER B . n 
B 1 176 LYS 176 175 175 LYS LYS B . n 
B 1 177 GLY 177 176 176 GLY GLY B . n 
B 1 178 GLY 178 177 177 GLY GLY B . n 
B 1 179 PRO 179 178 178 PRO PRO B . n 
B 1 180 ARG 180 179 179 ARG ARG B . n 
B 1 181 VAL 181 180 180 VAL VAL B . n 
B 1 182 TRP 182 181 181 TRP TRP B . n 
B 1 183 PHE 183 182 182 PHE PHE B . n 
B 1 184 VAL 184 183 183 VAL VAL B . n 
B 1 185 SER 185 184 184 SER SER B . n 
B 1 186 ASN 186 185 185 ASN ASN B . n 
B 1 187 ILE 187 186 186 ILE ILE B . n 
B 1 188 ASP 188 187 187 ASP ASP B . n 
B 1 189 GLY 189 188 188 GLY GLY B . n 
B 1 190 THR 190 189 189 THR THR B . n 
B 1 191 HIS 191 190 190 HIS HIS B . n 
B 1 192 ILE 192 191 191 ILE ILE B . n 
B 1 193 ALA 193 192 192 ALA ALA B . n 
B 1 194 LYS 194 193 193 LYS LYS B . n 
B 1 195 THR 195 194 194 THR THR B . n 
B 1 196 LEU 196 195 195 LEU LEU B . n 
B 1 197 ALA 197 196 196 ALA ALA B . n 
B 1 198 SER 198 197 197 SER SER B . n 
B 1 199 LEU 199 198 198 LEU LEU B . n 
B 1 200 SER 200 199 199 SER SER B . n 
B 1 201 PRO 201 200 200 PRO PRO B . n 
B 1 202 GLU 202 201 201 GLU GLU B . n 
B 1 203 THR 203 202 202 THR THR B . n 
B 1 204 SER 204 203 203 SER SER B . n 
B 1 205 LEU 205 204 204 LEU LEU B . n 
B 1 206 PHE 206 205 205 PHE PHE B . n 
B 1 207 ILE 207 206 206 ILE ILE B . n 
B 1 208 ILE 208 207 207 ILE ILE B . n 
B 1 209 ALA 209 208 208 ALA ALA B . n 
B 1 210 SER 210 209 209 SER SER B . n 
B 1 211 LYS 211 210 210 LYS LYS B . n 
B 1 212 THR 212 211 211 THR THR B . n 
B 1 213 PHE 213 212 212 PHE PHE B . n 
B 1 214 THR 214 213 213 THR THR B . n 
B 1 215 THR 215 214 214 THR THR B . n 
B 1 216 GLN 216 215 215 GLN GLN B . n 
B 1 217 GLU 217 216 216 GLU GLU B . n 
B 1 218 THR 218 217 217 THR THR B . n 
B 1 219 ILE 219 218 218 ILE ILE B . n 
B 1 220 THR 220 219 219 THR THR B . n 
B 1 221 ASN 221 220 220 ASN ASN B . n 
B 1 222 ALA 222 221 221 ALA ALA B . n 
B 1 223 GLU 223 222 222 GLU GLU B . n 
B 1 224 THR 224 223 223 THR THR B . n 
B 1 225 ALA 225 224 224 ALA ALA B . n 
B 1 226 LYS 226 225 225 LYS LYS B . n 
B 1 227 GLU 227 226 226 GLU GLU B . n 
B 1 228 TRP 228 227 227 TRP TRP B . n 
B 1 229 PHE 229 228 228 PHE PHE B . n 
B 1 230 LEU 230 229 229 LEU LEU B . n 
B 1 231 GLU 231 230 230 GLU GLU B . n 
B 1 232 ALA 232 231 231 ALA ALA B . n 
B 1 233 ALA 233 232 232 ALA ALA B . n 
B 1 234 LYS 234 233 233 LYS LYS B . n 
B 1 235 ASP 235 234 234 ASP ASP B . n 
B 1 236 PRO 236 235 235 PRO PRO B . n 
B 1 237 SER 237 236 236 SER SER B . n 
B 1 238 ALA 238 237 237 ALA ALA B . n 
B 1 239 VAL 239 238 238 VAL VAL B . n 
B 1 240 ALA 240 239 239 ALA ALA B . n 
B 1 241 LYS 241 240 240 LYS LYS B . n 
B 1 242 HIS 242 241 241 HIS HIS B . n 
B 1 243 PHE 243 242 242 PHE PHE B . n 
B 1 244 VAL 244 243 243 VAL VAL B . n 
B 1 245 ALA 245 244 244 ALA ALA B . n 
B 1 246 LEU 246 245 245 LEU LEU B . n 
B 1 247 SER 247 246 246 SER SER B . n 
B 1 248 THR 248 247 247 THR THR B . n 
B 1 249 ASN 249 248 248 ASN ASN B . n 
B 1 250 THR 250 249 249 THR THR B . n 
B 1 251 ALA 251 250 250 ALA ALA B . n 
B 1 252 LYS 252 251 251 LYS LYS B . n 
B 1 253 VAL 253 252 252 VAL VAL B . n 
B 1 254 LYS 254 253 253 LYS LYS B . n 
B 1 255 GLU 255 254 254 GLU GLU B . n 
B 1 256 PHE 256 255 255 PHE PHE B . n 
B 1 257 GLY 257 256 256 GLY GLY B . n 
B 1 258 ILE 258 257 257 ILE ILE B . n 
B 1 259 ASP 259 258 258 ASP ASP B . n 
B 1 260 PRO 260 259 259 PRO PRO B . n 
B 1 261 GLN 261 260 260 GLN GLN B . n 
B 1 262 ASN 262 261 261 ASN ASN B . n 
B 1 263 MET 263 262 262 MET MET B . n 
B 1 264 LEU 264 263 263 LEU LEU B . n 
B 1 265 GLU 265 264 264 GLU GLU B . n 
B 1 266 PHE 266 265 265 PHE PHE B . n 
B 1 267 TRP 267 266 266 TRP TRP B . n 
B 1 268 ASP 268 267 267 ASP ASP B . n 
B 1 269 TRP 269 268 268 TRP TRP B . n 
B 1 270 VAL 270 269 269 VAL VAL B . n 
B 1 271 GLY 271 270 270 GLY GLY B . n 
B 1 272 GLY 272 271 271 GLY GLY B . n 
B 1 273 ARG 273 272 272 ARG ARG B . n 
B 1 274 TYR 274 273 273 TYR TYR B . n 
B 1 275 SER 275 274 274 SER SER B . n 
B 1 276 LEU 276 275 275 LEU LEU B . n 
B 1 277 TRP 277 276 276 TRP TRP B . n 
B 1 278 SER 278 277 277 SER SER B . n 
B 1 279 ALA 279 278 278 ALA ALA B . n 
B 1 280 ILE 280 279 279 ILE ILE B . n 
B 1 281 GLY 281 280 280 GLY GLY B . n 
B 1 282 LEU 282 281 281 LEU LEU B . n 
B 1 283 SER 283 282 282 SER SER B . n 
B 1 284 ILE 284 283 283 ILE ILE B . n 
B 1 285 ALA 285 284 284 ALA ALA B . n 
B 1 286 LEU 286 285 285 LEU LEU B . n 
B 1 287 HIS 287 286 286 HIS HIS B . n 
B 1 288 VAL 288 287 287 VAL VAL B . n 
B 1 289 GLY 289 288 288 GLY GLY B . n 
B 1 290 PHE 290 289 289 PHE PHE B . n 
B 1 291 ASP 291 290 290 ASP ASP B . n 
B 1 292 HIS 292 291 291 HIS HIS B . n 
B 1 293 PHE 293 292 292 PHE PHE B . n 
B 1 294 GLU 294 293 293 GLU GLU B . n 
B 1 295 GLN 295 294 294 GLN GLN B . n 
B 1 296 LEU 296 295 295 LEU LEU B . n 
B 1 297 LEU 297 296 296 LEU LEU B . n 
B 1 298 SER 298 297 297 SER SER B . n 
B 1 299 GLY 299 298 298 GLY GLY B . n 
B 1 300 ALA 300 299 299 ALA ALA B . n 
B 1 301 HIS 301 300 300 HIS HIS B . n 
B 1 302 TRP 302 301 301 TRP TRP B . n 
B 1 303 MET 303 302 302 MET MET B . n 
B 1 304 ASP 304 303 303 ASP ASP B . n 
B 1 305 GLN 305 304 304 GLN GLN B . n 
B 1 306 HIS 306 305 305 HIS HIS B . n 
B 1 307 PHE 307 306 306 PHE PHE B . n 
B 1 308 LEU 308 307 307 LEU LEU B . n 
B 1 309 LYS 309 308 308 LYS LYS B . n 
B 1 310 THR 310 309 309 THR THR B . n 
B 1 311 PRO 311 310 310 PRO PRO B . n 
B 1 312 LEU 312 311 311 LEU LEU B . n 
B 1 313 GLU 313 312 312 GLU GLU B . n 
B 1 314 LYS 314 313 313 LYS LYS B . n 
B 1 315 ASN 315 314 314 ASN ASN B . n 
B 1 316 ALA 316 315 315 ALA ALA B . n 
B 1 317 PRO 317 316 316 PRO PRO B . n 
B 1 318 VAL 318 317 317 VAL VAL B . n 
B 1 319 LEU 319 318 318 LEU LEU B . n 
B 1 320 LEU 320 319 319 LEU LEU B . n 
B 1 321 ALA 321 320 320 ALA ALA B . n 
B 1 322 LEU 322 321 321 LEU LEU B . n 
B 1 323 LEU 323 322 322 LEU LEU B . n 
B 1 324 GLY 324 323 323 GLY GLY B . n 
B 1 325 ILE 325 324 324 ILE ILE B . n 
B 1 326 TRP 326 325 325 TRP TRP B . n 
B 1 327 TYR 327 326 326 TYR TYR B . n 
B 1 328 ILE 328 327 327 ILE ILE B . n 
B 1 329 ASN 329 328 328 ASN ASN B . n 
B 1 330 CYS 330 329 329 CYS CYS B . n 
B 1 331 TYR 331 330 330 TYR TYR B . n 
B 1 332 GLY 332 331 331 GLY GLY B . n 
B 1 333 CYS 333 332 332 CYS CYS B . n 
B 1 334 GLU 334 333 333 GLU GLU B . n 
B 1 335 THR 335 334 334 THR THR B . n 
B 1 336 HIS 336 335 335 HIS HIS B . n 
B 1 337 ALA 337 336 336 ALA ALA B . n 
B 1 338 LEU 338 337 337 LEU LEU B . n 
B 1 339 LEU 339 338 338 LEU LEU B . n 
B 1 340 PRO 340 339 339 PRO PRO B . n 
