data_1U3H
# 
_entry.id   1U3H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.322 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1U3H         
RCSB  RCSB023197   
WWPDB D_1000023197 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1k2d 
_pdbx_database_related.details        
'Crystal Structure Of The Autoimmune Mhc Class II I-Au Complexed With Myelin Basic Protein 1-11 At 2.2A' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1U3H 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Maynard, J.'     1 
'Petersson, K.'   2 
'Wilson, D.H.'    3 
'Adams, E.J.'     4 
'Blondelle, S.E.' 5 
'Boulanger, M.J.' 6 
'Wilson, D.B.'    7 
'Garcia, K.C.'    8 
# 
_citation.id                        primary 
_citation.title                     
'Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity' 
_citation.journal_abbrev            Immunity 
_citation.journal_volume            22 
_citation.page_first                81 
_citation.page_last                 92 
_citation.year                      2005 
_citation.journal_id_ASTM           IUNIEH 
_citation.country                   US 
_citation.journal_id_ISSN           1074-7613 
_citation.journal_id_CSD            2048 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15664161 
_citation.pdbx_database_id_DOI      10.1016/j.immuni.2004.11.015 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Maynard, J.'     1 ? 
primary 'Petersson, K.'   2 ? 
primary 'Wilson, D.H.'    3 ? 
primary 'Adams, E.J.'     4 ? 
primary 'Blondelle, S.E.' 5 ? 
primary 'Boulanger, M.J.' 6 ? 
primary 'Wilson, D.B.'    7 ? 
primary 'Garcia, K.C.'    8 ? 
# 
_cell.entry_id           1U3H 
_cell.length_a           87.835 
_cell.length_b           327.162 
_cell.length_c           127.161 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1U3H 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'T-cell receptor alpha-chain'                              12290.634 2   ? ?                   V2.3-J39-C ? 
2 polymer man 'Mouse TCRVbeta 172.10, extracellular variable domain'     12112.181 2   ? G17E,H47Y,I75T,L78S ? ? 
3 polymer man 'H-2 class II histocompatibility antigen, A-U alpha chain' 20670.047 2   ? ?                   
'extracellular alpha-1, extracellular alpha-2' ? 
4 polymer man 'H-2 class II histocompatibility antigen, A-U beta chain'  22495.164 2   ? ?                   
'extracellular beta-1, extracellular beta-2'   ? 
5 polymer syn 'Myelin basic protein (MBP)-peptide'                       1295.364  2   ? K4Y                 ? ? 
6 water   nat water                                                      18.015    183 ? ?                   ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSDKKEDGRFTIFFNKREKKLSLHIADSQP
GDSATYFCAASANSGTYQRFGTGTKLQVVP
;
;QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSDKKEDGRFTIFFNKREKKLSLHIADSQP
GDSATYFCAASANSGTYQRFGTGTKLQVVP
;
A,E ? 
2 'polypeptide(L)' no no 
;AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESAT
PSQTSVYFCASGDAGGGYEQYFGPGTRLTVL
;
;AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESAT
PSQTSVYFCASGDAGGGYEQYFGPGTRLTVL
;
B,F ? 
3 'polypeptide(L)' no no 
;IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNS
TPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDD
IYDCKVEHWGLEEPVLKHWEPE
;
;IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNS
TPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDD
IYDCKVEHWGLEEPVLKHWEPE
;
C,G ? 
4 'polypeptide(L)' no no 
;GDSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYN
YEETEVPTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVML
EMTPRRGEVYTCHVEHPSLKSPITVEWRA
;
;GDSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYN
YEETEVPTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVML
EMTPRRGEVYTCHVEHPSLKSPITVEWRA
;
D,H ? 
5 'polypeptide(L)' no no SRGGASQYRPSQ SRGGASQYRPSQ P,I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   VAL n 
1 3   ARG n 
1 4   GLN n 
1 5   SER n 
1 6   PRO n 
1 7   GLN n 
1 8   SER n 
1 9   LEU n 
1 10  THR n 
1 11  VAL n 
1 12  TRP n 
1 13  GLU n 
1 14  GLY n 
1 15  GLU n 
1 16  THR n 
1 17  ALA n 
1 18  ILE n 
1 19  LEU n 
1 20  ASN n 
1 21  CYS n 
1 22  SER n 
1 23  TYR n 
1 24  GLU n 
1 25  ASN n 
1 26  SER n 
1 27  ALA n 
1 28  PHE n 
1 29  ASP n 
1 30  TYR n 
1 31  PHE n 
1 32  PRO n 
1 33  TRP n 
1 34  TYR n 
1 35  GLN n 
1 36  GLN n 
1 37  PHE n 
1 38  PRO n 
1 39  GLY n 
1 40  GLU n 
1 41  GLY n 
1 42  PRO n 
1 43  ALA n 
1 44  LEU n 
1 45  LEU n 
1 46  ILE n 
1 47  SER n 
1 48  ILE n 
1 49  LEU n 
1 50  SER n 
1 51  VAL n 
1 52  SER n 
1 53  ASP n 
1 54  LYS n 
1 55  LYS n 
1 56  GLU n 
1 57  ASP n 
1 58  GLY n 
1 59  ARG n 
1 60  PHE n 
1 61  THR n 
1 62  ILE n 
1 63  PHE n 
1 64  PHE n 
1 65  ASN n 
1 66  LYS n 
1 67  ARG n 
1 68  GLU n 
1 69  LYS n 
1 70  LYS n 
1 71  LEU n 
1 72  SER n 
1 73  LEU n 
1 74  HIS n 
1 75  ILE n 
1 76  ALA n 
1 77  ASP n 
1 78  SER n 
1 79  GLN n 
1 80  PRO n 
1 81  GLY n 
1 82  ASP n 
1 83  SER n 
1 84  ALA n 
1 85  THR n 
1 86  TYR n 
1 87  PHE n 
1 88  CYS n 
1 89  ALA n 
1 90  ALA n 
1 91  SER n 
1 92  ALA n 
1 93  ASN n 
1 94  SER n 
1 95  GLY n 
1 96  THR n 
1 97  TYR n 
1 98  GLN n 
1 99  ARG n 
1 100 PHE n 
1 101 GLY n 
1 102 THR n 
1 103 GLY n 
1 104 THR n 
1 105 LYS n 
1 106 LEU n 
1 107 GLN n 
1 108 VAL n 
1 109 VAL n 
1 110 PRO n 
2 1   ALA n 
2 2   VAL n 
2 3   THR n 
2 4   GLN n 
2 5   SER n 
2 6   PRO n 
2 7   ARG n 
2 8   ASN n 
2 9   LYS n 
2 10  VAL n 
2 11  ALA n 
2 12  VAL n 
2 13  THR n 
2 14  GLY n 
2 15  GLU n 
2 16  LYS n 
2 17  VAL n 
2 18  THR n 
2 19  LEU n 
2 20  SER n 
2 21  CYS n 
2 22  ASN n 
2 23  GLN n 
2 24  THR n 
2 25  ASN n 
2 26  ASN n 
2 27  HIS n 
2 28  ASN n 
2 29  ASN n 
2 30  MET n 
2 31  TYR n 
2 32  TRP n 
2 33  TYR n 
2 34  ARG n 
2 35  GLN n 
2 36  ASP n 
2 37  THR n 
2 38  GLY n 
2 39  HIS n 
2 40  GLY n 
2 41  LEU n 
2 42  ARG n 
2 43  LEU n 
2 44  ILE n 
2 45  TYR n 
2 46  TYR n 
2 47  SER n 
2 48  TYR n 
2 49  GLY n 
2 50  ALA n 
2 51  GLY n 
2 52  SER n 
2 53  THR n 
2 54  GLU n 
2 55  LYS n 
2 56  GLY n 
2 57  ASP n 
2 58  ILE n 
2 59  PRO n 
2 60  ASP n 
2 61  GLY n 
2 62  TYR n 
2 63  LYS n 
2 64  ALA n 
2 65  SER n 
2 66  ARG n 
2 67  PRO n 
2 68  SER n 
2 69  GLN n 
2 70  GLU n 
2 71  ASN n 
2 72  PHE n 
2 73  SER n 
2 74  LEU n 
2 75  THR n 
2 76  LEU n 
2 77  GLU n 
2 78  SER n 
2 79  ALA n 
2 80  THR n 
2 81  PRO n 
2 82  SER n 
2 83  GLN n 
2 84  THR n 
2 85  SER n 
2 86  VAL n 
2 87  TYR n 
2 88  PHE n 
2 89  CYS n 
2 90  ALA n 
2 91  SER n 
2 92  GLY n 
2 93  ASP n 
2 94  ALA n 
2 95  GLY n 
2 96  GLY n 
2 97  GLY n 
2 98  TYR n 
2 99  GLU n 
2 100 GLN n 
2 101 TYR n 
2 102 PHE n 
2 103 GLY n 
2 104 PRO n 
2 105 GLY n 
2 106 THR n 
2 107 ARG n 
2 108 LEU n 
2 109 THR n 
2 110 VAL n 
2 111 LEU n 
3 1   ILE n 
3 2   GLU n 
3 3   ALA n 
3 4   ASP n 
3 5   HIS n 
3 6   VAL n 
3 7   GLY n 
3 8   SER n 
3 9   TYR n 
3 10  GLY n 
3 11  ILE n 
3 12  VAL n 
3 13  VAL n 
3 14  TYR n 
3 15  GLN n 
3 16  SER n 
3 17  PRO n 
3 18  GLY n 
3 19  ASP n 
3 20  ILE n 
3 21  GLY n 
3 22  GLN n 
3 23  TYR n 
3 24  THR n 
3 25  PHE n 
3 26  GLU n 
3 27  PHE n 
3 28  ASP n 
3 29  GLY n 
3 30  ASP n 
3 31  GLU n 
3 32  LEU n 
3 33  PHE n 
3 34  TYR n 
3 35  VAL n 
3 36  ASP n 
3 37  LEU n 
3 38  ASP n 
3 39  LYS n 
3 40  LYS n 
3 41  GLU n 
3 42  THR n 
3 43  ILE n 
3 44  TRP n 
3 45  MET n 
3 46  LEU n 
3 47  PRO n 
3 48  GLU n 
3 49  PHE n 
3 50  ALA n 
3 51  GLN n 
3 52  LEU n 
3 53  ARG n 
3 54  SER n 
3 55  PHE n 
3 56  ASP n 
3 57  PRO n 
3 58  GLN n 
3 59  GLY n 
3 60  GLY n 
3 61  LEU n 
3 62  GLN n 
3 63  ASN n 
3 64  ILE n 
3 65  ALA n 
3 66  THR n 
3 67  GLY n 
3 68  LYS n 
3 69  HIS n 
3 70  ASN n 
3 71  LEU n 
3 72  GLY n 
3 73  VAL n 
3 74  LEU n 
3 75  THR n 
3 76  LYS n 
3 77  ARG n 
3 78  SER n 
3 79  ASN n 
3 80  SER n 
3 81  THR n 
3 82  PRO n 
3 83  ALA n 
3 84  THR n 
3 85  ASN n 
3 86  GLU n 
3 87  ALA n 
3 88  PRO n 
3 89  GLN n 
3 90  ALA n 
3 91  THR n 
3 92  VAL n 
3 93  PHE n 
3 94  PRO n 
3 95  LYS n 
3 96  SER n 
3 97  PRO n 
3 98  VAL n 
3 99  LEU n 
3 100 LEU n 
3 101 GLY n 
3 102 GLN n 
3 103 PRO n 
3 104 ASN n 
3 105 THR n 
3 106 LEU n 
3 107 ILE n 
3 108 CYS n 
3 109 PHE n 
3 110 VAL n 
3 111 ASP n 
3 112 ASN n 
3 113 ILE n 
3 114 PHE n 
3 115 PRO n 
3 116 PRO n 
3 117 VAL n 
3 118 ILE n 
3 119 ASN n 
3 120 ILE n 
3 121 THR n 
3 122 TRP n 
3 123 LEU n 
3 124 ARG n 
3 125 ASN n 
3 126 SER n 
3 127 LYS n 
3 128 SER n 
3 129 VAL n 
3 130 ALA n 
3 131 ASP n 
3 132 GLY n 
3 133 VAL n 
3 134 TYR n 
3 135 GLU n 
3 136 THR n 
3 137 SER n 
3 138 PHE n 
3 139 PHE n 
3 140 VAL n 
3 141 ASN n 
3 142 ARG n 
3 143 ASP n 
3 144 TYR n 
3 145 SER n 
3 146 PHE n 
3 147 HIS n 
3 148 LYS n 
3 149 LEU n 
3 150 SER n 
3 151 TYR n 
3 152 LEU n 
3 153 THR n 
3 154 PHE n 
3 155 ILE n 
3 156 PRO n 
3 157 SER n 
3 158 ASP n 
3 159 ASP n 
3 160 ASP n 
3 161 ILE n 
3 162 TYR n 
3 163 ASP n 
3 164 CYS n 
3 165 LYS n 
3 166 VAL n 
3 167 GLU n 
3 168 HIS n 
3 169 TRP n 
3 170 GLY n 
3 171 LEU n 
3 172 GLU n 
3 173 GLU n 
3 174 PRO n 
3 175 VAL n 
3 176 LEU n 
3 177 LYS n 
3 178 HIS n 
3 179 TRP n 
3 180 GLU n 
3 181 PRO n 
3 182 GLU n 
4 1   GLY n 
4 2   ASP n 
4 3   SER n 
4 4   GLU n 
4 5   ARG n 
4 6   HIS n 
4 7   PHE n 
4 8   VAL n 
4 9   VAL n 
4 10  GLN n 
4 11  PHE n 
4 12  GLN n 
4 13  PRO n 
4 14  PHE n 
4 15  CYS n 
4 16  TYR n 
4 17  PHE n 
4 18  THR n 
4 19  ASN n 
4 20  GLY n 
4 21  THR n 
4 22  GLN n 
4 23  ARG n 
4 24  ILE n 
4 25  ARG n 
4 26  TYR n 
4 27  VAL n 
4 28  THR n 
4 29  ARG n 
4 30  TYR n 
4 31  ILE n 
4 32  TYR n 
4 33  ASN n 
4 34  ARG n 
4 35  GLU n 
4 36  GLU n 
4 37  TYR n 
4 38  LEU n 
4 39  ARG n 
4 40  PHE n 
4 41  ASP n 
4 42  SER n 
4 43  ASP n 
4 44  VAL n 
4 45  GLY n 
4 46  GLU n 
4 47  TYR n 
4 48  ARG n 
4 49  ALA n 
4 50  VAL n 
4 51  THR n 
4 52  GLU n 
4 53  LEU n 
4 54  GLY n 
4 55  ARG n 
4 56  PRO n 
4 57  ASP n 
4 58  ALA n 
4 59  GLU n 
4 60  TYR n 
4 61  TYR n 
4 62  ASN n 
4 63  LYS n 
4 64  GLN n 
4 65  TYR n 
4 66  LEU n 
4 67  GLU n 
4 68  ARG n 
4 69  THR n 
4 70  ARG n 
4 71  ALA n 
4 72  GLU n 
4 73  LEU n 
4 74  ASP n 
4 75  THR n 
4 76  VAL n 
4 77  CYS n 
4 78  ARG n 
4 79  TYR n 
4 80  ASN n 
4 81  TYR n 
4 82  GLU n 
4 83  GLU n 
4 84  THR n 
4 85  GLU n 
4 86  VAL n 
4 87  PRO n 
4 88  THR n 
4 89  SER n 
4 90  LEU n 
4 91  ARG n 
4 92  ARG n 
4 93  LEU n 
4 94  GLU n 
4 95  GLN n 
4 96  PRO n 
4 97  ASN n 
4 98  VAL n 
4 99  VAL n 
4 100 ILE n 
4 101 SER n 
4 102 LEU n 
4 103 SER n 
4 104 ARG n 
4 105 THR n 
4 106 GLU n 
4 107 ALA n 
4 108 LEU n 
4 109 ASN n 
4 110 HIS n 
4 111 HIS n 
4 112 ASN n 
4 113 THR n 
4 114 LEU n 
4 115 VAL n 
4 116 CYS n 
4 117 SER n 
4 118 VAL n 
4 119 THR n 
4 120 ASP n 
4 121 PHE n 
4 122 TYR n 
4 123 PRO n 
4 124 ALA n 
4 125 LYS n 
4 126 ILE n 
4 127 LYS n 
4 128 VAL n 
4 129 ARG n 
4 130 TRP n 
4 131 PHE n 
4 132 ARG n 
4 133 ASN n 
4 134 GLY n 
4 135 GLN n 
4 136 GLU n 
4 137 GLU n 
4 138 THR n 
4 139 VAL n 
4 140 GLY n 
4 141 VAL n 
4 142 SER n 
4 143 SER n 
4 144 THR n 
4 145 GLN n 
4 146 LEU n 
4 147 ILE n 
4 148 ARG n 
4 149 ASN n 
4 150 GLY n 
4 151 ASP n 
4 152 TRP n 
4 153 THR n 
4 154 PHE n 
4 155 GLN n 
4 156 VAL n 
4 157 LEU n 
4 158 VAL n 
4 159 MET n 
4 160 LEU n 
4 161 GLU n 
4 162 MET n 
4 163 THR n 
4 164 PRO n 
4 165 ARG n 
4 166 ARG n 
4 167 GLY n 
4 168 GLU n 
4 169 VAL n 
4 170 TYR n 
4 171 THR n 
4 172 CYS n 
4 173 HIS n 
4 174 VAL n 
4 175 GLU n 
4 176 HIS n 
4 177 PRO n 
4 178 SER n 
4 179 LEU n 
4 180 LYS n 
4 181 SER n 
4 182 PRO n 
4 183 ILE n 
4 184 THR n 
4 185 VAL n 
4 186 GLU n 
4 187 TRP n 
4 188 ARG n 
4 189 ALA n 
5 1   SER n 
5 2   ARG n 
5 3   GLY n 
5 4   GLY n 
5 5   ALA n 
5 6   SER n 
5 7   GLN n 
5 8   TYR n 
5 9   ARG n 
5 10  PRO n 
5 11  SER n 
5 12  GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ?     ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ?           'Escherichia coli BL21'   
511693 Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ?  ? ? ? ? ? plasmid ? ? ? pAK400 ? ? 
2 1 sample ? ? ? 'house mouse' Mus ?     ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ?           'Escherichia coli BL21'   
511693 Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ?  ? ? ? ? ? plasmid ? ? ? pAK400 ? ? 
3 1 sample ? ? ? 'house mouse' Mus H2-Aa ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fruit fly' 'Drosophila melanogaster' 7227 
Drosophila  ? ? ?                  ? ? ?    ? S2 ? ? ? ? ? plasmid ? ? ? pRMHa3 ? ? 
4 1 sample ? ? ? 'house mouse' Mus ?     ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fruit fly' 'Drosophila melanogaster' 7227 
Drosophila  ? ? ?                  ? ? ?    ? S2 ? ? ? ? ? plasmid ? ? ? pRMHa3 ? ? 
# 
_pdbx_entity_src_syn.entity_id              5 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP Q5R1B3_MOUSE Q5R1B3 1 30 ? ? 
2 UNP TVB5_MOUSE   P04213 2 11 ? ? 
3 UNP HA2U_MOUSE   P14438 3 1  ? ? 
4 UNP HB2U_MOUSE   P06344 4 28 ? ? 
5 PDB 1U3H         1U3H   5 ?  ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1U3H A 1 ? 105 ? Q5R1B3 30 ? 120 ? 2  111 
2  2 1U3H B 1 ? 111 ? P04213 11 ? 122 ? 3  117 
3  3 1U3H C 4 ? 182 ? P14438 1  ? 179 ? 4  181 
4  4 1U3H D 1 ? 188 ? P06344 28 ? 216 ? 1  189 
5  1 1U3H E 1 ? 105 ? Q5R1B3 30 ? 120 ? 2  111 
6  2 1U3H F 1 ? 111 ? P04213 11 ? 122 ? 3  117 
7  3 1U3H G 4 ? 182 ? P14438 1  ? 179 ? 4  181 
8  4 1U3H H 1 ? 188 ? P06344 28 ? 216 ? 1  189 
9  5 1U3H P 1 ? 12  ? 1U3H   -3 ? 8   ? -3 8   
10 5 1U3H I 1 ? 12  ? 1U3H   -3 ? 8   ? -3 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1U3H ILE C 1 ? UNP P14438 ? ? 'cloning artifact' 1 1 
3 1U3H GLU C 2 ? UNP P14438 ? ? 'cloning artifact' 2 2 
3 1U3H ALA C 3 ? UNP P14438 ? ? 'cloning artifact' 3 3 
7 1U3H ILE G 1 ? UNP P14438 ? ? 'cloning artifact' 1 4 
7 1U3H GLU G 2 ? UNP P14438 ? ? 'cloning artifact' 2 5 
7 1U3H ALA G 3 ? UNP P14438 ? ? 'cloning artifact' 3 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1U3H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.33 
_exptl_crystal.density_percent_sol   61.6 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'21% PEG 3350,  0.1M Hepes and 0.2M LiSO4, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-04-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1U3H 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   67849 
_reflns.number_all                   67849 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              0.061 
_reflns.pdbx_netI_over_sigmaI        20.2 
_reflns.B_iso_Wilson_estimate        37.7 
_reflns.pdbx_redundancy              9.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   93.5 
_reflns_shell.Rmerge_I_obs           0.386 
_reflns_shell.pdbx_Rsym_value        0.386 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        10.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6419 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1U3H 
_refine.ls_number_reflns_obs                     62711 
_refine.ls_number_reflns_all                     67849 
_refine.pdbx_ls_sigma_I                          -1 
_refine.pdbx_ls_sigma_F                          -1 
_refine.pdbx_data_cutoff_high_absF               195797.18 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.51 
_refine.ls_d_res_high                            2.42 
_refine.ls_percent_reflns_obs                    89.1 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.232 
_refine.ls_R_factor_R_free                       0.274 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3205 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               61.7 
_refine.aniso_B[1][1]                            -5.12 
_refine.aniso_B[2][2]                            -23.09 
_refine.aniso_B[3][3]                            28.21 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.330412 
_refine.solvent_model_param_bsol                 37.9538 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1D9K 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1U3H 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.50 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.46 
_refine_analyze.Luzzati_sigma_a_free            0.53 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9726 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             183 
_refine_hist.number_atoms_total               9909 
_refine_hist.d_res_high                       2.42 
_refine_hist.d_res_low                        41.51 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.2  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.07  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             6759 
_refine_ls_shell.R_factor_R_work                  0.387 
_refine_ls_shell.percent_reflns_obs               60.1 
_refine_ls_shell.R_factor_R_free                  0.417 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             364 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1U3H 
_struct.title                     'Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A' 
_struct.pdbx_descriptor           
;T-cell receptor alpha-chain, Mouse TCRVbeta 172.10, extracellular variable domain, H-2 class II histocompatibility antigen, A-U alpha chain, H-2 class II histocompatibility antigen, A-U beta chain, Myelin basic protein (MBP)-peptide
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1U3H 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'complex, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 66 ? GLU A 68 ? LYS A 68 GLU A 70 5 ? 3  
HELX_P HELX_P2  2  THR B 80 ? THR B 84 ? THR B 83 THR B 87 5 ? 5  
HELX_P HELX_P3  3  LEU C 46 ? GLN C 51 ? LEU C 45 GLN C 50 1 ? 6  
HELX_P HELX_P4  4  ASP C 56 ? SER C 78 ? ASP C 55 SER C 77 1 ? 23 
HELX_P HELX_P5  5  THR D 51 ? ARG D 55 ? THR D 51 ARG D 55 5 ? 5  
HELX_P HELX_P6  6  ASP D 57 ? TYR D 65 ? ASP D 57 TYR D 67 1 ? 9  
HELX_P HELX_P7  7  TYR D 65 ? VAL D 76 ? TYR D 67 VAL D 78 1 ? 12 
HELX_P HELX_P8  8  VAL D 76 ? THR D 84 ? VAL D 78 THR D 85 1 ? 9  
HELX_P HELX_P9  9  THR D 88 ? ARG D 92 ? THR D 89 ARG D 93 5 ? 5  
HELX_P HELX_P10 10 LYS F 66 ? GLU F 68 ? LYS E 68 GLU E 70 5 ? 3  
HELX_P HELX_P11 11 THR G 80 ? THR G 84 ? THR F 83 THR F 87 5 ? 5  
HELX_P HELX_P12 12 LEU H 46 ? GLN H 51 ? LEU G 45 GLN G 50 1 ? 6  
HELX_P HELX_P13 13 ASP H 56 ? SER H 78 ? ASP G 55 SER G 77 1 ? 23 
HELX_P HELX_P14 14 THR I 51 ? ARG I 55 ? THR H 51 ARG H 55 5 ? 5  
HELX_P HELX_P15 15 ASP I 57 ? TYR I 65 ? ASP H 57 TYR H 67 1 ? 9  
HELX_P HELX_P16 16 TYR I 65 ? VAL I 76 ? TYR H 67 VAL H 78 1 ? 12 
HELX_P HELX_P17 17 VAL I 76 ? THR I 84 ? VAL H 78 THR H 85 1 ? 9  
HELX_P HELX_P18 18 THR I 88 ? ARG I 92 ? THR H 89 ARG H 93 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 21  SG ? ? ? 1_555 A CYS 88  SG ? ? A CYS 22  A CYS 90  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf2  disulf ? ? B CYS 21  SG ? ? ? 1_555 B CYS 89  SG ? ? B CYS 23  B CYS 92  1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf3  disulf ? ? C CYS 108 SG ? ? ? 1_555 C CYS 164 SG ? ? C CYS 107 C CYS 163 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf4  disulf ? ? D CYS 15  SG ? ? ? 1_555 D CYS 77  SG ? ? D CYS 15  D CYS 79  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf5  disulf ? ? D CYS 116 SG ? ? ? 1_555 D CYS 172 SG ? ? D CYS 117 D CYS 173 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf6  disulf ? ? F CYS 21  SG ? ? ? 1_555 F CYS 88  SG ? ? E CYS 22  E CYS 90  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf7  disulf ? ? G CYS 21  SG ? ? ? 1_555 G CYS 89  SG ? ? F CYS 23  F CYS 92  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf8  disulf ? ? H CYS 108 SG ? ? ? 1_555 H CYS 164 SG ? ? G CYS 107 G CYS 163 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf9  disulf ? ? I CYS 15  SG ? ? ? 1_555 I CYS 77  SG ? ? H CYS 15  H CYS 79  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf10 disulf ? ? I CYS 116 SG ? ? ? 1_555 I CYS 172 SG ? ? H CYS 117 H CYS 173 1_555 ? ? ? ? ? ? ? 2.034 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 16  C . ? SER 15  C PRO 17  C ? PRO 16  C 1 0.03  
2 PHE 114 C . ? PHE 113 C PRO 115 C ? PRO 114 C 1 -0.53 
3 TYR 122 D . ? TYR 123 D PRO 123 D ? PRO 124 D 1 0.39  
4 SER 16  H . ? SER 15  G PRO 17  H ? PRO 16  G 1 0.25  
5 PHE 114 H . ? PHE 113 G PRO 115 H ? PRO 114 G 1 0.15  
6 TYR 122 I . ? TYR 123 H PRO 123 I ? PRO 124 H 1 0.18  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 5 ? 
C  ? 5 ? 
D  ? 4 ? 
E  ? 2 ? 
F  ? 5 ? 
G  ? 2 ? 
H  ? 8 ? 
I  ? 4 ? 
J  ? 4 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 4 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 5 ? 
Q  ? 4 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 8 ? 
X  ? 4 ? 
