data_1U32
# 
_entry.id   1U32 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1U32         
RCSB  RCSB023182   
WWPDB D_1000023182 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1U32 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Maynes, J.T.'    1 
'Perreault, K.R.' 2 
'Cherney, M.M.'   3 
'Luu, H.A.'       4 
'James, M.N.G.'   5 
'Holmes, C.F.B.'  6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure and Mutagenesis of a Protein Phosphatase-1:Calcineurin Hybrid Elucidate the Role of the {beta}12-{beta}13 Loop in Inhibitor Binding
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            279 
_citation.page_first                43198 
_citation.page_last                 43206 
_citation.year                      2004 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15280359 
_citation.pdbx_database_id_DOI      10.1074/jbc.M407184200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Maynes, J.T.'    1 
primary 'Perreault, K.R.' 2 
primary 'Cherney, M.M.'   3 
primary 'Luu, H.A.'       4 
primary 'James, M.N.G.'   5 
primary 'Holmes, C.F.B.'  6 
# 
_cell.entry_id           1U32 
_cell.length_a           98.759 
_cell.length_b           98.759 
_cell.length_c           62.180 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1U32 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine protein phosphatase PP1-gamma catalytic subunit' 33771.910 1  3.1.3.16 ? 'residues 6-298' ? 
2 non-polymer syn 'MANGANESE (II) ION'                                               54.938    2  ?        ? ?                ? 
3 non-polymer syn 'OKADAIC ACID'                                                     805.003   1  ?        ? ?                ? 
4 non-polymer syn BETA-MERCAPTOETHANOL                                               78.133    3  ?        ? ?                ? 
5 water       nat water                                                              18.015    89 ?        ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein Phosphatase-1: Calcineurin hybrid, PP-1G, Protein phosphatase 1C catalytic subunit' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPES
NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIV
DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLIC
RAHQVVEDGYEFFAKRQLVTLFSAPNYLDVYNNAGAMMSVDETLMCSFQILKP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPES
NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIV
DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLIC
RAHQVVEDGYEFFAKRQLVTLFSAPNYLDVYNNAGAMMSVDETLMCSFQILKP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   LEU n 
1 3   ASN n 
1 4   ILE n 
1 5   ASP n 
1 6   SER n 
1 7   ILE n 
1 8   ILE n 
1 9   GLN n 
1 10  ARG n 
1 11  LEU n 
1 12  LEU n 
1 13  GLU n 
1 14  VAL n 
1 15  ARG n 
1 16  GLY n 
1 17  SER n 
1 18  LYS n 
1 19  PRO n 
1 20  GLY n 
1 21  LYS n 
1 22  ASN n 
1 23  VAL n 
1 24  GLN n 
1 25  LEU n 
1 26  GLN n 
1 27  GLU n 
1 28  ASN n 
1 29  GLU n 
1 30  ILE n 
1 31  ARG n 
1 32  GLY n 
1 33  LEU n 
1 34  CYS n 
1 35  LEU n 
1 36  LYS n 
1 37  SER n 
1 38  ARG n 
1 39  GLU n 
1 40  ILE n 
1 41  PHE n 
1 42  LEU n 
1 43  SER n 
1 44  GLN n 
1 45  PRO n 
1 46  ILE n 
1 47  LEU n 
1 48  LEU n 
1 49  GLU n 
1 50  LEU n 
1 51  GLU n 
1 52  ALA n 
1 53  PRO n 
1 54  LEU n 
1 55  LYS n 
1 56  ILE n 
1 57  CYS n 
1 58  GLY n 
1 59  ASP n 
1 60  ILE n 
1 61  HIS n 
1 62  GLY n 
1 63  GLN n 
1 64  TYR n 
1 65  TYR n 
1 66  ASP n 
1 67  LEU n 
1 68  LEU n 
1 69  ARG n 
1 70  LEU n 
1 71  PHE n 
1 72  GLU n 
1 73  TYR n 
1 74  GLY n 
1 75  GLY n 
1 76  PHE n 
1 77  PRO n 
1 78  PRO n 
1 79  GLU n 
1 80  SER n 
1 81  ASN n 
1 82  TYR n 
1 83  LEU n 
1 84  PHE n 
1 85  LEU n 
1 86  GLY n 
1 87  ASP n 
1 88  TYR n 
1 89  VAL n 
1 90  ASP n 
1 91  ARG n 
1 92  GLY n 
1 93  LYS n 
1 94  GLN n 
1 95  SER n 
1 96  LEU n 
1 97  GLU n 
1 98  THR n 
1 99  ILE n 
1 100 CYS n 
1 101 LEU n 
1 102 LEU n 
1 103 LEU n 
1 104 ALA n 
1 105 TYR n 
1 106 LYS n 
1 107 ILE n 
1 108 LYS n 
1 109 TYR n 
1 110 PRO n 
1 111 GLU n 
1 112 ASN n 
1 113 PHE n 
1 114 PHE n 
1 115 LEU n 
1 116 LEU n 
1 117 ARG n 
1 118 GLY n 
1 119 ASN n 
1 120 HIS n 
1 121 GLU n 
1 122 CYS n 
1 123 ALA n 
1 124 SER n 
1 125 ILE n 
1 126 ASN n 
1 127 ARG n 
1 128 ILE n 
1 129 TYR n 
1 130 GLY n 
1 131 PHE n 
1 132 TYR n 
1 133 ASP n 
1 134 GLU n 
1 135 CYS n 
1 136 LYS n 
1 137 ARG n 
1 138 ARG n 
1 139 TYR n 
1 140 ASN n 
1 141 ILE n 
1 142 LYS n 
1 143 LEU n 
1 144 TRP n 
1 145 LYS n 
1 146 THR n 
1 147 PHE n 
1 148 THR n 
1 149 ASP n 
1 150 CYS n 
1 151 PHE n 
1 152 ASN n 
1 153 CYS n 
1 154 LEU n 
1 155 PRO n 
1 156 ILE n 
1 157 ALA n 
1 158 ALA n 
1 159 ILE n 
1 160 VAL n 
1 161 ASP n 
1 162 GLU n 
1 163 LYS n 
1 164 ILE n 
1 165 PHE n 
1 166 CYS n 
1 167 CYS n 
1 168 HIS n 
1 169 GLY n 
1 170 GLY n 
1 171 LEU n 
1 172 SER n 
1 173 PRO n 
1 174 ASP n 
1 175 LEU n 
1 176 GLN n 
1 177 SER n 
1 178 MET n 
1 179 GLU n 
1 180 GLN n 
1 181 ILE n 
1 182 ARG n 
1 183 ARG n 
1 184 ILE n 
1 185 MET n 
1 186 ARG n 
1 187 PRO n 
1 188 THR n 
1 189 ASP n 
1 190 VAL n 
1 191 PRO n 
1 192 ASP n 
1 193 GLN n 
1 194 GLY n 
1 195 LEU n 
1 196 LEU n 
1 197 CYS n 
1 198 ASP n 
1 199 LEU n 
1 200 LEU n 
1 201 TRP n 
1 202 SER n 
1 203 ASP n 
1 204 PRO n 
1 205 ASP n 
1 206 LYS n 
1 207 ASP n 
1 208 VAL n 
1 209 LEU n 
1 210 GLY n 
1 211 TRP n 
1 212 GLY n 
1 213 GLU n 
1 214 ASN n 
1 215 ASP n 
1 216 ARG n 
1 217 GLY n 
1 218 VAL n 
1 219 SER n 
1 220 PHE n 
1 221 THR n 
1 222 PHE n 
1 223 GLY n 
1 224 ALA n 
1 225 GLU n 
1 226 VAL n 
1 227 VAL n 
1 228 ALA n 
1 229 LYS n 
1 230 PHE n 
1 231 LEU n 
1 232 HIS n 
1 233 LYS n 
1 234 HIS n 
1 235 ASP n 
1 236 LEU n 
1 237 ASP n 
1 238 LEU n 
1 239 ILE n 
1 240 CYS n 
1 241 ARG n 
1 242 ALA n 
1 243 HIS n 
1 244 GLN n 
1 245 VAL n 
1 246 VAL n 
1 247 GLU n 
1 248 ASP n 
1 249 GLY n 
1 250 TYR n 
1 251 GLU n 
1 252 PHE n 
1 253 PHE n 
1 254 ALA n 
1 255 LYS n 
1 256 ARG n 
1 257 GLN n 
1 258 LEU n 
1 259 VAL n 
1 260 THR n 
1 261 LEU n 
1 262 PHE n 
1 263 SER n 
1 264 ALA n 
1 265 PRO n 
1 266 ASN n 
1 267 TYR n 
1 268 LEU n 
1 269 ASP n 
1 270 VAL n 
1 271 TYR n 
1 272 ASN n 
1 273 ASN n 
1 274 ALA n 
1 275 GLY n 
1 276 ALA n 
1 277 MET n 
1 278 MET n 
1 279 SER n 
1 280 VAL n 
1 281 ASP n 
1 282 GLU n 
1 283 THR n 
1 284 LEU n 
1 285 MET n 
1 286 CYS n 
1 287 SER n 
1 288 PHE n 
1 289 GLN n 
1 290 ILE n 
1 291 LEU n 
1 292 LYS n 
1 293 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PPP1CC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pet 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PP1G_HUMAN 
_struct_ref.pdbx_db_accession          P36873 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPES
NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIV
DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLIC
RAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP
;
_struct_ref.pdbx_align_begin           6 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1U32 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 293 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P36873 
_struct_ref_seq.db_align_beg                  6 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  298 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       298 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1U32 LEU A 268 ? UNP P36873 CYS 273 ENGINEERED 273 1 
1 1U32 ASP A 269 ? UNP P36873 GLY 274 ENGINEERED 274 2 
1 1U32 VAL A 270 ? UNP P36873 GLU 275 ENGINEERED 275 3 
1 1U32 TYR A 271 ? UNP P36873 PHE 276 ENGINEERED 276 4 
1 1U32 ASN A 272 ? UNP P36873 ASP 277 ENGINEERED 277 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ?                                           'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ?                                           'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ?                                           'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ?                                           'C4 H7 N O4'     133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL ?                                           'C2 H6 O S'      78.133  
CYS 'L-peptide linking' y CYSTEINE             ?                                           'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ?                                           'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ?                                           'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ?                                           'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ?                                           'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ?                                           'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ?                                           'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ?                                           'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ?                                           'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ?                                           'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ?                                           'Mn 2'           54.938  
OKA non-polymer         . 'OKADAIC ACID'       9,10-DEEPITHIO-9,10-DIDEHYDROACANTHIFOLICIN 'C44 H68 O13'    805.003 
PHE 'L-peptide linking' y PHENYLALANINE        ?                                           'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ?                                           'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ?                                           'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ?                                           'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ?                                           'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ?                                           'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ?                                           'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1U32 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'lithium sulfate, tris, PEG 400, mercaptoethanol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-07-22 
_diffrn_detector.details                'osmic mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1U32 
_reflns.observed_criterion_sigma_I   2.5 
_reflns.observed_criterion_sigma_F   1.9 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2 
_reflns.number_obs                   21304 
_reflns.number_all                   21891 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        21.1 
_reflns.B_iso_Wilson_estimate        15.0 
_reflns.pdbx_redundancy              5.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.369 
_reflns_shell.pdbx_Rsym_value        0.36 
_reflns_shell.meanI_over_sigI_obs    5.02 
_reflns_shell.pdbx_redundancy        5.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2063 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1U32 
_refine.ls_number_reflns_obs                     21272 
_refine.ls_number_reflns_all                     21272 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1946384.85 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.01 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          0.22 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.254 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.9 
_refine.ls_number_reflns_R_free                  1250 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               27.3 
_refine.aniso_B[1][1]                            -0.02 
_refine.aniso_B[2][2]                            -0.02 
_refine.aniso_B[3][3]                            0.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.359391 
_refine.solvent_model_param_bsol                 37.2487 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ID 1JK7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1U32 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.12 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.29 
_refine_analyze.Luzzati_sigma_a_free            0.20 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2371 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         71 
_refine_hist.number_atoms_solvent             89 
_refine_hist.number_atoms_total               2531 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        36.01 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.79  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.38  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.11  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.08  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.06  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             3254 
_refine_ls_shell.R_factor_R_work                  0.232 
_refine_ls_shell.percent_reflns_obs               98.8 
_refine_ls_shell.R_factor_R_free                  0.273 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            5.8 
_refine_ls_shell.number_reflns_R_free             199 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 BME.PARAM         BME.TOP     'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
4 DAM.PARAM         DAM.TOP     'X-RAY DIFFRACTION' 
5 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1U32 
_struct.title                     'Crystal structure of a Protein Phosphatase-1: Calcineurin Hybrid Bound to Okadaic Acid' 
_struct.pdbx_descriptor           'Serine/threonine protein phosphatase PP1-gamma catalytic subunit(E.C.3.1.3.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1U32 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            hydrolase 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 3   ? GLU A 13  ? ASN A 8   GLU A 18  1 ? 11 
HELX_P HELX_P2  2  GLN A 26  ? GLN A 44  ? GLN A 31  GLN A 49  1 ? 19 
HELX_P HELX_P3  3  GLN A 63  ? GLY A 75  ? GLN A 68  GLY A 80  1 ? 13 
HELX_P HELX_P4  4  GLN A 94  ? TYR A 109 ? GLN A 99  TYR A 114 1 ? 16 
HELX_P HELX_P5  5  CYS A 122 ? ARG A 127 ? CYS A 127 ARG A 132 1 ? 6  
HELX_P HELX_P6  6  GLY A 130 ? TYR A 139 ? GLY A 135 TYR A 144 1 ? 10 
HELX_P HELX_P7  7  ASN A 140 ? ASN A 152 ? ASN A 145 ASN A 157 1 ? 13 
HELX_P HELX_P8  8  SER A 177 ? ARG A 183 ? SER A 182 ARG A 188 1 ? 7  
HELX_P HELX_P9  9  GLY A 194 ? SER A 202 ? GLY A 199 SER A 207 1 ? 9  
HELX_P HELX_P10 10 GLY A 223 ? HIS A 234 ? GLY A 228 HIS A 239 1 ? 12 
HELX_P HELX_P11 11 ASN A 266 ? VAL A 270 ? ASN A 271 VAL A 275 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MN  .   MN ? ? ? 1_555 A ASP 87  OD2 ? ? A MN  400 A ASP 92  1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc2 metalc ? ? B MN  .   MN ? ? ? 1_555 A ASN 119 OD1 ? ? A MN  400 A ASN 124 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc3 metalc ? ? C MN  .   MN ? ? ? 1_555 A ASP 59  OD2 ? ? A MN  401 A ASP 64  1_555 ? ? ? ? ? ? ? 2.089 ? 
covale1 covale ? ? A CYS 122 SG ? ? ? 1_555 G BME .   S2  ? ? A CYS 127 A BME 303 1_555 ? ? ? ? ? ? ? 2.027 ? 
covale2 covale ? ? A CYS 197 SG ? ? ? 1_555 E BME .   S2  ? ? A CYS 202 A BME 301 1_555 ? ? ? ? ? ? ? 2.036 ? 
covale3 covale ? ? A CYS 286 SG ? ? ? 1_555 F BME .   S2  ? ? A CYS 291 A BME 302 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc4 metalc ? ? B MN  .   MN ? ? ? 1_555 A HIS 243 ND1 ? ? A MN  400 A HIS 248 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc5 metalc ? ? B MN  .   MN ? ? ? 1_555 A HIS 168 NE2 ? ? A MN  400 A HIS 173 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc6 metalc ? ? C MN  .   MN ? ? ? 1_555 A HIS 61  NE2 ? ? A MN  401 A HIS 66  1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc7 metalc ? ? C MN  .   MN ? ? ? 1_555 A ASP 87  OD2 ? ? A MN  401 A ASP 92  1_555 ? ? ? ? ? ? ? 2.220 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 52  A . ? ALA 57  A PRO 53  A ? PRO 58  A 1 -0.28 
2 PRO 77  A . ? PRO 82  A PRO 78  A ? PRO 83  A 1 0.21  
3 ARG 186 A . ? ARG 191 A PRO 187 A ? PRO 192 A 1 0.23  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 47  ? LEU A 50  ? LEU A 52  LEU A 55  
A 2 ALA A 157 ? VAL A 160 ? ALA A 162 VAL A 165 
A 3 ILE A 164 ? CYS A 166 ? ILE A 169 CYS A 171 
A 4 LEU A 238 ? ARG A 241 ? LEU A 243 ARG A 246 
A 5 LEU A 258 ? LEU A 261 ? LEU A 263 LEU A 266 
A 6 TYR A 250 ? PHE A 253 ? TYR A 255 PHE A 258 
B 1 PHE A 113 ? LEU A 115 ? PHE A 118 LEU A 120 
B 2 TYR A 82  ? PHE A 84  ? TYR A 87  PHE A 89  
B 3 LEU A 54  ? CYS A 57  ? LEU A 59  CYS A 62  
B 4 GLY A 275 ? VAL A 280 ? GLY A 280 VAL A 285 
B 5 CYS A 286 ? LEU A 291 ? CYS A 291 LEU A 296 
C 1 ASP A 203 ? PRO A 204 ? ASP A 208 PRO A 209 
C 2 PHE A 220 ? PHE A 222 ? PHE A 225 PHE A 227 
C 3 TRP A 211 ? GLU A 213 ? TRP A 216 GLU A 218 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 48  ? N LEU A 53  O ILE A 159 ? O ILE A 164 
A 2 3 N ALA A 158 ? N ALA A 163 O CYS A 166 ? O CYS A 171 
A 3 4 N PHE A 165 ? N PHE A 170 O CYS A 240 ? O CYS A 245 
A 4 5 N ARG A 241 ? N ARG A 246 O LEU A 261 ? O LEU A 266 
A 5 6 O THR A 260 ? O THR A 265 N GLU A 251 ? N GLU A 256 
B 1 2 O PHE A 114 ? O PHE A 119 N TYR A 82  ? N TYR A 87  
B 2 3 O LEU A 83  ? O LEU A 88  N CYS A 57  ? N CYS A 62  
B 3 4 N ILE A 56  ? N ILE A 61  O MET A 278 ? O MET A 283 
B 4 5 N GLY A 275 ? N GLY A 280 O LEU A 291 ? O LEU A 296 
C 1 2 N ASP A 203 ? N ASP A 208 O PHE A 222 ? O PHE A 227 
C 2 3 O THR A 221 ? O THR A 226 N GLY A 212 ? N GLY A 217 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 400'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MN A 401'  
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE OKA A 501' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BME A 301' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE BME A 302' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE BME A 303' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP A 87  ? ASP A 92  . ? 1_555 ? 
2  AC1 6  ASN A 119 ? ASN A 124 . ? 1_555 ? 
3  AC1 6  HIS A 168 ? HIS A 173 . ? 1_555 ? 
4  AC1 6  HIS A 243 ? HIS A 248 . ? 1_555 ? 
5  AC1 6  MN  C .   ? MN  A 401 . ? 1_555 ? 
6  AC1 6  HOH H .   ? HOH A 505 . ? 1_555 ? 
7  AC2 4  ASP A 59  ? ASP A 64  . ? 1_555 ? 
8  AC2 4  HIS A 61  ? HIS A 66  . ? 1_555 ? 
9  AC2 4  ASP A 87  ? ASP A 92  . ? 1_555 ? 
10 AC2 4  MN  B .   ? MN  A 400 . ? 1_555 ? 
11 AC3 15 ARG A 91  ? ARG A 96  . ? 1_555 ? 
12 AC3 15 HIS A 120 ? HIS A 125 . ? 1_555 ? 
13 AC3 15 ILE A 125 ? ILE A 130 . ? 1_555 ? 
14 AC3 15 TYR A 129 ? TYR A 134 . ? 1_555 ? 
15 AC3 15 GLN A 176 ? GLN A 181 . ? 4_565 ? 
16 AC3 15 ARG A 183 ? ARG A 188 . ? 4_565 ? 
17 AC3 15 ARG A 216 ? ARG A 221 . ? 1_555 ? 
18 AC3 15 LYS A 229 ? LYS A 234 . ? 3_645 ? 
19 AC3 15 HIS A 232 ? HIS A 237 . ? 3_645 ? 
20 AC3 15 TYR A 267 ? TYR A 272 . ? 1_555 ? 
21 AC3 15 LEU A 268 ? LEU A 273 . ? 1_555 ? 
22 AC3 15 TYR A 271 ? TYR A 276 . ? 1_555 ? 
23 AC3 15 BME E .   ? BME A 301 . ? 1_555 ? 
24 AC3 15 HOH H .   ? HOH A 556 . ? 1_555 ? 
25 AC3 15 HOH H .   ? HOH A 566 . ? 1_555 ? 
26 AC4 6  VAL A 190 ? VAL A 195 . ? 1_555 ? 
27 AC4 6  CYS A 197 ? CYS A 202 . ? 1_555 ? 
28 AC4 6  TRP A 201 ? TRP A 206 . ? 1_555 ? 
29 AC4 6  HIS A 232 ? HIS A 237 . ? 3_645 ? 
30 AC4 6  BME G .   ? BME A 303 . ? 1_555 ? 
31 AC4 6  OKA D .   ? OKA A 501 . ? 1_555 ? 
32 AC5 3  ILE A 164 ? ILE A 169 . ? 1_555 ? 
33 AC5 3  LEU A 284 ? LEU A 289 . ? 1_555 ? 
34 AC5 3  CYS A 286 ? CYS A 291 . ? 1_555 ? 
35 AC6 5  ARG A 117 ? ARG A 122 . ? 1_555 ? 
36 AC6 5  CYS A 122 ? CYS A 127 . ? 1_555 ? 
37 AC6 5  VAL A 190 ? VAL A 195 . ? 1_555 ? 
38 AC6 5  TRP A 201 ? TRP A 206 . ? 1_555 ? 
39 AC6 5  BME E .   ? BME A 301 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1U32 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1U32 
_atom_sites.fract_transf_matrix[1][1]   0.010126 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010126 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016082 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 1   ? 56.030  28.772 14.304  1.00 52.63 ? 6   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 1   ? 55.506  28.691 15.700  1.00 52.88 ? 6   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 1   ? 55.775  29.997 16.441  1.00 51.37 ? 6   LYS A C   1 
ATOM   4    O  O   . LYS A 1 1   ? 55.036  30.374 17.352  1.00 51.03 ? 6   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 1   ? 56.174  27.533 16.448  1.00 55.15 ? 6   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 1   ? 55.999  26.174 15.784  1.00 57.48 ? 6   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 1   ? 56.631  25.058 16.611  1.00 59.49 ? 6   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 1   ? 58.132  25.259 16.780  1.00 60.95 ? 6   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 1   ? 58.752  24.175 17.596  1.00 61.30 ? 6   LYS A NZ  1 
ATOM   10   N  N   . LEU A 1 2   ? 56.843  30.680 16.044  1.00 48.84 ? 7   LEU A N   1 
ATOM   11   C  CA  . LEU A 1 2   ? 57.226  31.946 16.654  1.00 46.27 ? 7   LEU A CA  1 
ATOM   12   C  C   . LEU A 1 2   ? 56.187  33.016 16.329  1.00 43.55 ? 7   LEU A C   1 
ATOM   13   O  O   . LEU A 1 2   ? 55.941  33.309 15.159  1.00 43.55 ? 7   LEU A O   1 
ATOM   14   C  CB  . LEU A 1 2   ? 58.596  32.375 16.124  1.00 47.58 ? 7   LEU A CB  1 
ATOM   15   C  CG  . LEU A 1 2   ? 59.219  33.648 16.699  1.00 48.79 ? 7   LEU A CG  1 
ATOM   16   C  CD1 . LEU A 1 2   ? 59.404  33.498 18.203  1.00 48.84 ? 7   LEU A CD1 1 
ATOM   17   C  CD2 . LEU A 1 2   ? 60.553  33.907 16.020  1.00 49.50 ? 7   LEU A CD2 1 
ATOM   18   N  N   . ASN A 1 3   ? 55.578  33.597 17.360  1.00 40.13 ? 8   ASN A N   1 
ATOM   19   C  CA  . ASN A 1 3   ? 54.569  34.631 17.152  1.00 38.01 ? 8   ASN A CA  1 
ATOM   20   C  C   . ASN A 1 3   ? 55.233  36.002 17.017  1.00 35.61 ? 8   ASN A C   1 
ATOM   21   O  O   . ASN A 1 3   ? 55.283  36.780 17.970  1.00 35.03 ? 8   ASN A O   1 
ATOM   22   C  CB  . ASN A 1 3   ? 53.579  34.661 18.319  1.00 39.37 ? 8   ASN A CB  1 
ATOM   23   C  CG  . ASN A 1 3   ? 52.284  35.375 17.965  1.00 41.46 ? 8   ASN A CG  1 
ATOM   24   O  OD1 . ASN A 1 3   ? 52.293  36.439 17.336  1.00 39.47 ? 8   ASN A OD1 1 
ATOM   25   N  ND2 . ASN A 1 3   ? 51.158  34.793 18.373  1.00 40.85 ? 8   ASN A ND2 1 
ATOM   26   N  N   . ILE A 1 4   ? 55.735  36.288 15.822  1.00 32.14 ? 9   ILE A N   1 
ATOM   27   C  CA  . ILE A 1 4   ? 56.410  37.549 15.540  1.00 30.11 ? 9   ILE A CA  1 
ATOM   28   C  C   . ILE A 1 4   ? 55.557  38.784 15.825  1.00 27.32 ? 9   ILE A C   1 
ATOM   29   O  O   . ILE A 1 4   ? 56.042  39.758 16.402  1.00 24.74 ? 9   ILE A O   1 
ATOM   30   C  CB  . ILE A 1 4   ? 56.869  37.599 14.063  1.00 30.56 ? 9   ILE A CB  1 
ATOM   31   C  CG1 . ILE A 1 4   ? 57.850  36.459 13.783  1.00 33.19 ? 9   ILE A CG1 1 
ATOM   32   C  CG2 . ILE A 1 4   ? 57.529  38.935 13.762  1.00 31.13 ? 9   ILE A CG2 1 
ATOM   33   C  CD1 . ILE A 1 4   ? 59.197  36.614 14.482  1.00 35.80 ? 9   ILE A CD1 1 
ATOM   34   N  N   . ASP A 1 5   ? 54.292  38.745 15.418  1.00 25.44 ? 10  ASP A N   1 
ATOM   35   C  CA  . ASP A 1 5   ? 53.396  39.879 15.614  1.00 27.27 ? 10  ASP A CA  1 
ATOM   36   C  C   . ASP A 1 5   ? 53.182  40.225 17.083  1.00 26.08 ? 10  ASP A C   1 
ATOM   37   O  O   . ASP A 1 5   ? 53.046  41.395 17.433  1.00 26.00 ? 10  ASP A O   1 
ATOM   38   C  CB  . ASP A 1 5   ? 52.042  39.615 14.945  1.00 29.40 ? 10  ASP A CB  1 
ATOM   39   C  CG  . ASP A 1 5   ? 52.166  39.406 13.448  1.00 33.17 ? 10  ASP A CG  1 
ATOM   40   O  OD1 . ASP A 1 5   ? 52.852  40.213 12.791  1.00 33.63 ? 10  ASP A OD1 1 
ATOM   41   O  OD2 . ASP A 1 5   ? 51.573  38.439 12.926  1.00 37.52 ? 10  ASP A OD2 1 
ATOM   42   N  N   . SER A 1 6   ? 53.148  39.207 17.936  1.00 25.75 ? 11  SER A N   1 
ATOM   43   C  CA  . SER A 1 6   ? 52.961  39.421 19.364  1.00 25.13 ? 11  SER A CA  1 
ATOM   44   C  C   . SER A 1 6   ? 54.234  40.000 19.975  1.00 23.61 ? 11  SER A C   1 
ATOM   45   O  O   . SER A 1 6   ? 54.176  40.870 20.842  1.00 23.15 ? 11  SER A O   1 
ATOM   46   C  CB  . SER A 1 6   ? 52.620  38.105 20.062  1.00 25.97 ? 11  SER A CB  1 
ATOM   47   O  OG  . SER A 1 6   ? 52.531  38.293 21.465  1.00 26.18 ? 11  SER A OG  1 
ATOM   48   N  N   . ILE A 1 7   ? 55.381  39.501 19.526  1.00 22.82 ? 12  ILE A N   1 
ATOM   49   C  CA  . ILE A 1 7   ? 56.670  39.977 20.019  1.00 22.63 ? 12  ILE A CA  1 
ATOM   50   C  C   . ILE A 1 7   ? 56.838  41.458 19.666  1.00 22.19 ? 12  ILE A C   1 
ATOM   51   O  O   . ILE A 1 7   ? 57.225  42.270 20.509  1.00 21.51 ? 12  ILE A O   1 
ATOM   52   C  CB  . ILE A 1 7   ? 57.829  39.157 19.405  1.00 22.03 ? 12  ILE A CB  1 
ATOM   53   C  CG1 . ILE A 1 7   ? 57.778  37.725 19.948  1.00 21.01 ? 12  ILE A CG1 1 
ATOM   54   C  CG2 . ILE A 1 7   ? 59.168  39.810 19.729  1.00 20.11 ? 12  ILE A CG2 1 
ATOM   55   C  CD1 . ILE A 1 7   ? 58.729  36.761 19.273  1.00 21.77 ? 12  ILE A CD1 1 
ATOM   56   N  N   . ILE A 1 8   ? 56.548  41.797 18.413  1.00 22.30 ? 13  ILE A N   1 
ATOM   57   C  CA  . ILE A 1 8   ? 56.639  43.176 17.948  1.00 23.46 ? 13  ILE A CA  1 
ATOM   58   C  C   . ILE A 1 8   ? 55.710  44.026 18.809  1.00 24.57 ? 13  ILE A C   1 
ATOM   59   O  O   . ILE A 1 8   ? 56.104  45.055 19.354  1.00 22.90 ? 13  ILE A O   1 
ATOM   60   C  CB  . ILE A 1 8   ? 56.148  43.322 16.489  1.00 24.53 ? 13  ILE A CB  1 
ATOM   61   C  CG1 . ILE A 1 8   ? 56.963  42.430 15.549  1.00 24.73 ? 13  ILE A CG1 1 
ATOM   62   C  CG2 . ILE A 1 8   ? 56.235  44.786 16.061  1.00 23.77 ? 13  ILE A CG2 1 
ATOM   63   C  CD1 . ILE A 1 8   ? 58.356  42.897 15.315  1.00 29.33 ? 13  ILE A CD1 1 
ATOM   64   N  N   . GLN A 1 9   ? 54.466  43.573 18.915  1.00 25.45 ? 14  GLN A N   1 
ATOM   65   C  CA  . GLN A 1 9   ? 53.445  44.275 19.681  1.00 27.02 ? 14  GLN A CA  1 
ATOM   66   C  C   . GLN A 1 9   ? 53.937  44.612 21.083  1.00 24.47 ? 14  GLN A C   1 
ATOM   67   O  O   . GLN A 1 9   ? 53.850  45.758 21.520  1.00 25.28 ? 14  GLN A O   1 
ATOM   68   C  CB  . GLN A 1 9   ? 52.173  43.421 19.745  1.00 28.68 ? 14  GLN A CB  1 
ATOM   69   C  CG  . GLN A 1 9   ? 50.936  44.183 20.181  1.00 34.48 ? 14  GLN A CG  1 
ATOM   70   C  CD  . GLN A 1 9   ? 50.870  44.388 21.676  1.00 36.64 ? 14  GLN A CD  1 
ATOM   71   O  OE1 . GLN A 1 9   ? 50.648  45.501 22.154  1.00 40.99 ? 14  GLN A OE1 1 
ATOM   72   N  NE2 . GLN A 1 9   ? 51.052  43.310 22.427  1.00 38.96 ? 14  GLN A NE2 1 
ATOM   73   N  N   . ARG A 1 10  ? 54.457  43.614 21.787  1.00 23.72 ? 15  ARG A N   1 
ATOM   74   C  CA  . ARG A 1 10  ? 54.964  43.837 23.131  1.00 23.04 ? 15  ARG A CA  1 
ATOM   75   C  C   . ARG A 1 10  ? 56.171  44.759 23.125  1.00 21.37 ? 15  ARG A C   1 
ATOM   76   O  O   . ARG A 1 10  ? 56.317  45.609 24.006  1.00 20.04 ? 15  ARG A O   1 
ATOM   77   C  CB  . ARG A 1 10  ? 55.330  42.509 23.790  1.00 23.32 ? 15  ARG A CB  1 
ATOM   78   C  CG  . ARG A 1 10  ? 54.174  41.869 24.547  1.00 26.12 ? 15  ARG A CG  1 
ATOM   79   C  CD  . ARG A 1 10  ? 54.560  40.492 25.031  1.00 25.13 ? 15  ARG A CD  1 
ATOM   80   N  NE  . ARG A 1 10  ? 54.607  39.541 23.927  1.00 24.57 ? 15  ARG A NE  1 
ATOM   81   C  CZ  . ARG A 1 10  ? 55.385  38.464 23.904  1.00 25.69 ? 15  ARG A CZ  1 
ATOM   82   N  NH1 . ARG A 1 10  ? 56.189  38.203 24.926  1.00 24.03 ? 15  ARG A NH1 1 
ATOM   83   N  NH2 . ARG A 1 10  ? 55.352  37.644 22.863  1.00 24.26 ? 15  ARG A NH2 1 
ATOM   84   N  N   . LEU A 1 11  ? 57.044  44.594 22.139  1.00 20.61 ? 16  LEU A N   1 
ATOM   85   C  CA  . LEU A 1 11  ? 58.220  45.454 22.069  1.00 21.92 ? 16  LEU A CA  1 
ATOM   86   C  C   . LEU A 1 11  ? 57.817  46.909 21.824  1.00 22.47 ? 16  LEU A C   1 
ATOM   87   O  O   . LEU A 1 11  ? 58.389  47.819 22.418  1.00 23.31 ? 16  LEU A O   1 
ATOM   88   C  CB  . LEU A 1 11  ? 59.185  44.969 20.975  1.00 19.87 ? 16  LEU A CB  1 
ATOM   89   C  CG  . LEU A 1 11  ? 60.082  43.775 21.351  1.00 17.23 ? 16  LEU A CG  1 
ATOM   90   C  CD1 . LEU A 1 11  ? 60.781  43.214 20.117  1.00 16.17 ? 16  LEU A CD1 1 
ATOM   91   C  CD2 . LEU A 1 11  ? 61.102  44.219 22.387  1.00 16.80 ? 16  LEU A CD2 1 
ATOM   92   N  N   . LEU A 1 12  ? 56.821  47.131 20.968  1.00 23.54 ? 17  LEU A N   1 
ATOM   93   C  CA  . LEU A 1 12  ? 56.383  48.497 20.675  1.00 26.21 ? 17  LEU A CA  1 
ATOM   94   C  C   . LEU A 1 12  ? 55.417  49.063 21.716  1.00 27.26 ? 17  LEU A C   1 
ATOM   95   O  O   . LEU A 1 12  ? 55.179  50.270 21.767  1.00 25.96 ? 17  LEU A O   1 
ATOM   96   C  CB  . LEU A 1 12  ? 55.743  48.560 19.285  1.00 25.69 ? 17  LEU A CB  1 
ATOM   97   C  CG  . LEU A 1 12  ? 56.676  48.205 18.120  1.00 26.85 ? 17  LEU A CG  1 
ATOM   98   C  CD1 . LEU A 1 12  ? 55.960  48.429 16.795  1.00 25.80 ? 17  LEU A CD1 1 
ATOM   99   C  CD2 . LEU A 1 12  ? 57.937  49.059 18.194  1.00 28.27 ? 17  LEU A CD2 1 
ATOM   100  N  N   . GLU A 1 13  ? 54.873  48.187 22.552  1.00 29.57 ? 18  GLU A N   1 
ATOM   101  C  CA  . GLU A 1 13  ? 53.934  48.596 23.591  1.00 30.76 ? 18  GLU A CA  1 
ATOM   102  C  C   . GLU A 1 13  ? 54.501  49.683 24.501  1.00 30.62 ? 18  GLU A C   1 
ATOM   103  O  O   . GLU A 1 13  ? 53.748  50.450 25.103  1.00 30.53 ? 18  GLU A O   1 
ATOM   104  C  CB  . GLU A 1 13  ? 53.532  47.375 24.427  1.00 32.58 ? 18  GLU A CB  1 
ATOM   105  C  CG  . GLU A 1 13  ? 52.605  47.683 25.588  1.00 36.36 ? 18  GLU A CG  1 
ATOM   106  C  CD  . GLU A 1 13  ? 52.077  46.427 26.259  1.00 38.96 ? 18  GLU A CD  1 
ATOM   107  O  OE1 . GLU A 1 13  ? 52.891  45.610 26.740  1.00 38.92 ? 18  GLU A OE1 1 
ATOM   108  O  OE2 . GLU A 1 13  ? 50.841  46.258 26.304  1.00 42.46 ? 18  GLU A OE2 1 
ATOM   109  N  N   . VAL A 1 14  ? 55.826  49.759 24.596  1.00 29.36 ? 19  VAL A N   1 
ATOM   110  C  CA  . VAL A 1 14  ? 56.456  50.754 25.453  1.00 29.58 ? 19  VAL A CA  1 
ATOM   111  C  C   . VAL A 1 14  ? 56.744  52.102 24.799  1.00 30.52 ? 19  VAL A C   1 
ATOM   112  O  O   . VAL A 1 14  ? 57.288  52.994 25.447  1.00 28.08 ? 19  VAL A O   1 
ATOM   113  C  CB  . VAL A 1 14  ? 57.771  50.223 26.061  1.00 28.55 ? 19  VAL A CB  1 
ATOM   114  C  CG1 . VAL A 1 14  ? 57.476  49.037 26.967  1.00 29.86 ? 19  VAL A CG1 1 
ATOM   115  C  CG2 . VAL A 1 14  ? 58.738  49.832 24.956  1.00 28.11 ? 19  VAL A CG2 1 
ATOM   116  N  N   . ARG A 1 15  ? 56.407  52.274 23.525  1.00 33.64 ? 20  ARG A N   1 
ATOM   117  C  CA  . ARG A 1 15  ? 56.655  53.579 22.929  1.00 38.43 ? 20  ARG A CA  1 
ATOM   118  C  C   . ARG A 1 15  ? 55.639  54.506 23.574  1.00 39.57 ? 20  ARG A C   1 
ATOM   119  O  O   . ARG A 1 15  ? 54.433  54.323 23.428  1.00 42.58 ? 20  ARG A O   1 
ATOM   120  C  CB  . ARG A 1 15  ? 56.498  53.563 21.403  1.00 40.47 ? 20  ARG A CB  1 
ATOM   121  C  CG  . ARG A 1 15  ? 55.139  53.188 20.863  1.00 45.18 ? 20  ARG A CG  1 
ATOM   122  C  CD  . ARG A 1 15  ? 55.082  53.500 19.374  1.00 50.72 ? 20  ARG A CD  1 
ATOM   123  N  NE  . ARG A 1 15  ? 53.970  52.841 18.694  1.00 55.09 ? 20  ARG A NE  1 
ATOM   124  C  CZ  . ARG A 1 15  ? 53.644  53.055 17.423  1.00 56.47 ? 20  ARG A CZ  1 
ATOM   125  N  NH1 . ARG A 1 15  ? 54.342  53.916 16.695  1.00 56.81 ? 20  ARG A NH1 1 
ATOM   126  N  NH2 . ARG A 1 15  ? 52.630  52.399 16.874  1.00 57.11 ? 20  ARG A NH2 1 
ATOM   127  N  N   . GLY A 1 16  ? 56.134  55.486 24.319  1.00 39.80 ? 21  GLY A N   1 
ATOM   128  C  CA  . GLY A 1 16  ? 55.244  56.402 25.005  1.00 39.13 ? 21  GLY A CA  1 
ATOM   129  C  C   . GLY A 1 16  ? 55.354  56.190 26.503  1.00 38.09 ? 21  GLY A C   1 
ATOM   130  O  O   . GLY A 1 16  ? 54.850  56.988 27.293  1.00 37.36 ? 21  GLY A O   1 
ATOM   131  N  N   . SER A 1 17  ? 56.004  55.097 26.894  1.00 35.86 ? 22  SER A N   1 
ATOM   132  C  CA  . SER A 1 17  ? 56.209  54.795 28.306  1.00 35.20 ? 22  SER A CA  1 
ATOM   133  C  C   . SER A 1 17  ? 57.430  55.581 28.757  1.00 33.94 ? 22  SER A C   1 
ATOM   134  O  O   . SER A 1 17  ? 58.109  56.203 27.940  1.00 33.65 ? 22  SER A O   1 
ATOM   135  C  CB  . SER A 1 17  ? 56.468  53.300 28.518  1.00 34.15 ? 22  SER A CB  1 
ATOM   136  O  OG  . SER A 1 17  ? 55.299  52.533 28.301  1.00 37.86 ? 22  SER A OG  1 
ATOM   137  N  N   . LYS A 1 18  ? 57.708  55.551 30.054  1.00 33.03 ? 23  LYS A N   1 
ATOM   138  C  CA  . LYS A 1 18  ? 58.860  56.255 30.597  1.00 34.18 ? 23  LYS A CA  1 
ATOM   139  C  C   . LYS A 1 18  ? 60.142  55.636 30.045  1.00 33.95 ? 23  LYS A C   1 
ATOM   140  O  O   . LYS A 1 18  ? 60.360  54.428 30.169  1.00 33.23 ? 23  LYS A O   1 
ATOM   141  C  CB  . LYS A 1 18  ? 58.859  56.158 32.122  1.00 36.53 ? 23  LYS A CB  1 
ATOM   142  C  CG  . LYS A 1 18  ? 59.994  56.899 32.808  1.00 38.06 ? 23  LYS A CG  1 
ATOM   143  C  CD  . LYS A 1 18  ? 59.878  56.746 34.314  1.00 40.80 ? 23  LYS A CD  1 