B 1 341 TYR 341 340 340 TYR TYR B . n 
B 1 342 ASP 342 341 341 ASP ASP B . n 
B 1 343 GLN 343 342 342 GLN GLN B . n 
B 1 344 TYR 344 343 343 TYR TYR B . n 
B 1 345 MET 345 344 344 MET MET B . n 
B 1 346 HIS 346 345 345 HIS HIS B . n 
B 1 347 ARG 347 346 346 ARG ARG B . n 
B 1 348 PHE 348 347 347 PHE PHE B . n 
B 1 349 ALA 349 348 348 ALA ALA B . n 
B 1 350 ALA 350 349 349 ALA ALA B . n 
B 1 351 TYR 351 350 350 TYR TYR B . n 
B 1 352 PHE 352 351 351 PHE PHE B . n 
B 1 353 GLN 353 352 352 GLN GLN B . n 
B 1 354 GLN 354 353 353 GLN GLN B . n 
B 1 355 GLY 355 354 354 GLY GLY B . n 
B 1 356 ASP 356 355 355 ASP ASP B . n 
B 1 357 MET 357 356 356 MET MET B . n 
B 1 358 GLU 358 357 357 GLU GLU B . n 
B 1 359 SER 359 358 358 SER SER B . n 
B 1 360 ASN 360 359 359 ASN ASN B . n 
B 1 361 GLY 361 360 360 GLY GLY B . n 
B 1 362 LYS 362 361 361 LYS LYS B . n 
B 1 363 TYR 363 362 362 TYR TYR B . n 
B 1 364 ILE 364 363 363 ILE ILE B . n 
B 1 365 THR 365 364 364 THR THR B . n 
B 1 366 LYS 366 365 365 LYS LYS B . n 
B 1 367 SER 367 366 366 SER SER B . n 
B 1 368 GLY 368 367 367 GLY GLY B . n 
B 1 369 ALA 369 368 368 ALA ALA B . n 
B 1 370 ARG 370 369 369 ARG ARG B . n 
B 1 371 VAL 371 370 370 VAL VAL B . n 
B 1 372 ASP 372 371 371 ASP ASP B . n 
B 1 373 HIS 373 372 372 HIS HIS B . n 
B 1 374 GLN 374 373 373 GLN GLN B . n 
B 1 375 THR 375 374 374 THR THR B . n 
B 1 376 GLY 376 375 375 GLY GLY B . n 
B 1 377 PRO 377 376 376 PRO PRO B . n 
B 1 378 ILE 378 377 377 ILE ILE B . n 
B 1 379 VAL 379 378 378 VAL VAL B . n 
B 1 380 TRP 380 379 379 TRP TRP B . n 
B 1 381 GLY 381 380 380 GLY GLY B . n 
B 1 382 GLU 382 381 381 GLU GLU B . n 
B 1 383 PRO 383 382 382 PRO PRO B . n 
B 1 384 GLY 384 383 383 GLY GLY B . n 
B 1 385 THR 385 384 384 THR THR B . n 
B 1 386 ASN 386 385 385 ASN ASN B . n 
B 1 387 GLY 387 386 386 GLY GLY B . n 
B 1 388 GLN 388 387 387 GLN GLN B . n 
B 1 389 HIS 389 388 388 HIS HIS B . n 
B 1 390 ALA 390 389 389 ALA ALA B . n 
B 1 391 PHE 391 390 390 PHE PHE B . n 
B 1 392 TYR 392 391 391 TYR TYR B . n 
B 1 393 GLN 393 392 392 GLN GLN B . n 
B 1 394 LEU 394 393 393 LEU LEU B . n 
B 1 395 ILE 395 394 394 ILE ILE B . n 
B 1 396 HIS 396 395 395 HIS HIS B . n 
B 1 397 GLN 397 396 396 GLN GLN B . n 
B 1 398 GLY 398 397 397 GLY GLY B . n 
B 1 399 THR 399 398 398 THR THR B . n 
B 1 400 LYS 400 399 399 LYS LYS B . n 
B 1 401 MET 401 400 400 MET MET B . n 
B 1 402 ILE 402 401 401 ILE ILE B . n 
B 1 403 PRO 403 402 402 PRO PRO B . n 
B 1 404 CYS 404 403 403 CYS CYS B . n 
B 1 405 ASP 405 404 404 ASP ASP B . n 
B 1 406 PHE 406 405 405 PHE PHE B . n 
B 1 407 LEU 407 406 406 LEU LEU B . n 
B 1 408 ILE 408 407 407 ILE ILE B . n 
B 1 409 PRO 409 408 408 PRO PRO B . n 
B 1 410 VAL 410 409 409 VAL VAL B . n 
B 1 411 GLN 411 410 410 GLN GLN B . n 
B 1 412 THR 412 411 411 THR THR B . n 
B 1 413 GLN 413 412 412 GLN GLN B . n 
B 1 414 HIS 414 413 413 HIS HIS B . n 
B 1 415 PRO 415 414 414 PRO PRO B . n 
B 1 416 ILE 416 415 415 ILE ILE B . n 
B 1 417 ARG 417 416 416 ARG ARG B . n 
B 1 418 LYS 418 417 417 LYS LYS B . n 
B 1 419 GLY 419 418 418 GLY GLY B . n 
B 1 420 LEU 420 419 419 LEU LEU B . n 
B 1 421 HIS 421 420 420 HIS HIS B . n 
B 1 422 HIS 422 421 421 HIS HIS B . n 
B 1 423 LYS 423 422 422 LYS LYS B . n 
B 1 424 ILE 424 423 423 ILE ILE B . n 
B 1 425 LEU 425 424 424 LEU LEU B . n 
B 1 426 LEU 426 425 425 LEU LEU B . n 
B 1 427 ALA 427 426 426 ALA ALA B . n 
B 1 428 ASN 428 427 427 ASN ASN B . n 
B 1 429 PHE 429 428 428 PHE PHE B . n 
B 1 430 LEU 430 429 429 LEU LEU B . n 
B 1 431 ALA 431 430 430 ALA ALA B . n 
B 1 432 GLN 432 431 431 GLN GLN B . n 
B 1 433 THR 433 432 432 THR THR B . n 
B 1 434 GLU 434 433 433 GLU GLU B . n 
B 1 435 ALA 435 434 434 ALA ALA B . n 
B 1 436 LEU 436 435 435 LEU LEU B . n 
B 1 437 MET 437 436 436 MET MET B . n 
B 1 438 LYS 438 437 437 LYS LYS B . n 
B 1 439 GLY 439 438 438 GLY GLY B . n 
B 1 440 LYS 440 439 439 LYS LYS B . n 
B 1 441 LEU 441 440 440 LEU LEU B . n 
B 1 442 PRO 442 441 441 PRO PRO B . n 
B 1 443 GLU 443 442 442 GLU GLU B . n 
B 1 444 GLU 444 443 443 GLU GLU B . n 
B 1 445 ALA 445 444 444 ALA ALA B . n 
B 1 446 ARG 446 445 445 ARG ARG B . n 
B 1 447 LYS 447 446 446 LYS LYS B . n 
B 1 448 GLU 448 447 447 GLU GLU B . n 
B 1 449 LEU 449 448 448 LEU LEU B . n 
B 1 450 GLN 450 449 449 GLN GLN B . n 
B 1 451 ALA 451 450 450 ALA ALA B . n 
B 1 452 ALA 452 451 451 ALA ALA B . n 
B 1 453 GLY 453 452 452 GLY GLY B . n 
B 1 454 LYS 454 453 453 LYS LYS B . n 
B 1 455 SER 455 454 454 SER SER B . n 
B 1 456 PRO 456 455 455 PRO PRO B . n 
B 1 457 GLU 457 456 456 GLU GLU B . n 
B 1 458 ASP 458 457 457 ASP ASP B . n 
B 1 459 LEU 459 458 458 LEU LEU B . n 
B 1 460 GLU 460 459 459 GLU GLU B . n 
B 1 461 LYS 461 460 460 LYS LYS B . n 
B 1 462 LEU 462 461 461 LEU LEU B . n 
B 1 463 LEU 463 462 462 LEU LEU B . n 
B 1 464 PRO 464 463 463 PRO PRO B . n 
B 1 465 HIS 465 464 464 HIS HIS B . n 
B 1 466 LYS 466 465 465 LYS LYS B . n 
B 1 467 VAL 467 466 466 VAL VAL B . n 
B 1 468 PHE 468 467 467 PHE PHE B . n 
B 1 469 GLU 469 468 468 GLU GLU B . n 
B 1 470 GLY 470 469 469 GLY GLY B . n 
B 1 471 ASN 471 470 470 ASN ASN B . n 
B 1 472 ARG 472 471 471 ARG ARG B . n 
B 1 473 PRO 473 472 472 PRO PRO B . n 
B 1 474 THR 474 473 473 THR THR B . n 
B 1 475 ASN 475 474 474 ASN ASN B . n 
B 1 476 SER 476 475 475 SER SER B . n 
B 1 477 ILE 477 476 476 ILE ILE B . n 
B 1 478 VAL 478 477 477 VAL VAL B . n 
B 1 479 PHE 479 478 478 PHE PHE B . n 
B 1 480 THR 480 479 479 THR THR B . n 
B 1 481 LYS 481 480 480 LYS LYS B . n 
B 1 482 LEU 482 481 481 LEU LEU B . n 
B 1 483 THR 483 482 482 THR THR B . n 
B 1 484 PRO 484 483 483 PRO PRO B . n 
B 1 485 PHE 485 484 484 PHE PHE B . n 
B 1 486 ILE 486 485 485 ILE ILE B . n 
B 1 487 LEU 487 486 486 LEU LEU B . n 
B 1 488 GLY 488 487 487 GLY GLY B . n 
B 1 489 ALA 489 488 488 ALA ALA B . n 
B 1 490 LEU 490 489 489 LEU LEU B . n 
B 1 491 ILE 491 490 490 ILE ILE B . n 
B 1 492 ALA 492 491 491 ALA ALA B . n 
B 1 493 MET 493 492 492 MET MET B . n 
B 1 494 TYR 494 493 493 TYR TYR B . n 
B 1 495 GLU 495 494 494 GLU GLU B . n 
B 1 496 HIS 496 495 495 HIS HIS B . n 
B 1 497 LYS 497 496 496 LYS LYS B . n 
B 1 498 ILE 498 497 497 ILE ILE B . n 
B 1 499 PHE 499 498 498 PHE PHE B . n 
B 1 500 VAL 500 499 499 VAL VAL B . n 
B 1 501 GLN 501 500 500 GLN GLN B . n 
B 1 502 GLY 502 501 501 GLY GLY B . n 
B 1 503 ILE 503 502 502 ILE ILE B . n 
B 1 504 MET 504 503 503 MET MET B . n 
B 1 505 TRP 505 504 504 TRP TRP B . n 
B 1 506 ASP 506 505 505 ASP ASP B . n 