Y  ? 4 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
B  1 2 ? parallel      
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
C  1 2 ? parallel      
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? parallel      
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
H  5 6 ? anti-parallel 
H  6 7 ? anti-parallel 
H  7 8 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? parallel      
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
Q  1 2 ? parallel      
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? parallel      
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
W  5 6 ? anti-parallel 
W  6 7 ? anti-parallel 
W  7 8 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 2   ? ARG A 3   ? VAL A 3   ARG A 4   
A  2 ALA A 17  ? TYR A 23  ? ALA A 18  TYR A 24  
A  3 LYS A 70  ? ILE A 75  ? LYS A 72  ILE A 77  
A  4 PHE A 60  ? ASN A 65  ? PHE A 62  ASN A 67  
A  5 LYS A 54  ? ASP A 57  ? LYS A 55  ASP A 58  
B  1 LEU A 9   ? TRP A 12  ? LEU A 10  TRP A 13  
B  2 THR A 104 ? VAL A 109 ? THR A 110 VAL A 115 
B  3 THR A 85  ? CYS A 88  ? THR A 87  CYS A 90  
B  4 PHE A 28  ? GLN A 36  ? PHE A 29  GLN A 37  
B  5 ALA A 43  ? LEU A 49  ? ALA A 44  LEU A 50  
C  1 LEU A 9   ? TRP A 12  ? LEU A 10  TRP A 13  
C  2 THR A 104 ? VAL A 109 ? THR A 110 VAL A 115 
C  3 THR A 85  ? CYS A 88  ? THR A 87  CYS A 90  
C  4 PHE A 28  ? GLN A 36  ? PHE A 29  GLN A 37  
C  5 SER A 91  ? ALA A 92  ? SER A 93  ALA A 98  
D  1 VAL B 2   ? GLN B 4   ? VAL B 4   GLN B 6   
D  2 VAL B 17  ? GLN B 23  ? VAL B 19  GLN B 25  
D  3 ASN B 71  ? LEU B 76  ? ASN B 74  LEU B 79  
D  4 LYS B 63  ? SER B 68  ? LYS B 66  SER B 71  
E  1 ASN B 8   ? VAL B 10  ? ASN B 10  VAL B 12  
E  2 ARG B 107 ? THR B 109 ? ARG B 113 THR B 115 
F  1 GLU B 54  ? LYS B 55  ? GLU B 56  LYS B 57  
F  2 TYR B 45  ? SER B 47  ? TYR B 47  SER B 49  
F  3 ASN B 29  ? TRP B 32  ? ASN B 31  TRP B 34  
F  4 CYS B 89  ? GLY B 92  ? CYS B 92  GLY B 95  
F  5 GLN B 100 ? PHE B 102 ? GLN B 106 PHE B 108 
G  1 GLN B 35  ? ASP B 36  ? GLN B 37  ASP B 38  
G  2 GLY B 40  ? LEU B 41  ? GLY B 42  LEU B 43  
H  1 GLU C 41  ? TRP C 44  ? GLU C 40  TRP C 43  
H  2 ASP C 30  ? ASP C 36  ? ASP C 29  ASP C 35  
H  3 ILE C 20  ? PHE C 27  ? ILE C 19  PHE C 26  
H  4 HIS C 5   ? SER C 16  ? HIS C 5   SER C 15  
H  5 PHE D 7   ? THR D 18  ? PHE D 7   THR D 18  
H  6 ARG D 23  ? ILE D 31  ? ARG D 23  ILE D 31  
H  7 GLU D 36  ? ASP D 41  ? GLU D 36  ASP D 41  
H  8 GLU D 46  ? ALA D 49  ? GLU D 46  ALA D 49  
I  1 GLN C 89  ? PRO C 94  ? GLN C 88  PRO C 93  
I  2 ASN C 104 ? ILE C 113 ? ASN C 103 ILE C 112 
I  3 PHE C 146 ? PHE C 154 ? PHE C 145 PHE C 153 
I  4 VAL C 133 ? GLU C 135 ? VAL C 132 GLU C 134 
J  1 GLN C 89  ? PRO C 94  ? GLN C 88  PRO C 93  
J  2 ASN C 104 ? ILE C 113 ? ASN C 103 ILE C 112 
J  3 PHE C 146 ? PHE C 154 ? PHE C 145 PHE C 153 
J  4 PHE C 139 ? VAL C 140 ? PHE C 138 VAL C 139 
K  1 LYS C 127 ? VAL C 129 ? LYS C 126 VAL C 128 
K  2 ASN C 119 ? ARG C 124 ? ASN C 118 ARG C 123 
K  3 TYR C 162 ? GLU C 167 ? TYR C 161 GLU C 166 
K  4 VAL C 175 ? TRP C 179 ? VAL C 174 TRP C 178 
L  1 ASN D 97  ? LEU D 102 ? ASN D 98  LEU D 103 
L  2 ASN D 112 ? PHE D 121 ? ASN D 113 PHE D 122 
L  3 PHE D 154 ? MET D 162 ? PHE D 155 MET D 163 
L  4 VAL D 141 ? SER D 143 ? VAL D 142 SER D 144 
M  1 ASN D 97  ? LEU D 102 ? ASN D 98  LEU D 103 
M  2 ASN D 112 ? PHE D 121 ? ASN D 113 PHE D 122 
M  3 PHE D 154 ? MET D 162 ? PHE D 155 MET D 163 
M  4 ILE D 147 ? ARG D 148 ? ILE D 148 ARG D 149 
N  1 GLN D 135 ? GLU D 137 ? GLN D 136 GLU D 138 
N  2 LYS D 127 ? ARG D 132 ? LYS D 128 ARG D 133 
N  3 TYR D 170 ? GLU D 175 ? TYR D 171 GLU D 176 
N  4 ILE D 183 ? TRP D 187 ? ILE D 184 TRP D 188 
O  1 VAL F 2   ? GLN F 4   ? VAL E 3   GLN E 5   
O  2 ALA F 17  ? TYR F 23  ? ALA E 18  TYR E 24  
O  3 LYS F 70  ? ILE F 75  ? LYS E 72  ILE E 77  
O  4 PHE F 60  ? ASN F 65  ? PHE E 62  ASN E 67  
O  5 LYS F 54  ? ASP F 57  ? LYS E 55  ASP E 58  
P  1 SER F 8   ? TRP F 12  ? SER E 9   TRP E 13  
P  2 THR F 104 ? VAL F 109 ? THR E 110 VAL E 115 
P  3 THR F 85  ? ALA F 92  ? THR E 87  ALA E 98  
P  4 PHE F 28  ? GLN F 36  ? PHE E 29  GLN E 37  
P  5 ALA F 43  ? LEU F 49  ? ALA E 44  LEU E 50  
Q  1 SER F 8   ? TRP F 12  ? SER E 9   TRP E 13  
Q  2 THR F 104 ? VAL F 109 ? THR E 110 VAL E 115 
Q  3 THR F 85  ? ALA F 92  ? THR E 87  ALA E 98  
Q  4 ARG F 99  ? PHE F 100 ? ARG E 105 PHE E 106 
R  1 VAL G 2   ? GLN G 4   ? VAL F 4   GLN F 6   
R  2 CYS G 21  ? GLN G 23  ? CYS F 23  GLN F 25  
S  1 ASN G 8   ? VAL G 10  ? ASN F 10  VAL F 12  
S  2 ARG G 107 ? THR G 109 ? ARG F 113 THR F 115 
T  1 VAL G 17  ? LEU G 19  ? VAL F 19  LEU F 21  
T  2 ASN G 71  ? LEU G 76  ? ASN F 74  LEU F 79  
T  3 LYS G 63  ? SER G 68  ? LYS F 66  SER F 71  
U  1 LEU G 41  ? LEU G 43  ? LEU F 43  LEU F 45  
U  2 ASN G 29  ? GLN G 35  ? ASN F 31  GLN F 37  
U  3 TYR G 87  ? GLY G 92  ? TYR F 90  GLY F 95  
U  4 TYR G 101 ? PHE G 102 ? TYR F 107 PHE F 108 
V  1 TYR G 45  ? TYR G 46  ? TYR F 47  TYR F 48  
V  2 GLU G 54  ? LYS G 55  ? GLU F 56  LYS F 57  
W  1 GLU H 41  ? TRP H 44  ? GLU G 40  TRP G 43  
W  2 ASP H 30  ? ASP H 36  ? ASP G 29  ASP G 35  
W  3 ILE H 20  ? PHE H 27  ? ILE G 19  PHE G 26  
W  4 HIS H 5   ? SER H 16  ? HIS G 5   SER G 15  
W  5 PHE I 7   ? THR I 18  ? PHE H 7   THR H 18  
W  6 ARG I 23  ? ILE I 31  ? ARG H 23  ILE H 31  
W  7 GLU I 36  ? ASP I 41  ? GLU H 36  ASP H 41  
W  8 TYR I 47  ? ALA I 49  ? TYR H 47  ALA H 49  
X  1 GLN H 89  ? PRO H 94  ? GLN G 88  PRO G 93  
X  2 ASN H 104 ? ILE H 113 ? ASN G 103 ILE G 112 
X  3 PHE H 146 ? PHE H 154 ? PHE G 145 PHE G 153 
X  4 VAL H 133 ? GLU H 135 ? VAL G 132 GLU G 134 
Y  1 GLN H 89  ? PRO H 94  ? GLN G 88  PRO G 93  
Y  2 ASN H 104 ? ILE H 113 ? ASN G 103 ILE G 112 
Y  3 PHE H 146 ? PHE H 154 ? PHE G 145 PHE G 153 
Y  4 PHE H 139 ? VAL H 140 ? PHE G 138 VAL G 139 
Z  1 LYS H 127 ? SER H 128 ? LYS G 126 SER G 127 
Z  2 ASN H 119 ? ARG H 124 ? ASN G 118 ARG G 123 
Z  3 TYR H 162 ? GLU H 167 ? TYR G 161 GLU G 166 
Z  4 VAL H 175 ? TRP H 179 ? VAL G 174 TRP G 178 
AA 1 ASN I 97  ? LEU I 102 ? ASN H 98  LEU H 103 
AA 2 ASN I 112 ? PHE I 121 ? ASN H 113 PHE H 122 
AA 3 PHE I 154 ? MET I 162 ? PHE H 155 MET H 163 
AA 4 VAL I 141 ? SER I 143 ? VAL H 142 SER H 144 
AB 1 ASN I 97  ? LEU I 102 ? ASN H 98  LEU H 103 
AB 2 ASN I 112 ? PHE I 121 ? ASN H 113 PHE H 122 
AB 3 PHE I 154 ? MET I 162 ? PHE H 155 MET H 163 
AB 4 ILE I 147 ? ARG I 148 ? ILE H 148 ARG H 149 
AC 1 GLN I 135 ? GLU I 137 ? GLN H 136 GLU H 138 
AC 2 LYS I 127 ? ARG I 132 ? LYS H 128 ARG H 133 
AC 3 VAL I 169 ? GLU I 175 ? VAL H 170 GLU H 176 
AC 4 ILE I 183 ? ARG I 188 ? ILE H 184 ARG H 189 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 3   ? N ARG A 4   O SER A 22  ? O SER A 23  
A  2 3 N ALA A 17  ? N ALA A 18  O ILE A 75  ? O ILE A 77  
A  3 4 O SER A 72  ? O SER A 74  N PHE A 63  ? N PHE A 65  
A  4 5 O ILE A 62  ? O ILE A 64  N LYS A 55  ? N LYS A 56  
B  1 2 N LEU A 9   ? N LEU A 10  O LYS A 105 ? O LYS A 111 
B  2 3 O THR A 104 ? O THR A 110 N TYR A 86  ? N TYR A 88  
B  3 4 O PHE A 87  ? O PHE A 89  N TYR A 34  ? N TYR A 35  
B  4 5 N GLN A 35  ? N GLN A 36  O ALA A 43  ? O ALA A 44  
C  1 2 N LEU A 9   ? N LEU A 10  O LYS A 105 ? O LYS A 111 
C  2 3 O THR A 104 ? O THR A 110 N TYR A 86  ? N TYR A 88  
C  3 4 O PHE A 87  ? O PHE A 89  N TYR A 34  ? N TYR A 35  
C  4 5 N ASP A 29  ? N ASP A 30  O SER A 91  ? O SER A 93  
D  1 2 N THR B 3   ? N THR B 5   O ASN B 22  ? O ASN B 24  
D  2 3 N LEU B 19  ? N LEU B 21  O LEU B 74  ? O LEU B 77  
D  3 4 O THR B 75  ? O THR B 78  N LYS B 63  ? N LYS B 66  
E  1 2 N LYS B 9   ? N LYS B 11  O ARG B 107 ? O ARG B 113 
F  1 2 O GLU B 54  ? O GLU B 56  N TYR B 46  ? N TYR B 48  
F  2 3 O SER B 47  ? O SER B 49  N MET B 30  ? N MET B 32  
F  3 4 N TYR B 31  ? N TYR B 33  O ALA B 90  ? O ALA B 93  
F  4 5 N SER B 91  ? N SER B 94  O TYR B 101 ? O TYR B 107 
G  1 2 N ASP B 36  ? N ASP B 38  O GLY B 40  ? O GLY B 42  
H  1 2 O GLU C 41  ? O GLU C 40  N ASP C 36  ? N ASP C 35  
H  2 3 O LEU C 32  ? O LEU C 31  N PHE C 25  ? N PHE C 24  
H  3 4 O ILE C 20  ? O ILE C 19  N GLN C 15  ? N GLN C 14  
H  4 5 N SER C 16  ? N SER C 15  O PHE D 7   ? O PHE D 7   
H  5 6 N GLN D 10  ? N GLN D 10  O ILE D 31  ? O ILE D 31  
H  6 7 N TYR D 30  ? N TYR D 30  O LEU D 38  ? O LEU D 38  
H  7 8 N ARG D 39  ? N ARG D 39  O ARG D 48  ? O ARG D 48  
I  1 2 N GLN C 89  ? N GLN C 88  O ASP C 111 ? O ASP C 110 
I  2 3 N LEU C 106 ? N LEU C 105 O LEU C 152 ? O LEU C 151 
I  3 4 O TYR C 151 ? O TYR C 150 N TYR C 134 ? N TYR C 133 
J  1 2 N GLN C 89  ? N GLN C 88  O ASP C 111 ? O ASP C 110 
J  2 3 N LEU C 106 ? N LEU C 105 O LEU C 152 ? O LEU C 151 
J  3 4 O HIS C 147 ? O HIS C 146 N PHE C 139 ? N PHE C 138 
K  1 2 O VAL C 129 ? O VAL C 128 N TRP C 122 ? N TRP C 121 
K  2 3 N THR C 121 ? N THR C 120 O LYS C 165 ? O LYS C 164 
K  3 4 N CYS C 164 ? N CYS C 163 O LYS C 177 ? O LYS C 176 
L  1 2 N VAL D 99  ? N VAL D 100 O SER D 117 ? O SER D 118 
L  2 3 N LEU D 114 ? N LEU D 115 O LEU D 160 ? O LEU D 161 
L  3 4 O MET D 159 ? O MET D 160 N SER D 142 ? N SER D 143 
M  1 2 N VAL D 99  ? N VAL D 100 O SER D 117 ? O SER D 118 
M  2 3 N LEU D 114 ? N LEU D 115 O LEU D 160 ? O LEU D 161 
M  3 4 O GLN D 155 ? O GLN D 156 N ILE D 147 ? N ILE D 148 
N  1 2 O GLN D 135 ? O GLN D 136 N ARG D 132 ? N ARG D 133 
N  2 3 N ARG D 129 ? N ARG D 130 O HIS D 173 ? O HIS D 174 
N  3 4 N VAL D 174 ? N VAL D 175 O ILE D 183 ? O ILE D 184 
O  1 2 N ARG F 3   ? N ARG E 4   O SER F 22  ? O SER E 23  
O  2 3 N ALA F 17  ? N ALA E 18  O ILE F 75  ? O ILE E 77  
O  3 4 O SER F 72  ? O SER E 74  N PHE F 63  ? N PHE E 65  
O  4 5 O ILE F 62  ? O ILE E 64  N LYS F 55  ? N LYS E 56  
P  1 2 N VAL F 11  ? N VAL E 12  O GLN F 107 ? O GLN E 113 
P  2 3 O THR F 104 ? O THR E 110 N TYR F 86  ? N TYR E 88  
P  3 4 O SER F 91  ? O SER E 93  N ASP F 29  ? N ASP E 30  
P  4 5 N GLN F 35  ? N GLN E 36  O ALA F 43  ? O ALA E 44  
Q  1 2 N VAL F 11  ? N VAL E 12  O GLN F 107 ? O GLN E 113 
Q  2 3 O THR F 104 ? O THR E 110 N TYR F 86  ? N TYR E 88  
Q  3 4 N ALA F 90  ? N ALA E 92  O ARG F 99  ? O ARG E 105 
R  1 2 N THR G 3   ? N THR F 5   O ASN G 22  ? O ASN F 24  
S  1 2 N LYS G 9   ? N LYS F 11  O ARG G 107 ? O ARG F 113 
T  1 2 N VAL G 17  ? N VAL F 19  O LEU G 76  ? O LEU F 79  
T  2 3 O SER G 73  ? O SER F 76  N SER G 65  ? N SER F 68  
U  1 2 O ARG G 42  ? O ARG F 44  N ARG G 34  ? N ARG F 36  
U  2 3 N TYR G 31  ? N TYR F 33  O ALA G 90  ? O ALA F 93  
U  3 4 N SER G 91  ? N SER F 94  O TYR G 101 ? O TYR F 107 
V  1 2 N TYR G 46  ? N TYR F 48  O GLU G 54  ? O GLU F 56  
W  1 2 O GLU H 41  ? O GLU G 40  N ASP H 36  ? N ASP G 35  
W  2 3 O LEU H 32  ? O LEU G 31  N PHE H 25  ? N PHE G 24  
W  3 4 O GLU H 26  ? O GLU G 25  N SER H 8   ? N SER G 8   
W  4 5 N HIS H 5   ? N HIS G 5   O PHE I 17  ? O PHE H 17  
W  5 6 N TYR I 16  ? N TYR H 16  O ARG I 25  ? O ARG H 25  
W  6 7 N THR I 28  ? N THR H 28  O PHE I 40  ? O PHE H 40  
W  7 8 N ARG I 39  ? N ARG H 39  O ARG I 48  ? O ARG H 48  
X  1 2 N THR H 91  ? N THR G 90  O PHE H 109 ? O PHE G 108 
X  2 3 N ILE H 113 ? N ILE G 112 O PHE H 146 ? O PHE G 145 
X  3 4 O TYR H 151 ? O TYR G 150 N TYR H 134 ? N TYR G 133 
Y  1 2 N THR H 91  ? N THR G 90  O PHE H 109 ? O PHE G 108 
Y  2 3 N ILE H 113 ? N ILE G 112 O PHE H 146 ? O PHE G 145 
Y  3 4 O HIS H 147 ? O HIS G 146 N PHE H 139 ? N PHE G 138 
Z  1 2 O LYS H 127 ? O LYS G 126 N ARG H 124 ? N ARG G 123 
Z  2 3 N THR H 121 ? N THR G 120 O LYS H 165 ? O LYS G 164 
Z  3 4 N CYS H 164 ? N CYS G 163 O LYS H 177 ? O LYS G 176 
AA 1 2 N SER I 101 ? N SER H 102 O VAL I 115 ? O VAL H 116 
AA 2 3 N CYS I 116 ? N CYS H 117 O VAL I 158 ? O VAL H 159 
AA 3 4 O MET I 159 ? O MET H 160 N SER I 142 ? N SER H 143 
AB 1 2 N SER I 101 ? N SER H 102 O VAL I 115 ? O VAL H 116 
AB 2 3 N CYS I 116 ? N CYS H 117 O VAL I 158 ? O VAL H 159 
AB 3 4 O GLN I 155 ? O GLN H 156 N ILE I 147 ? N ILE H 148 
AC 1 2 O GLN I 135 ? O GLN H 136 N ARG I 132 ? N ARG H 133 
AC 2 3 N ARG I 129 ? N ARG H 130 O HIS I 173 ? O HIS H 174 
AC 3 4 N VAL I 174 ? N VAL H 175 O ILE I 183 ? O ILE H 184 
# 
_database_PDB_matrix.entry_id          1U3H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1U3H 
_atom_sites.fract_transf_matrix[1][1]   0.011385 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003057 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007864 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 1   ? 5.786   36.547  34.243  1.00 82.02  ? 2   GLN A N   1 
ATOM   2    C CA  . GLN A 1 1   ? 5.755   35.068  34.052  1.00 83.96  ? 2   GLN A CA  1 
ATOM   3    C C   . GLN A 1 1   ? 6.586   34.613  32.852  1.00 85.25  ? 2   GLN A C   1 
ATOM   4    O O   . GLN A 1 1   ? 6.831   35.390  31.923  1.00 83.08  ? 2   GLN A O   1 
ATOM   5    C CB  . GLN A 1 1   ? 4.314   34.586  33.879  1.00 87.20  ? 2   GLN A CB  1 
ATOM   6    C CG  . GLN A 1 1   ? 4.208   33.111  33.525  1.00 95.76  ? 2   GLN A CG  1 
ATOM   7    C CD  . GLN A 1 1   ? 2.782   32.660  33.302  1.00 102.95 ? 2   GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 1   ? 2.007   33.336  32.628  1.00 107.30 ? 2   GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 1   ? 2.431   31.502  33.855  1.00 105.18 ? 2   GLN A NE2 1 
ATOM   10   N N   . VAL A 1 2   ? 7.005   33.346  32.885  1.00 85.21  ? 3   VAL A N   1 
ATOM   11   C CA  . VAL A 1 2   ? 7.816   32.731  31.830  1.00 84.11  ? 3   VAL A CA  1 
ATOM   12   C C   . VAL A 1 2   ? 7.111   31.527  31.196  1.00 84.51  ? 3   VAL A C   1 
ATOM   13   O O   . VAL A 1 2   ? 6.449   30.756  31.887  1.00 84.14  ? 3   VAL A O   1 
ATOM   14   C CB  . VAL A 1 2   ? 9.167   32.250  32.392  1.00 83.32  ? 3   VAL A CB  1 
ATOM   15   C CG1 . VAL A 1 2   ? 10.032  31.690  31.270  1.00 82.15  ? 3   VAL A CG1 1 
ATOM   16   C CG2 . VAL A 1 2   ? 9.868   33.395  33.102  1.00 78.95  ? 3   VAL A CG2 1 
ATOM   17   N N   . ARG A 1 3   ? 7.275   31.360  29.886  1.00 85.09  ? 4   ARG A N   1 
ATOM   18   C CA  . ARG A 1 3   ? 6.641   30.256  29.164  1.00 89.59  ? 4   ARG A CA  1 
ATOM   19   C C   . ARG A 1 3   ? 7.615   29.504  28.255  1.00 88.43  ? 4   ARG A C   1 
ATOM   20   O O   . ARG A 1 3   ? 8.406   30.121  27.542  1.00 89.41  ? 4   ARG A O   1 
ATOM   21   C CB  . ARG A 1 3   ? 5.494   30.789  28.303  1.00 92.80  ? 4   ARG A CB  1 
ATOM   22   C CG  . ARG A 1 3   ? 4.563   31.744  29.014  1.00 99.00  ? 4   ARG A CG  1 
ATOM   23   C CD  . ARG A 1 3   ? 3.525   32.304  28.054  1.00 105.52 ? 4   ARG A CD  1 
ATOM   24   N NE  . ARG A 1 3   ? 2.701   33.333  28.684  1.00 114.36 ? 4   ARG A NE  1 
ATOM   25   C CZ  . ARG A 1 3   ? 1.949   33.137  29.764  1.00 116.17 ? 4   ARG A CZ  1 
ATOM   26   N NH1 . ARG A 1 3   ? 1.908   31.944  30.345  1.00 115.99 ? 4   ARG A NH1 1 
ATOM   27   N NH2 . ARG A 1 3   ? 1.235   34.136  30.265  1.00 116.89 ? 4   ARG A NH2 1 
ATOM   28   N N   . GLN A 1 4   ? 7.543   28.175  28.272  1.00 86.70  ? 5   GLN A N   1 
ATOM   29   C CA  . GLN A 1 4   ? 8.409   27.346  27.434  1.00 88.11  ? 5   GLN A CA  1 
ATOM   30   C C   . GLN A 1 4   ? 7.580   26.540  26.439  1.00 90.04  ? 5   GLN A C   1 
ATOM   31   O O   . GLN A 1 4   ? 6.906   25.581  26.807  1.00 88.88  ? 5   GLN A O   1 
ATOM   32   C CB  . GLN A 1 4   ? 9.259   26.413  28.300  1.00 81.16  ? 5   GLN A CB  1 
ATOM   33   C CG  . GLN A 1 4   ? 10.256  27.155  29.168  1.00 73.75  ? 5   GLN A CG  1 
ATOM   34   C CD  . GLN A 1 4   ? 11.196  26.230  29.902  1.00 77.51  ? 5   GLN A CD  1 
ATOM   35   O OE1 . GLN A 1 4   ? 11.921  25.449  29.286  1.00 77.00  ? 5   GLN A OE1 1 
ATOM   36   N NE2 . GLN A 1 4   ? 11.195  26.314  31.226  1.00 74.91  ? 5   GLN A NE2 1 
ATOM   37   N N   . SER A 1 5   ? 7.651   26.944  25.174  1.00 96.79  ? 6   SER A N   1 
ATOM   38   C CA  . SER A 1 5   ? 6.901   26.324  24.084  1.00 101.22 ? 6   SER A CA  1 
ATOM   39   C C   . SER A 1 5   ? 6.899   24.798  23.986  1.00 104.42 ? 6   SER A C   1 
ATOM   40   O O   . SER A 1 5   ? 5.849   24.169  24.130  1.00 109.73 ? 6   SER A O   1 
ATOM   41   C CB  . SER A 1 5   ? 7.356   26.917  22.744  1.00 104.13 ? 6   SER A CB  1 
ATOM   42   O OG  . SER A 1 5   ? 6.769   26.238  21.646  1.00 107.30 ? 6   SER A OG  1 
ATOM   43   N N   . PRO A 1 6   ? 8.064   24.178  23.734  1.00 103.52 ? 7   PRO A N   1 
ATOM   44   C CA  . PRO A 1 6   ? 8.097   22.714  23.623  1.00 102.13 ? 7   PRO A CA  1 
ATOM   45   C C   . PRO A 1 6   ? 7.692   21.991  24.903  1.00 100.38 ? 7   PRO A C   1 
ATOM   46   O O   . PRO A 1 6   ? 8.525   21.767  25.778  1.00 100.05 ? 7   PRO A O   1 
ATOM   47   C CB  . PRO A 1 6   ? 9.548   22.428  23.243  1.00 102.48 ? 7   PRO A CB  1 
ATOM   48   C CG  . PRO A 1 6   ? 9.989   23.707  22.574  1.00 105.71 ? 7   PRO A CG  1 
ATOM   49   C CD  . PRO A 1 6   ? 9.396   24.747  23.477  1.00 102.28 ? 7   PRO A CD  1 
ATOM   50   N N   . GLN A 1 7   ? 6.417   21.624  25.010  1.00 100.15 ? 8   GLN A N   1 
ATOM   51   C CA  . GLN A 1 7   ? 5.932   20.925  26.196  1.00 97.79  ? 8   GLN A CA  1 
ATOM   52   C C   . GLN A 1 7   ? 6.780   19.685  26.456  1.00 98.10  ? 8   GLN A C   1 
ATOM   53   O O   . GLN A 1 7   ? 6.943   19.256  27.598  1.00 94.30  ? 8   GLN A O   1 
ATOM   54   C CB  . GLN A 1 7   ? 4.450   20.544  26.041  1.00 96.06  ? 8   GLN A CB  1 
ATOM   55   C CG  . GLN A 1 7   ? 3.955   20.358  24.608  1.00 93.76  ? 8   GLN A CG  1 
ATOM   56   C CD  . GLN A 1 7   ? 3.762   21.676  23.867  1.00 92.11  ? 8   GLN A CD  1 
ATOM   57   O OE1 . GLN A 1 7   ? 3.128   22.602  24.375  1.00 86.32  ? 8   GLN A OE1 1 
ATOM   58   N NE2 . GLN A 1 7   ? 4.299   21.758  22.655  1.00 87.29  ? 8   GLN A NE2 1 
ATOM   59   N N   . SER A 1 8   ? 7.331   19.126  25.384  1.00 100.26 ? 9   SER A N   1 
ATOM   60   C CA  . SER A 1 8   ? 8.184   17.949  25.474  1.00 100.46 ? 9   SER A CA  1 
ATOM   61   C C   . SER A 1 8   ? 8.838   17.740  24.108  1.00 100.53 ? 9   SER A C   1 
ATOM   62   O O   . SER A 1 8   ? 8.217   18.002  23.073  1.00 96.53  ? 9   SER A O   1 
ATOM   63   C CB  . SER A 1 8   ? 7.357   16.725  25.867  1.00 102.29 ? 9   SER A CB  1 
ATOM   64   O OG  . SER A 1 8   ? 8.193   15.689  26.349  1.00 104.84 ? 9   SER A OG  1 
ATOM   65   N N   . LEU A 1 9   ? 10.088  17.277  24.103  1.00 100.40 ? 10  LEU A N   1 
ATOM   66   C CA  . LEU A 1 9   ? 10.811  17.072  22.851  1.00 99.66  ? 10  LEU A CA  1 
ATOM   67   C C   . LEU A 1 9   ? 11.791  15.901  22.830  1.00 99.91  ? 10  LEU A C   1 
ATOM   68   O O   . LEU A 1 9   ? 12.533  15.668  23.786  1.00 98.21  ? 10  LEU A O   1 
ATOM   69   C CB  . LEU A 1 9   ? 11.577  18.341  22.484  1.00 101.60 ? 10  LEU A CB  1 
ATOM   70   C CG  . LEU A 1 9   ? 12.357  18.251  21.174  1.00 101.68 ? 10  LEU A CG  1 
ATOM   71   C CD1 . LEU A 1 9   ? 11.365  18.208  20.019  1.00 103.21 ? 10  LEU A CD1 1 
ATOM   72   C CD2 . LEU A 1 9   ? 13.302  19.437  21.037  1.00 100.00 ? 10  LEU A CD2 1 
ATOM   73   N N   . THR A 1 10  ? 11.799  15.186  21.708  1.00 100.58 ? 11  THR A N   1 
ATOM   74   C CA  . THR A 1 10  ? 12.680  14.039  21.507  1.00 100.53 ? 11  THR A CA  1 
ATOM   75   C C   . THR A 1 10  ? 13.402  14.182  20.167  1.00 99.81  ? 11  THR A C   1 
ATOM   76   O O   . THR A 1 10  ? 12.768  14.423  19.139  1.00 98.09  ? 11  THR A O   1 
ATOM   77   C CB  . THR A 1 10  ? 11.882  12.713  21.488  1.00 99.85  ? 11  THR A CB  1 
ATOM   78   O OG1 . THR A 1 10  ? 11.151  12.571  22.712  1.00 98.91  ? 11  THR A OG1 1 
ATOM   79   C CG2 . THR A 1 10  ? 12.824  11.527  21.330  1.00 101.18 ? 11  THR A CG2 1 
ATOM   80   N N   . VAL A 1 11  ? 14.724  14.041  20.183  1.00 99.16  ? 12  VAL A N   1 
ATOM   81   C CA  . VAL A 1 11  ? 15.524  14.146  18.964  1.00 102.32 ? 12  VAL A CA  1 
ATOM   82   C C   . VAL A 1 11  ? 16.658  13.123  18.987  1.00 102.96 ? 12  VAL A C   1 
ATOM   83   O O   . VAL A 1 11  ? 17.207  12.819  20.049  1.00 103.23 ? 12  VAL A O   1 
ATOM   84   C CB  . VAL A 1 11  ? 16.125  15.562  18.802  1.00 104.27 ? 12  VAL A CB  1 
ATOM   85   C CG1 . VAL A 1 11  ? 16.975  15.626  17.544  1.00 106.60 ? 12  VAL A CG1 1 
ATOM   86   C CG2 . VAL A 1 11  ? 15.013  16.595  18.731  1.00 102.64 ? 12  VAL A CG2 1 
ATOM   87   N N   . TRP A 1 12  ? 17.010  12.598  17.815  1.00 103.73 ? 13  TRP A N   1 
ATOM   88   C CA  . TRP A 1 12  ? 18.069  11.595  17.719  1.00 104.27 ? 13  TRP A CA  1 
ATOM   89   C C   . TRP A 1 12  ? 19.474  12.194  17.704  1.00 101.12 ? 13  TRP A C   1 
ATOM   90   O O   . TRP A 1 12  ? 19.774  13.102  16.924  1.00 97.17  ? 13  TRP A O   1 
ATOM   91   C CB  . TRP A 1 12  ? 17.870  10.721  16.473  1.00 107.65 ? 13  TRP A CB  1 
ATOM   92   C CG  . TRP A 1 12  ? 16.482  10.169  16.333  1.00 113.01 ? 13  TRP A CG  1 
ATOM   93   C CD1 . TRP A 1 12  ? 15.739  9.554   17.302  1.00 113.32 ? 13  TRP A CD1 1 
ATOM   94   C CD2 . TRP A 1 12  ? 15.665  10.195  15.155  1.00 116.63 ? 13  TRP A CD2 1 
ATOM   95   N NE1 . TRP A 1 12  ? 14.507  9.199   16.801  1.00 115.80 ? 13  TRP A NE1 1 
ATOM   96   C CE2 . TRP A 1 12  ? 14.435  9.580   15.486  1.00 118.36 ? 13  TRP A CE2 1 
ATOM   97   C CE3 . TRP A 1 12  ? 15.853  10.678  13.851  1.00 116.15 ? 13  TRP A CE3 1 
ATOM   98   C CZ2 . TRP A 1 12  ? 13.394  9.437   14.558  1.00 119.07 ? 13  TRP A CZ2 1 
ATOM   99   C CZ3 . TRP A 1 12  ? 14.818  10.535  12.929  1.00 117.01 ? 13  TRP A CZ3 1 
ATOM   100  C CH2 . TRP A 1 12  ? 13.604  9.919   13.289  1.00 119.19 ? 13  TRP A CH2 1 
ATOM   101  N N   . GLU A 1 13  ? 20.323  11.656  18.577  1.00 97.40  ? 14  GLU A N   1 
ATOM   102  C CA  . GLU A 1 13  ? 21.712  12.076  18.733  1.00 97.70  ? 14  GLU A CA  1 
ATOM   103  C C   . GLU A 1 13  ? 22.370  12.646  17.478  1.00 99.36  ? 14  GLU A C   1 
ATOM   104  O O   . GLU A 1 13  ? 22.399  11.997  16.433  1.00 99.06  ? 14  GLU A O   1 
ATOM   105  C CB  . GLU A 1 13  ? 22.537  10.895  19.250  1.00 95.06  ? 14  GLU A CB  1 
ATOM   106  C CG  . GLU A 1 13  ? 24.042  11.081  19.171  1.00 96.73  ? 14  GLU A CG  1 
ATOM   107  C CD  . GLU A 1 13  ? 24.791  9.935   19.823  1.00 100.29 ? 14  GLU A CD  1 
ATOM   108  O OE1 . GLU A 1 13  ? 24.443  8.769   19.545  1.00 103.55 ? 14  GLU A OE1 1 