ATOM   144  C  CE  . LYS A 1 18  ? 60.899  57.590 35.050  1.00 43.21 ? 23  LYS A CE  1 
ATOM   145  N  NZ  . LYS A 1 18  ? 60.729  57.454 36.526  1.00 44.86 ? 23  LYS A NZ  1 
ATOM   146  N  N   . PRO A 1 19  ? 61.000  56.454 29.413  1.00 32.42 ? 24  PRO A N   1 
ATOM   147  C  CA  . PRO A 1 19  ? 62.253  55.935 28.858  1.00 31.15 ? 24  PRO A CA  1 
ATOM   148  C  C   . PRO A 1 19  ? 62.969  55.048 29.870  1.00 29.72 ? 24  PRO A C   1 
ATOM   149  O  O   . PRO A 1 19  ? 63.141  55.424 31.031  1.00 27.71 ? 24  PRO A O   1 
ATOM   150  C  CB  . PRO A 1 19  ? 63.029  57.205 28.530  1.00 33.30 ? 24  PRO A CB  1 
ATOM   151  C  CG  . PRO A 1 19  ? 61.930  58.132 28.078  1.00 34.23 ? 24  PRO A CG  1 
ATOM   152  C  CD  . PRO A 1 19  ? 60.855  57.895 29.131  1.00 33.55 ? 24  PRO A CD  1 
ATOM   153  N  N   . GLY A 1 20  ? 63.371  53.863 29.424  1.00 27.88 ? 25  GLY A N   1 
ATOM   154  C  CA  . GLY A 1 20  ? 64.052  52.938 30.308  1.00 26.12 ? 25  GLY A CA  1 
ATOM   155  C  C   . GLY A 1 20  ? 63.168  51.766 30.696  1.00 25.85 ? 25  GLY A C   1 
ATOM   156  O  O   . GLY A 1 20  ? 63.653  50.776 31.246  1.00 24.47 ? 25  GLY A O   1 
ATOM   157  N  N   . LYS A 1 21  ? 61.869  51.861 30.418  1.00 24.69 ? 26  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 21  ? 60.976  50.763 30.773  1.00 24.72 ? 26  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 21  ? 61.336  49.532 29.958  1.00 22.18 ? 26  LYS A C   1 
ATOM   160  O  O   . LYS A 1 21  ? 61.363  49.576 28.730  1.00 20.89 ? 26  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 21  ? 59.508  51.121 30.531  1.00 25.67 ? 26  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 21  ? 58.562  50.040 31.053  1.00 27.86 ? 26  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 21  ? 57.100  50.454 31.006  1.00 31.09 ? 26  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 21  ? 56.208  49.362 31.603  1.00 33.31 ? 26  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 21  ? 54.763  49.725 31.554  1.00 36.21 ? 26  LYS A NZ  1 
ATOM   166  N  N   . ASN A 1 22  ? 61.609  48.435 30.656  1.00 22.04 ? 27  ASN A N   1 
ATOM   167  C  CA  . ASN A 1 22  ? 61.982  47.176 30.021  1.00 22.39 ? 27  ASN A CA  1 
ATOM   168  C  C   . ASN A 1 22  ? 60.812  46.413 29.426  1.00 22.43 ? 27  ASN A C   1 
ATOM   169  O  O   . ASN A 1 22  ? 59.666  46.576 29.845  1.00 22.41 ? 27  ASN A O   1 
ATOM   170  C  CB  . ASN A 1 22  ? 62.663  46.254 31.037  1.00 24.09 ? 27  ASN A CB  1 
ATOM   171  C  CG  . ASN A 1 22  ? 64.071  46.687 31.377  1.00 25.79 ? 27  ASN A CG  1 
ATOM   172  O  OD1 . ASN A 1 22  ? 64.494  47.791 31.040  1.00 27.36 ? 27  ASN A OD1 1 
ATOM   173  N  ND2 . ASN A 1 22  ? 64.807  45.814 32.057  1.00 26.17 ? 27  ASN A ND2 1 
ATOM   174  N  N   . VAL A 1 23  ? 61.125  45.594 28.428  1.00 22.41 ? 28  VAL A N   1 
ATOM   175  C  CA  . VAL A 1 23  ? 60.167  44.706 27.783  1.00 22.14 ? 28  VAL A CA  1 
ATOM   176  C  C   . VAL A 1 23  ? 60.862  43.358 27.959  1.00 21.65 ? 28  VAL A C   1 
ATOM   177  O  O   . VAL A 1 23  ? 61.925  43.121 27.379  1.00 19.85 ? 28  VAL A O   1 
ATOM   178  C  CB  . VAL A 1 23  ? 59.989  45.002 26.284  1.00 22.78 ? 28  VAL A CB  1 
ATOM   179  C  CG1 . VAL A 1 23  ? 59.123  43.915 25.649  1.00 24.73 ? 28  VAL A CG1 1 
ATOM   180  C  CG2 . VAL A 1 23  ? 59.324  46.370 26.092  1.00 25.01 ? 28  VAL A CG2 1 
ATOM   181  N  N   . GLN A 1 24  ? 60.280  42.490 28.781  1.00 21.00 ? 29  GLN A N   1 
ATOM   182  C  CA  . GLN A 1 24  ? 60.890  41.192 29.061  1.00 19.07 ? 29  GLN A CA  1 
ATOM   183  C  C   . GLN A 1 24  ? 60.232  40.048 28.304  1.00 19.38 ? 29  GLN A C   1 
ATOM   184  O  O   . GLN A 1 24  ? 59.277  39.439 28.785  1.00 20.04 ? 29  GLN A O   1 
ATOM   185  C  CB  . GLN A 1 24  ? 60.839  40.924 30.570  1.00 19.88 ? 29  GLN A CB  1 
ATOM   186  C  CG  . GLN A 1 24  ? 61.574  39.668 31.045  1.00 20.83 ? 29  GLN A CG  1 
ATOM   187  C  CD  . GLN A 1 24  ? 63.083  39.847 31.136  1.00 20.06 ? 29  GLN A CD  1 
ATOM   188  O  OE1 . GLN A 1 24  ? 63.598  40.970 31.081  1.00 17.17 ? 29  GLN A OE1 1 
ATOM   189  N  NE2 . GLN A 1 24  ? 63.799  38.735 31.301  1.00 18.77 ? 29  GLN A NE2 1 
ATOM   190  N  N   . LEU A 1 25  ? 60.749  39.763 27.113  1.00 19.53 ? 30  LEU A N   1 
ATOM   191  C  CA  . LEU A 1 25  ? 60.237  38.679 26.284  1.00 18.81 ? 30  LEU A CA  1 
ATOM   192  C  C   . LEU A 1 25  ? 60.655  37.367 26.937  1.00 18.20 ? 30  LEU A C   1 
ATOM   193  O  O   . LEU A 1 25  ? 61.547  37.355 27.780  1.00 16.95 ? 30  LEU A O   1 
ATOM   194  C  CB  . LEU A 1 25  ? 60.842  38.756 24.880  1.00 17.06 ? 30  LEU A CB  1 
ATOM   195  C  CG  . LEU A 1 25  ? 60.584  40.018 24.053  1.00 17.87 ? 30  LEU A CG  1 
ATOM   196  C  CD1 . LEU A 1 25  ? 61.341  39.922 22.726  1.00 17.05 ? 30  LEU A CD1 1 
ATOM   197  C  CD2 . LEU A 1 25  ? 59.086  40.179 23.806  1.00 16.76 ? 30  LEU A CD2 1 
ATOM   198  N  N   . GLN A 1 26  ? 60.019  36.269 26.543  1.00 18.29 ? 31  GLN A N   1 
ATOM   199  C  CA  . GLN A 1 26  ? 60.351  34.958 27.093  1.00 20.29 ? 31  GLN A CA  1 
ATOM   200  C  C   . GLN A 1 26  ? 61.643  34.470 26.456  1.00 20.87 ? 31  GLN A C   1 
ATOM   201  O  O   . GLN A 1 26  ? 61.980  34.875 25.341  1.00 19.52 ? 31  GLN A O   1 
ATOM   202  C  CB  . GLN A 1 26  ? 59.226  33.960 26.809  1.00 21.02 ? 31  GLN A CB  1 
ATOM   203  C  CG  . GLN A 1 26  ? 57.894  34.330 27.450  1.00 20.54 ? 31  GLN A CG  1 
ATOM   204  C  CD  . GLN A 1 26  ? 56.762  33.396 27.032  1.00 22.19 ? 31  GLN A CD  1 
ATOM   205  O  OE1 . GLN A 1 26  ? 55.619  33.563 27.454  1.00 22.58 ? 31  GLN A OE1 1 
ATOM   206  N  NE2 . GLN A 1 26  ? 57.080  32.413 26.199  1.00 22.27 ? 31  GLN A NE2 1 
ATOM   207  N  N   . GLU A 1 27  ? 62.371  33.610 27.162  1.00 20.62 ? 32  GLU A N   1 
ATOM   208  C  CA  . GLU A 1 27  ? 63.624  33.086 26.633  1.00 21.71 ? 32  GLU A CA  1 
ATOM   209  C  C   . GLU A 1 27  ? 63.432  32.380 25.291  1.00 21.10 ? 32  GLU A C   1 
ATOM   210  O  O   . GLU A 1 27  ? 64.223  32.568 24.364  1.00 22.34 ? 32  GLU A O   1 
ATOM   211  C  CB  . GLU A 1 27  ? 64.270  32.114 27.630  1.00 21.71 ? 32  GLU A CB  1 
ATOM   212  C  CG  . GLU A 1 27  ? 65.573  31.521 27.119  1.00 22.80 ? 32  GLU A CG  1 
ATOM   213  C  CD  . GLU A 1 27  ? 66.295  30.676 28.153  1.00 24.12 ? 32  GLU A CD  1 
ATOM   214  O  OE1 . GLU A 1 27  ? 66.485  31.153 29.292  1.00 21.89 ? 32  GLU A OE1 1 
ATOM   215  O  OE2 . GLU A 1 27  ? 66.686  29.538 27.820  1.00 23.38 ? 32  GLU A OE2 1 
ATOM   216  N  N   . ASN A 1 28  ? 62.380  31.575 25.182  1.00 22.42 ? 33  ASN A N   1 
ATOM   217  C  CA  . ASN A 1 28  ? 62.132  30.838 23.946  1.00 23.76 ? 33  ASN A CA  1 
ATOM   218  C  C   . ASN A 1 28  ? 61.865  31.764 22.759  1.00 23.09 ? 33  ASN A C   1 
ATOM   219  O  O   . ASN A 1 28  ? 62.232  31.452 21.626  1.00 23.85 ? 33  ASN A O   1 
ATOM   220  C  CB  . ASN A 1 28  ? 60.975  29.839 24.142  1.00 25.47 ? 33  ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 28  ? 59.600  30.495 24.134  1.00 28.01 ? 33  ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 28  ? 59.386  31.551 24.723  1.00 30.46 ? 33  ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 28  ? 58.650  29.844 23.475  1.00 30.51 ? 33  ASN A ND2 1 
ATOM   224  N  N   . GLU A 1 29  ? 61.244  32.907 23.022  1.00 20.50 ? 34  GLU A N   1 
ATOM   225  C  CA  . GLU A 1 29  ? 60.953  33.865 21.968  1.00 18.88 ? 34  GLU A CA  1 
ATOM   226  C  C   . GLU A 1 29  ? 62.251  34.498 21.465  1.00 17.81 ? 34  GLU A C   1 
ATOM   227  O  O   . GLU A 1 29  ? 62.467  34.614 20.263  1.00 19.49 ? 34  GLU A O   1 
ATOM   228  C  CB  . GLU A 1 29  ? 59.997  34.944 22.493  1.00 20.11 ? 34  GLU A CB  1 
ATOM   229  C  CG  . GLU A 1 29  ? 58.706  34.357 23.076  1.00 23.67 ? 34  GLU A CG  1 
ATOM   230  C  CD  . GLU A 1 29  ? 57.749  35.406 23.606  1.00 24.03 ? 34  GLU A CD  1 
ATOM   231  O  OE1 . GLU A 1 29  ? 58.184  36.293 24.376  1.00 23.73 ? 34  GLU A OE1 1 
ATOM   232  O  OE2 . GLU A 1 29  ? 56.552  35.333 23.262  1.00 24.95 ? 34  GLU A OE2 1 
ATOM   233  N  N   . ILE A 1 30  ? 63.123  34.898 22.383  1.00 16.97 ? 35  ILE A N   1 
ATOM   234  C  CA  . ILE A 1 30  ? 64.388  35.505 21.984  1.00 17.08 ? 35  ILE A CA  1 
ATOM   235  C  C   . ILE A 1 30  ? 65.250  34.514 21.206  1.00 16.98 ? 35  ILE A C   1 
ATOM   236  O  O   . ILE A 1 30  ? 65.857  34.866 20.191  1.00 16.38 ? 35  ILE A O   1 
ATOM   237  C  CB  . ILE A 1 30  ? 65.162  36.019 23.213  1.00 17.98 ? 35  ILE A CB  1 
ATOM   238  C  CG1 . ILE A 1 30  ? 64.347  37.119 23.899  1.00 17.48 ? 35  ILE A CG1 1 
ATOM   239  C  CG2 . ILE A 1 30  ? 66.531  36.552 22.792  1.00 20.93 ? 35  ILE A CG2 1 
ATOM   240  C  CD1 . ILE A 1 30  ? 65.059  37.767 25.067  1.00 18.00 ? 35  ILE A CD1 1 
ATOM   241  N  N   . ARG A 1 31  ? 65.294  33.269 21.666  1.00 19.27 ? 36  ARG A N   1 
ATOM   242  C  CA  . ARG A 1 31  ? 66.081  32.261 20.971  1.00 21.25 ? 36  ARG A CA  1 
ATOM   243  C  C   . ARG A 1 31  ? 65.509  32.048 19.568  1.00 20.15 ? 36  ARG A C   1 
ATOM   244  O  O   . ARG A 1 31  ? 66.258  31.838 18.618  1.00 20.14 ? 36  ARG A O   1 
ATOM   245  C  CB  . ARG A 1 31  ? 66.086  30.946 21.753  1.00 23.80 ? 36  ARG A CB  1 
ATOM   246  C  CG  . ARG A 1 31  ? 66.946  29.861 21.113  1.00 32.31 ? 36  ARG A CG  1 
ATOM   247  C  CD  . ARG A 1 31  ? 67.045  28.627 21.999  1.00 37.48 ? 36  ARG A CD  1 
ATOM   248  N  NE  . ARG A 1 31  ? 67.549  27.466 21.266  1.00 44.54 ? 36  ARG A NE  1 
ATOM   249  C  CZ  . ARG A 1 31  ? 68.775  27.358 20.755  1.00 46.47 ? 36  ARG A CZ  1 
ATOM   250  N  NH1 . ARG A 1 31  ? 69.654  28.344 20.889  1.00 45.79 ? 36  ARG A NH1 1 
ATOM   251  N  NH2 . ARG A 1 31  ? 69.120  26.255 20.102  1.00 47.07 ? 36  ARG A NH2 1 
ATOM   252  N  N   . GLY A 1 32  ? 64.184  32.105 19.445  1.00 19.70 ? 37  GLY A N   1 
ATOM   253  C  CA  . GLY A 1 32  ? 63.547  31.939 18.147  1.00 19.58 ? 37  GLY A CA  1 
ATOM   254  C  C   . GLY A 1 32  ? 63.938  33.075 17.206  1.00 20.51 ? 37  GLY A C   1 
ATOM   255  O  O   . GLY A 1 32  ? 64.251  32.846 16.030  1.00 19.91 ? 37  GLY A O   1 
ATOM   256  N  N   . LEU A 1 33  ? 63.921  34.303 17.722  1.00 17.42 ? 38  LEU A N   1 
ATOM   257  C  CA  . LEU A 1 33  ? 64.304  35.462 16.918  1.00 18.14 ? 38  LEU A CA  1 
ATOM   258  C  C   . LEU A 1 33  ? 65.717  35.244 16.386  1.00 17.92 ? 38  LEU A C   1 
ATOM   259  O  O   . LEU A 1 33  ? 65.991  35.500 15.216  1.00 18.72 ? 38  LEU A O   1 
ATOM   260  C  CB  . LEU A 1 33  ? 64.262  36.747 17.751  1.00 15.13 ? 38  LEU A CB  1 
ATOM   261  C  CG  . LEU A 1 33  ? 62.909  37.282 18.229  1.00 17.66 ? 38  LEU A CG  1 
ATOM   262  C  CD1 . LEU A 1 33  ? 63.148  38.440 19.189  1.00 13.56 ? 38  LEU A CD1 1 
ATOM   263  C  CD2 . LEU A 1 33  ? 62.065  37.744 17.031  1.00 14.78 ? 38  LEU A CD2 1 
ATOM   264  N  N   . CYS A 1 34  ? 66.610  34.762 17.245  1.00 17.86 ? 39  CYS A N   1 
ATOM   265  C  CA  . CYS A 1 34  ? 67.991  34.506 16.843  1.00 21.55 ? 39  CYS A CA  1 
ATOM   266  C  C   . CYS A 1 34  ? 68.099  33.423 15.764  1.00 22.58 ? 39  CYS A C   1 
ATOM   267  O  O   . CYS A 1 34  ? 68.732  33.625 14.728  1.00 22.38 ? 39  CYS A O   1 
ATOM   268  C  CB  . CYS A 1 34  ? 68.835  34.076 18.048  1.00 20.97 ? 39  CYS A CB  1 
ATOM   269  S  SG  . CYS A 1 34  ? 69.213  35.389 19.227  1.00 21.91 ? 39  CYS A SG  1 
ATOM   270  N  N   . LEU A 1 35  ? 67.484  32.273 16.021  1.00 23.04 ? 40  LEU A N   1 
ATOM   271  C  CA  . LEU A 1 35  ? 67.530  31.153 15.088  1.00 24.83 ? 40  LEU A CA  1 
ATOM   272  C  C   . LEU A 1 35  ? 66.850  31.430 13.749  1.00 23.90 ? 40  LEU A C   1 
ATOM   273  O  O   . LEU A 1 35  ? 67.343  31.008 12.708  1.00 26.04 ? 40  LEU A O   1 
ATOM   274  C  CB  . LEU A 1 35  ? 66.923  29.903 15.741  1.00 24.45 ? 40  LEU A CB  1 
ATOM   275  C  CG  . LEU A 1 35  ? 67.589  29.470 17.057  1.00 27.10 ? 40  LEU A CG  1 
ATOM   276  C  CD1 . LEU A 1 35  ? 66.992  28.151 17.531  1.00 28.09 ? 40  LEU A CD1 1 
ATOM   277  C  CD2 . LEU A 1 35  ? 69.094  29.324 16.858  1.00 28.36 ? 40  LEU A CD2 1 
ATOM   278  N  N   . LYS A 1 36  ? 65.722  32.134 13.764  1.00 23.98 ? 41  LYS A N   1 
ATOM   279  C  CA  . LYS A 1 36  ? 65.024  32.437 12.518  1.00 24.68 ? 41  LYS A CA  1 
ATOM   280  C  C   . LYS A 1 36  ? 65.774  33.496 11.704  1.00 23.29 ? 41  LYS A C   1 
ATOM   281  O  O   . LYS A 1 36  ? 65.927  33.354 10.492  1.00 23.95 ? 41  LYS A O   1 
ATOM   282  C  CB  . LYS A 1 36  ? 63.595  32.912 12.802  1.00 27.03 ? 41  LYS A CB  1 
ATOM   283  C  CG  . LYS A 1 36  ? 62.713  33.024 11.560  1.00 31.21 ? 41  LYS A CG  1 
ATOM   284  C  CD  . LYS A 1 36  ? 62.511  31.661 10.900  1.00 35.74 ? 41  LYS A CD  1 
ATOM   285  C  CE  . LYS A 1 36  ? 61.492  31.715 9.767   1.00 37.80 ? 41  LYS A CE  1 
ATOM   286  N  NZ  . LYS A 1 36  ? 61.946  32.547 8.621   1.00 38.33 ? 41  LYS A NZ  1 
ATOM   287  N  N   . SER A 1 37  ? 66.248  34.555 12.358  1.00 22.55 ? 42  SER A N   1 
ATOM   288  C  CA  . SER A 1 37  ? 66.985  35.594 11.631  1.00 21.50 ? 42  SER A CA  1 
ATOM   289  C  C   . SER A 1 37  ? 68.287  35.033 11.055  1.00 22.72 ? 42  SER A C   1 
ATOM   290  O  O   . SER A 1 37  ? 68.674  35.365 9.932   1.00 24.95 ? 42  SER A O   1 
ATOM   291  C  CB  . SER A 1 37  ? 67.271  36.805 12.539  1.00 20.25 ? 42  SER A CB  1 
ATOM   292  O  OG  . SER A 1 37  ? 68.006  36.450 13.700  1.00 17.59 ? 42  SER A OG  1 
ATOM   293  N  N   . ARG A 1 38  ? 68.954  34.172 11.818  1.00 23.38 ? 43  ARG A N   1 
ATOM   294  C  CA  . ARG A 1 38  ? 70.200  33.549 11.371  1.00 23.52 ? 43  ARG A CA  1 
ATOM   295  C  C   . ARG A 1 38  ? 69.983  32.858 10.021  1.00 24.22 ? 43  ARG A C   1 
ATOM   296  O  O   . ARG A 1 38  ? 70.780  33.001 9.092   1.00 23.81 ? 43  ARG A O   1 
ATOM   297  C  CB  . ARG A 1 38  ? 70.661  32.518 12.406  1.00 23.32 ? 43  ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 38  ? 71.948  31.780 12.065  1.00 25.22 ? 43  ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 38  ? 72.330  30.812 13.193  1.00 26.99 ? 43  ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 38  ? 73.693  30.298 13.062  1.00 29.03 ? 43  ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 38  ? 74.074  29.389 12.170  1.00 31.30 ? 43  ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 38  ? 73.196  28.879 11.318  1.00 32.09 ? 43  ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 38  ? 75.339  28.992 12.129  1.00 33.10 ? 43  ARG A NH2 1 
ATOM   304  N  N   . GLU A 1 39  ? 68.898  32.098 9.933   1.00 24.25 ? 44  GLU A N   1 
ATOM   305  C  CA  . GLU A 1 39  ? 68.541  31.375 8.717   1.00 25.27 ? 44  GLU A CA  1 
ATOM   306  C  C   . GLU A 1 39  ? 68.367  32.337 7.540   1.00 24.09 ? 44  GLU A C   1 
ATOM   307  O  O   . GLU A 1 39  ? 68.823  32.067 6.430   1.00 24.60 ? 44  GLU A O   1 
ATOM   308  C  CB  . GLU A 1 39  ? 67.241  30.609 8.959   1.00 27.81 ? 44  GLU A CB  1 
ATOM   309  C  CG  . GLU A 1 39  ? 66.642  29.960 7.733   1.00 33.93 ? 44  GLU A CG  1 
ATOM   310  C  CD  . GLU A 1 39  ? 65.252  29.421 8.010   1.00 36.57 ? 44  GLU A CD  1 
ATOM   311  O  OE1 . GLU A 1 39  ? 65.110  28.596 8.937   1.00 39.11 ? 44  GLU A OE1 1 
ATOM   312  O  OE2 . GLU A 1 39  ? 64.302  29.826 7.309   1.00 39.99 ? 44  GLU A OE2 1 
ATOM   313  N  N   . ILE A 1 40  ? 67.693  33.454 7.787   1.00 22.63 ? 45  ILE A N   1 
ATOM   314  C  CA  . ILE A 1 40  ? 67.474  34.454 6.750   1.00 22.76 ? 45  ILE A CA  1 
ATOM   315  C  C   . ILE A 1 40  ? 68.804  35.096 6.353   1.00 22.53 ? 45  ILE A C   1 
ATOM   316  O  O   . ILE A 1 40  ? 69.089  35.255 5.165   1.00 21.68 ? 45  ILE A O   1 
ATOM   317  C  CB  . ILE A 1 40  ? 66.500  35.553 7.229   1.00 22.46 ? 45  ILE A CB  1 
ATOM   318  C  CG1 . ILE A 1 40  ? 65.148  34.926 7.584   1.00 23.28 ? 45  ILE A CG1 1 
ATOM   319  C  CG2 . ILE A 1 40  ? 66.307  36.596 6.136   1.00 25.54 ? 45  ILE A CG2 1 
ATOM   320  C  CD1 . ILE A 1 40  ? 64.148  35.903 8.182   1.00 21.63 ? 45  ILE A CD1 1 
ATOM   321  N  N   . PHE A 1 41  ? 69.615  35.464 7.345   1.00 20.75 ? 46  PHE A N   1 
ATOM   322  C  CA  . PHE A 1 41  ? 70.906  36.081 7.068   1.00 20.91 ? 46  PHE A CA  1 
ATOM   323  C  C   . PHE A 1 41  ? 71.707  35.181 6.132   1.00 22.64 ? 46  PHE A C   1 
ATOM   324  O  O   . PHE A 1 41  ? 72.238  35.641 5.122   1.00 22.97 ? 46  PHE A O   1 
ATOM   325  C  CB  . PHE A 1 41  ? 71.685  36.313 8.374   1.00 18.75 ? 46  PHE A CB  1 
ATOM   326  C  CG  . PHE A 1 41  ? 71.092  37.382 9.259   1.00 18.90 ? 46  PHE A CG  1 
ATOM   327  C  CD1 . PHE A 1 41  ? 70.536  38.540 8.712   1.00 18.08 ? 46  PHE A CD1 1 
ATOM   328  C  CD2 . PHE A 1 41  ? 71.101  37.237 10.642  1.00 18.54 ? 46  PHE A CD2 1 
ATOM   329  C  CE1 . PHE A 1 41  ? 69.998  39.536 9.537   1.00 17.22 ? 46  PHE A CE1 1 
ATOM   330  C  CE2 . PHE A 1 41  ? 70.564  38.225 11.474  1.00 18.93 ? 46  PHE A CE2 1 
ATOM   331  C  CZ  . PHE A 1 41  ? 70.013  39.375 10.922  1.00 15.22 ? 46  PHE A CZ  1 
ATOM   332  N  N   . LEU A 1 42  ? 71.781  33.894 6.462   1.00 22.48 ? 47  LEU A N   1 
ATOM   333  C  CA  . LEU A 1 42  ? 72.517  32.942 5.637   1.00 24.32 ? 47  LEU A CA  1 
ATOM   334  C  C   . LEU A 1 42  ? 71.869  32.719 4.267   1.00 24.77 ? 47  LEU A C   1 
ATOM   335  O  O   . LEU A 1 42  ? 72.551  32.363 3.308   1.00 26.50 ? 47  LEU A O   1 
ATOM   336  C  CB  . LEU A 1 42  ? 72.664  31.605 6.373   1.00 22.46 ? 47  LEU A CB  1 
ATOM   337  C  CG  . LEU A 1 42  ? 73.606  31.625 7.583   1.00 22.41 ? 47  LEU A CG  1 
ATOM   338  C  CD1 . LEU A 1 42  ? 73.558  30.284 8.319   1.00 22.08 ? 47  LEU A CD1 1 
ATOM   339  C  CD2 . LEU A 1 42  ? 75.023  31.933 7.116   1.00 20.99 ? 47  LEU A CD2 1 
ATOM   340  N  N   . SER A 1 43  ? 70.563  32.940 4.167   1.00 26.54 ? 48  SER A N   1 
ATOM   341  C  CA  . SER A 1 43  ? 69.873  32.754 2.893   1.00 28.41 ? 48  SER A CA  1 
ATOM   342  C  C   . SER A 1 43  ? 70.094  33.927 1.938   1.00 29.05 ? 48  SER A C   1 
ATOM   343  O  O   . SER A 1 43  ? 69.841  33.808 0.739   1.00 30.60 ? 48  SER A O   1 
ATOM   344  C  CB  . SER A 1 43  ? 68.368  32.553 3.113   1.00 29.55 ? 48  SER A CB  1 
ATOM   345  O  OG  . SER A 1 43  ? 67.726  33.763 3.477   1.00 30.78 ? 48  SER A OG  1 
ATOM   346  N  N   . GLN A 1 44  ? 70.551  35.059 2.465   1.00 27.86 ? 49  GLN A N   1 
ATOM   347  C  CA  . GLN A 1 44  ? 70.807  36.234 1.630   1.00 27.81 ? 49  GLN A CA  1 
ATOM   348  C  C   . GLN A 1 44  ? 72.317  36.423 1.521   1.00 26.79 ? 49  GLN A C   1 
ATOM   349  O  O   . GLN A 1 44  ? 73.070  35.891 2.333   1.00 27.25 ? 49  GLN A O   1 
ATOM   350  C  CB  . GLN A 1 44  ? 70.159  37.480 2.244   1.00 27.72 ? 49  GLN A CB  1 
ATOM   351  C  CG  . GLN A 1 44  ? 68.672  37.323 2.522   1.00 28.66 ? 49  GLN A CG  1 
ATOM   352  C  CD  . GLN A 1 44  ? 68.038  38.583 3.071   1.00 29.58 ? 49  GLN A CD  1 
ATOM   353  O  OE1 . GLN A 1 44  ? 68.577  39.224 3.971   1.00 29.38 ? 49  GLN A OE1 1 
ATOM   354  N  NE2 . GLN A 1 44  ? 66.875  38.937 2.541   1.00 29.87 ? 49  GLN A NE2 1 
ATOM   355  N  N   . PRO A 1 45  ? 72.779  37.184 0.513   1.00 27.98 ? 50  PRO A N   1 
ATOM   356  C  CA  . PRO A 1 45  ? 74.213  37.432 0.304   1.00 27.28 ? 50  PRO A CA  1 
ATOM   357  C  C   . PRO A 1 45  ? 74.903  38.123 1.479   1.00 26.67 ? 50  PRO A C   1 
ATOM   358  O  O   . PRO A 1 45  ? 74.257  38.809 2.274   1.00 23.85 ? 50  PRO A O   1 
ATOM   359  C  CB  . PRO A 1 45  ? 74.234  38.308 -0.951  1.00 28.57 ? 50  PRO A CB  1 
ATOM   360  C  CG  . PRO A 1 45  ? 72.988  37.904 -1.678  1.00 29.56 ? 50  PRO A CG  1 
ATOM   361  C  CD  . PRO A 1 45  ? 71.985  37.815 -0.555  1.00 27.93 ? 50  PRO A CD  1 
ATOM   362  N  N   . ILE A 1 46  ? 76.216  37.940 1.585   1.00 25.00 ? 51  ILE A N   1 
ATOM   363  C  CA  . ILE A 1 46  ? 76.967  38.589 2.650   1.00 23.79 ? 51  ILE A CA  1 
ATOM   364  C  C   . ILE A 1 46  ? 77.246  40.028 2.203   1.00 24.07 ? 51  ILE A C   1 
ATOM   365  O  O   . ILE A 1 46  ? 77.574  40.892 3.013   1.00 22.39 ? 51  ILE A O   1 
ATOM   366  C  CB  . ILE A 1 46  ? 78.286  37.845 2.958   1.00 23.44 ? 51  ILE A CB  1 
ATOM   367  C  CG1 . ILE A 1 46  ? 78.873  38.370 4.271   1.00 22.79 ? 51  ILE A CG1 1 
ATOM   368  C  CG2 . ILE A 1 46  ? 79.276  38.023 1.813   1.00 24.25 ? 51  ILE A CG2 1 
ATOM   369  C  CD1 . ILE A 1 46  ? 80.037  37.552 4.811   1.00 21.96 ? 51  ILE A CD1 1 
ATOM   370  N  N   . LEU A 1 47  ? 77.116  40.269 0.899   1.00 23.19 ? 52  LEU A N   1 
ATOM   371  C  CA  . LEU A 1 47  ? 77.294  41.601 0.328   1.00 24.14 ? 52  LEU A CA  1 
ATOM   372  C  C   . LEU A 1 47  ? 75.948  41.907 -0.308  1.00 23.79 ? 52  LEU A C   1 
ATOM   373  O  O   . LEU A 1 47  ? 75.667  41.485 -1.426  1.00 23.11 ? 52  LEU A O   1 
ATOM   374  C  CB  . LEU A 1 47  ? 78.392  41.613 -0.741  1.00 26.73 ? 52  LEU A CB  1 
ATOM   375  C  CG  . LEU A 1 47  ? 78.570  42.942 -1.487  1.00 29.76 ? 52  LEU A CG  1 
ATOM   376  C  CD1 . LEU A 1 47  ? 79.071  44.019 -0.533  1.00 30.07 ? 52  LEU A CD1 1 
ATOM   377  C  CD2 . LEU A 1 47  ? 79.557  42.760 -2.635  1.00 30.35 ? 52  LEU A CD2 1 
ATOM   378  N  N   . LEU A 1 48  ? 75.110  42.635 0.419   1.00 23.48 ? 53  LEU A N   1 
ATOM   379  C  CA  . LEU A 1 48  ? 73.773  42.966 -0.057  1.00 23.94 ? 53  LEU A CA  1 
ATOM   380  C  C   . LEU A 1 48  ? 73.749  43.969 -1.206  1.00 25.22 ? 53  LEU A C   1 
ATOM   381  O  O   . LEU A 1 48  ? 74.553  44.892 -1.260  1.00 24.57 ? 53  LEU A O   1 
ATOM   382  C  CB  . LEU A 1 48  ? 72.938  43.510 1.105   1.00 21.90 ? 53  LEU A CB  1 
ATOM   383  C  CG  . LEU A 1 48  ? 72.697  42.562 2.284   1.00 22.89 ? 53  LEU A CG  1 
ATOM   384  C  CD1 . LEU A 1 48  ? 72.115  43.348 3.453   1.00 19.15 ? 53  LEU A CD1 1 
ATOM   385  C  CD2 . LEU A 1 48  ? 71.752  41.431 1.860   1.00 22.30 ? 53  LEU A CD2 1 
ATOM   386  N  N   . GLU A 1 49  ? 72.825  43.764 -2.135  1.00 26.42 ? 54  GLU A N   1 
ATOM   387  C  CA  . GLU A 1 49  ? 72.658  44.670 -3.261  1.00 28.01 ? 54  GLU A CA  1 
ATOM   388  C  C   . GLU A 1 49  ? 71.245  45.203 -3.119  1.00 26.95 ? 54  GLU A C   1 
ATOM   389  O  O   . GLU A 1 49  ? 70.273  44.544 -3.489  1.00 27.38 ? 54  GLU A O   1 
ATOM   390  C  CB  . GLU A 1 49  ? 72.852  43.928 -4.582  1.00 31.74 ? 54  GLU A CB  1 
ATOM   391  C  CG  . GLU A 1 49  ? 74.322  43.693 -4.905  1.00 38.33 ? 54  GLU A CG  1 
ATOM   392  C  CD  . GLU A 1 49  ? 74.532  42.824 -6.127  1.00 42.06 ? 54  GLU A CD  1 
ATOM   393  O  OE1 . GLU A 1 49  ? 73.929  43.118 -7.181  1.00 46.02 ? 54  GLU A OE1 1 
ATOM   394  O  OE2 . GLU A 1 49  ? 75.308  41.850 -6.035  1.00 44.62 ? 54  GLU A OE2 1 
ATOM   395  N  N   . LEU A 1 50  ? 71.148  46.398 -2.549  1.00 25.80 ? 55  LEU A N   1 
ATOM   396  C  CA  . LEU A 1 50  ? 69.868  47.033 -2.285  1.00 27.55 ? 55  LEU A CA  1 
ATOM   397  C  C   . LEU A 1 50  ? 69.527  48.156 -3.251  1.00 30.04 ? 55  LEU A C   1 
ATOM   398  O  O   . LEU A 1 50  ? 70.381  48.648 -3.993  1.00 30.01 ? 55  LEU A O   1 
ATOM   399  C  CB  . LEU A 1 50  ? 69.859  47.579 -0.857  1.00 26.52 ? 55  LEU A CB  1 
ATOM   400  C  CG  . LEU A 1 50  ? 70.341  46.603 0.222   1.00 24.95 ? 55  LEU A CG  1 
ATOM   401  C  CD1 . LEU A 1 50  ? 70.398  47.309 1.565   1.00 23.50 ? 55  LEU A CD1 1 
ATOM   402  C  CD2 . LEU A 1 50  ? 69.416  45.401 0.278   1.00 22.14 ? 55  LEU A CD2 1 
ATOM   403  N  N   . GLU A 1 51  ? 68.267  48.567 -3.211  1.00 32.04 ? 56  GLU A N   1 
ATOM   404  C  CA  . GLU A 1 51  ? 67.774  49.627 -4.072  1.00 34.77 ? 56  GLU A CA  1 
ATOM   405  C  C   . GLU A 1 51  ? 67.017  50.666 -3.257  1.00 34.84 ? 56  GLU A C   1 
ATOM   406  O  O   . GLU A 1 51  ? 66.313  50.327 -2.305  1.00 34.90 ? 56  GLU A O   1 
ATOM   407  C  CB  . GLU A 1 51  ? 66.848  49.032 -5.135  1.00 36.57 ? 56  GLU A CB  1 
ATOM   408  C  CG  . GLU A 1 51  ? 67.543  48.079 -6.094  1.00 41.13 ? 56  GLU A CG  1 
ATOM   409  C  CD  . GLU A 1 51  ? 66.572  47.352 -7.008  1.00 44.56 ? 56  GLU A CD  1 
ATOM   410  O  OE1 . GLU A 1 51  ? 65.668  48.011 -7.569  1.00 45.94 ? 56  GLU A OE1 1 
ATOM   411  O  OE2 . GLU A 1 51  ? 66.718  46.121 -7.170  1.00 45.77 ? 56  GLU A OE2 1 
ATOM   412  N  N   . ALA A 1 52  ? 67.175  51.934 -3.619  1.00 34.82 ? 57  ALA A N   1 
ATOM   413  C  CA  . ALA A 1 52  ? 66.465  53.004 -2.928  1.00 34.82 ? 57  ALA A CA  1 
ATOM   414  C  C   . ALA A 1 52  ? 64.996  52.834 -3.315  1.00 33.48 ? 57  ALA A C   1 
ATOM   415  O  O   . ALA A 1 52  ? 64.692  52.132 -4.276  1.00 33.76 ? 57  ALA A O   1 
ATOM   416  C  CB  . ALA A 1 52  ? 66.984  54.360 -3.388  1.00 34.72 ? 57  ALA A CB  1 
ATOM   417  N  N   . PRO A 1 53  ? 64.064  53.453 -2.567  1.00 33.41 ? 58  PRO A N   1 
ATOM   418  C  CA  . PRO A 1 53  ? 64.264  54.296 -1.384  1.00 32.40 ? 58  PRO A CA  1 
ATOM   419  C  C   . PRO A 1 53  ? 64.662  53.457 -0.176  1.00 32.24 ? 58  PRO A C   1 
ATOM   420  O  O   . PRO A 1 53  ? 64.235  52.310 -0.033  1.00 31.84 ? 58  PRO A O   1 
ATOM   421  C  CB  . PRO A 1 53  ? 62.903  54.955 -1.205  1.00 33.32 ? 58  PRO A CB  1 
ATOM   422  C  CG  . PRO A 1 53  ? 61.976  53.866 -1.619  1.00 32.86 ? 58  PRO A CG  1 
ATOM   423  C  CD  . PRO A 1 53  ? 62.628  53.338 -2.881  1.00 32.60 ? 58  PRO A CD  1 
ATOM   424  N  N   . LEU A 1 54  ? 65.469  54.043 0.697   1.00 32.24 ? 59  LEU A N   1 
ATOM   425  C  CA  . LEU A 1 54  ? 65.944  53.341 1.879   1.00 31.33 ? 59  LEU A CA  1 
ATOM   426  C  C   . LEU A 1 54  ? 66.373  54.340 2.944   1.00 30.72 ? 59  LEU A C   1 
ATOM   427  O  O   . LEU A 1 54  ? 66.789  55.456 2.631   1.00 31.86 ? 59  LEU A O   1 
ATOM   428  C  CB  . LEU A 1 54  ? 67.139  52.463 1.489   1.00 31.27 ? 59  LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 54  ? 67.863  51.621 2.538   1.00 32.15 ? 59  LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 54  ? 67.003  50.419 2.923   1.00 32.49 ? 59  LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 54  ? 69.198  51.157 1.965   1.00 31.50 ? 59  LEU A CD2 1 
ATOM   432  N  N   . LYS A 1 55  ? 66.260  53.932 4.202   1.00 28.87 ? 60  LYS A N   1 
ATOM   433  C  CA  . LYS A 1 55  ? 66.669  54.756 5.331   1.00 28.77 ? 60  LYS A CA  1 
ATOM   434  C  C   . LYS A 1 55  ? 67.872  54.028 5.924   1.00 27.49 ? 60  LYS A C   1 
ATOM   435  O  O   . LYS A 1 55  ? 67.757  52.870 6.322   1.00 25.22 ? 60  LYS A O   1 
ATOM   436  C  CB  . LYS A 1 55  ? 65.552  54.831 6.377   1.00 31.26 ? 60  LYS A CB  1 
ATOM   437  C  CG  . LYS A 1 55  ? 64.224  55.371 5.863   1.00 35.47 ? 60  LYS A CG  1 
ATOM   438  C  CD  . LYS A 1 55  ? 64.221  56.886 5.809   1.00 37.78 ? 60  LYS A CD  1 
ATOM   439  C  CE  . LYS A 1 55  ? 62.865  57.417 5.369   1.00 37.11 ? 60  LYS A CE  1 
ATOM   440  N  NZ  . LYS A 1 55  ? 62.829  58.904 5.420   1.00 38.40 ? 60  LYS A NZ  1 
ATOM   441  N  N   . ILE A 1 56  ? 69.021  54.696 5.978   1.00 25.38 ? 61  ILE A N   1 
ATOM   442  C  CA  . ILE A 1 56  ? 70.227  54.074 6.520   1.00 24.07 ? 61  ILE A CA  1 
ATOM   443  C  C   . ILE A 1 56  ? 70.559  54.646 7.892   1.00 22.99 ? 61  ILE A C   1 
ATOM   444  O  O   . ILE A 1 56  ? 70.596  55.866 8.077   1.00 23.24 ? 61  ILE A O   1 
ATOM   445  C  CB  . ILE A 1 56  ? 71.425  54.282 5.572   1.00 24.46 ? 61  ILE A CB  1 
ATOM   446  C  CG1 . ILE A 1 56  ? 71.025  53.886 4.147   1.00 24.47 ? 61  ILE A CG1 1 
ATOM   447  C  CG2 . ILE A 1 56  ? 72.611  53.447 6.034   1.00 23.54 ? 61  ILE A CG2 1 
ATOM   448  C  CD1 . ILE A 1 56  ? 72.123  54.090 3.118   1.00 24.85 ? 61  ILE A CD1 1 
ATOM   449  N  N   . CYS A 1 57  ? 70.806  53.760 8.853   1.00 21.40 ? 62  CYS A N   1 
ATOM   450  C  CA  . CYS A 1 57  ? 71.113  54.179 10.213  1.00 19.74 ? 62  CYS A CA  1 
ATOM   451  C  C   . CYS A 1 57  ? 72.460  53.670 10.714  1.00 18.99 ? 62  CYS A C   1 
ATOM   452  O  O   . CYS A 1 57  ? 72.911  52.591 10.329  1.00 15.03 ? 62  CYS A O   1 
ATOM   453  C  CB  . CYS A 1 57  ? 70.024  53.689 11.169  1.00 23.77 ? 62  CYS A CB  1 
ATOM   454  S  SG  . CYS A 1 57  ? 68.342  54.192 10.733  1.00 28.83 ? 62  CYS A SG  1 
ATOM   455  N  N   . GLY A 1 58  ? 73.075  54.455 11.594  1.00 16.83 ? 63  GLY A N   1 
ATOM   456  C  CA  . GLY A 1 58  ? 74.351  54.091 12.178  1.00 17.70 ? 63  GLY A CA  1 
ATOM   457  C  C   . GLY A 1 58  ? 74.178  53.457 13.548  1.00 18.12 ? 63  GLY A C   1 
ATOM   458  O  O   . GLY A 1 58  ? 73.098  52.969 13.875  1.00 19.33 ? 63  GLY A O   1 
ATOM   459  N  N   . ASP A 1 59  ? 75.241  53.487 14.350  1.00 18.20 ? 64  ASP A N   1 
ATOM   460  C  CA  . ASP A 1 59  ? 75.258  52.898 15.690  1.00 19.90 ? 64  ASP A CA  1 
ATOM   461  C  C   . ASP A 1 59  ? 74.005  53.202 16.523  1.00 20.13 ? 64  ASP A C   1 
ATOM   462  O  O   . ASP A 1 59  ? 73.482  54.316 16.491  1.00 22.26 ? 64  ASP A O   1 
ATOM   463  C  CB  . ASP A 1 59  ? 76.491  53.391 16.461  1.00 16.98 ? 64  ASP A CB  1 
ATOM   464  C  CG  . ASP A 1 59  ? 77.805  53.063 15.762  1.00 17.36 ? 64  ASP A CG  1 
ATOM   465  O  OD1 . ASP A 1 59  ? 77.815  52.885 14.525  1.00 13.97 ? 64  ASP A OD1 1 
ATOM   466  O  OD2 . ASP A 1 59  ? 78.841  53.007 16.459  1.00 12.51 ? 64  ASP A OD2 1 
ATOM   467  N  N   . ILE A 1 60  ? 73.542  52.204 17.274  1.00 19.18 ? 65  ILE A N   1 
ATOM   468  C  CA  . ILE A 1 60  ? 72.374  52.340 18.143  1.00 18.06 ? 65  ILE A CA  1 
ATOM   469  C  C   . ILE A 1 60  ? 72.797  52.072 19.590  1.00 17.37 ? 65  ILE A C   1 
ATOM   470  O  O   . ILE A 1 60  ? 72.302  52.696 20.522  1.00 14.71 ? 65  ILE A O   1 
ATOM   471  C  CB  . ILE A 1 60  ? 71.260  51.326 17.791  1.00 21.69 ? 65  ILE A CB  1 
ATOM   472  C  CG1 . ILE A 1 60  ? 70.805  51.505 16.343  1.00 23.20 ? 65  ILE A CG1 1 
ATOM   473  C  CG2 . ILE A 1 60  ? 70.076  51.526 18.729  1.00 23.14 ? 65  ILE A CG2 1 
ATOM   474  C  CD1 . ILE A 1 60  ? 70.122  52.834 16.067  1.00 26.85 ? 65  ILE A CD1 1 
ATOM   475  N  N   . HIS A 1 61  ? 73.714  51.128 19.767  1.00 15.11 ? 66  HIS A N   1 
ATOM   476  C  CA  . HIS A 1 61  ? 74.223  50.786 21.093  1.00 15.96 ? 66  HIS A CA  1 
ATOM   477  C  C   . HIS A 1 61  ? 73.222  50.691 22.244  1.00 16.30 ? 66  HIS A C   1 
ATOM   478  O  O   . HIS A 1 61  ? 73.391  51.344 23.278  1.00 15.66 ? 66  HIS A O   1 
ATOM   479  C  CB  . HIS A 1 61  ? 75.348  51.750 21.482  1.00 14.51 ? 66  HIS A CB  1 
ATOM   480  C  CG  . HIS A 1 61  ? 76.644  51.463 20.788  1.00 15.14 ? 66  HIS A CG  1 
ATOM   481  N  ND1 . HIS A 1 61  ? 77.255  50.229 20.846  1.00 15.80 ? 66  HIS A ND1 1 
ATOM   482  C  CD2 . HIS A 1 61  ? 77.430  52.237 20.002  1.00 15.42 ? 66  HIS A CD2 1 
ATOM   483  C  CE1 . HIS A 1 61  ? 78.361  50.254 20.123  1.00 18.23 ? 66  HIS A CE1 1 
ATOM   484  N  NE2 . HIS A 1 61  ? 78.489  51.460 19.601  1.00 14.41 ? 66  HIS A NE2 1 
ATOM   485  N  N   . GLY A 1 62  ? 72.180  49.886 22.059  1.00 15.26 ? 67  GLY A N   1 
ATOM   486  C  CA  . GLY A 1 62  ? 71.208  49.672 23.116  1.00 16.10 ? 67  GLY A CA  1 
ATOM   487  C  C   . GLY A 1 62  ? 70.353  50.827 23.610  1.00 17.08 ? 67  GLY A C   1 
ATOM   488  O  O   . GLY A 1 62  ? 69.698  50.696 24.647  1.00 17.34 ? 67  GLY A O   1 
ATOM   489  N  N   . GLN A 1 63  ? 70.349  51.948 22.896  1.00 15.27 ? 68  GLN A N   1 
ATOM   490  C  CA  . GLN A 1 63  ? 69.526  53.090 23.302  1.00 16.16 ? 68  GLN A CA  1 
ATOM   491  C  C   . GLN A 1 63  ? 68.179  52.854 22.639  1.00 17.26 ? 68  GLN A C   1 
ATOM   492  O  O   . GLN A 1 63  ? 67.824  53.488 21.642  1.00 18.25 ? 68  GLN A O   1 
ATOM   493  C  CB  . GLN A 1 63  ? 70.169  54.402 22.834  1.00 17.05 ? 68  GLN A CB  1 
ATOM   494  C  CG  . GLN A 1 63  ? 71.559  54.592 23.429  1.00 18.39 ? 68  GLN A CG  1 
ATOM   495  C  CD  . GLN A 1 63  ? 72.180  55.961 23.165  1.00 17.11 ? 68  GLN A CD  1 
ATOM   496  O  OE1 . GLN A 1 63  ? 73.343  56.180 23.488  1.00 19.88 ? 68  GLN A OE1 1 
ATOM   497  N  NE2 . GLN A 1 63  ? 71.412  56.881 22.587  1.00 14.92 ? 68  GLN A NE2 1 
ATOM   498  N  N   . TYR A 1 64  ? 67.446  51.900 23.206  1.00 16.39 ? 69  TYR A N   1 
ATOM   499  C  CA  . TYR A 1 64  ? 66.149  51.483 22.696  1.00 16.88 ? 69  TYR A CA  1 
ATOM   500  C  C   . TYR A 1 64  ? 65.135  52.577 22.410  1.00 16.62 ? 69  TYR A C   1 
ATOM   501  O  O   . TYR A 1 64  ? 64.503  52.572 21.355  1.00 17.12 ? 69  TYR A O   1 
ATOM   502  C  CB  . TYR A 1 64  ? 65.521  50.456 23.643  1.00 15.28 ? 69  TYR A CB  1 
ATOM   503  C  CG  . TYR A 1 64  ? 64.286  49.806 23.065  1.00 16.52 ? 69  TYR A CG  1 
ATOM   504  C  CD1 . TYR A 1 64  ? 64.327  49.181 21.815  1.00 18.52 ? 69  TYR A CD1 1 
ATOM   505  C  CD2 . TYR A 1 64  ? 63.081  49.807 23.763  1.00 13.66 ? 69  TYR A CD2 1 
ATOM   506  C  CE1 . TYR A 1 64  ? 63.191  48.572 21.276  1.00 17.66 ? 69  TYR A CE1 1 
ATOM   507  C  CE2 . TYR A 1 64  ? 61.944  49.203 23.234  1.00 17.06 ? 69  TYR A CE2 1 
ATOM   508  C  CZ  . TYR A 1 64  ? 62.007  48.587 21.993  1.00 17.54 ? 69  TYR A CZ  1 
ATOM   509  O  OH  . TYR A 1 64  ? 60.892  47.976 21.477  1.00 19.75 ? 69  TYR A OH  1 
ATOM   510  N  N   . TYR A 1 65  ? 64.950  53.505 23.340  1.00 18.06 ? 70  TYR A N   1 