B 1 507 ILE 507 506 506 ILE ILE B . n 
B 1 508 ASN 508 507 507 ASN ASN B . n 
B 1 509 SER 509 508 508 SER SER B . n 
B 1 510 PHE 510 509 509 PHE PHE B . n 
B 1 511 ASP 511 510 510 ASP ASP B . n 
B 1 512 GLN 512 511 511 GLN GLN B . n 
B 1 513 TRP 513 512 512 TRP TRP B . n 
B 1 514 GLY 514 513 513 GLY GLY B . n 
B 1 515 VAL 515 514 514 VAL VAL B . n 
B 1 516 GLU 516 515 515 GLU GLU B . n 
B 1 517 LEU 517 516 516 LEU LEU B . n 
B 1 518 GLY 518 517 517 GLY GLY B . n 
B 1 519 LYS 519 518 518 LYS LYS B . n 
B 1 520 GLN 520 519 519 GLN GLN B . n 
B 1 521 LEU 521 520 520 LEU LEU B . n 
B 1 522 ALA 522 521 521 ALA ALA B . n 
B 1 523 LYS 523 522 522 LYS LYS B . n 
B 1 524 LYS 524 523 523 LYS LYS B . n 
B 1 525 ILE 525 524 524 ILE ILE B . n 
B 1 526 GLU 526 525 525 GLU GLU B . n 
B 1 527 PRO 527 526 526 PRO PRO B . n 
B 1 528 GLU 528 527 527 GLU GLU B . n 
B 1 529 LEU 529 528 528 LEU LEU B . n 
B 1 530 GLU 530 529 529 GLU GLU B . n 
B 1 531 GLY 531 530 530 GLY GLY B . n 
B 1 532 SER 532 531 531 SER SER B . n 
B 1 533 SER 533 532 532 SER SER B . n 
B 1 534 ALA 534 533 533 ALA ALA B . n 
B 1 535 VAL 535 534 534 VAL VAL B . n 
B 1 536 THR 536 535 535 THR THR B . n 
B 1 537 SER 537 536 536 SER SER B . n 
B 1 538 HIS 538 537 537 HIS HIS B . n 
B 1 539 ASP 539 538 538 ASP ASP B . n 
B 1 540 SER 540 539 539 SER SER B . n 
B 1 541 SER 541 540 540 SER SER B . n 
B 1 542 THR 542 541 541 THR THR B . n 
B 1 543 ASN 543 542 542 ASN ASN B . n 
B 1 544 GLY 544 543 543 GLY GLY B . n 
B 1 545 LEU 545 544 544 LEU LEU B . n 
B 1 546 ILE 546 545 545 ILE ILE B . n 
B 1 547 SER 547 546 546 SER SER B . n 
B 1 548 PHE 548 547 547 PHE PHE B . n 
B 1 549 ILE 549 548 548 ILE ILE B . n 
B 1 550 LYS 550 549 549 LYS LYS B . n 
B 1 551 GLN 551 550 550 GLN GLN B . n 
B 1 552 GLN 552 551 551 GLN GLN B . n 
B 1 553 ARG 553 552 552 ARG ARG B . n 
B 1 554 ASP 554 553 553 ASP ASP B . n 
B 1 555 THR 555 554 554 THR THR B . n 
B 1 556 LYS 556 555 555 LYS LYS B . n 
B 1 557 LEU 557 556 556 LEU LEU B . n 
B 1 558 GLU 558 557 ?   ?   ?   B . n 
B 1 559 HIS 559 558 ?   ?   ?   B . n 
B 1 560 HIS 560 559 ?   ?   ?   B . n 
B 1 561 HIS 561 560 ?   ?   ?   B . n 
B 1 562 HIS 562 561 ?   ?   ?   B . n 
B 1 563 HIS 563 562 ?   ?   ?   B . n 
B 1 564 HIS 564 563 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C  2 G6P 1   900  900  G6P G6P A . 
D  3 G6Q 1   901  901  G6Q G6Q A . 
E  4 SO4 1   1001 1001 SO4 SO4 A . 
F  4 SO4 1   1002 1002 SO4 SO4 A . 
G  5 GOL 1   1021 1021 GOL GOL A . 
H  5 GOL 1   1023 1023 GOL GOL A . 
I  5 GOL 1   1024 1024 GOL GOL A . 
J  5 GOL 1   1025 1025 GOL GOL A . 
K  5 GOL 1   1026 1026 GOL GOL A . 
L  5 GOL 1   1027 1027 GOL GOL A . 
M  5 GOL 1   1030 1030 GOL GOL A . 
N  5 GOL 1   1031 1031 GOL GOL A . 
O  5 GOL 1   1032 1032 GOL GOL A . 
P  4 SO4 1   1003 1003 SO4 SO4 B . 
Q  4 SO4 1   1004 1004 SO4 SO4 B . 
R  4 SO4 1   1005 1005 SO4 SO4 B . 
S  4 SO4 1   1006 1006 SO4 SO4 B . 
T  4 SO4 1   1007 1007 SO4 SO4 B . 
U  4 SO4 1   1008 1008 SO4 SO4 B . 
V  6 BME 1   1011 1011 BME BME B . 
W  5 GOL 1   1022 1022 GOL GOL B . 
X  5 GOL 1   1028 1028 GOL GOL B . 
Y  5 GOL 1   1029 1029 GOL GOL B . 
Z  7 HOH 1   1033 1    HOH HOH A . 
Z  7 HOH 2   1034 2    HOH HOH A . 
Z  7 HOH 3   1035 3    HOH HOH A . 
Z  7 HOH 4   1036 4    HOH HOH A . 
Z  7 HOH 5   1037 6    HOH HOH A . 
Z  7 HOH 6   1038 7    HOH HOH A . 
Z  7 HOH 7   1039 8    HOH HOH A . 
Z  7 HOH 8   1040 10   HOH HOH A . 
Z  7 HOH 9   1041 11   HOH HOH A . 
Z  7 HOH 10  1042 12   HOH HOH A . 
Z  7 HOH 11  1043 13   HOH HOH A . 
Z  7 HOH 12  1044 14   HOH HOH A . 
Z  7 HOH 13  1045 15   HOH HOH A . 
Z  7 HOH 14  1046 16   HOH HOH A . 
Z  7 HOH 15  1047 17   HOH HOH A . 
Z  7 HOH 16  1048 19   HOH HOH A . 
Z  7 HOH 17  1049 20   HOH HOH A . 
Z  7 HOH 18  1050 22   HOH HOH A . 
Z  7 HOH 19  1051 25   HOH HOH A . 
Z  7 HOH 20  1052 29   HOH HOH A . 
Z  7 HOH 21  1053 30   HOH HOH A . 
Z  7 HOH 22  1054 31   HOH HOH A . 
Z  7 HOH 23  1055 32   HOH HOH A . 
Z  7 HOH 24  1056 33   HOH HOH A . 
Z  7 HOH 25  1057 37   HOH HOH A . 
Z  7 HOH 26  1058 38   HOH HOH A . 
Z  7 HOH 27  1059 39   HOH HOH A . 
Z  7 HOH 28  1060 40   HOH HOH A . 
Z  7 HOH 29  1061 41   HOH HOH A . 
Z  7 HOH 30  1062 44   HOH HOH A . 
Z  7 HOH 31  1063 47   HOH HOH A . 
Z  7 HOH 32  1064 48   HOH HOH A . 
Z  7 HOH 33  1065 52   HOH HOH A . 
Z  7 HOH 34  1066 53   HOH HOH A . 
Z  7 HOH 35  1067 57   HOH HOH A . 
Z  7 HOH 36  1068 58   HOH HOH A . 
Z  7 HOH 37  1069 59   HOH HOH A . 
Z  7 HOH 38  1070 62   HOH HOH A . 
Z  7 HOH 39  1071 63   HOH HOH A . 
Z  7 HOH 40  1072 64   HOH HOH A . 
Z  7 HOH 41  1073 65   HOH HOH A . 
Z  7 HOH 42  1074 66   HOH HOH A . 
Z  7 HOH 43  1075 67   HOH HOH A . 
Z  7 HOH 44  1076 69   HOH HOH A . 
Z  7 HOH 45  1077 70   HOH HOH A . 
Z  7 HOH 46  1078 74   HOH HOH A . 
Z  7 HOH 47  1079 76   HOH HOH A . 
Z  7 HOH 48  1080 79   HOH HOH A . 
Z  7 HOH 49  1081 83   HOH HOH A . 
Z  7 HOH 50  1082 86   HOH HOH A . 
Z  7 HOH 51  1083 90   HOH HOH A . 
Z  7 HOH 52  1084 92   HOH HOH A . 
Z  7 HOH 53  1085 96   HOH HOH A . 
Z  7 HOH 54  1086 97   HOH HOH A . 
Z  7 HOH 55  1087 100  HOH HOH A . 
Z  7 HOH 56  1088 103  HOH HOH A . 
Z  7 HOH 57  1089 107  HOH HOH A . 
Z  7 HOH 58  1090 108  HOH HOH A . 
Z  7 HOH 59  1091 112  HOH HOH A . 
Z  7 HOH 60  1092 113  HOH HOH A . 
Z  7 HOH 61  1093 115  HOH HOH A . 
Z  7 HOH 62  1094 117  HOH HOH A . 
Z  7 HOH 63  1095 118  HOH HOH A . 
Z  7 HOH 64  1096 120  HOH HOH A . 
Z  7 HOH 65  1097 121  HOH HOH A . 
Z  7 HOH 66  1098 122  HOH HOH A . 
Z  7 HOH 67  1099 123  HOH HOH A . 
Z  7 HOH 68  1100 126  HOH HOH A . 
Z  7 HOH 69  1101 127  HOH HOH A . 
Z  7 HOH 70  1102 130  HOH HOH A . 
Z  7 HOH 71  1103 133  HOH HOH A . 
Z  7 HOH 72  1104 134  HOH HOH A . 
Z  7 HOH 73  1105 136  HOH HOH A . 
Z  7 HOH 74  1106 137  HOH HOH A . 
Z  7 HOH 75  1107 138  HOH HOH A . 
Z  7 HOH 76  1108 140  HOH HOH A . 
Z  7 HOH 77  1109 141  HOH HOH A . 
Z  7 HOH 78  1110 142  HOH HOH A . 
Z  7 HOH 79  1111 145  HOH HOH A . 
Z  7 HOH 80  1112 146  HOH HOH A . 
Z  7 HOH 81  1113 147  HOH HOH A . 
Z  7 HOH 82  1114 151  HOH HOH A . 
Z  7 HOH 83  1115 153  HOH HOH A . 
Z  7 HOH 84  1116 156  HOH HOH A . 
Z  7 HOH 85  1117 157  HOH HOH A . 
Z  7 HOH 86  1118 161  HOH HOH A . 
Z  7 HOH 87  1119 163  HOH HOH A . 
Z  7 HOH 88  1120 164  HOH HOH A . 
Z  7 HOH 89  1121 167  HOH HOH A . 
Z  7 HOH 90  1122 168  HOH HOH A . 
Z  7 HOH 91  1123 174  HOH HOH A . 
Z  7 HOH 92  1124 175  HOH HOH A . 