ATOM   109  O OE2 . GLU A 1 13  ? 25.728  10.193  20.610  1.00 101.59 ? 14  GLU A OE2 1 
ATOM   110  N N   . GLY A 1 14  ? 22.896  13.864  17.592  1.00 98.61  ? 15  GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 23.565  14.492  16.466  1.00 98.02  ? 15  GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 22.849  15.650  15.791  1.00 97.36  ? 15  GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 23.495  16.495  15.172  1.00 95.94  ? 15  GLY A O   1 
ATOM   114  N N   . GLU A 1 15  ? 21.524  15.696  15.893  1.00 97.83  ? 16  GLU A N   1 
ATOM   115  C CA  . GLU A 1 15  ? 20.751  16.769  15.271  1.00 100.42 ? 16  GLU A CA  1 
ATOM   116  C C   . GLU A 1 15  ? 20.858  18.058  16.087  1.00 101.31 ? 16  GLU A C   1 
ATOM   117  O O   . GLU A 1 15  ? 21.765  18.212  16.906  1.00 100.39 ? 16  GLU A O   1 
ATOM   118  C CB  . GLU A 1 15  ? 19.282  16.359  15.156  1.00 101.92 ? 16  GLU A CB  1 
ATOM   119  C CG  . GLU A 1 15  ? 19.060  15.022  14.474  1.00 105.23 ? 16  GLU A CG  1 
ATOM   120  C CD  . GLU A 1 15  ? 17.596  14.630  14.425  1.00 108.06 ? 16  GLU A CD  1 
ATOM   121  O OE1 . GLU A 1 15  ? 16.807  15.350  13.778  1.00 111.49 ? 16  GLU A OE1 1 
ATOM   122  O OE2 . GLU A 1 15  ? 17.233  13.604  15.038  1.00 109.15 ? 16  GLU A OE2 1 
ATOM   123  N N   . THR A 1 16  ? 19.931  18.984  15.858  1.00 99.72  ? 17  THR A N   1 
ATOM   124  C CA  . THR A 1 16  ? 19.927  20.249  16.586  1.00 97.44  ? 17  THR A CA  1 
ATOM   125  C C   . THR A 1 16  ? 18.621  20.434  17.361  1.00 94.01  ? 17  THR A C   1 
ATOM   126  O O   . THR A 1 16  ? 17.551  20.582  16.770  1.00 90.16  ? 17  THR A O   1 
ATOM   127  C CB  . THR A 1 16  ? 20.111  21.450  15.633  1.00 96.75  ? 17  THR A CB  1 
ATOM   128  O OG1 . THR A 1 16  ? 21.295  21.261  14.848  1.00 99.84  ? 17  THR A OG1 1 
ATOM   129  C CG2 . THR A 1 16  ? 20.249  22.741  16.427  1.00 96.72  ? 17  THR A CG2 1 
ATOM   130  N N   . ALA A 1 17  ? 18.719  20.422  18.687  1.00 90.95  ? 18  ALA A N   1 
ATOM   131  C CA  . ALA A 1 17  ? 17.551  20.592  19.543  1.00 88.77  ? 18  ALA A CA  1 
ATOM   132  C C   . ALA A 1 17  ? 17.286  22.070  19.828  1.00 88.36  ? 18  ALA A C   1 
ATOM   133  O O   . ALA A 1 17  ? 18.125  22.763  20.404  1.00 89.38  ? 18  ALA A O   1 
ATOM   134  C CB  . ALA A 1 17  ? 17.753  19.838  20.853  1.00 85.17  ? 18  ALA A CB  1 
ATOM   135  N N   . ILE A 1 18  ? 16.117  22.547  19.417  1.00 83.86  ? 19  ILE A N   1 
ATOM   136  C CA  . ILE A 1 18  ? 15.735  23.932  19.638  1.00 80.96  ? 19  ILE A CA  1 
ATOM   137  C C   . ILE A 1 18  ? 14.672  24.004  20.724  1.00 82.54  ? 19  ILE A C   1 
ATOM   138  O O   . ILE A 1 18  ? 13.649  23.328  20.640  1.00 86.80  ? 19  ILE A O   1 
ATOM   139  C CB  . ILE A 1 18  ? 15.146  24.571  18.360  1.00 74.86  ? 19  ILE A CB  1 
ATOM   140  C CG1 . ILE A 1 18  ? 16.202  24.629  17.261  1.00 73.92  ? 19  ILE A CG1 1 
ATOM   141  C CG2 . ILE A 1 18  ? 14.646  25.972  18.661  1.00 73.75  ? 19  ILE A CG2 1 
ATOM   142  C CD1 . ILE A 1 18  ? 15.690  25.225  15.967  1.00 68.07  ? 19  ILE A CD1 1 
ATOM   143  N N   . LEU A 1 19  ? 14.917  24.815  21.745  1.00 80.83  ? 20  LEU A N   1 
ATOM   144  C CA  . LEU A 1 19  ? 13.951  24.990  22.824  1.00 79.28  ? 20  LEU A CA  1 
ATOM   145  C C   . LEU A 1 19  ? 13.416  26.419  22.747  1.00 80.27  ? 20  LEU A C   1 
ATOM   146  O O   . LEU A 1 19  ? 14.114  27.329  22.306  1.00 78.31  ? 20  LEU A O   1 
ATOM   147  C CB  . LEU A 1 19  ? 14.607  24.747  24.182  1.00 73.95  ? 20  LEU A CB  1 
ATOM   148  C CG  . LEU A 1 19  ? 15.270  23.383  24.360  1.00 76.48  ? 20  LEU A CG  1 
ATOM   149  C CD1 . LEU A 1 19  ? 15.603  23.157  25.836  1.00 73.74  ? 20  LEU A CD1 1 
ATOM   150  C CD2 . LEU A 1 19  ? 14.332  22.303  23.861  1.00 78.88  ? 20  LEU A CD2 1 
ATOM   151  N N   . ASN A 1 20  ? 12.179  26.624  23.171  1.00 80.69  ? 21  ASN A N   1 
ATOM   152  C CA  . ASN A 1 20  ? 11.614  27.957  23.100  1.00 82.76  ? 21  ASN A CA  1 
ATOM   153  C C   . ASN A 1 20  ? 11.183  28.488  24.456  1.00 82.69  ? 21  ASN A C   1 
ATOM   154  O O   . ASN A 1 20  ? 10.875  27.721  25.372  1.00 81.89  ? 21  ASN A O   1 
ATOM   155  C CB  . ASN A 1 20  ? 10.447  27.961  22.118  1.00 85.43  ? 21  ASN A CB  1 
ATOM   156  C CG  . ASN A 1 20  ? 10.874  27.571  20.715  1.00 86.74  ? 21  ASN A CG  1 
ATOM   157  O OD1 . ASN A 1 20  ? 11.563  28.329  20.029  1.00 89.08  ? 21  ASN A OD1 1 
ATOM   158  N ND2 . ASN A 1 20  ? 10.481  26.377  20.286  1.00 85.90  ? 21  ASN A ND2 1 
ATOM   159  N N   . CYS A 1 21  ? 11.182  29.814  24.570  1.00 82.30  ? 22  CYS A N   1 
ATOM   160  C CA  . CYS A 1 21  ? 10.816  30.496  25.805  1.00 77.06  ? 22  CYS A CA  1 
ATOM   161  C C   . CYS A 1 21  ? 10.251  31.871  25.484  1.00 73.96  ? 22  CYS A C   1 
ATOM   162  O O   . CYS A 1 21  ? 10.616  32.483  24.481  1.00 70.26  ? 22  CYS A O   1 
ATOM   163  C CB  . CYS A 1 21  ? 12.049  30.651  26.692  1.00 75.12  ? 22  CYS A CB  1 
ATOM   164  S SG  . CYS A 1 21  ? 11.717  31.219  28.388  1.00 74.20  ? 22  CYS A SG  1 
ATOM   165  N N   . SER A 1 22  ? 9.356   32.352  26.337  1.00 73.84  ? 23  SER A N   1 
ATOM   166  C CA  . SER A 1 22  ? 8.757   33.666  26.145  1.00 76.93  ? 23  SER A CA  1 
ATOM   167  C C   . SER A 1 22  ? 8.307   34.230  27.485  1.00 77.49  ? 23  SER A C   1 
ATOM   168  O O   . SER A 1 22  ? 8.040   33.485  28.429  1.00 75.35  ? 23  SER A O   1 
ATOM   169  C CB  . SER A 1 22  ? 7.563   33.578  25.202  1.00 77.62  ? 23  SER A CB  1 
ATOM   170  O OG  . SER A 1 22  ? 6.536   32.791  25.775  1.00 86.32  ? 23  SER A OG  1 
ATOM   171  N N   . TYR A 1 23  ? 8.224   35.553  27.553  1.00 77.26  ? 24  TYR A N   1 
ATOM   172  C CA  . TYR A 1 23  ? 7.827   36.256  28.769  1.00 78.32  ? 24  TYR A CA  1 
ATOM   173  C C   . TYR A 1 23  ? 7.164   37.538  28.306  1.00 78.40  ? 24  TYR A C   1 
ATOM   174  O O   . TYR A 1 23  ? 7.231   37.868  27.125  1.00 79.04  ? 24  TYR A O   1 
ATOM   175  C CB  . TYR A 1 23  ? 9.073   36.594  29.593  1.00 77.05  ? 24  TYR A CB  1 
ATOM   176  C CG  . TYR A 1 23  ? 10.065  37.454  28.830  1.00 76.10  ? 24  TYR A CG  1 
ATOM   177  C CD1 . TYR A 1 23  ? 9.937   38.841  28.797  1.00 78.20  ? 24  TYR A CD1 1 
ATOM   178  C CD2 . TYR A 1 23  ? 11.078  36.877  28.072  1.00 72.24  ? 24  TYR A CD2 1 
ATOM   179  C CE1 . TYR A 1 23  ? 10.787  39.627  28.025  1.00 77.21  ? 24  TYR A CE1 1 
ATOM   180  C CE2 . TYR A 1 23  ? 11.930  37.654  27.295  1.00 71.18  ? 24  TYR A CE2 1 
ATOM   181  C CZ  . TYR A 1 23  ? 11.779  39.026  27.275  1.00 72.57  ? 24  TYR A CZ  1 
ATOM   182  O OH  . TYR A 1 23  ? 12.605  39.799  26.495  1.00 67.50  ? 24  TYR A OH  1 
ATOM   183  N N   . GLU A 1 24  ? 6.514   38.257  29.215  1.00 80.88  ? 25  GLU A N   1 
ATOM   184  C CA  . GLU A 1 24  ? 5.901   39.521  28.828  1.00 86.30  ? 25  GLU A CA  1 
ATOM   185  C C   . GLU A 1 24  ? 6.004   40.587  29.901  1.00 81.98  ? 25  GLU A C   1 
ATOM   186  O O   . GLU A 1 24  ? 5.019   41.222  30.284  1.00 85.93  ? 25  GLU A O   1 
ATOM   187  C CB  . GLU A 1 24  ? 4.446   39.333  28.380  1.00 95.23  ? 25  GLU A CB  1 
ATOM   188  C CG  . GLU A 1 24  ? 3.550   38.553  29.310  1.00 103.01 ? 25  GLU A CG  1 
ATOM   189  C CD  . GLU A 1 24  ? 2.196   38.297  28.674  1.00 110.22 ? 25  GLU A CD  1 
ATOM   190  O OE1 . GLU A 1 24  ? 1.461   39.277  28.425  1.00 113.00 ? 25  GLU A OE1 1 
ATOM   191  O OE2 . GLU A 1 24  ? 1.873   37.119  28.408  1.00 114.54 ? 25  GLU A OE2 1 
ATOM   192  N N   . ASN A 1 25  ? 7.233   40.758  30.376  1.00 78.19  ? 26  ASN A N   1 
ATOM   193  C CA  . ASN A 1 25  ? 7.593   41.749  31.379  1.00 68.94  ? 26  ASN A CA  1 
ATOM   194  C C   . ASN A 1 25  ? 8.877   42.353  30.843  1.00 63.30  ? 26  ASN A C   1 
ATOM   195  O O   . ASN A 1 25  ? 9.976   41.874  31.146  1.00 58.62  ? 26  ASN A O   1 
ATOM   196  C CB  . ASN A 1 25  ? 7.862   41.094  32.733  1.00 71.09  ? 26  ASN A CB  1 
ATOM   197  C CG  . ASN A 1 25  ? 8.522   42.045  33.719  1.00 73.93  ? 26  ASN A CG  1 
ATOM   198  O OD1 . ASN A 1 25  ? 9.159   41.614  34.682  1.00 66.36  ? 26  ASN A OD1 1 
ATOM   199  N ND2 . ASN A 1 25  ? 8.370   43.342  33.484  1.00 78.80  ? 26  ASN A ND2 1 
ATOM   200  N N   . SER A 1 26  ? 8.725   43.396  30.032  1.00 57.62  ? 27  SER A N   1 
ATOM   201  C CA  . SER A 1 26  ? 9.859   44.066  29.416  1.00 54.90  ? 27  SER A CA  1 
ATOM   202  C C   . SER A 1 26  ? 10.948  44.475  30.402  1.00 51.98  ? 27  SER A C   1 
ATOM   203  O O   . SER A 1 26  ? 12.037  44.884  29.994  1.00 52.61  ? 27  SER A O   1 
ATOM   204  C CB  . SER A 1 26  ? 9.377   45.284  28.627  1.00 55.04  ? 27  SER A CB  1 
ATOM   205  O OG  . SER A 1 26  ? 8.492   46.076  29.395  1.00 63.86  ? 27  SER A OG  1 
ATOM   206  N N   . ALA A 1 27  ? 10.663  44.360  31.694  1.00 43.66  ? 28  ALA A N   1 
ATOM   207  C CA  . ALA A 1 27  ? 11.646  44.716  32.704  1.00 48.97  ? 28  ALA A CA  1 
ATOM   208  C C   . ALA A 1 27  ? 12.639  43.572  32.920  1.00 51.10  ? 28  ALA A C   1 
ATOM   209  O O   . ALA A 1 27  ? 13.663  43.752  33.581  1.00 48.41  ? 28  ALA A O   1 
ATOM   210  C CB  . ALA A 1 27  ? 10.955  45.071  34.017  1.00 45.04  ? 28  ALA A CB  1 
ATOM   211  N N   . PHE A 1 28  ? 12.333  42.395  32.374  1.00 49.93  ? 29  PHE A N   1 
ATOM   212  C CA  . PHE A 1 28  ? 13.239  41.255  32.507  1.00 54.22  ? 29  PHE A CA  1 
ATOM   213  C C   . PHE A 1 28  ? 14.535  41.558  31.749  1.00 54.68  ? 29  PHE A C   1 
ATOM   214  O O   . PHE A 1 28  ? 14.503  41.972  30.590  1.00 56.34  ? 29  PHE A O   1 
ATOM   215  C CB  . PHE A 1 28  ? 12.573  39.982  31.977  1.00 50.90  ? 29  PHE A CB  1 
ATOM   216  C CG  . PHE A 1 28  ? 11.586  39.372  32.940  1.00 58.46  ? 29  PHE A CG  1 
ATOM   217  C CD1 . PHE A 1 28  ? 11.869  39.314  34.305  1.00 57.95  ? 29  PHE A CD1 1 
ATOM   218  C CD2 . PHE A 1 28  ? 10.399  38.810  32.482  1.00 63.96  ? 29  PHE A CD2 1 
ATOM   219  C CE1 . PHE A 1 28  ? 10.980  38.699  35.205  1.00 60.79  ? 29  PHE A CE1 1 
ATOM   220  C CE2 . PHE A 1 28  ? 9.503   38.191  33.373  1.00 68.31  ? 29  PHE A CE2 1 
ATOM   221  C CZ  . PHE A 1 28  ? 9.798   38.137  34.736  1.00 61.69  ? 29  PHE A CZ  1 
ATOM   222  N N   . ASP A 1 29  ? 15.674  41.357  32.403  1.00 51.67  ? 30  ASP A N   1 
ATOM   223  C CA  . ASP A 1 29  ? 16.953  41.680  31.784  1.00 56.12  ? 30  ASP A CA  1 
ATOM   224  C C   . ASP A 1 29  ? 17.973  40.542  31.838  1.00 61.50  ? 30  ASP A C   1 
ATOM   225  O O   . ASP A 1 29  ? 18.993  40.569  31.139  1.00 63.20  ? 30  ASP A O   1 
ATOM   226  C CB  . ASP A 1 29  ? 17.534  42.923  32.468  1.00 50.40  ? 30  ASP A CB  1 
ATOM   227  C CG  . ASP A 1 29  ? 18.025  42.641  33.891  1.00 61.80  ? 30  ASP A CG  1 
ATOM   228  O OD1 . ASP A 1 29  ? 17.364  41.875  34.628  1.00 61.97  ? 30  ASP A OD1 1 
ATOM   229  O OD2 . ASP A 1 29  ? 19.075  43.196  34.280  1.00 65.94  ? 30  ASP A OD2 1 
ATOM   230  N N   . TYR A 1 30  ? 17.699  39.549  32.675  1.00 60.83  ? 31  TYR A N   1 
ATOM   231  C CA  . TYR A 1 30  ? 18.595  38.412  32.831  1.00 56.90  ? 31  TYR A CA  1 
ATOM   232  C C   . TYR A 1 30  ? 17.813  37.116  32.699  1.00 55.60  ? 31  TYR A C   1 
ATOM   233  O O   . TYR A 1 30  ? 16.770  36.948  33.331  1.00 54.39  ? 31  TYR A O   1 
ATOM   234  C CB  . TYR A 1 30  ? 19.271  38.481  34.193  1.00 55.27  ? 31  TYR A CB  1 
ATOM   235  C CG  . TYR A 1 30  ? 20.061  37.254  34.547  1.00 63.80  ? 31  TYR A CG  1 
ATOM   236  C CD1 . TYR A 1 30  ? 21.116  36.826  33.741  1.00 61.10  ? 31  TYR A CD1 1 
ATOM   237  C CD2 . TYR A 1 30  ? 19.771  36.528  35.705  1.00 65.28  ? 31  TYR A CD2 1 
ATOM   238  C CE1 . TYR A 1 30  ? 21.865  35.708  34.081  1.00 66.21  ? 31  TYR A CE1 1 
ATOM   239  C CE2 . TYR A 1 30  ? 20.513  35.408  36.057  1.00 67.71  ? 31  TYR A CE2 1 
ATOM   240  C CZ  . TYR A 1 30  ? 21.558  35.003  35.241  1.00 70.08  ? 31  TYR A CZ  1 
ATOM   241  O OH  . TYR A 1 30  ? 22.296  33.895  35.584  1.00 73.35  ? 31  TYR A OH  1 
ATOM   242  N N   . PHE A 1 31  ? 18.320  36.204  31.873  1.00 57.04  ? 32  PHE A N   1 
ATOM   243  C CA  . PHE A 1 31  ? 17.658  34.926  31.640  1.00 52.16  ? 32  PHE A CA  1 
ATOM   244  C C   . PHE A 1 31  ? 18.618  33.741  31.718  1.00 54.92  ? 32  PHE A C   1 
ATOM   245  O O   . PHE A 1 31  ? 19.380  33.488  30.788  1.00 55.13  ? 32  PHE A O   1 
ATOM   246  C CB  . PHE A 1 31  ? 16.986  34.926  30.265  1.00 46.40  ? 32  PHE A CB  1 
ATOM   247  C CG  . PHE A 1 31  ? 16.168  36.156  29.983  1.00 47.53  ? 32  PHE A CG  1 
ATOM   248  C CD1 . PHE A 1 31  ? 16.782  37.384  29.756  1.00 44.84  ? 32  PHE A CD1 1 
ATOM   249  C CD2 . PHE A 1 31  ? 14.780  36.088  29.948  1.00 49.35  ? 32  PHE A CD2 1 
ATOM   250  C CE1 . PHE A 1 31  ? 16.027  38.525  29.500  1.00 46.83  ? 32  PHE A CE1 1 
ATOM   251  C CE2 . PHE A 1 31  ? 14.016  37.226  29.692  1.00 48.50  ? 32  PHE A CE2 1 
ATOM   252  C CZ  . PHE A 1 31  ? 14.640  38.445  29.467  1.00 46.26  ? 32  PHE A CZ  1 
ATOM   253  N N   . PRO A 1 32  ? 18.608  33.007  32.841  1.00 60.25  ? 33  PRO A N   1 
ATOM   254  C CA  . PRO A 1 32  ? 19.503  31.855  32.965  1.00 58.95  ? 33  PRO A CA  1 
ATOM   255  C C   . PRO A 1 32  ? 18.749  30.553  32.716  1.00 61.37  ? 33  PRO A C   1 
ATOM   256  O O   . PRO A 1 32  ? 17.625  30.388  33.191  1.00 63.76  ? 33  PRO A O   1 
ATOM   257  C CB  . PRO A 1 32  ? 19.978  31.956  34.407  1.00 55.90  ? 33  PRO A CB  1 
ATOM   258  C CG  . PRO A 1 32  ? 18.736  32.360  35.102  1.00 47.35  ? 33  PRO A CG  1 
ATOM   259  C CD  . PRO A 1 32  ? 18.139  33.431  34.174  1.00 58.05  ? 33  PRO A CD  1 
ATOM   260  N N   . TRP A 1 33  ? 19.359  29.637  31.967  1.00 63.57  ? 34  TRP A N   1 
ATOM   261  C CA  . TRP A 1 33  ? 18.741  28.340  31.707  1.00 58.78  ? 34  TRP A CA  1 
ATOM   262  C C   . TRP A 1 33  ? 19.362  27.306  32.624  1.00 58.54  ? 34  TRP A C   1 
ATOM   263  O O   . TRP A 1 33  ? 20.581  27.199  32.704  1.00 64.30  ? 34  TRP A O   1 
ATOM   264  C CB  . TRP A 1 33  ? 18.947  27.904  30.262  1.00 48.58  ? 34  TRP A CB  1 
ATOM   265  C CG  . TRP A 1 33  ? 18.175  28.705  29.297  1.00 52.04  ? 34  TRP A CG  1 
ATOM   266  C CD1 . TRP A 1 33  ? 18.367  30.018  28.989  1.00 54.25  ? 34  TRP A CD1 1 
ATOM   267  C CD2 . TRP A 1 33  ? 17.073  28.259  28.502  1.00 47.94  ? 34  TRP A CD2 1 
ATOM   268  N NE1 . TRP A 1 33  ? 17.456  30.418  28.040  1.00 57.85  ? 34  TRP A NE1 1 
ATOM   269  C CE2 . TRP A 1 33  ? 16.654  29.355  27.718  1.00 49.17  ? 34  TRP A CE2 1 
ATOM   270  C CE3 . TRP A 1 33  ? 16.411  27.034  28.360  1.00 53.62  ? 34  TRP A CE3 1 
ATOM   271  C CZ2 . TRP A 1 33  ? 15.583  29.273  26.817  1.00 57.09  ? 34  TRP A CZ2 1 
ATOM   272  C CZ3 . TRP A 1 33  ? 15.344  26.950  27.461  1.00 59.90  ? 34  TRP A CZ3 1 
ATOM   273  C CH2 . TRP A 1 33  ? 14.948  28.063  26.696  1.00 54.31  ? 34  TRP A CH2 1 
ATOM   274  N N   . TYR A 1 34  ? 18.523  26.557  33.329  1.00 61.38  ? 35  TYR A N   1 
ATOM   275  C CA  . TYR A 1 34  ? 19.013  25.525  34.227  1.00 66.43  ? 35  TYR A CA  1 
ATOM   276  C C   . TYR A 1 34  ? 18.771  24.147  33.619  1.00 70.89  ? 35  TYR A C   1 
ATOM   277  O O   . TYR A 1 34  ? 17.808  23.930  32.879  1.00 71.24  ? 35  TYR A O   1 
ATOM   278  C CB  . TYR A 1 34  ? 18.316  25.606  35.588  1.00 67.52  ? 35  TYR A CB  1 
ATOM   279  C CG  . TYR A 1 34  ? 18.683  26.804  36.437  1.00 67.67  ? 35  TYR A CG  1 
ATOM   280  C CD1 . TYR A 1 34  ? 18.282  28.097  36.079  1.00 69.55  ? 35  TYR A CD1 1 
ATOM   281  C CD2 . TYR A 1 34  ? 19.392  26.640  37.631  1.00 63.54  ? 35  TYR A CD2 1 
ATOM   282  C CE1 . TYR A 1 34  ? 18.575  29.199  36.899  1.00 69.55  ? 35  TYR A CE1 1 
ATOM   283  C CE2 . TYR A 1 34  ? 19.692  27.732  38.456  1.00 67.95  ? 35  TYR A CE2 1 
ATOM   284  C CZ  . TYR A 1 34  ? 19.280  29.007  38.086  1.00 70.12  ? 35  TYR A CZ  1 
ATOM   285  O OH  . TYR A 1 34  ? 19.572  30.081  38.902  1.00 69.88  ? 35  TYR A OH  1 
ATOM   286  N N   . GLN A 1 35  ? 19.656  23.217  33.945  1.00 74.49  ? 36  GLN A N   1 
ATOM   287  C CA  . GLN A 1 35  ? 19.574  21.853  33.446  1.00 79.02  ? 36  GLN A CA  1 
ATOM   288  C C   . GLN A 1 35  ? 19.403  20.907  34.631  1.00 79.52  ? 36  GLN A C   1 
ATOM   289  O O   . GLN A 1 35  ? 20.215  20.914  35.560  1.00 80.82  ? 36  GLN A O   1 
ATOM   290  C CB  . GLN A 1 35  ? 20.852  21.537  32.656  1.00 80.14  ? 36  GLN A CB  1 
ATOM   291  C CG  . GLN A 1 35  ? 21.341  20.096  32.704  1.00 80.91  ? 36  GLN A CG  1 
ATOM   292  C CD  . GLN A 1 35  ? 22.511  19.855  31.758  1.00 82.19  ? 36  GLN A CD  1 
ATOM   293  O OE1 . GLN A 1 35  ? 22.331  19.725  30.541  1.00 71.78  ? 36  GLN A OE1 1 
ATOM   294  N NE2 . GLN A 1 35  ? 23.720  19.809  32.313  1.00 78.27  ? 36  GLN A NE2 1 
ATOM   295  N N   . GLN A 1 36  ? 18.337  20.113  34.612  1.00 75.73  ? 37  GLN A N   1 
ATOM   296  C CA  . GLN A 1 36  ? 18.101  19.178  35.705  1.00 80.10  ? 37  GLN A CA  1 
ATOM   297  C C   . GLN A 1 36  ? 18.034  17.720  35.265  1.00 80.45  ? 37  GLN A C   1 
ATOM   298  O O   . GLN A 1 36  ? 17.172  17.337  34.473  1.00 74.94  ? 37  GLN A O   1 
ATOM   299  C CB  . GLN A 1 36  ? 16.815  19.533  36.462  1.00 79.03  ? 37  GLN A CB  1 
ATOM   300  C CG  . GLN A 1 36  ? 16.522  18.580  37.624  1.00 80.33  ? 37  GLN A CG  1 
ATOM   301  C CD  . GLN A 1 36  ? 15.243  18.913  38.372  1.00 81.19  ? 37  GLN A CD  1 
ATOM   302  O OE1 . GLN A 1 36  ? 14.190  19.111  37.765  1.00 81.67  ? 37  GLN A OE1 1 
ATOM   303  N NE2 . GLN A 1 36  ? 15.326  18.963  39.698  1.00 76.17  ? 37  GLN A NE2 1 
ATOM   304  N N   . PHE A 1 37  ? 18.956  16.920  35.795  1.00 83.15  ? 38  PHE A N   1 
ATOM   305  C CA  . PHE A 1 37  ? 19.015  15.491  35.507  1.00 85.88  ? 38  PHE A CA  1 
ATOM   306  C C   . PHE A 1 37  ? 18.200  14.785  36.576  1.00 89.22  ? 38  PHE A C   1 
ATOM   307  O O   . PHE A 1 37  ? 18.256  15.151  37.756  1.00 90.14  ? 38  PHE A O   1 
ATOM   308  C CB  . PHE A 1 37  ? 20.454  14.970  35.565  1.00 79.25  ? 38  PHE A CB  1 
ATOM   309  C CG  . PHE A 1 37  ? 21.353  15.526  34.500  1.00 76.56  ? 38  PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 37  ? 21.021  15.401  33.156  1.00 76.29  ? 38  PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 37  ? 22.541  16.168  34.843  1.00 74.05  ? 38  PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 37  ? 21.860  15.908  32.168  1.00 75.94  ? 38  PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 37  ? 23.386  16.678  33.864  1.00 70.58  ? 38  PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 37  ? 23.047  16.549  32.527  1.00 73.76  ? 38  PHE A CZ  1 
ATOM   315  N N   . PRO A 1 38  ? 17.440  13.754  36.185  1.00 92.33  ? 39  PRO A N   1 
ATOM   316  C CA  . PRO A 1 38  ? 16.631  13.035  37.170  1.00 93.68  ? 39  PRO A CA  1 
ATOM   317  C C   . PRO A 1 38  ? 17.442  12.611  38.388  1.00 95.09  ? 39  PRO A C   1 
ATOM   318  O O   . PRO A 1 38  ? 18.532  12.048  38.253  1.00 91.94  ? 39  PRO A O   1 
ATOM   319  C CB  . PRO A 1 38  ? 16.101  11.842  36.375  1.00 93.73  ? 39  PRO A CB  1 
ATOM   320  C CG  . PRO A 1 38  ? 17.177  11.616  35.348  1.00 93.92  ? 39  PRO A CG  1 
ATOM   321  C CD  . PRO A 1 38  ? 17.478  13.025  34.906  1.00 92.55  ? 39  PRO A CD  1 
ATOM   322  N N   . GLY A 1 39  ? 16.911  12.908  39.572  1.00 97.72  ? 40  GLY A N   1 
ATOM   323  C CA  . GLY A 1 39  ? 17.577  12.531  40.808  1.00 100.12 ? 40  GLY A CA  1 
ATOM   324  C C   . GLY A 1 39  ? 18.244  13.660  41.565  1.00 99.87  ? 40  GLY A C   1 
ATOM   325  O O   . GLY A 1 39  ? 18.418  13.587  42.786  1.00 96.90  ? 40  GLY A O   1 
ATOM   326  N N   . GLU A 1 40  ? 18.619  14.709  40.846  1.00 99.21  ? 41  GLU A N   1 
ATOM   327  C CA  . GLU A 1 40  ? 19.282  15.839  41.473  1.00 99.15  ? 41  GLU A CA  1 
ATOM   328  C C   . GLU A 1 40  ? 18.517  17.122  41.199  1.00 97.09  ? 41  GLU A C   1 
ATOM   329  O O   . GLU A 1 40  ? 17.529  17.126  40.460  1.00 96.10  ? 41  GLU A O   1 
ATOM   330  C CB  . GLU A 1 40  ? 20.706  15.958  40.934  1.00 100.43 ? 41  GLU A CB  1 
ATOM   331  C CG  . GLU A 1 40  ? 21.341  14.617  40.612  1.00 104.48 ? 41  GLU A CG  1 
ATOM   332  C CD  . GLU A 1 40  ? 22.789  14.742  40.192  1.00 109.19 ? 41  GLU A CD  1 
ATOM   333  O OE1 . GLU A 1 40  ? 23.643  15.001  41.067  1.00 110.64 ? 41  GLU A OE1 1 
ATOM   334  O OE2 . GLU A 1 40  ? 23.071  14.589  38.985  1.00 111.99 ? 41  GLU A OE2 1 
ATOM   335  N N   . GLY A 1 41  ? 18.978  18.211  41.805  1.00 93.32  ? 42  GLY A N   1 
ATOM   336  C CA  . GLY A 1 41  ? 18.330  19.491  41.599  1.00 87.74  ? 42  GLY A CA  1 
ATOM   337  C C   . GLY A 1 41  ? 18.767  20.123  40.290  1.00 82.13  ? 42  GLY A C   1 
ATOM   338  O O   . GLY A 1 41  ? 19.628  19.582  39.592  1.00 80.70  ? 42  GLY A O   1 
ATOM   339  N N   . PRO A 1 42  ? 18.177  21.265  39.916  1.00 75.91  ? 43  PRO A N   1 
ATOM   340  C CA  . PRO A 1 42  ? 18.546  21.940  38.668  1.00 73.45  ? 43  PRO A CA  1 
ATOM   341  C C   . PRO A 1 42  ? 19.922  22.602  38.786  1.00 72.16  ? 43  PRO A C   1 
ATOM   342  O O   . PRO A 1 42  ? 20.426  22.819  39.892  1.00 69.74  ? 43  PRO A O   1 
ATOM   343  C CB  . PRO A 1 42  ? 17.432  22.970  38.491  1.00 71.88  ? 43  PRO A CB  1 
ATOM   344  C CG  . PRO A 1 42  ? 16.274  22.372  39.242  1.00 73.48  ? 43  PRO A CG  1 
ATOM   345  C CD  . PRO A 1 42  ? 16.940  21.834  40.473  1.00 70.79  ? 43  PRO A CD  1 
ATOM   346  N N   . ALA A 1 43  ? 20.529  22.922  37.648  1.00 68.39  ? 44  ALA A N   1 
ATOM   347  C CA  . ALA A 1 43  ? 21.837  23.568  37.655  1.00 69.43  ? 44  ALA A CA  1 
ATOM   348  C C   . ALA A 1 43  ? 21.978  24.522  36.477  1.00 66.53  ? 44  ALA A C   1 
ATOM   349  O O   . ALA A 1 43  ? 21.510  24.241  35.376  1.00 67.46  ? 44  ALA A O   1 
ATOM   350  C CB  . ALA A 1 43  ? 22.936  22.524  37.622  1.00 68.75  ? 44  ALA A CB  1 
ATOM   351  N N   . LEU A 1 44  ? 22.629  25.652  36.717  1.00 64.14  ? 45  LEU A N   1 
ATOM   352  C CA  . LEU A 1 44  ? 22.817  26.657  35.678  1.00 65.95  ? 45  LEU A CA  1 
ATOM   353  C C   . LEU A 1 44  ? 23.704  26.190  34.527  1.00 65.60  ? 45  LEU A C   1 
ATOM   354  O O   . LEU A 1 44  ? 24.862  25.821  34.735  1.00 64.54  ? 45  LEU A O   1 