ATOM   511  C  CA  . TYR A 1 65  ? 63.974  54.559 23.099  1.00 21.17 ? 70  TYR A CA  1 
ATOM   512  C  C   . TYR A 1 65  ? 64.378  55.492 21.969  1.00 21.49 ? 70  TYR A C   1 
ATOM   513  O  O   . TYR A 1 65  ? 63.522  56.113 21.332  1.00 22.26 ? 70  TYR A O   1 
ATOM   514  C  CB  . TYR A 1 65  ? 63.673  55.310 24.396  1.00 22.72 ? 70  TYR A CB  1 
ATOM   515  C  CG  . TYR A 1 65  ? 62.833  54.449 25.317  1.00 25.56 ? 70  TYR A CG  1 
ATOM   516  C  CD1 . TYR A 1 65  ? 63.378  53.323 25.938  1.00 26.61 ? 70  TYR A CD1 1 
ATOM   517  C  CD2 . TYR A 1 65  ? 61.471  54.695 25.481  1.00 27.33 ? 70  TYR A CD2 1 
ATOM   518  C  CE1 . TYR A 1 65  ? 62.586  52.457 26.692  1.00 28.10 ? 70  TYR A CE1 1 
ATOM   519  C  CE2 . TYR A 1 65  ? 60.669  53.839 26.233  1.00 28.15 ? 70  TYR A CE2 1 
ATOM   520  C  CZ  . TYR A 1 65  ? 61.231  52.722 26.833  1.00 28.87 ? 70  TYR A CZ  1 
ATOM   521  O  OH  . TYR A 1 65  ? 60.438  51.870 27.563  1.00 25.44 ? 70  TYR A OH  1 
ATOM   522  N  N   . ASP A 1 66  ? 65.679  55.567 21.697  1.00 20.36 ? 71  ASP A N   1 
ATOM   523  C  CA  . ASP A 1 66  ? 66.167  56.390 20.596  1.00 19.89 ? 71  ASP A CA  1 
ATOM   524  C  C   . ASP A 1 66  ? 65.916  55.618 19.307  1.00 20.76 ? 71  ASP A C   1 
ATOM   525  O  O   . ASP A 1 66  ? 65.687  56.209 18.252  1.00 20.54 ? 71  ASP A O   1 
ATOM   526  C  CB  . ASP A 1 66  ? 67.654  56.693 20.781  1.00 20.80 ? 71  ASP A CB  1 
ATOM   527  C  CG  . ASP A 1 66  ? 67.898  57.689 21.894  1.00 21.26 ? 71  ASP A CG  1 
ATOM   528  O  OD1 . ASP A 1 66  ? 67.194  58.719 21.913  1.00 22.84 ? 71  ASP A OD1 1 
ATOM   529  O  OD2 . ASP A 1 66  ? 68.781  57.455 22.747  1.00 21.23 ? 71  ASP A OD2 1 
ATOM   530  N  N   . LEU A 1 67  ? 65.938  54.289 19.392  1.00 20.96 ? 72  LEU A N   1 
ATOM   531  C  CA  . LEU A 1 67  ? 65.667  53.469 18.216  1.00 21.80 ? 72  LEU A CA  1 
ATOM   532  C  C   . LEU A 1 67  ? 64.193  53.652 17.865  1.00 22.67 ? 72  LEU A C   1 
ATOM   533  O  O   . LEU A 1 67  ? 63.818  53.688 16.691  1.00 21.37 ? 72  LEU A O   1 
ATOM   534  C  CB  . LEU A 1 67  ? 65.947  51.987 18.498  1.00 22.00 ? 72  LEU A CB  1 
ATOM   535  C  CG  . LEU A 1 67  ? 65.535  51.024 17.377  1.00 21.71 ? 72  LEU A CG  1 
ATOM   536  C  CD1 . LEU A 1 67  ? 66.296  51.354 16.092  1.00 24.02 ? 72  LEU A CD1 1 
ATOM   537  C  CD2 . LEU A 1 67  ? 65.806  49.590 17.809  1.00 21.25 ? 72  LEU A CD2 1 
ATOM   538  N  N   . LEU A 1 68  ? 63.358  53.758 18.895  1.00 23.12 ? 73  LEU A N   1 
ATOM   539  C  CA  . LEU A 1 68  ? 61.928  53.958 18.694  1.00 23.38 ? 73  LEU A CA  1 
ATOM   540  C  C   . LEU A 1 68  ? 61.703  55.342 18.085  1.00 24.75 ? 73  LEU A C   1 
ATOM   541  O  O   . LEU A 1 68  ? 60.819  55.524 17.249  1.00 24.38 ? 73  LEU A O   1 
ATOM   542  C  CB  . LEU A 1 68  ? 61.177  53.840 20.027  1.00 22.20 ? 73  LEU A CB  1 
ATOM   543  C  CG  . LEU A 1 68  ? 61.202  52.445 20.666  1.00 23.13 ? 73  LEU A CG  1 
ATOM   544  C  CD1 . LEU A 1 68  ? 60.377  52.450 21.941  1.00 23.61 ? 73  LEU A CD1 1 
ATOM   545  C  CD2 . LEU A 1 68  ? 60.656  51.418 19.680  1.00 20.19 ? 73  LEU A CD2 1 
ATOM   546  N  N   . ARG A 1 69  ? 62.509  56.315 18.507  1.00 26.56 ? 74  ARG A N   1 
ATOM   547  C  CA  . ARG A 1 69  ? 62.390  57.668 17.971  1.00 28.38 ? 74  ARG A CA  1 
ATOM   548  C  C   . ARG A 1 69  ? 62.757  57.713 16.489  1.00 27.46 ? 74  ARG A C   1 
ATOM   549  O  O   . ARG A 1 69  ? 62.159  58.466 15.721  1.00 26.20 ? 74  ARG A O   1 
ATOM   550  C  CB  . ARG A 1 69  ? 63.278  58.643 18.741  1.00 30.27 ? 74  ARG A CB  1 
ATOM   551  C  CG  . ARG A 1 69  ? 62.722  59.064 20.088  1.00 33.98 ? 74  ARG A CG  1 
ATOM   552  C  CD  . ARG A 1 69  ? 63.263  60.431 20.463  1.00 39.30 ? 74  ARG A CD  1 
ATOM   553  N  NE  . ARG A 1 69  ? 64.709  60.417 20.646  1.00 44.32 ? 74  ARG A NE  1 
ATOM   554  C  CZ  . ARG A 1 69  ? 65.484  61.495 20.573  1.00 45.56 ? 74  ARG A CZ  1 
ATOM   555  N  NH1 . ARG A 1 69  ? 64.957  62.680 20.295  1.00 47.84 ? 74  ARG A NH1 1 
ATOM   556  N  NH2 . ARG A 1 69  ? 66.792  61.383 20.762  1.00 46.10 ? 74  ARG A NH2 1 
ATOM   557  N  N   . LEU A 1 70  ? 63.739  56.909 16.090  1.00 27.00 ? 75  LEU A N   1 
ATOM   558  C  CA  . LEU A 1 70  ? 64.161  56.866 14.693  1.00 28.11 ? 75  LEU A CA  1 
ATOM   559  C  C   . LEU A 1 70  ? 63.013  56.370 13.827  1.00 28.64 ? 75  LEU A C   1 
ATOM   560  O  O   . LEU A 1 70  ? 62.682  56.974 12.803  1.00 27.50 ? 75  LEU A O   1 
ATOM   561  C  CB  . LEU A 1 70  ? 65.364  55.931 14.509  1.00 28.67 ? 75  LEU A CB  1 
ATOM   562  C  CG  . LEU A 1 70  ? 66.721  56.307 15.107  1.00 31.89 ? 75  LEU A CG  1 
ATOM   563  C  CD1 . LEU A 1 70  ? 67.712  55.174 14.839  1.00 30.00 ? 75  LEU A CD1 1 
ATOM   564  C  CD2 . LEU A 1 70  ? 67.224  57.619 14.494  1.00 32.31 ? 75  LEU A CD2 1 
ATOM   565  N  N   . PHE A 1 71  ? 62.406  55.263 14.242  1.00 28.85 ? 76  PHE A N   1 
ATOM   566  C  CA  . PHE A 1 71  ? 61.294  54.689 13.500  1.00 30.99 ? 76  PHE A CA  1 
ATOM   567  C  C   . PHE A 1 71  ? 60.102  55.635 13.441  1.00 33.27 ? 76  PHE A C   1 
ATOM   568  O  O   . PHE A 1 71  ? 59.414  55.713 12.426  1.00 32.72 ? 76  PHE A O   1 
ATOM   569  C  CB  . PHE A 1 71  ? 60.874  53.360 14.128  1.00 29.40 ? 76  PHE A CB  1 
ATOM   570  C  CG  . PHE A 1 71  ? 61.822  52.227 13.838  1.00 27.71 ? 76  PHE A CG  1 
ATOM   571  C  CD1 . PHE A 1 71  ? 62.345  52.053 12.559  1.00 26.50 ? 76  PHE A CD1 1 
ATOM   572  C  CD2 . PHE A 1 71  ? 62.172  51.321 14.837  1.00 24.86 ? 76  PHE A CD2 1 
ATOM   573  C  CE1 . PHE A 1 71  ? 63.204  50.992 12.277  1.00 26.66 ? 76  PHE A CE1 1 
ATOM   574  C  CE2 . PHE A 1 71  ? 63.027  50.260 14.570  1.00 23.99 ? 76  PHE A CE2 1 
ATOM   575  C  CZ  . PHE A 1 71  ? 63.546  50.093 13.285  1.00 24.99 ? 76  PHE A CZ  1 
ATOM   576  N  N   . GLU A 1 72  ? 59.859  56.361 14.525  1.00 36.22 ? 77  GLU A N   1 
ATOM   577  C  CA  . GLU A 1 72  ? 58.734  57.283 14.550  1.00 40.81 ? 77  GLU A CA  1 
ATOM   578  C  C   . GLU A 1 72  ? 58.993  58.484 13.649  1.00 41.65 ? 77  GLU A C   1 
ATOM   579  O  O   . GLU A 1 72  ? 58.058  59.103 13.138  1.00 41.59 ? 77  GLU A O   1 
ATOM   580  C  CB  . GLU A 1 72  ? 58.457  57.744 15.980  1.00 43.94 ? 77  GLU A CB  1 
ATOM   581  C  CG  . GLU A 1 72  ? 57.129  58.463 16.138  1.00 49.91 ? 77  GLU A CG  1 
ATOM   582  C  CD  . GLU A 1 72  ? 56.667  58.509 17.579  1.00 53.45 ? 77  GLU A CD  1 
ATOM   583  O  OE1 . GLU A 1 72  ? 56.495  57.423 18.179  1.00 55.44 ? 77  GLU A OE1 1 
ATOM   584  O  OE2 . GLU A 1 72  ? 56.475  59.625 18.111  1.00 54.35 ? 77  GLU A OE2 1 
ATOM   585  N  N   . TYR A 1 73  ? 60.267  58.804 13.447  1.00 42.80 ? 78  TYR A N   1 
ATOM   586  C  CA  . TYR A 1 73  ? 60.640  59.930 12.604  1.00 44.20 ? 78  TYR A CA  1 
ATOM   587  C  C   . TYR A 1 73  ? 60.779  59.491 11.147  1.00 42.15 ? 78  TYR A C   1 
ATOM   588  O  O   . TYR A 1 73  ? 60.415  60.227 10.231  1.00 42.63 ? 78  TYR A O   1 
ATOM   589  C  CB  . TYR A 1 73  ? 61.956  60.541 13.096  1.00 48.35 ? 78  TYR A CB  1 
ATOM   590  C  CG  . TYR A 1 73  ? 62.250  61.907 12.520  1.00 53.25 ? 78  TYR A CG  1 
ATOM   591  C  CD1 . TYR A 1 73  ? 61.373  62.974 12.725  1.00 55.75 ? 78  TYR A CD1 1 
ATOM   592  C  CD2 . TYR A 1 73  ? 63.404  62.138 11.773  1.00 55.94 ? 78  TYR A CD2 1 
ATOM   593  C  CE1 . TYR A 1 73  ? 61.639  64.239 12.199  1.00 57.54 ? 78  TYR A CE1 1 
ATOM   594  C  CE2 . TYR A 1 73  ? 63.680  63.400 11.241  1.00 57.62 ? 78  TYR A CE2 1 
ATOM   595  C  CZ  . TYR A 1 73  ? 62.795  64.444 11.459  1.00 58.03 ? 78  TYR A CZ  1 
ATOM   596  O  OH  . TYR A 1 73  ? 63.067  65.691 10.943  1.00 58.85 ? 78  TYR A OH  1 
ATOM   597  N  N   . GLY A 1 74  ? 61.296  58.284 10.938  1.00 40.16 ? 79  GLY A N   1 
ATOM   598  C  CA  . GLY A 1 74  ? 61.478  57.783 9.588   1.00 36.33 ? 79  GLY A CA  1 
ATOM   599  C  C   . GLY A 1 74  ? 60.346  56.903 9.094   1.00 35.47 ? 79  GLY A C   1 
ATOM   600  O  O   . GLY A 1 74  ? 60.248  56.622 7.897   1.00 33.16 ? 79  GLY A O   1 
ATOM   601  N  N   . GLY A 1 75  ? 59.492  56.463 10.014  1.00 34.85 ? 80  GLY A N   1 
ATOM   602  C  CA  . GLY A 1 75  ? 58.373  55.612 9.646   1.00 34.15 ? 80  GLY A CA  1 
ATOM   603  C  C   . GLY A 1 75  ? 58.585  54.160 10.036  1.00 33.95 ? 80  GLY A C   1 
ATOM   604  O  O   . GLY A 1 75  ? 59.551  53.530 9.605   1.00 34.27 ? 80  GLY A O   1 
ATOM   605  N  N   . PHE A 1 76  ? 57.688  53.622 10.855  1.00 32.87 ? 81  PHE A N   1 
ATOM   606  C  CA  . PHE A 1 76  ? 57.801  52.232 11.287  1.00 32.39 ? 81  PHE A CA  1 
ATOM   607  C  C   . PHE A 1 76  ? 57.648  51.275 10.119  1.00 32.32 ? 81  PHE A C   1 
ATOM   608  O  O   . PHE A 1 76  ? 56.816  51.487 9.236   1.00 32.72 ? 81  PHE A O   1 
ATOM   609  C  CB  . PHE A 1 76  ? 56.743  51.894 12.345  1.00 31.13 ? 81  PHE A CB  1 
ATOM   610  C  CG  . PHE A 1 76  ? 57.059  52.430 13.716  1.00 31.69 ? 81  PHE A CG  1 
ATOM   611  C  CD1 . PHE A 1 76  ? 56.790  53.755 14.042  1.00 30.79 ? 81  PHE A CD1 1 
ATOM   612  C  CD2 . PHE A 1 76  ? 57.656  51.610 14.673  1.00 28.99 ? 81  PHE A CD2 1 
ATOM   613  C  CE1 . PHE A 1 76  ? 57.114  54.259 15.306  1.00 31.68 ? 81  PHE A CE1 1 
ATOM   614  C  CE2 . PHE A 1 76  ? 57.984  52.100 15.933  1.00 29.46 ? 81  PHE A CE2 1 
ATOM   615  C  CZ  . PHE A 1 76  ? 57.713  53.427 16.253  1.00 31.36 ? 81  PHE A CZ  1 
ATOM   616  N  N   . PRO A 1 77  ? 58.460  50.208 10.088  1.00 31.85 ? 82  PRO A N   1 
ATOM   617  C  CA  . PRO A 1 77  ? 58.341  49.256 8.983   1.00 32.65 ? 82  PRO A CA  1 
ATOM   618  C  C   . PRO A 1 77  ? 56.897  48.746 8.948   1.00 33.91 ? 82  PRO A C   1 
ATOM   619  O  O   . PRO A 1 77  ? 56.246  48.644 9.987   1.00 32.86 ? 82  PRO A O   1 
ATOM   620  C  CB  . PRO A 1 77  ? 59.338  48.163 9.366   1.00 32.43 ? 82  PRO A CB  1 
ATOM   621  C  CG  . PRO A 1 77  ? 60.397  48.926 10.116  1.00 31.39 ? 82  PRO A CG  1 
ATOM   622  C  CD  . PRO A 1 77  ? 59.575  49.848 10.983  1.00 31.76 ? 82  PRO A CD  1 
ATOM   623  N  N   . PRO A 1 78  ? 56.379  48.420 7.756   1.00 35.33 ? 83  PRO A N   1 
ATOM   624  C  CA  . PRO A 1 78  ? 57.043  48.490 6.454   1.00 36.38 ? 83  PRO A CA  1 
ATOM   625  C  C   . PRO A 1 78  ? 56.862  49.819 5.707   1.00 37.39 ? 83  PRO A C   1 
ATOM   626  O  O   . PRO A 1 78  ? 57.038  49.867 4.489   1.00 37.83 ? 83  PRO A O   1 
ATOM   627  C  CB  . PRO A 1 78  ? 56.414  47.329 5.704   1.00 36.68 ? 83  PRO A CB  1 
ATOM   628  C  CG  . PRO A 1 78  ? 54.992  47.423 6.153   1.00 36.52 ? 83  PRO A CG  1 
ATOM   629  C  CD  . PRO A 1 78  ? 55.117  47.664 7.652   1.00 35.42 ? 83  PRO A CD  1 
ATOM   630  N  N   . GLU A 1 79  ? 56.509  50.884 6.426   1.00 37.27 ? 84  GLU A N   1 
ATOM   631  C  CA  . GLU A 1 79  ? 56.321  52.197 5.802   1.00 38.07 ? 84  GLU A CA  1 
ATOM   632  C  C   . GLU A 1 79  ? 57.573  52.578 5.021   1.00 37.39 ? 84  GLU A C   1 
ATOM   633  O  O   . GLU A 1 79  ? 57.493  53.124 3.918   1.00 37.39 ? 84  GLU A O   1 
ATOM   634  C  CB  . GLU A 1 79  ? 56.069  53.277 6.856   1.00 41.01 ? 84  GLU A CB  1 
ATOM   635  C  CG  . GLU A 1 79  ? 54.810  53.115 7.683   1.00 47.46 ? 84  GLU A CG  1 
ATOM   636  C  CD  . GLU A 1 79  ? 54.618  54.277 8.642   1.00 50.59 ? 84  GLU A CD  1 
ATOM   637  O  OE1 . GLU A 1 79  ? 54.496  55.425 8.161   1.00 52.45 ? 84  GLU A OE1 1 
ATOM   638  O  OE2 . GLU A 1 79  ? 54.598  54.049 9.873   1.00 51.81 ? 84  GLU A OE2 1 
ATOM   639  N  N   . SER A 1 80  ? 58.728  52.298 5.615   1.00 35.03 ? 85  SER A N   1 
ATOM   640  C  CA  . SER A 1 80  ? 60.014  52.593 4.998   1.00 33.61 ? 85  SER A CA  1 
ATOM   641  C  C   . SER A 1 80  ? 60.908  51.359 5.052   1.00 32.25 ? 85  SER A C   1 
ATOM   642  O  O   . SER A 1 80  ? 60.698  50.458 5.866   1.00 30.47 ? 85  SER A O   1 
ATOM   643  C  CB  . SER A 1 80  ? 60.714  53.740 5.732   1.00 34.05 ? 85  SER A CB  1 
ATOM   644  O  OG  . SER A 1 80  ? 59.911  54.905 5.786   1.00 34.34 ? 85  SER A OG  1 
ATOM   645  N  N   . ASN A 1 81  ? 61.899  51.322 4.172   1.00 31.34 ? 86  ASN A N   1 
ATOM   646  C  CA  . ASN A 1 81  ? 62.846  50.219 4.135   1.00 31.11 ? 86  ASN A CA  1 
ATOM   647  C  C   . ASN A 1 81  ? 64.048  50.713 4.920   1.00 29.83 ? 86  ASN A C   1 
ATOM   648  O  O   . ASN A 1 81  ? 64.382  51.897 4.863   1.00 29.51 ? 86  ASN A O   1 
ATOM   649  C  CB  . ASN A 1 81  ? 63.239  49.908 2.695   1.00 31.23 ? 86  ASN A CB  1 
ATOM   650  C  CG  . ASN A 1 81  ? 62.039  49.628 1.821   1.00 33.57 ? 86  ASN A CG  1 
ATOM   651  O  OD1 . ASN A 1 81  ? 61.323  48.647 2.027   1.00 33.31 ? 86  ASN A OD1 1 
ATOM   652  N  ND2 . ASN A 1 81  ? 61.806  50.494 0.841   1.00 35.09 ? 86  ASN A ND2 1 
ATOM   653  N  N   . TYR A 1 82  ? 64.698  49.817 5.652   1.00 27.93 ? 87  TYR A N   1 
ATOM   654  C  CA  . TYR A 1 82  ? 65.838  50.215 6.457   1.00 24.04 ? 87  TYR A CA  1 
ATOM   655  C  C   . TYR A 1 82  ? 67.092  49.389 6.273   1.00 23.43 ? 87  TYR A C   1 
ATOM   656  O  O   . TYR A 1 82  ? 67.040  48.204 5.949   1.00 21.39 ? 87  TYR A O   1 
ATOM   657  C  CB  . TYR A 1 82  ? 65.480  50.179 7.948   1.00 25.01 ? 87  TYR A CB  1 
ATOM   658  C  CG  . TYR A 1 82  ? 64.569  51.288 8.424   1.00 24.42 ? 87  TYR A CG  1 
ATOM   659  C  CD1 . TYR A 1 82  ? 63.182  51.154 8.371   1.00 23.40 ? 87  TYR A CD1 1 
ATOM   660  C  CD2 . TYR A 1 82  ? 65.098  52.474 8.931   1.00 23.76 ? 87  TYR A CD2 1 
ATOM   661  C  CE1 . TYR A 1 82  ? 62.347  52.174 8.815   1.00 22.72 ? 87  TYR A CE1 1 
ATOM   662  C  CE2 . TYR A 1 82  ? 64.272  53.497 9.374   1.00 23.36 ? 87  TYR A CE2 1 
ATOM   663  C  CZ  . TYR A 1 82  ? 62.897  53.342 9.314   1.00 23.80 ? 87  TYR A CZ  1 
ATOM   664  O  OH  . TYR A 1 82  ? 62.077  54.363 9.745   1.00 24.03 ? 87  TYR A OH  1 
ATOM   665  N  N   . LEU A 1 83  ? 68.226  50.048 6.484   1.00 22.23 ? 88  LEU A N   1 
ATOM   666  C  CA  . LEU A 1 83  ? 69.526  49.401 6.444   1.00 20.05 ? 88  LEU A CA  1 
ATOM   667  C  C   . LEU A 1 83  ? 70.266  49.967 7.644   1.00 17.99 ? 88  LEU A C   1 
ATOM   668  O  O   . LEU A 1 83  ? 70.452  51.179 7.746   1.00 20.05 ? 88  LEU A O   1 
ATOM   669  C  CB  . LEU A 1 83  ? 70.302  49.723 5.162   1.00 19.51 ? 88  LEU A CB  1 
ATOM   670  C  CG  . LEU A 1 83  ? 71.783  49.313 5.248   1.00 20.71 ? 88  LEU A CG  1 
ATOM   671  C  CD1 . LEU A 1 83  ? 71.893  47.806 5.432   1.00 18.99 ? 88  LEU A CD1 1 
ATOM   672  C  CD2 . LEU A 1 83  ? 72.537  49.748 3.989   1.00 20.48 ? 88  LEU A CD2 1 
ATOM   673  N  N   . PHE A 1 84  ? 70.642  49.095 8.573   1.00 17.78 ? 89  PHE A N   1 
ATOM   674  C  CA  . PHE A 1 84  ? 71.385  49.512 9.754   1.00 15.64 ? 89  PHE A CA  1 
ATOM   675  C  C   . PHE A 1 84  ? 72.809  49.032 9.540   1.00 17.98 ? 89  PHE A C   1 
ATOM   676  O  O   . PHE A 1 84  ? 73.032  47.948 8.989   1.00 17.35 ? 89  PHE A O   1 
ATOM   677  C  CB  . PHE A 1 84  ? 70.791  48.903 11.028  1.00 16.34 ? 89  PHE A CB  1 
ATOM   678  C  CG  . PHE A 1 84  ? 69.480  49.513 11.434  1.00 15.56 ? 89  PHE A CG  1 
ATOM   679  C  CD1 . PHE A 1 84  ? 68.301  49.155 10.788  1.00 17.44 ? 89  PHE A CD1 1 
ATOM   680  C  CD2 . PHE A 1 84  ? 69.426  50.460 12.454  1.00 16.90 ? 89  PHE A CD2 1 
ATOM   681  C  CE1 . PHE A 1 84  ? 67.076  49.732 11.155  1.00 17.51 ? 89  PHE A CE1 1 
ATOM   682  C  CE2 . PHE A 1 84  ? 68.206  51.046 12.827  1.00 18.11 ? 89  PHE A CE2 1 
ATOM   683  C  CZ  . PHE A 1 84  ? 67.031  50.678 12.176  1.00 14.78 ? 89  PHE A CZ  1 
ATOM   684  N  N   . LEU A 1 85  ? 73.768  49.836 9.985   1.00 15.90 ? 90  LEU A N   1 
ATOM   685  C  CA  . LEU A 1 85  ? 75.175  49.534 9.774   1.00 16.08 ? 90  LEU A CA  1 
ATOM   686  C  C   . LEU A 1 85  ? 75.911  48.846 10.915  1.00 12.60 ? 90  LEU A C   1 
ATOM   687  O  O   . LEU A 1 85  ? 77.133  48.758 10.881  1.00 16.18 ? 90  LEU A O   1 
ATOM   688  C  CB  . LEU A 1 85  ? 75.916  50.824 9.400   1.00 13.73 ? 90  LEU A CB  1 
ATOM   689  C  CG  . LEU A 1 85  ? 75.322  51.612 8.221   1.00 15.97 ? 90  LEU A CG  1 
ATOM   690  C  CD1 . LEU A 1 85  ? 76.100  52.905 8.029   1.00 16.24 ? 90  LEU A CD1 1 
ATOM   691  C  CD2 . LEU A 1 85  ? 75.367  50.767 6.958   1.00 16.87 ? 90  LEU A CD2 1 
ATOM   692  N  N   . GLY A 1 86  ? 75.193  48.374 11.926  1.00 13.53 ? 91  GLY A N   1 
ATOM   693  C  CA  . GLY A 1 86  ? 75.867  47.681 13.017  1.00 13.07 ? 91  GLY A CA  1 
ATOM   694  C  C   . GLY A 1 86  ? 75.918  48.359 14.371  1.00 16.16 ? 91  GLY A C   1 
ATOM   695  O  O   . GLY A 1 86  ? 75.379  49.454 14.561  1.00 15.56 ? 91  GLY A O   1 
ATOM   696  N  N   . ASP A 1 87  ? 76.587  47.699 15.317  1.00 14.58 ? 92  ASP A N   1 
ATOM   697  C  CA  . ASP A 1 87  ? 76.721  48.197 16.681  1.00 13.96 ? 92  ASP A CA  1 
ATOM   698  C  C   . ASP A 1 87  ? 75.364  48.444 17.325  1.00 14.53 ? 92  ASP A C   1 
ATOM   699  O  O   . ASP A 1 87  ? 75.034  49.564 17.727  1.00 15.40 ? 92  ASP A O   1 
ATOM   700  C  CB  . ASP A 1 87  ? 77.571  49.466 16.710  1.00 13.70 ? 92  ASP A CB  1 
ATOM   701  C  CG  . ASP A 1 87  ? 79.056  49.166 16.614  1.00 16.95 ? 92  ASP A CG  1 
ATOM   702  O  OD1 . ASP A 1 87  ? 79.418  47.992 16.371  1.00 12.97 ? 92  ASP A OD1 1 
ATOM   703  O  OD2 . ASP A 1 87  ? 79.862  50.099 16.784  1.00 10.89 ? 92  ASP A OD2 1 
ATOM   704  N  N   . TYR A 1 88  ? 74.591  47.366 17.422  1.00 15.31 ? 93  TYR A N   1 
ATOM   705  C  CA  . TYR A 1 88  ? 73.254  47.381 18.003  1.00 14.06 ? 93  TYR A CA  1 
ATOM   706  C  C   . TYR A 1 88  ? 73.289  47.213 19.515  1.00 13.85 ? 93  TYR A C   1 
ATOM   707  O  O   . TYR A 1 88  ? 72.385  47.673 20.217  1.00 16.05 ? 93  TYR A O   1 
ATOM   708  C  CB  . TYR A 1 88  ? 72.433  46.236 17.414  1.00 13.34 ? 93  TYR A CB  1 
ATOM   709  C  CG  . TYR A 1 88  ? 72.512  46.165 15.916  1.00 10.64 ? 93  TYR A CG  1 
ATOM   710  C  CD1 . TYR A 1 88  ? 72.024  47.203 15.125  1.00 10.35 ? 93  TYR A CD1 1 
ATOM   711  C  CD2 . TYR A 1 88  ? 73.103  45.074 15.285  1.00 9.52  ? 93  TYR A CD2 1 
ATOM   712  C  CE1 . TYR A 1 88  ? 72.126  47.159 13.734  1.00 12.70 ? 93  TYR A CE1 1 
ATOM   713  C  CE2 . TYR A 1 88  ? 73.215  45.019 13.894  1.00 10.67 ? 93  TYR A CE2 1 
ATOM   714  C  CZ  . TYR A 1 88  ? 72.726  46.066 13.127  1.00 12.77 ? 93  TYR A CZ  1 
ATOM   715  O  OH  . TYR A 1 88  ? 72.855  46.025 11.758  1.00 14.46 ? 93  TYR A OH  1 
ATOM   716  N  N   . VAL A 1 89  ? 74.327  46.546 20.011  1.00 15.31 ? 94  VAL A N   1 
ATOM   717  C  CA  . VAL A 1 89  ? 74.459  46.285 21.445  1.00 15.49 ? 94  VAL A CA  1 
ATOM   718  C  C   . VAL A 1 89  ? 75.668  46.949 22.097  1.00 16.31 ? 94  VAL A C   1 
ATOM   719  O  O   . VAL A 1 89  ? 76.501  47.552 21.417  1.00 16.77 ? 94  VAL A O   1 
ATOM   720  C  CB  . VAL A 1 89  ? 74.540  44.770 21.706  1.00 15.43 ? 94  VAL A CB  1 
ATOM   721  C  CG1 . VAL A 1 89  ? 73.329  44.066 21.072  1.00 16.85 ? 94  VAL A CG1 1 
ATOM   722  C  CG2 . VAL A 1 89  ? 75.843  44.205 21.123  1.00 16.65 ? 94  VAL A CG2 1 
ATOM   723  N  N   . ASP A 1 90  ? 75.753  46.815 23.422  1.00 13.95 ? 95  ASP A N   1 
ATOM   724  C  CA  . ASP A 1 90  ? 76.833  47.380 24.222  1.00 16.34 ? 95  ASP A CA  1 
ATOM   725  C  C   . ASP A 1 90  ? 76.641  48.856 24.529  1.00 18.99 ? 95  ASP A C   1 
ATOM   726  O  O   . ASP A 1 90  ? 76.058  49.603 23.737  1.00 18.41 ? 95  ASP A O   1 
ATOM   727  C  CB  . ASP A 1 90  ? 78.191  47.189 23.534  1.00 15.48 ? 95  ASP A CB  1 
ATOM   728  C  CG  . ASP A 1 90  ? 78.701  45.755 23.624  1.00 16.47 ? 95  ASP A CG  1 
ATOM   729  O  OD1 . ASP A 1 90  ? 78.153  44.967 24.431  1.00 16.04 ? 95  ASP A OD1 1 
ATOM   730  O  OD2 . ASP A 1 90  ? 79.655  45.419 22.892  1.00 15.69 ? 95  ASP A OD2 1 
ATOM   731  N  N   . ARG A 1 91  ? 77.145  49.255 25.693  1.00 19.46 ? 96  ARG A N   1 
ATOM   732  C  CA  . ARG A 1 91  ? 77.096  50.633 26.159  1.00 23.38 ? 96  ARG A CA  1 
ATOM   733  C  C   . ARG A 1 91  ? 75.718  51.144 26.579  1.00 24.40 ? 96  ARG A C   1 
ATOM   734  O  O   . ARG A 1 91  ? 75.575  51.719 27.660  1.00 26.71 ? 96  ARG A O   1 
ATOM   735  C  CB  . ARG A 1 91  ? 77.717  51.555 25.103  1.00 25.94 ? 96  ARG A CB  1 
ATOM   736  C  CG  . ARG A 1 91  ? 79.210  51.304 24.880  1.00 29.25 ? 96  ARG A CG  1 
ATOM   737  C  CD  . ARG A 1 91  ? 79.933  51.239 26.224  1.00 33.95 ? 96  ARG A CD  1 
ATOM   738  N  NE  . ARG A 1 91  ? 81.323  51.681 26.161  1.00 36.30 ? 96  ARG A NE  1 
ATOM   739  C  CZ  . ARG A 1 91  ? 82.097  51.841 27.232  1.00 38.60 ? 96  ARG A CZ  1 
ATOM   740  N  NH1 . ARG A 1 91  ? 81.615  51.591 28.445  1.00 39.50 ? 96  ARG A NH1 1 
ATOM   741  N  NH2 . ARG A 1 91  ? 83.345  52.265 27.095  1.00 38.93 ? 96  ARG A NH2 1 
ATOM   742  N  N   . GLY A 1 92  ? 74.708  50.935 25.743  1.00 23.48 ? 97  GLY A N   1 
ATOM   743  C  CA  . GLY A 1 92  ? 73.369  51.384 26.090  1.00 24.02 ? 97  GLY A CA  1 
ATOM   744  C  C   . GLY A 1 92  ? 72.803  50.569 27.237  1.00 24.42 ? 97  GLY A C   1 
ATOM   745  O  O   . GLY A 1 92  ? 73.407  49.578 27.656  1.00 23.62 ? 97  GLY A O   1 
ATOM   746  N  N   . LYS A 1 93  ? 71.641  50.972 27.741  1.00 22.85 ? 98  LYS A N   1 
ATOM   747  C  CA  . LYS A 1 93  ? 71.016  50.270 28.858  1.00 23.28 ? 98  LYS A CA  1 
ATOM   748  C  C   . LYS A 1 93  ? 70.031  49.200 28.414  1.00 21.30 ? 98  LYS A C   1 
ATOM   749  O  O   . LYS A 1 93  ? 69.617  48.368 29.214  1.00 20.50 ? 98  LYS A O   1 
ATOM   750  C  CB  . LYS A 1 93  ? 70.294  51.269 29.764  1.00 28.64 ? 98  LYS A CB  1 
ATOM   751  C  CG  . LYS A 1 93  ? 71.196  52.372 30.296  1.00 33.31 ? 98  LYS A CG  1 
ATOM   752  C  CD  . LYS A 1 93  ? 70.427  53.373 31.139  1.00 35.83 ? 98  LYS A CD  1 
ATOM   753  C  CE  . LYS A 1 93  ? 71.319  54.547 31.509  1.00 38.94 ? 98  LYS A CE  1 
ATOM   754  N  NZ  . LYS A 1 93  ? 72.623  54.088 32.076  1.00 40.68 ? 98  LYS A NZ  1 
ATOM   755  N  N   . GLN A 1 94  ? 69.645  49.224 27.143  1.00 18.57 ? 99  GLN A N   1 
ATOM   756  C  CA  . GLN A 1 94  ? 68.696  48.234 26.649  1.00 18.69 ? 99  GLN A CA  1 
ATOM   757  C  C   . GLN A 1 94  ? 69.085  47.599 25.322  1.00 17.08 ? 99  GLN A C   1 
ATOM   758  O  O   . GLN A 1 94  ? 68.379  47.731 24.326  1.00 15.58 ? 99  GLN A O   1 
ATOM   759  C  CB  . GLN A 1 94  ? 67.293  48.844 26.553  1.00 16.60 ? 99  GLN A CB  1 
ATOM   760  C  CG  . GLN A 1 94  ? 66.615  49.008 27.921  1.00 20.79 ? 99  GLN A CG  1 
ATOM   761  C  CD  . GLN A 1 94  ? 65.272  49.718 27.834  1.00 21.41 ? 99  GLN A CD  1 
ATOM   762  O  OE1 . GLN A 1 94  ? 65.207  50.911 27.537  1.00 21.72 ? 99  GLN A OE1 1 
ATOM   763  N  NE2 . GLN A 1 94  ? 64.193  48.981 28.085  1.00 17.66 ? 99  GLN A NE2 1 
ATOM   764  N  N   . SER A 1 95  ? 70.213  46.899 25.323  1.00 16.99 ? 100 SER A N   1 
ATOM   765  C  CA  . SER A 1 95  ? 70.675  46.204 24.131  1.00 15.73 ? 100 SER A CA  1 
ATOM   766  C  C   . SER A 1 95  ? 69.689  45.097 23.746  1.00 14.88 ? 100 SER A C   1 
ATOM   767  O  O   . SER A 1 95  ? 69.443  44.864 22.568  1.00 15.82 ? 100 SER A O   1 
ATOM   768  C  CB  . SER A 1 95  ? 72.057  45.585 24.378  1.00 15.13 ? 100 SER A CB  1 
ATOM   769  O  OG  . SER A 1 95  ? 73.057  46.585 24.497  1.00 17.24 ? 100 SER A OG  1 
ATOM   770  N  N   . LEU A 1 96  ? 69.121  44.419 24.744  1.00 15.35 ? 101 LEU A N   1 
ATOM   771  C  CA  . LEU A 1 96  ? 68.192  43.328 24.472  1.00 15.05 ? 101 LEU A CA  1 
ATOM   772  C  C   . LEU A 1 96  ? 66.948  43.761 23.705  1.00 13.90 ? 101 LEU A C   1 
ATOM   773  O  O   . LEU A 1 96  ? 66.624  43.169 22.677  1.00 14.82 ? 101 LEU A O   1 
ATOM   774  C  CB  . LEU A 1 96  ? 67.809  42.618 25.779  1.00 17.01 ? 101 LEU A CB  1 
ATOM   775  C  CG  . LEU A 1 96  ? 68.928  41.732 26.343  1.00 16.89 ? 101 LEU A CG  1 
ATOM   776  C  CD1 . LEU A 1 96  ? 68.682  41.422 27.813  1.00 19.38 ? 101 LEU A CD1 1 
ATOM   777  C  CD2 . LEU A 1 96  ? 69.020  40.449 25.521  1.00 17.91 ? 101 LEU A CD2 1 
ATOM   778  N  N   . GLU A 1 97  ? 66.244  44.778 24.192  1.00 15.20 ? 102 GLU A N   1 
ATOM   779  C  CA  . GLU A 1 97  ? 65.053  45.252 23.484  1.00 14.68 ? 102 GLU A CA  1 
ATOM   780  C  C   . GLU A 1 97  ? 65.450  45.713 22.083  1.00 15.51 ? 102 GLU A C   1 
ATOM   781  O  O   . GLU A 1 97  ? 64.775  45.412 21.094  1.00 15.43 ? 102 GLU A O   1 
ATOM   782  C  CB  . GLU A 1 97  ? 64.391  46.415 24.237  1.00 15.04 ? 102 GLU A CB  1 
ATOM   783  C  CG  . GLU A 1 97  ? 63.596  45.997 25.470  1.00 17.50 ? 102 GLU A CG  1 
ATOM   784  C  CD  . GLU A 1 97  ? 64.439  45.896 26.738  1.00 18.66 ? 102 GLU A CD  1 
ATOM   785  O  OE1 . GLU A 1 97  ? 65.686  45.829 26.642  1.00 17.06 ? 102 GLU A OE1 1 
ATOM   786  O  OE2 . GLU A 1 97  ? 63.842  45.875 27.838  1.00 16.19 ? 102 GLU A OE2 1 
ATOM   787  N  N   . THR A 1 98  ? 66.562  46.435 22.012  1.00 14.68 ? 103 THR A N   1 
ATOM   788  C  CA  . THR A 1 98  ? 67.072  46.957 20.751  1.00 14.10 ? 103 THR A CA  1 
ATOM   789  C  C   . THR A 1 98  ? 67.300  45.866 19.711  1.00 14.90 ? 103 THR A C   1 
ATOM   790  O  O   . THR A 1 98  ? 66.698  45.884 18.637  1.00 14.58 ? 103 THR A O   1 
ATOM   791  C  CB  . THR A 1 98  ? 68.399  47.731 20.983  1.00 15.55 ? 103 THR A CB  1 
ATOM   792  O  OG1 . THR A 1 98  ? 68.137  48.911 21.759  1.00 17.19 ? 103 THR A OG1 1 
ATOM   793  C  CG2 . THR A 1 98  ? 69.041  48.127 19.651  1.00 13.00 ? 103 THR A CG2 1 
ATOM   794  N  N   . ILE A 1 99  ? 68.164  44.907 20.030  1.00 14.26 ? 104 ILE A N   1 
ATOM   795  C  CA  . ILE A 1 99  ? 68.459  43.844 19.085  1.00 14.34 ? 104 ILE A CA  1 
ATOM   796  C  C   . ILE A 1 99  ? 67.242  42.964 18.770  1.00 14.23 ? 104 ILE A C   1 
ATOM   797  O  O   . ILE A 1 99  ? 67.067  42.533 17.630  1.00 13.94 ? 104 ILE A O   1 
ATOM   798  C  CB  . ILE A 1 99  ? 69.649  42.969 19.584  1.00 15.39 ? 104 ILE A CB  1 
ATOM   799  C  CG1 . ILE A 1 99  ? 70.058  41.989 18.487  1.00 15.88 ? 104 ILE A CG1 1 
ATOM   800  C  CG2 . ILE A 1 99  ? 69.279  42.235 20.861  1.00 15.47 ? 104 ILE A CG2 1 
ATOM   801  C  CD1 . ILE A 1 99  ? 70.494  42.672 17.199  1.00 17.31 ? 104 ILE A CD1 1 
ATOM   802  N  N   . CYS A 1 100 ? 66.393  42.710 19.764  1.00 13.64 ? 105 CYS A N   1 
ATOM   803  C  CA  . CYS A 1 100 ? 65.205  41.890 19.537  1.00 14.02 ? 105 CYS A CA  1 
ATOM   804  C  C   . CYS A 1 100 ? 64.232  42.538 18.545  1.00 14.47 ? 105 CYS A C   1 
ATOM   805  O  O   . CYS A 1 100 ? 63.696  41.863 17.665  1.00 16.23 ? 105 CYS A O   1 
ATOM   806  C  CB  . CYS A 1 100 ? 64.494  41.598 20.860  1.00 13.49 ? 105 CYS A CB  1 
ATOM   807  S  SG  . CYS A 1 100 ? 65.357  40.367 21.877  1.00 19.19 ? 105 CYS A SG  1 
ATOM   808  N  N   . LEU A 1 101 ? 64.008  43.841 18.677  1.00 15.25 ? 106 LEU A N   1 
ATOM   809  C  CA  . LEU A 1 101 ? 63.107  44.533 17.756  1.00 17.60 ? 106 LEU A CA  1 
ATOM   810  C  C   . LEU A 1 101 ? 63.670  44.455 16.339  1.00 16.65 ? 106 LEU A C   1 
ATOM   811  O  O   . LEU A 1 101 ? 62.947  44.186 15.385  1.00 18.20 ? 106 LEU A O   1 
ATOM   812  C  CB  . LEU A 1 101 ? 62.929  46.002 18.160  1.00 17.47 ? 106 LEU A CB  1 
ATOM   813  C  CG  . LEU A 1 101 ? 62.015  46.821 17.233  1.00 19.85 ? 106 LEU A CG  1 
ATOM   814  C  CD1 . LEU A 1 101 ? 60.649  46.138 17.122  1.00 16.63 ? 106 LEU A CD1 1 
ATOM   815  C  CD2 . LEU A 1 101 ? 61.861  48.244 17.770  1.00 17.91 ? 106 LEU A CD2 1 
ATOM   816  N  N   . LEU A 1 102 ? 64.972  44.679 16.207  1.00 17.91 ? 107 LEU A N   1 
ATOM   817  C  CA  . LEU A 1 102 ? 65.619  44.633 14.901  1.00 16.36 ? 107 LEU A CA  1 
ATOM   818  C  C   . LEU A 1 102 ? 65.533  43.243 14.274  1.00 15.05 ? 107 LEU A C   1 
ATOM   819  O  O   . LEU A 1 102 ? 65.184  43.106 13.099  1.00 15.79 ? 107 LEU A O   1 
ATOM   820  C  CB  . LEU A 1 102 ? 67.077  45.081 15.028  1.00 15.68 ? 107 LEU A CB  1 
ATOM   821  C  CG  . LEU A 1 102 ? 67.256  46.528 15.508  1.00 15.97 ? 107 LEU A CG  1 
ATOM   822  C  CD1 . LEU A 1 102 ? 68.730  46.806 15.771  1.00 16.39 ? 107 LEU A CD1 1 
ATOM   823  C  CD2 . LEU A 1 102 ? 66.719  47.501 14.459  1.00 14.64 ? 107 LEU A CD2 1 
ATOM   824  N  N   . LEU A 1 103 ? 65.859  42.208 15.042  1.00 15.54 ? 108 LEU A N   1 
ATOM   825  C  CA  . LEU A 1 103 ? 65.770  40.851 14.507  1.00 16.62 ? 108 LEU A CA  1 
ATOM   826  C  C   . LEU A 1 103 ? 64.317  40.533 14.152  1.00 15.73 ? 108 LEU A C   1 
ATOM   827  O  O   . LEU A 1 103 ? 64.041  39.898 13.130  1.00 16.67 ? 108 LEU A O   1 
ATOM   828  C  CB  . LEU A 1 103 ? 66.295  39.825 15.516  1.00 16.00 ? 108 LEU A CB  1 
ATOM   829  C  CG  . LEU A 1 103 ? 67.786  39.913 15.866  1.00 13.23 ? 108 LEU A CG  1 
ATOM   830  C  CD1 . LEU A 1 103 ? 68.174  38.745 16.772  1.00 16.02 ? 108 LEU A CD1 1 
ATOM   831  C  CD2 . LEU A 1 103 ? 68.614  39.883 14.586  1.00 15.90 ? 108 LEU A CD2 1 
ATOM   832  N  N   . ALA A 1 104 ? 63.395  40.988 14.996  1.00 17.54 ? 109 ALA A N   1 
ATOM   833  C  CA  . ALA A 1 104 ? 61.967  40.759 14.779  1.00 18.97 ? 109 ALA A CA  1 
ATOM   834  C  C   . ALA A 1 104 ? 61.523  41.352 13.444  1.00 20.87 ? 109 ALA A C   1 
ATOM   835  O  O   . ALA A 1 104 ? 60.784  40.716 12.693  1.00 21.95 ? 109 ALA A O   1 
ATOM   836  C  CB  . ALA A 1 104 ? 61.165  41.371 15.913  1.00 18.16 ? 109 ALA A CB  1 
ATOM   837  N  N   . TYR A 1 105 ? 61.966  42.574 13.154  1.00 20.54 ? 110 TYR A N   1 
ATOM   838  C  CA  . TYR A 1 105 ? 61.605  43.218 11.894  1.00 22.21 ? 110 TYR A CA  1 
ATOM   839  C  C   . TYR A 1 105 ? 62.284  42.545 10.707  1.00 22.43 ? 110 TYR A C   1 
ATOM   840  O  O   . TYR A 1 105 ? 61.723  42.499 9.613   1.00 23.88 ? 110 TYR A O   1 
ATOM   841  C  CB  . TYR A 1 105 ? 61.964  44.708 11.912  1.00 22.14 ? 110 TYR A CB  1 
ATOM   842  C  CG  . TYR A 1 105 ? 60.924  45.595 12.568  1.00 22.83 ? 110 TYR A CG  1 
ATOM   843  C  CD1 . TYR A 1 105 ? 59.561  45.403 12.328  1.00 23.22 ? 110 TYR A CD1 1 
ATOM   844  C  CD2 . TYR A 1 105 ? 61.305  46.672 13.373  1.00 24.18 ? 110 TYR A CD2 1 
ATOM   845  C  CE1 . TYR A 1 105 ? 58.601  46.266 12.869  1.00 21.90 ? 110 TYR A CE1 1 
ATOM   846  C  CE2 . TYR A 1 105 ? 60.350  47.541 13.917  1.00 24.89 ? 110 TYR A CE2 1 
ATOM   847  C  CZ  . TYR A 1 105 ? 59.003  47.329 13.655  1.00 22.20 ? 110 TYR A CZ  1 
ATOM   848  O  OH  . TYR A 1 105 ? 58.065  48.194 14.164  1.00 23.93 ? 110 TYR A OH  1 
ATOM   849  N  N   . LYS A 1 106 ? 63.489  42.024 10.916  1.00 22.86 ? 111 LYS A N   1 
ATOM   850  C  CA  . LYS A 1 106 ? 64.201  41.345 9.838   1.00 22.67 ? 111 LYS A CA  1 
ATOM   851  C  C   . LYS A 1 106 ? 63.422  40.099 9.428   1.00 23.69 ? 111 LYS A C   1 
ATOM   852  O  O   . LYS A 1 106 ? 63.308  39.774 8.245   1.00 23.09 ? 111 LYS A O   1 
ATOM   853  C  CB  . LYS A 1 106 ? 65.609  40.942 10.287  1.00 23.20 ? 111 LYS A CB  1 
ATOM   854  C  CG  . LYS A 1 106 ? 66.396  40.193 9.220   1.00 24.55 ? 111 LYS A CG  1 
ATOM   855  C  CD  . LYS A 1 106 ? 66.473  41.012 7.932   1.00 26.36 ? 111 LYS A CD  1 
ATOM   856  C  CE  . LYS A 1 106 ? 67.172  40.250 6.820   1.00 26.75 ? 111 LYS A CE  1 
ATOM   857  N  NZ  . LYS A 1 106 ? 67.058  40.963 5.513   1.00 27.64 ? 111 LYS A NZ  1 
ATOM   858  N  N   . ILE A 1 107 ? 62.884  39.399 10.417  1.00 23.64 ? 112 ILE A N   1 
ATOM   859  C  CA  . ILE A 1 107 ? 62.123  38.189 10.151  1.00 25.18 ? 112 ILE A CA  1 
ATOM   860  C  C   . ILE A 1 107 ? 60.784  38.541 9.517   1.00 26.27 ? 112 ILE A C   1 
ATOM   861  O  O   . ILE A 1 107 ? 60.320  37.858 8.601   1.00 27.28 ? 112 ILE A O   1 
ATOM   862  C  CB  . ILE A 1 107 ? 61.881  37.402 11.459  1.00 25.80 ? 112 ILE A CB  1 
ATOM   863  C  CG1 . ILE A 1 107 ? 63.230  37.003 12.070  1.00 24.66 ? 112 ILE A CG1 1 
ATOM   864  C  CG2 . ILE A 1 107 ? 61.014  36.175 11.186  1.00 26.79 ? 112 ILE A CG2 1 
ATOM   865  C  CD1 . ILE A 1 107 ? 63.135  36.409 13.461  1.00 25.06 ? 112 ILE A CD1 1 
ATOM   866  N  N   . LYS A 1 108 ? 60.179  39.621 10.002  1.00 26.28 ? 113 LYS A N   1 
ATOM   867  C  CA  . LYS A 1 108 ? 58.878  40.077 9.518   1.00 28.65 ? 113 LYS A CA  1 
ATOM   868  C  C   . LYS A 1 108 ? 58.930  40.676 8.106   1.00 29.10 ? 113 LYS A C   1 
ATOM   869  O  O   . LYS A 1 108 ? 58.021  40.460 7.298   1.00 27.26 ? 113 LYS A O   1 
ATOM   870  C  CB  . LYS A 1 108 ? 58.306  41.103 10.504  1.00 28.28 ? 113 LYS A CB  1 
ATOM   871  C  CG  . LYS A 1 108 ? 56.915  41.619 10.165  1.00 32.91 ? 113 LYS A CG  1 
ATOM   872  C  CD  . LYS A 1 108 ? 55.858  40.535 10.294  1.00 33.78 ? 113 LYS A CD  1 
ATOM   873  C  CE  . LYS A 1 108 ? 54.468  41.100 10.041  1.00 34.97 ? 113 LYS A CE  1 
ATOM   874  N  NZ  . LYS A 1 108 ? 53.412  40.062 10.191  1.00 34.76 ? 113 LYS A NZ  1 
ATOM   875  N  N   . TYR A 1 109 ? 59.991  41.424 7.813   1.00 29.60 ? 114 TYR A N   1 
ATOM   876  C  CA  . TYR A 1 109 ? 60.154  42.053 6.504   1.00 29.14 ? 114 TYR A CA  1 
ATOM   877  C  C   . TYR A 1 109 ? 61.558  41.786 5.963   1.00 29.81 ? 114 TYR A C   1 
ATOM   878  O  O   . TYR A 1 109 ? 62.350  42.710 5.780   1.00 31.45 ? 114 TYR A O   1 
ATOM   879  C  CB  . TYR A 1 109 ? 59.924  43.559 6.625   1.00 29.64 ? 114 TYR A CB  1 