Z  7 HOH 93  1125 176  HOH HOH A . 
Z  7 HOH 94  1126 178  HOH HOH A . 
Z  7 HOH 95  1127 179  HOH HOH A . 
Z  7 HOH 96  1128 181  HOH HOH A . 
Z  7 HOH 97  1129 182  HOH HOH A . 
Z  7 HOH 98  1130 183  HOH HOH A . 
Z  7 HOH 99  1131 185  HOH HOH A . 
Z  7 HOH 100 1132 186  HOH HOH A . 
Z  7 HOH 101 1133 187  HOH HOH A . 
Z  7 HOH 102 1134 190  HOH HOH A . 
Z  7 HOH 103 1135 191  HOH HOH A . 
Z  7 HOH 104 1136 192  HOH HOH A . 
Z  7 HOH 105 1137 193  HOH HOH A . 
Z  7 HOH 106 1138 194  HOH HOH A . 
Z  7 HOH 107 1139 195  HOH HOH A . 
Z  7 HOH 108 1140 197  HOH HOH A . 
Z  7 HOH 109 1141 198  HOH HOH A . 
Z  7 HOH 110 1142 199  HOH HOH A . 
Z  7 HOH 111 1143 203  HOH HOH A . 
Z  7 HOH 112 1144 204  HOH HOH A . 
Z  7 HOH 113 1145 207  HOH HOH A . 
Z  7 HOH 114 1146 208  HOH HOH A . 
Z  7 HOH 115 1147 212  HOH HOH A . 
Z  7 HOH 116 1148 215  HOH HOH A . 
Z  7 HOH 117 1149 216  HOH HOH A . 
Z  7 HOH 118 1150 218  HOH HOH A . 
Z  7 HOH 119 1151 220  HOH HOH A . 
Z  7 HOH 120 1152 222  HOH HOH A . 
Z  7 HOH 121 1153 223  HOH HOH A . 
Z  7 HOH 122 1154 224  HOH HOH A . 
Z  7 HOH 123 1155 225  HOH HOH A . 
Z  7 HOH 124 1156 226  HOH HOH A . 
Z  7 HOH 125 1157 229  HOH HOH A . 
Z  7 HOH 126 1158 230  HOH HOH A . 
Z  7 HOH 127 1159 232  HOH HOH A . 
Z  7 HOH 128 1160 233  HOH HOH A . 
Z  7 HOH 129 1161 235  HOH HOH A . 
Z  7 HOH 130 1162 236  HOH HOH A . 
Z  7 HOH 131 1163 237  HOH HOH A . 
Z  7 HOH 132 1164 238  HOH HOH A . 
Z  7 HOH 133 1165 241  HOH HOH A . 
Z  7 HOH 134 1166 242  HOH HOH A . 
Z  7 HOH 135 1167 243  HOH HOH A . 
Z  7 HOH 136 1168 244  HOH HOH A . 
Z  7 HOH 137 1169 245  HOH HOH A . 
Z  7 HOH 138 1170 249  HOH HOH A . 
Z  7 HOH 139 1171 250  HOH HOH A . 
Z  7 HOH 140 1172 257  HOH HOH A . 
Z  7 HOH 141 1173 260  HOH HOH A . 
Z  7 HOH 142 1174 264  HOH HOH A . 
Z  7 HOH 143 1175 265  HOH HOH A . 
Z  7 HOH 144 1176 266  HOH HOH A . 
Z  7 HOH 145 1177 268  HOH HOH A . 
Z  7 HOH 146 1178 270  HOH HOH A . 
Z  7 HOH 147 1179 271  HOH HOH A . 
Z  7 HOH 148 1180 272  HOH HOH A . 
Z  7 HOH 149 1181 275  HOH HOH A . 
Z  7 HOH 150 1182 277  HOH HOH A . 
Z  7 HOH 151 1183 279  HOH HOH A . 
Z  7 HOH 152 1184 280  HOH HOH A . 
Z  7 HOH 153 1185 283  HOH HOH A . 
Z  7 HOH 154 1186 285  HOH HOH A . 
Z  7 HOH 155 1187 286  HOH HOH A . 
Z  7 HOH 156 1188 287  HOH HOH A . 
Z  7 HOH 157 1189 289  HOH HOH A . 
Z  7 HOH 158 1190 291  HOH HOH A . 
Z  7 HOH 159 1191 293  HOH HOH A . 
Z  7 HOH 160 1192 297  HOH HOH A . 
Z  7 HOH 161 1193 299  HOH HOH A . 
Z  7 HOH 162 1194 301  HOH HOH A . 
Z  7 HOH 163 1195 303  HOH HOH A . 
Z  7 HOH 164 1196 304  HOH HOH A . 
Z  7 HOH 165 1197 306  HOH HOH A . 
Z  7 HOH 166 1198 307  HOH HOH A . 
Z  7 HOH 167 1199 312  HOH HOH A . 
Z  7 HOH 168 1200 316  HOH HOH A . 
Z  7 HOH 169 1201 317  HOH HOH A . 
Z  7 HOH 170 1202 318  HOH HOH A . 
Z  7 HOH 171 1203 319  HOH HOH A . 
Z  7 HOH 172 1204 320  HOH HOH A . 
Z  7 HOH 173 1205 321  HOH HOH A . 
Z  7 HOH 174 1206 322  HOH HOH A . 
Z  7 HOH 175 1207 323  HOH HOH A . 
Z  7 HOH 176 1208 324  HOH HOH A . 
Z  7 HOH 177 1209 326  HOH HOH A . 
Z  7 HOH 178 1210 327  HOH HOH A . 
Z  7 HOH 179 1211 330  HOH HOH A . 
Z  7 HOH 180 1212 331  HOH HOH A . 
Z  7 HOH 181 1213 332  HOH HOH A . 
Z  7 HOH 182 1214 335  HOH HOH A . 
Z  7 HOH 183 1215 336  HOH HOH A . 
Z  7 HOH 184 1216 340  HOH HOH A . 
Z  7 HOH 185 1217 344  HOH HOH A . 
Z  7 HOH 186 1218 345  HOH HOH A . 
Z  7 HOH 187 1219 346  HOH HOH A . 
Z  7 HOH 188 1220 350  HOH HOH A . 
Z  7 HOH 189 1221 352  HOH HOH A . 
Z  7 HOH 190 1222 354  HOH HOH A . 
Z  7 HOH 191 1223 355  HOH HOH A . 
Z  7 HOH 192 1224 357  HOH HOH A . 
Z  7 HOH 193 1225 358  HOH HOH A . 
Z  7 HOH 194 1226 359  HOH HOH A . 
Z  7 HOH 195 1227 360  HOH HOH A . 
Z  7 HOH 196 1228 361  HOH HOH A . 
Z  7 HOH 197 1229 365  HOH HOH A . 
Z  7 HOH 198 1230 366  HOH HOH A . 
Z  7 HOH 199 1231 367  HOH HOH A . 
Z  7 HOH 200 1232 370  HOH HOH A . 
Z  7 HOH 201 1233 371  HOH HOH A . 
Z  7 HOH 202 1234 382  HOH HOH A . 
Z  7 HOH 203 1235 383  HOH HOH A . 
Z  7 HOH 204 1236 384  HOH HOH A . 
Z  7 HOH 205 1237 391  HOH HOH A . 
Z  7 HOH 206 1238 392  HOH HOH A . 
Z  7 HOH 207 1239 394  HOH HOH A . 
Z  7 HOH 208 1240 396  HOH HOH A . 
Z  7 HOH 209 1241 397  HOH HOH A . 
Z  7 HOH 210 1242 398  HOH HOH A . 
Z  7 HOH 211 1243 399  HOH HOH A . 
Z  7 HOH 212 1244 401  HOH HOH A . 
Z  7 HOH 213 1245 402  HOH HOH A . 
Z  7 HOH 214 1246 403  HOH HOH A . 
Z  7 HOH 215 1247 406  HOH HOH A . 
Z  7 HOH 216 1248 407  HOH HOH A . 
Z  7 HOH 217 1249 408  HOH HOH A . 
Z  7 HOH 218 1250 409  HOH HOH A . 
Z  7 HOH 219 1251 417  HOH HOH A . 
Z  7 HOH 220 1252 420  HOH HOH A . 
Z  7 HOH 221 1253 421  HOH HOH A . 
Z  7 HOH 222 1254 422  HOH HOH A . 
Z  7 HOH 223 1255 423  HOH HOH A . 
Z  7 HOH 224 1256 425  HOH HOH A . 
Z  7 HOH 225 1257 427  HOH HOH A . 
Z  7 HOH 226 1258 428  HOH HOH A . 
Z  7 HOH 227 1259 430  HOH HOH A . 
Z  7 HOH 228 1260 431  HOH HOH A . 
Z  7 HOH 229 1261 432  HOH HOH A . 
Z  7 HOH 230 1262 437  HOH HOH A . 
Z  7 HOH 231 1263 438  HOH HOH A . 
Z  7 HOH 232 1264 439  HOH HOH A . 
Z  7 HOH 233 1265 440  HOH HOH A . 
Z  7 HOH 234 1266 441  HOH HOH A . 
Z  7 HOH 235 1267 442  HOH HOH A . 
Z  7 HOH 236 1268 444  HOH HOH A . 
Z  7 HOH 237 1269 445  HOH HOH A . 
Z  7 HOH 238 1270 447  HOH HOH A . 
Z  7 HOH 239 1271 449  HOH HOH A . 
Z  7 HOH 240 1272 450  HOH HOH A . 
Z  7 HOH 241 1273 452  HOH HOH A . 
Z  7 HOH 242 1274 455  HOH HOH A . 
Z  7 HOH 243 1275 456  HOH HOH A . 
Z  7 HOH 244 1276 458  HOH HOH A . 
Z  7 HOH 245 1277 461  HOH HOH A . 
Z  7 HOH 246 1278 463  HOH HOH A . 
Z  7 HOH 247 1279 465  HOH HOH A . 
Z  7 HOH 248 1280 471  HOH HOH A . 
Z  7 HOH 249 1281 472  HOH HOH A . 
Z  7 HOH 250 1282 486  HOH HOH A . 
Z  7 HOH 251 1283 487  HOH HOH A . 
Z  7 HOH 252 1284 488  HOH HOH A . 
Z  7 HOH 253 1285 489  HOH HOH A . 
Z  7 HOH 254 1286 492  HOH HOH A . 
Z  7 HOH 255 1287 499  HOH HOH A . 
Z  7 HOH 256 1288 507  HOH HOH A . 
Z  7 HOH 257 1289 510  HOH HOH A . 
Z  7 HOH 258 1290 516  HOH HOH A . 
Z  7 HOH 259 1291 518  HOH HOH A . 
Z  7 HOH 260 1292 526  HOH HOH A . 
Z  7 HOH 261 1293 528  HOH HOH A . 
Z  7 HOH 262 1294 529  HOH HOH A . 
Z  7 HOH 263 1295 530  HOH HOH A . 