ATOM   355  C CB  . LEU A 1 44  ? 23.417  27.922  36.288  1.00 65.21  ? 45  LEU A CB  1 
ATOM   356  C CG  . LEU A 1 44  ? 23.636  29.075  35.309  1.00 66.84  ? 45  LEU A CG  1 
ATOM   357  C CD1 . LEU A 1 44  ? 22.288  29.568  34.785  1.00 67.76  ? 45  LEU A CD1 1 
ATOM   358  C CD2 . LEU A 1 44  ? 24.379  30.194  36.009  1.00 65.32  ? 45  LEU A CD2 1 
ATOM   359  N N   . LEU A 1 45  ? 23.159  26.223  33.314  1.00 63.71  ? 46  LEU A N   1 
ATOM   360  C CA  . LEU A 1 45  ? 23.903  25.824  32.123  1.00 63.95  ? 46  LEU A CA  1 
ATOM   361  C C   . LEU A 1 45  ? 24.464  27.051  31.399  1.00 65.67  ? 46  LEU A C   1 
ATOM   362  O O   . LEU A 1 45  ? 25.678  27.245  31.337  1.00 65.61  ? 46  LEU A O   1 
ATOM   363  C CB  . LEU A 1 45  ? 23.000  25.047  31.164  1.00 63.25  ? 46  LEU A CB  1 
ATOM   364  C CG  . LEU A 1 45  ? 23.712  24.508  29.919  1.00 63.14  ? 46  LEU A CG  1 
ATOM   365  C CD1 . LEU A 1 45  ? 24.682  23.409  30.338  1.00 55.81  ? 46  LEU A CD1 1 
ATOM   366  C CD2 . LEU A 1 45  ? 22.696  23.979  28.918  1.00 59.06  ? 46  LEU A CD2 1 
ATOM   367  N N   . ILE A 1 46  ? 23.572  27.866  30.842  1.00 64.79  ? 47  ILE A N   1 
ATOM   368  C CA  . ILE A 1 46  ? 23.966  29.080  30.130  1.00 69.08  ? 47  ILE A CA  1 
ATOM   369  C C   . ILE A 1 46  ? 23.026  30.249  30.447  1.00 69.20  ? 47  ILE A C   1 
ATOM   370  O O   . ILE A 1 46  ? 21.810  30.073  30.523  1.00 72.28  ? 47  ILE A O   1 
ATOM   371  C CB  . ILE A 1 46  ? 23.988  28.847  28.597  1.00 67.63  ? 47  ILE A CB  1 
ATOM   372  C CG1 . ILE A 1 46  ? 25.394  28.460  28.152  1.00 76.35  ? 47  ILE A CG1 1 
ATOM   373  C CG2 . ILE A 1 46  ? 23.583  30.100  27.856  1.00 72.10  ? 47  ILE A CG2 1 
ATOM   374  C CD1 . ILE A 1 46  ? 25.580  28.482  26.633  1.00 85.06  ? 47  ILE A CD1 1 
ATOM   375  N N   . SER A 1 47  ? 23.592  31.439  30.628  1.00 65.41  ? 48  SER A N   1 
ATOM   376  C CA  . SER A 1 47  ? 22.796  32.627  30.928  1.00 64.81  ? 48  SER A CA  1 
ATOM   377  C C   . SER A 1 47  ? 23.123  33.793  30.000  1.00 64.34  ? 48  SER A C   1 
ATOM   378  O O   . SER A 1 47  ? 24.265  33.959  29.570  1.00 65.13  ? 48  SER A O   1 
ATOM   379  C CB  . SER A 1 47  ? 23.010  33.056  32.381  1.00 63.01  ? 48  SER A CB  1 
ATOM   380  O OG  . SER A 1 47  ? 24.379  33.294  32.655  1.00 65.10  ? 48  SER A OG  1 
ATOM   381  N N   . ILE A 1 48  ? 22.114  34.604  29.696  1.00 64.95  ? 49  ILE A N   1 
ATOM   382  C CA  . ILE A 1 48  ? 22.304  35.756  28.818  1.00 60.06  ? 49  ILE A CA  1 
ATOM   383  C C   . ILE A 1 48  ? 21.658  37.038  29.368  1.00 61.06  ? 49  ILE A C   1 
ATOM   384  O O   . ILE A 1 48  ? 20.731  36.985  30.178  1.00 61.37  ? 49  ILE A O   1 
ATOM   385  C CB  . ILE A 1 48  ? 21.720  35.478  27.414  1.00 52.85  ? 49  ILE A CB  1 
ATOM   386  C CG1 . ILE A 1 48  ? 22.206  36.551  26.426  1.00 49.55  ? 49  ILE A CG1 1 
ATOM   387  C CG2 . ILE A 1 48  ? 20.188  35.451  27.484  1.00 46.66  ? 49  ILE A CG2 1 
ATOM   388  C CD1 . ILE A 1 48  ? 21.762  36.326  24.985  1.00 45.57  ? 49  ILE A CD1 1 
ATOM   389  N N   . LEU A 1 49  ? 22.168  38.185  28.920  1.00 61.23  ? 50  LEU A N   1 
ATOM   390  C CA  . LEU A 1 49  ? 21.654  39.496  29.313  1.00 51.83  ? 50  LEU A CA  1 
ATOM   391  C C   . LEU A 1 49  ? 20.856  40.075  28.152  1.00 54.55  ? 50  LEU A C   1 
ATOM   392  O O   . LEU A 1 49  ? 21.156  39.804  26.987  1.00 53.82  ? 50  LEU A O   1 
ATOM   393  C CB  . LEU A 1 49  ? 22.806  40.430  29.644  1.00 50.24  ? 50  LEU A CB  1 
ATOM   394  C CG  . LEU A 1 49  ? 23.528  40.109  30.942  1.00 53.21  ? 50  LEU A CG  1 
ATOM   395  C CD1 . LEU A 1 49  ? 24.808  40.906  31.036  1.00 52.39  ? 50  LEU A CD1 1 
ATOM   396  C CD2 . LEU A 1 49  ? 22.613  40.427  32.098  1.00 53.26  ? 50  LEU A CD2 1 
ATOM   397  N N   . SER A 1 50  ? 19.842  40.873  28.463  1.00 55.53  ? 51  SER A N   1 
ATOM   398  C CA  . SER A 1 50  ? 19.015  41.469  27.422  1.00 58.45  ? 51  SER A CA  1 
ATOM   399  C C   . SER A 1 50  ? 19.831  42.385  26.509  1.00 62.31  ? 51  SER A C   1 
ATOM   400  O O   . SER A 1 50  ? 19.385  42.747  25.416  1.00 60.61  ? 51  SER A O   1 
ATOM   401  C CB  . SER A 1 50  ? 17.846  42.246  28.051  1.00 60.32  ? 51  SER A CB  1 
ATOM   402  O OG  . SER A 1 50  ? 18.288  43.197  29.007  1.00 60.72  ? 51  SER A OG  1 
ATOM   403  N N   . VAL A 1 51  ? 21.031  42.748  26.959  1.00 65.31  ? 52  VAL A N   1 
ATOM   404  C CA  . VAL A 1 51  ? 21.910  43.623  26.192  1.00 72.18  ? 52  VAL A CA  1 
ATOM   405  C C   . VAL A 1 51  ? 22.254  43.022  24.836  1.00 76.54  ? 52  VAL A C   1 
ATOM   406  O O   . VAL A 1 51  ? 22.131  43.683  23.805  1.00 77.56  ? 52  VAL A O   1 
ATOM   407  C CB  . VAL A 1 51  ? 23.228  43.892  26.946  1.00 74.71  ? 52  VAL A CB  1 
ATOM   408  C CG1 . VAL A 1 51  ? 24.158  44.723  26.077  1.00 78.12  ? 52  VAL A CG1 1 
ATOM   409  C CG2 . VAL A 1 51  ? 22.944  44.611  28.251  1.00 77.37  ? 52  VAL A CG2 1 
ATOM   410  N N   . SER A 1 52  ? 22.692  41.767  24.844  1.00 79.56  ? 53  SER A N   1 
ATOM   411  C CA  . SER A 1 52  ? 23.056  41.082  23.613  1.00 80.54  ? 53  SER A CA  1 
ATOM   412  C C   . SER A 1 52  ? 21.849  40.376  23.022  1.00 80.38  ? 53  SER A C   1 
ATOM   413  O O   . SER A 1 52  ? 20.735  40.508  23.526  1.00 78.83  ? 53  SER A O   1 
ATOM   414  C CB  . SER A 1 52  ? 24.171  40.066  23.875  1.00 76.29  ? 53  SER A CB  1 
ATOM   415  O OG  . SER A 1 52  ? 23.766  39.112  24.835  1.00 78.29  ? 53  SER A OG  1 
ATOM   416  N N   . ASP A 1 53  ? 22.084  39.628  21.950  1.00 83.31  ? 54  ASP A N   1 
ATOM   417  C CA  . ASP A 1 53  ? 21.026  38.896  21.267  1.00 80.59  ? 54  ASP A CA  1 
ATOM   418  C C   . ASP A 1 53  ? 21.483  37.472  20.983  1.00 77.69  ? 54  ASP A C   1 
ATOM   419  O O   . ASP A 1 53  ? 20.794  36.712  20.309  1.00 74.87  ? 54  ASP A O   1 
ATOM   420  C CB  . ASP A 1 53  ? 20.672  39.598  19.954  1.00 84.52  ? 54  ASP A CB  1 
ATOM   421  C CG  . ASP A 1 53  ? 21.838  39.632  18.977  1.00 88.96  ? 54  ASP A CG  1 
ATOM   422  O OD1 . ASP A 1 53  ? 22.965  39.974  19.400  1.00 93.19  ? 54  ASP A OD1 1 
ATOM   423  O OD2 . ASP A 1 53  ? 21.626  39.326  17.784  1.00 86.71  ? 54  ASP A OD2 1 
ATOM   424  N N   . LYS A 1 54  ? 22.650  37.115  21.509  1.00 76.20  ? 55  LYS A N   1 
ATOM   425  C CA  . LYS A 1 54  ? 23.197  35.782  21.301  1.00 79.46  ? 55  LYS A CA  1 
ATOM   426  C C   . LYS A 1 54  ? 24.271  35.474  22.340  1.00 77.64  ? 55  LYS A C   1 
ATOM   427  O O   . LYS A 1 54  ? 24.930  36.375  22.856  1.00 79.23  ? 55  LYS A O   1 
ATOM   428  C CB  . LYS A 1 54  ? 23.784  35.683  19.888  1.00 83.88  ? 55  LYS A CB  1 
ATOM   429  C CG  . LYS A 1 54  ? 24.247  34.294  19.471  1.00 88.39  ? 55  LYS A CG  1 
ATOM   430  C CD  . LYS A 1 54  ? 24.765  34.310  18.033  1.00 95.54  ? 55  LYS A CD  1 
ATOM   431  C CE  . LYS A 1 54  ? 25.117  32.913  17.538  1.00 97.21  ? 55  LYS A CE  1 
ATOM   432  N NZ  . LYS A 1 54  ? 25.584  32.921  16.120  1.00 99.97  ? 55  LYS A NZ  1 
ATOM   433  N N   . LYS A 1 55  ? 24.437  34.194  22.643  1.00 75.11  ? 56  LYS A N   1 
ATOM   434  C CA  . LYS A 1 55  ? 25.423  33.755  23.618  1.00 76.67  ? 56  LYS A CA  1 
ATOM   435  C C   . LYS A 1 55  ? 25.756  32.303  23.314  1.00 80.81  ? 56  LYS A C   1 
ATOM   436  O O   . LYS A 1 55  ? 24.864  31.457  23.261  1.00 83.83  ? 56  LYS A O   1 
ATOM   437  C CB  . LYS A 1 55  ? 24.846  33.874  25.028  1.00 75.02  ? 56  LYS A CB  1 
ATOM   438  C CG  . LYS A 1 55  ? 25.719  33.288  26.127  1.00 75.60  ? 56  LYS A CG  1 
ATOM   439  C CD  . LYS A 1 55  ? 26.948  34.135  26.394  1.00 75.50  ? 56  LYS A CD  1 
ATOM   440  C CE  . LYS A 1 55  ? 27.805  33.507  27.477  1.00 74.33  ? 56  LYS A CE  1 
ATOM   441  N NZ  . LYS A 1 55  ? 27.031  33.274  28.730  1.00 78.26  ? 56  LYS A NZ  1 
ATOM   442  N N   . GLU A 1 56  ? 27.038  32.016  23.110  1.00 83.65  ? 57  GLU A N   1 
ATOM   443  C CA  . GLU A 1 56  ? 27.478  30.659  22.799  1.00 82.46  ? 57  GLU A CA  1 
ATOM   444  C C   . GLU A 1 56  ? 28.448  30.096  23.826  1.00 77.66  ? 57  GLU A C   1 
ATOM   445  O O   . GLU A 1 56  ? 29.178  30.836  24.482  1.00 71.03  ? 57  GLU A O   1 
ATOM   446  C CB  . GLU A 1 56  ? 28.154  30.616  21.424  1.00 89.28  ? 57  GLU A CB  1 
ATOM   447  C CG  . GLU A 1 56  ? 27.264  30.995  20.248  1.00 100.55 ? 57  GLU A CG  1 
ATOM   448  C CD  . GLU A 1 56  ? 27.908  30.674  18.904  1.00 108.63 ? 57  GLU A CD  1 
ATOM   449  O OE1 . GLU A 1 56  ? 28.996  31.221  18.617  1.00 108.97 ? 57  GLU A OE1 1 
ATOM   450  O OE2 . GLU A 1 56  ? 27.325  29.873  18.136  1.00 108.39 ? 57  GLU A OE2 1 
ATOM   451  N N   . ASP A 1 57  ? 28.444  28.774  23.951  1.00 77.83  ? 58  ASP A N   1 
ATOM   452  C CA  . ASP A 1 57  ? 29.341  28.067  24.857  1.00 82.54  ? 58  ASP A CA  1 
ATOM   453  C C   . ASP A 1 57  ? 29.191  26.575  24.609  1.00 82.95  ? 58  ASP A C   1 
ATOM   454  O O   . ASP A 1 57  ? 28.398  25.894  25.262  1.00 84.65  ? 58  ASP A O   1 
ATOM   455  C CB  . ASP A 1 57  ? 29.035  28.408  26.319  1.00 85.32  ? 58  ASP A CB  1 
ATOM   456  C CG  . ASP A 1 57  ? 29.985  27.721  27.290  1.00 89.78  ? 58  ASP A CG  1 
ATOM   457  O OD1 . ASP A 1 57  ? 31.165  27.507  26.932  1.00 93.93  ? 58  ASP A OD1 1 
ATOM   458  O OD2 . ASP A 1 57  ? 29.557  27.405  28.420  1.00 93.16  ? 58  ASP A OD2 1 
ATOM   459  N N   . GLY A 1 58  ? 29.966  26.080  23.648  1.00 80.66  ? 59  GLY A N   1 
ATOM   460  C CA  . GLY A 1 58  ? 29.907  24.680  23.284  1.00 75.85  ? 59  GLY A CA  1 
ATOM   461  C C   . GLY A 1 58  ? 28.804  24.515  22.258  1.00 78.19  ? 59  GLY A C   1 
ATOM   462  O O   . GLY A 1 58  ? 28.655  25.343  21.350  1.00 73.66  ? 59  GLY A O   1 
ATOM   463  N N   . ARG A 1 59  ? 28.025  23.450  22.398  1.00 77.29  ? 61  ARG A N   1 
ATOM   464  C CA  . ARG A 1 59  ? 26.921  23.203  21.481  1.00 77.38  ? 61  ARG A CA  1 
ATOM   465  C C   . ARG A 1 59  ? 25.777  24.157  21.837  1.00 76.65  ? 61  ARG A C   1 
ATOM   466  O O   . ARG A 1 59  ? 24.910  24.441  21.011  1.00 74.08  ? 61  ARG A O   1 
ATOM   467  C CB  . ARG A 1 59  ? 26.431  21.752  21.609  1.00 81.22  ? 61  ARG A CB  1 
ATOM   468  C CG  . ARG A 1 59  ? 27.492  20.677  21.375  1.00 78.07  ? 61  ARG A CG  1 
ATOM   469  C CD  . ARG A 1 59  ? 26.885  19.270  21.391  1.00 73.06  ? 61  ARG A CD  1 
ATOM   470  N NE  . ARG A 1 59  ? 26.409  18.850  22.711  1.00 69.83  ? 61  ARG A NE  1 
ATOM   471  C CZ  . ARG A 1 59  ? 27.203  18.590  23.752  1.00 70.18  ? 61  ARG A CZ  1 
ATOM   472  N NH1 . ARG A 1 59  ? 28.520  18.704  23.638  1.00 66.66  ? 61  ARG A NH1 1 
ATOM   473  N NH2 . ARG A 1 59  ? 26.682  18.208  24.911  1.00 60.92  ? 61  ARG A NH2 1 
ATOM   474  N N   . PHE A 1 60  ? 25.803  24.661  23.069  1.00 74.58  ? 62  PHE A N   1 
ATOM   475  C CA  . PHE A 1 60  ? 24.761  25.547  23.585  1.00 73.36  ? 62  PHE A CA  1 
ATOM   476  C C   . PHE A 1 60  ? 24.822  27.020  23.178  1.00 68.82  ? 62  PHE A C   1 
ATOM   477  O O   . PHE A 1 60  ? 25.813  27.715  23.412  1.00 63.05  ? 62  PHE A O   1 
ATOM   478  C CB  . PHE A 1 60  ? 24.727  25.432  25.107  1.00 77.25  ? 62  PHE A CB  1 
ATOM   479  C CG  . PHE A 1 60  ? 24.713  24.013  25.600  1.00 80.61  ? 62  PHE A CG  1 
ATOM   480  C CD1 . PHE A 1 60  ? 23.709  23.136  25.204  1.00 82.11  ? 62  PHE A CD1 1 
ATOM   481  C CD2 . PHE A 1 60  ? 25.712  23.547  26.449  1.00 82.31  ? 62  PHE A CD2 1 
ATOM   482  C CE1 . PHE A 1 60  ? 23.700  21.814  25.646  1.00 84.16  ? 62  PHE A CE1 1 
ATOM   483  C CE2 . PHE A 1 60  ? 25.712  22.228  26.897  1.00 81.32  ? 62  PHE A CE2 1 
ATOM   484  C CZ  . PHE A 1 60  ? 24.705  21.360  26.494  1.00 83.36  ? 62  PHE A CZ  1 
ATOM   485  N N   . THR A 1 61  ? 23.720  27.481  22.591  1.00 67.29  ? 63  THR A N   1 
ATOM   486  C CA  . THR A 1 61  ? 23.582  28.853  22.118  1.00 68.35  ? 63  THR A CA  1 
ATOM   487  C C   . THR A 1 61  ? 22.193  29.431  22.400  1.00 65.04  ? 63  THR A C   1 
ATOM   488  O O   . THR A 1 61  ? 21.188  28.875  21.960  1.00 67.59  ? 63  THR A O   1 
ATOM   489  C CB  . THR A 1 61  ? 23.825  28.933  20.588  1.00 68.35  ? 63  THR A CB  1 
ATOM   490  O OG1 . THR A 1 61  ? 25.166  28.524  20.292  1.00 67.38  ? 63  THR A OG1 1 
ATOM   491  C CG2 . THR A 1 61  ? 23.605  30.355  20.080  1.00 63.37  ? 63  THR A CG2 1 
ATOM   492  N N   . ILE A 1 62  ? 22.136  30.546  23.125  1.00 60.24  ? 64  ILE A N   1 
ATOM   493  C CA  . ILE A 1 62  ? 20.859  31.189  23.411  1.00 61.20  ? 64  ILE A CA  1 
ATOM   494  C C   . ILE A 1 62  ? 20.584  32.260  22.362  1.00 63.77  ? 64  ILE A C   1 
ATOM   495  O O   . ILE A 1 62  ? 21.453  33.069  22.049  1.00 66.14  ? 64  ILE A O   1 
ATOM   496  C CB  . ILE A 1 62  ? 20.846  31.907  24.772  1.00 62.25  ? 64  ILE A CB  1 
ATOM   497  C CG1 . ILE A 1 62  ? 21.053  30.917  25.913  1.00 57.14  ? 64  ILE A CG1 1 
ATOM   498  C CG2 . ILE A 1 62  ? 19.519  32.642  24.947  1.00 57.68  ? 64  ILE A CG2 1 
ATOM   499  C CD1 . ILE A 1 62  ? 20.941  31.571  27.274  1.00 53.39  ? 64  ILE A CD1 1 
ATOM   500  N N   . PHE A 1 63  ? 19.371  32.266  21.828  1.00 68.75  ? 65  PHE A N   1 
ATOM   501  C CA  . PHE A 1 63  ? 18.970  33.259  20.835  1.00 77.45  ? 65  PHE A CA  1 
ATOM   502  C C   . PHE A 1 63  ? 17.944  34.184  21.496  1.00 75.72  ? 65  PHE A C   1 
ATOM   503  O O   . PHE A 1 63  ? 16.774  33.823  21.623  1.00 73.40  ? 65  PHE A O   1 
ATOM   504  C CB  . PHE A 1 63  ? 18.340  32.574  19.609  1.00 83.63  ? 65  PHE A CB  1 
ATOM   505  C CG  . PHE A 1 63  ? 19.343  32.071  18.589  1.00 90.97  ? 65  PHE A CG  1 
ATOM   506  C CD1 . PHE A 1 63  ? 20.378  31.214  18.956  1.00 92.26  ? 65  PHE A CD1 1 
ATOM   507  C CD2 . PHE A 1 63  ? 19.230  32.442  17.248  1.00 93.19  ? 65  PHE A CD2 1 
ATOM   508  C CE1 . PHE A 1 63  ? 21.284  30.737  18.001  1.00 93.39  ? 65  PHE A CE1 1 
ATOM   509  C CE2 . PHE A 1 63  ? 20.131  31.969  16.290  1.00 93.63  ? 65  PHE A CE2 1 
ATOM   510  C CZ  . PHE A 1 63  ? 21.159  31.116  16.668  1.00 90.45  ? 65  PHE A CZ  1 
ATOM   511  N N   . PHE A 1 64  ? 18.386  35.368  21.919  1.00 78.92  ? 66  PHE A N   1 
ATOM   512  C CA  . PHE A 1 64  ? 17.501  36.334  22.578  1.00 79.89  ? 66  PHE A CA  1 
ATOM   513  C C   . PHE A 1 64  ? 16.937  37.400  21.632  1.00 80.32  ? 66  PHE A C   1 
ATOM   514  O O   . PHE A 1 64  ? 17.683  38.159  21.011  1.00 81.69  ? 66  PHE A O   1 
ATOM   515  C CB  . PHE A 1 64  ? 18.232  37.030  23.734  1.00 77.35  ? 66  PHE A CB  1 
ATOM   516  C CG  . PHE A 1 64  ? 17.354  37.955  24.531  1.00 77.84  ? 66  PHE A CG  1 
ATOM   517  C CD1 . PHE A 1 64  ? 16.503  37.455  25.509  1.00 79.73  ? 66  PHE A CD1 1 
ATOM   518  C CD2 . PHE A 1 64  ? 17.338  39.323  24.266  1.00 75.80  ? 66  PHE A CD2 1 
ATOM   519  C CE1 . PHE A 1 64  ? 15.644  38.301  26.208  1.00 79.42  ? 66  PHE A CE1 1 
ATOM   520  C CE2 . PHE A 1 64  ? 16.484  40.178  24.959  1.00 73.77  ? 66  PHE A CE2 1 
ATOM   521  C CZ  . PHE A 1 64  ? 15.635  39.666  25.931  1.00 76.38  ? 66  PHE A CZ  1 
ATOM   522  N N   . ASN A 1 65  ? 15.612  37.458  21.544  1.00 83.65  ? 67  ASN A N   1 
ATOM   523  C CA  . ASN A 1 65  ? 14.929  38.419  20.685  1.00 85.84  ? 67  ASN A CA  1 
ATOM   524  C C   . ASN A 1 65  ? 14.224  39.471  21.538  1.00 86.32  ? 67  ASN A C   1 
ATOM   525  O O   . ASN A 1 65  ? 13.041  39.339  21.840  1.00 86.37  ? 67  ASN A O   1 
ATOM   526  C CB  . ASN A 1 65  ? 13.901  37.695  19.813  1.00 87.05  ? 67  ASN A CB  1 
ATOM   527  C CG  . ASN A 1 65  ? 13.310  38.590  18.746  1.00 92.37  ? 67  ASN A CG  1 
ATOM   528  O OD1 . ASN A 1 65  ? 12.405  38.186  18.014  1.00 96.28  ? 67  ASN A OD1 1 
ATOM   529  N ND2 . ASN A 1 65  ? 13.824  39.812  18.644  1.00 91.27  ? 67  ASN A ND2 1 
ATOM   530  N N   . LYS A 1 66  ? 14.961  40.512  21.915  1.00 87.52  ? 68  LYS A N   1 
ATOM   531  C CA  . LYS A 1 66  ? 14.440  41.597  22.744  1.00 85.91  ? 68  LYS A CA  1 
ATOM   532  C C   . LYS A 1 66  ? 12.947  41.865  22.588  1.00 88.78  ? 68  LYS A C   1 
ATOM   533  O O   . LYS A 1 66  ? 12.180  41.647  23.523  1.00 90.32  ? 68  LYS A O   1 
ATOM   534  C CB  . LYS A 1 66  ? 15.213  42.880  22.461  1.00 85.80  ? 68  LYS A CB  1 
ATOM   535  C CG  . LYS A 1 66  ? 14.789  44.051  23.324  1.00 84.59  ? 68  LYS A CG  1 
ATOM   536  C CD  . LYS A 1 66  ? 14.979  43.750  24.796  1.00 75.49  ? 68  LYS A CD  1 
ATOM   537  C CE  . LYS A 1 66  ? 14.774  45.007  25.603  1.00 76.15  ? 68  LYS A CE  1 
ATOM   538  N NZ  . LYS A 1 66  ? 15.657  46.095  25.100  1.00 74.06  ? 68  LYS A NZ  1 
ATOM   539  N N   . ARG A 1 67  ? 12.536  42.359  21.423  1.00 90.32  ? 69  ARG A N   1 
ATOM   540  C CA  . ARG A 1 67  ? 11.121  42.630  21.186  1.00 92.93  ? 69  ARG A CA  1 
ATOM   541  C C   . ARG A 1 67  ? 10.415  41.318  20.890  1.00 94.69  ? 69  ARG A C   1 
ATOM   542  O O   . ARG A 1 67  ? 11.062  40.329  20.546  1.00 98.65  ? 69  ARG A O   1 
ATOM   543  C CB  . ARG A 1 67  ? 10.944  43.623  20.034  1.00 95.77  ? 69  ARG A CB  1 
ATOM   544  C CG  . ARG A 1 67  ? 11.762  43.331  18.792  1.00 99.36  ? 69  ARG A CG  1 
ATOM   545  C CD  . ARG A 1 67  ? 11.854  44.579  17.923  1.00 102.12 ? 69  ARG A CD  1 
ATOM   546  N NE  . ARG A 1 67  ? 10.540  45.065  17.505  1.00 106.18 ? 69  ARG A NE  1 
ATOM   547  C CZ  . ARG A 1 67  ? 10.319  46.256  16.953  1.00 106.75 ? 69  ARG A CZ  1 
ATOM   548  N NH1 . ARG A 1 67  ? 11.326  47.096  16.752  1.00 106.61 ? 69  ARG A NH1 1 
ATOM   549  N NH2 . ARG A 1 67  ? 9.090   46.608  16.598  1.00 104.75 ? 69  ARG A NH2 1 
ATOM   550  N N   . GLU A 1 68  ? 9.094   41.303  21.024  1.00 95.09  ? 70  GLU A N   1 
ATOM   551  C CA  . GLU A 1 68  ? 8.323   40.079  20.813  1.00 97.09  ? 70  GLU A CA  1 
ATOM   552  C C   . GLU A 1 68  ? 8.569   39.171  22.020  1.00 94.44  ? 70  GLU A C   1 
ATOM   553  O O   . GLU A 1 68  ? 7.947   38.118  22.165  1.00 94.60  ? 70  GLU A O   1 
ATOM   554  C CB  . GLU A 1 68  ? 8.752   39.368  19.523  1.00 100.26 ? 70  GLU A CB  1 
ATOM   555  C CG  . GLU A 1 68  ? 8.214   39.992  18.240  1.00 108.99 ? 70  GLU A CG  1 
ATOM   556  C CD  . GLU A 1 68  ? 8.763   39.324  16.984  1.00 114.44 ? 70  GLU A CD  1 
ATOM   557  O OE1 . GLU A 1 68  ? 9.945   39.558  16.649  1.00 113.59 ? 70  GLU A OE1 1 
ATOM   558  O OE2 . GLU A 1 68  ? 8.016   38.558  16.335  1.00 117.47 ? 70  GLU A OE2 1 
ATOM   559  N N   . LYS A 1 69  ? 9.488   39.604  22.881  1.00 89.79  ? 71  LYS A N   1 
ATOM   560  C CA  . LYS A 1 69  ? 9.851   38.889  24.102  1.00 83.73  ? 71  LYS A CA  1 
ATOM   561  C C   . LYS A 1 69  ? 9.983   37.383  23.923  1.00 80.55  ? 71  LYS A C   1 
ATOM   562  O O   . LYS A 1 69  ? 9.449   36.601  24.711  1.00 79.56  ? 71  LYS A O   1 
ATOM   563  C CB  . LYS A 1 69  ? 8.832   39.200  25.193  1.00 83.41  ? 71  LYS A CB  1 
ATOM   564  C CG  . LYS A 1 69  ? 8.616   40.688  25.409  1.00 83.19  ? 71  LYS A CG  1 
ATOM   565  C CD  . LYS A 1 69  ? 7.388   40.947  26.260  1.00 87.69  ? 71  LYS A CD  1 
ATOM   566  C CE  . LYS A 1 69  ? 7.040   42.426  26.306  1.00 92.90  ? 71  LYS A CE  1 
ATOM   567  N NZ  . LYS A 1 69  ? 5.761   42.673  27.038  1.00 97.67  ? 71  LYS A NZ  1 
ATOM   568  N N   . LYS A 1 70  ? 10.699  36.988  22.876  1.00 81.59  ? 72  LYS A N   1 
ATOM   569  C CA  . LYS A 1 70  ? 10.941  35.582  22.573  1.00 80.94  ? 72  LYS A CA  1 
ATOM   570  C C   . LYS A 1 70  ? 12.362  35.247  23.030  1.00 78.52  ? 72  LYS A C   1 
ATOM   571  O O   . LYS A 1 70  ? 13.150  36.138  23.345  1.00 76.67  ? 72  LYS A O   1 
ATOM   572  C CB  . LYS A 1 70  ? 10.814  35.319  21.066  1.00 86.90  ? 72  LYS A CB  1 
ATOM   573  C CG  . LYS A 1 70  ? 9.423   35.527  20.465  1.00 85.49  ? 72  LYS A CG  1 
ATOM   574  C CD  . LYS A 1 70  ? 9.479   35.381  18.936  1.00 90.16  ? 72  LYS A CD  1 
ATOM   575  C CE  . LYS A 1 70  ? 8.121   35.608  18.269  1.00 89.54  ? 72  LYS A CE  1 
ATOM   576  N NZ  . LYS A 1 70  ? 7.103   34.587  18.658  1.00 89.61  ? 72  LYS A NZ  1 
ATOM   577  N N   . LEU A 1 71  ? 12.693  33.964  23.042  1.00 73.92  ? 73  LEU A N   1 
ATOM   578  C CA  . LEU A 1 71  ? 14.005  33.522  23.487  1.00 69.11  ? 73  LEU A CA  1 
ATOM   579  C C   . LEU A 1 71  ? 14.082  32.028  23.185  1.00 72.94  ? 73  LEU A C   1 
ATOM   580  O O   . LEU A 1 71  ? 13.074  31.327  23.287  1.00 75.79  ? 73  LEU A O   1 
ATOM   581  C CB  . LEU A 1 71  ? 14.121  33.776  24.992  1.00 64.33  ? 73  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 71  ? 15.305  33.237  25.794  1.00 68.98  ? 73  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 71  ? 16.571  33.935  25.362  1.00 74.74  ? 73  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 71  ? 15.065  33.465  27.276  1.00 60.28  ? 73  LEU A CD2 1 
ATOM   585  N N   . SER A 1 72  ? 15.257  31.534  22.805  1.00 72.77  ? 74  SER A N   1 
ATOM   586  C CA  . SER A 1 72  ? 15.394  30.110  22.507  1.00 73.72  ? 74  SER A CA  1 
ATOM   587  C C   . SER A 1 72  ? 16.799  29.560  22.731  1.00 71.46  ? 74  SER A C   1 
ATOM   588  O O   . SER A 1 72  ? 17.795  30.242  22.493  1.00 75.77  ? 74  SER A O   1 
ATOM   589  C CB  . SER A 1 72  ? 14.955  29.824  21.066  1.00 74.19  ? 74  SER A CB  1 
ATOM   590  O OG  . SER A 1 72  ? 15.873  30.353  20.129  1.00 77.40  ? 74  SER A OG  1 
ATOM   591  N N   . LEU A 1 73  ? 16.866  28.318  23.197  1.00 69.05  ? 75  LEU A N   1 
ATOM   592  C CA  . LEU A 1 73  ? 18.135  27.648  23.459  1.00 69.25  ? 75  LEU A CA  1 
ATOM   593  C C   . LEU A 1 73  ? 18.399  26.537  22.436  1.00 77.62  ? 75  LEU A C   1 
ATOM   594  O O   . LEU A 1 73  ? 17.713  25.512  22.442  1.00 82.95  ? 75  LEU A O   1 
ATOM   595  C CB  . LEU A 1 73  ? 18.119  27.045  24.858  1.00 56.00  ? 75  LEU A CB  1 
ATOM   596  C CG  . LEU A 1 73  ? 19.223  26.022  25.108  1.00 53.71  ? 75  LEU A CG  1 
ATOM   597  C CD1 . LEU A 1 73  ? 20.572  26.688  24.920  1.00 56.17  ? 75  LEU A CD1 1 
ATOM   598  C CD2 . LEU A 1 73  ? 19.098  25.450  26.505  1.00 49.30  ? 75  LEU A CD2 1 
ATOM   599  N N   . HIS A 1 74  ? 19.396  26.734  21.572  1.00 78.84  ? 76  HIS A N   1 
ATOM   600  C CA  . HIS A 1 74  ? 19.740  25.748  20.544  1.00 73.91  ? 76  HIS A CA  1 