ATOM   880  C  CG  . TYR A 1 109 ? 58.639  43.922 7.335   1.00 32.10 ? 114 TYR A CG  1 
ATOM   881  C  CD1 . TYR A 1 109 ? 57.396  43.636 6.766   1.00 33.15 ? 114 TYR A CD1 1 
ATOM   882  C  CD2 . TYR A 1 109 ? 58.663  44.537 8.588   1.00 31.77 ? 114 TYR A CD2 1 
ATOM   883  C  CE1 . TYR A 1 109 ? 56.207  43.956 7.429   1.00 33.78 ? 114 TYR A CE1 1 
ATOM   884  C  CE2 . TYR A 1 109 ? 57.483  44.859 9.258   1.00 33.65 ? 114 TYR A CE2 1 
ATOM   885  C  CZ  . TYR A 1 109 ? 56.260  44.565 8.672   1.00 34.54 ? 114 TYR A CZ  1 
ATOM   886  O  OH  . TYR A 1 109 ? 55.094  44.881 9.333   1.00 35.31 ? 114 TYR A OH  1 
ATOM   887  N  N   . PRO A 1 110 ? 61.871  40.513 5.680   1.00 29.56 ? 115 PRO A N   1 
ATOM   888  C  CA  . PRO A 1 110 ? 63.166  40.058 5.163   1.00 30.48 ? 115 PRO A CA  1 
ATOM   889  C  C   . PRO A 1 110 ? 63.683  40.716 3.885   1.00 31.72 ? 115 PRO A C   1 
ATOM   890  O  O   . PRO A 1 110 ? 64.890  40.709 3.632   1.00 30.58 ? 115 PRO A O   1 
ATOM   891  C  CB  . PRO A 1 110 ? 62.955  38.554 4.988   1.00 30.52 ? 115 PRO A CB  1 
ATOM   892  C  CG  . PRO A 1 110 ? 61.481  38.460 4.679   1.00 30.38 ? 115 PRO A CG  1 
ATOM   893  C  CD  . PRO A 1 110 ? 60.901  39.403 5.697   1.00 30.53 ? 115 PRO A CD  1 
ATOM   894  N  N   . GLU A 1 111 ? 62.784  41.279 3.081   1.00 31.99 ? 116 GLU A N   1 
ATOM   895  C  CA  . GLU A 1 111 ? 63.183  41.921 1.829   1.00 33.08 ? 116 GLU A CA  1 
ATOM   896  C  C   . GLU A 1 111 ? 63.133  43.448 1.875   1.00 32.56 ? 116 GLU A C   1 
ATOM   897  O  O   . GLU A 1 111 ? 63.435  44.109 0.881   1.00 32.46 ? 116 GLU A O   1 
ATOM   898  C  CB  . GLU A 1 111 ? 62.291  41.438 0.678   1.00 36.16 ? 116 GLU A CB  1 
ATOM   899  C  CG  . GLU A 1 111 ? 62.302  39.936 0.433   1.00 41.40 ? 116 GLU A CG  1 
ATOM   900  C  CD  . GLU A 1 111 ? 63.685  39.403 0.103   1.00 45.81 ? 116 GLU A CD  1 
ATOM   901  O  OE1 . GLU A 1 111 ? 64.343  39.961 -0.804  1.00 49.47 ? 116 GLU A OE1 1 
ATOM   902  O  OE2 . GLU A 1 111 ? 64.114  38.420 0.746   1.00 48.48 ? 116 GLU A OE2 1 
ATOM   903  N  N   . ASN A 1 112 ? 62.751  44.007 3.020   1.00 31.11 ? 117 ASN A N   1 
ATOM   904  C  CA  . ASN A 1 112 ? 62.648  45.459 3.162   1.00 31.02 ? 117 ASN A CA  1 
ATOM   905  C  C   . ASN A 1 112 ? 63.351  45.967 4.416   1.00 29.24 ? 117 ASN A C   1 
ATOM   906  O  O   . ASN A 1 112 ? 63.241  47.143 4.763   1.00 29.22 ? 117 ASN A O   1 
ATOM   907  C  CB  . ASN A 1 112 ? 61.174  45.873 3.225   1.00 33.39 ? 117 ASN A CB  1 
ATOM   908  C  CG  . ASN A 1 112 ? 60.417  45.547 1.950   1.00 36.86 ? 117 ASN A CG  1 
ATOM   909  O  OD1 . ASN A 1 112 ? 60.607  46.191 0.916   1.00 37.42 ? 117 ASN A OD1 1 
ATOM   910  N  ND2 . ASN A 1 112 ? 59.558  44.536 2.016   1.00 37.50 ? 117 ASN A ND2 1 
ATOM   911  N  N   . PHE A 1 113 ? 64.077  45.082 5.090   1.00 27.45 ? 118 PHE A N   1 
ATOM   912  C  CA  . PHE A 1 113 ? 64.763  45.441 6.326   1.00 23.67 ? 118 PHE A CA  1 
ATOM   913  C  C   . PHE A 1 113 ? 66.104  44.712 6.366   1.00 22.99 ? 118 PHE A C   1 
ATOM   914  O  O   . PHE A 1 113 ? 66.152  43.486 6.275   1.00 19.93 ? 118 PHE A O   1 
ATOM   915  C  CB  . PHE A 1 113 ? 63.901  45.018 7.518   1.00 21.91 ? 118 PHE A CB  1 
ATOM   916  C  CG  . PHE A 1 113 ? 64.295  45.657 8.817   1.00 21.10 ? 118 PHE A CG  1 
ATOM   917  C  CD1 . PHE A 1 113 ? 63.789  46.900 9.178   1.00 22.46 ? 118 PHE A CD1 1 
ATOM   918  C  CD2 . PHE A 1 113 ? 65.174  45.016 9.680   1.00 21.02 ? 118 PHE A CD2 1 
ATOM   919  C  CE1 . PHE A 1 113 ? 64.151  47.496 10.382  1.00 22.16 ? 118 PHE A CE1 1 
ATOM   920  C  CE2 . PHE A 1 113 ? 65.545  45.603 10.890  1.00 20.19 ? 118 PHE A CE2 1 
ATOM   921  C  CZ  . PHE A 1 113 ? 65.036  46.842 11.242  1.00 20.23 ? 118 PHE A CZ  1 
ATOM   922  N  N   . PHE A 1 114 ? 67.191  45.463 6.510   1.00 20.36 ? 119 PHE A N   1 
ATOM   923  C  CA  . PHE A 1 114 ? 68.510  44.851 6.527   1.00 20.63 ? 119 PHE A CA  1 
ATOM   924  C  C   . PHE A 1 114 ? 69.411  45.331 7.651   1.00 17.80 ? 119 PHE A C   1 
ATOM   925  O  O   . PHE A 1 114 ? 69.358  46.489 8.056   1.00 17.77 ? 119 PHE A O   1 
ATOM   926  C  CB  . PHE A 1 114 ? 69.193  45.063 5.175   1.00 20.85 ? 119 PHE A CB  1 
ATOM   927  C  CG  . PHE A 1 114 ? 68.402  44.526 4.022   1.00 23.09 ? 119 PHE A CG  1 
ATOM   928  C  CD1 . PHE A 1 114 ? 67.367  45.271 3.467   1.00 23.53 ? 119 PHE A CD1 1 
ATOM   929  C  CD2 . PHE A 1 114 ? 68.650  43.250 3.530   1.00 23.79 ? 119 PHE A CD2 1 
ATOM   930  C  CE1 . PHE A 1 114 ? 66.586  44.749 2.440   1.00 23.46 ? 119 PHE A CE1 1 
ATOM   931  C  CE2 . PHE A 1 114 ? 67.874  42.719 2.503   1.00 26.19 ? 119 PHE A CE2 1 
ATOM   932  C  CZ  . PHE A 1 114 ? 66.838  43.474 1.960   1.00 24.54 ? 119 PHE A CZ  1 
ATOM   933  N  N   . LEU A 1 115 ? 70.238  44.415 8.148   1.00 16.92 ? 120 LEU A N   1 
ATOM   934  C  CA  . LEU A 1 115 ? 71.159  44.704 9.236   1.00 16.53 ? 120 LEU A CA  1 
ATOM   935  C  C   . LEU A 1 115 ? 72.569  44.233 8.883   1.00 15.96 ? 120 LEU A C   1 
ATOM   936  O  O   . LEU A 1 115 ? 72.758  43.089 8.473   1.00 15.87 ? 120 LEU A O   1 
ATOM   937  C  CB  . LEU A 1 115 ? 70.713  43.975 10.508  1.00 15.63 ? 120 LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 115 ? 69.295  44.188 11.036  1.00 16.21 ? 120 LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 115 ? 69.028  43.196 12.170  1.00 15.92 ? 120 LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 115 ? 69.125  45.623 11.506  1.00 14.28 ? 120 LEU A CD2 1 
ATOM   941  N  N   . LEU A 1 116 ? 73.548  45.117 9.029   1.00 15.56 ? 121 LEU A N   1 
ATOM   942  C  CA  . LEU A 1 116 ? 74.928  44.744 8.771   1.00 15.31 ? 121 LEU A CA  1 
ATOM   943  C  C   . LEU A 1 116 ? 75.567  44.465 10.121  1.00 14.89 ? 121 LEU A C   1 
ATOM   944  O  O   . LEU A 1 116 ? 75.027  44.834 11.167  1.00 12.35 ? 121 LEU A O   1 
ATOM   945  C  CB  . LEU A 1 116 ? 75.705  45.869 8.084   1.00 13.60 ? 121 LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 116 ? 75.227  46.293 6.691   1.00 14.92 ? 121 LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 116 ? 76.246  47.261 6.108   1.00 11.78 ? 121 LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 116 ? 75.071  45.067 5.782   1.00 11.70 ? 121 LEU A CD2 1 
ATOM   949  N  N   . ARG A 1 117 ? 76.725  43.825 10.081  1.00 14.50 ? 122 ARG A N   1 
ATOM   950  C  CA  . ARG A 1 117 ? 77.468  43.492 11.282  1.00 13.58 ? 122 ARG A CA  1 
ATOM   951  C  C   . ARG A 1 117 ? 78.415  44.636 11.671  1.00 12.38 ? 122 ARG A C   1 
ATOM   952  O  O   . ARG A 1 117 ? 79.125  45.174 10.819  1.00 9.97  ? 122 ARG A O   1 
ATOM   953  C  CB  . ARG A 1 117 ? 78.278  42.216 11.027  1.00 15.38 ? 122 ARG A CB  1 
ATOM   954  C  CG  . ARG A 1 117 ? 79.009  41.681 12.245  1.00 15.16 ? 122 ARG A CG  1 
ATOM   955  C  CD  . ARG A 1 117 ? 79.691  40.355 11.946  1.00 16.81 ? 122 ARG A CD  1 
ATOM   956  N  NE  . ARG A 1 117 ? 80.146  39.710 13.178  1.00 17.01 ? 122 ARG A NE  1 
ATOM   957  C  CZ  . ARG A 1 117 ? 80.691  38.499 13.234  1.00 19.15 ? 122 ARG A CZ  1 
ATOM   958  N  NH1 . ARG A 1 117 ? 80.859  37.787 12.128  1.00 17.12 ? 122 ARG A NH1 1 
ATOM   959  N  NH2 . ARG A 1 117 ? 81.066  37.998 14.400  1.00 17.92 ? 122 ARG A NH2 1 
ATOM   960  N  N   . GLY A 1 118 ? 78.393  45.009 12.953  1.00 11.35 ? 123 GLY A N   1 
ATOM   961  C  CA  . GLY A 1 118 ? 79.275  46.040 13.481  1.00 12.02 ? 123 GLY A CA  1 
ATOM   962  C  C   . GLY A 1 118 ? 80.308  45.300 14.321  1.00 13.59 ? 123 GLY A C   1 
ATOM   963  O  O   . GLY A 1 118 ? 80.131  44.105 14.560  1.00 14.75 ? 123 GLY A O   1 
ATOM   964  N  N   . ASN A 1 119 ? 81.368  45.970 14.773  1.00 13.82 ? 124 ASN A N   1 
ATOM   965  C  CA  . ASN A 1 119 ? 82.380  45.275 15.563  1.00 15.40 ? 124 ASN A CA  1 
ATOM   966  C  C   . ASN A 1 119 ? 81.837  44.867 16.924  1.00 14.97 ? 124 ASN A C   1 
ATOM   967  O  O   . ASN A 1 119 ? 82.440  44.047 17.618  1.00 15.03 ? 124 ASN A O   1 
ATOM   968  C  CB  . ASN A 1 119 ? 83.652  46.129 15.721  1.00 15.02 ? 124 ASN A CB  1 
ATOM   969  C  CG  . ASN A 1 119 ? 83.382  47.479 16.354  1.00 15.38 ? 124 ASN A CG  1 
ATOM   970  O  OD1 . ASN A 1 119 ? 82.506  48.214 15.912  1.00 14.90 ? 124 ASN A OD1 1 
ATOM   971  N  ND2 . ASN A 1 119 ? 84.145  47.816 17.387  1.00 12.82 ? 124 ASN A ND2 1 
ATOM   972  N  N   . HIS A 1 120 ? 80.698  45.436 17.309  1.00 14.81 ? 125 HIS A N   1 
ATOM   973  C  CA  . HIS A 1 120 ? 80.096  45.072 18.586  1.00 14.90 ? 125 HIS A CA  1 
ATOM   974  C  C   . HIS A 1 120 ? 79.229  43.822 18.456  1.00 14.91 ? 125 HIS A C   1 
ATOM   975  O  O   . HIS A 1 120 ? 78.746  43.275 19.445  1.00 16.21 ? 125 HIS A O   1 
ATOM   976  C  CB  . HIS A 1 120 ? 79.324  46.261 19.168  1.00 13.77 ? 125 HIS A CB  1 
ATOM   977  C  CG  . HIS A 1 120 ? 80.217  47.264 19.836  1.00 14.79 ? 125 HIS A CG  1 
ATOM   978  N  ND1 . HIS A 1 120 ? 80.477  47.245 21.191  1.00 13.58 ? 125 HIS A ND1 1 
ATOM   979  C  CD2 . HIS A 1 120 ? 81.001  48.242 19.319  1.00 15.84 ? 125 HIS A CD2 1 
ATOM   980  C  CE1 . HIS A 1 120 ? 81.385  48.161 21.478  1.00 14.62 ? 125 HIS A CE1 1 
ATOM   981  N  NE2 . HIS A 1 120 ? 81.721  48.779 20.360  1.00 13.28 ? 125 HIS A NE2 1 
ATOM   982  N  N   . GLU A 1 121 ? 79.025  43.364 17.226  1.00 14.83 ? 126 GLU A N   1 
ATOM   983  C  CA  . GLU A 1 121 ? 78.284  42.127 17.036  1.00 15.16 ? 126 GLU A CA  1 
ATOM   984  C  C   . GLU A 1 121 ? 79.373  41.055 16.953  1.00 16.54 ? 126 GLU A C   1 
ATOM   985  O  O   . GLU A 1 121 ? 79.425  40.243 16.025  1.00 16.27 ? 126 GLU A O   1 
ATOM   986  C  CB  . GLU A 1 121 ? 77.443  42.160 15.758  1.00 14.36 ? 126 GLU A CB  1 
ATOM   987  C  CG  . GLU A 1 121 ? 76.129  42.919 15.913  1.00 12.95 ? 126 GLU A CG  1 
ATOM   988  C  CD  . GLU A 1 121 ? 76.327  44.409 16.134  1.00 16.05 ? 126 GLU A CD  1 
ATOM   989  O  OE1 . GLU A 1 121 ? 76.968  45.043 15.273  1.00 14.33 ? 126 GLU A OE1 1 
ATOM   990  O  OE2 . GLU A 1 121 ? 75.846  44.947 17.162  1.00 13.39 ? 126 GLU A OE2 1 
ATOM   991  N  N   . CYS A 1 122 ? 80.257  41.100 17.946  1.00 19.02 ? 127 CYS A N   1 
ATOM   992  C  CA  . CYS A 1 122 ? 81.380  40.181 18.085  1.00 20.21 ? 127 CYS A CA  1 
ATOM   993  C  C   . CYS A 1 122 ? 81.465  39.773 19.554  1.00 21.56 ? 127 CYS A C   1 
ATOM   994  O  O   . CYS A 1 122 ? 81.423  40.628 20.441  1.00 20.74 ? 127 CYS A O   1 
ATOM   995  C  CB  . CYS A 1 122 ? 82.679  40.872 17.680  1.00 22.89 ? 127 CYS A CB  1 
ATOM   996  S  SG  . CYS A 1 122 ? 82.833  41.311 15.919  1.00 25.60 ? 127 CYS A SG  1 
ATOM   997  N  N   . ALA A 1 123 ? 81.596  38.473 19.802  1.00 20.84 ? 128 ALA A N   1 
ATOM   998  C  CA  . ALA A 1 123 ? 81.664  37.944 21.163  1.00 23.49 ? 128 ALA A CA  1 
ATOM   999  C  C   . ALA A 1 123 ? 82.695  38.615 22.059  1.00 22.34 ? 128 ALA A C   1 
ATOM   1000 O  O   . ALA A 1 123 ? 82.373  39.067 23.154  1.00 24.58 ? 128 ALA A O   1 
ATOM   1001 C  CB  . ALA A 1 123 ? 81.924  36.438 21.126  1.00 22.84 ? 128 ALA A CB  1 
ATOM   1002 N  N   . SER A 1 124 ? 83.936  38.677 21.596  1.00 24.56 ? 129 SER A N   1 
ATOM   1003 C  CA  . SER A 1 124 ? 85.007  39.269 22.385  1.00 26.38 ? 129 SER A CA  1 
ATOM   1004 C  C   . SER A 1 124 ? 84.741  40.715 22.765  1.00 26.23 ? 129 SER A C   1 
ATOM   1005 O  O   . SER A 1 124 ? 85.225  41.188 23.790  1.00 26.45 ? 129 SER A O   1 
ATOM   1006 C  CB  . SER A 1 124 ? 86.329  39.166 21.628  1.00 28.61 ? 129 SER A CB  1 
ATOM   1007 O  OG  . SER A 1 124 ? 86.577  37.822 21.265  1.00 35.51 ? 129 SER A OG  1 
ATOM   1008 N  N   . ILE A 1 125 ? 83.965  41.415 21.945  1.00 26.06 ? 130 ILE A N   1 
ATOM   1009 C  CA  . ILE A 1 125 ? 83.646  42.811 22.214  1.00 25.16 ? 130 ILE A CA  1 
ATOM   1010 C  C   . ILE A 1 125 ? 82.435  42.987 23.133  1.00 25.11 ? 130 ILE A C   1 
ATOM   1011 O  O   . ILE A 1 125 ? 82.544  43.615 24.192  1.00 23.17 ? 130 ILE A O   1 
ATOM   1012 C  CB  . ILE A 1 125 ? 83.373  43.581 20.904  1.00 24.89 ? 130 ILE A CB  1 
ATOM   1013 C  CG1 . ILE A 1 125 ? 84.614  43.554 20.008  1.00 27.82 ? 130 ILE A CG1 1 
ATOM   1014 C  CG2 . ILE A 1 125 ? 82.994  45.025 21.217  1.00 28.40 ? 130 ILE A CG2 1 
ATOM   1015 C  CD1 . ILE A 1 125 ? 85.804  44.305 20.579  1.00 27.22 ? 130 ILE A CD1 1 
ATOM   1016 N  N   . ASN A 1 126 ? 81.282  42.439 22.742  1.00 24.10 ? 131 ASN A N   1 
ATOM   1017 C  CA  . ASN A 1 126 ? 80.090  42.611 23.566  1.00 23.61 ? 131 ASN A CA  1 
ATOM   1018 C  C   . ASN A 1 126 ? 80.155  41.834 24.871  1.00 24.57 ? 131 ASN A C   1 
ATOM   1019 O  O   . ASN A 1 126 ? 79.258  41.908 25.703  1.00 25.74 ? 131 ASN A O   1 
ATOM   1020 C  CB  . ASN A 1 126 ? 78.795  42.301 22.774  1.00 22.86 ? 131 ASN A CB  1 
ATOM   1021 C  CG  . ASN A 1 126 ? 78.737  40.887 22.228  1.00 23.39 ? 131 ASN A CG  1 
ATOM   1022 O  OD1 . ASN A 1 126 ? 78.867  39.909 22.965  1.00 26.12 ? 131 ASN A OD1 1 
ATOM   1023 N  ND2 . ASN A 1 126 ? 78.517  40.773 20.924  1.00 23.43 ? 131 ASN A ND2 1 
ATOM   1024 N  N   . ARG A 1 127 ? 81.248  41.109 25.060  1.00 25.37 ? 132 ARG A N   1 
ATOM   1025 C  CA  . ARG A 1 127 ? 81.443  40.365 26.289  1.00 25.29 ? 132 ARG A CA  1 
ATOM   1026 C  C   . ARG A 1 127 ? 81.902  41.356 27.355  1.00 24.26 ? 132 ARG A C   1 
ATOM   1027 O  O   . ARG A 1 127 ? 81.553  41.230 28.524  1.00 25.23 ? 132 ARG A O   1 
ATOM   1028 C  CB  . ARG A 1 127 ? 82.508  39.284 26.079  1.00 27.16 ? 132 ARG A CB  1 
ATOM   1029 C  CG  . ARG A 1 127 ? 82.932  38.549 27.332  1.00 29.07 ? 132 ARG A CG  1 
ATOM   1030 C  CD  . ARG A 1 127 ? 83.844  37.384 26.977  1.00 32.30 ? 132 ARG A CD  1 
ATOM   1031 N  NE  . ARG A 1 127 ? 83.274  36.121 27.430  1.00 35.85 ? 132 ARG A NE  1 
ATOM   1032 C  CZ  . ARG A 1 127 ? 83.358  34.982 26.757  1.00 34.84 ? 132 ARG A CZ  1 
ATOM   1033 N  NH1 . ARG A 1 127 ? 83.991  34.946 25.593  1.00 35.01 ? 132 ARG A NH1 1 
ATOM   1034 N  NH2 . ARG A 1 127 ? 82.806  33.882 27.248  1.00 37.36 ? 132 ARG A NH2 1 
ATOM   1035 N  N   . ILE A 1 128 ? 82.654  42.364 26.920  1.00 25.03 ? 133 ILE A N   1 
ATOM   1036 C  CA  . ILE A 1 128 ? 83.224  43.384 27.803  1.00 23.97 ? 133 ILE A CA  1 
ATOM   1037 C  C   . ILE A 1 128 ? 82.461  44.701 27.953  1.00 23.57 ? 133 ILE A C   1 
ATOM   1038 O  O   . ILE A 1 128 ? 82.501  45.321 29.018  1.00 23.09 ? 133 ILE A O   1 
ATOM   1039 C  CB  . ILE A 1 128 ? 84.628  43.815 27.324  1.00 27.23 ? 133 ILE A CB  1 
ATOM   1040 C  CG1 . ILE A 1 128 ? 85.484  42.607 26.983  1.00 30.44 ? 133 ILE A CG1 1 
ATOM   1041 C  CG2 . ILE A 1 128 ? 85.310  44.647 28.398  1.00 29.10 ? 133 ILE A CG2 1 
ATOM   1042 C  CD1 . ILE A 1 128 ? 86.816  43.010 26.365  1.00 34.68 ? 133 ILE A CD1 1 
ATOM   1043 N  N   . TYR A 1 129 ? 81.793  45.140 26.893  1.00 20.64 ? 134 TYR A N   1 
ATOM   1044 C  CA  . TYR A 1 129 ? 81.121  46.430 26.922  1.00 20.72 ? 134 TYR A CA  1 
ATOM   1045 C  C   . TYR A 1 129 ? 79.632  46.529 27.217  1.00 19.38 ? 134 TYR A C   1 
ATOM   1046 O  O   . TYR A 1 129 ? 78.998  47.517 26.852  1.00 19.32 ? 134 TYR A O   1 
ATOM   1047 C  CB  . TYR A 1 129 ? 81.458  47.188 25.633  1.00 22.57 ? 134 TYR A CB  1 
ATOM   1048 C  CG  . TYR A 1 129 ? 82.950  47.404 25.504  1.00 25.21 ? 134 TYR A CG  1 
ATOM   1049 C  CD1 . TYR A 1 129 ? 83.631  48.230 26.400  1.00 26.73 ? 134 TYR A CD1 1 
ATOM   1050 C  CD2 . TYR A 1 129 ? 83.694  46.718 24.548  1.00 26.14 ? 134 TYR A CD2 1 
ATOM   1051 C  CE1 . TYR A 1 129 ? 85.020  48.362 26.352  1.00 27.25 ? 134 TYR A CE1 1 
ATOM   1052 C  CE2 . TYR A 1 129 ? 85.081  46.842 24.491  1.00 27.74 ? 134 TYR A CE2 1 
ATOM   1053 C  CZ  . TYR A 1 129 ? 85.736  47.663 25.396  1.00 27.12 ? 134 TYR A CZ  1 
ATOM   1054 O  OH  . TYR A 1 129 ? 87.106  47.769 25.351  1.00 32.50 ? 134 TYR A OH  1 
ATOM   1055 N  N   . GLY A 1 130 ? 79.075  45.523 27.888  1.00 20.47 ? 135 GLY A N   1 
ATOM   1056 C  CA  . GLY A 1 130 ? 77.676  45.608 28.260  1.00 19.00 ? 135 GLY A CA  1 
ATOM   1057 C  C   . GLY A 1 130 ? 76.683  44.511 27.931  1.00 19.33 ? 135 GLY A C   1 
ATOM   1058 O  O   . GLY A 1 130 ? 75.918  44.098 28.807  1.00 16.72 ? 135 GLY A O   1 
ATOM   1059 N  N   . PHE A 1 131 ? 76.678  44.036 26.690  1.00 18.43 ? 136 PHE A N   1 
ATOM   1060 C  CA  . PHE A 1 131 ? 75.705  43.027 26.290  1.00 18.38 ? 136 PHE A CA  1 
ATOM   1061 C  C   . PHE A 1 131 ? 75.740  41.752 27.113  1.00 19.45 ? 136 PHE A C   1 
ATOM   1062 O  O   . PHE A 1 131 ? 74.693  41.254 27.521  1.00 18.47 ? 136 PHE A O   1 
ATOM   1063 C  CB  . PHE A 1 131 ? 75.854  42.689 24.809  1.00 18.78 ? 136 PHE A CB  1 
ATOM   1064 C  CG  . PHE A 1 131 ? 74.685  41.938 24.247  1.00 18.12 ? 136 PHE A CG  1 
ATOM   1065 C  CD1 . PHE A 1 131 ? 73.382  42.311 24.581  1.00 16.80 ? 136 PHE A CD1 1 
ATOM   1066 C  CD2 . PHE A 1 131 ? 74.876  40.878 23.364  1.00 17.00 ? 136 PHE A CD2 1 
ATOM   1067 C  CE1 . PHE A 1 131 ? 72.293  41.642 24.046  1.00 15.49 ? 136 PHE A CE1 1 
ATOM   1068 C  CE2 . PHE A 1 131 ? 73.785  40.204 22.822  1.00 16.42 ? 136 PHE A CE2 1 
ATOM   1069 C  CZ  . PHE A 1 131 ? 72.493  40.588 23.164  1.00 15.54 ? 136 PHE A CZ  1 
ATOM   1070 N  N   . TYR A 1 132 ? 76.934  41.216 27.340  1.00 18.51 ? 137 TYR A N   1 
ATOM   1071 C  CA  . TYR A 1 132 ? 77.078  40.001 28.139  1.00 18.63 ? 137 TYR A CA  1 
ATOM   1072 C  C   . TYR A 1 132 ? 76.474  40.236 29.526  1.00 18.09 ? 137 TYR A C   1 
ATOM   1073 O  O   . TYR A 1 132 ? 75.678  39.430 30.005  1.00 17.97 ? 137 TYR A O   1 
ATOM   1074 C  CB  . TYR A 1 132 ? 78.566  39.627 28.245  1.00 19.46 ? 137 TYR A CB  1 
ATOM   1075 C  CG  . TYR A 1 132 ? 78.899  38.514 29.225  1.00 21.29 ? 137 TYR A CG  1 
ATOM   1076 C  CD1 . TYR A 1 132 ? 78.882  38.741 30.602  1.00 20.83 ? 137 TYR A CD1 1 
ATOM   1077 C  CD2 . TYR A 1 132 ? 79.252  37.241 28.772  1.00 19.13 ? 137 TYR A CD2 1 
ATOM   1078 C  CE1 . TYR A 1 132 ? 79.212  37.723 31.510  1.00 22.89 ? 137 TYR A CE1 1 
ATOM   1079 C  CE2 . TYR A 1 132 ? 79.579  36.219 29.668  1.00 21.29 ? 137 TYR A CE2 1 
ATOM   1080 C  CZ  . TYR A 1 132 ? 79.558  36.470 31.033  1.00 21.87 ? 137 TYR A CZ  1 
ATOM   1081 O  OH  . TYR A 1 132 ? 79.879  35.468 31.919  1.00 25.78 ? 137 TYR A OH  1 
ATOM   1082 N  N   . ASP A 1 133 ? 76.853  41.337 30.169  1.00 18.47 ? 138 ASP A N   1 
ATOM   1083 C  CA  . ASP A 1 133 ? 76.330  41.652 31.497  1.00 20.23 ? 138 ASP A CA  1 
ATOM   1084 C  C   . ASP A 1 133 ? 74.807  41.795 31.483  1.00 20.77 ? 138 ASP A C   1 
ATOM   1085 O  O   . ASP A 1 133 ? 74.118  41.369 32.415  1.00 19.29 ? 138 ASP A O   1 
ATOM   1086 C  CB  . ASP A 1 133 ? 76.960  42.941 32.028  1.00 23.27 ? 138 ASP A CB  1 
ATOM   1087 C  CG  . ASP A 1 133 ? 78.457  42.813 32.242  1.00 25.79 ? 138 ASP A CG  1 
ATOM   1088 O  OD1 . ASP A 1 133 ? 78.880  41.784 32.806  1.00 24.51 ? 138 ASP A OD1 1 
ATOM   1089 O  OD2 . ASP A 1 133 ? 79.206  43.742 31.854  1.00 28.74 ? 138 ASP A OD2 1 
ATOM   1090 N  N   . GLU A 1 134 ? 74.277  42.393 30.423  1.00 19.65 ? 139 GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 134 ? 72.833  42.567 30.324  1.00 20.63 ? 139 GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 134 ? 72.142  41.207 30.218  1.00 19.10 ? 139 GLU A C   1 
ATOM   1093 O  O   . GLU A 1 134 ? 71.093  40.983 30.829  1.00 18.29 ? 139 GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 134 ? 72.488  43.440 29.118  1.00 20.54 ? 139 GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 134 ? 71.091  44.021 29.169  1.00 24.10 ? 139 GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 134 ? 70.828  45.020 28.055  1.00 22.91 ? 139 GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 134 ? 71.698  45.877 27.799  1.00 20.65 ? 139 GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 134 ? 69.741  44.958 27.449  1.00 26.02 ? 139 GLU A OE2 1 
ATOM   1099 N  N   . CYS A 1 135 ? 72.734  40.292 29.455  1.00 17.21 ? 140 CYS A N   1 
ATOM   1100 C  CA  . CYS A 1 135 ? 72.159  38.958 29.304  1.00 19.72 ? 140 CYS A CA  1 
ATOM   1101 C  C   . CYS A 1 135 ? 72.273  38.165 30.604  1.00 21.77 ? 140 CYS A C   1 
ATOM   1102 O  O   . CYS A 1 135 ? 71.362  37.420 30.970  1.00 18.37 ? 140 CYS A O   1 
ATOM   1103 C  CB  . CYS A 1 135 ? 72.858  38.184 28.180  1.00 18.07 ? 140 CYS A CB  1 
ATOM   1104 S  SG  . CYS A 1 135 ? 72.450  38.728 26.493  1.00 18.93 ? 140 CYS A SG  1 
ATOM   1105 N  N   . LYS A 1 136 ? 73.398  38.324 31.296  1.00 23.54 ? 141 LYS A N   1 
ATOM   1106 C  CA  . LYS A 1 136 ? 73.625  37.617 32.552  1.00 25.42 ? 141 LYS A CA  1 
ATOM   1107 C  C   . LYS A 1 136 ? 72.595  38.060 33.587  1.00 25.76 ? 141 LYS A C   1 
ATOM   1108 O  O   . LYS A 1 136 ? 72.076  37.247 34.345  1.00 26.51 ? 141 LYS A O   1 
ATOM   1109 C  CB  . LYS A 1 136 ? 75.038  37.901 33.077  1.00 27.25 ? 141 LYS A CB  1 
ATOM   1110 C  CG  . LYS A 1 136 ? 75.474  37.016 34.250  1.00 30.16 ? 141 LYS A CG  1 
ATOM   1111 C  CD  . LYS A 1 136 ? 76.819  37.481 34.813  1.00 33.88 ? 141 LYS A CD  1 
ATOM   1112 C  CE  . LYS A 1 136 ? 77.415  36.494 35.818  1.00 37.18 ? 141 LYS A CE  1 
ATOM   1113 N  NZ  . LYS A 1 136 ? 77.999  35.276 35.168  1.00 41.06 ? 141 LYS A NZ  1 
ATOM   1114 N  N   . ARG A 1 137 ? 72.294  39.352 33.604  1.00 26.22 ? 142 ARG A N   1 
ATOM   1115 C  CA  . ARG A 1 137 ? 71.332  39.897 34.552  1.00 26.67 ? 142 ARG A CA  1 
ATOM   1116 C  C   . ARG A 1 137 ? 69.880  39.507 34.257  1.00 25.52 ? 142 ARG A C   1 
ATOM   1117 O  O   . ARG A 1 137 ? 69.206  38.910 35.095  1.00 25.84 ? 142 ARG A O   1 
ATOM   1118 C  CB  . ARG A 1 137 ? 71.448  41.425 34.589  1.00 30.54 ? 142 ARG A CB  1 
ATOM   1119 C  CG  . ARG A 1 137 ? 70.542  42.090 35.620  1.00 36.53 ? 142 ARG A CG  1 
ATOM   1120 C  CD  . ARG A 1 137 ? 70.740  43.607 35.706  1.00 41.03 ? 142 ARG A CD  1 
ATOM   1121 N  NE  . ARG A 1 137 ? 70.171  44.335 34.570  1.00 44.04 ? 142 ARG A NE  1 
ATOM   1122 C  CZ  . ARG A 1 137 ? 70.789  44.525 33.408  1.00 45.66 ? 142 ARG A CZ  1 
ATOM   1123 N  NH1 . ARG A 1 137 ? 72.016  44.057 33.218  1.00 48.75 ? 142 ARG A NH1 1 
ATOM   1124 N  NH2 . ARG A 1 137 ? 70.182  45.198 32.440  1.00 45.01 ? 142 ARG A NH2 1 
ATOM   1125 N  N   . ARG A 1 138 ? 69.414  39.831 33.056  1.00 22.77 ? 143 ARG A N   1 
ATOM   1126 C  CA  . ARG A 1 138 ? 68.032  39.573 32.666  1.00 22.37 ? 143 ARG A CA  1 
ATOM   1127 C  C   . ARG A 1 138 ? 67.684  38.173 32.177  1.00 20.46 ? 143 ARG A C   1 
ATOM   1128 O  O   . ARG A 1 138 ? 66.533  37.753 32.265  1.00 20.85 ? 143 ARG A O   1 
ATOM   1129 C  CB  . ARG A 1 138 ? 67.618  40.612 31.624  1.00 22.16 ? 143 ARG A CB  1 
ATOM   1130 C  CG  . ARG A 1 138 ? 67.754  42.034 32.146  1.00 22.67 ? 143 ARG A CG  1 
ATOM   1131 C  CD  . ARG A 1 138 ? 67.448  43.054 31.071  1.00 22.01 ? 143 ARG A CD  1 
ATOM   1132 N  NE  . ARG A 1 138 ? 66.103  42.886 30.536  1.00 21.34 ? 143 ARG A NE  1 
ATOM   1133 C  CZ  . ARG A 1 138 ? 65.595  43.630 29.562  1.00 21.87 ? 143 ARG A CZ  1 
ATOM   1134 N  NH1 . ARG A 1 138 ? 66.325  44.594 29.013  1.00 21.62 ? 143 ARG A NH1 1 
ATOM   1135 N  NH2 . ARG A 1 138 ? 64.361  43.409 29.137  1.00 22.14 ? 143 ARG A NH2 1 
ATOM   1136 N  N   . TYR A 1 139 ? 68.670  37.450 31.664  1.00 19.20 ? 144 TYR A N   1 
ATOM   1137 C  CA  . TYR A 1 139 ? 68.439  36.097 31.174  1.00 17.99 ? 144 TYR A CA  1 
ATOM   1138 C  C   . TYR A 1 139 ? 69.579  35.197 31.648  1.00 18.46 ? 144 TYR A C   1 
ATOM   1139 O  O   . TYR A 1 139 ? 69.683  34.915 32.842  1.00 15.36 ? 144 TYR A O   1 
ATOM   1140 C  CB  . TYR A 1 139 ? 68.337  36.112 29.644  1.00 19.05 ? 144 TYR A CB  1 
ATOM   1141 C  CG  . TYR A 1 139 ? 67.107  36.848 29.149  1.00 19.07 ? 144 TYR A CG  1 
ATOM   1142 C  CD1 . TYR A 1 139 ? 65.890  36.181 28.987  1.00 17.87 ? 144 TYR A CD1 1 
ATOM   1143 C  CD2 . TYR A 1 139 ? 67.141  38.225 28.915  1.00 16.98 ? 144 TYR A CD2 1 
ATOM   1144 C  CE1 . TYR A 1 139 ? 64.731  36.870 28.607  1.00 19.22 ? 144 TYR A CE1 1 
ATOM   1145 C  CE2 . TYR A 1 139 ? 65.986  38.924 28.539  1.00 18.30 ? 144 TYR A CE2 1 
ATOM   1146 C  CZ  . TYR A 1 139 ? 64.786  38.239 28.389  1.00 18.46 ? 144 TYR A CZ  1 
ATOM   1147 O  OH  . TYR A 1 139 ? 63.636  38.920 28.047  1.00 17.47 ? 144 TYR A OH  1 
ATOM   1148 N  N   . ASN A 1 140 ? 70.429  34.752 30.725  1.00 16.47 ? 145 ASN A N   1 
ATOM   1149 C  CA  . ASN A 1 140 ? 71.559  33.900 31.079  1.00 18.53 ? 145 ASN A CA  1 
ATOM   1150 C  C   . ASN A 1 140 ? 72.645  33.943 30.002  1.00 19.89 ? 145 ASN A C   1 
ATOM   1151 O  O   . ASN A 1 140 ? 72.435  34.484 28.907  1.00 15.71 ? 145 ASN A O   1 
ATOM   1152 C  CB  . ASN A 1 140 ? 71.085  32.458 31.318  1.00 19.42 ? 145 ASN A CB  1 
ATOM   1153 C  CG  . ASN A 1 140 ? 70.257  31.918 30.173  1.00 22.41 ? 145 ASN A CG  1 
ATOM   1154 O  OD1 . ASN A 1 140 ? 70.769  31.664 29.079  1.00 21.84 ? 145 ASN A OD1 1 
ATOM   1155 N  ND2 . ASN A 1 140 ? 68.963  31.743 30.415  1.00 20.77 ? 145 ASN A ND2 1 
ATOM   1156 N  N   . ILE A 1 141 ? 73.810  33.380 30.310  1.00 20.28 ? 146 ILE A N   1 
ATOM   1157 C  CA  . ILE A 1 141 ? 74.917  33.402 29.362  1.00 22.72 ? 146 ILE A CA  1 
ATOM   1158 C  C   . ILE A 1 141 ? 74.678  32.514 28.151  1.00 22.49 ? 146 ILE A C   1 
ATOM   1159 O  O   . ILE A 1 141 ? 75.174  32.793 27.059  1.00 23.22 ? 146 ILE A O   1 
ATOM   1160 C  CB  . ILE A 1 141 ? 76.239  33.005 30.054  1.00 24.39 ? 146 ILE A CB  1 
ATOM   1161 C  CG1 . ILE A 1 141 ? 76.477  33.921 31.255  1.00 23.47 ? 146 ILE A CG1 1 
ATOM   1162 C  CG2 . ILE A 1 141 ? 77.402  33.124 29.080  1.00 24.72 ? 146 ILE A CG2 1 
ATOM   1163 C  CD1 . ILE A 1 141 ? 76.426  35.391 30.913  1.00 25.21 ? 146 ILE A CD1 1 
ATOM   1164 N  N   . LYS A 1 142 ? 73.911  31.448 28.340  1.00 22.13 ? 147 LYS A N   1 
ATOM   1165 C  CA  . LYS A 1 142 ? 73.609  30.540 27.243  1.00 21.54 ? 147 LYS A CA  1 
ATOM   1166 C  C   . LYS A 1 142 ? 72.864  31.297 26.150  1.00 20.32 ? 147 LYS A C   1 
ATOM   1167 O  O   . LYS A 1 142 ? 73.061  31.044 24.962  1.00 18.99 ? 147 LYS A O   1 
ATOM   1168 C  CB  . LYS A 1 142 ? 72.754  29.372 27.737  1.00 25.04 ? 147 LYS A CB  1 
ATOM   1169 C  CG  . LYS A 1 142 ? 72.298  28.433 26.631  1.00 29.77 ? 147 LYS A CG  1 
ATOM   1170 C  CD  . LYS A 1 142 ? 71.487  27.271 27.193  1.00 33.54 ? 147 LYS A CD  1 
ATOM   1171 C  CE  . LYS A 1 142 ? 70.994  26.345 26.091  1.00 36.11 ? 147 LYS A CE  1 
ATOM   1172 N  NZ  . LYS A 1 142 ? 70.235  25.181 26.647  1.00 35.84 ? 147 LYS A NZ  1 
ATOM   1173 N  N   . LEU A 1 143 ? 72.001  32.223 26.556  1.00 17.65 ? 148 LEU A N   1 
ATOM   1174 C  CA  . LEU A 1 143 ? 71.245  33.016 25.593  1.00 17.93 ? 148 LEU A CA  1 
ATOM   1175 C  C   . LEU A 1 143 ? 72.201  33.984 24.896  1.00 17.86 ? 148 LEU A C   1 
ATOM   1176 O  O   . LEU A 1 143 ? 72.048  34.283 23.715  1.00 17.79 ? 148 LEU A O   1 
ATOM   1177 C  CB  . LEU A 1 143 ? 70.130  33.798 26.295  1.00 17.82 ? 148 LEU A CB  1 
ATOM   1178 C  CG  . LEU A 1 143 ? 69.182  34.552 25.352  1.00 20.38 ? 148 LEU A CG  1 
ATOM   1179 C  CD1 . LEU A 1 143 ? 68.469  33.559 24.432  1.00 19.81 ? 148 LEU A CD1 1 
ATOM   1180 C  CD2 . LEU A 1 143 ? 68.170  35.343 26.161  1.00 18.45 ? 148 LEU A CD2 1 
ATOM   1181 N  N   . TRP A 1 144 ? 73.190  34.473 25.639  1.00 16.89 ? 149 TRP A N   1 
ATOM   1182 C  CA  . TRP A 1 144 ? 74.170  35.386 25.073  1.00 17.22 ? 149 TRP A CA  1 
ATOM   1183 C  C   . TRP A 1 144 ? 74.932  34.668 23.958  1.00 17.59 ? 149 TRP A C   1 
ATOM   1184 O  O   . TRP A 1 144 ? 75.187  35.239 22.898  1.00 16.67 ? 149 TRP A O   1 
ATOM   1185 C  CB  . TRP A 1 144 ? 75.149  35.849 26.153  1.00 16.91 ? 149 TRP A CB  1 
ATOM   1186 C  CG  . TRP A 1 144 ? 76.288  36.653 25.607  1.00 17.19 ? 149 TRP A CG  1 
ATOM   1187 C  CD1 . TRP A 1 144 ? 76.231  37.913 25.081  1.00 17.52 ? 149 TRP A CD1 1 
ATOM   1188 C  CD2 . TRP A 1 144 ? 77.652  36.239 25.516  1.00 17.23 ? 149 TRP A CD2 1 
ATOM   1189 N  NE1 . TRP A 1 144 ? 77.482  38.312 24.667  1.00 18.16 ? 149 TRP A NE1 1 
ATOM   1190 C  CE2 . TRP A 1 144 ? 78.374  37.302 24.924  1.00 19.14 ? 149 TRP A CE2 1 
ATOM   1191 C  CE3 . TRP A 1 144 ? 78.339  35.070 25.877  1.00 19.46 ? 149 TRP A CE3 1 
ATOM   1192 C  CZ2 . TRP A 1 144 ? 79.748  37.231 24.687  1.00 16.66 ? 149 TRP A CZ2 1 
ATOM   1193 C  CZ3 . TRP A 1 144 ? 79.711  35.000 25.639  1.00 19.88 ? 149 TRP A CZ3 1 
ATOM   1194 C  CH2 . TRP A 1 144 ? 80.398  36.077 25.049  1.00 18.85 ? 149 TRP A CH2 1 
ATOM   1195 N  N   . LYS A 1 145 ? 75.299  33.414 24.204  1.00 17.37 ? 150 LYS A N   1 
ATOM   1196 C  CA  . LYS A 1 145 ? 76.026  32.631 23.206  1.00 18.88 ? 150 LYS A CA  1 
ATOM   1197 C  C   . LYS A 1 145 ? 75.146  32.366 21.989  1.00 18.77 ? 150 LYS A C   1 
ATOM   1198 O  O   . LYS A 1 145 ? 75.646  32.227 20.869  1.00 17.22 ? 150 LYS A O   1 
ATOM   1199 C  CB  . LYS A 1 145 ? 76.520  31.312 23.819  1.00 21.95 ? 150 LYS A CB  1 
ATOM   1200 C  CG  . LYS A 1 145 ? 77.578  31.520 24.899  1.00 26.90 ? 150 LYS A CG  1 
ATOM   1201 C  CD  . LYS A 1 145 ? 77.981  30.215 25.579  1.00 33.00 ? 150 LYS A CD  1 
ATOM   1202 C  CE  . LYS A 1 145 ? 79.038  30.472 26.651  1.00 35.59 ? 150 LYS A CE  1 
ATOM   1203 N  NZ  . LYS A 1 145 ? 79.361  29.255 27.456  1.00 39.79 ? 150 LYS A NZ  1 
ATOM   1204 N  N   . THR A 1 146 ? 73.835  32.295 22.203  1.00 17.20 ? 151 THR A N   1 
ATOM   1205 C  CA  . THR A 1 146 ? 72.918  32.082 21.089  1.00 18.57 ? 151 THR A CA  1 
ATOM   1206 C  C   . THR A 1 146 ? 72.938  33.341 20.213  1.00 17.43 ? 151 THR A C   1 
ATOM   1207 O  O   . THR A 1 146 ? 72.919  33.260 18.980  1.00 14.71 ? 151 THR A O   1 
ATOM   1208 C  CB  . THR A 1 146 ? 71.483  31.804 21.588  1.00 19.82 ? 151 THR A CB  1 
ATOM   1209 O  OG1 . THR A 1 146 ? 71.440  30.512 22.210  1.00 19.78 ? 151 THR A OG1 1 
ATOM   1210 C  CG2 . THR A 1 146 ? 70.500  31.832 20.435  1.00 21.50 ? 151 THR A CG2 1 
ATOM   1211 N  N   . PHE A 1 147 ? 72.986  34.503 20.861  1.00 17.11 ? 152 PHE A N   1 
ATOM   1212 C  CA  . PHE A 1 147 ? 73.044  35.778 20.149  1.00 18.00 ? 152 PHE A CA  1 
ATOM   1213 C  C   . PHE A 1 147 ? 74.325  35.811 19.320  1.00 19.12 ? 152 PHE A C   1 
ATOM   1214 O  O   . PHE A 1 147 ? 74.322  36.220 18.155  1.00 19.33 ? 152 PHE A O   1 
ATOM   1215 C  CB  . PHE A 1 147 ? 73.059  36.946 21.141  1.00 15.27 ? 152 PHE A CB  1 
ATOM   1216 C  CG  . PHE A 1 147 ? 71.698  37.477 21.485  1.00 16.98 ? 152 PHE A CG  1 
ATOM   1217 C  CD1 . PHE A 1 147 ? 70.908  38.082 20.511  1.00 17.97 ? 152 PHE A CD1 1 
ATOM   1218 C  CD2 . PHE A 1 147 ? 71.208  37.388 22.785  1.00 17.58 ? 152 PHE A CD2 1 
ATOM   1219 C  CE1 . PHE A 1 147 ? 69.648  38.594 20.828  1.00 20.19 ? 152 PHE A CE1 1 
ATOM   1220 C  CE2 . PHE A 1 147 ? 69.950  37.898 23.113  1.00 20.46 ? 152 PHE A CE2 1 
ATOM   1221 C  CZ  . PHE A 1 147 ? 69.170  38.502 22.132  1.00 18.55 ? 152 PHE A CZ  1 
ATOM   1222 N  N   . THR A 1 148 ? 75.422  35.380 19.938  1.00 20.04 ? 153 THR A N   1 
ATOM   1223 C  CA  . THR A 1 148 ? 76.718  35.354 19.272  1.00 20.58 ? 153 THR A CA  1 
ATOM   1224 C  C   . THR A 1 148 ? 76.661  34.502 18.012  1.00 21.52 ? 153 THR A C   1 
ATOM   1225 O  O   . THR A 1 148 ? 77.211  34.882 16.977  1.00 21.38 ? 153 THR A O   1 
ATOM   1226 C  CB  . THR A 1 148 ? 77.818  34.809 20.217  1.00 20.96 ? 153 THR A CB  1 
ATOM   1227 O  OG1 . THR A 1 148 ? 78.084  35.778 21.239  1.00 24.50 ? 153 THR A OG1 1 
ATOM   1228 C  CG2 . THR A 1 148 ? 79.105  34.535 19.451  1.00 24.59 ? 153 THR A CG2 1 
ATOM   1229 N  N   . ASP A 1 149 ? 75.993  33.353 18.093  1.00 22.23 ? 154 ASP A N   1 
ATOM   1230 C  CA  . ASP A 1 149 ? 75.880  32.467 16.934  1.00 23.12 ? 154 ASP A CA  1 
ATOM   1231 C  C   . ASP A 1 149 ? 75.090  33.149 15.823  1.00 22.36 ? 154 ASP A C   1 
ATOM   1232 O  O   . ASP A 1 149 ? 75.324  32.900 14.642  1.00 20.67 ? 154 ASP A O   1 
ATOM   1233 C  CB  . ASP A 1 149 ? 75.187  31.150 17.305  1.00 28.37 ? 154 ASP A CB  1 
ATOM   1234 C  CG  . ASP A 1 149 ? 76.019  30.292 18.244  1.00 33.34 ? 154 ASP A CG  1 
ATOM   1235 O  OD1 . ASP A 1 149 ? 77.244  30.172 18.023  1.00 35.45 ? 154 ASP A OD1 1 
ATOM   1236 O  OD2 . ASP A 1 149 ? 75.444  29.724 19.197  1.00 37.96 ? 154 ASP A OD2 1 
ATOM   1237 N  N   . CYS A 1 150 ? 74.133  33.989 16.210  1.00 18.91 ? 155 CYS A N   1 
ATOM   1238 C  CA  . CYS A 1 150 ? 73.324  34.722 15.241  1.00 18.28 ? 155 CYS A CA  1 
ATOM   1239 C  C   . CYS A 1 150 ? 74.190  35.810 14.593  1.00 16.96 ? 155 CYS A C   1 
ATOM   1240 O  O   . CYS A 1 150 ? 74.235  35.938 13.364  1.00 17.19 ? 155 CYS A O   1 
ATOM   1241 C  CB  . CYS A 1 150 ? 72.118  35.356 15.943  1.00 18.78 ? 155 CYS A CB  1 
ATOM   1242 S  SG  . CYS A 1 150 ? 71.062  36.379 14.884  1.00 22.36 ? 155 CYS A SG  1 
ATOM   1243 N  N   . PHE A 1 151 ? 74.885  36.579 15.428  1.00 15.41 ? 156 PHE A N   1 
ATOM   1244 C  CA  . PHE A 1 151 ? 75.756  37.658 14.955  1.00 15.09 ? 156 PHE A CA  1 
ATOM   1245 C  C   . PHE A 1 151 ? 76.821  37.172 13.964  1.00 16.67 ? 156 PHE A C   1 
ATOM   1246 O  O   . PHE A 1 151 ? 77.148  37.870 13.004  1.00 18.92 ? 156 PHE A O   1 