Z  7 HOH 264 1296 534  HOH HOH A . 
Z  7 HOH 265 1297 535  HOH HOH A . 
Z  7 HOH 266 1298 536  HOH HOH A . 
Z  7 HOH 267 1299 537  HOH HOH A . 
Z  7 HOH 268 1300 541  HOH HOH A . 
Z  7 HOH 269 1301 546  HOH HOH A . 
Z  7 HOH 270 1302 547  HOH HOH A . 
Z  7 HOH 271 1303 548  HOH HOH A . 
Z  7 HOH 272 1304 549  HOH HOH A . 
Z  7 HOH 273 1305 551  HOH HOH A . 
Z  7 HOH 274 1306 556  HOH HOH A . 
Z  7 HOH 275 1307 558  HOH HOH A . 
Z  7 HOH 276 1308 561  HOH HOH A . 
Z  7 HOH 277 1309 562  HOH HOH A . 
Z  7 HOH 278 1310 568  HOH HOH A . 
Z  7 HOH 279 1311 569  HOH HOH A . 
Z  7 HOH 280 1312 573  HOH HOH A . 
Z  7 HOH 281 1313 576  HOH HOH A . 
Z  7 HOH 282 1314 577  HOH HOH A . 
Z  7 HOH 283 1315 578  HOH HOH A . 
Z  7 HOH 284 1316 579  HOH HOH A . 
Z  7 HOH 285 1317 580  HOH HOH A . 
Z  7 HOH 286 1318 581  HOH HOH A . 
Z  7 HOH 287 1319 582  HOH HOH A . 
Z  7 HOH 288 1320 583  HOH HOH A . 
Z  7 HOH 289 1321 586  HOH HOH A . 
Z  7 HOH 290 1322 592  HOH HOH A . 
Z  7 HOH 291 1323 593  HOH HOH A . 
Z  7 HOH 292 1324 594  HOH HOH A . 
Z  7 HOH 293 1325 598  HOH HOH A . 
Z  7 HOH 294 1326 599  HOH HOH A . 
Z  7 HOH 295 1327 601  HOH HOH A . 
Z  7 HOH 296 1328 602  HOH HOH A . 
Z  7 HOH 297 1329 606  HOH HOH A . 
Z  7 HOH 298 1330 607  HOH HOH A . 
Z  7 HOH 299 1331 609  HOH HOH A . 
Z  7 HOH 300 1332 610  HOH HOH A . 
Z  7 HOH 301 1333 613  HOH HOH A . 
Z  7 HOH 302 1334 614  HOH HOH A . 
Z  7 HOH 303 1335 617  HOH HOH A . 
Z  7 HOH 304 1336 624  HOH HOH A . 
Z  7 HOH 305 1337 626  HOH HOH A . 
Z  7 HOH 306 1338 629  HOH HOH A . 
Z  7 HOH 307 1339 630  HOH HOH A . 
Z  7 HOH 308 1340 631  HOH HOH A . 
Z  7 HOH 309 1341 632  HOH HOH A . 
Z  7 HOH 310 1342 633  HOH HOH A . 
Z  7 HOH 311 1343 634  HOH HOH A . 
Z  7 HOH 312 1344 636  HOH HOH A . 
Z  7 HOH 313 1345 641  HOH HOH A . 
Z  7 HOH 314 1346 642  HOH HOH A . 
Z  7 HOH 315 1347 645  HOH HOH A . 
Z  7 HOH 316 1348 646  HOH HOH A . 
Z  7 HOH 317 1349 648  HOH HOH A . 
Z  7 HOH 318 1350 650  HOH HOH A . 
Z  7 HOH 319 1351 651  HOH HOH A . 
Z  7 HOH 320 1352 652  HOH HOH A . 
Z  7 HOH 321 1353 654  HOH HOH A . 
Z  7 HOH 322 1354 655  HOH HOH A . 
Z  7 HOH 323 1355 656  HOH HOH A . 
Z  7 HOH 324 1356 657  HOH HOH A . 
Z  7 HOH 325 1357 658  HOH HOH A . 
Z  7 HOH 326 1358 661  HOH HOH A . 
Z  7 HOH 327 1359 662  HOH HOH A . 
Z  7 HOH 328 1360 663  HOH HOH A . 
Z  7 HOH 329 1361 664  HOH HOH A . 
Z  7 HOH 330 1362 666  HOH HOH A . 
Z  7 HOH 331 1363 667  HOH HOH A . 
Z  7 HOH 332 1364 668  HOH HOH A . 
Z  7 HOH 333 1365 669  HOH HOH A . 
Z  7 HOH 334 1366 671  HOH HOH A . 
Z  7 HOH 335 1367 672  HOH HOH A . 
Z  7 HOH 336 1368 673  HOH HOH A . 
Z  7 HOH 337 1369 674  HOH HOH A . 
Z  7 HOH 338 1370 676  HOH HOH A . 
Z  7 HOH 339 1371 677  HOH HOH A . 
Z  7 HOH 340 1372 678  HOH HOH A . 
Z  7 HOH 341 1373 679  HOH HOH A . 
Z  7 HOH 342 1374 680  HOH HOH A . 
Z  7 HOH 343 1375 686  HOH HOH A . 
Z  7 HOH 344 1376 690  HOH HOH A . 
Z  7 HOH 345 1377 691  HOH HOH A . 
Z  7 HOH 346 1378 692  HOH HOH A . 
Z  7 HOH 347 1379 693  HOH HOH A . 
Z  7 HOH 348 1380 694  HOH HOH A . 
Z  7 HOH 349 1381 695  HOH HOH A . 
Z  7 HOH 350 1382 697  HOH HOH A . 
Z  7 HOH 351 1383 698  HOH HOH A . 
Z  7 HOH 352 1384 700  HOH HOH A . 
Z  7 HOH 353 1385 703  HOH HOH A . 
Z  7 HOH 354 1386 704  HOH HOH A . 
Z  7 HOH 355 1387 706  HOH HOH A . 
Z  7 HOH 356 1388 707  HOH HOH A . 
Z  7 HOH 357 1389 708  HOH HOH A . 
Z  7 HOH 358 1390 711  HOH HOH A . 
Z  7 HOH 359 1391 714  HOH HOH A . 
Z  7 HOH 360 1392 716  HOH HOH A . 
Z  7 HOH 361 1393 717  HOH HOH A . 
Z  7 HOH 362 1394 718  HOH HOH A . 
Z  7 HOH 363 1395 719  HOH HOH A . 
Z  7 HOH 364 1396 721  HOH HOH A . 
Z  7 HOH 365 1397 722  HOH HOH A . 
Z  7 HOH 366 1398 723  HOH HOH A . 
Z  7 HOH 367 1399 724  HOH HOH A . 
Z  7 HOH 368 1400 725  HOH HOH A . 
Z  7 HOH 369 1401 731  HOH HOH A . 
Z  7 HOH 370 1402 732  HOH HOH A . 
Z  7 HOH 371 1403 733  HOH HOH A . 
Z  7 HOH 372 1404 734  HOH HOH A . 
Z  7 HOH 373 1405 735  HOH HOH A . 
Z  7 HOH 374 1406 736  HOH HOH A . 
Z  7 HOH 375 1407 737  HOH HOH A . 
Z  7 HOH 376 1408 738  HOH HOH A . 
Z  7 HOH 377 1409 741  HOH HOH A . 
Z  7 HOH 378 1410 745  HOH HOH A . 
Z  7 HOH 379 1411 746  HOH HOH A . 
Z  7 HOH 380 1412 749  HOH HOH A . 
Z  7 HOH 381 1413 751  HOH HOH A . 
Z  7 HOH 382 1414 755  HOH HOH A . 
Z  7 HOH 383 1415 756  HOH HOH A . 
Z  7 HOH 384 1416 757  HOH HOH A . 
Z  7 HOH 385 1417 759  HOH HOH A . 
Z  7 HOH 386 1418 762  HOH HOH A . 
Z  7 HOH 387 1419 763  HOH HOH A . 
Z  7 HOH 388 1420 764  HOH HOH A . 
Z  7 HOH 389 1421 765  HOH HOH A . 
Z  7 HOH 390 1422 766  HOH HOH A . 
Z  7 HOH 391 1423 767  HOH HOH A . 
Z  7 HOH 392 1424 768  HOH HOH A . 
Z  7 HOH 393 1425 771  HOH HOH A . 
Z  7 HOH 394 1426 772  HOH HOH A . 
Z  7 HOH 395 1427 773  HOH HOH A . 
Z  7 HOH 396 1428 774  HOH HOH A . 
Z  7 HOH 397 1429 775  HOH HOH A . 
Z  7 HOH 398 1430 777  HOH HOH A . 
Z  7 HOH 399 1431 778  HOH HOH A . 
Z  7 HOH 400 1432 781  HOH HOH A . 
Z  7 HOH 401 1433 782  HOH HOH A . 
Z  7 HOH 402 1434 783  HOH HOH A . 
Z  7 HOH 403 1435 784  HOH HOH A . 
Z  7 HOH 404 1436 785  HOH HOH A . 
Z  7 HOH 405 1437 786  HOH HOH A . 
Z  7 HOH 406 1438 787  HOH HOH A . 
Z  7 HOH 407 1439 790  HOH HOH A . 
Z  7 HOH 408 1440 792  HOH HOH A . 
Z  7 HOH 409 1441 798  HOH HOH A . 
Z  7 HOH 410 1442 799  HOH HOH A . 
Z  7 HOH 411 1443 800  HOH HOH A . 
Z  7 HOH 412 1444 802  HOH HOH A . 
Z  7 HOH 413 1445 804  HOH HOH A . 
Z  7 HOH 414 1446 807  HOH HOH A . 
Z  7 HOH 415 1447 808  HOH HOH A . 
Z  7 HOH 416 1448 809  HOH HOH A . 
Z  7 HOH 417 1449 810  HOH HOH A . 
Z  7 HOH 418 1450 812  HOH HOH A . 
Z  7 HOH 419 1451 814  HOH HOH A . 
Z  7 HOH 420 1452 815  HOH HOH A . 
Z  7 HOH 421 1453 817  HOH HOH A . 
Z  7 HOH 422 1454 819  HOH HOH A . 
Z  7 HOH 423 1455 824  HOH HOH A . 
Z  7 HOH 424 1456 827  HOH HOH A . 
Z  7 HOH 425 1457 829  HOH HOH A . 
Z  7 HOH 426 1458 830  HOH HOH A . 
Z  7 HOH 427 1459 831  HOH HOH A . 
Z  7 HOH 428 1460 833  HOH HOH A . 
Z  7 HOH 429 1461 836  HOH HOH A . 
Z  7 HOH 430 1462 837  HOH HOH A . 
Z  7 HOH 431 1463 839  HOH HOH A . 
Z  7 HOH 432 1464 841  HOH HOH A . 
Z  7 HOH 433 1465 842  HOH HOH A . 
Z  7 HOH 434 1466 845  HOH HOH A . 