ATOM   601  C C   . HIS A 1 74  ? 20.898  24.841  20.938  1.00 77.00  ? 76  HIS A C   1 
ATOM   602  O O   . HIS A 1 74  ? 21.986  25.318  21.258  1.00 77.69  ? 76  HIS A O   1 
ATOM   603  C CB  . HIS A 1 74  ? 20.094  26.447  19.230  1.00 65.46  ? 76  HIS A CB  1 
ATOM   604  C CG  . HIS A 1 74  ? 18.981  27.269  18.667  1.00 70.38  ? 76  HIS A CG  1 
ATOM   605  N ND1 . HIS A 1 74  ? 19.050  27.865  17.428  1.00 73.19  ? 76  HIS A ND1 1 
ATOM   606  C CD2 . HIS A 1 74  ? 17.771  27.602  19.177  1.00 74.99  ? 76  HIS A CD2 1 
ATOM   607  C CE1 . HIS A 1 74  ? 17.932  28.531  17.199  1.00 75.92  ? 76  HIS A CE1 1 
ATOM   608  N NE2 . HIS A 1 74  ? 17.139  28.388  18.245  1.00 72.08  ? 76  HIS A NE2 1 
ATOM   609  N N   . ILE A 1 75  ? 20.660  23.532  20.914  1.00 78.25  ? 77  ILE A N   1 
ATOM   610  C CA  . ILE A 1 75  ? 21.703  22.572  21.242  1.00 79.20  ? 77  ILE A CA  1 
ATOM   611  C C   . ILE A 1 75  ? 22.114  21.859  19.965  1.00 81.35  ? 77  ILE A C   1 
ATOM   612  O O   . ILE A 1 75  ? 21.550  20.827  19.610  1.00 82.04  ? 77  ILE A O   1 
ATOM   613  C CB  . ILE A 1 75  ? 21.228  21.528  22.253  1.00 77.53  ? 77  ILE A CB  1 
ATOM   614  C CG1 . ILE A 1 75  ? 20.806  22.223  23.547  1.00 82.54  ? 77  ILE A CG1 1 
ATOM   615  C CG2 . ILE A 1 75  ? 22.346  20.530  22.522  1.00 72.35  ? 77  ILE A CG2 1 
ATOM   616  C CD1 . ILE A 1 75  ? 20.373  21.273  24.651  1.00 87.80  ? 77  ILE A CD1 1 
ATOM   617  N N   . ALA A 1 76  ? 23.093  22.433  19.273  1.00 86.15  ? 78  ALA A N   1 
ATOM   618  C CA  . ALA A 1 76  ? 23.593  21.873  18.026  1.00 87.95  ? 78  ALA A CA  1 
ATOM   619  C C   . ALA A 1 76  ? 24.312  20.565  18.295  1.00 88.91  ? 78  ALA A C   1 
ATOM   620  O O   . ALA A 1 76  ? 24.911  20.374  19.358  1.00 85.72  ? 78  ALA A O   1 
ATOM   621  C CB  . ALA A 1 76  ? 24.541  22.861  17.349  1.00 88.73  ? 78  ALA A CB  1 
ATOM   622  N N   . ASP A 1 77  ? 24.248  19.664  17.324  1.00 90.45  ? 79  ASP A N   1 
ATOM   623  C CA  . ASP A 1 77  ? 24.894  18.372  17.460  1.00 94.19  ? 79  ASP A CA  1 
ATOM   624  C C   . ASP A 1 77  ? 24.451  17.725  18.772  1.00 93.29  ? 79  ASP A C   1 
ATOM   625  O O   . ASP A 1 77  ? 25.226  17.618  19.724  1.00 93.41  ? 79  ASP A O   1 
ATOM   626  C CB  . ASP A 1 77  ? 26.411  18.553  17.436  1.00 97.33  ? 79  ASP A CB  1 
ATOM   627  C CG  . ASP A 1 77  ? 27.147  17.248  17.248  1.00 102.96 ? 79  ASP A CG  1 
ATOM   628  O OD1 . ASP A 1 77  ? 27.071  16.385  18.149  1.00 107.70 ? 79  ASP A OD1 1 
ATOM   629  O OD2 . ASP A 1 77  ? 27.796  17.086  16.193  1.00 104.71 ? 79  ASP A OD2 1 
ATOM   630  N N   . SER A 1 78  ? 23.190  17.304  18.809  1.00 93.54  ? 80  SER A N   1 
ATOM   631  C CA  . SER A 1 78  ? 22.607  16.669  19.984  1.00 94.75  ? 80  SER A CA  1 
ATOM   632  C C   . SER A 1 78  ? 23.524  15.592  20.536  1.00 95.36  ? 80  SER A C   1 
ATOM   633  O O   . SER A 1 78  ? 24.564  15.289  19.951  1.00 98.23  ? 80  SER A O   1 
ATOM   634  C CB  . SER A 1 78  ? 21.249  16.055  19.634  1.00 95.56  ? 80  SER A CB  1 
ATOM   635  O OG  . SER A 1 78  ? 20.353  17.040  19.148  1.00 91.32  ? 80  SER A OG  1 
ATOM   636  N N   . GLN A 1 79  ? 23.130  14.998  21.655  1.00 93.20  ? 81  GLN A N   1 
ATOM   637  C CA  . GLN A 1 79  ? 23.960  13.975  22.263  1.00 95.36  ? 81  GLN A CA  1 
ATOM   638  C C   . GLN A 1 79  ? 23.374  13.396  23.549  1.00 98.80  ? 81  GLN A C   1 
ATOM   639  O O   . GLN A 1 79  ? 23.023  14.134  24.468  1.00 102.73 ? 81  GLN A O   1 
ATOM   640  C CB  . GLN A 1 79  ? 25.343  14.577  22.523  1.00 90.88  ? 81  GLN A CB  1 
ATOM   641  C CG  . GLN A 1 79  ? 26.122  13.971  23.657  1.00 91.50  ? 81  GLN A CG  1 
ATOM   642  C CD  . GLN A 1 79  ? 27.470  14.633  23.814  1.00 94.59  ? 81  GLN A CD  1 
ATOM   643  O OE1 . GLN A 1 79  ? 28.157  14.441  24.818  1.00 98.50  ? 81  GLN A OE1 1 
ATOM   644  N NE2 . GLN A 1 79  ? 27.863  15.416  22.814  1.00 90.03  ? 81  GLN A NE2 1 
ATOM   645  N N   . PRO A 1 80  ? 23.247  12.059  23.625  1.00 100.48 ? 82  PRO A N   1 
ATOM   646  C CA  . PRO A 1 80  ? 22.700  11.435  24.834  1.00 98.66  ? 82  PRO A CA  1 
ATOM   647  C C   . PRO A 1 80  ? 23.610  11.782  26.007  1.00 96.52  ? 82  PRO A C   1 
ATOM   648  O O   . PRO A 1 80  ? 24.782  11.407  26.040  1.00 100.35 ? 82  PRO A O   1 
ATOM   649  C CB  . PRO A 1 80  ? 22.708  9.944   24.491  1.00 100.48 ? 82  PRO A CB  1 
ATOM   650  C CG  . PRO A 1 80  ? 23.860  9.820   23.533  1.00 101.90 ? 82  PRO A CG  1 
ATOM   651  C CD  . PRO A 1 80  ? 23.674  11.036  22.653  1.00 101.43 ? 82  PRO A CD  1 
ATOM   652  N N   . GLY A 1 81  ? 23.061  12.510  26.964  1.00 93.57  ? 83  GLY A N   1 
ATOM   653  C CA  . GLY A 1 81  ? 23.836  12.943  28.109  1.00 89.94  ? 83  GLY A CA  1 
ATOM   654  C C   . GLY A 1 81  ? 23.353  14.350  28.345  1.00 85.35  ? 83  GLY A C   1 
ATOM   655  O O   . GLY A 1 81  ? 23.524  14.928  29.414  1.00 84.70  ? 83  GLY A O   1 
ATOM   656  N N   . ASP A 1 82  ? 22.744  14.898  27.303  1.00 82.14  ? 84  ASP A N   1 
ATOM   657  C CA  . ASP A 1 82  ? 22.167  16.225  27.359  1.00 81.91  ? 84  ASP A CA  1 
ATOM   658  C C   . ASP A 1 82  ? 20.672  16.039  27.613  1.00 81.90  ? 84  ASP A C   1 
ATOM   659  O O   . ASP A 1 82  ? 19.923  17.005  27.603  1.00 82.49  ? 84  ASP A O   1 
ATOM   660  C CB  . ASP A 1 82  ? 22.324  16.962  26.014  1.00 75.85  ? 84  ASP A CB  1 
ATOM   661  C CG  . ASP A 1 82  ? 23.767  17.304  25.678  1.00 73.79  ? 84  ASP A CG  1 
ATOM   662  O OD1 . ASP A 1 82  ? 24.633  17.224  26.577  1.00 68.48  ? 84  ASP A OD1 1 
ATOM   663  O OD2 . ASP A 1 82  ? 24.028  17.670  24.507  1.00 69.77  ? 84  ASP A OD2 1 
ATOM   664  N N   . SER A 1 83  ? 20.243  14.812  27.874  1.00 81.01  ? 85  SER A N   1 
ATOM   665  C CA  . SER A 1 83  ? 18.824  14.513  28.028  1.00 79.84  ? 85  SER A CA  1 
ATOM   666  C C   . SER A 1 83  ? 17.985  14.784  29.268  1.00 77.94  ? 85  SER A C   1 
ATOM   667  O O   . SER A 1 83  ? 17.117  13.975  29.539  1.00 74.58  ? 85  SER A O   1 
ATOM   668  C CB  . SER A 1 83  ? 18.597  13.038  27.681  1.00 77.59  ? 85  SER A CB  1 
ATOM   669  O OG  . SER A 1 83  ? 18.316  12.844  26.310  1.00 67.23  ? 85  SER A OG  1 
ATOM   670  N N   . ALA A 1 84  ? 18.167  15.834  30.053  1.00 79.85  ? 86  ALA A N   1 
ATOM   671  C CA  . ALA A 1 84  ? 17.217  15.931  31.168  1.00 79.42  ? 86  ALA A CA  1 
ATOM   672  C C   . ALA A 1 84  ? 16.131  16.962  30.829  1.00 76.94  ? 86  ALA A C   1 
ATOM   673  O O   . ALA A 1 84  ? 15.750  17.113  29.659  1.00 66.26  ? 86  ALA A O   1 
ATOM   674  C CB  . ALA A 1 84  ? 17.926  16.299  32.456  1.00 78.97  ? 86  ALA A CB  1 
ATOM   675  N N   . THR A 1 85  ? 15.640  17.647  31.865  1.00 75.88  ? 87  THR A N   1 
ATOM   676  C CA  . THR A 1 85  ? 14.625  18.703  31.757  1.00 78.70  ? 87  THR A CA  1 
ATOM   677  C C   . THR A 1 85  ? 15.367  20.033  31.844  1.00 80.77  ? 87  THR A C   1 
ATOM   678  O O   . THR A 1 85  ? 16.200  20.231  32.738  1.00 78.36  ? 87  THR A O   1 
ATOM   679  C CB  . THR A 1 85  ? 13.617  18.655  32.932  1.00 79.51  ? 87  THR A CB  1 
ATOM   680  O OG1 . THR A 1 85  ? 13.055  17.342  33.023  1.00 83.97  ? 87  THR A OG1 1 
ATOM   681  C CG2 . THR A 1 85  ? 12.493  19.670  32.724  1.00 80.39  ? 87  THR A CG2 1 
ATOM   682  N N   . TYR A 1 86  ? 15.065  20.935  30.917  1.00 79.19  ? 88  TYR A N   1 
ATOM   683  C CA  . TYR A 1 86  ? 15.706  22.239  30.883  1.00 80.36  ? 88  TYR A CA  1 
ATOM   684  C C   . TYR A 1 86  ? 14.748  23.321  31.364  1.00 78.60  ? 88  TYR A C   1 
ATOM   685  O O   . TYR A 1 86  ? 13.554  23.275  31.077  1.00 78.61  ? 88  TYR A O   1 
ATOM   686  C CB  . TYR A 1 86  ? 16.192  22.537  29.460  1.00 82.57  ? 88  TYR A CB  1 
ATOM   687  C CG  . TYR A 1 86  ? 17.405  21.724  29.070  1.00 87.66  ? 88  TYR A CG  1 
ATOM   688  C CD1 . TYR A 1 86  ? 18.549  21.734  29.867  1.00 88.88  ? 88  TYR A CD1 1 
ATOM   689  C CD2 . TYR A 1 86  ? 17.415  20.946  27.914  1.00 87.87  ? 88  TYR A CD2 1 
ATOM   690  C CE1 . TYR A 1 86  ? 19.671  20.993  29.527  1.00 90.88  ? 88  TYR A CE1 1 
ATOM   691  C CE2 . TYR A 1 86  ? 18.538  20.198  27.563  1.00 89.08  ? 88  TYR A CE2 1 
ATOM   692  C CZ  . TYR A 1 86  ? 19.662  20.230  28.377  1.00 90.27  ? 88  TYR A CZ  1 
ATOM   693  O OH  . TYR A 1 86  ? 20.787  19.510  28.051  1.00 88.95  ? 88  TYR A OH  1 
ATOM   694  N N   . PHE A 1 87  ? 15.270  24.292  32.105  1.00 76.37  ? 89  PHE A N   1 
ATOM   695  C CA  . PHE A 1 87  ? 14.431  25.366  32.616  1.00 75.83  ? 89  PHE A CA  1 
ATOM   696  C C   . PHE A 1 87  ? 14.853  26.760  32.189  1.00 74.29  ? 89  PHE A C   1 
ATOM   697  O O   . PHE A 1 87  ? 16.016  27.136  32.319  1.00 73.01  ? 89  PHE A O   1 
ATOM   698  C CB  . PHE A 1 87  ? 14.373  25.308  34.141  1.00 74.20  ? 89  PHE A CB  1 
ATOM   699  C CG  . PHE A 1 87  ? 13.525  24.194  34.668  1.00 75.06  ? 89  PHE A CG  1 
ATOM   700  C CD1 . PHE A 1 87  ? 12.205  24.058  34.254  1.00 71.94  ? 89  PHE A CD1 1 
ATOM   701  C CD2 . PHE A 1 87  ? 14.037  23.287  35.588  1.00 76.76  ? 89  PHE A CD2 1 
ATOM   702  C CE1 . PHE A 1 87  ? 11.406  23.039  34.746  1.00 74.15  ? 89  PHE A CE1 1 
ATOM   703  C CE2 . PHE A 1 87  ? 13.245  22.259  36.090  1.00 77.37  ? 89  PHE A CE2 1 
ATOM   704  C CZ  . PHE A 1 87  ? 11.927  22.135  35.668  1.00 77.27  ? 89  PHE A CZ  1 
ATOM   705  N N   . CYS A 1 88  ? 13.888  27.519  31.677  1.00 74.36  ? 90  CYS A N   1 
ATOM   706  C CA  . CYS A 1 88  ? 14.117  28.894  31.247  1.00 74.42  ? 90  CYS A CA  1 
ATOM   707  C C   . CYS A 1 88  ? 13.622  29.815  32.358  1.00 73.30  ? 90  CYS A C   1 
ATOM   708  O O   . CYS A 1 88  ? 12.439  29.797  32.703  1.00 74.82  ? 90  CYS A O   1 
ATOM   709  C CB  . CYS A 1 88  ? 13.348  29.182  29.955  1.00 72.27  ? 90  CYS A CB  1 
ATOM   710  S SG  . CYS A 1 88  ? 13.485  30.893  29.341  1.00 77.22  ? 90  CYS A SG  1 
ATOM   711  N N   . ALA A 1 89  ? 14.528  30.609  32.919  1.00 69.28  ? 91  ALA A N   1 
ATOM   712  C CA  . ALA A 1 89  ? 14.176  31.528  33.995  1.00 65.78  ? 91  ALA A CA  1 
ATOM   713  C C   . ALA A 1 89  ? 14.363  32.991  33.585  1.00 63.81  ? 91  ALA A C   1 
ATOM   714  O O   . ALA A 1 89  ? 14.775  33.285  32.461  1.00 58.56  ? 91  ALA A O   1 
ATOM   715  C CB  . ALA A 1 89  ? 15.015  31.215  35.226  1.00 65.36  ? 91  ALA A CB  1 
ATOM   716  N N   . ALA A 1 90  ? 14.048  33.908  34.497  1.00 59.35  ? 92  ALA A N   1 
ATOM   717  C CA  . ALA A 1 90  ? 14.201  35.334  34.218  1.00 57.06  ? 92  ALA A CA  1 
ATOM   718  C C   . ALA A 1 90  ? 14.023  36.194  35.462  1.00 55.20  ? 92  ALA A C   1 
ATOM   719  O O   . ALA A 1 90  ? 13.274  35.849  36.371  1.00 52.48  ? 92  ALA A O   1 
ATOM   720  C CB  . ALA A 1 90  ? 13.214  35.769  33.142  1.00 49.36  ? 92  ALA A CB  1 
ATOM   721  N N   . SER A 1 91  ? 14.731  37.315  35.493  1.00 57.27  ? 93  SER A N   1 
ATOM   722  C CA  . SER A 1 91  ? 14.655  38.248  36.608  1.00 58.33  ? 93  SER A CA  1 
ATOM   723  C C   . SER A 1 91  ? 14.595  39.684  36.057  1.00 58.40  ? 93  SER A C   1 
ATOM   724  O O   . SER A 1 91  ? 15.040  39.941  34.933  1.00 59.91  ? 93  SER A O   1 
ATOM   725  C CB  . SER A 1 91  ? 15.859  38.050  37.527  1.00 53.36  ? 93  SER A CB  1 
ATOM   726  O OG  . SER A 1 91  ? 17.062  38.276  36.832  1.00 56.91  ? 93  SER A OG  1 
ATOM   727  N N   . ALA A 1 92  ? 14.043  40.609  36.843  1.00 52.41  ? 98  ALA A N   1 
ATOM   728  C CA  . ALA A 1 92  ? 13.876  42.006  36.415  1.00 51.36  ? 98  ALA A CA  1 
ATOM   729  C C   . ALA A 1 92  ? 15.061  42.943  36.671  1.00 46.51  ? 98  ALA A C   1 
ATOM   730  O O   . ALA A 1 92  ? 16.000  42.573  37.362  1.00 47.27  ? 98  ALA A O   1 
ATOM   731  C CB  . ALA A 1 92  ? 12.621  42.580  37.062  1.00 50.03  ? 98  ALA A CB  1 
ATOM   732  N N   . ASN A 1 93  ? 14.997  44.156  36.104  1.00 50.39  ? 99  ASN A N   1 
ATOM   733  C CA  . ASN A 1 93  ? 16.044  45.189  36.249  1.00 46.51  ? 99  ASN A CA  1 
ATOM   734  C C   . ASN A 1 93  ? 16.143  45.711  37.691  1.00 46.41  ? 99  ASN A C   1 
ATOM   735  O O   . ASN A 1 93  ? 17.105  46.394  38.066  1.00 41.88  ? 99  ASN A O   1 
ATOM   736  C CB  . ASN A 1 93  ? 15.785  46.335  35.288  1.00 47.45  ? 99  ASN A CB  1 
ATOM   737  C CG  . ASN A 1 93  ? 14.352  46.766  35.303  1.00 52.59  ? 99  ASN A CG  1 
ATOM   738  O OD1 . ASN A 1 93  ? 13.584  46.344  36.162  1.00 55.29  ? 99  ASN A OD1 1 
ATOM   739  N ND2 . ASN A 1 93  ? 13.975  47.614  34.357  1.00 61.92  ? 99  ASN A ND2 1 
ATOM   740  N N   . SER A 1 94  ? 15.111  45.425  38.480  1.00 45.68  ? 100 SER A N   1 
ATOM   741  C CA  . SER A 1 94  ? 15.164  45.714  39.903  1.00 49.68  ? 100 SER A CA  1 
ATOM   742  C C   . SER A 1 94  ? 15.970  44.480  40.285  1.00 56.21  ? 100 SER A C   1 
ATOM   743  O O   . SER A 1 94  ? 16.359  43.716  39.406  1.00 63.78  ? 100 SER A O   1 
ATOM   744  C CB  . SER A 1 94  ? 13.782  45.654  40.541  1.00 48.53  ? 100 SER A CB  1 
ATOM   745  O OG  . SER A 1 94  ? 12.960  44.671  39.945  1.00 50.07  ? 100 SER A OG  1 
ATOM   746  N N   . GLY A 1 95  ? 16.236  44.239  41.555  1.00 59.15  ? 101 GLY A N   1 
ATOM   747  C CA  . GLY A 1 95  ? 17.019  43.044  41.844  1.00 54.76  ? 101 GLY A CA  1 
ATOM   748  C C   . GLY A 1 95  ? 16.188  41.844  42.268  1.00 51.72  ? 101 GLY A C   1 
ATOM   749  O O   . GLY A 1 95  ? 16.707  40.939  42.913  1.00 61.17  ? 101 GLY A O   1 
ATOM   750  N N   . THR A 1 96  ? 14.912  41.807  41.895  1.00 51.53  ? 102 THR A N   1 
ATOM   751  C CA  . THR A 1 96  ? 14.032  40.726  42.335  1.00 53.17  ? 102 THR A CA  1 
ATOM   752  C C   . THR A 1 96  ? 14.382  39.297  41.920  1.00 57.90  ? 102 THR A C   1 
ATOM   753  O O   . THR A 1 96  ? 15.153  39.071  40.982  1.00 60.14  ? 102 THR A O   1 
ATOM   754  C CB  . THR A 1 96  ? 12.585  41.037  41.953  1.00 51.13  ? 102 THR A CB  1 
ATOM   755  O OG1 . THR A 1 96  ? 12.506  41.289  40.546  1.00 49.85  ? 102 THR A OG1 1 
ATOM   756  C CG2 . THR A 1 96  ? 12.100  42.267  42.721  1.00 45.53  ? 102 THR A CG2 1 
ATOM   757  N N   . TYR A 1 97  ? 13.800  38.337  42.640  1.00 58.10  ? 103 TYR A N   1 
ATOM   758  C CA  . TYR A 1 97  ? 14.044  36.909  42.417  1.00 57.61  ? 103 TYR A CA  1 
ATOM   759  C C   . TYR A 1 97  ? 13.723  36.367  41.030  1.00 56.26  ? 103 TYR A C   1 
ATOM   760  O O   . TYR A 1 97  ? 12.897  36.927  40.302  1.00 55.90  ? 103 TYR A O   1 
ATOM   761  C CB  . TYR A 1 97  ? 13.296  36.076  43.475  1.00 57.80  ? 103 TYR A CB  1 
ATOM   762  C CG  . TYR A 1 97  ? 11.776  36.096  43.398  1.00 54.46  ? 103 TYR A CG  1 
ATOM   763  C CD1 . TYR A 1 97  ? 11.089  35.336  42.446  1.00 50.95  ? 103 TYR A CD1 1 
ATOM   764  C CD2 . TYR A 1 97  ? 11.024  36.848  44.304  1.00 55.35  ? 103 TYR A CD2 1 
ATOM   765  C CE1 . TYR A 1 97  ? 9.696   35.320  42.403  1.00 37.24  ? 103 TYR A CE1 1 
ATOM   766  C CE2 . TYR A 1 97  ? 9.631   36.842  44.266  1.00 42.50  ? 103 TYR A CE2 1 
ATOM   767  C CZ  . TYR A 1 97  ? 8.978   36.076  43.316  1.00 48.41  ? 103 TYR A CZ  1 
ATOM   768  O OH  . TYR A 1 97  ? 7.608   36.068  43.288  1.00 47.11  ? 103 TYR A OH  1 
ATOM   769  N N   . GLN A 1 98  ? 14.392  35.268  40.683  1.00 58.88  ? 104 GLN A N   1 
ATOM   770  C CA  . GLN A 1 98  ? 14.207  34.595  39.396  1.00 57.73  ? 104 GLN A CA  1 
ATOM   771  C C   . GLN A 1 98  ? 12.873  33.878  39.362  1.00 57.89  ? 104 GLN A C   1 
ATOM   772  O O   . GLN A 1 98  ? 12.392  33.379  40.381  1.00 57.25  ? 104 GLN A O   1 
ATOM   773  C CB  . GLN A 1 98  ? 15.296  33.554  39.164  1.00 61.45  ? 104 GLN A CB  1 
ATOM   774  C CG  . GLN A 1 98  ? 16.646  34.094  38.774  1.00 69.27  ? 104 GLN A CG  1 
ATOM   775  C CD  . GLN A 1 98  ? 17.718  33.025  38.845  1.00 72.94  ? 104 GLN A CD  1 
ATOM   776  O OE1 . GLN A 1 98  ? 17.527  31.903  38.366  1.00 73.04  ? 104 GLN A OE1 1 
ATOM   777  N NE2 . GLN A 1 98  ? 18.856  33.366  39.442  1.00 72.16  ? 104 GLN A NE2 1 
ATOM   778  N N   . ARG A 1 99  ? 12.294  33.807  38.173  1.00 58.87  ? 105 ARG A N   1 
ATOM   779  C CA  . ARG A 1 99  ? 11.014  33.149  37.981  1.00 61.79  ? 105 ARG A CA  1 
ATOM   780  C C   . ARG A 1 99  ? 11.180  32.145  36.850  1.00 66.55  ? 105 ARG A C   1 
ATOM   781  O O   . ARG A 1 99  ? 11.418  32.524  35.703  1.00 69.79  ? 105 ARG A O   1 
ATOM   782  C CB  . ARG A 1 99  ? 9.963   34.204  37.642  1.00 58.93  ? 105 ARG A CB  1 
ATOM   783  C CG  . ARG A 1 99  ? 10.152  35.443  38.490  1.00 61.72  ? 105 ARG A CG  1 
ATOM   784  C CD  . ARG A 1 99  ? 8.884   36.226  38.757  1.00 62.68  ? 105 ARG A CD  1 
ATOM   785  N NE  . ARG A 1 99  ? 9.173   37.274  39.732  1.00 65.43  ? 105 ARG A NE  1 
ATOM   786  C CZ  . ARG A 1 99  ? 8.271   38.101  40.246  1.00 67.94  ? 105 ARG A CZ  1 
ATOM   787  N NH1 . ARG A 1 99  ? 6.995   38.017  39.882  1.00 76.47  ? 105 ARG A NH1 1 
ATOM   788  N NH2 . ARG A 1 99  ? 8.652   39.009  41.133  1.00 68.71  ? 105 ARG A NH2 1 
ATOM   789  N N   . PHE A 1 100 ? 11.061  30.861  37.178  1.00 71.83  ? 106 PHE A N   1 
ATOM   790  C CA  . PHE A 1 100 ? 11.236  29.803  36.184  1.00 72.99  ? 106 PHE A CA  1 
ATOM   791  C C   . PHE A 1 100 ? 10.000  29.518  35.334  1.00 73.43  ? 106 PHE A C   1 
ATOM   792  O O   . PHE A 1 100 ? 8.981   30.195  35.453  1.00 76.83  ? 106 PHE A O   1 
ATOM   793  C CB  . PHE A 1 100 ? 11.695  28.522  36.877  1.00 69.00  ? 106 PHE A CB  1 
ATOM   794  C CG  . PHE A 1 100 ? 12.909  28.703  37.739  1.00 65.93  ? 106 PHE A CG  1 
ATOM   795  C CD1 . PHE A 1 100 ? 12.827  29.396  38.941  1.00 71.63  ? 106 PHE A CD1 1 
ATOM   796  C CD2 . PHE A 1 100 ? 14.136  28.183  37.348  1.00 68.29  ? 106 PHE A CD2 1 
ATOM   797  C CE1 . PHE A 1 100 ? 13.951  29.568  39.745  1.00 73.10  ? 106 PHE A CE1 1 
ATOM   798  C CE2 . PHE A 1 100 ? 15.268  28.347  38.144  1.00 70.74  ? 106 PHE A CE2 1 
ATOM   799  C CZ  . PHE A 1 100 ? 15.175  29.042  39.345  1.00 74.29  ? 106 PHE A CZ  1 
ATOM   800  N N   . GLY A 1 101 ? 10.096  28.516  34.467  1.00 74.42  ? 107 GLY A N   1 
ATOM   801  C CA  . GLY A 1 101 ? 8.968   28.179  33.619  1.00 72.18  ? 107 GLY A CA  1 
ATOM   802  C C   . GLY A 1 101 ? 8.537   26.733  33.751  1.00 70.95  ? 107 GLY A C   1 
ATOM   803  O O   . GLY A 1 101 ? 8.994   26.021  34.644  1.00 67.63  ? 107 GLY A O   1 
ATOM   804  N N   . THR A 1 102 ? 7.648   26.309  32.857  1.00 78.33  ? 108 THR A N   1 
ATOM   805  C CA  . THR A 1 102 ? 7.135   24.939  32.826  1.00 80.62  ? 108 THR A CA  1 
ATOM   806  C C   . THR A 1 102 ? 8.300   23.955  32.755  1.00 82.23  ? 108 THR A C   1 
ATOM   807  O O   . THR A 1 102 ? 8.377   23.000  33.530  1.00 81.19  ? 108 THR A O   1 
ATOM   808  C CB  . THR A 1 102 ? 6.266   24.699  31.579  1.00 82.25  ? 108 THR A CB  1 
ATOM   809  O OG1 . THR A 1 102 ? 5.324   25.768  31.432  1.00 80.44  ? 108 THR A OG1 1 
ATOM   810  C CG2 . THR A 1 102 ? 5.526   23.370  31.699  1.00 87.51  ? 108 THR A CG2 1 
ATOM   811  N N   . GLY A 1 103 ? 9.198   24.199  31.806  1.00 80.22  ? 109 GLY A N   1 
ATOM   812  C CA  . GLY A 1 103 ? 10.349  23.338  31.641  1.00 84.75  ? 109 GLY A CA  1 
ATOM   813  C C   . GLY A 1 103 ? 10.127  22.267  30.596  1.00 87.62  ? 109 GLY A C   1 
ATOM   814  O O   . GLY A 1 103 ? 9.169   21.497  30.678  1.00 87.94  ? 109 GLY A O   1 
ATOM   815  N N   . THR A 1 104 ? 11.019  22.225  29.610  1.00 87.98  ? 110 THR A N   1 
ATOM   816  C CA  . THR A 1 104 ? 10.944  21.246  28.534  1.00 87.62  ? 110 THR A CA  1 
ATOM   817  C C   . THR A 1 104 ? 11.812  20.035  28.865  1.00 87.23  ? 110 THR A C   1 
ATOM   818  O O   . THR A 1 104 ? 12.934  20.177  29.354  1.00 86.08  ? 110 THR A O   1 
ATOM   819  C CB  . THR A 1 104 ? 11.438  21.841  27.198  1.00 87.40  ? 110 THR A CB  1 
ATOM   820  O OG1 . THR A 1 104 ? 10.679  23.013  26.876  1.00 91.47  ? 110 THR A OG1 1 
ATOM   821  C CG2 . THR A 1 104 ? 11.283  20.826  26.080  1.00 91.10  ? 110 THR A CG2 1 
ATOM   822  N N   . LYS A 1 105 ? 11.283  18.843  28.616  1.00 86.65  ? 111 LYS A N   1 
ATOM   823  C CA  . LYS A 1 105 ? 12.036  17.624  28.866  1.00 86.20  ? 111 LYS A CA  1 
ATOM   824  C C   . LYS A 1 105 ? 12.616  17.177  27.530  1.00 83.21  ? 111 LYS A C   1 
ATOM   825  O O   . LYS A 1 105 ? 11.886  17.026  26.544  1.00 77.85  ? 111 LYS A O   1 
ATOM   826  C CB  . LYS A 1 105 ? 11.127  16.537  29.454  1.00 91.33  ? 111 LYS A CB  1 
ATOM   827  C CG  . LYS A 1 105 ? 10.691  16.820  30.889  1.00 100.07 ? 111 LYS A CG  1 
ATOM   828  C CD  . LYS A 1 105 ? 9.755   15.748  31.449  1.00 105.67 ? 111 LYS A CD  1 
ATOM   829  C CE  . LYS A 1 105 ? 9.301   16.104  32.869  1.00 107.01 ? 111 LYS A CE  1 
ATOM   830  N NZ  . LYS A 1 105 ? 8.308   15.143  33.431  1.00 105.68 ? 111 LYS A NZ  1 
ATOM   831  N N   . LEU A 1 106 ? 13.933  16.995  27.492  1.00 80.63  ? 112 LEU A N   1 
ATOM   832  C CA  . LEU A 1 106 ? 14.597  16.576  26.263  1.00 80.51  ? 112 LEU A CA  1 
ATOM   833  C C   . LEU A 1 106 ? 15.148  15.163  26.350  1.00 79.59  ? 112 LEU A C   1 
ATOM   834  O O   . LEU A 1 106 ? 15.827  14.803  27.314  1.00 73.92  ? 112 LEU A O   1 
ATOM   835  C CB  . LEU A 1 106 ? 15.744  17.528  25.910  1.00 76.12  ? 112 LEU A CB  1 
ATOM   836  C CG  . LEU A 1 106 ? 16.396  17.271  24.543  1.00 72.36  ? 112 LEU A CG  1 
ATOM   837  C CD1 . LEU A 1 106 ? 15.403  17.621  23.432  1.00 60.73  ? 112 LEU A CD1 1 
ATOM   838  C CD2 . LEU A 1 106 ? 17.676  18.092  24.409  1.00 69.59  ? 112 LEU A CD2 1 
ATOM   839  N N   . GLN A 1 107 ? 14.852  14.375  25.324  1.00 82.01  ? 113 GLN A N   1 
ATOM   840  C CA  . GLN A 1 107 ? 15.318  13.002  25.246  1.00 86.57  ? 113 GLN A CA  1 
ATOM   841  C C   . GLN A 1 107 ? 16.160  12.872  23.980  1.00 87.66  ? 113 GLN A C   1 
ATOM   842  O O   . GLN A 1 107 ? 15.684  13.153  22.877  1.00 84.27  ? 113 GLN A O   1 
ATOM   843  C CB  . GLN A 1 107 ? 14.123  12.052  25.178  1.00 93.16  ? 113 GLN A CB  1 
ATOM   844  C CG  . GLN A 1 107 ? 14.447  10.599  25.487  1.00 98.26  ? 113 GLN A CG  1 
ATOM   845  C CD  . GLN A 1 107 ? 13.236  9.698   25.335  1.00 102.18 ? 113 GLN A CD  1 
ATOM   846  O OE1 . GLN A 1 107 ? 12.787  9.428   24.218  1.00 101.25 ? 113 GLN A OE1 1 
ATOM   847  N NE2 . GLN A 1 107 ? 12.691  9.239   26.460  1.00 103.93 ? 113 GLN A NE2 1 
ATOM   848  N N   . VAL A 1 108 ? 17.416  12.467  24.145  1.00 89.48  ? 114 VAL A N   1 