ATOM   1247 C  CB  . PHE A 1 151 ? 76.467  38.337 16.133  1.00 13.61 ? 156 PHE A CB  1 
ATOM   1248 C  CG  . PHE A 1 151 ? 75.544  39.048 17.101  1.00 14.22 ? 156 PHE A CG  1 
ATOM   1249 C  CD1 . PHE A 1 151 ? 74.262  39.433 16.729  1.00 14.15 ? 156 PHE A CD1 1 
ATOM   1250 C  CD2 . PHE A 1 151 ? 75.990  39.362 18.387  1.00 17.20 ? 156 PHE A CD2 1 
ATOM   1251 C  CE1 . PHE A 1 151 ? 73.436  40.123 17.622  1.00 15.98 ? 156 PHE A CE1 1 
ATOM   1252 C  CE2 . PHE A 1 151 ? 75.174  40.051 19.287  1.00 17.79 ? 156 PHE A CE2 1 
ATOM   1253 C  CZ  . PHE A 1 151 ? 73.896  40.432 18.904  1.00 16.18 ? 156 PHE A CZ  1 
ATOM   1254 N  N   . ASN A 1 152 ? 77.375  35.986 14.207  1.00 17.01 ? 157 ASN A N   1 
ATOM   1255 C  CA  . ASN A 1 152 ? 78.406  35.439 13.327  1.00 16.89 ? 157 ASN A CA  1 
ATOM   1256 C  C   . ASN A 1 152 ? 77.906  35.202 11.903  1.00 17.24 ? 157 ASN A C   1 
ATOM   1257 O  O   . ASN A 1 152 ? 78.701  34.898 11.010  1.00 17.92 ? 157 ASN A O   1 
ATOM   1258 C  CB  . ASN A 1 152 ? 78.961  34.121 13.892  1.00 16.69 ? 157 ASN A CB  1 
ATOM   1259 C  CG  . ASN A 1 152 ? 79.829  34.323 15.118  1.00 18.69 ? 157 ASN A CG  1 
ATOM   1260 O  OD1 . ASN A 1 152 ? 80.317  35.421 15.379  1.00 17.78 ? 157 ASN A OD1 1 
ATOM   1261 N  ND2 . ASN A 1 152 ? 80.043  33.248 15.871  1.00 19.31 ? 157 ASN A ND2 1 
ATOM   1262 N  N   . CYS A 1 153 ? 76.599  35.353 11.689  1.00 17.65 ? 158 CYS A N   1 
ATOM   1263 C  CA  . CYS A 1 153 ? 76.011  35.145 10.370  1.00 17.81 ? 158 CYS A CA  1 
ATOM   1264 C  C   . CYS A 1 153 ? 75.486  36.412 9.697   1.00 17.99 ? 158 CYS A C   1 
ATOM   1265 O  O   . CYS A 1 153 ? 74.925  36.354 8.605   1.00 18.36 ? 158 CYS A O   1 
ATOM   1266 C  CB  . CYS A 1 153 ? 74.886  34.111 10.456  1.00 20.72 ? 158 CYS A CB  1 
ATOM   1267 S  SG  . CYS A 1 153 ? 75.479  32.461 10.896  1.00 23.53 ? 158 CYS A SG  1 
ATOM   1268 N  N   . LEU A 1 154 ? 75.661  37.556 10.347  1.00 18.08 ? 159 LEU A N   1 
ATOM   1269 C  CA  . LEU A 1 154 ? 75.203  38.826 9.776   1.00 17.32 ? 159 LEU A CA  1 
ATOM   1270 C  C   . LEU A 1 154 ? 75.984  39.163 8.508   1.00 16.35 ? 159 LEU A C   1 
ATOM   1271 O  O   . LEU A 1 154 ? 77.157  38.820 8.399   1.00 18.53 ? 159 LEU A O   1 
ATOM   1272 C  CB  . LEU A 1 154 ? 75.420  39.954 10.779  1.00 14.62 ? 159 LEU A CB  1 
ATOM   1273 C  CG  . LEU A 1 154 ? 74.456  40.073 11.952  1.00 17.21 ? 159 LEU A CG  1 
ATOM   1274 C  CD1 . LEU A 1 154 ? 75.074  40.974 13.026  1.00 17.34 ? 159 LEU A CD1 1 
ATOM   1275 C  CD2 . LEU A 1 154 ? 73.136  40.640 11.450  1.00 15.35 ? 159 LEU A CD2 1 
ATOM   1276 N  N   . PRO A 1 155 ? 75.343  39.838 7.534   1.00 16.44 ? 160 PRO A N   1 
ATOM   1277 C  CA  . PRO A 1 155 ? 76.052  40.201 6.301   1.00 16.43 ? 160 PRO A CA  1 
ATOM   1278 C  C   . PRO A 1 155 ? 77.061  41.278 6.686   1.00 16.62 ? 160 PRO A C   1 
ATOM   1279 O  O   . PRO A 1 155 ? 76.934  41.882 7.748   1.00 14.66 ? 160 PRO A O   1 
ATOM   1280 C  CB  . PRO A 1 155 ? 74.936  40.722 5.397   1.00 15.15 ? 160 PRO A CB  1 
ATOM   1281 C  CG  . PRO A 1 155 ? 73.957  41.300 6.365   1.00 14.97 ? 160 PRO A CG  1 
ATOM   1282 C  CD  . PRO A 1 155 ? 73.931  40.256 7.470   1.00 16.04 ? 160 PRO A CD  1 
ATOM   1283 N  N   . ILE A 1 156 ? 78.043  41.537 5.828   1.00 17.16 ? 161 ILE A N   1 
ATOM   1284 C  CA  . ILE A 1 156 ? 79.090  42.503 6.160   1.00 17.28 ? 161 ILE A CA  1 
ATOM   1285 C  C   . ILE A 1 156 ? 79.050  43.848 5.446   1.00 18.14 ? 161 ILE A C   1 
ATOM   1286 O  O   . ILE A 1 156 ? 79.587  44.839 5.946   1.00 16.83 ? 161 ILE A O   1 
ATOM   1287 C  CB  . ILE A 1 156 ? 80.485  41.873 5.928   1.00 17.32 ? 161 ILE A CB  1 
ATOM   1288 C  CG1 . ILE A 1 156 ? 80.586  40.555 6.702   1.00 17.65 ? 161 ILE A CG1 1 
ATOM   1289 C  CG2 . ILE A 1 156 ? 81.579  42.831 6.376   1.00 17.27 ? 161 ILE A CG2 1 
ATOM   1290 C  CD1 . ILE A 1 156 ? 80.293  40.706 8.191   1.00 14.42 ? 161 ILE A CD1 1 
ATOM   1291 N  N   . ALA A 1 157 ? 78.430  43.888 4.274   1.00 18.80 ? 162 ALA A N   1 
ATOM   1292 C  CA  . ALA A 1 157 ? 78.358  45.132 3.527   1.00 18.57 ? 162 ALA A CA  1 
ATOM   1293 C  C   . ALA A 1 157 ? 77.190  45.104 2.566   1.00 19.97 ? 162 ALA A C   1 
ATOM   1294 O  O   . ALA A 1 157 ? 76.580  44.058 2.340   1.00 19.95 ? 162 ALA A O   1 
ATOM   1295 C  CB  . ALA A 1 157 ? 79.658  45.361 2.762   1.00 19.49 ? 162 ALA A CB  1 
ATOM   1296 N  N   . ALA A 1 158 ? 76.882  46.269 2.010   1.00 20.07 ? 163 ALA A N   1 
ATOM   1297 C  CA  . ALA A 1 158 ? 75.796  46.408 1.057   1.00 21.63 ? 163 ALA A CA  1 
ATOM   1298 C  C   . ALA A 1 158 ? 76.126  47.519 0.073   1.00 24.42 ? 163 ALA A C   1 
ATOM   1299 O  O   . ALA A 1 158 ? 76.863  48.456 0.389   1.00 24.80 ? 163 ALA A O   1 
ATOM   1300 C  CB  . ALA A 1 158 ? 74.496  46.736 1.781   1.00 21.47 ? 163 ALA A CB  1 
ATOM   1301 N  N   . ILE A 1 159 ? 75.585  47.403 -1.129  1.00 23.81 ? 164 ILE A N   1 
ATOM   1302 C  CA  . ILE A 1 159 ? 75.786  48.423 -2.138  1.00 25.07 ? 164 ILE A CA  1 
ATOM   1303 C  C   . ILE A 1 159 ? 74.390  48.864 -2.526  1.00 24.23 ? 164 ILE A C   1 
ATOM   1304 O  O   . ILE A 1 159 ? 73.547  48.040 -2.889  1.00 25.47 ? 164 ILE A O   1 
ATOM   1305 C  CB  . ILE A 1 159 ? 76.535  47.874 -3.372  1.00 25.18 ? 164 ILE A CB  1 
ATOM   1306 C  CG1 . ILE A 1 159 ? 77.938  47.422 -2.956  1.00 25.77 ? 164 ILE A CG1 1 
ATOM   1307 C  CG2 . ILE A 1 159 ? 76.615  48.951 -4.449  1.00 25.05 ? 164 ILE A CG2 1 
ATOM   1308 C  CD1 . ILE A 1 159 ? 78.799  46.887 -4.093  1.00 27.77 ? 164 ILE A CD1 1 
ATOM   1309 N  N   . VAL A 1 160 ? 74.133  50.159 -2.404  1.00 25.43 ? 165 VAL A N   1 
ATOM   1310 C  CA  . VAL A 1 160 ? 72.830  50.700 -2.742  1.00 25.51 ? 165 VAL A CA  1 
ATOM   1311 C  C   . VAL A 1 160 ? 72.884  51.311 -4.135  1.00 26.51 ? 165 VAL A C   1 
ATOM   1312 O  O   . VAL A 1 160 ? 73.685  52.212 -4.404  1.00 24.85 ? 165 VAL A O   1 
ATOM   1313 C  CB  . VAL A 1 160 ? 72.389  51.761 -1.718  1.00 25.93 ? 165 VAL A CB  1 
ATOM   1314 C  CG1 . VAL A 1 160 ? 71.052  52.360 -2.125  1.00 26.68 ? 165 VAL A CG1 1 
ATOM   1315 C  CG2 . VAL A 1 160 ? 72.277  51.118 -0.338  1.00 28.40 ? 165 VAL A CG2 1 
ATOM   1316 N  N   . ASP A 1 161 ? 72.040  50.785 -5.015  1.00 26.46 ? 166 ASP A N   1 
ATOM   1317 C  CA  . ASP A 1 161 ? 71.951  51.241 -6.396  1.00 29.00 ? 166 ASP A CA  1 
ATOM   1318 C  C   . ASP A 1 161 ? 73.295  51.340 -7.106  1.00 29.40 ? 166 ASP A C   1 
ATOM   1319 O  O   . ASP A 1 161 ? 73.544  52.287 -7.851  1.00 29.57 ? 166 ASP A O   1 
ATOM   1320 C  CB  . ASP A 1 161 ? 71.228  52.587 -6.455  1.00 30.75 ? 166 ASP A CB  1 
ATOM   1321 C  CG  . ASP A 1 161 ? 69.774  52.477 -6.045  1.00 32.64 ? 166 ASP A CG  1 
ATOM   1322 O  OD1 . ASP A 1 161 ? 69.055  51.648 -6.641  1.00 34.36 ? 166 ASP A OD1 1 
ATOM   1323 O  OD2 . ASP A 1 161 ? 69.349  53.212 -5.130  1.00 34.81 ? 166 ASP A OD2 1 
ATOM   1324 N  N   . GLU A 1 162 ? 74.157  50.356 -6.867  1.00 28.92 ? 167 GLU A N   1 
ATOM   1325 C  CA  . GLU A 1 162 ? 75.472  50.306 -7.499  1.00 29.12 ? 167 GLU A CA  1 
ATOM   1326 C  C   . GLU A 1 162 ? 76.300  51.566 -7.282  1.00 27.72 ? 167 GLU A C   1 
ATOM   1327 O  O   . GLU A 1 162 ? 77.293  51.782 -7.977  1.00 27.17 ? 167 GLU A O   1 
ATOM   1328 C  CB  . GLU A 1 162 ? 75.312  50.088 -9.005  1.00 32.01 ? 167 GLU A CB  1 
ATOM   1329 C  CG  . GLU A 1 162 ? 74.552  48.838 -9.396  1.00 35.26 ? 167 GLU A CG  1 
ATOM   1330 C  CD  . GLU A 1 162 ? 74.294  48.774 -10.893 1.00 37.86 ? 167 GLU A CD  1 
ATOM   1331 O  OE1 . GLU A 1 162 ? 73.578  49.660 -11.408 1.00 41.21 ? 167 GLU A OE1 1 
ATOM   1332 O  OE2 . GLU A 1 162 ? 74.808  47.848 -11.554 1.00 37.20 ? 167 GLU A OE2 1 
ATOM   1333 N  N   . LYS A 1 163 ? 75.916  52.397 -6.324  1.00 26.22 ? 168 LYS A N   1 
ATOM   1334 C  CA  . LYS A 1 163 ? 76.659  53.629 -6.107  1.00 23.81 ? 168 LYS A CA  1 
ATOM   1335 C  C   . LYS A 1 163 ? 77.152  53.883 -4.694  1.00 23.74 ? 168 LYS A C   1 
ATOM   1336 O  O   . LYS A 1 163 ? 78.198  54.519 -4.509  1.00 21.04 ? 168 LYS A O   1 
ATOM   1337 C  CB  . LYS A 1 163 ? 75.821  54.822 -6.575  1.00 25.49 ? 168 LYS A CB  1 
ATOM   1338 C  CG  . LYS A 1 163 ? 75.588  54.848 -8.083  1.00 28.56 ? 168 LYS A CG  1 
ATOM   1339 C  CD  . LYS A 1 163 ? 76.906  54.828 -8.844  1.00 30.00 ? 168 LYS A CD  1 
ATOM   1340 C  CE  . LYS A 1 163 ? 76.686  54.867 -10.354 1.00 33.51 ? 168 LYS A CE  1 
ATOM   1341 N  NZ  . LYS A 1 163 ? 77.970  54.715 -11.100 1.00 32.95 ? 168 LYS A NZ  1 
ATOM   1342 N  N   . ILE A 1 164 ? 76.413  53.399 -3.700  1.00 20.98 ? 169 ILE A N   1 
ATOM   1343 C  CA  . ILE A 1 164 ? 76.806  53.619 -2.312  1.00 21.91 ? 169 ILE A CA  1 
ATOM   1344 C  C   . ILE A 1 164 ? 77.282  52.351 -1.607  1.00 20.86 ? 169 ILE A C   1 
ATOM   1345 O  O   . ILE A 1 164 ? 76.499  51.434 -1.362  1.00 19.51 ? 169 ILE A O   1 
ATOM   1346 C  CB  . ILE A 1 164 ? 75.647  54.215 -1.491  1.00 22.95 ? 169 ILE A CB  1 
ATOM   1347 C  CG1 . ILE A 1 164 ? 75.071  55.438 -2.209  1.00 23.83 ? 169 ILE A CG1 1 
ATOM   1348 C  CG2 . ILE A 1 164 ? 76.152  54.638 -0.108  1.00 22.94 ? 169 ILE A CG2 1 
ATOM   1349 C  CD1 . ILE A 1 164 ? 73.789  55.957 -1.600  1.00 21.40 ? 169 ILE A CD1 1 
ATOM   1350 N  N   . PHE A 1 165 ? 78.572  52.310 -1.285  1.00 20.70 ? 170 PHE A N   1 
ATOM   1351 C  CA  . PHE A 1 165 ? 79.149  51.170 -0.583  1.00 18.05 ? 170 PHE A CA  1 
ATOM   1352 C  C   . PHE A 1 165 ? 78.950  51.379 0.918   1.00 19.47 ? 170 PHE A C   1 
ATOM   1353 O  O   . PHE A 1 165 ? 79.411  52.377 1.485   1.00 18.19 ? 170 PHE A O   1 
ATOM   1354 C  CB  . PHE A 1 165 ? 80.641  51.054 -0.877  1.00 18.03 ? 170 PHE A CB  1 
ATOM   1355 C  CG  . PHE A 1 165 ? 81.298  49.874 -0.208  1.00 17.90 ? 170 PHE A CG  1 
ATOM   1356 C  CD1 . PHE A 1 165 ? 81.201  48.598 -0.759  1.00 18.93 ? 170 PHE A CD1 1 
ATOM   1357 C  CD2 . PHE A 1 165 ? 81.985  50.035 0.989   1.00 18.33 ? 170 PHE A CD2 1 
ATOM   1358 C  CE1 . PHE A 1 165 ? 81.780  47.497 -0.125  1.00 20.40 ? 170 PHE A CE1 1 
ATOM   1359 C  CE2 . PHE A 1 165 ? 82.569  48.940 1.636   1.00 19.55 ? 170 PHE A CE2 1 
ATOM   1360 C  CZ  . PHE A 1 165 ? 82.467  47.670 1.078   1.00 18.24 ? 170 PHE A CZ  1 
ATOM   1361 N  N   . CYS A 1 166 ? 78.277  50.429 1.558   1.00 18.17 ? 171 CYS A N   1 
ATOM   1362 C  CA  . CYS A 1 166 ? 78.010  50.518 2.986   1.00 17.81 ? 171 CYS A CA  1 
ATOM   1363 C  C   . CYS A 1 166 ? 78.643  49.387 3.796   1.00 17.70 ? 171 CYS A C   1 
ATOM   1364 O  O   . CYS A 1 166 ? 78.589  48.223 3.407   1.00 18.85 ? 171 CYS A O   1 
ATOM   1365 C  CB  . CYS A 1 166 ? 76.503  50.499 3.231   1.00 19.47 ? 171 CYS A CB  1 
ATOM   1366 S  SG  . CYS A 1 166 ? 75.576  51.723 2.293   1.00 22.53 ? 171 CYS A SG  1 
ATOM   1367 N  N   . CYS A 1 167 ? 79.224  49.746 4.934   1.00 17.51 ? 172 CYS A N   1 
ATOM   1368 C  CA  . CYS A 1 167 ? 79.840  48.785 5.843   1.00 16.93 ? 172 CYS A CA  1 
ATOM   1369 C  C   . CYS A 1 167 ? 79.949  49.494 7.180   1.00 16.23 ? 172 CYS A C   1 
ATOM   1370 O  O   . CYS A 1 167 ? 79.662  50.686 7.270   1.00 16.03 ? 172 CYS A O   1 
ATOM   1371 C  CB  . CYS A 1 167 ? 81.221  48.351 5.346   1.00 16.69 ? 172 CYS A CB  1 
ATOM   1372 S  SG  . CYS A 1 167 ? 82.462  49.649 5.280   1.00 20.46 ? 172 CYS A SG  1 
ATOM   1373 N  N   . HIS A 1 168 ? 80.362  48.785 8.219   1.00 15.87 ? 173 HIS A N   1 
ATOM   1374 C  CA  . HIS A 1 168 ? 80.444  49.422 9.525   1.00 15.60 ? 173 HIS A CA  1 
ATOM   1375 C  C   . HIS A 1 168 ? 81.676  50.298 9.732   1.00 15.17 ? 173 HIS A C   1 
ATOM   1376 O  O   . HIS A 1 168 ? 81.552  51.487 10.027  1.00 14.37 ? 173 HIS A O   1 
ATOM   1377 C  CB  . HIS A 1 168 ? 80.387  48.383 10.642  1.00 15.51 ? 173 HIS A CB  1 
ATOM   1378 C  CG  . HIS A 1 168 ? 80.306  48.996 12.004  1.00 14.25 ? 173 HIS A CG  1 
ATOM   1379 N  ND1 . HIS A 1 168 ? 79.201  49.696 12.433  1.00 15.05 ? 173 HIS A ND1 1 
ATOM   1380 C  CD2 . HIS A 1 168 ? 81.215  49.074 13.004  1.00 14.92 ? 173 HIS A CD2 1 
ATOM   1381 C  CE1 . HIS A 1 168 ? 79.434  50.186 13.637  1.00 15.14 ? 173 HIS A CE1 1 
ATOM   1382 N  NE2 . HIS A 1 168 ? 80.648  49.823 14.006  1.00 15.65 ? 173 HIS A NE2 1 
ATOM   1383 N  N   . GLY A 1 169 ? 82.855  49.701 9.582   1.00 13.92 ? 174 GLY A N   1 
ATOM   1384 C  CA  . GLY A 1 169 ? 84.095  50.431 9.773   1.00 15.28 ? 174 GLY A CA  1 
ATOM   1385 C  C   . GLY A 1 169 ? 84.579  51.148 8.528   1.00 16.75 ? 174 GLY A C   1 
ATOM   1386 O  O   . GLY A 1 169 ? 84.315  52.337 8.345   1.00 16.31 ? 174 GLY A O   1 
ATOM   1387 N  N   . GLY A 1 170 ? 85.295  50.435 7.666   1.00 15.15 ? 175 GLY A N   1 
ATOM   1388 C  CA  . GLY A 1 170 ? 85.793  51.069 6.461   1.00 17.19 ? 175 GLY A CA  1 
ATOM   1389 C  C   . GLY A 1 170 ? 86.556  50.151 5.528   1.00 18.58 ? 175 GLY A C   1 
ATOM   1390 O  O   . GLY A 1 170 ? 86.302  48.947 5.476   1.00 18.35 ? 175 GLY A O   1 
ATOM   1391 N  N   . LEU A 1 171 ? 87.503  50.724 4.795   1.00 17.48 ? 176 LEU A N   1 
ATOM   1392 C  CA  . LEU A 1 171 ? 88.286  49.959 3.834   1.00 17.36 ? 176 LEU A CA  1 
ATOM   1393 C  C   . LEU A 1 171 ? 89.433  49.164 4.453   1.00 19.20 ? 176 LEU A C   1 
ATOM   1394 O  O   . LEU A 1 171 ? 89.769  49.313 5.639   1.00 16.82 ? 176 LEU A O   1 
ATOM   1395 C  CB  . LEU A 1 171 ? 88.827  50.893 2.739   1.00 17.66 ? 176 LEU A CB  1 
ATOM   1396 C  CG  . LEU A 1 171 ? 87.758  51.721 2.012   1.00 17.23 ? 176 LEU A CG  1 
ATOM   1397 C  CD1 . LEU A 1 171 ? 88.405  52.588 0.934   1.00 17.10 ? 176 LEU A CD1 1 
ATOM   1398 C  CD2 . LEU A 1 171 ? 86.732  50.790 1.395   1.00 16.91 ? 176 LEU A CD2 1 
ATOM   1399 N  N   . SER A 1 172 ? 90.043  48.326 3.621   1.00 19.41 ? 177 SER A N   1 
ATOM   1400 C  CA  . SER A 1 172 ? 91.137  47.470 4.043   1.00 19.09 ? 177 SER A CA  1 
ATOM   1401 C  C   . SER A 1 172 ? 92.246  47.456 2.996   1.00 18.96 ? 177 SER A C   1 
ATOM   1402 O  O   . SER A 1 172 ? 91.977  47.478 1.800   1.00 17.23 ? 177 SER A O   1 
ATOM   1403 C  CB  . SER A 1 172 ? 90.611  46.045 4.238   1.00 17.92 ? 177 SER A CB  1 
ATOM   1404 O  OG  . SER A 1 172 ? 91.668  45.132 4.457   1.00 19.09 ? 177 SER A OG  1 
ATOM   1405 N  N   . PRO A 1 173 ? 93.513  47.440 3.432   1.00 21.37 ? 178 PRO A N   1 
ATOM   1406 C  CA  . PRO A 1 173 ? 94.556  47.412 2.403   1.00 23.02 ? 178 PRO A CA  1 
ATOM   1407 C  C   . PRO A 1 173 ? 94.484  46.100 1.609   1.00 23.26 ? 178 PRO A C   1 
ATOM   1408 O  O   . PRO A 1 173 ? 95.112  45.967 0.561   1.00 22.14 ? 178 PRO A O   1 
ATOM   1409 C  CB  . PRO A 1 173 ? 95.849  47.554 3.207   1.00 21.13 ? 178 PRO A CB  1 
ATOM   1410 C  CG  . PRO A 1 173 ? 95.488  46.999 4.559   1.00 23.59 ? 178 PRO A CG  1 
ATOM   1411 C  CD  . PRO A 1 173 ? 94.093  47.536 4.782   1.00 21.76 ? 178 PRO A CD  1 
ATOM   1412 N  N   . ASP A 1 174 ? 93.698  45.146 2.111   1.00 24.66 ? 179 ASP A N   1 
ATOM   1413 C  CA  . ASP A 1 174 ? 93.530  43.843 1.455   1.00 26.18 ? 179 ASP A CA  1 
ATOM   1414 C  C   . ASP A 1 174 ? 92.354  43.795 0.474   1.00 27.17 ? 179 ASP A C   1 
ATOM   1415 O  O   . ASP A 1 174 ? 92.241  42.862 -0.326  1.00 25.75 ? 179 ASP A O   1 
ATOM   1416 C  CB  . ASP A 1 174 ? 93.319  42.737 2.494   1.00 26.03 ? 179 ASP A CB  1 
ATOM   1417 C  CG  . ASP A 1 174 ? 94.563  42.451 3.308   1.00 27.92 ? 179 ASP A CG  1 
ATOM   1418 O  OD1 . ASP A 1 174 ? 95.668  42.448 2.724   1.00 27.17 ? 179 ASP A OD1 1 
ATOM   1419 O  OD2 . ASP A 1 174 ? 94.431  42.212 4.527   1.00 26.69 ? 179 ASP A OD2 1 
ATOM   1420 N  N   . LEU A 1 175 ? 91.477  44.790 0.543   1.00 27.24 ? 180 LEU A N   1 
ATOM   1421 C  CA  . LEU A 1 175 ? 90.306  44.831 -0.323  1.00 27.88 ? 180 LEU A CA  1 
ATOM   1422 C  C   . LEU A 1 175 ? 90.616  45.314 -1.738  1.00 30.56 ? 180 LEU A C   1 
ATOM   1423 O  O   . LEU A 1 175 ? 90.772  46.517 -1.981  1.00 29.00 ? 180 LEU A O   1 
ATOM   1424 C  CB  . LEU A 1 175 ? 89.230  45.716 0.314   1.00 27.19 ? 180 LEU A CB  1 
ATOM   1425 C  CG  . LEU A 1 175 ? 87.894  45.891 -0.411  1.00 26.49 ? 180 LEU A CG  1 
ATOM   1426 C  CD1 . LEU A 1 175 ? 87.246  44.530 -0.667  1.00 22.51 ? 180 LEU A CD1 1 
ATOM   1427 C  CD2 . LEU A 1 175 ? 86.987  46.778 0.436   1.00 24.99 ? 180 LEU A CD2 1 
ATOM   1428 N  N   . GLN A 1 176 ? 90.691  44.364 -2.668  1.00 32.62 ? 181 GLN A N   1 
ATOM   1429 C  CA  . GLN A 1 176 ? 90.974  44.658 -4.073  1.00 34.94 ? 181 GLN A CA  1 
ATOM   1430 C  C   . GLN A 1 176 ? 89.737  44.513 -4.954  1.00 35.11 ? 181 GLN A C   1 
ATOM   1431 O  O   . GLN A 1 176 ? 89.512  45.317 -5.863  1.00 35.31 ? 181 GLN A O   1 
ATOM   1432 C  CB  . GLN A 1 176 ? 92.065  43.726 -4.605  1.00 37.84 ? 181 GLN A CB  1 
ATOM   1433 C  CG  . GLN A 1 176 ? 93.440  43.969 -4.025  1.00 41.19 ? 181 GLN A CG  1 
ATOM   1434 C  CD  . GLN A 1 176 ? 94.502  43.130 -4.709  1.00 44.44 ? 181 GLN A CD  1 
ATOM   1435 O  OE1 . GLN A 1 176 ? 94.512  41.903 -4.593  1.00 45.00 ? 181 GLN A OE1 1 
ATOM   1436 N  NE2 . GLN A 1 176 ? 95.398  43.790 -5.437  1.00 46.55 ? 181 GLN A NE2 1 
ATOM   1437 N  N   . SER A 1 177 ? 88.945  43.476 -4.700  1.00 34.92 ? 182 SER A N   1 
ATOM   1438 C  CA  . SER A 1 177 ? 87.739  43.253 -5.482  1.00 34.78 ? 182 SER A CA  1 
ATOM   1439 C  C   . SER A 1 177 ? 86.537  42.992 -4.591  1.00 34.94 ? 182 SER A C   1 
ATOM   1440 O  O   . SER A 1 177 ? 86.673  42.561 -3.440  1.00 33.28 ? 182 SER A O   1 
ATOM   1441 C  CB  . SER A 1 177 ? 87.923  42.069 -6.431  1.00 35.90 ? 182 SER A CB  1 
ATOM   1442 O  OG  . SER A 1 177 ? 87.888  40.843 -5.723  1.00 39.22 ? 182 SER A OG  1 
ATOM   1443 N  N   . MET A 1 178 ? 85.357  43.246 -5.141  1.00 34.40 ? 183 MET A N   1 
ATOM   1444 C  CA  . MET A 1 178 ? 84.115  43.046 -4.415  1.00 36.10 ? 183 MET A CA  1 
ATOM   1445 C  C   . MET A 1 178 ? 83.909  41.547 -4.221  1.00 36.74 ? 183 MET A C   1 
ATOM   1446 O  O   . MET A 1 178 ? 83.176  41.115 -3.329  1.00 37.28 ? 183 MET A O   1 
ATOM   1447 C  CB  . MET A 1 178 ? 82.956  43.659 -5.206  1.00 35.54 ? 183 MET A CB  1 
ATOM   1448 C  CG  . MET A 1 178 ? 81.982  44.463 -4.360  1.00 35.45 ? 183 MET A CG  1 
ATOM   1449 S  SD  . MET A 1 178 ? 82.797  45.702 -3.324  1.00 30.49 ? 183 MET A SD  1 
ATOM   1450 C  CE  . MET A 1 178 ? 82.417  47.202 -4.197  1.00 32.42 ? 183 MET A CE  1 
ATOM   1451 N  N   . GLU A 1 179 ? 84.571  40.755 -5.059  1.00 36.48 ? 184 GLU A N   1 
ATOM   1452 C  CA  . GLU A 1 179 ? 84.473  39.304 -4.975  1.00 36.12 ? 184 GLU A CA  1 
ATOM   1453 C  C   . GLU A 1 179 ? 85.027  38.796 -3.654  1.00 35.04 ? 184 GLU A C   1 
ATOM   1454 O  O   . GLU A 1 179 ? 84.503  37.842 -3.076  1.00 34.98 ? 184 GLU A O   1 
ATOM   1455 C  CB  . GLU A 1 179 ? 85.230  38.652 -6.134  1.00 38.49 ? 184 GLU A CB  1 
ATOM   1456 C  CG  . GLU A 1 179 ? 84.358  38.334 -7.328  1.00 41.54 ? 184 GLU A CG  1 
ATOM   1457 C  CD  . GLU A 1 179 ? 83.277  37.323 -6.995  1.00 42.05 ? 184 GLU A CD  1 
ATOM   1458 O  OE1 . GLU A 1 179 ? 83.618  36.227 -6.504  1.00 43.14 ? 184 GLU A OE1 1 
ATOM   1459 O  OE2 . GLU A 1 179 ? 82.087  37.622 -7.227  1.00 43.38 ? 184 GLU A OE2 1 
ATOM   1460 N  N   . GLN A 1 180 ? 86.095  39.435 -3.185  1.00 33.37 ? 185 GLN A N   1 
ATOM   1461 C  CA  . GLN A 1 180 ? 86.720  39.057 -1.925  1.00 32.07 ? 185 GLN A CA  1 
ATOM   1462 C  C   . GLN A 1 180 ? 85.714  39.069 -0.789  1.00 31.39 ? 185 GLN A C   1 
ATOM   1463 O  O   . GLN A 1 180 ? 85.766  38.225 0.104   1.00 30.96 ? 185 GLN A O   1 
ATOM   1464 C  CB  . GLN A 1 180 ? 87.852  40.017 -1.583  1.00 32.33 ? 185 GLN A CB  1 
ATOM   1465 C  CG  . GLN A 1 180 ? 89.150  39.717 -2.275  1.00 32.76 ? 185 GLN A CG  1 
ATOM   1466 C  CD  . GLN A 1 180 ? 90.180  40.778 -2.002  1.00 32.98 ? 185 GLN A CD  1 
ATOM   1467 O  OE1 . GLN A 1 180 ? 90.103  41.879 -2.543  1.00 32.79 ? 185 GLN A OE1 1 
ATOM   1468 N  NE2 . GLN A 1 180 ? 91.145  40.463 -1.142  1.00 34.46 ? 185 GLN A NE2 1 
ATOM   1469 N  N   . ILE A 1 181 ? 84.809  40.042 -0.819  1.00 29.97 ? 186 ILE A N   1 
ATOM   1470 C  CA  . ILE A 1 181 ? 83.796  40.159 0.218   1.00 28.39 ? 186 ILE A CA  1 
ATOM   1471 C  C   . ILE A 1 181 ? 82.780  39.047 0.026   1.00 29.06 ? 186 ILE A C   1 
ATOM   1472 O  O   . ILE A 1 181 ? 82.512  38.264 0.936   1.00 25.28 ? 186 ILE A O   1 
ATOM   1473 C  CB  . ILE A 1 181 ? 83.039  41.503 0.134   1.00 27.67 ? 186 ILE A CB  1 
ATOM   1474 C  CG1 . ILE A 1 181 ? 84.027  42.675 0.147   1.00 30.02 ? 186 ILE A CG1 1 
ATOM   1475 C  CG2 . ILE A 1 181 ? 82.056  41.619 1.300   1.00 28.26 ? 186 ILE A CG2 1 
ATOM   1476 C  CD1 . ILE A 1 181 ? 84.892  42.734 1.380   1.00 32.93 ? 186 ILE A CD1 1 
ATOM   1477 N  N   . ARG A 1 182 ? 82.230  38.990 -1.181  1.00 29.79 ? 187 ARG A N   1 
ATOM   1478 C  CA  . ARG A 1 182 ? 81.219  38.008 -1.533  1.00 32.97 ? 187 ARG A CA  1 
ATOM   1479 C  C   . ARG A 1 182 ? 81.630  36.571 -1.209  1.00 33.01 ? 187 ARG A C   1 
ATOM   1480 O  O   . ARG A 1 182 ? 80.772  35.720 -0.972  1.00 35.32 ? 187 ARG A O   1 
ATOM   1481 C  CB  . ARG A 1 182 ? 80.875  38.147 -3.023  1.00 33.97 ? 187 ARG A CB  1 
ATOM   1482 C  CG  . ARG A 1 182 ? 79.525  37.564 -3.404  1.00 37.66 ? 187 ARG A CG  1 
ATOM   1483 C  CD  . ARG A 1 182 ? 79.177  37.784 -4.877  1.00 38.91 ? 187 ARG A CD  1 
ATOM   1484 N  NE  . ARG A 1 182 ? 78.876  39.176 -5.220  1.00 40.41 ? 187 ARG A NE  1 
ATOM   1485 C  CZ  . ARG A 1 182 ? 79.784  40.086 -5.566  1.00 41.76 ? 187 ARG A CZ  1 
ATOM   1486 N  NH1 . ARG A 1 182 ? 81.069  39.762 -5.616  1.00 42.67 ? 187 ARG A NH1 1 
ATOM   1487 N  NH2 . ARG A 1 182 ? 79.404  41.320 -5.881  1.00 40.75 ? 187 ARG A NH2 1 
ATOM   1488 N  N   . ARG A 1 183 ? 82.934  36.303 -1.175  1.00 33.35 ? 188 ARG A N   1 
ATOM   1489 C  CA  . ARG A 1 183 ? 83.427  34.957 -0.890  1.00 34.57 ? 188 ARG A CA  1 
ATOM   1490 C  C   . ARG A 1 183 ? 83.653  34.635 0.586   1.00 33.50 ? 188 ARG A C   1 
ATOM   1491 O  O   . ARG A 1 183 ? 84.051  33.519 0.919   1.00 34.75 ? 188 ARG A O   1 
ATOM   1492 C  CB  . ARG A 1 183 ? 84.729  34.685 -1.658  1.00 37.16 ? 188 ARG A CB  1 
ATOM   1493 C  CG  . ARG A 1 183 ? 84.588  34.729 -3.173  1.00 41.91 ? 188 ARG A CG  1 
ATOM   1494 C  CD  . ARG A 1 183 ? 85.761  34.034 -3.859  1.00 43.86 ? 188 ARG A CD  1 
ATOM   1495 N  NE  . ARG A 1 183 ? 87.051  34.639 -3.537  1.00 45.42 ? 188 ARG A NE  1 
ATOM   1496 C  CZ  . ARG A 1 183 ? 87.539  35.723 -4.129  1.00 45.22 ? 188 ARG A CZ  1 
ATOM   1497 N  NH1 . ARG A 1 183 ? 86.844  36.328 -5.084  1.00 46.23 ? 188 ARG A NH1 1 
ATOM   1498 N  NH2 . ARG A 1 183 ? 88.723  36.201 -3.770  1.00 44.47 ? 188 ARG A NH2 1 
ATOM   1499 N  N   . ILE A 1 184 ? 83.417  35.601 1.469   1.00 31.40 ? 189 ILE A N   1 
ATOM   1500 C  CA  . ILE A 1 184 ? 83.593  35.367 2.903   1.00 30.12 ? 189 ILE A CA  1 
ATOM   1501 C  C   . ILE A 1 184 ? 82.544  34.356 3.359   1.00 28.96 ? 189 ILE A C   1 
ATOM   1502 O  O   . ILE A 1 184 ? 81.360  34.515 3.068   1.00 26.22 ? 189 ILE A O   1 
ATOM   1503 C  CB  . ILE A 1 184 ? 83.406  36.668 3.724   1.00 30.00 ? 189 ILE A CB  1 
ATOM   1504 C  CG1 . ILE A 1 184 ? 84.398  37.737 3.255   1.00 31.19 ? 189 ILE A CG1 1 
ATOM   1505 C  CG2 . ILE A 1 184 ? 83.596  36.379 5.205   1.00 28.69 ? 189 ILE A CG2 1 
ATOM   1506 C  CD1 . ILE A 1 184 ? 85.842  37.327 3.355   1.00 32.39 ? 189 ILE A CD1 1 
ATOM   1507 N  N   . MET A 1 185 ? 82.979  33.321 4.072   1.00 28.52 ? 190 MET A N   1 
ATOM   1508 C  CA  . MET A 1 185 ? 82.063  32.288 4.543   1.00 29.76 ? 190 MET A CA  1 
ATOM   1509 C  C   . MET A 1 185 ? 81.513  32.553 5.943   1.00 26.78 ? 190 MET A C   1 
ATOM   1510 O  O   . MET A 1 185 ? 82.194  33.121 6.791   1.00 25.71 ? 190 MET A O   1 
ATOM   1511 C  CB  . MET A 1 185 ? 82.764  30.925 4.518   1.00 34.51 ? 190 MET A CB  1 
ATOM   1512 C  CG  . MET A 1 185 ? 83.215  30.502 3.130   1.00 41.26 ? 190 MET A CG  1 
ATOM   1513 S  SD  . MET A 1 185 ? 84.240  29.019 3.145   1.00 51.95 ? 190 MET A SD  1 
ATOM   1514 C  CE  . MET A 1 185 ? 85.866  29.723 3.528   1.00 48.29 ? 190 MET A CE  1 
ATOM   1515 N  N   . ARG A 1 186 ? 80.267  32.141 6.162   1.00 24.95 ? 191 ARG A N   1 
ATOM   1516 C  CA  . ARG A 1 186 ? 79.596  32.289 7.448   1.00 24.21 ? 191 ARG A CA  1 
ATOM   1517 C  C   . ARG A 1 186 ? 79.087  30.912 7.877   1.00 24.59 ? 191 ARG A C   1 
ATOM   1518 O  O   . ARG A 1 186 ? 78.820  30.062 7.036   1.00 26.06 ? 191 ARG A O   1 
ATOM   1519 C  CB  . ARG A 1 186 ? 78.412  33.255 7.324   1.00 22.19 ? 191 ARG A CB  1 
ATOM   1520 C  CG  . ARG A 1 186 ? 78.814  34.704 7.092   1.00 22.95 ? 191 ARG A CG  1 
ATOM   1521 C  CD  . ARG A 1 186 ? 77.598  35.572 6.809   1.00 22.93 ? 191 ARG A CD  1 
ATOM   1522 N  NE  . ARG A 1 186 ? 76.984  35.219 5.531   1.00 23.19 ? 191 ARG A NE  1 
ATOM   1523 C  CZ  . ARG A 1 186 ? 75.868  35.764 5.060   1.00 23.67 ? 191 ARG A CZ  1 
ATOM   1524 N  NH1 . ARG A 1 186 ? 75.225  36.696 5.760   1.00 21.11 ? 191 ARG A NH1 1 
ATOM   1525 N  NH2 . ARG A 1 186 ? 75.395  35.377 3.884   1.00 20.95 ? 191 ARG A NH2 1 
ATOM   1526 N  N   . PRO A 1 187 ? 78.938  30.679 9.190   1.00 25.00 ? 192 PRO A N   1 
ATOM   1527 C  CA  . PRO A 1 187 ? 79.214  31.628 10.269  1.00 24.92 ? 192 PRO A CA  1 
ATOM   1528 C  C   . PRO A 1 187 ? 80.695  31.889 10.427  1.00 26.34 ? 192 PRO A C   1 
ATOM   1529 O  O   . PRO A 1 187 ? 81.534  31.084 10.012  1.00 25.59 ? 192 PRO A O   1 
ATOM   1530 C  CB  . PRO A 1 187 ? 78.631  30.934 11.496  1.00 25.68 ? 192 PRO A CB  1 
ATOM   1531 C  CG  . PRO A 1 187 ? 78.867  29.487 11.185  1.00 25.04 ? 192 PRO A CG  1 
ATOM   1532 C  CD  . PRO A 1 187 ? 78.427  29.410 9.739   1.00 25.39 ? 192 PRO A CD  1 
ATOM   1533 N  N   . THR A 1 188 ? 81.015  33.027 11.024  1.00 25.10 ? 193 THR A N   1 
ATOM   1534 C  CA  . THR A 1 188 ? 82.400  33.363 11.253  1.00 25.99 ? 193 THR A CA  1 
ATOM   1535 C  C   . THR A 1 188 ? 82.587  34.352 12.373  1.00 27.49 ? 193 THR A C   1 
ATOM   1536 O  O   . THR A 1 188 ? 81.847  35.332 12.491  1.00 24.16 ? 193 THR A O   1 
ATOM   1537 C  CB  . THR A 1 188 ? 83.066  33.984 10.010  1.00 27.08 ? 193 THR A CB  1 
ATOM   1538 O  OG1 . THR A 1 188 ? 84.428  34.309 10.322  1.00 25.86 ? 193 THR A OG1 1 
ATOM   1539 C  CG2 . THR A 1 188 ? 82.348  35.269 9.593   1.00 24.82 ? 193 THR A CG2 1 
ATOM   1540 N  N   . ASP A 1 189 ? 83.549  34.060 13.232  1.00 28.31 ? 194 ASP A N   1 
ATOM   1541 C  CA  . ASP A 1 189 ? 83.906  35.003 14.266  1.00 32.13 ? 194 ASP A CA  1 
ATOM   1542 C  C   . ASP A 1 189 ? 85.076  35.575 13.465  1.00 34.91 ? 194 ASP A C   1 
ATOM   1543 O  O   . ASP A 1 189 ? 85.486  34.966 12.481  1.00 37.99 ? 194 ASP A O   1 
ATOM   1544 C  CB  . ASP A 1 189 ? 84.364  34.284 15.541  1.00 35.03 ? 194 ASP A CB  1 
ATOM   1545 C  CG  . ASP A 1 189 ? 85.477  33.279 15.296  1.00 38.05 ? 194 ASP A CG  1 
ATOM   1546 O  OD1 . ASP A 1 189 ? 85.949  33.142 14.147  1.00 38.60 ? 194 ASP A OD1 1 
ATOM   1547 O  OD2 . ASP A 1 189 ? 85.884  32.616 16.273  1.00 42.27 ? 194 ASP A OD2 1 
ATOM   1548 N  N   . VAL A 1 190 ? 85.596  36.736 13.812  1.00 36.90 ? 195 VAL A N   1 
ATOM   1549 C  CA  . VAL A 1 190 ? 86.709  37.264 13.030  1.00 35.89 ? 195 VAL A CA  1 
ATOM   1550 C  C   . VAL A 1 190 ? 87.956  37.034 13.877  1.00 34.12 ? 195 VAL A C   1 
ATOM   1551 O  O   . VAL A 1 190 ? 88.403  37.920 14.598  1.00 32.44 ? 195 VAL A O   1 
ATOM   1552 C  CB  . VAL A 1 190 ? 86.491  38.764 12.725  1.00 35.68 ? 195 VAL A CB  1 
ATOM   1553 C  CG1 . VAL A 1 190 ? 87.572  39.285 11.795  1.00 36.48 ? 195 VAL A CG1 1 
ATOM   1554 C  CG2 . VAL A 1 190 ? 85.114  38.959 12.109  1.00 36.30 ? 195 VAL A CG2 1 
ATOM   1555 N  N   . PRO A 1 191 ? 88.535  35.821 13.788  1.00 33.99 ? 196 PRO A N   1 
ATOM   1556 C  CA  . PRO A 1 191 ? 89.725  35.417 14.538  1.00 33.81 ? 196 PRO A CA  1 
ATOM   1557 C  C   . PRO A 1 191 ? 91.052  36.020 14.101  1.00 34.20 ? 196 PRO A C   1 
ATOM   1558 O  O   . PRO A 1 191 ? 91.988  36.098 14.897  1.00 34.92 ? 196 PRO A O   1 
ATOM   1559 C  CB  . PRO A 1 191 ? 89.721  33.906 14.372  1.00 33.18 ? 196 PRO A CB  1 
ATOM   1560 C  CG  . PRO A 1 191 ? 89.314  33.767 12.951  1.00 34.31 ? 196 PRO A CG  1 
ATOM   1561 C  CD  . PRO A 1 191 ? 88.165  34.768 12.821  1.00 32.88 ? 196 PRO A CD  1 
ATOM   1562 N  N   . ASP A 1 192 ? 91.142  36.442 12.845  1.00 32.50 ? 197 ASP A N   1 
ATOM   1563 C  CA  . ASP A 1 192 ? 92.401  36.985 12.351  1.00 31.98 ? 197 ASP A CA  1 
ATOM   1564 C  C   . ASP A 1 192 ? 92.318  38.404 11.812  1.00 30.50 ? 197 ASP A C   1 
ATOM   1565 O  O   . ASP A 1 192 ? 91.252  38.872 11.398  1.00 29.37 ? 197 ASP A O   1 
ATOM   1566 C  CB  . ASP A 1 192 ? 92.960  36.080 11.245  1.00 33.89 ? 197 ASP A CB  1 
ATOM   1567 C  CG  . ASP A 1 192 ? 92.778  34.600 11.545  1.00 35.38 ? 197 ASP A CG  1 
ATOM   1568 O  OD1 . ASP A 1 192 ? 93.160  34.166 12.650  1.00 35.85 ? 197 ASP A OD1 1 
ATOM   1569 O  OD2 . ASP A 1 192 ? 92.256  33.872 10.671  1.00 36.37 ? 197 ASP A OD2 1 
ATOM   1570 N  N   . GLN A 1 193 ? 93.462  39.082 11.821  1.00 27.40 ? 198 GLN A N   1 
ATOM   1571 C  CA  . GLN A 1 193 ? 93.547  40.429 11.284  1.00 26.56 ? 198 GLN A CA  1 
ATOM   1572 C  C   . GLN A 1 193 ? 93.320  40.227 9.794   1.00 24.99 ? 198 GLN A C   1 
ATOM   1573 O  O   . GLN A 1 193 ? 93.404  39.099 9.291   1.00 23.01 ? 198 GLN A O   1 
ATOM   1574 C  CB  . GLN A 1 193 ? 94.944  41.021 11.529  1.00 26.26 ? 198 GLN A CB  1 
ATOM   1575 C  CG  . GLN A 1 193 ? 96.085  40.235 10.884  1.00 24.96 ? 198 GLN A CG  1 
ATOM   1576 C  CD  . GLN A 1 193 ? 97.449  40.898 11.076  1.00 26.68 ? 198 GLN A CD  1 
ATOM   1577 O  OE1 . GLN A 1 193 ? 97.643  42.059 10.723  1.00 22.32 ? 198 GLN A OE1 1 
ATOM   1578 N  NE2 . GLN A 1 193 ? 98.399  40.152 11.630  1.00 27.79 ? 198 GLN A NE2 1 
ATOM   1579 N  N   . GLY A 1 194 ? 93.027  41.301 9.079   1.00 24.10 ? 199 GLY A N   1 
ATOM   1580 C  CA  . GLY A 1 194 ? 92.805  41.152 7.655   1.00 24.45 ? 199 GLY A CA  1 
ATOM   1581 C  C   . GLY A 1 194 ? 91.567  41.860 7.153   1.00 22.42 ? 199 GLY A C   1 
ATOM   1582 O  O   . GLY A 1 194 ? 91.057  42.770 7.803   1.00 21.62 ? 199 GLY A O   1 
ATOM   1583 N  N   . LEU A 1 195 ? 91.077  41.424 5.998   1.00 21.81 ? 200 LEU A N   1 
ATOM   1584 C  CA  . LEU A 1 195 ? 89.919  42.042 5.366   1.00 21.64 ? 200 LEU A CA  1 
ATOM   1585 C  C   . LEU A 1 195 ? 88.682  42.248 6.237   1.00 22.47 ? 200 LEU A C   1 
ATOM   1586 O  O   . LEU A 1 195 ? 88.265  43.384 6.465   1.00 21.25 ? 200 LEU A O   1 
ATOM   1587 C  CB  . LEU A 1 195 ? 89.532  41.254 4.117   1.00 21.66 ? 200 LEU A CB  1 
ATOM   1588 C  CG  . LEU A 1 195 ? 88.303  41.753 3.360   1.00 22.18 ? 200 LEU A CG  1 
ATOM   1589 C  CD1 . LEU A 1 195 ? 88.478  43.222 2.983   1.00 24.07 ? 200 LEU A CD1 1 
ATOM   1590 C  CD2 . LEU A 1 195 ? 88.104  40.897 2.123   1.00 25.09 ? 200 LEU A CD2 1 
ATOM   1591 N  N   . LEU A 1 196 ? 88.082  41.158 6.712   1.00 22.11 ? 201 LEU A N   1 
ATOM   1592 C  CA  . LEU A 1 196 ? 86.881  41.276 7.535   1.00 20.75 ? 201 LEU A CA  1 
ATOM   1593 C  C   . LEU A 1 196 ? 87.119  42.130 8.780   1.00 20.27 ? 201 LEU A C   1 
ATOM   1594 O  O   . LEU A 1 196 ? 86.259  42.910 9.184   1.00 18.87 ? 201 LEU A O   1 
ATOM   1595 C  CB  . LEU A 1 196 ? 86.376  39.888 7.935   1.00 24.02 ? 201 LEU A CB  1 
ATOM   1596 C  CG  . LEU A 1 196 ? 85.010  39.828 8.627   1.00 26.17 ? 201 LEU A CG  1 
ATOM   1597 C  CD1 . LEU A 1 196 ? 83.994  40.663 7.855   1.00 27.75 ? 201 LEU A CD1 1 
ATOM   1598 C  CD2 . LEU A 1 196 ? 84.553  38.375 8.720   1.00 28.54 ? 201 LEU A CD2 1 
ATOM   1599 N  N   . CYS A 1 197 ? 88.286  41.973 9.391   1.00 19.44 ? 202 CYS A N   1 
ATOM   1600 C  CA  . CYS A 1 197 ? 88.647  42.742 10.574  1.00 18.12 ? 202 CYS A CA  1 
ATOM   1601 C  C   . CYS A 1 197 ? 88.606  44.236 10.244  1.00 17.67 ? 202 CYS A C   1 
ATOM   1602 O  O   . CYS A 1 197 ? 88.024  45.041 10.979  1.00 15.15 ? 202 CYS A O   1 
ATOM   1603 C  CB  . CYS A 1 197 ? 90.056  42.357 11.011  1.00 20.25 ? 202 CYS A CB  1 
ATOM   1604 S  SG  . CYS A 1 197 ? 90.663  43.227 12.486  1.00 22.75 ? 202 CYS A SG  1 
ATOM   1605 N  N   . ASP A 1 198 ? 89.229  44.596 9.127   1.00 16.70 ? 203 ASP A N   1 
ATOM   1606 C  CA  . ASP A 1 198 ? 89.271  45.986 8.694   1.00 17.80 ? 203 ASP A CA  1 
ATOM   1607 C  C   . ASP A 1 198 ? 87.890  46.562 8.369   1.00 17.31 ? 203 ASP A C   1 
ATOM   1608 O  O   . ASP A 1 198 ? 87.590  47.702 8.724   1.00 16.71 ? 203 ASP A O   1 
ATOM   1609 C  CB  . ASP A 1 198 ? 90.192  46.129 7.477   1.00 17.25 ? 203 ASP A CB  1 
ATOM   1610 C  CG  . ASP A 1 198 ? 91.642  45.811 7.802   1.00 17.13 ? 203 ASP A CG  1 
ATOM   1611 O  OD1 . ASP A 1 198 ? 92.032  45.925 8.981   1.00 16.91 ? 203 ASP A OD1 1 
ATOM   1612 O  OD2 . ASP A 1 198 ? 92.402  45.461 6.878   1.00 15.97 ? 203 ASP A OD2 1 
ATOM   1613 N  N   . LEU A 1 199 ? 87.053  45.781 7.688   1.00 17.10 ? 204 LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 199 ? 85.712  46.239 7.335   1.00 16.30 ? 204 LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 199 ? 84.916  46.593 8.582   1.00 17.64 ? 204 LEU A C   1 