Z  7 HOH 435 1467 846  HOH HOH A . 
Z  7 HOH 436 1468 847  HOH HOH A . 
Z  7 HOH 437 1469 849  HOH HOH A . 
Z  7 HOH 438 1470 855  HOH HOH A . 
Z  7 HOH 439 1471 856  HOH HOH A . 
Z  7 HOH 440 1472 857  HOH HOH A . 
Z  7 HOH 441 1473 858  HOH HOH A . 
AA 7 HOH 1   1030 5    HOH HOH B . 
AA 7 HOH 2   1031 9    HOH HOH B . 
AA 7 HOH 3   1032 18   HOH HOH B . 
AA 7 HOH 4   1033 21   HOH HOH B . 
AA 7 HOH 5   1034 23   HOH HOH B . 
AA 7 HOH 6   1035 24   HOH HOH B . 
AA 7 HOH 7   1036 26   HOH HOH B . 
AA 7 HOH 8   1037 27   HOH HOH B . 
AA 7 HOH 9   1038 28   HOH HOH B . 
AA 7 HOH 10  1039 34   HOH HOH B . 
AA 7 HOH 11  1040 35   HOH HOH B . 
AA 7 HOH 12  1041 36   HOH HOH B . 
AA 7 HOH 13  1042 42   HOH HOH B . 
AA 7 HOH 14  1043 43   HOH HOH B . 
AA 7 HOH 15  1044 45   HOH HOH B . 
AA 7 HOH 16  1045 46   HOH HOH B . 
AA 7 HOH 17  1046 49   HOH HOH B . 
AA 7 HOH 18  1047 50   HOH HOH B . 
AA 7 HOH 19  1048 51   HOH HOH B . 
AA 7 HOH 20  1049 54   HOH HOH B . 
AA 7 HOH 21  1050 55   HOH HOH B . 
AA 7 HOH 22  1051 56   HOH HOH B . 
AA 7 HOH 23  1052 60   HOH HOH B . 
AA 7 HOH 24  1053 61   HOH HOH B . 
AA 7 HOH 25  1054 68   HOH HOH B . 
AA 7 HOH 26  1055 71   HOH HOH B . 
AA 7 HOH 27  1056 72   HOH HOH B . 
AA 7 HOH 28  1057 73   HOH HOH B . 
AA 7 HOH 29  1058 75   HOH HOH B . 
AA 7 HOH 30  1059 77   HOH HOH B . 
AA 7 HOH 31  1060 78   HOH HOH B . 
AA 7 HOH 32  1061 80   HOH HOH B . 
AA 7 HOH 33  1062 81   HOH HOH B . 
AA 7 HOH 34  1063 82   HOH HOH B . 
AA 7 HOH 35  1064 84   HOH HOH B . 
AA 7 HOH 36  1065 85   HOH HOH B . 
AA 7 HOH 37  1066 87   HOH HOH B . 
AA 7 HOH 38  1067 88   HOH HOH B . 
AA 7 HOH 39  1068 89   HOH HOH B . 
AA 7 HOH 40  1069 91   HOH HOH B . 
AA 7 HOH 41  1070 93   HOH HOH B . 
AA 7 HOH 42  1071 94   HOH HOH B . 
AA 7 HOH 43  1072 95   HOH HOH B . 
AA 7 HOH 44  1073 98   HOH HOH B . 
AA 7 HOH 45  1074 99   HOH HOH B . 
AA 7 HOH 46  1075 101  HOH HOH B . 
AA 7 HOH 47  1076 102  HOH HOH B . 
AA 7 HOH 48  1077 104  HOH HOH B . 
AA 7 HOH 49  1078 105  HOH HOH B . 
AA 7 HOH 50  1079 106  HOH HOH B . 
AA 7 HOH 51  1080 109  HOH HOH B . 
AA 7 HOH 52  1081 110  HOH HOH B . 
AA 7 HOH 53  1082 111  HOH HOH B . 
AA 7 HOH 54  1083 114  HOH HOH B . 
AA 7 HOH 55  1084 116  HOH HOH B . 
AA 7 HOH 56  1085 119  HOH HOH B . 
AA 7 HOH 57  1086 124  HOH HOH B . 
AA 7 HOH 58  1087 125  HOH HOH B . 
AA 7 HOH 59  1088 128  HOH HOH B . 
AA 7 HOH 60  1089 129  HOH HOH B . 
AA 7 HOH 61  1090 131  HOH HOH B . 
AA 7 HOH 62  1091 132  HOH HOH B . 
AA 7 HOH 63  1092 135  HOH HOH B . 
AA 7 HOH 64  1093 139  HOH HOH B . 
AA 7 HOH 65  1094 143  HOH HOH B . 
AA 7 HOH 66  1095 144  HOH HOH B . 
AA 7 HOH 67  1096 148  HOH HOH B . 
AA 7 HOH 68  1097 149  HOH HOH B . 
AA 7 HOH 69  1098 150  HOH HOH B . 
AA 7 HOH 70  1099 152  HOH HOH B . 
AA 7 HOH 71  1100 154  HOH HOH B . 
AA 7 HOH 72  1101 155  HOH HOH B . 
AA 7 HOH 73  1102 158  HOH HOH B . 
AA 7 HOH 74  1103 159  HOH HOH B . 
AA 7 HOH 75  1104 160  HOH HOH B . 
AA 7 HOH 76  1105 162  HOH HOH B . 
AA 7 HOH 77  1106 165  HOH HOH B . 
AA 7 HOH 78  1107 166  HOH HOH B . 
AA 7 HOH 79  1108 169  HOH HOH B . 
AA 7 HOH 80  1109 170  HOH HOH B . 
AA 7 HOH 81  1110 171  HOH HOH B . 
AA 7 HOH 82  1111 172  HOH HOH B . 
AA 7 HOH 83  1112 173  HOH HOH B . 
AA 7 HOH 84  1113 177  HOH HOH B . 
AA 7 HOH 85  1114 180  HOH HOH B . 
AA 7 HOH 86  1115 184  HOH HOH B . 
AA 7 HOH 87  1116 188  HOH HOH B . 
AA 7 HOH 88  1117 189  HOH HOH B . 
AA 7 HOH 89  1118 196  HOH HOH B . 
AA 7 HOH 90  1119 200  HOH HOH B . 
AA 7 HOH 91  1120 201  HOH HOH B . 
AA 7 HOH 92  1121 202  HOH HOH B . 
AA 7 HOH 93  1122 205  HOH HOH B . 
AA 7 HOH 94  1123 206  HOH HOH B . 
AA 7 HOH 95  1124 209  HOH HOH B . 
AA 7 HOH 96  1125 210  HOH HOH B . 
AA 7 HOH 97  1126 211  HOH HOH B . 
AA 7 HOH 98  1127 213  HOH HOH B . 
AA 7 HOH 99  1128 214  HOH HOH B . 
AA 7 HOH 100 1129 217  HOH HOH B . 
AA 7 HOH 101 1130 219  HOH HOH B . 
AA 7 HOH 102 1131 221  HOH HOH B . 
AA 7 HOH 103 1132 227  HOH HOH B . 
AA 7 HOH 104 1133 228  HOH HOH B . 
AA 7 HOH 105 1134 231  HOH HOH B . 
AA 7 HOH 106 1135 234  HOH HOH B . 
AA 7 HOH 107 1136 239  HOH HOH B . 
AA 7 HOH 108 1137 240  HOH HOH B . 
AA 7 HOH 109 1138 246  HOH HOH B . 
AA 7 HOH 110 1139 247  HOH HOH B . 
AA 7 HOH 111 1140 248  HOH HOH B . 
AA 7 HOH 112 1141 251  HOH HOH B . 
AA 7 HOH 113 1142 252  HOH HOH B . 
AA 7 HOH 114 1143 253  HOH HOH B . 
AA 7 HOH 115 1144 254  HOH HOH B . 
AA 7 HOH 116 1145 255  HOH HOH B . 
AA 7 HOH 117 1146 256  HOH HOH B . 
AA 7 HOH 118 1147 258  HOH HOH B . 
AA 7 HOH 119 1148 259  HOH HOH B . 
AA 7 HOH 120 1149 261  HOH HOH B . 
AA 7 HOH 121 1150 262  HOH HOH B . 
AA 7 HOH 122 1151 263  HOH HOH B . 
AA 7 HOH 123 1152 267  HOH HOH B . 
AA 7 HOH 124 1153 269  HOH HOH B . 
AA 7 HOH 125 1154 273  HOH HOH B . 
AA 7 HOH 126 1155 274  HOH HOH B . 
AA 7 HOH 127 1156 276  HOH HOH B . 
AA 7 HOH 128 1157 278  HOH HOH B . 
AA 7 HOH 129 1158 281  HOH HOH B . 
AA 7 HOH 130 1159 282  HOH HOH B . 
AA 7 HOH 131 1160 284  HOH HOH B . 
AA 7 HOH 132 1161 288  HOH HOH B . 
AA 7 HOH 133 1162 290  HOH HOH B . 
AA 7 HOH 134 1163 292  HOH HOH B . 
AA 7 HOH 135 1164 294  HOH HOH B . 
AA 7 HOH 136 1165 295  HOH HOH B . 
AA 7 HOH 137 1166 296  HOH HOH B . 
AA 7 HOH 138 1167 298  HOH HOH B . 
AA 7 HOH 139 1168 300  HOH HOH B . 
AA 7 HOH 140 1169 302  HOH HOH B . 
AA 7 HOH 141 1170 305  HOH HOH B . 
AA 7 HOH 142 1171 308  HOH HOH B . 
AA 7 HOH 143 1172 309  HOH HOH B . 
AA 7 HOH 144 1173 310  HOH HOH B . 
AA 7 HOH 145 1174 311  HOH HOH B . 
AA 7 HOH 146 1175 313  HOH HOH B . 
AA 7 HOH 147 1176 314  HOH HOH B . 
AA 7 HOH 148 1177 315  HOH HOH B . 
AA 7 HOH 149 1178 325  HOH HOH B . 
AA 7 HOH 150 1179 328  HOH HOH B . 
AA 7 HOH 151 1180 329  HOH HOH B . 
AA 7 HOH 152 1181 333  HOH HOH B . 
AA 7 HOH 153 1182 334  HOH HOH B . 
AA 7 HOH 154 1183 337  HOH HOH B . 
AA 7 HOH 155 1184 338  HOH HOH B . 
AA 7 HOH 156 1185 339  HOH HOH B . 
AA 7 HOH 157 1186 341  HOH HOH B . 
AA 7 HOH 158 1187 342  HOH HOH B . 
AA 7 HOH 159 1188 343  HOH HOH B . 
AA 7 HOH 160 1189 347  HOH HOH B . 
AA 7 HOH 161 1190 348  HOH HOH B . 
AA 7 HOH 162 1191 349  HOH HOH B . 
AA 7 HOH 163 1192 351  HOH HOH B . 
AA 7 HOH 164 1193 353  HOH HOH B . 