ATOM   849  C CA  . VAL A 1 108 ? 18.323  12.296  23.015  1.00 90.65  ? 114 VAL A CA  1 
ATOM   850  C C   . VAL A 1 108 ? 18.514  10.804  22.755  1.00 91.60  ? 114 VAL A C   1 
ATOM   851  O O   . VAL A 1 108 ? 19.097  10.095  23.577  1.00 88.65  ? 114 VAL A O   1 
ATOM   852  C CB  . VAL A 1 108 ? 19.705  12.932  23.294  1.00 90.18  ? 114 VAL A CB  1 
ATOM   853  C CG1 . VAL A 1 108 ? 20.569  12.849  22.052  1.00 89.40  ? 114 VAL A CG1 1 
ATOM   854  C CG2 . VAL A 1 108 ? 19.541  14.378  23.722  1.00 86.91  ? 114 VAL A CG2 1 
ATOM   855  N N   . VAL A 1 109 ? 18.013  10.337  21.614  1.00 93.57  ? 115 VAL A N   1 
ATOM   856  C CA  . VAL A 1 109 ? 18.117  8.926   21.231  1.00 95.78  ? 115 VAL A CA  1 
ATOM   857  C C   . VAL A 1 109 ? 19.491  8.620   20.643  1.00 94.50  ? 115 VAL A C   1 
ATOM   858  O O   . VAL A 1 109 ? 19.878  9.198   19.626  1.00 98.23  ? 115 VAL A O   1 
ATOM   859  C CB  . VAL A 1 109 ? 17.051  8.552   20.169  1.00 96.17  ? 115 VAL A CB  1 
ATOM   860  C CG1 . VAL A 1 109 ? 17.196  7.092   19.770  1.00 93.73  ? 115 VAL A CG1 1 
ATOM   861  C CG2 . VAL A 1 109 ? 15.657  8.825   20.708  1.00 96.31  ? 115 VAL A CG2 1 
ATOM   862  N N   . PRO A 1 110 ? 20.247  7.706   21.274  1.00 91.96  ? 116 PRO A N   1 
ATOM   863  C CA  . PRO A 1 110 ? 21.580  7.355   20.768  1.00 93.47  ? 116 PRO A CA  1 
ATOM   864  C C   . PRO A 1 110 ? 21.557  6.809   19.333  1.00 96.57  ? 116 PRO A C   1 
ATOM   865  O O   . PRO A 1 110 ? 20.448  6.635   18.779  1.00 98.97  ? 116 PRO A O   1 
ATOM   866  C CB  . PRO A 1 110 ? 22.064  6.319   21.779  1.00 87.82  ? 116 PRO A CB  1 
ATOM   867  C CG  . PRO A 1 110 ? 21.414  6.777   23.051  1.00 88.25  ? 116 PRO A CG  1 
ATOM   868  C CD  . PRO A 1 110 ? 20.008  7.086   22.589  1.00 87.98  ? 116 PRO A CD  1 
ATOM   869  O OXT . PRO A 1 110 ? 22.651  6.562   18.778  1.00 96.13  ? 116 PRO A OXT 1 
ATOM   870  N N   . ALA B 2 1   ? 26.921  22.613  46.821  1.00 91.38  ? 3   ALA B N   1 
ATOM   871  C CA  . ALA B 2 1   ? 27.133  22.013  48.172  1.00 91.75  ? 3   ALA B CA  1 
ATOM   872  C C   . ALA B 2 1   ? 26.015  22.418  49.135  1.00 92.72  ? 3   ALA B C   1 
ATOM   873  O O   . ALA B 2 1   ? 26.271  23.007  50.187  1.00 89.38  ? 3   ALA B O   1 
ATOM   874  C CB  . ALA B 2 1   ? 28.481  22.451  48.725  1.00 90.64  ? 3   ALA B CB  1 
ATOM   875  N N   . VAL B 2 2   ? 24.778  22.086  48.766  1.00 95.20  ? 4   VAL B N   1 
ATOM   876  C CA  . VAL B 2 2   ? 23.598  22.408  49.572  1.00 94.59  ? 4   VAL B CA  1 
ATOM   877  C C   . VAL B 2 2   ? 22.928  21.137  50.113  1.00 91.51  ? 4   VAL B C   1 
ATOM   878  O O   . VAL B 2 2   ? 22.676  20.193  49.364  1.00 89.49  ? 4   VAL B O   1 
ATOM   879  C CB  . VAL B 2 2   ? 22.556  23.188  48.731  1.00 98.53  ? 4   VAL B CB  1 
ATOM   880  C CG1 . VAL B 2 2   ? 21.461  23.727  49.630  1.00 102.56 ? 4   VAL B CG1 1 
ATOM   881  C CG2 . VAL B 2 2   ? 23.234  24.317  47.967  1.00 96.46  ? 4   VAL B CG2 1 
ATOM   882  N N   . THR B 2 3   ? 22.622  21.127  51.408  1.00 90.07  ? 5   THR B N   1 
ATOM   883  C CA  . THR B 2 3   ? 21.995  19.967  52.045  1.00 89.76  ? 5   THR B CA  1 
ATOM   884  C C   . THR B 2 3   ? 20.575  20.228  52.556  1.00 91.32  ? 5   THR B C   1 
ATOM   885  O O   . THR B 2 3   ? 20.237  21.350  52.938  1.00 93.33  ? 5   THR B O   1 
ATOM   886  C CB  . THR B 2 3   ? 22.840  19.481  53.231  1.00 87.71  ? 5   THR B CB  1 
ATOM   887  O OG1 . THR B 2 3   ? 24.168  19.204  52.782  1.00 85.44  ? 5   THR B OG1 1 
ATOM   888  C CG2 . THR B 2 3   ? 22.249  18.221  53.834  1.00 91.96  ? 5   THR B CG2 1 
ATOM   889  N N   . GLN B 2 4   ? 19.758  19.175  52.575  1.00 91.08  ? 6   GLN B N   1 
ATOM   890  C CA  . GLN B 2 4   ? 18.369  19.254  53.041  1.00 89.71  ? 6   GLN B CA  1 
ATOM   891  C C   . GLN B 2 4   ? 18.071  18.091  54.007  1.00 91.57  ? 6   GLN B C   1 
ATOM   892  O O   . GLN B 2 4   ? 18.371  16.948  53.687  1.00 90.46  ? 6   GLN B O   1 
ATOM   893  C CB  . GLN B 2 4   ? 17.421  19.173  51.843  1.00 85.42  ? 6   GLN B CB  1 
ATOM   894  C CG  . GLN B 2 4   ? 17.784  20.103  50.699  1.00 77.96  ? 6   GLN B CG  1 
ATOM   895  C CD  . GLN B 2 4   ? 16.818  20.014  49.535  1.00 73.46  ? 6   GLN B CD  1 
ATOM   896  O OE1 . GLN B 2 4   ? 17.044  20.609  48.488  1.00 79.25  ? 6   GLN B OE1 1 
ATOM   897  N NE2 . GLN B 2 4   ? 15.735  19.273  49.714  1.00 71.13  ? 6   GLN B NE2 1 
ATOM   898  N N   . SER B 2 5   ? 17.440  18.387  55.151  1.00 95.82  ? 7   SER B N   1 
ATOM   899  C CA  . SER B 2 5   ? 17.115  17.406  56.217  1.00 99.16  ? 7   SER B CA  1 
ATOM   900  C C   . SER B 2 5   ? 16.300  16.145  55.827  1.00 103.44 ? 7   SER B C   1 
ATOM   901  O O   . SER B 2 5   ? 16.850  15.053  55.887  1.00 111.20 ? 7   SER B O   1 
ATOM   902  C CB  . SER B 2 5   ? 16.501  18.154  57.400  1.00 98.48  ? 7   SER B CB  1 
ATOM   903  O OG  . SER B 2 5   ? 15.434  18.983  56.981  1.00 100.48 ? 7   SER B OG  1 
ATOM   904  N N   . PRO B 2 6   ? 14.973  16.231  55.626  1.00 102.81 ? 8   PRO B N   1 
ATOM   905  C CA  . PRO B 2 6   ? 14.346  14.976  55.206  1.00 101.31 ? 8   PRO B CA  1 
ATOM   906  C C   . PRO B 2 6   ? 14.692  14.751  53.744  1.00 99.71  ? 8   PRO B C   1 
ATOM   907  O O   . PRO B 2 6   ? 14.305  15.568  52.924  1.00 101.78 ? 8   PRO B O   1 
ATOM   908  C CB  . PRO B 2 6   ? 12.867  15.287  55.327  1.00 100.20 ? 8   PRO B CB  1 
ATOM   909  C CG  . PRO B 2 6   ? 12.795  16.110  56.545  1.00 102.07 ? 8   PRO B CG  1 
ATOM   910  C CD  . PRO B 2 6   ? 14.186  16.704  56.778  1.00 101.30 ? 8   PRO B CD  1 
ATOM   911  N N   . ARG B 2 7   ? 15.402  13.700  53.363  1.00 94.11  ? 9   ARG B N   1 
ATOM   912  C CA  . ARG B 2 7   ? 15.617  13.588  51.920  1.00 91.61  ? 9   ARG B CA  1 
ATOM   913  C C   . ARG B 2 7   ? 14.357  12.946  51.323  1.00 90.13  ? 9   ARG B C   1 
ATOM   914  O O   . ARG B 2 7   ? 14.139  12.926  50.107  1.00 84.19  ? 9   ARG B O   1 
ATOM   915  C CB  . ARG B 2 7   ? 16.856  12.750  51.608  1.00 92.74  ? 9   ARG B CB  1 
ATOM   916  C CG  . ARG B 2 7   ? 17.759  13.343  50.524  1.00 93.08  ? 9   ARG B CG  1 
ATOM   917  C CD  . ARG B 2 7   ? 17.015  13.445  49.210  1.00 100.72 ? 9   ARG B CD  1 
ATOM   918  N NE  . ARG B 2 7   ? 17.912  13.567  48.067  1.00 103.02 ? 9   ARG B NE  1 
ATOM   919  C CZ  . ARG B 2 7   ? 17.501  13.611  46.803  1.00 107.09 ? 9   ARG B CZ  1 
ATOM   920  N NH1 . ARG B 2 7   ? 16.205  13.548  46.520  1.00 105.39 ? 9   ARG B NH1 1 
ATOM   921  N NH2 . ARG B 2 7   ? 18.384  13.707  45.817  1.00 110.48 ? 9   ARG B NH2 1 
ATOM   922  N N   . ASN B 2 8   ? 13.529  12.435  52.226  1.00 88.94  ? 10  ASN B N   1 
ATOM   923  C CA  . ASN B 2 8   ? 12.281  11.773  51.893  1.00 86.56  ? 10  ASN B CA  1 
ATOM   924  C C   . ASN B 2 8   ? 11.506  11.638  53.200  1.00 84.37  ? 10  ASN B C   1 
ATOM   925  O O   . ASN B 2 8   ? 12.027  11.105  54.183  1.00 83.00  ? 10  ASN B O   1 
ATOM   926  C CB  . ASN B 2 8   ? 12.562  10.394  51.305  1.00 86.12  ? 10  ASN B CB  1 
ATOM   927  C CG  . ASN B 2 8   ? 11.327  9.758   50.713  1.00 90.42  ? 10  ASN B CG  1 
ATOM   928  O OD1 . ASN B 2 8   ? 10.326  9.554   51.405  1.00 88.52  ? 10  ASN B OD1 1 
ATOM   929  N ND2 . ASN B 2 8   ? 11.383  9.446   49.420  1.00 90.32  ? 10  ASN B ND2 1 
ATOM   930  N N   . LYS B 2 9   ? 10.269  12.127  53.211  1.00 82.69  ? 11  LYS B N   1 
ATOM   931  C CA  . LYS B 2 9   ? 9.443   12.082  54.414  1.00 82.21  ? 11  LYS B CA  1 
ATOM   932  C C   . LYS B 2 9   ? 7.973   11.840  54.083  1.00 82.61  ? 11  LYS B C   1 
ATOM   933  O O   . LYS B 2 9   ? 7.450   12.360  53.094  1.00 81.61  ? 11  LYS B O   1 
ATOM   934  C CB  . LYS B 2 9   ? 9.598   13.397  55.182  1.00 81.18  ? 11  LYS B CB  1 
ATOM   935  C CG  . LYS B 2 9   ? 9.540   13.278  56.698  1.00 81.63  ? 11  LYS B CG  1 
ATOM   936  C CD  . LYS B 2 9   ? 8.130   13.435  57.232  1.00 82.03  ? 11  LYS B CD  1 
ATOM   937  C CE  . LYS B 2 9   ? 8.151   13.645  58.741  1.00 80.98  ? 11  LYS B CE  1 
ATOM   938  N NZ  . LYS B 2 9   ? 6.810   13.972  59.300  1.00 82.32  ? 11  LYS B NZ  1 
ATOM   939  N N   . VAL B 2 10  ? 7.317   11.034  54.915  1.00 83.92  ? 12  VAL B N   1 
ATOM   940  C CA  . VAL B 2 10  ? 5.906   10.711  54.735  1.00 82.01  ? 12  VAL B CA  1 
ATOM   941  C C   . VAL B 2 10  ? 5.161   11.024  56.022  1.00 80.78  ? 12  VAL B C   1 
ATOM   942  O O   . VAL B 2 10  ? 5.410   10.410  57.059  1.00 79.89  ? 12  VAL B O   1 
ATOM   943  C CB  . VAL B 2 10  ? 5.701   9.219   54.393  1.00 81.50  ? 12  VAL B CB  1 
ATOM   944  C CG1 . VAL B 2 10  ? 4.217   8.930   54.220  1.00 74.88  ? 12  VAL B CG1 1 
ATOM   945  C CG2 . VAL B 2 10  ? 6.466   8.862   53.120  1.00 78.79  ? 12  VAL B CG2 1 
ATOM   946  N N   . ALA B 2 11  ? 4.249   11.988  55.948  1.00 80.97  ? 13  ALA B N   1 
ATOM   947  C CA  . ALA B 2 11  ? 3.472   12.401  57.111  1.00 83.17  ? 13  ALA B CA  1 
ATOM   948  C C   . ALA B 2 11  ? 1.986   12.267  56.831  1.00 81.71  ? 13  ALA B C   1 
ATOM   949  O O   . ALA B 2 11  ? 1.589   11.816  55.759  1.00 81.98  ? 13  ALA B O   1 
ATOM   950  C CB  . ALA B 2 11  ? 3.807   13.846  57.484  1.00 82.38  ? 13  ALA B CB  1 
ATOM   951  N N   . VAL B 2 12  ? 1.169   12.669  57.799  1.00 78.56  ? 14  VAL B N   1 
ATOM   952  C CA  . VAL B 2 12  ? -0.276  12.582  57.660  1.00 78.13  ? 14  VAL B CA  1 
ATOM   953  C C   . VAL B 2 12  ? -0.903  13.959  57.710  1.00 76.26  ? 14  VAL B C   1 
ATOM   954  O O   . VAL B 2 12  ? -0.357  14.874  58.332  1.00 76.19  ? 14  VAL B O   1 
ATOM   955  C CB  . VAL B 2 12  ? -0.892  11.743  58.795  1.00 82.51  ? 14  VAL B CB  1 
ATOM   956  C CG1 . VAL B 2 12  ? -2.364  11.457  58.495  1.00 82.02  ? 14  VAL B CG1 1 
ATOM   957  C CG2 . VAL B 2 12  ? -0.103  10.457  58.975  1.00 83.11  ? 14  VAL B CG2 1 
ATOM   958  N N   . THR B 2 13  ? -2.055  14.096  57.059  1.00 75.48  ? 15  THR B N   1 
ATOM   959  C CA  . THR B 2 13  ? -2.782  15.360  57.040  1.00 75.19  ? 15  THR B CA  1 
ATOM   960  C C   . THR B 2 13  ? -2.888  15.910  58.455  1.00 79.07  ? 15  THR B C   1 
ATOM   961  O O   . THR B 2 13  ? -3.245  15.183  59.384  1.00 80.51  ? 15  THR B O   1 
ATOM   962  C CB  . THR B 2 13  ? -4.206  15.176  56.489  1.00 70.93  ? 15  THR B CB  1 
ATOM   963  O OG1 . THR B 2 13  ? -4.137  14.741  55.127  1.00 75.48  ? 15  THR B OG1 1 
ATOM   964  C CG2 . THR B 2 13  ? -4.985  16.482  56.566  1.00 65.65  ? 15  THR B CG2 1 
ATOM   965  N N   . GLY B 2 14  ? -2.576  17.193  58.615  1.00 79.50  ? 16  GLY B N   1 
ATOM   966  C CA  . GLY B 2 14  ? -2.646  17.812  59.925  1.00 79.89  ? 16  GLY B CA  1 
ATOM   967  C C   . GLY B 2 14  ? -1.315  17.841  60.651  1.00 80.18  ? 16  GLY B C   1 
ATOM   968  O O   . GLY B 2 14  ? -1.108  18.692  61.516  1.00 79.80  ? 16  GLY B O   1 
ATOM   969  N N   . GLU B 2 15  ? -0.416  16.921  60.307  1.00 79.30  ? 17  GLU B N   1 
ATOM   970  C CA  . GLU B 2 15  ? 0.891   16.857  60.948  1.00 80.45  ? 17  GLU B CA  1 
ATOM   971  C C   . GLU B 2 15  ? 1.704   18.117  60.667  1.00 84.07  ? 17  GLU B C   1 
ATOM   972  O O   . GLU B 2 15  ? 1.517   18.771  59.648  1.00 85.71  ? 17  GLU B O   1 
ATOM   973  C CB  . GLU B 2 15  ? 1.656   15.615  60.486  1.00 20.00  ? 17  GLU B CB  1 
ATOM   974  C CG  . GLU B 2 15  ? 2.927   15.341  61.274  1.00 20.00  ? 17  GLU B CG  1 
ATOM   975  C CD  . GLU B 2 15  ? 3.662   14.110  60.783  1.00 20.00  ? 17  GLU B CD  1 
ATOM   976  O OE1 . GLU B 2 15  ? 3.180   13.475  59.821  1.00 20.00  ? 17  GLU B OE1 1 
ATOM   977  O OE2 . GLU B 2 15  ? 4.719   13.779  61.360  1.00 20.00  ? 17  GLU B OE2 1 
ATOM   978  N N   . LYS B 2 16  ? 2.617   18.453  61.579  1.00 84.17  ? 18  LYS B N   1 
ATOM   979  C CA  . LYS B 2 16  ? 3.457   19.639  61.418  1.00 87.25  ? 18  LYS B CA  1 
ATOM   980  C C   . LYS B 2 16  ? 4.813   19.279  60.814  1.00 87.51  ? 18  LYS B C   1 
ATOM   981  O O   . LYS B 2 16  ? 5.793   19.111  61.539  1.00 89.54  ? 18  LYS B O   1 
ATOM   982  C CB  . LYS B 2 16  ? 3.644   20.347  62.773  1.00 90.79  ? 18  LYS B CB  1 
ATOM   983  C CG  . LYS B 2 16  ? 4.627   21.500  62.736  1.00 94.12  ? 18  LYS B CG  1 
ATOM   984  C CD  . LYS B 2 16  ? 5.162   21.817  64.122  1.00 99.58  ? 18  LYS B CD  1 
ATOM   985  C CE  . LYS B 2 16  ? 6.041   23.059  64.115  1.00 101.25 ? 18  LYS B CE  1 
ATOM   986  N NZ  . LYS B 2 16  ? 5.247   24.311  63.957  1.00 105.54 ? 18  LYS B NZ  1 
ATOM   987  N N   . VAL B 2 17  ? 4.869   19.170  59.489  1.00 85.78  ? 19  VAL B N   1 
ATOM   988  C CA  . VAL B 2 17  ? 6.110   18.824  58.799  1.00 82.98  ? 19  VAL B CA  1 
ATOM   989  C C   . VAL B 2 17  ? 7.074   20.005  58.715  1.00 82.42  ? 19  VAL B C   1 
ATOM   990  O O   . VAL B 2 17  ? 6.660   21.148  58.524  1.00 82.46  ? 19  VAL B O   1 
ATOM   991  C CB  . VAL B 2 17  ? 5.821   18.309  57.377  1.00 83.55  ? 19  VAL B CB  1 
ATOM   992  C CG1 . VAL B 2 17  ? 7.118   18.102  56.620  1.00 81.58  ? 19  VAL B CG1 1 
ATOM   993  C CG2 . VAL B 2 17  ? 5.049   17.007  57.453  1.00 82.21  ? 19  VAL B CG2 1 
ATOM   994  N N   . THR B 2 18  ? 8.364   19.715  58.853  1.00 81.79  ? 20  THR B N   1 
ATOM   995  C CA  . THR B 2 18  ? 9.395   20.747  58.811  1.00 84.50  ? 20  THR B CA  1 
ATOM   996  C C   . THR B 2 18  ? 10.660  20.307  58.063  1.00 87.89  ? 20  THR B C   1 
ATOM   997  O O   . THR B 2 18  ? 11.516  19.625  58.627  1.00 89.68  ? 20  THR B O   1 
ATOM   998  C CB  . THR B 2 18  ? 9.794   21.178  60.247  1.00 82.04  ? 20  THR B CB  1 
ATOM   999  O OG1 . THR B 2 18  ? 8.639   21.676  60.937  1.00 83.86  ? 20  THR B OG1 1 
ATOM   1000 C CG2 . THR B 2 18  ? 10.866  22.264  60.210  1.00 79.08  ? 20  THR B CG2 1 
ATOM   1001 N N   . LEU B 2 19  ? 10.773  20.695  56.795  1.00 88.12  ? 21  LEU B N   1 
ATOM   1002 C CA  . LEU B 2 19  ? 11.948  20.361  55.997  1.00 84.20  ? 21  LEU B CA  1 
ATOM   1003 C C   . LEU B 2 19  ? 12.964  21.447  56.296  1.00 86.08  ? 21  LEU B C   1 
ATOM   1004 O O   . LEU B 2 19  ? 12.598  22.615  56.388  1.00 91.65  ? 21  LEU B O   1 
ATOM   1005 C CB  . LEU B 2 19  ? 11.625  20.398  54.505  1.00 81.19  ? 21  LEU B CB  1 
ATOM   1006 C CG  . LEU B 2 19  ? 10.414  19.620  53.998  1.00 85.05  ? 21  LEU B CG  1 
ATOM   1007 C CD1 . LEU B 2 19  ? 9.142   20.279  54.500  1.00 88.87  ? 21  LEU B CD1 1 
ATOM   1008 C CD2 . LEU B 2 19  ? 10.421  19.598  52.478  1.00 84.36  ? 21  LEU B CD2 1 
ATOM   1009 N N   . SER B 2 20  ? 14.230  21.085  56.460  1.00 86.43  ? 22  SER B N   1 
ATOM   1010 C CA  . SER B 2 20  ? 15.243  22.100  56.733  1.00 87.97  ? 22  SER B CA  1 
ATOM   1011 C C   . SER B 2 20  ? 16.391  22.065  55.728  1.00 84.23  ? 22  SER B C   1 
ATOM   1012 O O   . SER B 2 20  ? 16.623  21.056  55.056  1.00 75.48  ? 22  SER B O   1 
ATOM   1013 C CB  . SER B 2 20  ? 15.772  21.977  58.171  1.00 90.07  ? 22  SER B CB  1 
ATOM   1014 O OG  . SER B 2 20  ? 16.314  20.699  58.430  1.00 92.07  ? 22  SER B OG  1 
ATOM   1015 N N   . CYS B 2 21  ? 17.105  23.181  55.625  1.00 82.83  ? 23  CYS B N   1 
ATOM   1016 C CA  . CYS B 2 21  ? 18.199  23.278  54.675  1.00 81.90  ? 23  CYS B CA  1 
ATOM   1017 C C   . CYS B 2 21  ? 19.483  23.818  55.281  1.00 80.42  ? 23  CYS B C   1 
ATOM   1018 O O   . CYS B 2 21  ? 19.473  24.456  56.336  1.00 82.94  ? 23  CYS B O   1 
ATOM   1019 C CB  . CYS B 2 21  ? 17.783  24.171  53.512  1.00 83.35  ? 23  CYS B CB  1 
ATOM   1020 S SG  . CYS B 2 21  ? 18.873  24.079  52.063  1.00 86.09  ? 23  CYS B SG  1 
ATOM   1021 N N   . ASN B 2 22  ? 20.587  23.559  54.588  1.00 74.64  ? 24  ASN B N   1 
ATOM   1022 C CA  . ASN B 2 22  ? 21.897  24.009  55.027  1.00 72.99  ? 24  ASN B CA  1 
ATOM   1023 C C   . ASN B 2 22  ? 22.775  24.307  53.808  1.00 73.09  ? 24  ASN B C   1 
ATOM   1024 O O   . ASN B 2 22  ? 22.792  23.543  52.840  1.00 73.00  ? 24  ASN B O   1 
ATOM   1025 C CB  . ASN B 2 22  ? 22.555  22.933  55.891  1.00 74.99  ? 24  ASN B CB  1 
ATOM   1026 C CG  . ASN B 2 22  ? 23.765  23.447  56.640  1.00 78.68  ? 24  ASN B CG  1 
ATOM   1027 O OD1 . ASN B 2 22  ? 23.636  24.237  57.579  1.00 73.96  ? 24  ASN B OD1 1 
ATOM   1028 N ND2 . ASN B 2 22  ? 24.952  23.009  56.225  1.00 76.79  ? 24  ASN B ND2 1 
ATOM   1029 N N   . GLN B 2 23  ? 23.492  25.426  53.856  1.00 73.96  ? 25  GLN B N   1 
ATOM   1030 C CA  . GLN B 2 23  ? 24.369  25.817  52.760  1.00 74.63  ? 25  GLN B CA  1 
ATOM   1031 C C   . GLN B 2 23  ? 25.684  26.363  53.297  1.00 78.66  ? 25  GLN B C   1 
ATOM   1032 O O   . GLN B 2 23  ? 25.712  27.256  54.149  1.00 77.30  ? 25  GLN B O   1 
ATOM   1033 C CB  . GLN B 2 23  ? 23.677  26.856  51.864  1.00 76.62  ? 25  GLN B CB  1 
ATOM   1034 C CG  . GLN B 2 23  ? 23.291  28.174  52.540  1.00 79.17  ? 25  GLN B CG  1 
ATOM   1035 C CD  . GLN B 2 23  ? 24.312  29.275  52.308  1.00 77.44  ? 25  GLN B CD  1 
ATOM   1036 O OE1 . GLN B 2 23  ? 24.743  29.506  51.180  1.00 75.42  ? 25  GLN B OE1 1 
ATOM   1037 N NE2 . GLN B 2 23  ? 24.693  29.967  53.374  1.00 78.20  ? 25  GLN B NE2 1 
ATOM   1038 N N   . THR B 2 24  ? 26.779  25.807  52.796  1.00 80.44  ? 26  THR B N   1 
ATOM   1039 C CA  . THR B 2 24  ? 28.104  26.216  53.224  1.00 81.63  ? 26  THR B CA  1 
ATOM   1040 C C   . THR B 2 24  ? 28.677  27.273  52.300  1.00 83.03  ? 26  THR B C   1 
ATOM   1041 O O   . THR B 2 24  ? 29.664  27.928  52.637  1.00 83.25  ? 26  THR B O   1 
ATOM   1042 C CB  . THR B 2 24  ? 29.059  25.019  53.244  1.00 82.49  ? 26  THR B CB  1 
ATOM   1043 O OG1 . THR B 2 24  ? 28.523  24.006  54.099  1.00 83.38  ? 26  THR B OG1 1 
ATOM   1044 C CG2 . THR B 2 24  ? 30.429  25.435  53.757  1.00 88.52  ? 26  THR B CG2 1 
ATOM   1045 N N   . ASN B 2 25  ? 28.052  27.441  51.137  1.00 82.13  ? 27  ASN B N   1 
ATOM   1046 C CA  . ASN B 2 25  ? 28.518  28.415  50.156  1.00 79.19  ? 27  ASN B CA  1 
ATOM   1047 C C   . ASN B 2 25  ? 28.631  29.820  50.728  1.00 74.77  ? 27  ASN B C   1 
ATOM   1048 O O   . ASN B 2 25  ? 29.178  30.715  50.087  1.00 69.97  ? 27  ASN B O   1 
ATOM   1049 C CB  . ASN B 2 25  ? 27.595  28.421  48.937  1.00 84.88  ? 27  ASN B CB  1 
ATOM   1050 C CG  . ASN B 2 25  ? 27.666  27.127  48.144  1.00 93.21  ? 27  ASN B CG  1 
ATOM   1051 O OD1 . ASN B 2 25  ? 28.718  26.769  47.606  1.00 96.57  ? 27  ASN B OD1 1 
ATOM   1052 N ND2 . ASN B 2 25  ? 26.546  26.416  48.071  1.00 95.69  ? 27  ASN B ND2 1 
ATOM   1053 N N   . ASN B 2 26  ? 28.123  30.012  51.940  1.00 74.84  ? 28  ASN B N   1 
ATOM   1054 C CA  . ASN B 2 26  ? 28.182  31.317  52.576  1.00 77.26  ? 28  ASN B CA  1 
ATOM   1055 C C   . ASN B 2 26  ? 27.487  32.356  51.690  1.00 77.07  ? 28  ASN B C   1 
ATOM   1056 O O   . ASN B 2 26  ? 28.010  33.449  51.456  1.00 73.71  ? 28  ASN B O   1 
ATOM   1057 C CB  . ASN B 2 26  ? 29.641  31.720  52.807  1.00 80.73  ? 28  ASN B CB  1 
ATOM   1058 C CG  . ASN B 2 26  ? 29.780  32.869  53.788  1.00 87.72  ? 28  ASN B CG  1 
ATOM   1059 O OD1 . ASN B 2 26  ? 29.124  33.905  53.655  1.00 93.62  ? 28  ASN B OD1 1 
ATOM   1060 N ND2 . ASN B 2 26  ? 30.644  32.693  54.780  1.00 90.70  ? 28  ASN B ND2 1 
ATOM   1061 N N   . HIS B 2 27  ? 26.314  31.992  51.179  1.00 75.81  ? 29  HIS B N   1 
ATOM   1062 C CA  . HIS B 2 27  ? 25.527  32.891  50.344  1.00 74.24  ? 29  HIS B CA  1 
ATOM   1063 C C   . HIS B 2 27  ? 24.574  33.702  51.227  1.00 75.98  ? 29  HIS B C   1 
ATOM   1064 O O   . HIS B 2 27  ? 24.222  33.278  52.334  1.00 75.23  ? 29  HIS B O   1 
ATOM   1065 C CB  . HIS B 2 27  ? 24.712  32.102  49.321  1.00 68.93  ? 29  HIS B CB  1 
ATOM   1066 C CG  . HIS B 2 27  ? 25.524  31.544  48.197  1.00 71.51  ? 29  HIS B CG  1 
ATOM   1067 N ND1 . HIS B 2 27  ? 26.556  32.243  47.608  1.00 72.04  ? 29  HIS B ND1 1 
ATOM   1068 C CD2 . HIS B 2 27  ? 25.412  30.385  47.506  1.00 73.51  ? 29  HIS B CD2 1 
ATOM   1069 C CE1 . HIS B 2 27  ? 27.043  31.540  46.601  1.00 74.37  ? 29  HIS B CE1 1 
ATOM   1070 N NE2 . HIS B 2 27  ? 26.366  30.408  46.517  1.00 75.82  ? 29  HIS B NE2 1 
ATOM   1071 N N   . ASN B 2 28  ? 24.158  34.868  50.744  1.00 71.14  ? 30  ASN B N   1 
ATOM   1072 C CA  . ASN B 2 28  ? 23.242  35.707  51.510  1.00 65.41  ? 30  ASN B CA  1 
ATOM   1073 C C   . ASN B 2 28  ? 21.792  35.292  51.294  1.00 60.04  ? 30  ASN B C   1 
ATOM   1074 O O   . ASN B 2 28  ? 20.992  35.296  52.229  1.00 53.75  ? 30  ASN B O   1 
ATOM   1075 C CB  . ASN B 2 28  ? 23.426  37.180  51.129  1.00 65.39  ? 30  ASN B CB  1 
ATOM   1076 C CG  . ASN B 2 28  ? 24.520  37.863  51.942  1.00 65.66  ? 30  ASN B CG  1 
ATOM   1077 O OD1 . ASN B 2 28  ? 25.182  37.232  52.772  1.00 58.21  ? 30  ASN B OD1 1 
ATOM   1078 N ND2 . ASN B 2 28  ? 24.710  39.164  51.709  1.00 58.20  ? 30  ASN B ND2 1 
ATOM   1079 N N   . ASN B 2 29  ? 21.470  34.918  50.059  1.00 57.01  ? 31  ASN B N   1 
ATOM   1080 C CA  . ASN B 2 29  ? 20.122  34.508  49.686  1.00 57.60  ? 31  ASN B CA  1 
ATOM   1081 C C   . ASN B 2 29  ? 19.873  33.001  49.775  1.00 61.36  ? 31  ASN B C   1 
ATOM   1082 O O   . ASN B 2 29  ? 20.747  32.190  49.471  1.00 59.97  ? 31  ASN B O   1 
ATOM   1083 C CB  . ASN B 2 29  ? 19.821  34.969  48.256  1.00 56.98  ? 31  ASN B CB  1 
ATOM   1084 C CG  . ASN B 2 29  ? 19.489  36.447  48.171  1.00 54.63  ? 31  ASN B CG  1 
ATOM   1085 O OD1 . ASN B 2 29  ? 20.126  37.278  48.817  1.00 60.05  ? 31  ASN B OD1 1 
ATOM   1086 N ND2 . ASN B 2 29  ? 18.492  36.781  47.361  1.00 44.84  ? 31  ASN B ND2 1 
ATOM   1087 N N   . MET B 2 30  ? 18.663  32.644  50.197  1.00 67.21  ? 32  MET B N   1 
ATOM   1088 C CA  . MET B 2 30  ? 18.238  31.251  50.302  1.00 64.53  ? 32  MET B CA  1 
ATOM   1089 C C   . MET B 2 30  ? 16.779  31.131  49.873  1.00 62.69  ? 32  MET B C   1 
ATOM   1090 O O   . MET B 2 30  ? 15.953  31.995  50.177  1.00 63.41  ? 32  MET B O   1 
ATOM   1091 C CB  . MET B 2 30  ? 18.432  30.721  51.723  1.00 60.76  ? 32  MET B CB  1 
ATOM   1092 C CG  . MET B 2 30  ? 19.880  30.348  52.019  1.00 64.13  ? 32  MET B CG  1 
ATOM   1093 S SD  . MET B 2 30  ? 20.038  28.953  53.149  1.00 69.13  ? 32  MET B SD  1 
ATOM   1094 C CE  . MET B 2 30  ? 20.248  29.802  54.695  1.00 58.78  ? 32  MET B CE  1 
ATOM   1095 N N   . TYR B 2 31  ? 16.468  30.056  49.159  1.00 61.75  ? 33  TYR B N   1 