ATOM   1616 O  O   . LEU A 1 199 ? 84.058  47.476 8.562   1.00 15.48 ? 204 LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 199 ? 84.964  45.151 6.559   1.00 18.28 ? 204 LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 199 ? 85.283  45.022 5.067   1.00 18.49 ? 204 LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 199 ? 84.737  43.711 4.532   1.00 19.63 ? 204 LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 199 ? 84.675  46.201 4.322   1.00 18.03 ? 204 LEU A CD2 1 
ATOM   1621 N  N   . LEU A 1 200 ? 85.207  45.894 9.670   1.00 17.48 ? 205 LEU A N   1 
ATOM   1622 C  CA  . LEU A 1 200 ? 84.506  46.107 10.934  1.00 17.97 ? 205 LEU A CA  1 
ATOM   1623 C  C   . LEU A 1 200 ? 85.140  47.149 11.845  1.00 17.96 ? 205 LEU A C   1 
ATOM   1624 O  O   . LEU A 1 200 ? 84.463  47.710 12.707  1.00 17.95 ? 205 LEU A O   1 
ATOM   1625 C  CB  . LEU A 1 200 ? 84.428  44.781 11.700  1.00 18.86 ? 205 LEU A CB  1 
ATOM   1626 C  CG  . LEU A 1 200 ? 83.183  43.894 11.619  1.00 21.79 ? 205 LEU A CG  1 
ATOM   1627 C  CD1 . LEU A 1 200 ? 82.460  44.054 10.300  1.00 24.14 ? 205 LEU A CD1 1 
ATOM   1628 C  CD2 . LEU A 1 200 ? 83.610  42.459 11.856  1.00 19.91 ? 205 LEU A CD2 1 
ATOM   1629 N  N   . TRP A 1 201 ? 86.430  47.416 11.650  1.00 15.41 ? 206 TRP A N   1 
ATOM   1630 C  CA  . TRP A 1 201 ? 87.148  48.337 12.524  1.00 16.88 ? 206 TRP A CA  1 
ATOM   1631 C  C   . TRP A 1 201 ? 87.843  49.583 11.968  1.00 15.99 ? 206 TRP A C   1 
ATOM   1632 O  O   . TRP A 1 201 ? 88.078  50.523 12.719  1.00 13.98 ? 206 TRP A O   1 
ATOM   1633 C  CB  . TRP A 1 201 ? 88.223  47.577 13.306  1.00 15.14 ? 206 TRP A CB  1 
ATOM   1634 C  CG  . TRP A 1 201 ? 87.753  46.652 14.393  1.00 16.24 ? 206 TRP A CG  1 
ATOM   1635 C  CD1 . TRP A 1 201 ? 87.482  45.314 14.280  1.00 17.67 ? 206 TRP A CD1 1 
ATOM   1636 C  CD2 . TRP A 1 201 ? 87.591  46.978 15.776  1.00 14.95 ? 206 TRP A CD2 1 
ATOM   1637 N  NE1 . TRP A 1 201 ? 87.172  44.788 15.513  1.00 15.85 ? 206 TRP A NE1 1 
ATOM   1638 C  CE2 . TRP A 1 201 ? 87.230  45.789 16.447  1.00 15.93 ? 206 TRP A CE2 1 
ATOM   1639 C  CE3 . TRP A 1 201 ? 87.721  48.162 16.517  1.00 15.88 ? 206 TRP A CE3 1 
ATOM   1640 C  CZ2 . TRP A 1 201 ? 86.996  45.749 17.824  1.00 14.13 ? 206 TRP A CZ2 1 
ATOM   1641 C  CZ3 . TRP A 1 201 ? 87.489  48.121 17.888  1.00 17.68 ? 206 TRP A CZ3 1 
ATOM   1642 C  CH2 . TRP A 1 201 ? 87.131  46.920 18.525  1.00 14.92 ? 206 TRP A CH2 1 
ATOM   1643 N  N   . SER A 1 202 ? 88.201  49.604 10.688  1.00 17.94 ? 207 SER A N   1 
ATOM   1644 C  CA  . SER A 1 202 ? 88.937  50.760 10.172  1.00 16.52 ? 207 SER A CA  1 
ATOM   1645 C  C   . SER A 1 202 ? 88.185  52.096 10.218  1.00 17.04 ? 207 SER A C   1 
ATOM   1646 O  O   . SER A 1 202 ? 86.950  52.130 10.230  1.00 13.12 ? 207 SER A O   1 
ATOM   1647 C  CB  . SER A 1 202 ? 89.423  50.484 8.746   1.00 16.59 ? 207 SER A CB  1 
ATOM   1648 O  OG  . SER A 1 202 ? 88.354  50.492 7.826   1.00 13.16 ? 207 SER A OG  1 
ATOM   1649 N  N   . ASP A 1 203 ? 88.952  53.189 10.248  1.00 16.55 ? 208 ASP A N   1 
ATOM   1650 C  CA  . ASP A 1 203 ? 88.408  54.558 10.287  1.00 15.04 ? 208 ASP A CA  1 
ATOM   1651 C  C   . ASP A 1 203 ? 89.130  55.443 9.272   1.00 17.76 ? 208 ASP A C   1 
ATOM   1652 O  O   . ASP A 1 203 ? 90.309  55.228 8.970   1.00 16.27 ? 208 ASP A O   1 
ATOM   1653 C  CB  . ASP A 1 203 ? 88.656  55.245 11.638  1.00 14.70 ? 208 ASP A CB  1 
ATOM   1654 C  CG  . ASP A 1 203 ? 87.982  54.563 12.806  1.00 13.84 ? 208 ASP A CG  1 
ATOM   1655 O  OD1 . ASP A 1 203 ? 86.737  54.490 12.835  1.00 13.71 ? 208 ASP A OD1 1 
ATOM   1656 O  OD2 . ASP A 1 203 ? 88.716  54.124 13.709  1.00 14.08 ? 208 ASP A OD2 1 
ATOM   1657 N  N   . PRO A 1 204 ? 88.434  56.456 8.737   1.00 18.69 ? 209 PRO A N   1 
ATOM   1658 C  CA  . PRO A 1 204 ? 89.085  57.351 7.778   1.00 20.24 ? 209 PRO A CA  1 
ATOM   1659 C  C   . PRO A 1 204 ? 89.928  58.310 8.618   1.00 22.59 ? 209 PRO A C   1 
ATOM   1660 O  O   . PRO A 1 204 ? 89.581  58.591 9.765   1.00 20.77 ? 209 PRO A O   1 
ATOM   1661 C  CB  . PRO A 1 204 ? 87.907  58.055 7.107   1.00 19.85 ? 209 PRO A CB  1 
ATOM   1662 C  CG  . PRO A 1 204 ? 86.871  58.093 8.203   1.00 21.16 ? 209 PRO A CG  1 
ATOM   1663 C  CD  . PRO A 1 204 ? 86.980  56.696 8.780   1.00 19.44 ? 209 PRO A CD  1 
ATOM   1664 N  N   . ASP A 1 205 ? 91.042  58.788 8.079   1.00 24.96 ? 210 ASP A N   1 
ATOM   1665 C  CA  . ASP A 1 205 ? 91.874  59.720 8.831   1.00 29.49 ? 210 ASP A CA  1 
ATOM   1666 C  C   . ASP A 1 205 ? 92.258  60.895 7.939   1.00 30.77 ? 210 ASP A C   1 
ATOM   1667 O  O   . ASP A 1 205 ? 92.699  60.709 6.802   1.00 30.46 ? 210 ASP A O   1 
ATOM   1668 C  CB  . ASP A 1 205 ? 93.130  59.027 9.373   1.00 31.66 ? 210 ASP A CB  1 
ATOM   1669 C  CG  . ASP A 1 205 ? 93.853  59.867 10.422  1.00 35.53 ? 210 ASP A CG  1 
ATOM   1670 O  OD1 . ASP A 1 205 ? 94.256  61.007 10.107  1.00 37.08 ? 210 ASP A OD1 1 
ATOM   1671 O  OD2 . ASP A 1 205 ? 94.019  59.388 11.564  1.00 37.78 ? 210 ASP A OD2 1 
ATOM   1672 N  N   . LYS A 1 206 ? 92.081  62.098 8.475   1.00 31.99 ? 211 LYS A N   1 
ATOM   1673 C  CA  . LYS A 1 206 ? 92.358  63.347 7.768   1.00 35.50 ? 211 LYS A CA  1 
ATOM   1674 C  C   . LYS A 1 206 ? 93.840  63.627 7.530   1.00 35.94 ? 211 LYS A C   1 
ATOM   1675 O  O   . LYS A 1 206 ? 94.201  64.314 6.577   1.00 37.44 ? 211 LYS A O   1 
ATOM   1676 C  CB  . LYS A 1 206 ? 91.759  64.520 8.553   1.00 38.02 ? 211 LYS A CB  1 
ATOM   1677 C  CG  . LYS A 1 206 ? 90.275  64.373 8.890   1.00 41.97 ? 211 LYS A CG  1 
ATOM   1678 C  CD  . LYS A 1 206 ? 89.868  65.340 10.009  1.00 44.20 ? 211 LYS A CD  1 
ATOM   1679 C  CE  . LYS A 1 206 ? 88.367  65.293 10.304  1.00 43.90 ? 211 LYS A CE  1 
ATOM   1680 N  NZ  . LYS A 1 206 ? 87.545  65.849 9.189   1.00 42.89 ? 211 LYS A NZ  1 
ATOM   1681 N  N   . ASP A 1 207 ? 94.697  63.097 8.393   1.00 36.44 ? 212 ASP A N   1 
ATOM   1682 C  CA  . ASP A 1 207 ? 96.128  63.349 8.284   1.00 38.29 ? 212 ASP A CA  1 
ATOM   1683 C  C   . ASP A 1 207 ? 96.895  62.613 7.181   1.00 38.33 ? 212 ASP A C   1 
ATOM   1684 O  O   . ASP A 1 207 ? 97.823  63.174 6.595   1.00 38.29 ? 212 ASP A O   1 
ATOM   1685 C  CB  . ASP A 1 207 ? 96.792  63.089 9.639   1.00 39.72 ? 212 ASP A CB  1 
ATOM   1686 C  CG  . ASP A 1 207 ? 96.143  63.880 10.766  1.00 41.13 ? 212 ASP A CG  1 
ATOM   1687 O  OD1 . ASP A 1 207 ? 95.884  65.089 10.577  1.00 40.48 ? 212 ASP A OD1 1 
ATOM   1688 O  OD2 . ASP A 1 207 ? 95.897  63.296 11.841  1.00 43.01 ? 212 ASP A OD2 1 
ATOM   1689 N  N   . VAL A 1 208 ? 96.512  61.373 6.888   1.00 36.29 ? 213 VAL A N   1 
ATOM   1690 C  CA  . VAL A 1 208 ? 97.197  60.592 5.858   1.00 36.01 ? 213 VAL A CA  1 
ATOM   1691 C  C   . VAL A 1 208 ? 96.340  60.366 4.611   1.00 33.52 ? 213 VAL A C   1 
ATOM   1692 O  O   . VAL A 1 208 ? 95.121  60.244 4.706   1.00 33.06 ? 213 VAL A O   1 
ATOM   1693 C  CB  . VAL A 1 208 ? 97.614  59.213 6.413   1.00 37.50 ? 213 VAL A CB  1 
ATOM   1694 C  CG1 . VAL A 1 208 ? 98.348  58.423 5.351   1.00 40.04 ? 213 VAL A CG1 1 
ATOM   1695 C  CG2 . VAL A 1 208 ? 98.487  59.391 7.644   1.00 38.94 ? 213 VAL A CG2 1 
ATOM   1696 N  N   . LEU A 1 209 ? 96.981  60.311 3.444   1.00 30.87 ? 214 LEU A N   1 
ATOM   1697 C  CA  . LEU A 1 209 ? 96.264  60.073 2.190   1.00 29.46 ? 214 LEU A CA  1 
ATOM   1698 C  C   . LEU A 1 209 ? 96.134  58.575 1.946   1.00 26.56 ? 214 LEU A C   1 
ATOM   1699 O  O   . LEU A 1 209 ? 95.152  58.113 1.364   1.00 23.30 ? 214 LEU A O   1 
ATOM   1700 C  CB  . LEU A 1 209 ? 97.001  60.701 1.000   1.00 31.78 ? 214 LEU A CB  1 
ATOM   1701 C  CG  . LEU A 1 209 ? 96.908  62.214 0.798   1.00 32.45 ? 214 LEU A CG  1 
ATOM   1702 C  CD1 . LEU A 1 209 ? 97.700  62.608 -0.442  1.00 35.36 ? 214 LEU A CD1 1 
ATOM   1703 C  CD2 . LEU A 1 209 ? 95.449  62.625 0.648   1.00 35.13 ? 214 LEU A CD2 1 
ATOM   1704 N  N   . GLY A 1 210 ? 97.141  57.828 2.394   1.00 24.09 ? 215 GLY A N   1 
ATOM   1705 C  CA  . GLY A 1 210 ? 97.148  56.386 2.220   1.00 21.48 ? 215 GLY A CA  1 
ATOM   1706 C  C   . GLY A 1 210 ? 96.722  55.669 3.482   1.00 21.20 ? 215 GLY A C   1 
ATOM   1707 O  O   . GLY A 1 210 ? 95.673  55.976 4.042   1.00 21.35 ? 215 GLY A O   1 
ATOM   1708 N  N   . TRP A 1 211 ? 97.539  54.727 3.939   1.00 20.42 ? 216 TRP A N   1 
ATOM   1709 C  CA  . TRP A 1 211 ? 97.226  53.963 5.144   1.00 21.40 ? 216 TRP A CA  1 
ATOM   1710 C  C   . TRP A 1 211 ? 97.947  54.460 6.393   1.00 21.20 ? 216 TRP A C   1 
ATOM   1711 O  O   . TRP A 1 211 ? 99.148  54.742 6.369   1.00 18.98 ? 216 TRP A O   1 
ATOM   1712 C  CB  . TRP A 1 211 ? 97.547  52.484 4.924   1.00 21.44 ? 216 TRP A CB  1 
ATOM   1713 C  CG  . TRP A 1 211 ? 96.735  51.893 3.832   1.00 21.98 ? 216 TRP A CG  1 
ATOM   1714 C  CD1 . TRP A 1 211 ? 97.113  51.706 2.533   1.00 21.32 ? 216 TRP A CD1 1 
ATOM   1715 C  CD2 . TRP A 1 211 ? 95.367  51.479 3.918   1.00 20.35 ? 216 TRP A CD2 1 
ATOM   1716 N  NE1 . TRP A 1 211 ? 96.063  51.203 1.804   1.00 21.25 ? 216 TRP A NE1 1 
ATOM   1717 C  CE2 . TRP A 1 211 ? 94.979  51.054 2.630   1.00 21.32 ? 216 TRP A CE2 1 
ATOM   1718 C  CE3 . TRP A 1 211 ? 94.432  51.429 4.959   1.00 22.14 ? 216 TRP A CE3 1 
ATOM   1719 C  CZ2 . TRP A 1 211 ? 93.690  50.584 2.354   1.00 20.73 ? 216 TRP A CZ2 1 
ATOM   1720 C  CZ3 . TRP A 1 211 ? 93.147  50.961 4.684   1.00 19.86 ? 216 TRP A CZ3 1 
ATOM   1721 C  CH2 . TRP A 1 211 ? 92.792  50.546 3.392   1.00 21.99 ? 216 TRP A CH2 1 
ATOM   1722 N  N   . GLY A 1 212 ? 97.207  54.548 7.492   1.00 20.79 ? 217 GLY A N   1 
ATOM   1723 C  CA  . GLY A 1 212 ? 97.796  55.017 8.729   1.00 21.43 ? 217 GLY A CA  1 
ATOM   1724 C  C   . GLY A 1 212 ? 97.530  54.126 9.920   1.00 22.32 ? 217 GLY A C   1 
ATOM   1725 O  O   . GLY A 1 212 ? 96.857  53.101 9.817   1.00 23.04 ? 217 GLY A O   1 
ATOM   1726 N  N   . GLU A 1 213 ? 98.064  54.535 11.064  1.00 23.46 ? 218 GLU A N   1 
ATOM   1727 C  CA  . GLU A 1 213 ? 97.920  53.790 12.303  1.00 25.21 ? 218 GLU A CA  1 
ATOM   1728 C  C   . GLU A 1 213 ? 96.612  54.130 13.019  1.00 24.12 ? 218 GLU A C   1 
ATOM   1729 O  O   . GLU A 1 213 ? 96.241  55.300 13.143  1.00 23.48 ? 218 GLU A O   1 
ATOM   1730 C  CB  . GLU A 1 213 ? 99.135  54.072 13.194  1.00 26.04 ? 218 GLU A CB  1 
ATOM   1731 C  CG  . GLU A 1 213 ? 100.455 53.631 12.546  1.00 30.01 ? 218 GLU A CG  1 
ATOM   1732 C  CD  . GLU A 1 213 ? 101.681 53.986 13.373  1.00 32.38 ? 218 GLU A CD  1 
ATOM   1733 O  OE1 . GLU A 1 213 ? 101.598 53.884 14.615  1.00 34.14 ? 218 GLU A OE1 1 
ATOM   1734 O  OE2 . GLU A 1 213 ? 102.728 54.350 12.785  1.00 31.21 ? 218 GLU A OE2 1 
ATOM   1735 N  N   . ASN A 1 214 ? 95.914  53.097 13.485  1.00 23.60 ? 219 ASN A N   1 
ATOM   1736 C  CA  . ASN A 1 214 ? 94.636  53.281 14.164  1.00 23.15 ? 219 ASN A CA  1 
ATOM   1737 C  C   . ASN A 1 214 ? 94.774  53.294 15.690  1.00 23.30 ? 219 ASN A C   1 
ATOM   1738 O  O   . ASN A 1 214 ? 95.281  52.340 16.285  1.00 23.29 ? 219 ASN A O   1 
ATOM   1739 C  CB  . ASN A 1 214 ? 93.668  52.170 13.739  1.00 21.73 ? 219 ASN A CB  1 
ATOM   1740 C  CG  . ASN A 1 214 ? 92.230  52.487 14.095  1.00 21.69 ? 219 ASN A CG  1 
ATOM   1741 O  OD1 . ASN A 1 214 ? 91.934  52.905 15.218  1.00 21.05 ? 219 ASN A OD1 1 
ATOM   1742 N  ND2 . ASN A 1 214 ? 91.324  52.285 13.140  1.00 18.41 ? 219 ASN A ND2 1 
ATOM   1743 N  N   . ASP A 1 215 ? 94.312  54.372 16.318  1.00 24.31 ? 220 ASP A N   1 
ATOM   1744 C  CA  . ASP A 1 215 ? 94.386  54.512 17.772  1.00 26.89 ? 220 ASP A CA  1 
ATOM   1745 C  C   . ASP A 1 215 ? 93.595  53.449 18.534  1.00 25.59 ? 220 ASP A C   1 
ATOM   1746 O  O   . ASP A 1 215 ? 93.802  53.269 19.732  1.00 27.63 ? 220 ASP A O   1 
ATOM   1747 C  CB  . ASP A 1 215 ? 93.884  55.895 18.215  1.00 31.12 ? 220 ASP A CB  1 
ATOM   1748 C  CG  . ASP A 1 215 ? 94.749  57.033 17.698  1.00 35.01 ? 220 ASP A CG  1 
ATOM   1749 O  OD1 . ASP A 1 215 ? 95.992  56.917 17.760  1.00 36.93 ? 220 ASP A OD1 1 
ATOM   1750 O  OD2 . ASP A 1 215 ? 94.184  58.051 17.242  1.00 38.69 ? 220 ASP A OD2 1 
ATOM   1751 N  N   . ARG A 1 216 ? 92.689  52.752 17.854  1.00 23.74 ? 221 ARG A N   1 
ATOM   1752 C  CA  . ARG A 1 216 ? 91.878  51.726 18.513  1.00 23.41 ? 221 ARG A CA  1 
ATOM   1753 C  C   . ARG A 1 216 ? 92.692  50.513 18.961  1.00 24.24 ? 221 ARG A C   1 
ATOM   1754 O  O   . ARG A 1 216 ? 92.246  49.734 19.806  1.00 25.10 ? 221 ARG A O   1 
ATOM   1755 C  CB  . ARG A 1 216 ? 90.743  51.262 17.590  1.00 21.83 ? 221 ARG A CB  1 
ATOM   1756 C  CG  . ARG A 1 216 ? 89.666  52.311 17.324  1.00 20.85 ? 221 ARG A CG  1 
ATOM   1757 C  CD  . ARG A 1 216 ? 88.637  51.757 16.358  1.00 20.10 ? 221 ARG A CD  1 
ATOM   1758 N  NE  . ARG A 1 216 ? 87.773  52.786 15.787  1.00 19.35 ? 221 ARG A NE  1 
ATOM   1759 C  CZ  . ARG A 1 216 ? 86.613  53.181 16.306  1.00 18.77 ? 221 ARG A CZ  1 
ATOM   1760 N  NH1 . ARG A 1 216 ? 86.153  52.634 17.431  1.00 17.17 ? 221 ARG A NH1 1 
ATOM   1761 N  NH2 . ARG A 1 216 ? 85.900  54.113 15.685  1.00 17.03 ? 221 ARG A NH2 1 
ATOM   1762 N  N   . GLY A 1 217 ? 93.882  50.354 18.396  1.00 23.85 ? 222 GLY A N   1 
ATOM   1763 C  CA  . GLY A 1 217 ? 94.721  49.225 18.766  1.00 24.12 ? 222 GLY A CA  1 
ATOM   1764 C  C   . GLY A 1 217 ? 94.446  48.025 17.880  1.00 23.09 ? 222 GLY A C   1 
ATOM   1765 O  O   . GLY A 1 217 ? 94.827  46.898 18.193  1.00 22.66 ? 222 GLY A O   1 
ATOM   1766 N  N   . VAL A 1 218 ? 93.766  48.276 16.768  1.00 20.34 ? 223 VAL A N   1 
ATOM   1767 C  CA  . VAL A 1 218 ? 93.434  47.227 15.814  1.00 21.37 ? 223 VAL A CA  1 
ATOM   1768 C  C   . VAL A 1 218 ? 93.145  47.879 14.469  1.00 20.15 ? 223 VAL A C   1 
ATOM   1769 O  O   . VAL A 1 218 ? 92.742  49.038 14.418  1.00 19.10 ? 223 VAL A O   1 
ATOM   1770 C  CB  . VAL A 1 218 ? 92.183  46.432 16.269  1.00 23.00 ? 223 VAL A CB  1 
ATOM   1771 C  CG1 . VAL A 1 218 ? 91.011  47.375 16.478  1.00 23.87 ? 223 VAL A CG1 1 
ATOM   1772 C  CG2 . VAL A 1 218 ? 91.828  45.376 15.239  1.00 24.10 ? 223 VAL A CG2 1 
ATOM   1773 N  N   . SER A 1 219 ? 93.381  47.139 13.389  1.00 18.44 ? 224 SER A N   1 
ATOM   1774 C  CA  . SER A 1 219 ? 93.115  47.626 12.039  1.00 18.06 ? 224 SER A CA  1 
ATOM   1775 C  C   . SER A 1 219 ? 93.962  48.850 11.674  1.00 17.97 ? 224 SER A C   1 
ATOM   1776 O  O   . SER A 1 219 ? 95.027  49.071 12.253  1.00 16.79 ? 224 SER A O   1 
ATOM   1777 C  CB  . SER A 1 219 ? 91.622  47.952 11.899  1.00 17.76 ? 224 SER A CB  1 
ATOM   1778 O  OG  . SER A 1 219 ? 91.252  48.117 10.540  1.00 15.87 ? 224 SER A OG  1 
ATOM   1779 N  N   . PHE A 1 220 ? 93.486  49.642 10.716  1.00 18.39 ? 225 PHE A N   1 
ATOM   1780 C  CA  . PHE A 1 220 ? 94.221  50.826 10.260  1.00 18.96 ? 225 PHE A CA  1 
ATOM   1781 C  C   . PHE A 1 220 ? 93.277  51.993 9.997   1.00 18.77 ? 225 PHE A C   1 
ATOM   1782 O  O   . PHE A 1 220 ? 92.074  51.897 10.219  1.00 17.26 ? 225 PHE A O   1 
ATOM   1783 C  CB  . PHE A 1 220 ? 94.945  50.549 8.933   1.00 22.49 ? 225 PHE A CB  1 
ATOM   1784 C  CG  . PHE A 1 220 ? 95.578  49.191 8.834   1.00 25.42 ? 225 PHE A CG  1 
ATOM   1785 C  CD1 . PHE A 1 220 ? 94.814  48.069 8.524   1.00 25.07 ? 225 PHE A CD1 1 
ATOM   1786 C  CD2 . PHE A 1 220 ? 96.947  49.032 9.041   1.00 29.96 ? 225 PHE A CD2 1 
ATOM   1787 C  CE1 . PHE A 1 220 ? 95.406  46.809 8.419   1.00 27.50 ? 225 PHE A CE1 1 
ATOM   1788 C  CE2 . PHE A 1 220 ? 97.548  47.775 8.939   1.00 30.93 ? 225 PHE A CE2 1 
ATOM   1789 C  CZ  . PHE A 1 220 ? 96.775  46.663 8.628   1.00 30.11 ? 225 PHE A CZ  1 
ATOM   1790 N  N   . THR A 1 221 ? 93.846  53.098 9.521   1.00 18.06 ? 226 THR A N   1 
ATOM   1791 C  CA  . THR A 1 221 ? 93.066  54.266 9.145   1.00 17.65 ? 226 THR A CA  1 
ATOM   1792 C  C   . THR A 1 221 ? 93.337  54.415 7.653   1.00 18.81 ? 226 THR A C   1 
ATOM   1793 O  O   . THR A 1 221 ? 94.353  53.915 7.150   1.00 17.02 ? 226 THR A O   1 
ATOM   1794 C  CB  . THR A 1 221 ? 93.512  55.551 9.877   1.00 18.34 ? 226 THR A CB  1 
ATOM   1795 O  OG1 . THR A 1 221 ? 94.907  55.778 9.654   1.00 16.82 ? 226 THR A OG1 1 
ATOM   1796 C  CG2 . THR A 1 221 ? 93.234  55.436 11.369  1.00 18.18 ? 226 THR A CG2 1 
ATOM   1797 N  N   . PHE A 1 222 ? 92.431  55.070 6.937   1.00 17.70 ? 227 PHE A N   1 
ATOM   1798 C  CA  . PHE A 1 222 ? 92.615  55.250 5.505   1.00 19.65 ? 227 PHE A CA  1 
ATOM   1799 C  C   . PHE A 1 222 ? 92.337  56.684 5.091   1.00 21.64 ? 227 PHE A C   1 
ATOM   1800 O  O   . PHE A 1 222 ? 91.450  57.346 5.646   1.00 21.67 ? 227 PHE A O   1 
ATOM   1801 C  CB  . PHE A 1 222 ? 91.722  54.281 4.720   1.00 18.85 ? 227 PHE A CB  1 
ATOM   1802 C  CG  . PHE A 1 222 ? 90.272  54.334 5.103   1.00 19.71 ? 227 PHE A CG  1 
ATOM   1803 C  CD1 . PHE A 1 222 ? 89.795  53.600 6.182   1.00 17.63 ? 227 PHE A CD1 1 
ATOM   1804 C  CD2 . PHE A 1 222 ? 89.375  55.115 4.373   1.00 19.89 ? 227 PHE A CD2 1 
ATOM   1805 C  CE1 . PHE A 1 222 ? 88.449  53.638 6.528   1.00 18.07 ? 227 PHE A CE1 1 
ATOM   1806 C  CE2 . PHE A 1 222 ? 88.027  55.162 4.711   1.00 20.90 ? 227 PHE A CE2 1 
ATOM   1807 C  CZ  . PHE A 1 222 ? 87.562  54.419 5.794   1.00 18.81 ? 227 PHE A CZ  1 
ATOM   1808 N  N   . GLY A 1 223 ? 93.106  57.162 4.117   1.00 21.57 ? 228 GLY A N   1 
ATOM   1809 C  CA  . GLY A 1 223 ? 92.951  58.528 3.654   1.00 22.02 ? 228 GLY A CA  1 
ATOM   1810 C  C   . GLY A 1 223 ? 92.133  58.707 2.391   1.00 20.94 ? 228 GLY A C   1 
ATOM   1811 O  O   . GLY A 1 223 ? 91.630  57.743 1.811   1.00 20.28 ? 228 GLY A O   1 
ATOM   1812 N  N   . ALA A 1 224 ? 92.025  59.960 1.958   1.00 20.68 ? 229 ALA A N   1 
ATOM   1813 C  CA  . ALA A 1 224 ? 91.250  60.321 0.779   1.00 19.81 ? 229 ALA A CA  1 
ATOM   1814 C  C   . ALA A 1 224 ? 91.701  59.645 -0.506  1.00 19.92 ? 229 ALA A C   1 
ATOM   1815 O  O   . ALA A 1 224 ? 90.868  59.294 -1.339  1.00 19.25 ? 229 ALA A O   1 
ATOM   1816 C  CB  . ALA A 1 224 ? 91.263  61.835 0.598   1.00 20.54 ? 229 ALA A CB  1 
ATOM   1817 N  N   . GLU A 1 225 ? 93.009  59.469 -0.679  1.00 20.46 ? 230 GLU A N   1 
ATOM   1818 C  CA  . GLU A 1 225 ? 93.509  58.835 -1.898  1.00 21.82 ? 230 GLU A CA  1 
ATOM   1819 C  C   . GLU A 1 225 ? 93.040  57.386 -1.948  1.00 21.35 ? 230 GLU A C   1 
ATOM   1820 O  O   . GLU A 1 225 ? 92.559  56.911 -2.977  1.00 20.79 ? 230 GLU A O   1 
ATOM   1821 C  CB  . GLU A 1 225 ? 95.042  58.901 -1.958  1.00 24.02 ? 230 GLU A CB  1 
ATOM   1822 C  CG  . GLU A 1 225 ? 95.624  58.308 -3.233  1.00 27.87 ? 230 GLU A CG  1 
ATOM   1823 C  CD  . GLU A 1 225 ? 97.124  58.513 -3.350  1.00 30.25 ? 230 GLU A CD  1 
ATOM   1824 O  OE1 . GLU A 1 225 ? 97.552  59.658 -3.598  1.00 32.31 ? 230 GLU A OE1 1 
ATOM   1825 O  OE2 . GLU A 1 225 ? 97.878  57.533 -3.187  1.00 32.87 ? 230 GLU A OE2 1 
ATOM   1826 N  N   . VAL A 1 226 ? 93.175  56.685 -0.826  1.00 20.02 ? 231 VAL A N   1 
ATOM   1827 C  CA  . VAL A 1 226 ? 92.736  55.300 -0.756  1.00 19.16 ? 231 VAL A CA  1 
ATOM   1828 C  C   . VAL A 1 226 ? 91.267  55.225 -1.144  1.00 18.32 ? 231 VAL A C   1 
ATOM   1829 O  O   . VAL A 1 226 ? 90.868  54.375 -1.933  1.00 17.80 ? 231 VAL A O   1 
ATOM   1830 C  CB  . VAL A 1 226 ? 92.901  54.733 0.668   1.00 20.77 ? 231 VAL A CB  1 
ATOM   1831 C  CG1 . VAL A 1 226 ? 92.109  53.434 0.810   1.00 21.61 ? 231 VAL A CG1 1 
ATOM   1832 C  CG2 . VAL A 1 226 ? 94.376  54.491 0.948   1.00 21.62 ? 231 VAL A CG2 1 
ATOM   1833 N  N   . VAL A 1 227 ? 90.464  56.124 -0.580  1.00 18.30 ? 232 VAL A N   1 
ATOM   1834 C  CA  . VAL A 1 227 ? 89.039  56.154 -0.873  1.00 17.30 ? 232 VAL A CA  1 
ATOM   1835 C  C   . VAL A 1 227 ? 88.805  56.415 -2.360  1.00 16.38 ? 232 VAL A C   1 
ATOM   1836 O  O   . VAL A 1 227 ? 87.989  55.750 -2.996  1.00 15.56 ? 232 VAL A O   1 
ATOM   1837 C  CB  . VAL A 1 227 ? 88.312  57.254 -0.055  1.00 16.38 ? 232 VAL A CB  1 
ATOM   1838 C  CG1 . VAL A 1 227 ? 86.840  57.292 -0.440  1.00 14.68 ? 232 VAL A CG1 1 
ATOM   1839 C  CG2 . VAL A 1 227 ? 88.446  56.973 1.440   1.00 17.40 ? 232 VAL A CG2 1 
ATOM   1840 N  N   . ALA A 1 228 ? 89.527  57.386 -2.907  1.00 15.91 ? 233 ALA A N   1 
ATOM   1841 C  CA  . ALA A 1 228 ? 89.390  57.730 -4.319  1.00 17.80 ? 233 ALA A CA  1 
ATOM   1842 C  C   . ALA A 1 228 ? 89.655  56.535 -5.224  1.00 17.23 ? 233 ALA A C   1 
ATOM   1843 O  O   . ALA A 1 228 ? 88.888  56.267 -6.146  1.00 16.83 ? 233 ALA A O   1 
ATOM   1844 C  CB  . ALA A 1 228 ? 90.340  58.867 -4.670  1.00 16.47 ? 233 ALA A CB  1 
ATOM   1845 N  N   . LYS A 1 229 ? 90.748  55.822 -4.973  1.00 18.35 ? 234 LYS A N   1 
ATOM   1846 C  CA  . LYS A 1 229 ? 91.076  54.658 -5.792  1.00 19.48 ? 234 LYS A CA  1 
ATOM   1847 C  C   . LYS A 1 229 ? 89.971  53.611 -5.714  1.00 20.20 ? 234 LYS A C   1 
ATOM   1848 O  O   . LYS A 1 229 ? 89.627  52.980 -6.713  1.00 21.29 ? 234 LYS A O   1 
ATOM   1849 C  CB  . LYS A 1 229 ? 92.391  54.025 -5.336  1.00 21.07 ? 234 LYS A CB  1 
ATOM   1850 C  CG  . LYS A 1 229 ? 93.622  54.864 -5.593  1.00 25.16 ? 234 LYS A CG  1 
ATOM   1851 C  CD  . LYS A 1 229 ? 94.870  54.141 -5.114  1.00 26.24 ? 234 LYS A CD  1 
ATOM   1852 C  CE  . LYS A 1 229 ? 96.112  54.977 -5.341  1.00 29.13 ? 234 LYS A CE  1 
ATOM   1853 N  NZ  . LYS A 1 229 ? 97.309  54.346 -4.718  1.00 32.52 ? 234 LYS A NZ  1 
ATOM   1854 N  N   . PHE A 1 230 ? 89.417  53.434 -4.519  1.00 20.45 ? 235 PHE A N   1 
ATOM   1855 C  CA  . PHE A 1 230 ? 88.358  52.451 -4.294  1.00 20.05 ? 235 PHE A CA  1 
ATOM   1856 C  C   . PHE A 1 230 ? 87.087  52.783 -5.067  1.00 19.80 ? 235 PHE A C   1 
ATOM   1857 O  O   . PHE A 1 230 ? 86.551  51.948 -5.801  1.00 22.78 ? 235 PHE A O   1 
ATOM   1858 C  CB  . PHE A 1 230 ? 88.048  52.364 -2.794  1.00 19.49 ? 235 PHE A CB  1 
ATOM   1859 C  CG  . PHE A 1 230 ? 86.880  51.479 -2.462  1.00 19.67 ? 235 PHE A CG  1 
ATOM   1860 C  CD1 . PHE A 1 230 ? 87.028  50.097 -2.408  1.00 20.77 ? 235 PHE A CD1 1 
ATOM   1861 C  CD2 . PHE A 1 230 ? 85.627  52.033 -2.212  1.00 18.17 ? 235 PHE A CD2 1 
ATOM   1862 C  CE1 . PHE A 1 230 ? 85.941  49.273 -2.107  1.00 20.60 ? 235 PHE A CE1 1 
ATOM   1863 C  CE2 . PHE A 1 230 ? 84.535  51.226 -1.911  1.00 20.83 ? 235 PHE A CE2 1 
ATOM   1864 C  CZ  . PHE A 1 230 ? 84.692  49.839 -1.859  1.00 22.33 ? 235 PHE A CZ  1 
ATOM   1865 N  N   . LEU A 1 231 ? 86.605  54.007 -4.902  1.00 20.45 ? 236 LEU A N   1 
ATOM   1866 C  CA  . LEU A 1 231 ? 85.395  54.445 -5.577  1.00 20.22 ? 236 LEU A CA  1 
ATOM   1867 C  C   . LEU A 1 231 ? 85.486  54.328 -7.098  1.00 22.77 ? 236 LEU A C   1 
ATOM   1868 O  O   . LEU A 1 231 ? 84.557  53.838 -7.746  1.00 22.72 ? 236 LEU A O   1 
ATOM   1869 C  CB  . LEU A 1 231 ? 85.078  55.888 -5.191  1.00 19.65 ? 236 LEU A CB  1 
ATOM   1870 C  CG  . LEU A 1 231 ? 84.697  56.136 -3.728  1.00 19.31 ? 236 LEU A CG  1 
ATOM   1871 C  CD1 . LEU A 1 231 ? 84.417  57.622 -3.529  1.00 21.75 ? 236 LEU A CD1 1 
ATOM   1872 C  CD2 . LEU A 1 231 ? 83.467  55.310 -3.361  1.00 19.17 ? 236 LEU A CD2 1 
ATOM   1873 N  N   . HIS A 1 232 ? 86.598  54.770 -7.675  1.00 24.13 ? 237 HIS A N   1 
ATOM   1874 C  CA  . HIS A 1 232 ? 86.732  54.696 -9.125  1.00 25.93 ? 237 HIS A CA  1 
ATOM   1875 C  C   . HIS A 1 232 ? 86.849  53.262 -9.621  1.00 25.31 ? 237 HIS A C   1 
ATOM   1876 O  O   . HIS A 1 232 ? 86.227  52.891 -10.611 1.00 26.22 ? 237 HIS A O   1 
ATOM   1877 C  CB  . HIS A 1 232 ? 87.936  55.510 -9.609  1.00 29.39 ? 237 HIS A CB  1 
ATOM   1878 C  CG  . HIS A 1 232 ? 88.080  55.530 -11.100 1.00 33.44 ? 237 HIS A CG  1 
ATOM   1879 N  ND1 . HIS A 1 232 ? 88.576  54.459 -11.813 1.00 35.51 ? 237 HIS A ND1 1 
ATOM   1880 C  CD2 . HIS A 1 232 ? 87.741  56.466 -12.017 1.00 34.49 ? 237 HIS A CD2 1 
ATOM   1881 C  CE1 . HIS A 1 232 ? 88.531  54.733 -13.104 1.00 34.69 ? 237 HIS A CE1 1 
ATOM   1882 N  NE2 . HIS A 1 232 ? 88.028  55.945 -13.256 1.00 34.84 ? 237 HIS A NE2 1 
ATOM   1883 N  N   . LYS A 1 233 ? 87.634  52.450 -8.926  1.00 25.20 ? 238 LYS A N   1 
ATOM   1884 C  CA  . LYS A 1 233 ? 87.818  51.065 -9.331  1.00 26.99 ? 238 LYS A CA  1 
ATOM   1885 C  C   . LYS A 1 233 ? 86.507  50.288 -9.421  1.00 27.76 ? 238 LYS A C   1 
ATOM   1886 O  O   . LYS A 1 233 ? 86.343  49.448 -10.308 1.00 27.46 ? 238 LYS A O   1 
ATOM   1887 C  CB  . LYS A 1 233 ? 88.768  50.348 -8.368  1.00 29.62 ? 238 LYS A CB  1 
ATOM   1888 C  CG  . LYS A 1 233 ? 89.064  48.906 -8.768  1.00 33.90 ? 238 LYS A CG  1 
ATOM   1889 C  CD  . LYS A 1 233 ? 90.113  48.279 -7.861  1.00 38.72 ? 238 LYS A CD  1 
ATOM   1890 C  CE  . LYS A 1 233 ? 90.496  46.887 -8.348  1.00 41.45 ? 238 LYS A CE  1 
ATOM   1891 N  NZ  . LYS A 1 233 ? 91.569  46.281 -7.511  1.00 43.09 ? 238 LYS A NZ  1 
ATOM   1892 N  N   . HIS A 1 234 ? 85.570  50.576 -8.520  1.00 26.88 ? 239 HIS A N   1 
ATOM   1893 C  CA  . HIS A 1 234 ? 84.299  49.862 -8.512  1.00 27.76 ? 239 HIS A CA  1 
ATOM   1894 C  C   . HIS A 1 234 ? 83.118  50.707 -8.960  1.00 26.74 ? 239 HIS A C   1 
ATOM   1895 O  O   . HIS A 1 234 ? 81.966  50.345 -8.744  1.00 26.52 ? 239 HIS A O   1 
ATOM   1896 C  CB  . HIS A 1 234 ? 84.045  49.281 -7.119  1.00 28.84 ? 239 HIS A CB  1 
ATOM   1897 C  CG  . HIS A 1 234 ? 85.173  48.434 -6.616  1.00 30.12 ? 239 HIS A CG  1 
ATOM   1898 N  ND1 . HIS A 1 234 ? 86.148  48.916 -5.768  1.00 32.75 ? 239 HIS A ND1 1 
ATOM   1899 C  CD2 . HIS A 1 234 ? 85.527  47.161 -6.907  1.00 30.42 ? 239 HIS A CD2 1 
ATOM   1900 C  CE1 . HIS A 1 234 ? 87.054  47.977 -5.561  1.00 30.36 ? 239 HIS A CE1 1 
ATOM   1901 N  NE2 . HIS A 1 234 ? 86.701  46.903 -6.242  1.00 32.30 ? 239 HIS A NE2 1 
ATOM   1902 N  N   . ASP A 1 235 ? 83.421  51.832 -9.597  1.00 27.06 ? 240 ASP A N   1 
ATOM   1903 C  CA  . ASP A 1 235 ? 82.411  52.749 -10.107 1.00 27.21 ? 240 ASP A CA  1 
ATOM   1904 C  C   . ASP A 1 235 ? 81.372  53.127 -9.057  1.00 26.86 ? 240 ASP A C   1 
ATOM   1905 O  O   . ASP A 1 235 ? 80.168  52.992 -9.281  1.00 28.82 ? 240 ASP A O   1 
ATOM   1906 C  CB  . ASP A 1 235 ? 81.719  52.130 -11.325 1.00 31.45 ? 240 ASP A CB  1 
ATOM   1907 C  CG  . ASP A 1 235 ? 81.289  53.173 -12.342 1.00 36.09 ? 240 ASP A CG  1 
ATOM   1908 O  OD1 . ASP A 1 235 ? 80.458  54.043 -12.002 1.00 37.04 ? 240 ASP A OD1 1 
ATOM   1909 O  OD2 . ASP A 1 235 ? 81.796  53.124 -13.484 1.00 40.02 ? 240 ASP A OD2 1 
ATOM   1910 N  N   . LEU A 1 236 ? 81.844  53.610 -7.913  1.00 25.18 ? 241 LEU A N   1 
ATOM   1911 C  CA  . LEU A 1 236 ? 80.965  54.014 -6.820  1.00 24.88 ? 241 LEU A CA  1 
ATOM   1912 C  C   . LEU A 1 236 ? 81.090  55.509 -6.589  1.00 23.91 ? 241 LEU A C   1 
ATOM   1913 O  O   . LEU A 1 236 ? 82.091  56.119 -6.957  1.00 24.71 ? 241 LEU A O   1 
ATOM   1914 C  CB  . LEU A 1 236 ? 81.347  53.283 -5.532  1.00 23.01 ? 241 LEU A CB  1 
ATOM   1915 C  CG  . LEU A 1 236 ? 81.264  51.759 -5.523  1.00 20.86 ? 241 LEU A CG  1 
ATOM   1916 C  CD1 . LEU A 1 236 ? 82.023  51.226 -4.323  1.00 22.42 ? 241 LEU A CD1 1 
ATOM   1917 C  CD2 . LEU A 1 236 ? 79.808  51.318 -5.490  1.00 23.52 ? 241 LEU A CD2 1 
ATOM   1918 N  N   . ASP A 1 237 ? 80.079  56.096 -5.963  1.00 23.80 ? 242 ASP A N   1 
ATOM   1919 C  CA  . ASP A 1 237 ? 80.106  57.523 -5.689  1.00 24.56 ? 242 ASP A CA  1 
ATOM   1920 C  C   . ASP A 1 237 ? 80.373  57.840 -4.237  1.00 23.05 ? 242 ASP A C   1 
ATOM   1921 O  O   . ASP A 1 237 ? 80.845  58.928 -3.918  1.00 21.55 ? 242 ASP A O   1 
ATOM   1922 C  CB  . ASP A 1 237 ? 78.775  58.179 -6.062  1.00 25.37 ? 242 ASP A CB  1 
ATOM   1923 C  CG  . ASP A 1 237 ? 78.451  58.043 -7.525  1.00 25.03 ? 242 ASP A CG  1 
ATOM   1924 O  OD1 . ASP A 1 237 ? 79.399  57.924 -8.325  1.00 26.63 ? 242 ASP A OD1 1 
ATOM   1925 O  OD2 . ASP A 1 237 ? 77.250  58.073 -7.868  1.00 22.88 ? 242 ASP A OD2 1 
ATOM   1926 N  N   . LEU A 1 238 ? 80.080  56.898 -3.349  1.00 22.68 ? 243 LEU A N   1 
ATOM   1927 C  CA  . LEU A 1 238 ? 80.242  57.190 -1.936  1.00 21.42 ? 243 LEU A CA  1 
ATOM   1928 C  C   . LEU A 1 238 ? 80.337  55.979 -1.023  1.00 20.67 ? 243 LEU A C   1 
ATOM   1929 O  O   . LEU A 1 238 ? 79.852  54.891 -1.347  1.00 20.45 ? 243 LEU A O   1 
ATOM   1930 C  CB  . LEU A 1 238 ? 79.051  58.044 -1.486  1.00 22.53 ? 243 LEU A CB  1 
ATOM   1931 C  CG  . LEU A 1 238 ? 78.937  58.536 -0.043  1.00 22.75 ? 243 LEU A CG  1 
ATOM   1932 C  CD1 . LEU A 1 238 ? 79.794  59.771 0.139   1.00 24.10 ? 243 LEU A CD1 1 
ATOM   1933 C  CD2 . LEU A 1 238 ? 77.478  58.863 0.271   1.00 25.46 ? 243 LEU A CD2 1 
ATOM   1934 N  N   . ILE A 1 239 ? 80.972  56.194 0.121   1.00 18.69 ? 244 ILE A N   1 
ATOM   1935 C  CA  . ILE A 1 239 ? 81.093  55.168 1.149   1.00 18.96 ? 244 ILE A CA  1 
ATOM   1936 C  C   . ILE A 1 239 ? 80.229  55.662 2.300   1.00 18.83 ? 244 ILE A C   1 
ATOM   1937 O  O   . ILE A 1 239 ? 80.359  56.814 2.729   1.00 19.38 ? 244 ILE A O   1 
ATOM   1938 C  CB  . ILE A 1 239 ? 82.538  55.016 1.681   1.00 17.69 ? 244 ILE A CB  1 
ATOM   1939 C  CG1 . ILE A 1 239 ? 83.432  54.375 0.616   1.00 15.41 ? 244 ILE A CG1 1 
ATOM   1940 C  CG2 . ILE A 1 239 ? 82.537  54.138 2.939   1.00 18.51 ? 244 ILE A CG2 1 
ATOM   1941 C  CD1 . ILE A 1 239 ? 84.870  54.227 1.034   1.00 16.19 ? 244 ILE A CD1 1 
ATOM   1942 N  N   . CYS A 1 240 ? 79.331  54.807 2.776   1.00 18.01 ? 245 CYS A N   1 
ATOM   1943 C  CA  . CYS A 1 240 ? 78.474  55.151 3.906   1.00 16.16 ? 245 CYS A CA  1 
ATOM   1944 C  C   . CYS A 1 240 ? 78.801  54.160 5.024   1.00 16.40 ? 245 CYS A C   1 
ATOM   1945 O  O   . CYS A 1 240 ? 78.612  52.953 4.872   1.00 16.50 ? 245 CYS A O   1 
ATOM   1946 C  CB  . CYS A 1 240 ? 76.997  55.044 3.519   1.00 17.96 ? 245 CYS A CB  1 
ATOM   1947 S  SG  . CYS A 1 240 ? 75.830  55.528 4.830   1.00 22.06 ? 245 CYS A SG  1 
ATOM   1948 N  N   . ARG A 1 241 ? 79.314  54.669 6.135   1.00 16.28 ? 246 ARG A N   1 
ATOM   1949 C  CA  . ARG A 1 241 ? 79.673  53.821 7.261   1.00 16.18 ? 246 ARG A CA  1 
ATOM   1950 C  C   . ARG A 1 241 ? 79.236  54.480 8.571   1.00 15.92 ? 246 ARG A C   1 
ATOM   1951 O  O   . ARG A 1 241 ? 78.590  55.530 8.558   1.00 16.86 ? 246 ARG A O   1 
ATOM   1952 C  CB  . ARG A 1 241 ? 81.182  53.545 7.236   1.00 15.97 ? 246 ARG A CB  1 
ATOM   1953 C  CG  . ARG A 1 241 ? 82.044  54.777 6.998   1.00 17.47 ? 246 ARG A CG  1 
ATOM   1954 C  CD  . ARG A 1 241 ? 82.387  55.498 8.302   1.00 15.03 ? 246 ARG A CD  1 
ATOM   1955 N  NE  . ARG A 1 241 ? 83.375  54.748 9.075   1.00 15.99 ? 246 ARG A NE  1 
ATOM   1956 C  CZ  . ARG A 1 241 ? 84.053  55.247 10.102  1.00 15.50 ? 246 ARG A CZ  1 
ATOM   1957 N  NH1 . ARG A 1 241 ? 83.849  56.504 10.482  1.00 16.10 ? 246 ARG A NH1 1 
ATOM   1958 N  NH2 . ARG A 1 241 ? 84.934  54.494 10.749  1.00 13.61 ? 246 ARG A NH2 1 
ATOM   1959 N  N   . ALA A 1 242 ? 79.579  53.860 9.694   1.00 15.10 ? 247 ALA A N   1 
ATOM   1960 C  CA  . ALA A 1 242 ? 79.199  54.371 11.010  1.00 13.36 ? 247 ALA A CA  1 
ATOM   1961 C  C   . ALA A 1 242 ? 80.450  54.264 11.868  1.00 14.15 ? 247 ALA A C   1 
ATOM   1962 O  O   . ALA A 1 242 ? 81.481  54.852 11.533  1.00 14.63 ? 247 ALA A O   1 
ATOM   1963 C  CB  . ALA A 1 242 ? 78.072  53.496 11.576  1.00 10.91 ? 247 ALA A CB  1 
ATOM   1964 N  N   . HIS A 1 243 ? 80.353  53.554 12.993  1.00 14.04 ? 248 HIS A N   1 
ATOM   1965 C  CA  . HIS A 1 243 ? 81.531  53.286 13.815  1.00 16.54 ? 248 HIS A CA  1 
ATOM   1966 C  C   . HIS A 1 243 ? 82.130  54.433 14.652  1.00 17.37 ? 248 HIS A C   1 
ATOM   1967 O  O   . HIS A 1 243 ? 82.728  54.181 15.697  1.00 18.41 ? 248 HIS A O   1 
ATOM   1968 C  CB  . HIS A 1 243 ? 82.588  52.669 12.873  1.00 14.79 ? 248 HIS A CB  1 
ATOM   1969 C  CG  . HIS A 1 243 ? 83.725  51.980 13.562  1.00 15.72 ? 248 HIS A CG  1 
ATOM   1970 N  ND1 . HIS A 1 243 ? 83.545  51.091 14.598  1.00 15.00 ? 248 HIS A ND1 1 
ATOM   1971 C  CD2 . HIS A 1 243 ? 85.056  51.989 13.303  1.00 13.22 ? 248 HIS A CD2 1 
ATOM   1972 C  CE1 . HIS A 1 243 ? 84.713  50.582 14.950  1.00 13.68 ? 248 HIS A CE1 1 
ATOM   1973 N  NE2 . HIS A 1 243 ? 85.648  51.111 14.179  1.00 15.40 ? 248 HIS A NE2 1 
ATOM   1974 N  N   . GLN A 1 244 ? 81.981  55.681 14.218  1.00 19.43 ? 249 GLN A N   1 
ATOM   1975 C  CA  . GLN A 1 244 ? 82.537  56.798 14.994  1.00 19.95 ? 249 GLN A CA  1 
ATOM   1976 C  C   . GLN A 1 244 ? 81.493  57.824 15.416  1.00 20.28 ? 249 GLN A C   1 
ATOM   1977 O  O   . GLN A 1 244 ? 80.664  58.242 14.617  1.00 19.14 ? 249 GLN A O   1 
ATOM   1978 C  CB  . GLN A 1 244 ? 83.644  57.507 14.206  1.00 20.28 ? 249 GLN A CB  1 
ATOM   1979 C  CG  . GLN A 1 244 ? 84.955  56.745 14.160  1.00 20.19 ? 249 GLN A CG  1 
ATOM   1980 C  CD  . GLN A 1 244 ? 86.033  57.469 13.369  1.00 19.62 ? 249 GLN A CD  1 
ATOM   1981 O  OE1 . GLN A 1 244 ? 85.873  57.737 12.176  1.00 19.00 ? 249 GLN A OE1 1 
ATOM   1982 N  NE2 . GLN A 1 244 ? 87.141  57.781 14.033  1.00 19.12 ? 249 GLN A NE2 1 
ATOM   1983 N  N   . VAL A 1 245 ? 81.542  58.235 16.679  1.00 21.73 ? 250 VAL A N   1 
ATOM   1984 C  CA  . VAL A 1 245 ? 80.593  59.226 17.181  1.00 24.06 ? 250 VAL A CA  1 