AA 7 HOH 165 1194 356  HOH HOH B . 
AA 7 HOH 166 1195 362  HOH HOH B . 
AA 7 HOH 167 1196 363  HOH HOH B . 
AA 7 HOH 168 1197 364  HOH HOH B . 
AA 7 HOH 169 1198 368  HOH HOH B . 
AA 7 HOH 170 1199 369  HOH HOH B . 
AA 7 HOH 171 1200 372  HOH HOH B . 
AA 7 HOH 172 1201 373  HOH HOH B . 
AA 7 HOH 173 1202 374  HOH HOH B . 
AA 7 HOH 174 1203 375  HOH HOH B . 
AA 7 HOH 175 1204 376  HOH HOH B . 
AA 7 HOH 176 1205 377  HOH HOH B . 
AA 7 HOH 177 1206 378  HOH HOH B . 
AA 7 HOH 178 1207 379  HOH HOH B . 
AA 7 HOH 179 1208 380  HOH HOH B . 
AA 7 HOH 180 1209 381  HOH HOH B . 
AA 7 HOH 181 1210 385  HOH HOH B . 
AA 7 HOH 182 1211 386  HOH HOH B . 
AA 7 HOH 183 1212 387  HOH HOH B . 
AA 7 HOH 184 1213 388  HOH HOH B . 
AA 7 HOH 185 1214 389  HOH HOH B . 
AA 7 HOH 186 1215 390  HOH HOH B . 
AA 7 HOH 187 1216 393  HOH HOH B . 
AA 7 HOH 188 1217 395  HOH HOH B . 
AA 7 HOH 189 1218 400  HOH HOH B . 
AA 7 HOH 190 1219 404  HOH HOH B . 
AA 7 HOH 191 1220 405  HOH HOH B . 
AA 7 HOH 192 1221 410  HOH HOH B . 
AA 7 HOH 193 1222 411  HOH HOH B . 
AA 7 HOH 194 1223 412  HOH HOH B . 
AA 7 HOH 195 1224 413  HOH HOH B . 
AA 7 HOH 196 1225 414  HOH HOH B . 
AA 7 HOH 197 1226 415  HOH HOH B . 
AA 7 HOH 198 1227 416  HOH HOH B . 
AA 7 HOH 199 1228 418  HOH HOH B . 
AA 7 HOH 200 1229 419  HOH HOH B . 
AA 7 HOH 201 1230 424  HOH HOH B . 
AA 7 HOH 202 1231 426  HOH HOH B . 
AA 7 HOH 203 1232 429  HOH HOH B . 
AA 7 HOH 204 1233 433  HOH HOH B . 
AA 7 HOH 205 1234 434  HOH HOH B . 
AA 7 HOH 206 1235 435  HOH HOH B . 
AA 7 HOH 207 1236 436  HOH HOH B . 
AA 7 HOH 208 1237 443  HOH HOH B . 
AA 7 HOH 209 1238 446  HOH HOH B . 
AA 7 HOH 210 1239 448  HOH HOH B . 
AA 7 HOH 211 1240 451  HOH HOH B . 
AA 7 HOH 212 1241 453  HOH HOH B . 
AA 7 HOH 213 1242 454  HOH HOH B . 
AA 7 HOH 214 1243 457  HOH HOH B . 
AA 7 HOH 215 1244 459  HOH HOH B . 
AA 7 HOH 216 1245 460  HOH HOH B . 
AA 7 HOH 217 1246 462  HOH HOH B . 
AA 7 HOH 218 1247 464  HOH HOH B . 
AA 7 HOH 219 1248 466  HOH HOH B . 
AA 7 HOH 220 1249 467  HOH HOH B . 
AA 7 HOH 221 1250 468  HOH HOH B . 
AA 7 HOH 222 1251 469  HOH HOH B . 
AA 7 HOH 223 1252 470  HOH HOH B . 
AA 7 HOH 224 1253 473  HOH HOH B . 
AA 7 HOH 225 1254 474  HOH HOH B . 
AA 7 HOH 226 1255 475  HOH HOH B . 
AA 7 HOH 227 1256 476  HOH HOH B . 
AA 7 HOH 228 1257 477  HOH HOH B . 
AA 7 HOH 229 1258 478  HOH HOH B . 
AA 7 HOH 230 1259 479  HOH HOH B . 
AA 7 HOH 231 1260 480  HOH HOH B . 
AA 7 HOH 232 1261 481  HOH HOH B . 
AA 7 HOH 233 1262 482  HOH HOH B . 
AA 7 HOH 234 1263 483  HOH HOH B . 
AA 7 HOH 235 1264 484  HOH HOH B . 
AA 7 HOH 236 1265 485  HOH HOH B . 
AA 7 HOH 237 1266 490  HOH HOH B . 
AA 7 HOH 238 1267 491  HOH HOH B . 
AA 7 HOH 239 1268 493  HOH HOH B . 
AA 7 HOH 240 1269 494  HOH HOH B . 
AA 7 HOH 241 1270 495  HOH HOH B . 
AA 7 HOH 242 1271 496  HOH HOH B . 
AA 7 HOH 243 1272 497  HOH HOH B . 
AA 7 HOH 244 1273 498  HOH HOH B . 
AA 7 HOH 245 1274 500  HOH HOH B . 
AA 7 HOH 246 1275 501  HOH HOH B . 
AA 7 HOH 247 1276 502  HOH HOH B . 
AA 7 HOH 248 1277 503  HOH HOH B . 
AA 7 HOH 249 1278 504  HOH HOH B . 
AA 7 HOH 250 1279 505  HOH HOH B . 
AA 7 HOH 251 1280 506  HOH HOH B . 
AA 7 HOH 252 1281 508  HOH HOH B . 
AA 7 HOH 253 1282 509  HOH HOH B . 
AA 7 HOH 254 1283 511  HOH HOH B . 
AA 7 HOH 255 1284 512  HOH HOH B . 
AA 7 HOH 256 1285 513  HOH HOH B . 
AA 7 HOH 257 1286 514  HOH HOH B . 
AA 7 HOH 258 1287 515  HOH HOH B . 
AA 7 HOH 259 1288 517  HOH HOH B . 
AA 7 HOH 260 1289 519  HOH HOH B . 
AA 7 HOH 261 1290 520  HOH HOH B . 
AA 7 HOH 262 1291 521  HOH HOH B . 
AA 7 HOH 263 1292 522  HOH HOH B . 
AA 7 HOH 264 1293 523  HOH HOH B . 
AA 7 HOH 265 1294 524  HOH HOH B . 
AA 7 HOH 266 1295 525  HOH HOH B . 
AA 7 HOH 267 1296 527  HOH HOH B . 
AA 7 HOH 268 1297 531  HOH HOH B . 
AA 7 HOH 269 1298 532  HOH HOH B . 
AA 7 HOH 270 1299 533  HOH HOH B . 
AA 7 HOH 271 1300 538  HOH HOH B . 
AA 7 HOH 272 1301 539  HOH HOH B . 
AA 7 HOH 273 1302 540  HOH HOH B . 
AA 7 HOH 274 1303 542  HOH HOH B . 
AA 7 HOH 275 1304 543  HOH HOH B . 
AA 7 HOH 276 1305 544  HOH HOH B . 
AA 7 HOH 277 1306 545  HOH HOH B . 
AA 7 HOH 278 1307 550  HOH HOH B . 
AA 7 HOH 279 1308 552  HOH HOH B . 
AA 7 HOH 280 1309 553  HOH HOH B . 
AA 7 HOH 281 1310 554  HOH HOH B . 
AA 7 HOH 282 1311 555  HOH HOH B . 
AA 7 HOH 283 1312 557  HOH HOH B . 
AA 7 HOH 284 1313 559  HOH HOH B . 
AA 7 HOH 285 1314 560  HOH HOH B . 
AA 7 HOH 286 1315 563  HOH HOH B . 
AA 7 HOH 287 1316 564  HOH HOH B . 
AA 7 HOH 288 1317 565  HOH HOH B . 
AA 7 HOH 289 1318 566  HOH HOH B . 
AA 7 HOH 290 1319 567  HOH HOH B . 
AA 7 HOH 291 1320 570  HOH HOH B . 
AA 7 HOH 292 1321 571  HOH HOH B . 
AA 7 HOH 293 1322 572  HOH HOH B . 
AA 7 HOH 294 1323 574  HOH HOH B . 
AA 7 HOH 295 1324 575  HOH HOH B . 
AA 7 HOH 296 1325 584  HOH HOH B . 
AA 7 HOH 297 1326 585  HOH HOH B . 
AA 7 HOH 298 1327 587  HOH HOH B . 
AA 7 HOH 299 1328 588  HOH HOH B . 
AA 7 HOH 300 1329 589  HOH HOH B . 
AA 7 HOH 301 1330 590  HOH HOH B . 
AA 7 HOH 302 1331 591  HOH HOH B . 
AA 7 HOH 303 1332 595  HOH HOH B . 
AA 7 HOH 304 1333 596  HOH HOH B . 
AA 7 HOH 305 1334 597  HOH HOH B . 
AA 7 HOH 306 1335 600  HOH HOH B . 
AA 7 HOH 307 1336 603  HOH HOH B . 
AA 7 HOH 308 1337 604  HOH HOH B . 
AA 7 HOH 309 1338 605  HOH HOH B . 
AA 7 HOH 310 1339 608  HOH HOH B . 
AA 7 HOH 311 1340 611  HOH HOH B . 
AA 7 HOH 312 1341 612  HOH HOH B . 
AA 7 HOH 313 1342 615  HOH HOH B . 
AA 7 HOH 314 1343 616  HOH HOH B . 
AA 7 HOH 315 1344 618  HOH HOH B . 
AA 7 HOH 316 1345 619  HOH HOH B . 
AA 7 HOH 317 1346 620  HOH HOH B . 
AA 7 HOH 318 1347 621  HOH HOH B . 
AA 7 HOH 319 1348 622  HOH HOH B . 
AA 7 HOH 320 1349 623  HOH HOH B . 
AA 7 HOH 321 1350 625  HOH HOH B . 
AA 7 HOH 322 1351 627  HOH HOH B . 
AA 7 HOH 323 1352 628  HOH HOH B . 
AA 7 HOH 324 1353 635  HOH HOH B . 
AA 7 HOH 325 1354 637  HOH HOH B . 
AA 7 HOH 326 1355 638  HOH HOH B . 
AA 7 HOH 327 1356 639  HOH HOH B . 
AA 7 HOH 328 1357 640  HOH HOH B . 
AA 7 HOH 329 1358 643  HOH HOH B . 
AA 7 HOH 330 1359 644  HOH HOH B . 
AA 7 HOH 331 1360 647  HOH HOH B . 
AA 7 HOH 332 1361 649  HOH HOH B . 
AA 7 HOH 333 1362 653  HOH HOH B . 
AA 7 HOH 334 1363 659  HOH HOH B . 
AA 7 HOH 335 1364 660  HOH HOH B . 
AA 7 HOH 336 1365 665  HOH HOH B . 