ATOM   1096 C CA  . TYR B 2 31  ? 15.121  29.859  48.644  1.00 60.05  ? 33  TYR B CA  1 
ATOM   1097 C C   . TYR B 2 31  ? 14.534  28.463  48.865  1.00 60.50  ? 33  TYR B C   1 
ATOM   1098 O O   . TYR B 2 31  ? 15.260  27.481  49.012  1.00 63.62  ? 33  TYR B O   1 
ATOM   1099 C CB  . TYR B 2 31  ? 15.115  30.143  47.142  1.00 60.61  ? 33  TYR B CB  1 
ATOM   1100 C CG  . TYR B 2 31  ? 15.922  31.349  46.715  1.00 63.72  ? 33  TYR B CG  1 
ATOM   1101 C CD1 . TYR B 2 31  ? 17.315  31.361  46.814  1.00 64.11  ? 33  TYR B CD1 1 
ATOM   1102 C CD2 . TYR B 2 31  ? 15.292  32.475  46.194  1.00 64.06  ? 33  TYR B CD2 1 
ATOM   1103 C CE1 . TYR B 2 31  ? 18.057  32.468  46.402  1.00 65.16  ? 33  TYR B CE1 1 
ATOM   1104 C CE2 . TYR B 2 31  ? 16.024  33.581  45.780  1.00 64.47  ? 33  TYR B CE2 1 
ATOM   1105 C CZ  . TYR B 2 31  ? 17.400  33.574  45.886  1.00 62.51  ? 33  TYR B CZ  1 
ATOM   1106 O OH  . TYR B 2 31  ? 18.107  34.681  45.479  1.00 64.02  ? 33  TYR B OH  1 
ATOM   1107 N N   . TRP B 2 32  ? 13.205  28.396  48.876  1.00 57.01  ? 34  TRP B N   1 
ATOM   1108 C CA  . TRP B 2 32  ? 12.482  27.142  49.021  1.00 53.15  ? 34  TRP B CA  1 
ATOM   1109 C C   . TRP B 2 32  ? 11.503  27.043  47.861  1.00 54.80  ? 34  TRP B C   1 
ATOM   1110 O O   . TRP B 2 32  ? 10.651  27.913  47.678  1.00 54.00  ? 34  TRP B O   1 
ATOM   1111 C CB  . TRP B 2 32  ? 11.727  27.081  50.353  1.00 57.45  ? 34  TRP B CB  1 
ATOM   1112 C CG  . TRP B 2 32  ? 12.518  26.425  51.463  1.00 63.99  ? 34  TRP B CG  1 
ATOM   1113 C CD1 . TRP B 2 32  ? 12.973  27.014  52.607  1.00 62.88  ? 34  TRP B CD1 1 
ATOM   1114 C CD2 . TRP B 2 32  ? 12.956  25.059  51.515  1.00 64.68  ? 34  TRP B CD2 1 
ATOM   1115 N NE1 . TRP B 2 32  ? 13.668  26.103  53.368  1.00 64.85  ? 34  TRP B NE1 1 
ATOM   1116 C CE2 . TRP B 2 32  ? 13.674  24.896  52.722  1.00 67.58  ? 34  TRP B CE2 1 
ATOM   1117 C CE3 . TRP B 2 32  ? 12.815  23.956  50.656  1.00 68.89  ? 34  TRP B CE3 1 
ATOM   1118 C CZ2 . TRP B 2 32  ? 14.249  23.672  53.096  1.00 71.02  ? 34  TRP B CZ2 1 
ATOM   1119 C CZ3 . TRP B 2 32  ? 13.388  22.736  51.026  1.00 65.25  ? 34  TRP B CZ3 1 
ATOM   1120 C CH2 . TRP B 2 32  ? 14.096  22.608  52.236  1.00 71.31  ? 34  TRP B CH2 1 
ATOM   1121 N N   . TYR B 2 33  ? 11.651  25.989  47.067  1.00 55.02  ? 35  TYR B N   1 
ATOM   1122 C CA  . TYR B 2 33  ? 10.792  25.749  45.914  1.00 55.03  ? 35  TYR B CA  1 
ATOM   1123 C C   . TYR B 2 33  ? 10.022  24.442  46.079  1.00 59.07  ? 35  TYR B C   1 
ATOM   1124 O O   . TYR B 2 33  ? 10.104  23.780  47.109  1.00 62.84  ? 35  TYR B O   1 
ATOM   1125 C CB  . TYR B 2 33  ? 11.630  25.641  44.637  1.00 53.31  ? 35  TYR B CB  1 
ATOM   1126 C CG  . TYR B 2 33  ? 12.357  26.899  44.214  1.00 59.61  ? 35  TYR B CG  1 
ATOM   1127 C CD1 . TYR B 2 33  ? 13.553  27.279  44.819  1.00 55.55  ? 35  TYR B CD1 1 
ATOM   1128 C CD2 . TYR B 2 33  ? 11.868  27.687  43.169  1.00 63.27  ? 35  TYR B CD2 1 
ATOM   1129 C CE1 . TYR B 2 33  ? 14.251  28.407  44.388  1.00 60.11  ? 35  TYR B CE1 1 
ATOM   1130 C CE2 . TYR B 2 33  ? 12.554  28.820  42.732  1.00 64.30  ? 35  TYR B CE2 1 
ATOM   1131 C CZ  . TYR B 2 33  ? 13.745  29.175  43.344  1.00 64.96  ? 35  TYR B CZ  1 
ATOM   1132 O OH  . TYR B 2 33  ? 14.424  30.295  42.910  1.00 60.59  ? 35  TYR B OH  1 
ATOM   1133 N N   . ARG B 2 34  ? 9.273   24.081  45.045  1.00 61.21  ? 36  ARG B N   1 
ATOM   1134 C CA  . ARG B 2 34  ? 8.526   22.834  45.018  1.00 62.48  ? 36  ARG B CA  1 
ATOM   1135 C C   . ARG B 2 34  ? 8.265   22.547  43.557  1.00 64.06  ? 36  ARG B C   1 
ATOM   1136 O O   . ARG B 2 34  ? 7.740   23.395  42.838  1.00 66.12  ? 36  ARG B O   1 
ATOM   1137 C CB  . ARG B 2 34  ? 7.204   22.938  45.788  1.00 66.06  ? 36  ARG B CB  1 
ATOM   1138 C CG  . ARG B 2 34  ? 6.236   24.001  45.303  1.00 66.38  ? 36  ARG B CG  1 
ATOM   1139 C CD  . ARG B 2 34  ? 4.883   23.827  45.975  1.00 63.13  ? 36  ARG B CD  1 
ATOM   1140 N NE  . ARG B 2 34  ? 4.186   22.642  45.476  1.00 70.87  ? 36  ARG B NE  1 
ATOM   1141 C CZ  . ARG B 2 34  ? 3.114   22.096  46.044  1.00 68.07  ? 36  ARG B CZ  1 
ATOM   1142 N NH1 . ARG B 2 34  ? 2.594   22.618  47.148  1.00 66.30  ? 36  ARG B NH1 1 
ATOM   1143 N NH2 . ARG B 2 34  ? 2.560   21.022  45.503  1.00 69.51  ? 36  ARG B NH2 1 
ATOM   1144 N N   . GLN B 2 35  ? 8.654   21.361  43.109  1.00 67.16  ? 37  GLN B N   1 
ATOM   1145 C CA  . GLN B 2 35  ? 8.459   21.000  41.713  1.00 72.48  ? 37  GLN B CA  1 
ATOM   1146 C C   . GLN B 2 35  ? 7.191   20.168  41.526  1.00 73.45  ? 37  GLN B C   1 
ATOM   1147 O O   . GLN B 2 35  ? 6.938   19.211  42.258  1.00 70.68  ? 37  GLN B O   1 
ATOM   1148 C CB  . GLN B 2 35  ? 9.688   20.252  41.181  1.00 64.85  ? 37  GLN B CB  1 
ATOM   1149 C CG  . GLN B 2 35  ? 9.706   20.101  39.666  1.00 64.92  ? 37  GLN B CG  1 
ATOM   1150 C CD  . GLN B 2 35  ? 11.078  19.730  39.120  1.00 70.70  ? 37  GLN B CD  1 
ATOM   1151 O OE1 . GLN B 2 35  ? 11.276  19.676  37.906  1.00 69.86  ? 37  GLN B OE1 1 
ATOM   1152 N NE2 . GLN B 2 35  ? 12.031  19.476  40.013  1.00 64.99  ? 37  GLN B NE2 1 
ATOM   1153 N N   . ASP B 2 36  ? 6.389   20.552  40.542  1.00 75.12  ? 38  ASP B N   1 
ATOM   1154 C CA  . ASP B 2 36  ? 5.150   19.853  40.274  1.00 77.42  ? 38  ASP B CA  1 
ATOM   1155 C C   . ASP B 2 36  ? 4.868   19.825  38.793  1.00 77.99  ? 38  ASP B C   1 
ATOM   1156 O O   . ASP B 2 36  ? 5.000   20.838  38.106  1.00 73.12  ? 38  ASP B O   1 
ATOM   1157 C CB  . ASP B 2 36  ? 3.989   20.538  40.994  1.00 81.14  ? 38  ASP B CB  1 
ATOM   1158 C CG  . ASP B 2 36  ? 4.170   20.561  42.496  1.00 90.97  ? 38  ASP B CG  1 
ATOM   1159 O OD1 . ASP B 2 36  ? 4.288   19.470  43.099  1.00 91.41  ? 38  ASP B OD1 1 
ATOM   1160 O OD2 . ASP B 2 36  ? 4.194   21.672  43.072  1.00 95.16  ? 38  ASP B OD2 1 
ATOM   1161 N N   . THR B 2 37  ? 4.479   18.651  38.311  1.00 79.60  ? 39  THR B N   1 
ATOM   1162 C CA  . THR B 2 37  ? 4.155   18.466  36.911  1.00 80.30  ? 39  THR B CA  1 
ATOM   1163 C C   . THR B 2 37  ? 3.176   19.550  36.493  1.00 77.13  ? 39  THR B C   1 
ATOM   1164 O O   . THR B 2 37  ? 2.065   19.626  37.011  1.00 79.19  ? 39  THR B O   1 
ATOM   1165 C CB  . THR B 2 37  ? 3.514   17.093  36.682  1.00 82.95  ? 39  THR B CB  1 
ATOM   1166 O OG1 . THR B 2 37  ? 4.440   16.071  37.070  1.00 86.06  ? 39  THR B OG1 1 
ATOM   1167 C CG2 . THR B 2 37  ? 3.132   16.919  35.216  1.00 85.45  ? 39  THR B CG2 1 
ATOM   1168 N N   . GLY B 2 38  ? 3.600   20.400  35.567  1.00 76.65  ? 40  GLY B N   1 
ATOM   1169 C CA  . GLY B 2 38  ? 2.737   21.469  35.101  1.00 77.90  ? 40  GLY B CA  1 
ATOM   1170 C C   . GLY B 2 38  ? 3.042   22.843  35.679  1.00 77.09  ? 40  GLY B C   1 
ATOM   1171 O O   . GLY B 2 38  ? 2.412   23.833  35.303  1.00 79.82  ? 40  GLY B O   1 
ATOM   1172 N N   . HIS B 2 39  ? 4.005   22.922  36.587  1.00 74.72  ? 41  HIS B N   1 
ATOM   1173 C CA  . HIS B 2 39  ? 4.346   24.201  37.190  1.00 74.77  ? 41  HIS B CA  1 
ATOM   1174 C C   . HIS B 2 39  ? 5.853   24.393  37.286  1.00 73.04  ? 41  HIS B C   1 
ATOM   1175 O O   . HIS B 2 39  ? 6.326   25.480  37.605  1.00 73.12  ? 41  HIS B O   1 
ATOM   1176 C CB  . HIS B 2 39  ? 3.742   24.284  38.590  1.00 78.20  ? 41  HIS B CB  1 
ATOM   1177 C CG  . HIS B 2 39  ? 2.256   24.099  38.626  1.00 80.52  ? 41  HIS B CG  1 
ATOM   1178 N ND1 . HIS B 2 39  ? 1.367   25.114  38.336  1.00 80.78  ? 41  HIS B ND1 1 
ATOM   1179 C CD2 . HIS B 2 39  ? 1.504   23.015  38.930  1.00 79.86  ? 41  HIS B CD2 1 
ATOM   1180 C CE1 . HIS B 2 39  ? 0.132   24.663  38.463  1.00 77.36  ? 41  HIS B CE1 1 
ATOM   1181 N NE2 . HIS B 2 39  ? 0.187   23.392  38.822  1.00 80.70  ? 41  HIS B NE2 1 
ATOM   1182 N N   . GLY B 2 40  ? 6.604   23.332  37.012  1.00 72.10  ? 42  GLY B N   1 
ATOM   1183 C CA  . GLY B 2 40  ? 8.047   23.422  37.106  1.00 71.85  ? 42  GLY B CA  1 
ATOM   1184 C C   . GLY B 2 40  ? 8.420   23.824  38.520  1.00 73.14  ? 42  GLY B C   1 
ATOM   1185 O O   . GLY B 2 40  ? 7.925   23.241  39.491  1.00 76.81  ? 42  GLY B O   1 
ATOM   1186 N N   . LEU B 2 41  ? 9.288   24.822  38.643  1.00 71.11  ? 43  LEU B N   1 
ATOM   1187 C CA  . LEU B 2 41  ? 9.710   25.311  39.951  1.00 68.99  ? 43  LEU B CA  1 
ATOM   1188 C C   . LEU B 2 41  ? 8.894   26.544  40.352  1.00 64.85  ? 43  LEU B C   1 
ATOM   1189 O O   . LEU B 2 41  ? 8.696   27.461  39.552  1.00 60.67  ? 43  LEU B O   1 
ATOM   1190 C CB  . LEU B 2 41  ? 11.207  25.664  39.941  1.00 72.35  ? 43  LEU B CB  1 
ATOM   1191 C CG  . LEU B 2 41  ? 12.271  24.561  40.012  1.00 72.19  ? 43  LEU B CG  1 
ATOM   1192 C CD1 . LEU B 2 41  ? 12.231  23.903  41.374  1.00 66.96  ? 43  LEU B CD1 1 
ATOM   1193 C CD2 . LEU B 2 41  ? 12.043  23.535  38.916  1.00 74.36  ? 43  LEU B CD2 1 
ATOM   1194 N N   . ARG B 2 42  ? 8.411   26.543  41.590  1.00 60.59  ? 44  ARG B N   1 
ATOM   1195 C CA  . ARG B 2 42  ? 7.631   27.649  42.129  1.00 55.87  ? 44  ARG B CA  1 
ATOM   1196 C C   . ARG B 2 42  ? 8.222   28.057  43.472  1.00 58.70  ? 44  ARG B C   1 
ATOM   1197 O O   . ARG B 2 42  ? 8.310   27.249  44.406  1.00 57.67  ? 44  ARG B O   1 
ATOM   1198 C CB  . ARG B 2 42  ? 6.164   27.244  42.296  1.00 60.73  ? 44  ARG B CB  1 
ATOM   1199 C CG  . ARG B 2 42  ? 5.350   27.325  41.012  1.00 61.67  ? 44  ARG B CG  1 
ATOM   1200 C CD  . ARG B 2 42  ? 4.316   26.219  40.951  1.00 69.84  ? 44  ARG B CD  1 
ATOM   1201 N NE  . ARG B 2 42  ? 3.253   26.355  41.943  1.00 80.25  ? 44  ARG B NE  1 
ATOM   1202 C CZ  . ARG B 2 42  ? 2.418   25.375  42.284  1.00 78.20  ? 44  ARG B CZ  1 
ATOM   1203 N NH1 . ARG B 2 42  ? 2.527   24.182  41.716  1.00 79.37  ? 44  ARG B NH1 1 
ATOM   1204 N NH2 . ARG B 2 42  ? 1.470   25.587  43.188  1.00 80.40  ? 44  ARG B NH2 1 
ATOM   1205 N N   . LEU B 2 43  ? 8.641   29.315  43.554  1.00 55.53  ? 45  LEU B N   1 
ATOM   1206 C CA  . LEU B 2 43  ? 9.236   29.844  44.767  1.00 49.43  ? 45  LEU B CA  1 
ATOM   1207 C C   . LEU B 2 43  ? 8.168   29.937  45.839  1.00 51.86  ? 45  LEU B C   1 
ATOM   1208 O O   . LEU B 2 43  ? 7.049   30.375  45.576  1.00 48.80  ? 45  LEU B O   1 
ATOM   1209 C CB  . LEU B 2 43  ? 9.841   31.222  44.496  1.00 48.93  ? 45  LEU B CB  1 
ATOM   1210 C CG  . LEU B 2 43  ? 10.616  31.850  45.656  1.00 51.74  ? 45  LEU B CG  1 
ATOM   1211 C CD1 . LEU B 2 43  ? 11.634  30.846  46.200  1.00 48.22  ? 45  LEU B CD1 1 
ATOM   1212 C CD2 . LEU B 2 43  ? 11.298  33.133  45.188  1.00 41.73  ? 45  LEU B CD2 1 
ATOM   1213 N N   . ILE B 2 44  ? 8.512   29.508  47.047  1.00 52.52  ? 46  ILE B N   1 
ATOM   1214 C CA  . ILE B 2 44  ? 7.570   29.540  48.157  1.00 56.40  ? 46  ILE B CA  1 
ATOM   1215 C C   . ILE B 2 44  ? 7.944   30.623  49.165  1.00 58.70  ? 46  ILE B C   1 
ATOM   1216 O O   . ILE B 2 44  ? 7.135   31.492  49.497  1.00 55.29  ? 46  ILE B O   1 
ATOM   1217 C CB  . ILE B 2 44  ? 7.522   28.174  48.861  1.00 54.89  ? 46  ILE B CB  1 
ATOM   1218 C CG1 . ILE B 2 44  ? 6.925   27.123  47.932  1.00 60.15  ? 46  ILE B CG1 1 
ATOM   1219 C CG2 . ILE B 2 44  ? 6.707   28.261  50.144  1.00 49.34  ? 46  ILE B CG2 1 
ATOM   1220 C CD1 . ILE B 2 44  ? 7.190   25.693  48.366  1.00 62.41  ? 46  ILE B CD1 1 
ATOM   1221 N N   . TYR B 2 45  ? 9.166   30.548  49.645  1.00 51.51  ? 47  TYR B N   1 
ATOM   1222 C CA  . TYR B 2 45  ? 9.690   31.515  50.584  1.00 58.12  ? 47  TYR B CA  1 
ATOM   1223 C C   . TYR B 2 45  ? 11.186  31.658  50.360  1.00 61.29  ? 47  TYR B C   1 
ATOM   1224 O O   . TYR B 2 45  ? 11.856  30.702  49.936  1.00 61.48  ? 47  TYR B O   1 
ATOM   1225 C CB  . TYR B 2 45  ? 9.399   31.093  52.025  1.00 57.35  ? 47  TYR B CB  1 
ATOM   1226 C CG  . TYR B 2 45  ? 8.230   31.822  52.653  1.00 68.58  ? 47  TYR B CG  1 
ATOM   1227 C CD1 . TYR B 2 45  ? 6.944   31.307  52.576  1.00 20.00  ? 47  TYR B CD1 1 
ATOM   1228 C CD2 . TYR B 2 45  ? 8.415   33.026  53.323  1.00 72.01  ? 47  TYR B CD2 1 
ATOM   1229 C CE1 . TYR B 2 45  ? 5.874   31.967  53.149  1.00 75.05  ? 47  TYR B CE1 1 
ATOM   1230 C CE2 . TYR B 2 45  ? 7.351   33.692  53.901  1.00 20.00  ? 47  TYR B CE2 1 
ATOM   1231 C CZ  . TYR B 2 45  ? 6.083   33.159  53.810  1.00 20.00  ? 47  TYR B CZ  1 
ATOM   1232 O OH  . TYR B 2 45  ? 5.020   33.820  54.383  1.00 20.00  ? 47  TYR B OH  1 
ATOM   1233 N N   . TYR B 2 46  ? 11.717  32.837  50.637  1.00 57.98  ? 48  TYR B N   1 
ATOM   1234 C CA  . TYR B 2 46  ? 13.144  33.066  50.458  1.00 54.86  ? 48  TYR B CA  1 
ATOM   1235 C C   . TYR B 2 46  ? 13.638  34.025  51.523  1.00 56.82  ? 48  TYR B C   1 
ATOM   1236 O O   . TYR B 2 46  ? 12.845  34.574  52.292  1.00 61.00  ? 48  TYR B O   1 
ATOM   1237 C CB  . TYR B 2 46  ? 13.463  33.613  49.090  1.00 49.72  ? 48  TYR B CB  1 
ATOM   1238 C CG  . TYR B 2 46  ? 12.794  34.920  48.685  1.00 45.67  ? 48  TYR B CG  1 
ATOM   1239 C CD1 . TYR B 2 46  ? 11.430  34.970  48.419  1.00 44.47  ? 48  TYR B CD1 1 
ATOM   1240 C CD2 . TYR B 2 46  ? 13.540  36.097  48.529  1.00 46.64  ? 48  TYR B CD2 1 
ATOM   1241 C CE1 . TYR B 2 46  ? 10.819  36.151  47.998  1.00 43.35  ? 48  TYR B CE1 1 
ATOM   1242 C CE2 . TYR B 2 46  ? 12.936  37.291  48.105  1.00 36.42  ? 48  TYR B CE2 1 
ATOM   1243 C CZ  . TYR B 2 46  ? 11.574  37.305  47.840  1.00 39.23  ? 48  TYR B CZ  1 
ATOM   1244 O OH  . TYR B 2 46  ? 10.954  38.455  47.408  1.00 43.65  ? 48  TYR B OH  1 
ATOM   1245 N N   . SER B 2 47  ? 14.946  34.230  51.570  1.00 56.31  ? 49  SER B N   1 
ATOM   1246 C CA  . SER B 2 47  ? 15.510  35.111  52.575  1.00 55.49  ? 49  SER B CA  1 
ATOM   1247 C C   . SER B 2 47  ? 16.726  35.892  52.108  1.00 52.76  ? 49  SER B C   1 
ATOM   1248 O O   . SER B 2 47  ? 17.500  35.426  51.269  1.00 47.94  ? 49  SER B O   1 
ATOM   1249 C CB  . SER B 2 47  ? 15.885  34.294  53.816  1.00 56.97  ? 49  SER B CB  1 
ATOM   1250 O OG  . SER B 2 47  ? 16.459  35.115  54.810  1.00 60.22  ? 49  SER B OG  1 
ATOM   1251 N N   . TYR B 2 48  ? 16.876  37.097  52.652  1.00 50.80  ? 50  TYR B N   1 
ATOM   1252 C CA  . TYR B 2 48  ? 18.030  37.920  52.342  1.00 55.07  ? 50  TYR B CA  1 
ATOM   1253 C C   . TYR B 2 48  ? 19.065  37.524  53.401  1.00 57.50  ? 50  TYR B C   1 
ATOM   1254 O O   . TYR B 2 48  ? 20.157  38.095  53.490  1.00 57.15  ? 50  TYR B O   1 
ATOM   1255 C CB  . TYR B 2 48  ? 17.648  39.397  52.380  1.00 50.77  ? 50  TYR B CB  1 
ATOM   1256 C CG  . TYR B 2 48  ? 16.627  39.759  51.315  1.00 44.92  ? 50  TYR B CG  1 
ATOM   1257 C CD1 . TYR B 2 48  ? 16.829  39.407  49.976  1.00 41.81  ? 50  TYR B CD1 1 
ATOM   1258 C CD2 . TYR B 2 48  ? 15.459  40.455  51.645  1.00 43.51  ? 50  TYR B CD2 1 
ATOM   1259 C CE1 . TYR B 2 48  ? 15.890  39.740  48.991  1.00 40.78  ? 50  TYR B CE1 1 
ATOM   1260 C CE2 . TYR B 2 48  ? 14.510  40.794  50.667  1.00 38.78  ? 50  TYR B CE2 1 
ATOM   1261 C CZ  . TYR B 2 48  ? 14.735  40.430  49.344  1.00 46.51  ? 50  TYR B CZ  1 
ATOM   1262 O OH  . TYR B 2 48  ? 13.803  40.745  48.381  1.00 48.00  ? 50  TYR B OH  1 
ATOM   1263 N N   . GLY B 2 49  ? 18.640  36.511  54.172  1.00 66.50  ? 51  GLY B N   1 
ATOM   1264 C CA  . GLY B 2 49  ? 19.385  35.810  55.206  1.00 67.48  ? 51  GLY B CA  1 
ATOM   1265 C C   . GLY B 2 49  ? 19.947  36.374  56.478  1.00 69.27  ? 51  GLY B C   1 
ATOM   1266 O O   . GLY B 2 49  ? 21.150  36.516  56.588  1.00 73.67  ? 51  GLY B O   1 
ATOM   1267 N N   . ALA B 2 50  ? 19.141  36.734  57.451  1.00 71.18  ? 52  ALA B N   1 
ATOM   1268 C CA  . ALA B 2 50  ? 19.796  37.182  58.684  1.00 77.50  ? 52  ALA B CA  1 
ATOM   1269 C C   . ALA B 2 50  ? 19.006  36.399  59.661  1.00 77.22  ? 52  ALA B C   1 
ATOM   1270 O O   . ALA B 2 50  ? 19.461  35.432  60.325  1.00 82.92  ? 52  ALA B O   1 
ATOM   1271 C CB  . ALA B 2 50  ? 19.555  38.676  58.945  1.00 72.84  ? 52  ALA B CB  1 
ATOM   1272 N N   . GLY B 2 51  ? 17.791  36.964  59.612  1.00 77.31  ? 53  GLY B N   1 
ATOM   1273 C CA  . GLY B 2 51  ? 16.517  36.723  60.263  1.00 72.80  ? 53  GLY B CA  1 
ATOM   1274 C C   . GLY B 2 51  ? 15.469  37.398  59.322  1.00 71.82  ? 53  GLY B C   1 
ATOM   1275 O O   . GLY B 2 51  ? 14.519  38.079  59.766  1.00 69.79  ? 53  GLY B O   1 
ATOM   1276 N N   . SER B 2 52  ? 15.684  37.204  58.009  1.00 67.25  ? 54  SER B N   1 
ATOM   1277 C CA  . SER B 2 52  ? 14.854  37.706  56.896  1.00 61.74  ? 54  SER B CA  1 
ATOM   1278 C C   . SER B 2 52  ? 13.953  36.582  56.353  1.00 54.37  ? 54  SER B C   1 
ATOM   1279 O O   . SER B 2 52  ? 14.295  35.411  56.437  1.00 59.35  ? 54  SER B O   1 
ATOM   1280 C CB  . SER B 2 52  ? 15.767  38.251  55.778  1.00 64.06  ? 54  SER B CB  1 
ATOM   1281 O OG  . SER B 2 52  ? 15.116  38.249  54.515  1.00 59.34  ? 54  SER B OG  1 
ATOM   1282 N N   . THR B 2 53  ? 12.806  36.959  55.803  1.00 54.29  ? 55  THR B N   1 
ATOM   1283 C CA  . THR B 2 53  ? 11.828  36.021  55.286  1.00 49.79  ? 55  THR B CA  1 
ATOM   1284 C C   . THR B 2 53  ? 10.911  36.797  54.353  1.00 49.45  ? 55  THR B C   1 
ATOM   1285 O O   . THR B 2 53  ? 10.368  37.836  54.732  1.00 48.95  ? 55  THR B O   1 
ATOM   1286 C CB  . THR B 2 53  ? 11.022  35.415  56.465  1.00 52.44  ? 55  THR B CB  1 
ATOM   1287 O OG1 . THR B 2 53  ? 11.447  34.067  56.673  1.00 60.00  ? 55  THR B OG1 1 
ATOM   1288 C CG2 . THR B 2 53  ? 9.522   35.446  56.204  1.00 49.48  ? 55  THR B CG2 1 
ATOM   1289 N N   . GLU B 2 54  ? 10.750  36.303  53.130  1.00 50.01  ? 56  GLU B N   1 
ATOM   1290 C CA  . GLU B 2 54  ? 9.890   36.972  52.150  1.00 54.46  ? 56  GLU B CA  1 
ATOM   1291 C C   . GLU B 2 54  ? 9.038   35.947  51.398  1.00 52.06  ? 56  GLU B C   1 
ATOM   1292 O O   . GLU B 2 54  ? 9.488   34.833  51.128  1.00 51.59  ? 56  GLU B O   1 
ATOM   1293 C CB  . GLU B 2 54  ? 10.733  37.777  51.144  1.00 47.57  ? 56  GLU B CB  1 
ATOM   1294 C CG  . GLU B 2 54  ? 11.732  38.776  51.755  1.00 50.06  ? 56  GLU B CG  1 
ATOM   1295 C CD  . GLU B 2 54  ? 11.083  39.833  52.644  1.00 57.66  ? 56  GLU B CD  1 
ATOM   1296 O OE1 . GLU B 2 54  ? 9.949   40.259  52.342  1.00 57.70  ? 56  GLU B OE1 1 
ATOM   1297 O OE2 . GLU B 2 54  ? 11.722  40.250  53.635  1.00 62.31  ? 56  GLU B OE2 1 
ATOM   1298 N N   . LYS B 2 55  ? 7.812   36.326  51.053  1.00 51.39  ? 57  LYS B N   1 
ATOM   1299 C CA  . LYS B 2 55  ? 6.917   35.416  50.352  1.00 51.85  ? 57  LYS B CA  1 
ATOM   1300 C C   . LYS B 2 55  ? 7.241   35.281  48.879  1.00 53.51  ? 57  LYS B C   1 
ATOM   1301 O O   . LYS B 2 55  ? 7.536   36.262  48.209  1.00 58.66  ? 57  LYS B O   1 
ATOM   1302 C CB  . LYS B 2 55  ? 5.473   35.875  50.514  1.00 50.72  ? 57  LYS B CB  1 
ATOM   1303 C CG  . LYS B 2 55  ? 5.012   35.892  51.954  1.00 55.09  ? 57  LYS B CG  1 
ATOM   1304 C CD  . LYS B 2 55  ? 3.553   36.285  52.062  1.00 54.16  ? 57  LYS B CD  1 
ATOM   1305 C CE  . LYS B 2 55  ? 3.133   36.415  53.512  1.00 53.56  ? 57  LYS B CE  1 
ATOM   1306 N NZ  . LYS B 2 55  ? 1.677   36.709  53.628  1.00 59.43  ? 57  LYS B NZ  1 
ATOM   1307 N N   . GLY B 2 56  ? 7.185   34.053  48.379  1.00 56.67  ? 58  GLY B N   1 
ATOM   1308 C CA  . GLY B 2 56  ? 7.463   33.814  46.975  1.00 56.52  ? 58  GLY B CA  1 
ATOM   1309 C C   . GLY B 2 56  ? 6.191   33.901  46.158  1.00 51.39  ? 58  GLY B C   1 
ATOM   1310 O O   . GLY B 2 56  ? 5.388   34.805  46.347  1.00 52.55  ? 58  GLY B O   1 
ATOM   1311 N N   . ASP B 2 57  ? 5.998   32.953  45.253  1.00 52.60  ? 59  ASP B N   1 
ATOM   1312 C CA  . ASP B 2 57  ? 4.805   32.940  44.417  1.00 55.92  ? 59  ASP B CA  1 
ATOM   1313 C C   . ASP B 2 57  ? 3.629   32.268  45.139  1.00 58.47  ? 59  ASP B C   1 
ATOM   1314 O O   . ASP B 2 57  ? 2.506   32.766  45.079  1.00 56.53  ? 59  ASP B O   1 
ATOM   1315 C CB  . ASP B 2 57  ? 5.118   32.222  43.105  1.00 64.23  ? 59  ASP B CB  1 
ATOM   1316 C CG  . ASP B 2 57  ? 6.395   32.739  42.449  1.00 71.49  ? 59  ASP B CG  1 
ATOM   1317 O OD1 . ASP B 2 57  ? 6.397   33.906  42.002  1.00 78.89  ? 59  ASP B OD1 1 
ATOM   1318 O OD2 . ASP B 2 57  ? 7.396   31.985  42.390  1.00 65.49  ? 59  ASP B OD2 1 
ATOM   1319 N N   . ILE B 2 58  ? 3.894   31.149  45.821  1.00 61.43  ? 60  ILE B N   1 
ATOM   1320 C CA  . ILE B 2 58  ? 2.866   30.409  46.573  1.00 66.28  ? 60  ILE B CA  1 
ATOM   1321 C C   . ILE B 2 58  ? 3.282   30.162  48.023  1.00 66.50  ? 60  ILE B C   1 
ATOM   1322 O O   . ILE B 2 58  ? 3.752   29.077  48.365  1.00 70.26  ? 60  ILE B O   1 
ATOM   1323 C CB  . ILE B 2 58  ? 2.560   29.004  45.975  1.00 67.42  ? 60  ILE B CB  1 
ATOM   1324 C CG1 . ILE B 2 58  ? 3.550   28.650  44.865  1.00 68.62  ? 60  ILE B CG1 1 
ATOM   1325 C CG2 . ILE B 2 58  ? 1.115   28.955  45.493  1.00 71.08  ? 60  ILE B CG2 1 
ATOM   1326 C CD1 . ILE B 2 58  ? 3.211   29.278  43.526  1.00 70.32  ? 60  ILE B CD1 1 
ATOM   1327 N N   . PRO B 2 59  ? 3.105   31.162  48.895  1.00 66.10  ? 61  PRO B N   1 
ATOM   1328 C CA  . PRO B 2 59  ? 3.471   31.037  50.313  1.00 63.82  ? 61  PRO B CA  1 
ATOM   1329 C C   . PRO B 2 59  ? 2.380   30.514  51.260  1.00 65.60  ? 61  PRO B C   1 
ATOM   1330 O O   . PRO B 2 59  ? 2.659   30.194  52.421  1.00 62.25  ? 61  PRO B O   1 
ATOM   1331 C CB  . PRO B 2 59  ? 3.887   32.456  50.668  1.00 63.90  ? 61  PRO B CB  1 
ATOM   1332 C CG  . PRO B 2 59  ? 2.901   33.271  49.874  1.00 61.30  ? 61  PRO B CG  1 
ATOM   1333 C CD  . PRO B 2 59  ? 2.884   32.574  48.529  1.00 60.94  ? 61  PRO B CD  1 
ATOM   1334 N N   . ASP B 2 60  ? 1.146   30.437  50.772  1.00 64.85  ? 62  ASP B N   1 
ATOM   1335 C CA  . ASP B 2 60  ? 0.025   29.979  51.591  1.00 66.06  ? 62  ASP B CA  1 
ATOM   1336 C C   . ASP B 2 60  ? 0.199   28.582  52.156  1.00 65.72  ? 62  ASP B C   1 
ATOM   1337 O O   . ASP B 2 60  ? 0.562   27.650  51.443  1.00 66.46  ? 62  ASP B O   1 
ATOM   1338 C CB  . ASP B 2 60  ? -1.267  30.050  50.787  1.00 69.43  ? 62  ASP B CB  1 
ATOM   1339 C CG  . ASP B 2 60  ? -1.542  31.445  50.278  1.00 71.55  ? 62  ASP B CG  1 
ATOM   1340 O OD1 . ASP B 2 60  ? -0.723  31.958  49.489  1.00 80.25  ? 62  ASP B OD1 1 
ATOM   1341 O OD2 . ASP B 2 60  ? -2.567  32.033  50.673  1.00 67.58  ? 62  ASP B OD2 1 
ATOM   1342 N N   . GLY B 2 61  ? -0.065  28.447  53.451  1.00 63.28  ? 63  GLY B N   1 