ATOM   1985 C  C   . VAL A 1 245 ? 80.871  60.586 16.541  1.00 24.70 ? 250 VAL A C   1 
ATOM   1986 O  O   . VAL A 1 245 ? 82.000  61.072 16.593  1.00 24.16 ? 250 VAL A O   1 
ATOM   1987 C  CB  . VAL A 1 245 ? 80.708  59.394 18.715  1.00 24.24 ? 250 VAL A CB  1 
ATOM   1988 C  CG1 . VAL A 1 245 ? 79.605  60.314 19.220  1.00 23.68 ? 250 VAL A CG1 1 
ATOM   1989 C  CG2 . VAL A 1 245 ? 80.637  58.036 19.397  1.00 25.71 ? 250 VAL A CG2 1 
ATOM   1990 N  N   . VAL A 1 246 ? 79.849  61.182 15.931  1.00 26.36 ? 251 VAL A N   1 
ATOM   1991 C  CA  . VAL A 1 246 ? 79.977  62.499 15.311  1.00 29.12 ? 251 VAL A CA  1 
ATOM   1992 C  C   . VAL A 1 246 ? 78.929  63.432 15.917  1.00 31.08 ? 251 VAL A C   1 
ATOM   1993 O  O   . VAL A 1 246 ? 77.806  63.020 16.199  1.00 30.03 ? 251 VAL A O   1 
ATOM   1994 C  CB  . VAL A 1 246 ? 79.799  62.447 13.768  1.00 28.59 ? 251 VAL A CB  1 
ATOM   1995 C  CG1 . VAL A 1 246 ? 80.955  61.676 13.141  1.00 29.89 ? 251 VAL A CG1 1 
ATOM   1996 C  CG2 . VAL A 1 246 ? 78.472  61.809 13.406  1.00 27.92 ? 251 VAL A CG2 1 
ATOM   1997 N  N   . GLU A 1 247 ? 79.312  64.692 16.107  1.00 32.86 ? 252 GLU A N   1 
ATOM   1998 C  CA  . GLU A 1 247 ? 78.457  65.706 16.722  1.00 33.81 ? 252 GLU A CA  1 
ATOM   1999 C  C   . GLU A 1 247 ? 77.056  65.913 16.135  1.00 32.97 ? 252 GLU A C   1 
ATOM   2000 O  O   . GLU A 1 247 ? 76.076  66.010 16.877  1.00 31.76 ? 252 GLU A O   1 
ATOM   2001 C  CB  . GLU A 1 247 ? 79.209  67.040 16.734  1.00 38.91 ? 252 GLU A CB  1 
ATOM   2002 C  CG  . GLU A 1 247 ? 78.674  68.061 17.720  1.00 44.70 ? 252 GLU A CG  1 
ATOM   2003 C  CD  . GLU A 1 247 ? 79.519  69.322 17.754  1.00 49.35 ? 252 GLU A CD  1 
ATOM   2004 O  OE1 . GLU A 1 247 ? 79.563  70.038 16.730  1.00 51.30 ? 252 GLU A OE1 1 
ATOM   2005 O  OE2 . GLU A 1 247 ? 80.144  69.594 18.804  1.00 50.92 ? 252 GLU A OE2 1 
ATOM   2006 N  N   . ASP A 1 248 ? 76.953  65.980 14.814  1.00 32.43 ? 253 ASP A N   1 
ATOM   2007 C  CA  . ASP A 1 248 ? 75.663  66.207 14.171  1.00 33.22 ? 253 ASP A CA  1 
ATOM   2008 C  C   . ASP A 1 248 ? 74.933  64.940 13.737  1.00 31.87 ? 253 ASP A C   1 
ATOM   2009 O  O   . ASP A 1 248 ? 73.967  65.007 12.979  1.00 32.03 ? 253 ASP A O   1 
ATOM   2010 C  CB  . ASP A 1 248 ? 75.853  67.129 12.964  1.00 36.75 ? 253 ASP A CB  1 
ATOM   2011 C  CG  . ASP A 1 248 ? 76.459  68.471 13.346  1.00 39.46 ? 253 ASP A CG  1 
ATOM   2012 O  OD1 . ASP A 1 248 ? 76.510  68.786 14.556  1.00 39.81 ? 253 ASP A OD1 1 
ATOM   2013 O  OD2 . ASP A 1 248 ? 76.880  69.213 12.435  1.00 42.97 ? 253 ASP A OD2 1 
ATOM   2014 N  N   . GLY A 1 249 ? 75.380  63.786 14.220  1.00 31.17 ? 254 GLY A N   1 
ATOM   2015 C  CA  . GLY A 1 249 ? 74.730  62.547 13.832  1.00 30.56 ? 254 GLY A CA  1 
ATOM   2016 C  C   . GLY A 1 249 ? 75.319  62.014 12.539  1.00 30.38 ? 254 GLY A C   1 
ATOM   2017 O  O   . GLY A 1 249 ? 75.389  60.805 12.326  1.00 29.18 ? 254 GLY A O   1 
ATOM   2018 N  N   . TYR A 1 250 ? 75.721  62.925 11.659  1.00 30.39 ? 255 TYR A N   1 
ATOM   2019 C  CA  . TYR A 1 250 ? 76.339  62.540 10.401  1.00 29.10 ? 255 TYR A CA  1 
ATOM   2020 C  C   . TYR A 1 250 ? 77.489  63.502 10.114  1.00 28.62 ? 255 TYR A C   1 
ATOM   2021 O  O   . TYR A 1 250 ? 77.506  64.638 10.599  1.00 24.03 ? 255 TYR A O   1 
ATOM   2022 C  CB  . TYR A 1 250 ? 75.326  62.576 9.251   1.00 32.60 ? 255 TYR A CB  1 
ATOM   2023 C  CG  . TYR A 1 250 ? 74.978  63.966 8.763   1.00 34.78 ? 255 TYR A CG  1 
ATOM   2024 C  CD1 . TYR A 1 250 ? 74.072  64.767 9.460   1.00 35.36 ? 255 TYR A CD1 1 
ATOM   2025 C  CD2 . TYR A 1 250 ? 75.574  64.487 7.613   1.00 34.76 ? 255 TYR A CD2 1 
ATOM   2026 C  CE1 . TYR A 1 250 ? 73.766  66.053 9.024   1.00 37.20 ? 255 TYR A CE1 1 
ATOM   2027 C  CE2 . TYR A 1 250 ? 75.278  65.773 7.170   1.00 36.83 ? 255 TYR A CE2 1 
ATOM   2028 C  CZ  . TYR A 1 250 ? 74.372  66.550 7.880   1.00 38.07 ? 255 TYR A CZ  1 
ATOM   2029 O  OH  . TYR A 1 250 ? 74.074  67.822 7.449   1.00 40.42 ? 255 TYR A OH  1 
ATOM   2030 N  N   . GLU A 1 251 ? 78.460  63.041 9.336   1.00 27.88 ? 256 GLU A N   1 
ATOM   2031 C  CA  . GLU A 1 251 ? 79.598  63.878 9.003   1.00 27.80 ? 256 GLU A CA  1 
ATOM   2032 C  C   . GLU A 1 251 ? 80.353  63.283 7.829   1.00 26.95 ? 256 GLU A C   1 
ATOM   2033 O  O   . GLU A 1 251 ? 80.536  62.068 7.746   1.00 26.43 ? 256 GLU A O   1 
ATOM   2034 C  CB  . GLU A 1 251 ? 80.531  64.007 10.208  1.00 28.69 ? 256 GLU A CB  1 
ATOM   2035 C  CG  . GLU A 1 251 ? 81.548  65.133 10.081  1.00 32.13 ? 256 GLU A CG  1 
ATOM   2036 C  CD  . GLU A 1 251 ? 82.336  65.349 11.355  1.00 34.57 ? 256 GLU A CD  1 
ATOM   2037 O  OE1 . GLU A 1 251 ? 81.706  65.500 12.422  1.00 37.00 ? 256 GLU A OE1 1 
ATOM   2038 O  OE2 . GLU A 1 251 ? 83.583  65.375 11.293  1.00 37.75 ? 256 GLU A OE2 1 
ATOM   2039 N  N   . PHE A 1 252 ? 80.779  64.152 6.920   1.00 25.92 ? 257 PHE A N   1 
ATOM   2040 C  CA  . PHE A 1 252 ? 81.527  63.738 5.742   1.00 24.98 ? 257 PHE A CA  1 
ATOM   2041 C  C   . PHE A 1 252 ? 83.022  63.742 6.023   1.00 23.68 ? 257 PHE A C   1 
ATOM   2042 O  O   . PHE A 1 252 ? 83.519  64.572 6.784   1.00 21.72 ? 257 PHE A O   1 
ATOM   2043 C  CB  . PHE A 1 252 ? 81.226  64.681 4.576   1.00 26.79 ? 257 PHE A CB  1 
ATOM   2044 C  CG  . PHE A 1 252 ? 79.890  64.447 3.940   1.00 25.97 ? 257 PHE A CG  1 
ATOM   2045 C  CD1 . PHE A 1 252 ? 79.731  63.459 2.977   1.00 26.37 ? 257 PHE A CD1 1 
ATOM   2046 C  CD2 . PHE A 1 252 ? 78.783  65.195 4.323   1.00 27.96 ? 257 PHE A CD2 1 
ATOM   2047 C  CE1 . PHE A 1 252 ? 78.488  63.214 2.402   1.00 29.45 ? 257 PHE A CE1 1 
ATOM   2048 C  CE2 . PHE A 1 252 ? 77.534  64.960 3.757   1.00 28.16 ? 257 PHE A CE2 1 
ATOM   2049 C  CZ  . PHE A 1 252 ? 77.386  63.966 2.793   1.00 30.22 ? 257 PHE A CZ  1 
ATOM   2050 N  N   . PHE A 1 253 ? 83.730  62.803 5.406   1.00 22.68 ? 258 PHE A N   1 
ATOM   2051 C  CA  . PHE A 1 253 ? 85.174  62.701 5.562   1.00 21.68 ? 258 PHE A CA  1 
ATOM   2052 C  C   . PHE A 1 253 ? 85.787  62.383 4.208   1.00 19.79 ? 258 PHE A C   1 
ATOM   2053 O  O   . PHE A 1 253 ? 85.071  62.097 3.252   1.00 17.99 ? 258 PHE A O   1 
ATOM   2054 C  CB  . PHE A 1 253 ? 85.545  61.595 6.558   1.00 23.64 ? 258 PHE A CB  1 
ATOM   2055 C  CG  . PHE A 1 253 ? 85.085  61.860 7.968   1.00 25.40 ? 258 PHE A CG  1 
ATOM   2056 C  CD1 . PHE A 1 253 ? 85.829  62.677 8.812   1.00 26.49 ? 258 PHE A CD1 1 
ATOM   2057 C  CD2 . PHE A 1 253 ? 83.911  61.292 8.450   1.00 24.10 ? 258 PHE A CD2 1 
ATOM   2058 C  CE1 . PHE A 1 253 ? 85.411  62.925 10.123  1.00 28.07 ? 258 PHE A CE1 1 
ATOM   2059 C  CE2 . PHE A 1 253 ? 83.484  61.531 9.758   1.00 26.02 ? 258 PHE A CE2 1 
ATOM   2060 C  CZ  . PHE A 1 253 ? 84.233  62.347 10.596  1.00 25.70 ? 258 PHE A CZ  1 
ATOM   2061 N  N   . ALA A 1 254 ? 87.111  62.440 4.130   1.00 21.42 ? 259 ALA A N   1 
ATOM   2062 C  CA  . ALA A 1 254 ? 87.815  62.144 2.886   1.00 21.65 ? 259 ALA A CA  1 
ATOM   2063 C  C   . ALA A 1 254 ? 87.311  62.991 1.717   1.00 21.54 ? 259 ALA A C   1 
ATOM   2064 O  O   . ALA A 1 254 ? 87.045  62.474 0.628   1.00 17.46 ? 259 ALA A O   1 
ATOM   2065 C  CB  . ALA A 1 254 ? 87.676  60.665 2.553   1.00 21.34 ? 259 ALA A CB  1 
ATOM   2066 N  N   . LYS A 1 255 ? 87.181  64.294 1.950   1.00 21.56 ? 260 LYS A N   1 
ATOM   2067 C  CA  . LYS A 1 255 ? 86.725  65.217 0.913   1.00 23.42 ? 260 LYS A CA  1 
ATOM   2068 C  C   . LYS A 1 255 ? 85.369  64.809 0.338   1.00 22.82 ? 260 LYS A C   1 
ATOM   2069 O  O   . LYS A 1 255 ? 85.189  64.719 -0.877  1.00 22.40 ? 260 LYS A O   1 
ATOM   2070 C  CB  . LYS A 1 255 ? 87.764  65.298 -0.211  1.00 25.18 ? 260 LYS A CB  1 
ATOM   2071 C  CG  . LYS A 1 255 ? 89.106  65.924 0.189   1.00 29.78 ? 260 LYS A CG  1 
ATOM   2072 C  CD  . LYS A 1 255 ? 89.960  64.981 1.021   1.00 30.74 ? 260 LYS A CD  1 
ATOM   2073 C  CE  . LYS A 1 255 ? 91.391  65.500 1.181   1.00 32.83 ? 260 LYS A CE  1 
ATOM   2074 N  NZ  . LYS A 1 255 ? 91.492  66.703 2.059   1.00 33.94 ? 260 LYS A NZ  1 
ATOM   2075 N  N   . ARG A 1 256 ? 84.423  64.567 1.238   1.00 23.96 ? 261 ARG A N   1 
ATOM   2076 C  CA  . ARG A 1 256 ? 83.063  64.172 0.898   1.00 23.86 ? 261 ARG A CA  1 
ATOM   2077 C  C   . ARG A 1 256 ? 82.909  62.923 0.046   1.00 22.66 ? 261 ARG A C   1 
ATOM   2078 O  O   . ARG A 1 256 ? 81.919  62.781 -0.666  1.00 23.18 ? 261 ARG A O   1 
ATOM   2079 C  CB  . ARG A 1 256 ? 82.312  65.337 0.246   1.00 26.88 ? 261 ARG A CB  1 
ATOM   2080 C  CG  . ARG A 1 256 ? 82.058  66.488 1.208   1.00 32.30 ? 261 ARG A CG  1 
ATOM   2081 C  CD  . ARG A 1 256 ? 81.127  67.532 0.623   1.00 33.48 ? 261 ARG A CD  1 
ATOM   2082 N  NE  . ARG A 1 256 ? 81.094  68.731 1.456   1.00 36.24 ? 261 ARG A NE  1 
ATOM   2083 C  CZ  . ARG A 1 256 ? 80.404  69.830 1.166   1.00 36.64 ? 261 ARG A CZ  1 
ATOM   2084 N  NH1 . ARG A 1 256 ? 79.675  69.888 0.056   1.00 35.14 ? 261 ARG A NH1 1 
ATOM   2085 N  NH2 . ARG A 1 256 ? 80.456  70.877 1.979   1.00 38.51 ? 261 ARG A NH2 1 
ATOM   2086 N  N   . GLN A 1 257 ? 83.876  62.013 0.118   1.00 20.61 ? 262 GLN A N   1 
ATOM   2087 C  CA  . GLN A 1 257 ? 83.777  60.763 -0.633  1.00 19.05 ? 262 GLN A CA  1 
ATOM   2088 C  C   . GLN A 1 257 ? 83.190  59.724 0.315   1.00 18.93 ? 262 GLN A C   1 
ATOM   2089 O  O   . GLN A 1 257 ? 82.839  58.618 -0.095  1.00 17.79 ? 262 GLN A O   1 
ATOM   2090 C  CB  . GLN A 1 257 ? 85.148  60.267 -1.091  1.00 18.46 ? 262 GLN A CB  1 
ATOM   2091 C  CG  . GLN A 1 257 ? 85.970  61.259 -1.893  1.00 21.04 ? 262 GLN A CG  1 
ATOM   2092 C  CD  . GLN A 1 257 ? 87.282  60.659 -2.359  1.00 19.65 ? 262 GLN A CD  1 
ATOM   2093 O  OE1 . GLN A 1 257 ? 87.346  60.021 -3.409  1.00 21.75 ? 262 GLN A OE1 1 
ATOM   2094 N  NE2 . GLN A 1 257 ? 88.332  60.845 -1.571  1.00 17.39 ? 262 GLN A NE2 1 
ATOM   2095 N  N   . LEU A 1 258 ? 83.104  60.090 1.590   1.00 18.33 ? 263 LEU A N   1 
ATOM   2096 C  CA  . LEU A 1 258 ? 82.578  59.200 2.618   1.00 19.27 ? 263 LEU A CA  1 
ATOM   2097 C  C   . LEU A 1 258 ? 81.746  59.960 3.641   1.00 19.58 ? 263 LEU A C   1 
ATOM   2098 O  O   . LEU A 1 258 ? 82.047  61.107 3.975   1.00 20.09 ? 263 LEU A O   1 
ATOM   2099 C  CB  . LEU A 1 258 ? 83.735  58.485 3.334   1.00 19.19 ? 263 LEU A CB  1 
ATOM   2100 C  CG  . LEU A 1 258 ? 83.452  57.517 4.500   1.00 18.60 ? 263 LEU A CG  1 
ATOM   2101 C  CD1 . LEU A 1 258 ? 84.705  56.670 4.751   1.00 19.81 ? 263 LEU A CD1 1 
ATOM   2102 C  CD2 . LEU A 1 258 ? 83.065  58.275 5.767   1.00 18.38 ? 263 LEU A CD2 1 
ATOM   2103 N  N   . VAL A 1 259 ? 80.693  59.312 4.125   1.00 18.46 ? 264 VAL A N   1 
ATOM   2104 C  CA  . VAL A 1 259 ? 79.838  59.898 5.143   1.00 20.35 ? 264 VAL A CA  1 
ATOM   2105 C  C   . VAL A 1 259 ? 79.721  58.886 6.279   1.00 19.80 ? 264 VAL A C   1 
ATOM   2106 O  O   . VAL A 1 259 ? 79.567  57.683 6.040   1.00 17.68 ? 264 VAL A O   1 
ATOM   2107 C  CB  . VAL A 1 259 ? 78.421  60.241 4.596   1.00 19.96 ? 264 VAL A CB  1 
ATOM   2108 C  CG1 . VAL A 1 259 ? 77.657  58.974 4.252   1.00 22.98 ? 264 VAL A CG1 1 
ATOM   2109 C  CG2 . VAL A 1 259 ? 77.655  61.060 5.624   1.00 21.88 ? 264 VAL A CG2 1 
ATOM   2110 N  N   . THR A 1 260 ? 79.837  59.382 7.506   1.00 19.97 ? 265 THR A N   1 
ATOM   2111 C  CA  . THR A 1 260 ? 79.732  58.557 8.704   1.00 20.91 ? 265 THR A CA  1 
ATOM   2112 C  C   . THR A 1 260 ? 78.386  58.857 9.361   1.00 20.59 ? 265 THR A C   1 
ATOM   2113 O  O   . THR A 1 260 ? 78.010  60.022 9.509   1.00 20.76 ? 265 THR A O   1 
ATOM   2114 C  CB  . THR A 1 260 ? 80.846  58.888 9.721   1.00 23.22 ? 265 THR A CB  1 
ATOM   2115 O  OG1 . THR A 1 260 ? 82.130  58.646 9.137   1.00 25.21 ? 265 THR A OG1 1 
ATOM   2116 C  CG2 . THR A 1 260 ? 80.703  58.025 10.966  1.00 26.72 ? 265 THR A CG2 1 
ATOM   2117 N  N   . LEU A 1 261 ? 77.662  57.806 9.735   1.00 18.28 ? 266 LEU A N   1 
ATOM   2118 C  CA  . LEU A 1 261 ? 76.365  57.950 10.383  1.00 19.04 ? 266 LEU A CA  1 
ATOM   2119 C  C   . LEU A 1 261 ? 76.439  57.373 11.796  1.00 20.23 ? 266 LEU A C   1 
ATOM   2120 O  O   . LEU A 1 261 ? 77.036  56.318 12.021  1.00 17.11 ? 266 LEU A O   1 
ATOM   2121 C  CB  . LEU A 1 261 ? 75.279  57.206 9.600   1.00 19.67 ? 266 LEU A CB  1 
ATOM   2122 C  CG  . LEU A 1 261 ? 75.018  57.600 8.148   1.00 19.77 ? 266 LEU A CG  1 
ATOM   2123 C  CD1 . LEU A 1 261 ? 73.987  56.666 7.563   1.00 18.73 ? 266 LEU A CD1 1 
ATOM   2124 C  CD2 . LEU A 1 261 ? 74.528  59.048 8.078   1.00 22.61 ? 266 LEU A CD2 1 
ATOM   2125 N  N   . PHE A 1 262 ? 75.837  58.078 12.745  1.00 20.24 ? 267 PHE A N   1 
ATOM   2126 C  CA  . PHE A 1 262 ? 75.812  57.633 14.132  1.00 19.98 ? 267 PHE A CA  1 
ATOM   2127 C  C   . PHE A 1 262 ? 74.412  57.973 14.609  1.00 20.57 ? 267 PHE A C   1 
ATOM   2128 O  O   . PHE A 1 262 ? 73.997  59.131 14.546  1.00 18.90 ? 267 PHE A O   1 
ATOM   2129 C  CB  . PHE A 1 262 ? 76.875  58.367 14.947  1.00 19.50 ? 267 PHE A CB  1 
ATOM   2130 C  CG  . PHE A 1 262 ? 77.145  57.746 16.283  1.00 19.63 ? 267 PHE A CG  1 
ATOM   2131 C  CD1 . PHE A 1 262 ? 78.032  56.677 16.398  1.00 19.00 ? 267 PHE A CD1 1 
ATOM   2132 C  CD2 . PHE A 1 262 ? 76.502  58.208 17.424  1.00 19.55 ? 267 PHE A CD2 1 
ATOM   2133 C  CE1 . PHE A 1 262 ? 78.272  56.077 17.632  1.00 17.84 ? 267 PHE A CE1 1 
ATOM   2134 C  CE2 . PHE A 1 262 ? 76.738  57.616 18.664  1.00 19.29 ? 267 PHE A CE2 1 
ATOM   2135 C  CZ  . PHE A 1 262 ? 77.622  56.551 18.770  1.00 18.31 ? 267 PHE A CZ  1 
ATOM   2136 N  N   . SER A 1 263 ? 73.683  56.962 15.079  1.00 19.82 ? 268 SER A N   1 
ATOM   2137 C  CA  . SER A 1 263 ? 72.300  57.165 15.492  1.00 20.92 ? 268 SER A CA  1 
ATOM   2138 C  C   . SER A 1 263 ? 71.976  57.060 16.979  1.00 21.20 ? 268 SER A C   1 
ATOM   2139 O  O   . SER A 1 263 ? 70.814  56.885 17.346  1.00 24.02 ? 268 SER A O   1 
ATOM   2140 C  CB  . SER A 1 263 ? 71.416  56.191 14.712  1.00 21.17 ? 268 SER A CB  1 
ATOM   2141 O  OG  . SER A 1 263 ? 71.702  56.262 13.325  1.00 20.89 ? 268 SER A OG  1 
ATOM   2142 N  N   . ALA A 1 264 ? 72.982  57.164 17.835  1.00 21.89 ? 269 ALA A N   1 
ATOM   2143 C  CA  . ALA A 1 264 ? 72.751  57.079 19.273  1.00 21.85 ? 269 ALA A CA  1 
ATOM   2144 C  C   . ALA A 1 264 ? 72.958  58.452 19.898  1.00 22.96 ? 269 ALA A C   1 
ATOM   2145 O  O   . ALA A 1 264 ? 74.075  58.808 20.277  1.00 22.29 ? 269 ALA A O   1 
ATOM   2146 C  CB  . ALA A 1 264 ? 73.706  56.063 19.901  1.00 20.96 ? 269 ALA A CB  1 
ATOM   2147 N  N   . PRO A 1 265 ? 71.879  59.246 20.011  1.00 25.34 ? 270 PRO A N   1 
ATOM   2148 C  CA  . PRO A 1 265 ? 71.987  60.587 20.598  1.00 27.27 ? 270 PRO A CA  1 
ATOM   2149 C  C   . PRO A 1 265 ? 72.540  60.557 22.017  1.00 29.62 ? 270 PRO A C   1 
ATOM   2150 O  O   . PRO A 1 265 ? 72.267  59.630 22.781  1.00 28.72 ? 270 PRO A O   1 
ATOM   2151 C  CB  . PRO A 1 265 ? 70.548  61.106 20.560  1.00 26.11 ? 270 PRO A CB  1 
ATOM   2152 C  CG  . PRO A 1 265 ? 69.927  60.348 19.417  1.00 27.16 ? 270 PRO A CG  1 
ATOM   2153 C  CD  . PRO A 1 265 ? 70.492  58.960 19.606  1.00 25.58 ? 270 PRO A CD  1 
ATOM   2154 N  N   . ASN A 1 266 ? 73.325  61.574 22.361  1.00 31.80 ? 271 ASN A N   1 
ATOM   2155 C  CA  . ASN A 1 266 ? 73.906  61.680 23.693  1.00 33.76 ? 271 ASN A CA  1 
ATOM   2156 C  C   . ASN A 1 266 ? 74.597  60.380 24.104  1.00 34.07 ? 271 ASN A C   1 
ATOM   2157 O  O   . ASN A 1 266 ? 74.335  59.828 25.176  1.00 32.71 ? 271 ASN A O   1 
ATOM   2158 C  CB  . ASN A 1 266 ? 72.806  62.038 24.698  1.00 37.81 ? 271 ASN A CB  1 
ATOM   2159 C  CG  . ASN A 1 266 ? 73.349  62.708 25.942  1.00 41.29 ? 271 ASN A CG  1 
ATOM   2160 O  OD1 . ASN A 1 266 ? 73.310  62.142 27.036  1.00 44.10 ? 271 ASN A OD1 1 
ATOM   2161 N  ND2 . ASN A 1 266 ? 73.863  63.923 25.782  1.00 44.86 ? 271 ASN A ND2 1 
ATOM   2162 N  N   . TYR A 1 267 ? 75.490  59.905 23.242  1.00 33.03 ? 272 TYR A N   1 
ATOM   2163 C  CA  . TYR A 1 267 ? 76.233  58.669 23.469  1.00 33.90 ? 272 TYR A CA  1 
ATOM   2164 C  C   . TYR A 1 267 ? 76.731  58.499 24.904  1.00 35.71 ? 272 TYR A C   1 
ATOM   2165 O  O   . TYR A 1 267 ? 77.370  59.388 25.472  1.00 35.46 ? 272 TYR A O   1 
ATOM   2166 C  CB  . TYR A 1 267 ? 77.411  58.593 22.488  1.00 30.10 ? 272 TYR A CB  1 
ATOM   2167 C  CG  . TYR A 1 267 ? 78.141  57.263 22.448  1.00 29.06 ? 272 TYR A CG  1 
ATOM   2168 C  CD1 . TYR A 1 267 ? 77.445  56.057 22.340  1.00 27.18 ? 272 TYR A CD1 1 
ATOM   2169 C  CD2 . TYR A 1 267 ? 79.534  57.216 22.472  1.00 27.97 ? 272 TYR A CD2 1 
ATOM   2170 C  CE1 . TYR A 1 267 ? 78.122  54.836 22.255  1.00 26.13 ? 272 TYR A CE1 1 
ATOM   2171 C  CE2 . TYR A 1 267 ? 80.218  56.004 22.386  1.00 29.50 ? 272 TYR A CE2 1 
ATOM   2172 C  CZ  . TYR A 1 267 ? 79.507  54.818 22.277  1.00 26.45 ? 272 TYR A CZ  1 
ATOM   2173 O  OH  . TYR A 1 267 ? 80.192  53.626 22.182  1.00 24.08 ? 272 TYR A OH  1 
ATOM   2174 N  N   . LEU A 1 268 ? 76.417  57.344 25.481  1.00 36.91 ? 273 LEU A N   1 
ATOM   2175 C  CA  . LEU A 1 268 ? 76.816  57.001 26.840  1.00 39.51 ? 273 LEU A CA  1 
ATOM   2176 C  C   . LEU A 1 268 ? 76.487  58.059 27.888  1.00 41.54 ? 273 LEU A C   1 
ATOM   2177 O  O   . LEU A 1 268 ? 77.101  58.092 28.955  1.00 41.33 ? 273 LEU A O   1 
ATOM   2178 C  CB  . LEU A 1 268 ? 78.312  56.686 26.868  1.00 39.10 ? 273 LEU A CB  1 
ATOM   2179 C  CG  . LEU A 1 268 ? 78.669  55.313 26.291  1.00 39.97 ? 273 LEU A CG  1 
ATOM   2180 C  CD1 . LEU A 1 268 ? 80.168  55.201 26.069  1.00 39.43 ? 273 LEU A CD1 1 
ATOM   2181 C  CD2 . LEU A 1 268 ? 78.184  54.231 27.247  1.00 39.08 ? 273 LEU A CD2 1 
ATOM   2182 N  N   . ASP A 1 269 ? 75.510  58.910 27.589  1.00 43.65 ? 274 ASP A N   1 
ATOM   2183 C  CA  . ASP A 1 269 ? 75.103  59.967 28.509  1.00 47.13 ? 274 ASP A CA  1 
ATOM   2184 C  C   . ASP A 1 269 ? 76.186  61.007 28.767  1.00 48.37 ? 274 ASP A C   1 
ATOM   2185 O  O   . ASP A 1 269 ? 75.951  61.973 29.490  1.00 48.96 ? 274 ASP A O   1 
ATOM   2186 C  CB  . ASP A 1 269 ? 74.663  59.370 29.850  1.00 47.79 ? 274 ASP A CB  1 
ATOM   2187 C  CG  . ASP A 1 269 ? 73.216  58.931 29.845  1.00 47.88 ? 274 ASP A CG  1 
ATOM   2188 O  OD1 . ASP A 1 269 ? 72.340  59.795 29.637  1.00 47.46 ? 274 ASP A OD1 1 
ATOM   2189 O  OD2 . ASP A 1 269 ? 72.957  57.728 30.051  1.00 49.01 ? 274 ASP A OD2 1 
ATOM   2190 N  N   . VAL A 1 270 ? 77.366  60.816 28.187  1.00 49.49 ? 275 VAL A N   1 
ATOM   2191 C  CA  . VAL A 1 270 ? 78.456  61.764 28.392  1.00 51.23 ? 275 VAL A CA  1 
ATOM   2192 C  C   . VAL A 1 270 ? 78.543  62.743 27.229  1.00 51.67 ? 275 VAL A C   1 
ATOM   2193 O  O   . VAL A 1 270 ? 78.649  63.952 27.429  1.00 52.12 ? 275 VAL A O   1 
ATOM   2194 C  CB  . VAL A 1 270 ? 79.809  61.049 28.547  1.00 51.76 ? 275 VAL A CB  1 
ATOM   2195 C  CG1 . VAL A 1 270 ? 80.845  62.030 29.054  1.00 53.43 ? 275 VAL A CG1 1 
ATOM   2196 C  CG2 . VAL A 1 270 ? 79.678  59.881 29.509  1.00 52.53 ? 275 VAL A CG2 1 
ATOM   2197 N  N   . TYR A 1 271 ? 78.510  62.216 26.012  1.00 52.21 ? 276 TYR A N   1 
ATOM   2198 C  CA  . TYR A 1 271 ? 78.550  63.060 24.824  1.00 53.31 ? 276 TYR A CA  1 
ATOM   2199 C  C   . TYR A 1 271 ? 77.189  63.733 24.697  1.00 52.10 ? 276 TYR A C   1 
ATOM   2200 O  O   . TYR A 1 271 ? 76.199  63.236 25.227  1.00 53.64 ? 276 TYR A O   1 
ATOM   2201 C  CB  . TYR A 1 271 ? 78.807  62.214 23.574  1.00 54.64 ? 276 TYR A CB  1 
ATOM   2202 C  CG  . TYR A 1 271 ? 80.252  62.128 23.142  1.00 56.98 ? 276 TYR A CG  1 
ATOM   2203 C  CD1 . TYR A 1 271 ? 81.218  61.543 23.960  1.00 57.34 ? 276 TYR A CD1 1 
ATOM   2204 C  CD2 . TYR A 1 271 ? 80.649  62.617 21.897  1.00 57.94 ? 276 TYR A CD2 1 
ATOM   2205 C  CE1 . TYR A 1 271 ? 82.547  61.445 23.545  1.00 57.99 ? 276 TYR A CE1 1 
ATOM   2206 C  CE2 . TYR A 1 271 ? 81.971  62.525 21.473  1.00 58.64 ? 276 TYR A CE2 1 
ATOM   2207 C  CZ  . TYR A 1 271 ? 82.914  61.938 22.299  1.00 58.43 ? 276 TYR A CZ  1 
ATOM   2208 O  OH  . TYR A 1 271 ? 84.218  61.838 21.869  1.00 58.91 ? 276 TYR A OH  1 
ATOM   2209 N  N   . ASN A 1 272 ? 77.138  64.866 24.010  1.00 51.16 ? 277 ASN A N   1 
ATOM   2210 C  CA  . ASN A 1 272 ? 75.869  65.553 23.812  1.00 49.65 ? 277 ASN A CA  1 
ATOM   2211 C  C   . ASN A 1 272 ? 75.620  65.614 22.313  1.00 46.89 ? 277 ASN A C   1 
ATOM   2212 O  O   . ASN A 1 272 ? 75.018  66.554 21.794  1.00 47.52 ? 277 ASN A O   1 
ATOM   2213 C  CB  . ASN A 1 272 ? 75.905  66.967 24.391  1.00 52.19 ? 277 ASN A CB  1 
ATOM   2214 C  CG  . ASN A 1 272 ? 74.517  67.558 24.547  1.00 54.41 ? 277 ASN A CG  1 
ATOM   2215 O  OD1 . ASN A 1 272 ? 73.718  67.082 25.355  1.00 54.84 ? 277 ASN A OD1 1 
ATOM   2216 N  ND2 . ASN A 1 272 ? 74.217  68.589 23.765  1.00 55.26 ? 277 ASN A ND2 1 
ATOM   2217 N  N   . ASN A 1 273 ? 76.100  64.582 21.631  1.00 43.39 ? 278 ASN A N   1 
ATOM   2218 C  CA  . ASN A 1 273 ? 75.973  64.456 20.188  1.00 39.36 ? 278 ASN A CA  1 
ATOM   2219 C  C   . ASN A 1 273 ? 74.540  64.163 19.781  1.00 37.04 ? 278 ASN A C   1 
ATOM   2220 O  O   . ASN A 1 273 ? 73.749  63.644 20.565  1.00 36.18 ? 278 ASN A O   1 
ATOM   2221 C  CB  . ASN A 1 273 ? 76.858  63.313 19.702  1.00 38.69 ? 278 ASN A CB  1 
ATOM   2222 C  CG  . ASN A 1 273 ? 76.304  61.953 20.091  1.00 38.63 ? 278 ASN A CG  1 
ATOM   2223 O  OD1 . ASN A 1 273 ? 75.426  61.413 19.414  1.00 36.82 ? 278 ASN A OD1 1 
ATOM   2224 N  ND2 . ASN A 1 273 ? 76.797  61.404 21.197  1.00 35.91 ? 278 ASN A ND2 1 
ATOM   2225 N  N   . ALA A 1 274 ? 74.211  64.501 18.543  1.00 35.69 ? 279 ALA A N   1 
ATOM   2226 C  CA  . ALA A 1 274 ? 72.888  64.233 18.016  1.00 33.39 ? 279 ALA A CA  1 
ATOM   2227 C  C   . ALA A 1 274 ? 73.004  62.920 17.254  1.00 33.29 ? 279 ALA A C   1 
ATOM   2228 O  O   . ALA A 1 274 ? 74.112  62.440 16.991  1.00 31.59 ? 279 ALA A O   1 
ATOM   2229 C  CB  . ALA A 1 274 ? 72.460  65.342 17.073  1.00 35.38 ? 279 ALA A CB  1 
ATOM   2230 N  N   . GLY A 1 275 ? 71.864  62.337 16.910  1.00 31.28 ? 280 GLY A N   1 
ATOM   2231 C  CA  . GLY A 1 275 ? 71.881  61.099 16.160  1.00 30.86 ? 280 GLY A CA  1 
ATOM   2232 C  C   . GLY A 1 275 ? 71.329  61.428 14.796  1.00 30.54 ? 280 GLY A C   1 
ATOM   2233 O  O   . GLY A 1 275 ? 70.533  62.357 14.664  1.00 30.15 ? 280 GLY A O   1 
ATOM   2234 N  N   . ALA A 1 276 ? 71.741  60.692 13.775  1.00 29.10 ? 281 ALA A N   1 
ATOM   2235 C  CA  . ALA A 1 276 ? 71.243  60.972 12.441  1.00 29.26 ? 281 ALA A CA  1 
ATOM   2236 C  C   . ALA A 1 276 ? 70.886  59.722 11.675  1.00 30.20 ? 281 ALA A C   1 
ATOM   2237 O  O   . ALA A 1 276 ? 71.323  58.617 12.000  1.00 28.08 ? 281 ALA A O   1 
ATOM   2238 C  CB  . ALA A 1 276 ? 72.263  61.787 11.657  1.00 30.23 ? 281 ALA A CB  1 
ATOM   2239 N  N   . MET A 1 277 ? 70.089  59.927 10.637  1.00 29.74 ? 282 MET A N   1 
ATOM   2240 C  CA  . MET A 1 277 ? 69.623  58.865 9.773   1.00 32.33 ? 282 MET A CA  1 
ATOM   2241 C  C   . MET A 1 277 ? 69.678  59.440 8.363   1.00 33.21 ? 282 MET A C   1 
ATOM   2242 O  O   . MET A 1 277 ? 69.251  60.573 8.144   1.00 33.94 ? 282 MET A O   1 
ATOM   2243 C  CB  . MET A 1 277 ? 68.194  58.516 10.181  1.00 34.28 ? 282 MET A CB  1 
ATOM   2244 C  CG  . MET A 1 277 ? 67.469  57.503 9.336   1.00 37.24 ? 282 MET A CG  1 
ATOM   2245 S  SD  . MET A 1 277 ? 65.928  57.048 10.186  1.00 39.02 ? 282 MET A SD  1 
ATOM   2246 C  CE  . MET A 1 277 ? 65.110  58.618 10.287  1.00 37.13 ? 282 MET A CE  1 
ATOM   2247 N  N   . MET A 1 278 ? 70.225  58.686 7.416   1.00 33.09 ? 283 MET A N   1 
ATOM   2248 C  CA  . MET A 1 278 ? 70.308  59.170 6.041   1.00 34.14 ? 283 MET A CA  1 
ATOM   2249 C  C   . MET A 1 278 ? 69.298  58.496 5.131   1.00 33.72 ? 283 MET A C   1 
ATOM   2250 O  O   . MET A 1 278 ? 69.295  57.275 4.981   1.00 34.39 ? 283 MET A O   1 
ATOM   2251 C  CB  . MET A 1 278 ? 71.711  58.963 5.466   1.00 34.31 ? 283 MET A CB  1 
ATOM   2252 C  CG  . MET A 1 278 ? 71.834  59.426 4.019   1.00 34.10 ? 283 MET A CG  1 
ATOM   2253 S  SD  . MET A 1 278 ? 73.519  59.402 3.377   1.00 34.94 ? 283 MET A SD  1 
ATOM   2254 C  CE  . MET A 1 278 ? 73.607  57.751 2.692   1.00 34.08 ? 283 MET A CE  1 
ATOM   2255 N  N   . SER A 1 279 ? 68.446  59.305 4.514   1.00 34.54 ? 284 SER A N   1 
ATOM   2256 C  CA  . SER A 1 279 ? 67.427  58.796 3.611   1.00 36.73 ? 284 SER A CA  1 
ATOM   2257 C  C   . SER A 1 279 ? 67.887  58.962 2.168   1.00 38.35 ? 284 SER A C   1 
ATOM   2258 O  O   . SER A 1 279 ? 68.435  60.000 1.797   1.00 38.19 ? 284 SER A O   1 
ATOM   2259 C  CB  . SER A 1 279 ? 66.109  59.543 3.836   1.00 37.14 ? 284 SER A CB  1 
ATOM   2260 O  OG  . SER A 1 279 ? 65.075  59.011 3.028   1.00 43.02 ? 284 SER A OG  1 
ATOM   2261 N  N   . VAL A 1 280 ? 67.674  57.927 1.363   1.00 40.02 ? 285 VAL A N   1 
ATOM   2262 C  CA  . VAL A 1 280 ? 68.057  57.953 -0.043  1.00 42.56 ? 285 VAL A CA  1 
ATOM   2263 C  C   . VAL A 1 280 ? 66.848  57.600 -0.908  1.00 44.71 ? 285 VAL A C   1 
ATOM   2264 O  O   . VAL A 1 280 ? 66.245  56.537 -0.742  1.00 43.52 ? 285 VAL A O   1 
ATOM   2265 C  CB  . VAL A 1 280 ? 69.212  56.959 -0.320  1.00 42.45 ? 285 VAL A CB  1 
ATOM   2266 C  CG1 . VAL A 1 280 ? 68.845  55.582 0.192   1.00 44.19 ? 285 VAL A CG1 1 
ATOM   2267 C  CG2 . VAL A 1 280 ? 69.517  56.909 -1.807  1.00 42.14 ? 285 VAL A CG2 1 
ATOM   2268 N  N   . ASP A 1 281 ? 66.490  58.499 -1.823  1.00 47.15 ? 286 ASP A N   1 
ATOM   2269 C  CA  . ASP A 1 281 ? 65.343  58.277 -2.699  1.00 50.32 ? 286 ASP A CA  1 
ATOM   2270 C  C   . ASP A 1 281 ? 65.740  57.662 -4.038  1.00 51.78 ? 286 ASP A C   1 
ATOM   2271 O  O   . ASP A 1 281 ? 66.925  57.516 -4.336  1.00 52.03 ? 286 ASP A O   1 
ATOM   2272 C  CB  . ASP A 1 281 ? 64.584  59.594 -2.917  1.00 51.60 ? 286 ASP A CB  1 
ATOM   2273 C  CG  . ASP A 1 281 ? 65.405  60.633 -3.659  1.00 51.60 ? 286 ASP A CG  1 
ATOM   2274 O  OD1 . ASP A 1 281 ? 66.382  60.261 -4.342  1.00 51.58 ? 286 ASP A OD1 1 
ATOM   2275 O  OD2 . ASP A 1 281 ? 65.060  61.831 -3.567  1.00 52.60 ? 286 ASP A OD2 1 
ATOM   2276 N  N   . GLU A 1 282 ? 64.740  57.306 -4.840  1.00 53.40 ? 287 GLU A N   1 
ATOM   2277 C  CA  . GLU A 1 282 ? 64.966  56.686 -6.143  1.00 55.23 ? 287 GLU A CA  1 
ATOM   2278 C  C   . GLU A 1 282 ? 65.859  57.477 -7.091  1.00 55.46 ? 287 GLU A C   1 
ATOM   2279 O  O   . GLU A 1 282 ? 66.439  56.909 -8.015  1.00 55.60 ? 287 GLU A O   1 
ATOM   2280 C  CB  . GLU A 1 282 ? 63.628  56.399 -6.833  1.00 57.31 ? 287 GLU A CB  1 
ATOM   2281 C  CG  . GLU A 1 282 ? 62.455  57.218 -6.313  1.00 59.62 ? 287 GLU A CG  1 
ATOM   2282 C  CD  . GLU A 1 282 ? 61.957  56.725 -4.967  1.00 60.94 ? 287 GLU A CD  1 
ATOM   2283 O  OE1 . GLU A 1 282 ? 61.574  55.539 -4.878  1.00 61.80 ? 287 GLU A OE1 1 
ATOM   2284 O  OE2 . GLU A 1 282 ? 61.948  57.519 -4.001  1.00 62.06 ? 287 GLU A OE2 1 
ATOM   2285 N  N   . THR A 1 283 ? 65.964  58.784 -6.874  1.00 56.05 ? 288 THR A N   1 
ATOM   2286 C  CA  . THR A 1 283 ? 66.803  59.620 -7.726  1.00 56.11 ? 288 THR A CA  1 
ATOM   2287 C  C   . THR A 1 283 ? 68.213  59.641 -7.149  1.00 56.68 ? 288 THR A C   1 
ATOM   2288 O  O   . THR A 1 283 ? 69.024  60.509 -7.477  1.00 56.67 ? 288 THR A O   1 
ATOM   2289 C  CB  . THR A 1 283 ? 66.271  61.068 -7.805  1.00 55.68 ? 288 THR A CB  1 
ATOM   2290 O  OG1 . THR A 1 283 ? 66.445  61.717 -6.540  1.00 54.94 ? 288 THR A OG1 1 
ATOM   2291 C  CG2 . THR A 1 283 ? 64.792  61.068 -8.169  1.00 55.93 ? 288 THR A CG2 1 
ATOM   2292 N  N   . LEU A 1 284 ? 68.489  58.669 -6.285  1.00 56.89 ? 289 LEU A N   1 
ATOM   2293 C  CA  . LEU A 1 284 ? 69.784  58.539 -5.632  1.00 56.92 ? 289 LEU A CA  1 
ATOM   2294 C  C   . LEU A 1 284 ? 70.169  59.849 -4.957  1.00 56.70 ? 289 LEU A C   1 
ATOM   2295 O  O   . LEU A 1 284 ? 71.347  60.188 -4.848  1.00 57.27 ? 289 LEU A O   1 
ATOM   2296 C  CB  . LEU A 1 284 ? 70.859  58.127 -6.645  1.00 57.04 ? 289 LEU A CB  1 
ATOM   2297 C  CG  . LEU A 1 284 ? 72.192  57.622 -6.075  1.00 57.31 ? 289 LEU A CG  1 
ATOM   2298 C  CD1 . LEU A 1 284 ? 71.949  56.398 -5.204  1.00 57.09 ? 289 LEU A CD1 1 
ATOM   2299 C  CD2 . LEU A 1 284 ? 73.144  57.277 -7.209  1.00 56.85 ? 289 LEU A CD2 1 
ATOM   2300 N  N   . MET A 1 285 ? 69.164  60.587 -4.505  1.00 56.21 ? 290 MET A N   1 
ATOM   2301 C  CA  . MET A 1 285 ? 69.401  61.849 -3.824  1.00 55.97 ? 290 MET A CA  1 
ATOM   2302 C  C   . MET A 1 285 ? 69.486  61.568 -2.329  1.00 54.43 ? 290 MET A C   1 
ATOM   2303 O  O   . MET A 1 285 ? 68.591  60.947 -1.762  1.00 53.46 ? 290 MET A O   1 
ATOM   2304 C  CB  . MET A 1 285 ? 68.260  62.827 -4.105  1.00 58.88 ? 290 MET A CB  1 
ATOM   2305 C  CG  . MET A 1 285 ? 68.411  64.155 -3.387  1.00 61.81 ? 290 MET A CG  1 
ATOM   2306 S  SD  . MET A 1 285 ? 67.099  65.323 -3.782  1.00 67.15 ? 290 MET A SD  1 
ATOM   2307 C  CE  . MET A 1 285 ? 67.869  66.245 -5.117  1.00 65.32 ? 290 MET A CE  1 
ATOM   2308 N  N   . CYS A 1 286 ? 70.563  62.020 -1.697  1.00 52.84 ? 291 CYS A N   1 
ATOM   2309 C  CA  . CYS A 1 286 ? 70.750  61.799 -0.270  1.00 52.38 ? 291 CYS A CA  1 
ATOM   2310 C  C   . CYS A 1 286 ? 70.240  62.933 0.600   1.00 51.26 ? 291 CYS A C   1 
ATOM   2311 O  O   . CYS A 1 286 ? 70.430  64.109 0.287   1.00 50.49 ? 291 CYS A O   1 
ATOM   2312 C  CB  . CYS A 1 286 ? 72.227  61.529 0.028   1.00 53.65 ? 291 CYS A CB  1 
ATOM   2313 S  SG  . CYS A 1 286 ? 72.621  59.760 -0.120  1.00 54.14 ? 291 CYS A SG  1 
ATOM   2314 N  N   . SER A 1 287 ? 69.592  62.556 1.699   1.00 49.36 ? 292 SER A N   1 
ATOM   2315 C  CA  . SER A 1 287 ? 69.025  63.504 2.653   1.00 48.45 ? 292 SER A CA  1 
ATOM   2316 C  C   . SER A 1 287 ? 69.266  63.012 4.082   1.00 47.90 ? 292 SER A C   1 
ATOM   2317 O  O   . SER A 1 287 ? 69.280  61.807 4.334   1.00 47.89 ? 292 SER A O   1 
ATOM   2318 C  CB  . SER A 1 287 ? 67.523  63.647 2.407   1.00 47.89 ? 292 SER A CB  1 
ATOM   2319 O  OG  . SER A 1 287 ? 66.950  64.548 3.333   1.00 50.75 ? 292 SER A OG  1 
ATOM   2320 N  N   . PHE A 1 288 ? 69.444  63.940 5.016   1.00 46.17 ? 293 PHE A N   1 
ATOM   2321 C  CA  . PHE A 1 288 ? 69.700  63.576 6.404   1.00 44.90 ? 293 PHE A CA  1 
ATOM   2322 C  C   . PHE A 1 288 ? 68.588  63.991 7.362   1.00 46.27 ? 293 PHE A C   1 
ATOM   2323 O  O   . PHE A 1 288 ? 68.124  65.129 7.347   1.00 45.34 ? 293 PHE A O   1 
ATOM   2324 C  CB  . PHE A 1 288 ? 71.030  64.186 6.859   1.00 43.01 ? 293 PHE A CB  1 
ATOM   2325 C  CG  . PHE A 1 288 ? 72.215  63.690 6.078   1.00 42.02 ? 293 PHE A CG  1 
ATOM   2326 C  CD1 . PHE A 1 288 ? 72.746  62.427 6.321   1.00 41.18 ? 293 PHE A CD1 1 
ATOM   2327 C  CD2 . PHE A 1 288 ? 72.767  64.463 5.062   1.00 41.10 ? 293 PHE A CD2 1 
ATOM   2328 C  CE1 . PHE A 1 288 ? 73.809  61.938 5.559   1.00 40.98 ? 293 PHE A CE1 1 
ATOM   2329 C  CE2 . PHE A 1 288 ? 73.829  63.984 4.295   1.00 42.19 ? 293 PHE A CE2 1 
ATOM   2330 C  CZ  . PHE A 1 288 ? 74.350  62.717 4.544   1.00 40.46 ? 293 PHE A CZ  1 
ATOM   2331 N  N   . GLN A 1 289 ? 68.159  63.042 8.185   1.00 47.31 ? 294 GLN A N   1 
ATOM   2332 C  CA  . GLN A 1 289 ? 67.124  63.282 9.178   1.00 49.07 ? 294 GLN A CA  1 
ATOM   2333 C  C   . GLN A 1 289 ? 67.822  63.203 10.529  1.00 49.19 ? 294 GLN A C   1 
ATOM   2334 O  O   . GLN A 1 289 ? 68.293  62.140 10.931  1.00 48.52 ? 294 GLN A O   1 
ATOM   2335 C  CB  . GLN A 1 289 ? 66.031  62.216 9.068   1.00 51.13 ? 294 GLN A CB  1 
ATOM   2336 C  CG  . GLN A 1 289 ? 65.288  62.239 7.736   1.00 54.81 ? 294 GLN A CG  1 
ATOM   2337 C  CD  . GLN A 1 289 ? 64.254  61.132 7.613   1.00 57.34 ? 294 GLN A CD  1 
ATOM   2338 O  OE1 . GLN A 1 289 ? 64.597  59.954 7.494   1.00 58.50 ? 294 GLN A OE1 1 
ATOM   2339 N  NE2 . GLN A 1 289 ? 62.978  61.506 7.644   1.00 58.83 ? 294 GLN A NE2 1 
ATOM   2340 N  N   . ILE A 1 290 ? 67.903  64.335 11.219  1.00 50.03 ? 295 ILE A N   1 
ATOM   2341 C  CA  . ILE A 1 290 ? 68.574  64.393 12.511  1.00 50.94 ? 295 ILE A CA  1 
ATOM   2342 C  C   . ILE A 1 290 ? 67.666  64.113 13.706  1.00 52.44 ? 295 ILE A C   1 
ATOM   2343 O  O   . ILE A 1 290 ? 66.472  64.418 13.691  1.00 52.07 ? 295 ILE A O   1 
ATOM   2344 C  CB  . ILE A 1 290 ? 69.269  65.762 12.705  1.00 51.33 ? 295 ILE A CB  1 
ATOM   2345 C  CG1 . ILE A 1 290 ? 70.380  65.925 11.664  1.00 51.80 ? 295 ILE A CG1 1 
ATOM   2346 C  CG2 . ILE A 1 290 ? 69.849  65.870 14.108  1.00 50.85 ? 295 ILE A CG2 1 
ATOM   2347 C  CD1 . ILE A 1 290 ? 71.223  67.172 11.844  1.00 52.68 ? 295 ILE A CD1 1 
ATOM   2348 N  N   . LEU A 1 291 ? 68.259  63.523 14.739  1.00 53.26 ? 296 LEU A N   1 
ATOM   2349 C  CA  . LEU A 1 291 ? 67.557  63.178 15.964  1.00 54.67 ? 296 LEU A CA  1 
ATOM   2350 C  C   . LEU A 1 291 ? 68.300  63.806 17.141  1.00 55.52 ? 296 LEU A C   1 
ATOM   2351 O  O   . LEU A 1 291 ? 69.337  63.303 17.577  1.00 55.25 ? 296 LEU A O   1 
ATOM   2352 C  CB  . LEU A 1 291 ? 67.514  61.656 16.120  1.00 56.34 ? 296 LEU A CB  1 
ATOM   2353 C  CG  . LEU A 1 291 ? 66.614  61.066 17.206  1.00 57.21 ? 296 LEU A CG  1 