AA 7 HOH 337 1366 670  HOH HOH B . 
AA 7 HOH 338 1367 675  HOH HOH B . 
AA 7 HOH 339 1368 681  HOH HOH B . 
AA 7 HOH 340 1369 682  HOH HOH B . 
AA 7 HOH 341 1370 683  HOH HOH B . 
AA 7 HOH 342 1371 684  HOH HOH B . 
AA 7 HOH 343 1372 685  HOH HOH B . 
AA 7 HOH 344 1373 687  HOH HOH B . 
AA 7 HOH 345 1374 688  HOH HOH B . 
AA 7 HOH 346 1375 689  HOH HOH B . 
AA 7 HOH 347 1376 696  HOH HOH B . 
AA 7 HOH 348 1377 699  HOH HOH B . 
AA 7 HOH 349 1378 701  HOH HOH B . 
AA 7 HOH 350 1379 702  HOH HOH B . 
AA 7 HOH 351 1380 705  HOH HOH B . 
AA 7 HOH 352 1381 709  HOH HOH B . 
AA 7 HOH 353 1382 710  HOH HOH B . 
AA 7 HOH 354 1383 712  HOH HOH B . 
AA 7 HOH 355 1384 713  HOH HOH B . 
AA 7 HOH 356 1385 715  HOH HOH B . 
AA 7 HOH 357 1386 720  HOH HOH B . 
AA 7 HOH 358 1387 726  HOH HOH B . 
AA 7 HOH 359 1388 727  HOH HOH B . 
AA 7 HOH 360 1389 728  HOH HOH B . 
AA 7 HOH 361 1390 729  HOH HOH B . 
AA 7 HOH 362 1391 730  HOH HOH B . 
AA 7 HOH 363 1392 739  HOH HOH B . 
AA 7 HOH 364 1393 740  HOH HOH B . 
AA 7 HOH 365 1394 742  HOH HOH B . 
AA 7 HOH 366 1395 743  HOH HOH B . 
AA 7 HOH 367 1396 744  HOH HOH B . 
AA 7 HOH 368 1397 747  HOH HOH B . 
AA 7 HOH 369 1398 748  HOH HOH B . 
AA 7 HOH 370 1399 750  HOH HOH B . 
AA 7 HOH 371 1400 752  HOH HOH B . 
AA 7 HOH 372 1401 753  HOH HOH B . 
AA 7 HOH 373 1402 754  HOH HOH B . 
AA 7 HOH 374 1403 758  HOH HOH B . 
AA 7 HOH 375 1404 760  HOH HOH B . 
AA 7 HOH 376 1405 761  HOH HOH B . 
AA 7 HOH 377 1406 769  HOH HOH B . 
AA 7 HOH 378 1407 770  HOH HOH B . 
AA 7 HOH 379 1408 776  HOH HOH B . 
AA 7 HOH 380 1409 779  HOH HOH B . 
AA 7 HOH 381 1410 780  HOH HOH B . 
AA 7 HOH 382 1411 788  HOH HOH B . 
AA 7 HOH 383 1412 789  HOH HOH B . 
AA 7 HOH 384 1413 791  HOH HOH B . 
AA 7 HOH 385 1414 793  HOH HOH B . 
AA 7 HOH 386 1415 794  HOH HOH B . 
AA 7 HOH 387 1416 795  HOH HOH B . 
AA 7 HOH 388 1417 796  HOH HOH B . 
AA 7 HOH 389 1418 797  HOH HOH B . 
AA 7 HOH 390 1419 801  HOH HOH B . 
AA 7 HOH 391 1420 803  HOH HOH B . 
AA 7 HOH 392 1421 805  HOH HOH B . 
AA 7 HOH 393 1422 806  HOH HOH B . 
AA 7 HOH 394 1423 811  HOH HOH B . 
AA 7 HOH 395 1424 813  HOH HOH B . 
AA 7 HOH 396 1425 816  HOH HOH B . 
AA 7 HOH 397 1426 818  HOH HOH B . 
AA 7 HOH 398 1427 820  HOH HOH B . 
AA 7 HOH 399 1428 821  HOH HOH B . 
AA 7 HOH 400 1429 822  HOH HOH B . 
AA 7 HOH 401 1430 823  HOH HOH B . 
AA 7 HOH 402 1431 825  HOH HOH B . 
AA 7 HOH 403 1432 826  HOH HOH B . 
AA 7 HOH 404 1433 828  HOH HOH B . 
AA 7 HOH 405 1434 832  HOH HOH B . 
AA 7 HOH 406 1435 834  HOH HOH B . 
AA 7 HOH 407 1436 835  HOH HOH B . 
AA 7 HOH 408 1437 838  HOH HOH B . 
AA 7 HOH 409 1438 840  HOH HOH B . 
AA 7 HOH 410 1439 843  HOH HOH B . 
AA 7 HOH 411 1440 844  HOH HOH B . 
AA 7 HOH 412 1441 848  HOH HOH B . 
AA 7 HOH 413 1442 850  HOH HOH B . 
AA 7 HOH 414 1443 851  HOH HOH B . 
AA 7 HOH 415 1444 852  HOH HOH B . 
AA 7 HOH 416 1445 853  HOH HOH B . 
AA 7 HOH 417 1446 854  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 18600 ? 
1 MORE         -195  ? 
1 'SSA (A^2)'  37370 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-11-02 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Database references'       
7 5 'Structure model' 'Derived calculations'      
8 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software                  
2 5 'Structure model' chem_comp                 
3 5 'Structure model' entity                    
4 5 'Structure model' pdbx_chem_comp_identifier 
5 5 'Structure model' pdbx_entity_nonpoly       
6 5 'Structure model' struct_ref_seq_dif        
7 5 'Structure model' struct_site               
8 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_chem_comp.mon_nstd_flag'    
2 5 'Structure model' '_chem_comp.name'             
3 5 'Structure model' '_chem_comp.type'             
4 5 'Structure model' '_entity.pdbx_description'    
5 5 'Structure model' '_pdbx_entity_nonpoly.name'   
6 5 'Structure model' '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.1.24 ? 1 
MAR345    'data collection' .      ? 2 
SCALEPACK 'data scaling'    .      ? 3 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
RESIDUE 263 IS A LEU NOT A PHE AS SHOWN BY THE SEQUENCE OF THE CONSTRUCT AS WELL AS THE ELECTRON DENSITY MAP. IT APPEARS TO EMANATE FROM THE ORIGINAL EXPRESSED SEQUENCE TAG AND IS NOT A PCR ERROR. HENCE THIS IS A POLYMORPHISM IN THE MAMMARY CELL LINE USED TO MAKE THE CDNA.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE2 B GLN 449  ? A O B HOH 1383 ? ? 1.92 
2 1 O2  B SO4 1008 ? ? O B HOH 1266 ? ? 2.08 
3 1 O1  A GOL 1030 ? ? O A HOH 1391 ? ? 2.10 
4 1 NE2 B GLN 449  ? B O B HOH 1337 ? ? 2.11 
5 1 O4  B SO4 1008 ? ? O B HOH 1342 ? ? 2.13 
6 1 O2  A GOL 1026 ? ? O A HOH 1207 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 187 ? ? CG A ASP 187 ? ? OD2 A ASP 187 ? ? 124.06 118.30 5.76 0.90 N 
2 1 CB A ASP 234 ? ? CG A ASP 234 ? ? OD2 A ASP 234 ? ? 123.79 118.30 5.49 0.90 N 
3 1 CB A ASP 457 ? ? CG A ASP 457 ? ? OD2 A ASP 457 ? ? 123.88 118.30 5.58 0.90 N 
4 1 CB B ASP 126 ? ? CG B ASP 126 ? ? OD2 B ASP 126 ? ? 123.72 118.30 5.42 0.90 N 
5 1 CB B ASP 187 ? ? CG B ASP 187 ? ? OD2 B ASP 187 ? ? 124.20 118.30 5.90 0.90 N 
6 1 CB B ASP 234 ? ? CG B ASP 234 ? ? OD2 B ASP 234 ? ? 123.96 118.30 5.66 0.90 N 
7 1 CB B ASP 267 ? ? CG B ASP 267 ? ? OD2 B ASP 267 ? ? 125.27 118.30 6.97 0.90 N 
8 1 CB B ASP 290 ? ? CG B ASP 290 ? ? OD2 B ASP 290 ? ? 125.31 118.30 7.01 0.90 N 
9 1 CB B ASP 457 ? ? CG B ASP 457 ? ? OD2 B ASP 457 ? ? 123.79 118.30 5.49 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 56  ? ? -86.64  33.83   
2  1 ASP A 160 ? ? -130.44 -51.23  
3  1 SER A 184 ? ? -139.58 -50.97  
4  1 ASN A 248 ? ? -109.92 79.65   
5  1 ASP A 341 ? ? -165.59 113.94  
6  1 THR A 374 ? ? -112.24 -136.78 
7  1 GLN A 511 ? ? -160.71 61.93   
8  1 ASN B 46  ? ? 73.43   -5.71   
9  1 LYS B 56  ? ? -86.21  34.55   
10 1 ASP B 160 ? ? -127.70 -53.23  
11 1 SER B 184 ? ? -138.76 -46.50  
12 1 SER B 209 ? ? -178.00 121.62  
13 1 ASN B 261 ? ? -95.68  30.92   
14 1 ASP B 341 ? ? -165.46 113.37  
15 1 TYR B 362 ? ? -141.12 -1.97   
16 1 THR B 374 ? ? -115.48 -137.10 
17 1 GLN B 511 ? ? -159.86 59.11   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 0   ? A MET 1   
2  1 Y 1 A GLU 557 ? A GLU 558 
3  1 Y 1 A HIS 558 ? A HIS 559 
4  1 Y 1 A HIS 559 ? A HIS 560 
5  1 Y 1 A HIS 560 ? A HIS 561 
6  1 Y 1 A HIS 561 ? A HIS 562 
7  1 Y 1 A HIS 562 ? A HIS 563 
8  1 Y 1 A HIS 563 ? A HIS 564 
9  1 Y 1 B MET 0   ? B MET 1   
10 1 Y 1 B GLU 557 ? B GLU 558 
11 1 Y 1 B HIS 558 ? B HIS 559 
12 1 Y 1 B HIS 559 ? B HIS 560 
13 1 Y 1 B HIS 560 ? B HIS 561 
14 1 Y 1 B HIS 561 ? B HIS 562 
15 1 Y 1 B HIS 562 ? B HIS 563 
16 1 Y 1 B HIS 563 ? B HIS 564 
# 
_pdbx_chem_comp_identifier.comp_id           G6P 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        a-D-Glcp6PO3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 6-O-phosphono-alpha-D-glucopyranose G6P 
3 GLUCOSE-6-PHOSPHATE                 G6Q 
4 'SULFATE ION'                       SO4 
5 GLYCEROL                            GOL 
6 BETA-MERCAPTOETHANOL                BME 
7 water                               HOH 
#