ATOM   2354 C  CD1 . LEU A 1 291 ? 65.161  61.420 16.917  1.00 58.01 ? 296 LEU A CD1 1 
ATOM   2355 C  CD2 . LEU A 1 291 ? 66.793  59.557 17.247  1.00 57.68 ? 296 LEU A CD2 1 
ATOM   2356 N  N   . LYS A 1 292 ? 67.769  64.912 17.648  1.00 56.59 ? 297 LYS A N   1 
ATOM   2357 C  CA  . LYS A 1 292 ? 68.381  65.620 18.765  1.00 58.26 ? 297 LYS A CA  1 
ATOM   2358 C  C   . LYS A 1 292 ? 68.267  64.807 20.052  1.00 58.51 ? 297 LYS A C   1 
ATOM   2359 O  O   . LYS A 1 292 ? 67.317  64.047 20.231  1.00 58.55 ? 297 LYS A O   1 
ATOM   2360 C  CB  . LYS A 1 292 ? 67.705  66.981 18.937  1.00 60.21 ? 297 LYS A CB  1 
ATOM   2361 C  CG  . LYS A 1 292 ? 67.701  67.813 17.661  1.00 62.93 ? 297 LYS A CG  1 
ATOM   2362 C  CD  . LYS A 1 292 ? 66.790  69.027 17.766  1.00 64.48 ? 297 LYS A CD  1 
ATOM   2363 C  CE  . LYS A 1 292 ? 66.703  69.754 16.429  1.00 65.97 ? 297 LYS A CE  1 
ATOM   2364 N  NZ  . LYS A 1 292 ? 65.720  70.875 16.443  1.00 66.68 ? 297 LYS A NZ  1 
ATOM   2365 N  N   . PRO A 1 293 ? 69.241  64.956 20.964  1.00 58.92 ? 298 PRO A N   1 
ATOM   2366 C  CA  . PRO A 1 293 ? 69.250  64.232 22.240  1.00 60.02 ? 298 PRO A CA  1 
ATOM   2367 C  C   . PRO A 1 293 ? 68.129  64.665 23.185  1.00 61.15 ? 298 PRO A C   1 
ATOM   2368 O  O   . PRO A 1 293 ? 68.445  65.259 24.240  1.00 61.11 ? 298 PRO A O   1 
ATOM   2369 C  CB  . PRO A 1 293 ? 70.637  64.543 22.798  1.00 59.87 ? 298 PRO A CB  1 
ATOM   2370 C  CG  . PRO A 1 293 ? 70.879  65.933 22.300  1.00 59.24 ? 298 PRO A CG  1 
ATOM   2371 C  CD  . PRO A 1 293 ? 70.410  65.849 20.863  1.00 58.45 ? 298 PRO A CD  1 
HETATM 2372 MN MN  . MN  B 2 .   ? 81.849  50.276 15.866  1.00 18.64 ? 400 MN  A MN  1 
HETATM 2373 MN MN  . MN  C 2 .   ? 79.933  52.000 17.928  1.00 22.33 ? 401 MN  A MN  1 
HETATM 2374 C  C1  . OKA D 3 .   ? 83.770  52.844 21.981  1.00 30.78 ? 501 OKA A C1  1 
HETATM 2375 C  C2  . OKA D 3 .   ? 83.561  52.203 23.343  1.00 30.53 ? 501 OKA A C2  1 
HETATM 2376 C  C3  . OKA D 3 .   ? 84.859  52.083 24.110  1.00 30.55 ? 501 OKA A C3  1 
HETATM 2377 C  C4  . OKA D 3 .   ? 85.571  53.421 24.502  1.00 30.42 ? 501 OKA A C4  1 
HETATM 2378 C  C5  . OKA D 3 .   ? 86.819  53.242 25.222  1.00 30.31 ? 501 OKA A C5  1 
HETATM 2379 C  C6  . OKA D 3 .   ? 87.428  54.586 25.594  1.00 32.02 ? 501 OKA A C6  1 
HETATM 2380 C  C7  . OKA D 3 .   ? 86.359  55.359 26.422  1.00 29.46 ? 501 OKA A C7  1 
HETATM 2381 C  C8  . OKA D 3 .   ? 85.069  55.558 25.702  1.00 30.09 ? 501 OKA A C8  1 
HETATM 2382 C  C9  . OKA D 3 .   ? 83.983  56.205 26.422  1.00 30.37 ? 501 OKA A C9  1 
HETATM 2383 C  C10 . OKA D 3 .   ? 83.302  57.282 25.997  1.00 30.63 ? 501 OKA A C10 1 
HETATM 2384 C  C11 . OKA D 3 .   ? 83.621  57.906 24.647  1.00 30.84 ? 501 OKA A C11 1 
HETATM 2385 C  C12 . OKA D 3 .   ? 84.390  56.898 23.748  1.00 30.70 ? 501 OKA A C12 1 
HETATM 2386 C  C13 . OKA D 3 .   ? 85.025  57.552 22.526  1.00 30.39 ? 501 OKA A C13 1 
HETATM 2387 C  C14 . OKA D 3 .   ? 85.774  56.537 21.757  1.00 30.41 ? 501 OKA A C14 1 
HETATM 2388 C  C15 . OKA D 3 .   ? 87.010  56.541 21.560  1.00 28.95 ? 501 OKA A C15 1 
HETATM 2389 C  C16 . OKA D 3 .   ? 87.907  55.557 20.834  1.00 29.15 ? 501 OKA A C16 1 
HETATM 2390 C  C17 . OKA D 3 .   ? 88.877  56.033 19.760  1.00 28.45 ? 501 OKA A C17 1 
HETATM 2391 C  C18 . OKA D 3 .   ? 90.129  55.108 19.884  1.00 28.04 ? 501 OKA A C18 1 
HETATM 2392 C  C19 . OKA D 3 .   ? 89.717  54.147 21.092  1.00 28.34 ? 501 OKA A C19 1 
HETATM 2393 C  C20 . OKA D 3 .   ? 90.877  53.822 21.948  1.00 27.78 ? 501 OKA A C20 1 
HETATM 2394 C  C21 . OKA D 3 .   ? 90.411  52.857 23.122  1.00 28.59 ? 501 OKA A C21 1 
HETATM 2395 C  C22 . OKA D 3 .   ? 89.761  51.625 22.451  1.00 27.45 ? 501 OKA A C22 1 
HETATM 2396 C  C23 . OKA D 3 .   ? 88.645  52.085 21.560  1.00 27.33 ? 501 OKA A C23 1 
HETATM 2397 C  C24 . OKA D 3 .   ? 88.015  50.807 20.914  1.00 26.88 ? 501 OKA A C24 1 
HETATM 2398 C  C25 . OKA D 3 .   ? 87.518  49.815 22.056  1.00 27.14 ? 501 OKA A C25 1 
HETATM 2399 C  C26 . OKA D 3 .   ? 88.616  49.534 23.000  1.00 26.27 ? 501 OKA A C26 1 
HETATM 2400 C  C27 . OKA D 3 .   ? 89.766  48.554 22.609  1.00 27.77 ? 501 OKA A C27 1 
HETATM 2401 C  C28 . OKA D 3 .   ? 89.220  47.159 22.204  1.00 24.93 ? 501 OKA A C28 1 
HETATM 2402 C  C29 . OKA D 3 .   ? 90.336  46.154 21.783  1.00 28.21 ? 501 OKA A C29 1 
HETATM 2403 C  C30 . OKA D 3 .   ? 89.704  44.761 21.489  1.00 28.57 ? 501 OKA A C30 1 
HETATM 2404 C  C31 . OKA D 3 .   ? 88.941  44.132 22.662  1.00 30.32 ? 501 OKA A C31 1 
HETATM 2405 C  C32 . OKA D 3 .   ? 88.481  42.745 22.191  1.00 32.15 ? 501 OKA A C32 1 
HETATM 2406 C  C33 . OKA D 3 .   ? 89.666  41.869 21.684  1.00 33.41 ? 501 OKA A C33 1 
HETATM 2407 C  C34 . OKA D 3 .   ? 90.513  42.581 20.687  1.00 33.23 ? 501 OKA A C34 1 
HETATM 2408 C  C35 . OKA D 3 .   ? 91.860  41.951 20.384  1.00 34.63 ? 501 OKA A C35 1 
HETATM 2409 C  C36 . OKA D 3 .   ? 92.513  42.557 19.108  1.00 35.78 ? 501 OKA A C36 1 
HETATM 2410 C  C37 . OKA D 3 .   ? 91.622  42.611 17.894  1.00 37.18 ? 501 OKA A C37 1 
HETATM 2411 C  C38 . OKA D 3 .   ? 90.269  43.215 18.269  1.00 36.28 ? 501 OKA A C38 1 
HETATM 2412 C  C39 . OKA D 3 .   ? 89.753  43.990 23.980  1.00 30.96 ? 501 OKA A C39 1 
HETATM 2413 C  C40 . OKA D 3 .   ? 91.047  46.651 20.541  1.00 23.96 ? 501 OKA A C40 1 
HETATM 2414 C  C41 . OKA D 3 .   ? 86.332  49.414 22.074  1.00 26.59 ? 501 OKA A C41 1 
HETATM 2415 C  C42 . OKA D 3 .   ? 84.033  58.248 21.643  1.00 32.98 ? 501 OKA A C42 1 
HETATM 2416 C  C43 . OKA D 3 .   ? 82.191  57.936 26.784  1.00 32.94 ? 501 OKA A C43 1 
HETATM 2417 C  C44 . OKA D 3 .   ? 82.958  50.803 23.011  1.00 30.36 ? 501 OKA A C44 1 
HETATM 2418 O  O1  . OKA D 3 .   ? 82.956  53.902 21.725  1.00 29.60 ? 501 OKA A O1  1 
HETATM 2419 O  O2  . OKA D 3 .   ? 84.586  52.517 21.127  1.00 32.03 ? 501 OKA A O2  1 
HETATM 2420 O  O3  . OKA D 3 .   ? 82.548  52.849 24.037  1.00 28.90 ? 501 OKA A O3  1 
HETATM 2421 O  O4  . OKA D 3 .   ? 84.562  54.211 25.268  1.00 28.58 ? 501 OKA A O4  1 
HETATM 2422 O  O5  . OKA D 3 .   ? 86.905  56.655 26.821  1.00 29.37 ? 501 OKA A O5  1 
HETATM 2423 O  O6  . OKA D 3 .   ? 85.400  56.255 24.486  1.00 28.84 ? 501 OKA A O6  1 
HETATM 2424 O  O7  . OKA D 3 .   ? 88.704  54.906 21.793  1.00 27.20 ? 501 OKA A O7  1 
HETATM 2425 O  O8  . OKA D 3 .   ? 89.090  52.955 20.524  1.00 29.06 ? 501 OKA A O8  1 
HETATM 2426 O  O9  . OKA D 3 .   ? 89.307  50.769 23.487  1.00 26.52 ? 501 OKA A O9  1 
HETATM 2427 O  O10 . OKA D 3 .   ? 86.972  51.145 20.021  1.00 25.85 ? 501 OKA A O10 1 
HETATM 2428 O  O11 . OKA D 3 .   ? 90.684  48.399 23.606  1.00 29.30 ? 501 OKA A O11 1 
HETATM 2429 O  O12 . OKA D 3 .   ? 90.813  43.908 21.081  1.00 30.22 ? 501 OKA A O12 1 
HETATM 2430 O  O13 . OKA D 3 .   ? 89.700  42.590 19.480  1.00 35.04 ? 501 OKA A O13 1 
HETATM 2431 C  C1  . BME E 4 .   ? 91.757  41.039 14.489  1.00 38.75 ? 301 BME A C1  1 
HETATM 2432 C  C2  . BME E 4 .   ? 90.227  40.893 14.398  1.00 34.95 ? 301 BME A C2  1 
HETATM 2433 O  O1  . BME E 4 .   ? 92.249  40.214 15.524  1.00 44.11 ? 301 BME A O1  1 
HETATM 2434 S  S2  . BME E 4 .   ? 89.466  42.464 13.945  1.00 26.16 ? 301 BME A S2  1 
HETATM 2435 C  C1  . BME F 4 .   ? 74.793  60.981 -2.882  1.00 62.03 ? 302 BME A C1  1 
HETATM 2436 C  C2  . BME F 4 .   ? 74.370  59.527 -2.583  1.00 60.11 ? 302 BME A C2  1 
HETATM 2437 O  O1  . BME F 4 .   ? 76.194  61.098 -2.741  1.00 63.41 ? 302 BME A O1  1 
HETATM 2438 S  S2  . BME F 4 .   ? 72.625  59.428 -2.120  1.00 58.27 ? 302 BME A S2  1 
HETATM 2439 C  C1  . BME G 4 .   ? 85.926  41.553 15.311  1.00 38.04 ? 303 BME A C1  1 
HETATM 2440 C  C2  . BME G 4 .   ? 85.582  40.084 15.615  1.00 36.89 ? 303 BME A C2  1 
HETATM 2441 O  O1  . BME G 4 .   ? 87.058  41.943 16.060  1.00 37.16 ? 303 BME A O1  1 
HETATM 2442 S  S2  . BME G 4 .   ? 83.853  39.708 15.213  1.00 35.11 ? 303 BME A S2  1 
HETATM 2443 O  O   . HOH H 5 .   ? 79.347  37.554 9.629   1.00 18.85 ? 502 HOH A O   1 
HETATM 2444 O  O   . HOH H 5 .   ? 94.479  43.985 6.255   1.00 18.02 ? 503 HOH A O   1 
HETATM 2445 O  O   . HOH H 5 .   ? 70.468  41.731 7.194   1.00 13.60 ? 504 HOH A O   1 
HETATM 2446 O  O   . HOH H 5 .   ? 83.116  50.930 18.477  1.00 34.65 ? 505 HOH A O   1 
HETATM 2447 O  O   . HOH H 5 .   ? 79.229  42.889 29.242  1.00 16.14 ? 506 HOH A O   1 
HETATM 2448 O  O   . HOH H 5 .   ? 80.365  46.107 8.244   1.00 20.93 ? 507 HOH A O   1 
HETATM 2449 O  O   . HOH H 5 .   ? 93.457  44.011 10.210  1.00 22.25 ? 508 HOH A O   1 
HETATM 2450 O  O   . HOH H 5 .   ? 62.947  43.314 32.569  1.00 25.48 ? 509 HOH A O   1 
HETATM 2451 O  O   . HOH H 5 .   ? 85.485  40.847 19.440  1.00 62.10 ? 510 HOH A O   1 
HETATM 2452 O  O   . HOH H 5 .   ? 70.724  39.594 5.303   1.00 16.76 ? 511 HOH A O   1 
HETATM 2453 O  O   . HOH H 5 .   ? 56.712  39.765 27.479  1.00 20.03 ? 512 HOH A O   1 
HETATM 2454 O  O   . HOH H 5 .   ? 96.120  42.999 8.829   1.00 24.18 ? 513 HOH A O   1 
HETATM 2455 O  O   . HOH H 5 .   ? 89.101  36.877 10.525  1.00 24.87 ? 514 HOH A O   1 
HETATM 2456 O  O   . HOH H 5 .   ? 67.144  54.848 25.133  1.00 20.62 ? 515 HOH A O   1 
HETATM 2457 O  O   . HOH H 5 .   ? 96.344  57.604 11.841  1.00 24.50 ? 516 HOH A O   1 
HETATM 2458 O  O   . HOH H 5 .   ? 73.017  50.341 13.247  1.00 17.99 ? 517 HOH A O   1 
HETATM 2459 O  O   . HOH H 5 .   ? 72.963  38.176 4.616   1.00 19.25 ? 518 HOH A O   1 
HETATM 2460 O  O   . HOH H 5 .   ? 63.367  41.087 26.148  1.00 14.01 ? 519 HOH A O   1 
HETATM 2461 O  O   . HOH H 5 .   ? 79.955  67.101 7.228   1.00 20.29 ? 520 HOH A O   1 
HETATM 2462 O  O   . HOH H 5 .   ? 89.083  38.411 -6.596  1.00 29.72 ? 521 HOH A O   1 
HETATM 2463 O  O   . HOH H 5 .   ? 84.772  66.644 8.958   1.00 27.01 ? 522 HOH A O   1 
HETATM 2464 O  O   . HOH H 5 .   ? 81.653  36.401 17.660  1.00 27.66 ? 523 HOH A O   1 
HETATM 2465 O  O   . HOH H 5 .   ? 52.632  43.175 15.638  1.00 33.40 ? 524 HOH A O   1 
HETATM 2466 O  O   . HOH H 5 .   ? 57.570  42.646 30.138  1.00 19.17 ? 525 HOH A O   1 
HETATM 2467 O  O   . HOH H 5 .   ? 89.985  39.607 8.958   1.00 21.94 ? 526 HOH A O   1 
HETATM 2468 O  O   . HOH H 5 .   ? 74.207  46.392 26.968  1.00 32.29 ? 527 HOH A O   1 
HETATM 2469 O  O   . HOH H 5 .   ? 88.934  61.887 6.496   1.00 23.81 ? 528 HOH A O   1 
HETATM 2470 O  O   . HOH H 5 .   ? 73.300  47.912 -5.529  1.00 24.37 ? 529 HOH A O   1 
HETATM 2471 O  O   . HOH H 5 .   ? 99.960  54.306 2.556   1.00 22.23 ? 530 HOH A O   1 
HETATM 2472 O  O   . HOH H 5 .   ? 55.415  45.045 26.463  1.00 26.76 ? 531 HOH A O   1 
HETATM 2473 O  O   . HOH H 5 .   ? 97.158  50.479 13.170  1.00 29.56 ? 532 HOH A O   1 
HETATM 2474 O  O   . HOH H 5 .   ? 52.437  47.818 20.749  1.00 30.00 ? 533 HOH A O   1 
HETATM 2475 O  O   . HOH H 5 .   ? 60.570  43.952 33.722  1.00 28.27 ? 534 HOH A O   1 
HETATM 2476 O  O   . HOH H 5 .   ? 81.418  31.812 27.915  1.00 37.23 ? 535 HOH A O   1 
HETATM 2477 O  O   . HOH H 5 .   ? 75.086  46.309 30.635  1.00 23.78 ? 536 HOH A O   1 
HETATM 2478 O  O   . HOH H 5 .   ? 87.272  58.691 -10.209 1.00 37.78 ? 537 HOH A O   1 
HETATM 2479 O  O   . HOH H 5 .   ? 74.746  54.074 24.648  1.00 33.20 ? 538 HOH A O   1 
HETATM 2480 O  O   . HOH H 5 .   ? 61.015  47.867 6.387   1.00 27.15 ? 539 HOH A O   1 
HETATM 2481 O  O   . HOH H 5 .   ? 91.130  52.956 -9.087  1.00 29.96 ? 540 HOH A O   1 
HETATM 2482 O  O   . HOH H 5 .   ? 93.042  61.955 3.779   1.00 29.86 ? 541 HOH A O   1 
HETATM 2483 O  O   . HOH H 5 .   ? 85.452  36.357 23.474  1.00 29.83 ? 542 HOH A O   1 
HETATM 2484 O  O   . HOH H 5 .   ? 67.511  46.082 33.934  1.00 37.95 ? 543 HOH A O   1 
HETATM 2485 O  O   . HOH H 5 .   ? 58.735  30.702 20.435  1.00 40.65 ? 544 HOH A O   1 
HETATM 2486 O  O   . HOH H 5 .   ? 69.541  29.714 24.019  1.00 28.74 ? 545 HOH A O   1 
HETATM 2487 O  O   . HOH H 5 .   ? 77.998  67.421 9.865   1.00 31.06 ? 546 HOH A O   1 
HETATM 2488 O  O   . HOH H 5 .   ? 59.994  41.984 3.352   1.00 36.03 ? 547 HOH A O   1 
HETATM 2489 O  O   . HOH H 5 .   ? 89.745  58.384 12.380  1.00 33.59 ? 548 HOH A O   1 
HETATM 2490 O  O   . HOH H 5 .   ? 69.943  53.475 26.884  1.00 24.44 ? 549 HOH A O   1 
HETATM 2491 O  O   . HOH H 5 .   ? 55.374  30.212 24.461  1.00 37.46 ? 550 HOH A O   1 
HETATM 2492 O  O   . HOH H 5 .   ? 69.121  59.157 24.607  1.00 32.64 ? 551 HOH A O   1 
HETATM 2493 O  O   . HOH H 5 .   ? 87.822  58.288 -7.778  1.00 32.98 ? 552 HOH A O   1 
HETATM 2494 O  O   . HOH H 5 .   ? 93.349  56.296 14.839  1.00 28.32 ? 553 HOH A O   1 
HETATM 2495 O  O   . HOH H 5 .   ? 96.444  41.555 5.966   1.00 27.49 ? 554 HOH A O   1 
HETATM 2496 O  O   . HOH H 5 .   ? 89.644  48.137 -4.042  1.00 33.78 ? 555 HOH A O   1 
HETATM 2497 O  O   . HOH H 5 .   ? 89.603  56.997 23.586  1.00 33.17 ? 556 HOH A O   1 
HETATM 2498 O  O   . HOH H 5 .   ? 75.452  40.852 34.751  1.00 26.47 ? 557 HOH A O   1 
HETATM 2499 O  O   . HOH H 5 .   ? 82.983  30.582 13.650  1.00 43.97 ? 558 HOH A O   1 
HETATM 2500 O  O   . HOH H 5 .   ? 96.818  54.970 -1.847  1.00 33.47 ? 559 HOH A O   1 
HETATM 2501 O  O   . HOH H 5 .   ? 68.756  46.010 30.049  1.00 33.34 ? 560 HOH A O   1 
HETATM 2502 O  O   . HOH H 5 .   ? 79.206  50.011 -9.372  1.00 46.71 ? 561 HOH A O   1 
HETATM 2503 O  O   . HOH H 5 .   ? 88.212  62.046 12.681  1.00 54.78 ? 562 HOH A O   1 
HETATM 2504 O  O   . HOH H 5 .   ? 69.621  29.611 5.466   1.00 35.25 ? 563 HOH A O   1 
HETATM 2505 O  O   . HOH H 5 .   ? 91.585  51.756 -2.241  1.00 30.09 ? 564 HOH A O   1 
HETATM 2506 O  O   . HOH H 5 .   ? 69.575  30.062 27.329  1.00 29.66 ? 565 HOH A O   1 
HETATM 2507 O  O   . HOH H 5 .   ? 83.428  54.264 18.898  1.00 41.85 ? 566 HOH A O   1 
HETATM 2508 O  O   . HOH H 5 .   ? 79.475  30.721 3.730   1.00 38.89 ? 567 HOH A O   1 
HETATM 2509 O  O   . HOH H 5 .   ? 83.165  56.655 -9.433  1.00 35.83 ? 568 HOH A O   1 
HETATM 2510 O  O   . HOH H 5 .   ? 55.170  44.827 12.094  1.00 32.92 ? 569 HOH A O   1 
HETATM 2511 O  O   . HOH H 5 .   ? 52.949  36.168 13.779  1.00 39.07 ? 570 HOH A O   1 
HETATM 2512 O  O   . HOH H 5 .   ? 51.108  40.626 22.530  1.00 49.94 ? 571 HOH A O   1 
HETATM 2513 O  O   . HOH H 5 .   ? 58.218  57.629 25.652  1.00 36.37 ? 572 HOH A O   1 
HETATM 2514 O  O   . HOH H 5 .   ? 78.603  33.797 3.571   1.00 41.17 ? 573 HOH A O   1 
HETATM 2515 O  O   . HOH H 5 .   ? 59.160  56.422 3.443   1.00 43.92 ? 574 HOH A O   1 
HETATM 2516 O  O   . HOH H 5 .   ? 61.427  48.362 33.553  1.00 31.12 ? 575 HOH A O   1 
HETATM 2517 O  O   . HOH H 5 .   ? 87.344  30.748 12.827  1.00 40.64 ? 576 HOH A O   1 
HETATM 2518 O  O   . HOH H 5 .   ? 68.932  29.005 12.436  1.00 36.20 ? 577 HOH A O   1 
HETATM 2519 O  O   . HOH H 5 .   ? 63.864  58.014 32.138  1.00 36.28 ? 578 HOH A O   1 
HETATM 2520 O  O   . HOH H 5 .   ? 77.264  35.721 -0.130  1.00 41.20 ? 579 HOH A O   1 
HETATM 2521 O  O   . HOH H 5 .   ? 66.153  52.247 -6.696  1.00 42.53 ? 580 HOH A O   1 
HETATM 2522 O  O   . HOH H 5 .   ? 75.788  26.514 10.325  1.00 44.62 ? 581 HOH A O   1 
HETATM 2523 O  O   . HOH H 5 .   ? 61.997  53.822 2.278   1.00 24.61 ? 582 HOH A O   1 
HETATM 2524 O  O   . HOH H 5 .   ? 85.318  36.926 16.190  1.00 58.93 ? 583 HOH A O   1 
HETATM 2525 O  O   . HOH H 5 .   ? 84.744  37.535 18.696  1.00 43.52 ? 584 HOH A O   1 
HETATM 2526 O  O   . HOH H 5 .   ? 62.236  36.533 30.492  1.00 32.62 ? 585 HOH A O   1 
HETATM 2527 O  O   . HOH H 5 .   ? 85.352  66.043 4.211   1.00 21.19 ? 586 HOH A O   1 
HETATM 2528 O  O   . HOH H 5 .   ? 88.513  65.506 5.317   1.00 33.48 ? 587 HOH A O   1 
HETATM 2529 O  O   . HOH H 5 .   ? 84.386  57.265 17.911  1.00 26.13 ? 588 HOH A O   1 
HETATM 2530 O  O   . HOH H 5 .   ? 84.442  41.512 -8.272  1.00 36.74 ? 589 HOH A O   1 
HETATM 2531 O  O   . HOH H 5 .   ? 83.920  45.837 -8.879  1.00 28.64 ? 590 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   6   6   LYS LYS A . n 
A 1 2   LEU 2   7   7   LEU LEU A . n 
A 1 3   ASN 3   8   8   ASN ASN A . n 
A 1 4   ILE 4   9   9   ILE ILE A . n 
A 1 5   ASP 5   10  10  ASP ASP A . n 
A 1 6   SER 6   11  11  SER SER A . n 
A 1 7   ILE 7   12  12  ILE ILE A . n 
A 1 8   ILE 8   13  13  ILE ILE A . n 
A 1 9   GLN 9   14  14  GLN GLN A . n 
A 1 10  ARG 10  15  15  ARG ARG A . n 
A 1 11  LEU 11  16  16  LEU LEU A . n 
A 1 12  LEU 12  17  17  LEU LEU A . n 
A 1 13  GLU 13  18  18  GLU GLU A . n 
A 1 14  VAL 14  19  19  VAL VAL A . n 
A 1 15  ARG 15  20  20  ARG ARG A . n 
A 1 16  GLY 16  21  21  GLY GLY A . n 
A 1 17  SER 17  22  22  SER SER A . n 
A 1 18  LYS 18  23  23  LYS LYS A . n 
A 1 19  PRO 19  24  24  PRO PRO A . n 
A 1 20  GLY 20  25  25  GLY GLY A . n 
A 1 21  LYS 21  26  26  LYS LYS A . n 
A 1 22  ASN 22  27  27  ASN ASN A . n 
A 1 23  VAL 23  28  28  VAL VAL A . n 
A 1 24  GLN 24  29  29  GLN GLN A . n 
A 1 25  LEU 25  30  30  LEU LEU A . n 
A 1 26  GLN 26  31  31  GLN GLN A . n 
A 1 27  GLU 27  32  32  GLU GLU A . n 
A 1 28  ASN 28  33  33  ASN ASN A . n 
A 1 29  GLU 29  34  34  GLU GLU A . n 
A 1 30  ILE 30  35  35  ILE ILE A . n 
A 1 31  ARG 31  36  36  ARG ARG A . n 
A 1 32  GLY 32  37  37  GLY GLY A . n 
A 1 33  LEU 33  38  38  LEU LEU A . n 
A 1 34  CYS 34  39  39  CYS CYS A . n 
A 1 35  LEU 35  40  40  LEU LEU A . n 
A 1 36  LYS 36  41  41  LYS LYS A . n 
A 1 37  SER 37  42  42  SER SER A . n 
A 1 38  ARG 38  43  43  ARG ARG A . n 
A 1 39  GLU 39  44  44  GLU GLU A . n 
A 1 40  ILE 40  45  45  ILE ILE A . n 
A 1 41  PHE 41  46  46  PHE PHE A . n 
A 1 42  LEU 42  47  47  LEU LEU A . n 
A 1 43  SER 43  48  48  SER SER A . n 
A 1 44  GLN 44  49  49  GLN GLN A . n 
A 1 45  PRO 45  50  50  PRO PRO A . n 
A 1 46  ILE 46  51  51  ILE ILE A . n 
A 1 47  LEU 47  52  52  LEU LEU A . n 
A 1 48  LEU 48  53  53  LEU LEU A . n 
A 1 49  GLU 49  54  54  GLU GLU A . n 
A 1 50  LEU 50  55  55  LEU LEU A . n 
A 1 51  GLU 51  56  56  GLU GLU A . n 
A 1 52  ALA 52  57  57  ALA ALA A . n 
A 1 53  PRO 53  58  58  PRO PRO A . n 
A 1 54  LEU 54  59  59  LEU LEU A . n 
A 1 55  LYS 55  60  60  LYS LYS A . n 
A 1 56  ILE 56  61  61  ILE ILE A . n 
A 1 57  CYS 57  62  62  CYS CYS A . n 
A 1 58  GLY 58  63  63  GLY GLY A . n 
A 1 59  ASP 59  64  64  ASP ASP A . n 
A 1 60  ILE 60  65  65  ILE ILE A . n 
A 1 61  HIS 61  66  66  HIS HIS A . n 
A 1 62  GLY 62  67  67  GLY GLY A . n 
A 1 63  GLN 63  68  68  GLN GLN A . n 
A 1 64  TYR 64  69  69  TYR TYR A . n 
A 1 65  TYR 65  70  70  TYR TYR A . n 
A 1 66  ASP 66  71  71  ASP ASP A . n 
A 1 67  LEU 67  72  72  LEU LEU A . n 
A 1 68  LEU 68  73  73  LEU LEU A . n 
A 1 69  ARG 69  74  74  ARG ARG A . n 
A 1 70  LEU 70  75  75  LEU LEU A . n 
A 1 71  PHE 71  76  76  PHE PHE A . n 
A 1 72  GLU 72  77  77  GLU GLU A . n 
A 1 73  TYR 73  78  78  TYR TYR A . n 
A 1 74  GLY 74  79  79  GLY GLY A . n 
A 1 75  GLY 75  80  80  GLY GLY A . n 
A 1 76  PHE 76  81  81  PHE PHE A . n 
A 1 77  PRO 77  82  82  PRO PRO A . n 
A 1 78  PRO 78  83  83  PRO PRO A . n 
A 1 79  GLU 79  84  84  GLU GLU A . n 
A 1 80  SER 80  85  85  SER SER A . n 
A 1 81  ASN 81  86  86  ASN ASN A . n 
A 1 82  TYR 82  87  87  TYR TYR A . n 
A 1 83  LEU 83  88  88  LEU LEU A . n 
A 1 84  PHE 84  89  89  PHE PHE A . n 
A 1 85  LEU 85  90  90  LEU LEU A . n 
A 1 86  GLY 86  91  91  GLY GLY A . n 
A 1 87  ASP 87  92  92  ASP ASP A . n 
A 1 88  TYR 88  93  93  TYR TYR A . n 
A 1 89  VAL 89  94  94  VAL VAL A . n 
A 1 90  ASP 90  95  95  ASP ASP A . n 
A 1 91  ARG 91  96  96  ARG ARG A . n 
A 1 92  GLY 92  97  97  GLY GLY A . n 
A 1 93  LYS 93  98  98  LYS LYS A . n 
A 1 94  GLN 94  99  99  GLN GLN A . n 
A 1 95  SER 95  100 100 SER SER A . n 
A 1 96  LEU 96  101 101 LEU LEU A . n 
A 1 97  GLU 97  102 102 GLU GLU A . n 
A 1 98  THR 98  103 103 THR THR A . n 
A 1 99  ILE 99  104 104 ILE ILE A . n 
A 1 100 CYS 100 105 105 CYS CYS A . n 
A 1 101 LEU 101 106 106 LEU LEU A . n 
A 1 102 LEU 102 107 107 LEU LEU A . n 
A 1 103 LEU 103 108 108 LEU LEU A . n 
A 1 104 ALA 104 109 109 ALA ALA A . n 
A 1 105 TYR 105 110 110 TYR TYR A . n 
A 1 106 LYS 106 111 111 LYS LYS A . n 
A 1 107 ILE 107 112 112 ILE ILE A . n 
A 1 108 LYS 108 113 113 LYS LYS A . n 
A 1 109 TYR 109 114 114 TYR TYR A . n 
A 1 110 PRO 110 115 115 PRO PRO A . n 
A 1 111 GLU 111 116 116 GLU GLU A . n 
A 1 112 ASN 112 117 117 ASN ASN A . n 
A 1 113 PHE 113 118 118 PHE PHE A . n 
A 1 114 PHE 114 119 119 PHE PHE A . n 
A 1 115 LEU 115 120 120 LEU LEU A . n 
A 1 116 LEU 116 121 121 LEU LEU A . n 
A 1 117 ARG 117 122 122 ARG ARG A . n 
A 1 118 GLY 118 123 123 GLY GLY A . n 
A 1 119 ASN 119 124 124 ASN ASN A . n 
A 1 120 HIS 120 125 125 HIS HIS A . n 
A 1 121 GLU 121 126 126 GLU GLU A . n 
A 1 122 CYS 122 127 127 CYS CYS A . n 
A 1 123 ALA 123 128 128 ALA ALA A . n 
A 1 124 SER 124 129 129 SER SER A . n 
A 1 125 ILE 125 130 130 ILE ILE A . n 
A 1 126 ASN 126 131 131 ASN ASN A . n 
A 1 127 ARG 127 132 132 ARG ARG A . n 
A 1 128 ILE 128 133 133 ILE ILE A . n 
A 1 129 TYR 129 134 134 TYR TYR A . n 
A 1 130 GLY 130 135 135 GLY GLY A . n 
A 1 131 PHE 131 136 136 PHE PHE A . n 
A 1 132 TYR 132 137 137 TYR TYR A . n 
A 1 133 ASP 133 138 138 ASP ASP A . n 
A 1 134 GLU 134 139 139 GLU GLU A . n 
A 1 135 CYS 135 140 140 CYS CYS A . n 
A 1 136 LYS 136 141 141 LYS LYS A . n 
A 1 137 ARG 137 142 142 ARG ARG A . n 
A 1 138 ARG 138 143 143 ARG ARG A . n 
A 1 139 TYR 139 144 144 TYR TYR A . n 
A 1 140 ASN 140 145 145 ASN ASN A . n 
A 1 141 ILE 141 146 146 ILE ILE A . n 
A 1 142 LYS 142 147 147 LYS LYS A . n 
A 1 143 LEU 143 148 148 LEU LEU A . n 
A 1 144 TRP 144 149 149 TRP TRP A . n 
A 1 145 LYS 145 150 150 LYS LYS A . n 
A 1 146 THR 146 151 151 THR THR A . n 
A 1 147 PHE 147 152 152 PHE PHE A . n 
A 1 148 THR 148 153 153 THR THR A . n 
A 1 149 ASP 149 154 154 ASP ASP A . n 
A 1 150 CYS 150 155 155 CYS CYS A . n 
A 1 151 PHE 151 156 156 PHE PHE A . n 
A 1 152 ASN 152 157 157 ASN ASN A . n 
A 1 153 CYS 153 158 158 CYS CYS A . n 
A 1 154 LEU 154 159 159 LEU LEU A . n 
A 1 155 PRO 155 160 160 PRO PRO A . n 
A 1 156 ILE 156 161 161 ILE ILE A . n 
A 1 157 ALA 157 162 162 ALA ALA A . n 
A 1 158 ALA 158 163 163 ALA ALA A . n 
A 1 159 ILE 159 164 164 ILE ILE A . n 
A 1 160 VAL 160 165 165 VAL VAL A . n 
A 1 161 ASP 161 166 166 ASP ASP A . n 
A 1 162 GLU 162 167 167 GLU GLU A . n 
A 1 163 LYS 163 168 168 LYS LYS A . n 
A 1 164 ILE 164 169 169 ILE ILE A . n 
A 1 165 PHE 165 170 170 PHE PHE A . n 
A 1 166 CYS 166 171 171 CYS CYS A . n 
A 1 167 CYS 167 172 172 CYS CYS A . n 
A 1 168 HIS 168 173 173 HIS HIS A . n 
A 1 169 GLY 169 174 174 GLY GLY A . n 
A 1 170 GLY 170 175 175 GLY GLY A . n 
A 1 171 LEU 171 176 176 LEU LEU A . n 
A 1 172 SER 172 177 177 SER SER A . n 
A 1 173 PRO 173 178 178 PRO PRO A . n 
A 1 174 ASP 174 179 179 ASP ASP A . n 
A 1 175 LEU 175 180 180 LEU LEU A . n 
A 1 176 GLN 176 181 181 GLN GLN A . n 
A 1 177 SER 177 182 182 SER SER A . n 
A 1 178 MET 178 183 183 MET MET A . n 
A 1 179 GLU 179 184 184 GLU GLU A . n 
A 1 180 GLN 180 185 185 GLN GLN A . n 
A 1 181 ILE 181 186 186 ILE ILE A . n 
A 1 182 ARG 182 187 187 ARG ARG A . n 
A 1 183 ARG 183 188 188 ARG ARG A . n 
A 1 184 ILE 184 189 189 ILE ILE A . n 
A 1 185 MET 185 190 190 MET MET A . n 
A 1 186 ARG 186 191 191 ARG ARG A . n 
A 1 187 PRO 187 192 192 PRO PRO A . n 
A 1 188 THR 188 193 193 THR THR A . n 
A 1 189 ASP 189 194 194 ASP ASP A . n 
A 1 190 VAL 190 195 195 VAL VAL A . n 
A 1 191 PRO 191 196 196 PRO PRO A . n 
A 1 192 ASP 192 197 197 ASP ASP A . n 
A 1 193 GLN 193 198 198 GLN GLN A . n 
A 1 194 GLY 194 199 199 GLY GLY A . n 
A 1 195 LEU 195 200 200 LEU LEU A . n 
A 1 196 LEU 196 201 201 LEU LEU A . n 
A 1 197 CYS 197 202 202 CYS CYS A . n 
A 1 198 ASP 198 203 203 ASP ASP A . n 
A 1 199 LEU 199 204 204 LEU LEU A . n 
A 1 200 LEU 200 205 205 LEU LEU A . n 
A 1 201 TRP 201 206 206 TRP TRP A . n 
A 1 202 SER 202 207 207 SER SER A . n 
A 1 203 ASP 203 208 208 ASP ASP A . n 
A 1 204 PRO 204 209 209 PRO PRO A . n 
A 1 205 ASP 205 210 210 ASP ASP A . n 
A 1 206 LYS 206 211 211 LYS LYS A . n 
A 1 207 ASP 207 212 212 ASP ASP A . n 
A 1 208 VAL 208 213 213 VAL VAL A . n 
A 1 209 LEU 209 214 214 LEU LEU A . n 
A 1 210 GLY 210 215 215 GLY GLY A . n 
A 1 211 TRP 211 216 216 TRP TRP A . n 
A 1 212 GLY 212 217 217 GLY GLY A . n 
A 1 213 GLU 213 218 218 GLU GLU A . n 
A 1 214 ASN 214 219 219 ASN ASN A . n 
A 1 215 ASP 215 220 220 ASP ASP A . n 
A 1 216 ARG 216 221 221 ARG ARG A . n 
A 1 217 GLY 217 222 222 GLY GLY A . n 
A 1 218 VAL 218 223 223 VAL VAL A . n 
A 1 219 SER 219 224 224 SER SER A . n 
A 1 220 PHE 220 225 225 PHE PHE A . n 
A 1 221 THR 221 226 226 THR THR A . n 
A 1 222 PHE 222 227 227 PHE PHE A . n 
A 1 223 GLY 223 228 228 GLY GLY A . n 
A 1 224 ALA 224 229 229 ALA ALA A . n 
A 1 225 GLU 225 230 230 GLU GLU A . n 
A 1 226 VAL 226 231 231 VAL VAL A . n 
A 1 227 VAL 227 232 232 VAL VAL A . n 
A 1 228 ALA 228 233 233 ALA ALA A . n 
A 1 229 LYS 229 234 234 LYS LYS A . n 
A 1 230 PHE 230 235 235 PHE PHE A . n 
A 1 231 LEU 231 236 236 LEU LEU A . n 
A 1 232 HIS 232 237 237 HIS HIS A . n 
A 1 233 LYS 233 238 238 LYS LYS A . n 
A 1 234 HIS 234 239 239 HIS HIS A . n 
A 1 235 ASP 235 240 240 ASP ASP A . n 
A 1 236 LEU 236 241 241 LEU LEU A . n 
A 1 237 ASP 237 242 242 ASP ASP A . n 
A 1 238 LEU 238 243 243 LEU LEU A . n 
A 1 239 ILE 239 244 244 ILE ILE A . n 
A 1 240 CYS 240 245 245 CYS CYS A . n 
A 1 241 ARG 241 246 246 ARG ARG A . n 
A 1 242 ALA 242 247 247 ALA ALA A . n 
A 1 243 HIS 243 248 248 HIS HIS A . n 
A 1 244 GLN 244 249 249 GLN GLN A . n 
A 1 245 VAL 245 250 250 VAL VAL A . n 
A 1 246 VAL 246 251 251 VAL VAL A . n 
A 1 247 GLU 247 252 252 GLU GLU A . n 
A 1 248 ASP 248 253 253 ASP ASP A . n 
A 1 249 GLY 249 254 254 GLY GLY A . n 
A 1 250 TYR 250 255 255 TYR TYR A . n 
A 1 251 GLU 251 256 256 GLU GLU A . n 
A 1 252 PHE 252 257 257 PHE PHE A . n 
A 1 253 PHE 253 258 258 PHE PHE A . n 
A 1 254 ALA 254 259 259 ALA ALA A . n 
A 1 255 LYS 255 260 260 LYS LYS A . n 
A 1 256 ARG 256 261 261 ARG ARG A . n 
A 1 257 GLN 257 262 262 GLN GLN A . n 
A 1 258 LEU 258 263 263 LEU LEU A . n 
A 1 259 VAL 259 264 264 VAL VAL A . n 
A 1 260 THR 260 265 265 THR THR A . n 
A 1 261 LEU 261 266 266 LEU LEU A . n 
A 1 262 PHE 262 267 267 PHE PHE A . n 
A 1 263 SER 263 268 268 SER SER A . n 
A 1 264 ALA 264 269 269 ALA ALA A . n 
A 1 265 PRO 265 270 270 PRO PRO A . n 
A 1 266 ASN 266 271 271 ASN ASN A . n 
A 1 267 TYR 267 272 272 TYR TYR A . n 
A 1 268 LEU 268 273 273 LEU LEU A . n 
A 1 269 ASP 269 274 274 ASP ASP A . n 
A 1 270 VAL 270 275 275 VAL VAL A . n 
A 1 271 TYR 271 276 276 TYR TYR A . n 
A 1 272 ASN 272 277 277 ASN ASN A . n 
A 1 273 ASN 273 278 278 ASN ASN A . n 
A 1 274 ALA 274 279 279 ALA ALA A . n 
A 1 275 GLY 275 280 280 GLY GLY A . n 
A 1 276 ALA 276 281 281 ALA ALA A . n 
A 1 277 MET 277 282 282 MET MET A . n 
A 1 278 MET 278 283 283 MET MET A . n 
A 1 279 SER 279 284 284 SER SER A . n 
A 1 280 VAL 280 285 285 VAL VAL A . n 
A 1 281 ASP 281 286 286 ASP ASP A . n 
A 1 282 GLU 282 287 287 GLU GLU A . n 
A 1 283 THR 283 288 288 THR THR A . n 
A 1 284 LEU 284 289 289 LEU LEU A . n 
A 1 285 MET 285 290 290 MET MET A . n 
A 1 286 CYS 286 291 291 CYS CYS A . n 
A 1 287 SER 287 292 292 SER SER A . n 
A 1 288 PHE 288 293 293 PHE PHE A . n 
A 1 289 GLN 289 294 294 GLN GLN A . n 
A 1 290 ILE 290 295 295 ILE ILE A . n 
A 1 291 LEU 291 296 296 LEU LEU A . n 
A 1 292 LYS 292 297 297 LYS LYS A . n 
A 1 293 PRO 293 298 298 PRO PRO A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MN  1  400 400 MN  MN  A . 
C 2 MN  1  401 401 MN  MN  A . 
D 3 OKA 1  501 501 OKA DAM A . 
E 4 BME 1  301 301 BME BME A . 
F 4 BME 1  302 302 BME BME A . 
G 4 BME 1  303 303 BME BME A . 
H 5 HOH 1  502 1   HOH WAT A . 
H 5 HOH 2  503 2   HOH WAT A . 
H 5 HOH 3  504 3   HOH WAT A . 
H 5 HOH 4  505 4   HOH WAT A . 
H 5 HOH 5  506 5   HOH WAT A . 
H 5 HOH 6  507 6   HOH WAT A . 
H 5 HOH 7  508 7   HOH WAT A . 
H 5 HOH 8  509 8   HOH WAT A . 
H 5 HOH 9  510 9   HOH WAT A . 
H 5 HOH 10 511 10  HOH WAT A . 
H 5 HOH 11 512 11  HOH WAT A . 
H 5 HOH 12 513 12  HOH WAT A . 
H 5 HOH 13 514 13  HOH WAT A . 
H 5 HOH 14 515 14  HOH WAT A . 
H 5 HOH 15 516 15  HOH WAT A . 
H 5 HOH 16 517 16  HOH WAT A . 
H 5 HOH 17 518 17  HOH WAT A . 
H 5 HOH 18 519 18  HOH WAT A . 
H 5 HOH 19 520 19  HOH WAT A . 
H 5 HOH 20 521 20  HOH WAT A . 
H 5 HOH 21 522 21  HOH WAT A . 
H 5 HOH 22 523 22  HOH WAT A . 
H 5 HOH 23 524 23  HOH WAT A . 
H 5 HOH 24 525 24  HOH WAT A . 
H 5 HOH 25 526 25  HOH WAT A . 
H 5 HOH 26 527 26  HOH WAT A . 
H 5 HOH 27 528 27  HOH WAT A . 
H 5 HOH 28 529 28  HOH WAT A . 
H 5 HOH 29 530 29  HOH WAT A . 
H 5 HOH 30 531 30  HOH WAT A . 
H 5 HOH 31 532 31  HOH WAT A . 
H 5 HOH 32 533 32  HOH WAT A . 
H 5 HOH 33 534 33  HOH WAT A . 
H 5 HOH 34 535 34  HOH WAT A . 
H 5 HOH 35 536 35  HOH WAT A . 
H 5 HOH 36 537 36  HOH WAT A . 
H 5 HOH 37 538 37  HOH WAT A . 
H 5 HOH 38 539 38  HOH WAT A . 
H 5 HOH 39 540 39  HOH WAT A . 
H 5 HOH 40 541 40  HOH WAT A . 
H 5 HOH 41 542 41  HOH WAT A . 
H 5 HOH 42 543 42  HOH WAT A . 
H 5 HOH 43 544 43  HOH WAT A . 
H 5 HOH 44 545 44  HOH WAT A . 
H 5 HOH 45 546 45  HOH WAT A . 
H 5 HOH 46 547 46  HOH WAT A . 
H 5 HOH 47 548 47  HOH WAT A . 
H 5 HOH 48 549 48  HOH WAT A . 
H 5 HOH 49 550 49  HOH WAT A . 
H 5 HOH 50 551 50  HOH WAT A . 
H 5 HOH 51 552 51  HOH WAT A . 
H 5 HOH 52 553 52  HOH WAT A . 
H 5 HOH 53 554 53  HOH WAT A . 
H 5 HOH 54 555 54  HOH WAT A . 
H 5 HOH 55 556 55  HOH WAT A . 
H 5 HOH 56 557 56  HOH WAT A . 
H 5 HOH 57 558 57  HOH WAT A . 
H 5 HOH 58 559 58  HOH WAT A . 
H 5 HOH 59 560 59  HOH WAT A . 
H 5 HOH 60 561 60  HOH WAT A . 
H 5 HOH 61 562 61  HOH WAT A . 
H 5 HOH 62 563 62  HOH WAT A . 
H 5 HOH 63 564 63  HOH WAT A . 
H 5 HOH 64 565 64  HOH WAT A . 
H 5 HOH 65 566 65  HOH WAT A . 
H 5 HOH 66 567 66  HOH WAT A . 
H 5 HOH 67 568 67  HOH WAT A . 
H 5 HOH 68 569 68  HOH WAT A . 
H 5 HOH 69 570 69  HOH WAT A . 
H 5 HOH 70 571 70  HOH WAT A . 
H 5 HOH 71 572 71  HOH WAT A . 
H 5 HOH 72 573 72  HOH WAT A . 
H 5 HOH 73 574 73  HOH WAT A . 
H 5 HOH 74 575 74  HOH WAT A . 
H 5 HOH 75 576 75  HOH WAT A . 
H 5 HOH 76 577 76  HOH WAT A . 
H 5 HOH 77 578 77  HOH WAT A . 
H 5 HOH 78 579 78  HOH WAT A . 
H 5 HOH 79 580 79  HOH WAT A . 
H 5 HOH 80 581 80  HOH WAT A . 
H 5 HOH 81 582 81  HOH WAT A . 
H 5 HOH 82 583 82  HOH WAT A . 
H 5 HOH 83 584 83  HOH WAT A . 
H 5 HOH 84 585 84  HOH WAT A . 
H 5 HOH 85 586 85  HOH WAT A . 
H 5 HOH 86 587 86  HOH WAT A . 
H 5 HOH 87 588 87  HOH WAT A . 
H 5 HOH 88 589 88  HOH WAT A . 
H 5 HOH 89 590 89  HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD2 ? A ASP 87  ? A ASP 92  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 OD1 ? A ASN 119 ? A ASN 124 ? 1_555 100.9 ? 
2 OD2 ? A ASP 87  ? A ASP 92  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 ND1 ? A HIS 243 ? A HIS 248 ? 1_555 159.9 ? 
3 OD1 ? A ASN 119 ? A ASN 124 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 ND1 ? A HIS 243 ? A HIS 248 ? 1_555 97.3  ? 
4 OD2 ? A ASP 87  ? A ASP 92  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 168 ? A HIS 173 ? 1_555 81.2  ? 
5 OD1 ? A ASN 119 ? A ASN 124 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 168 ? A HIS 173 ? 1_555 89.3  ? 
6 ND1 ? A HIS 243 ? A HIS 248 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 168 ? A HIS 173 ? 1_555 90.5  ? 
7 OD2 ? A ASP 59  ? A ASP 64  ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 NE2 ? A HIS 61  ? A HIS 66  ? 1_555 107.4 ? 
8 OD2 ? A ASP 59  ? A ASP 64  ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 OD2 ? A ASP 87  ? A ASP 92  ? 1_555 91.9  ? 
9 NE2 ? A HIS 61  ? A HIS 66  ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 OD2 ? A ASP 87  ? A ASP 92  ? 1_555 98.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-17 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     585 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     585 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_666 
_pdbx_validate_symm_contact.dist              1.20 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              194 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              194 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              194 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                93.35 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            -17.65 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 95  ? ? 80.78   148.60  
2 1 ARG A 96  ? ? 71.31   -48.94  
3 1 GLU A 126 ? ? -94.35  50.54   
4 1 TYR A 144 ? ? -136.62 -110.44 
5 1 GLU A 167 ? ? 54.90   15.85   
6 1 SER A 224 ? ? 62.65   -156.53 
7 1 ALA A 247 ? ? -135.24 -123.19 
8 1 HIS A 248 ? ? 73.46   -28.46  
9 1 ASP A 274 ? ? 64.43   -2.58   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 'OKADAIC ACID'       OKA 
4 BETA-MERCAPTOETHANOL BME 
5 water                HOH 
#