ATOM   1343 C CA  . GLY B 2 61  ? 0.081   27.159  54.096  1.00 60.93  ? 63  GLY B CA  1 
ATOM   1344 C C   . GLY B 2 61  ? 1.508   26.950  54.561  1.00 64.15  ? 63  GLY B C   1 
ATOM   1345 O O   . GLY B 2 61  ? 1.801   26.002  55.295  1.00 65.95  ? 63  GLY B O   1 
ATOM   1346 N N   . TYR B 2 62  ? 2.407   27.834  54.138  1.00 62.50  ? 65  TYR B N   1 
ATOM   1347 C CA  . TYR B 2 62  ? 3.802   27.710  54.537  1.00 62.27  ? 65  TYR B CA  1 
ATOM   1348 C C   . TYR B 2 62  ? 4.316   28.881  55.356  1.00 62.87  ? 65  TYR B C   1 
ATOM   1349 O O   . TYR B 2 62  ? 3.689   29.939  55.446  1.00 67.53  ? 65  TYR B O   1 
ATOM   1350 C CB  . TYR B 2 62  ? 4.720   27.558  53.322  1.00 60.26  ? 65  TYR B CB  1 
ATOM   1351 C CG  . TYR B 2 62  ? 4.381   26.432  52.380  1.00 58.11  ? 65  TYR B CG  1 
ATOM   1352 C CD1 . TYR B 2 62  ? 3.468   26.620  51.341  1.00 59.45  ? 65  TYR B CD1 1 
ATOM   1353 C CD2 . TYR B 2 62  ? 5.017   25.197  52.487  1.00 58.42  ? 65  TYR B CD2 1 
ATOM   1354 C CE1 . TYR B 2 62  ? 3.204   25.606  50.424  1.00 66.57  ? 65  TYR B CE1 1 
ATOM   1355 C CE2 . TYR B 2 62  ? 4.759   24.172  51.578  1.00 65.67  ? 65  TYR B CE2 1 
ATOM   1356 C CZ  . TYR B 2 62  ? 3.855   24.383  50.546  1.00 68.92  ? 65  TYR B CZ  1 
ATOM   1357 O OH  . TYR B 2 62  ? 3.614   23.384  49.629  1.00 71.10  ? 65  TYR B OH  1 
ATOM   1358 N N   . LYS B 2 63  ? 5.483   28.657  55.945  1.00 62.24  ? 66  LYS B N   1 
ATOM   1359 C CA  . LYS B 2 63  ? 6.185   29.640  56.749  1.00 62.33  ? 66  LYS B CA  1 
ATOM   1360 C C   . LYS B 2 63  ? 7.636   29.202  56.754  1.00 61.79  ? 66  LYS B C   1 
ATOM   1361 O O   . LYS B 2 63  ? 7.930   28.025  56.955  1.00 65.47  ? 66  LYS B O   1 
ATOM   1362 C CB  . LYS B 2 63  ? 5.650   29.671  58.180  1.00 60.62  ? 66  LYS B CB  1 
ATOM   1363 C CG  . LYS B 2 63  ? 4.281   30.298  58.311  1.00 60.30  ? 66  LYS B CG  1 
ATOM   1364 C CD  . LYS B 2 63  ? 4.148   31.030  59.641  1.00 75.84  ? 66  LYS B CD  1 
ATOM   1365 C CE  . LYS B 2 63  ? 4.364   30.100  60.832  1.00 84.09  ? 66  LYS B CE  1 
ATOM   1366 N NZ  . LYS B 2 63  ? 4.217   30.812  62.138  1.00 87.10  ? 66  LYS B NZ  1 
ATOM   1367 N N   . ALA B 2 64  ? 8.542   30.138  56.513  1.00 57.24  ? 67  ALA B N   1 
ATOM   1368 C CA  . ALA B 2 64  ? 9.956   29.810  56.497  1.00 55.49  ? 67  ALA B CA  1 
ATOM   1369 C C   . ALA B 2 64  ? 10.655  30.466  57.680  1.00 55.76  ? 67  ALA B C   1 
ATOM   1370 O O   . ALA B 2 64  ? 10.093  31.337  58.346  1.00 57.87  ? 67  ALA B O   1 
ATOM   1371 C CB  . ALA B 2 64  ? 10.584  30.269  55.182  1.00 51.90  ? 67  ALA B CB  1 
ATOM   1372 N N   . SER B 2 65  ? 11.884  30.042  57.941  1.00 54.32  ? 68  SER B N   1 
ATOM   1373 C CA  . SER B 2 65  ? 12.651  30.596  59.042  1.00 59.68  ? 68  SER B CA  1 
ATOM   1374 C C   . SER B 2 65  ? 14.144  30.504  58.755  1.00 64.39  ? 68  SER B C   1 
ATOM   1375 O O   . SER B 2 65  ? 14.680  29.424  58.505  1.00 66.02  ? 68  SER B O   1 
ATOM   1376 C CB  . SER B 2 65  ? 12.319  29.855  60.336  1.00 60.72  ? 68  SER B CB  1 
ATOM   1377 O OG  . SER B 2 65  ? 13.005  30.426  61.432  1.00 61.76  ? 68  SER B OG  1 
ATOM   1378 N N   . ARG B 2 66  ? 14.812  31.649  58.794  1.00 68.66  ? 69  ARG B N   1 
ATOM   1379 C CA  . ARG B 2 66  ? 16.241  31.712  58.531  1.00 74.26  ? 69  ARG B CA  1 
ATOM   1380 C C   . ARG B 2 66  ? 16.940  32.186  59.806  1.00 77.52  ? 69  ARG B C   1 
ATOM   1381 O O   . ARG B 2 66  ? 17.234  33.372  59.959  1.00 81.89  ? 69  ARG B O   1 
ATOM   1382 C CB  . ARG B 2 66  ? 16.489  32.682  57.373  1.00 70.85  ? 69  ARG B CB  1 
ATOM   1383 C CG  . ARG B 2 66  ? 17.550  32.237  56.378  1.00 68.15  ? 69  ARG B CG  1 
ATOM   1384 C CD  . ARG B 2 66  ? 18.915  32.725  56.788  1.00 66.23  ? 69  ARG B CD  1 
ATOM   1385 N NE  . ARG B 2 66  ? 19.940  32.526  55.762  1.00 71.14  ? 69  ARG B NE  1 
ATOM   1386 C CZ  . ARG B 2 66  ? 19.840  32.905  54.489  1.00 62.78  ? 69  ARG B CZ  1 
ATOM   1387 N NH1 . ARG B 2 66  ? 18.746  33.503  54.042  1.00 70.33  ? 69  ARG B NH1 1 
ATOM   1388 N NH2 . ARG B 2 66  ? 20.861  32.725  53.667  1.00 62.85  ? 69  ARG B NH2 1 
ATOM   1389 N N   . PRO B 2 67  ? 17.212  31.256  60.741  1.00 77.03  ? 70  PRO B N   1 
ATOM   1390 C CA  . PRO B 2 67  ? 17.870  31.535  62.024  1.00 76.51  ? 70  PRO B CA  1 
ATOM   1391 C C   . PRO B 2 67  ? 19.358  31.873  61.928  1.00 75.65  ? 70  PRO B C   1 
ATOM   1392 O O   . PRO B 2 67  ? 19.957  32.355  62.893  1.00 69.03  ? 70  PRO B O   1 
ATOM   1393 C CB  . PRO B 2 67  ? 17.627  30.254  62.809  1.00 77.69  ? 70  PRO B CB  1 
ATOM   1394 C CG  . PRO B 2 67  ? 17.749  29.214  61.741  1.00 76.09  ? 70  PRO B CG  1 
ATOM   1395 C CD  . PRO B 2 67  ? 16.930  29.814  60.612  1.00 75.02  ? 70  PRO B CD  1 
ATOM   1396 N N   . SER B 2 68  ? 19.953  31.616  60.767  1.00 75.28  ? 71  SER B N   1 
ATOM   1397 C CA  . SER B 2 68  ? 21.369  31.893  60.567  1.00 77.82  ? 71  SER B CA  1 
ATOM   1398 C C   . SER B 2 68  ? 21.760  31.803  59.098  1.00 77.13  ? 71  SER B C   1 
ATOM   1399 O O   . SER B 2 68  ? 21.076  31.174  58.295  1.00 78.97  ? 71  SER B O   1 
ATOM   1400 C CB  . SER B 2 68  ? 22.215  30.916  61.385  1.00 78.44  ? 71  SER B CB  1 
ATOM   1401 O OG  . SER B 2 68  ? 21.934  29.578  61.014  1.00 79.53  ? 71  SER B OG  1 
ATOM   1402 N N   . GLN B 2 69  ? 22.881  32.427  58.766  1.00 75.14  ? 72  GLN B N   1 
ATOM   1403 C CA  . GLN B 2 69  ? 23.385  32.464  57.403  1.00 79.06  ? 72  GLN B CA  1 
ATOM   1404 C C   . GLN B 2 69  ? 23.253  31.182  56.591  1.00 81.89  ? 72  GLN B C   1 
ATOM   1405 O O   . GLN B 2 69  ? 22.958  31.233  55.398  1.00 86.04  ? 72  GLN B O   1 
ATOM   1406 C CB  . GLN B 2 69  ? 24.855  32.892  57.412  1.00 78.74  ? 72  GLN B CB  1 
ATOM   1407 C CG  . GLN B 2 69  ? 25.110  34.274  56.842  1.00 87.72  ? 72  GLN B CG  1 
ATOM   1408 C CD  . GLN B 2 69  ? 25.024  34.310  55.329  1.00 89.90  ? 72  GLN B CD  1 
ATOM   1409 O OE1 . GLN B 2 69  ? 25.888  33.769  54.633  1.00 85.96  ? 72  GLN B OE1 1 
ATOM   1410 N NE2 . GLN B 2 69  ? 23.978  34.946  54.810  1.00 89.55  ? 72  GLN B NE2 1 
ATOM   1411 N N   . GLU B 2 70  ? 23.466  30.035  57.229  1.00 83.76  ? 73  GLU B N   1 
ATOM   1412 C CA  . GLU B 2 70  ? 23.425  28.754  56.525  1.00 80.53  ? 73  GLU B CA  1 
ATOM   1413 C C   . GLU B 2 70  ? 22.192  27.896  56.753  1.00 76.46  ? 73  GLU B C   1 
ATOM   1414 O O   . GLU B 2 70  ? 22.061  26.832  56.157  1.00 73.01  ? 73  GLU B O   1 
ATOM   1415 C CB  . GLU B 2 70  ? 24.669  27.938  56.880  1.00 83.14  ? 73  GLU B CB  1 
ATOM   1416 C CG  . GLU B 2 70  ? 24.892  27.813  58.373  1.00 93.82  ? 73  GLU B CG  1 
ATOM   1417 C CD  . GLU B 2 70  ? 25.151  29.159  59.033  1.00 102.39 ? 73  GLU B CD  1 
ATOM   1418 O OE1 . GLU B 2 70  ? 26.263  29.706  58.860  1.00 108.86 ? 73  GLU B OE1 1 
ATOM   1419 O OE2 . GLU B 2 70  ? 24.235  29.677  59.711  1.00 102.99 ? 73  GLU B OE2 1 
ATOM   1420 N N   . ASN B 2 71  ? 21.280  28.350  57.600  1.00 80.21  ? 74  ASN B N   1 
ATOM   1421 C CA  . ASN B 2 71  ? 20.085  27.565  57.872  1.00 79.84  ? 74  ASN B CA  1 
ATOM   1422 C C   . ASN B 2 71  ? 18.773  28.234  57.473  1.00 73.95  ? 74  ASN B C   1 
ATOM   1423 O O   . ASN B 2 71  ? 18.431  29.317  57.953  1.00 70.33  ? 74  ASN B O   1 
ATOM   1424 C CB  . ASN B 2 71  ? 20.054  27.174  59.353  1.00 86.35  ? 74  ASN B CB  1 
ATOM   1425 C CG  . ASN B 2 71  ? 21.132  26.157  59.709  1.00 90.45  ? 74  ASN B CG  1 
ATOM   1426 O OD1 . ASN B 2 71  ? 21.539  26.045  60.867  1.00 94.27  ? 74  ASN B OD1 1 
ATOM   1427 N ND2 . ASN B 2 71  ? 21.591  25.404  58.713  1.00 88.10  ? 74  ASN B ND2 1 
ATOM   1428 N N   . PHE B 2 72  ? 18.049  27.564  56.585  1.00 67.42  ? 75  PHE B N   1 
ATOM   1429 C CA  . PHE B 2 72  ? 16.762  28.040  56.105  1.00 62.45  ? 75  PHE B CA  1 
ATOM   1430 C C   . PHE B 2 72  ? 15.814  26.839  56.128  1.00 60.61  ? 75  PHE B C   1 
ATOM   1431 O O   . PHE B 2 72  ? 16.065  25.825  55.477  1.00 58.78  ? 75  PHE B O   1 
ATOM   1432 C CB  . PHE B 2 72  ? 16.922  28.600  54.686  1.00 60.51  ? 75  PHE B CB  1 
ATOM   1433 C CG  . PHE B 2 72  ? 15.710  29.329  54.166  1.00 51.73  ? 75  PHE B CG  1 
ATOM   1434 C CD1 . PHE B 2 72  ? 14.929  30.109  55.012  1.00 53.40  ? 75  PHE B CD1 1 
ATOM   1435 C CD2 . PHE B 2 72  ? 15.386  29.279  52.810  1.00 53.32  ? 75  PHE B CD2 1 
ATOM   1436 C CE1 . PHE B 2 72  ? 13.842  30.832  54.515  1.00 56.00  ? 75  PHE B CE1 1 
ATOM   1437 C CE2 . PHE B 2 72  ? 14.306  29.994  52.302  1.00 54.68  ? 75  PHE B CE2 1 
ATOM   1438 C CZ  . PHE B 2 72  ? 13.530  30.774  53.157  1.00 57.25  ? 75  PHE B CZ  1 
ATOM   1439 N N   . SER B 2 73  ? 14.734  26.957  56.894  1.00 62.39  ? 76  SER B N   1 
ATOM   1440 C CA  . SER B 2 73  ? 13.754  25.881  57.032  1.00 65.45  ? 76  SER B CA  1 
ATOM   1441 C C   . SER B 2 73  ? 12.344  26.235  56.540  1.00 67.68  ? 76  SER B C   1 
ATOM   1442 O O   . SER B 2 73  ? 11.898  27.381  56.642  1.00 68.38  ? 76  SER B O   1 
ATOM   1443 C CB  . SER B 2 73  ? 13.659  25.462  58.500  1.00 63.70  ? 76  SER B CB  1 
ATOM   1444 O OG  . SER B 2 73  ? 13.050  26.487  59.277  1.00 61.29  ? 76  SER B OG  1 
ATOM   1445 N N   . LEU B 2 74  ? 11.647  25.232  56.016  1.00 63.37  ? 77  LEU B N   1 
ATOM   1446 C CA  . LEU B 2 74  ? 10.283  25.403  55.538  1.00 61.60  ? 77  LEU B CA  1 
ATOM   1447 C C   . LEU B 2 74  ? 9.369   24.641  56.509  1.00 65.92  ? 77  LEU B C   1 
ATOM   1448 O O   . LEU B 2 74  ? 9.673   23.517  56.913  1.00 63.71  ? 77  LEU B O   1 
ATOM   1449 C CB  . LEU B 2 74  ? 10.156  24.852  54.120  1.00 53.36  ? 77  LEU B CB  1 
ATOM   1450 C CG  . LEU B 2 74  ? 8.898   25.263  53.363  1.00 48.79  ? 77  LEU B CG  1 
ATOM   1451 C CD1 . LEU B 2 74  ? 8.769   26.787  53.368  1.00 43.82  ? 77  LEU B CD1 1 
ATOM   1452 C CD2 . LEU B 2 74  ? 8.968   24.734  51.945  1.00 45.02  ? 77  LEU B CD2 1 
ATOM   1453 N N   . THR B 2 75  ? 8.250   25.251  56.885  1.00 68.37  ? 78  THR B N   1 
ATOM   1454 C CA  . THR B 2 75  ? 7.344   24.632  57.844  1.00 69.97  ? 78  THR B CA  1 
ATOM   1455 C C   . THR B 2 75  ? 5.863   24.650  57.474  1.00 75.02  ? 78  THR B C   1 
ATOM   1456 O O   . THR B 2 75  ? 5.310   25.696  57.130  1.00 73.04  ? 78  THR B O   1 
ATOM   1457 C CB  . THR B 2 75  ? 7.481   25.311  59.219  1.00 71.35  ? 78  THR B CB  1 
ATOM   1458 O OG1 . THR B 2 75  ? 8.856   25.296  59.628  1.00 71.29  ? 78  THR B OG1 1 
ATOM   1459 C CG2 . THR B 2 75  ? 6.625   24.595  60.254  1.00 72.82  ? 78  THR B CG2 1 
ATOM   1460 N N   . LEU B 2 76  ? 5.229   23.482  57.565  1.00 78.46  ? 79  LEU B N   1 
ATOM   1461 C CA  . LEU B 2 76  ? 3.802   23.333  57.283  1.00 76.88  ? 79  LEU B CA  1 
ATOM   1462 C C   . LEU B 2 76  ? 3.166   23.007  58.631  1.00 81.11  ? 79  LEU B C   1 
ATOM   1463 O O   . LEU B 2 76  ? 3.365   21.915  59.162  1.00 87.74  ? 79  LEU B O   1 
ATOM   1464 C CB  . LEU B 2 76  ? 3.559   22.182  56.302  1.00 69.92  ? 79  LEU B CB  1 
ATOM   1465 C CG  . LEU B 2 76  ? 4.300   22.216  54.963  1.00 65.23  ? 79  LEU B CG  1 
ATOM   1466 C CD1 . LEU B 2 76  ? 5.782   22.002  55.203  1.00 62.76  ? 79  LEU B CD1 1 
ATOM   1467 C CD2 . LEU B 2 76  ? 3.765   21.130  54.039  1.00 63.92  ? 79  LEU B CD2 1 
ATOM   1468 N N   . GLU B 2 77  ? 2.412   23.947  59.190  1.00 83.96  ? 80  GLU B N   1 
ATOM   1469 C CA  . GLU B 2 77  ? 1.800   23.731  60.499  1.00 87.67  ? 80  GLU B CA  1 
ATOM   1470 C C   . GLU B 2 77  ? 0.520   22.907  60.476  1.00 85.78  ? 80  GLU B C   1 
ATOM   1471 O O   . GLU B 2 77  ? -0.145  22.754  61.500  1.00 84.67  ? 80  GLU B O   1 
ATOM   1472 C CB  . GLU B 2 77  ? 1.550   25.077  61.187  1.00 91.09  ? 80  GLU B CB  1 
ATOM   1473 C CG  . GLU B 2 77  ? 2.826   25.890  61.353  1.00 103.99 ? 80  GLU B CG  1 
ATOM   1474 C CD  . GLU B 2 77  ? 2.646   27.136  62.198  1.00 109.41 ? 80  GLU B CD  1 
ATOM   1475 O OE1 . GLU B 2 77  ? 1.797   27.987  61.849  1.00 110.86 ? 80  GLU B OE1 1 
ATOM   1476 O OE2 . GLU B 2 77  ? 3.365   27.262  63.213  1.00 110.71 ? 80  GLU B OE2 1 
ATOM   1477 N N   . SER B 2 78  ? 0.184   22.369  59.309  1.00 83.22  ? 81  SER B N   1 
ATOM   1478 C CA  . SER B 2 78  ? -1.014  21.552  59.155  1.00 76.24  ? 81  SER B CA  1 
ATOM   1479 C C   . SER B 2 78  ? -1.025  20.963  57.753  1.00 73.26  ? 81  SER B C   1 
ATOM   1480 O O   . SER B 2 78  ? -1.826  21.363  56.912  1.00 75.80  ? 81  SER B O   1 
ATOM   1481 C CB  . SER B 2 78  ? -2.265  22.405  59.377  1.00 77.41  ? 81  SER B CB  1 
ATOM   1482 O OG  . SER B 2 78  ? -3.436  21.609  59.362  1.00 79.30  ? 81  SER B OG  1 
ATOM   1483 N N   . ALA B 2 79  ? -0.128  20.010  57.514  1.00 70.10  ? 82  ALA B N   1 
ATOM   1484 C CA  . ALA B 2 79  ? 0.008   19.357  56.217  1.00 72.27  ? 82  ALA B CA  1 
ATOM   1485 C C   . ALA B 2 79  ? -1.306  19.191  55.451  1.00 75.52  ? 82  ALA B C   1 
ATOM   1486 O O   . ALA B 2 79  ? -2.375  19.025  56.041  1.00 75.60  ? 82  ALA B O   1 
ATOM   1487 C CB  . ALA B 2 79  ? 0.686   18.008  56.393  1.00 73.71  ? 82  ALA B CB  1 
ATOM   1488 N N   . THR B 2 80  ? -1.207  19.233  54.126  1.00 76.41  ? 83  THR B N   1 
ATOM   1489 C CA  . THR B 2 80  ? -2.366  19.109  53.249  1.00 79.07  ? 83  THR B CA  1 
ATOM   1490 C C   . THR B 2 80  ? -2.009  18.259  52.040  1.00 79.67  ? 83  THR B C   1 
ATOM   1491 O O   . THR B 2 80  ? -0.869  18.261  51.591  1.00 84.53  ? 83  THR B O   1 
ATOM   1492 C CB  . THR B 2 80  ? -2.817  20.496  52.753  1.00 80.59  ? 83  THR B CB  1 
ATOM   1493 O OG1 . THR B 2 80  ? -3.177  21.301  53.881  1.00 86.62  ? 83  THR B OG1 1 
ATOM   1494 C CG2 . THR B 2 80  ? -4.010  20.381  51.800  1.00 81.01  ? 83  THR B CG2 1 
ATOM   1495 N N   . PRO B 2 81  ? -2.976  17.509  51.499  1.00 81.42  ? 84  PRO B N   1 
ATOM   1496 C CA  . PRO B 2 81  ? -2.613  16.701  50.336  1.00 82.69  ? 84  PRO B CA  1 
ATOM   1497 C C   . PRO B 2 81  ? -2.039  17.548  49.204  1.00 81.39  ? 84  PRO B C   1 
ATOM   1498 O O   . PRO B 2 81  ? -1.176  17.091  48.453  1.00 83.78  ? 84  PRO B O   1 
ATOM   1499 C CB  . PRO B 2 81  ? -3.931  16.024  49.970  1.00 82.43  ? 84  PRO B CB  1 
ATOM   1500 C CG  . PRO B 2 81  ? -4.560  15.814  51.317  1.00 83.25  ? 84  PRO B CG  1 
ATOM   1501 C CD  . PRO B 2 81  ? -4.321  17.155  51.986  1.00 83.29  ? 84  PRO B CD  1 
ATOM   1502 N N   . SER B 2 82  ? -2.509  18.788  49.096  1.00 79.52  ? 85  SER B N   1 
ATOM   1503 C CA  . SER B 2 82  ? -2.050  19.694  48.045  1.00 75.33  ? 85  SER B CA  1 
ATOM   1504 C C   . SER B 2 82  ? -0.578  20.026  48.204  1.00 70.05  ? 85  SER B C   1 
ATOM   1505 O O   . SER B 2 82  ? 0.031   20.617  47.319  1.00 73.91  ? 85  SER B O   1 
ATOM   1506 C CB  . SER B 2 82  ? -2.866  20.990  48.058  1.00 76.76  ? 85  SER B CB  1 
ATOM   1507 O OG  . SER B 2 82  ? -2.706  21.690  49.284  1.00 84.33  ? 85  SER B OG  1 
ATOM   1508 N N   . GLN B 2 83  ? -0.004  19.638  49.332  1.00 66.93  ? 86  GLN B N   1 
ATOM   1509 C CA  . GLN B 2 83  ? 1.396   19.918  49.591  1.00 71.48  ? 86  GLN B CA  1 
ATOM   1510 C C   . GLN B 2 83  ? 2.299   18.703  49.356  1.00 77.06  ? 86  GLN B C   1 
ATOM   1511 O O   . GLN B 2 83  ? 3.429   18.664  49.837  1.00 81.29  ? 86  GLN B O   1 
ATOM   1512 C CB  . GLN B 2 83  ? 1.556   20.442  51.026  1.00 71.87  ? 86  GLN B CB  1 
ATOM   1513 C CG  . GLN B 2 83  ? 0.824   21.756  51.268  1.00 73.18  ? 86  GLN B CG  1 
ATOM   1514 C CD  . GLN B 2 83  ? 0.954   22.254  52.688  1.00 74.60  ? 86  GLN B CD  1 
ATOM   1515 O OE1 . GLN B 2 83  ? 0.629   21.542  53.638  1.00 79.59  ? 86  GLN B OE1 1 
ATOM   1516 N NE2 . GLN B 2 83  ? 1.424   23.487  52.843  1.00 73.22  ? 86  GLN B NE2 1 
ATOM   1517 N N   . THR B 2 84  ? 1.811   17.726  48.596  1.00 78.96  ? 87  THR B N   1 
ATOM   1518 C CA  . THR B 2 84  ? 2.571   16.501  48.304  1.00 80.47  ? 87  THR B CA  1 
ATOM   1519 C C   . THR B 2 84  ? 3.491   16.673  47.109  1.00 79.37  ? 87  THR B C   1 
ATOM   1520 O O   . THR B 2 84  ? 3.077   16.445  45.973  1.00 76.33  ? 87  THR B O   1 
ATOM   1521 C CB  . THR B 2 84  ? 1.639   15.341  47.966  1.00 84.30  ? 87  THR B CB  1 
ATOM   1522 O OG1 . THR B 2 84  ? 0.777   15.077  49.077  1.00 83.25  ? 87  THR B OG1 1 
ATOM   1523 C CG2 . THR B 2 84  ? 2.449   14.098  47.625  1.00 85.22  ? 87  THR B CG2 1 
ATOM   1524 N N   . SER B 2 85  ? 4.749   17.017  47.342  1.00 79.90  ? 88  SER B N   1 
ATOM   1525 C CA  . SER B 2 85  ? 5.611   17.260  46.199  1.00 80.44  ? 88  SER B CA  1 
ATOM   1526 C C   . SER B 2 85  ? 7.087   17.041  46.491  1.00 75.72  ? 88  SER B C   1 
ATOM   1527 O O   . SER B 2 85  ? 7.442   16.366  47.457  1.00 71.33  ? 88  SER B O   1 
ATOM   1528 C CB  . SER B 2 85  ? 5.374   18.702  45.726  1.00 82.71  ? 88  SER B CB  1 
ATOM   1529 O OG  . SER B 2 85  ? 6.084   18.976  44.538  1.00 73.94  ? 88  SER B OG  1 
ATOM   1530 N N   . VAL B 2 86  ? 7.935   17.606  45.633  1.00 72.17  ? 89  VAL B N   1 
ATOM   1531 C CA  . VAL B 2 86  ? 9.380   17.522  45.793  1.00 68.62  ? 89  VAL B CA  1 
ATOM   1532 C C   . VAL B 2 86  ? 9.890   18.926  46.085  1.00 67.88  ? 89  VAL B C   1 
ATOM   1533 O O   . VAL B 2 86  ? 9.827   19.808  45.229  1.00 68.95  ? 89  VAL B O   1 
ATOM   1534 C CB  . VAL B 2 86  ? 10.067  17.026  44.525  1.00 63.73  ? 89  VAL B CB  1 
ATOM   1535 C CG1 . VAL B 2 86  ? 11.547  16.815  44.793  1.00 65.29  ? 89  VAL B CG1 1 
ATOM   1536 C CG2 . VAL B 2 86  ? 9.419   15.754  44.063  1.00 70.95  ? 89  VAL B CG2 1 
ATOM   1537 N N   . TYR B 2 87  ? 10.399  19.128  47.293  1.00 64.21  ? 90  TYR B N   1 
ATOM   1538 C CA  . TYR B 2 87  ? 10.894  20.434  47.690  1.00 67.09  ? 90  TYR B CA  1 
ATOM   1539 C C   . TYR B 2 87  ? 12.378  20.648  47.440  1.00 67.85  ? 90  TYR B C   1 
ATOM   1540 O O   . TYR B 2 87  ? 13.217  19.857  47.871  1.00 63.77  ? 90  TYR B O   1 
ATOM   1541 C CB  . TYR B 2 87  ? 10.542  20.694  49.160  1.00 65.30  ? 90  TYR B CB  1 
ATOM   1542 C CG  . TYR B 2 87  ? 9.051   20.859  49.358  1.00 68.31  ? 90  TYR B CG  1 
ATOM   1543 C CD1 . TYR B 2 87  ? 8.185   19.775  49.207  1.00 68.42  ? 90  TYR B CD1 1 
ATOM   1544 C CD2 . TYR B 2 87  ? 8.497   22.112  49.602  1.00 65.16  ? 90  TYR B CD2 1 
ATOM   1545 C CE1 . TYR B 2 87  ? 6.810   19.937  49.287  1.00 70.26  ? 90  TYR B CE1 1 
ATOM   1546 C CE2 . TYR B 2 87  ? 7.122   22.287  49.683  1.00 69.39  ? 90  TYR B CE2 1 
ATOM   1547 C CZ  . TYR B 2 87  ? 6.285   21.196  49.523  1.00 74.74  ? 90  TYR B CZ  1 
ATOM   1548 O OH  . TYR B 2 87  ? 4.922   21.365  49.595  1.00 77.16  ? 90  TYR B OH  1 
ATOM   1549 N N   . PHE B 2 88  ? 12.679  21.733  46.729  1.00 68.34  ? 91  PHE B N   1 
ATOM   1550 C CA  . PHE B 2 88  ? 14.046  22.102  46.385  1.00 65.60  ? 91  PHE B CA  1 
ATOM   1551 C C   . PHE B 2 88  ? 14.508  23.366  47.092  1.00 66.57  ? 91  PHE B C   1 
ATOM   1552 O O   . PHE B 2 88  ? 13.933  24.439  46.915  1.00 65.45  ? 91  PHE B O   1 
ATOM   1553 C CB  . PHE B 2 88  ? 14.168  22.324  44.880  1.00 68.39  ? 91  PHE B CB  1 
ATOM   1554 C CG  . PHE B 2 88  ? 14.183  21.063  44.080  1.00 70.76  ? 91  PHE B CG  1 
ATOM   1555 C CD1 . PHE B 2 88  ? 15.314  20.250  44.062  1.00 74.19  ? 91  PHE B CD1 1 
ATOM   1556 C CD2 . PHE B 2 88  ? 13.070  20.685  43.336  1.00 73.91  ? 91  PHE B CD2 1 
ATOM   1557 C CE1 . PHE B 2 88  ? 15.338  19.077  43.312  1.00 71.94  ? 91  PHE B CE1 1 
ATOM   1558 C CE2 . PHE B 2 88  ? 13.081  19.515  42.583  1.00 75.03  ? 91  PHE B CE2 1 
ATOM   1559 C CZ  . PHE B 2 88  ? 14.218  18.709  42.570  1.00 76.15  ? 91  PHE B CZ  1 
ATOM   1560 N N   . CYS B 2 89  ? 15.554  23.226  47.894  1.00 67.36  ? 92  CYS B N   1 
ATOM   1561 C CA  . CYS B 2 89  ? 16.140  24.347  48.607  1.00 67.48  ? 92  CYS B CA  1 
ATOM   1562 C C   . CYS B 2 89  ? 17.222  24.942  47.707  1.00 69.62  ? 92  CYS B C   1 
ATOM   1563 O O   . CYS B 2 89  ? 17.737  24.259  46.826  1.00 71.31  ? 92  CYS B O   1 
ATOM   1564 C CB  . CYS B 2 89  ? 16.772  23.865  49.904  1.00 70.91  ? 92  CYS B CB  1 
ATOM   1565 S SG  . CYS B 2 89  ? 17.847  25.115  50.658  1.00 79.15  ? 92  CYS B SG  1 
ATOM   1566 N N   . ALA B 2 90  ? 17.573  26.205  47.918  1.00 68.79  ? 93  ALA B N   1 
ATOM   1567 C CA  . ALA B 2 90  ? 18.600  26.828  47.086  1.00 67.87  ? 93  ALA B CA  1 
ATOM   1568 C C   . ALA B 2 90  ? 19.285  28.008  47.767  1.00 66.95  ? 93  ALA B C   1 
ATOM   1569 O O   . ALA B 2 90  ? 18.770  28.561  48.739  1.00 66.51  ? 93  ALA B O   1 
ATOM   1570 C CB  . ALA B 2 90  ? 17.993  27.272  45.760  1.00 66.02  ? 93  ALA B CB  1 
ATOM   1571 N N   . SER B 2 91  ? 20.456  28.382  47.258  1.00 63.43  ? 94  SER B N   1 
ATOM   1572 C CA  . SER B 2 91  ? 21.204  29.502  47.815  1.00 63.61  ? 94  SER B CA  1 
ATOM   1573 C C   . SER B 2 91  ? 21.947  30.237  46.710  1.00 65.85  ? 94  SER B C   1 
ATOM   1574 O O   . SER B 2 91  ? 22.346  29.637  45.709  1.00 61.80  ? 94  SER B O   1 
ATOM   1575 C CB  . SER B 2 91  ? 22.202  29.018  48.869  1.00 63.45  ? 94  SER B CB  1 
ATOM   1576 O OG  . SER B 2 91  ? 23.316  28.386  48.262  1.00 65.09  ? 94  SER B OG  1 
ATOM   1577 N N   . GLY B 2 92  ? 22.132  31.540  46.903  1.00 69.17  ? 95  GLY B N   1 
ATOM   1578 C CA  . GLY B 2 92  ? 22.822  32.347  45.916  1.00 69.55  ? 95  GLY B CA  1 
ATOM   1579 C C   . GLY B 2 92  ? 23.245  33.701  46.448  1.00 70.69  ? 95  GLY B C   1 
ATOM   1580 O O   . GLY B 2 92  ? 23.032  34.031  47.622  1.00 63.70  ? 95  GLY B O   1 
ATOM   1581 N N   . ASP B 2 93  ? 23.847  34.498  45.575  1.00 71.24  ? 96  ASP B N   1 
ATOM   1582 C CA  . ASP B 2 93  ? 24.309  35.813  45.982  1.00 72.68  ? 96  ASP B CA  1 
ATOM   1583 C C   . ASP B 2 93  ? 23.119  36.743  46.225  1.00 75.77  ? 96  ASP B C   1 
ATOM   1584 O O   . ASP B 2 93  ? 22.014  36.455  45.762  1.00 79.70  ? 96  ASP B O   1 
ATOM   1585 C CB  . ASP B 2 93  ? 25.219  36.403  44.902  1.00 71.37  ? 96  ASP B CB  1 
ATOM   1586 C CG  . ASP B 2 93  ? 26.496  36.984  45.481  1.00 78.90  ? 96  ASP B CG  1 
ATOM   1587 O OD1 . ASP B 2 93  ? 26.401  37.698  46.506  1.00 69.84  ? 96  ASP B OD1 1 
ATOM   1588 O OD2 . ASP B 2 93  ? 27.591  36.731  44.923  1.00 80.03  ? 96  ASP B OD2 1 
ATOM   1589 N N   . ALA B 2 94  ? 23.321  37.833  46.972  1.00 77.54  ? 97  ALA B N   1 
ATOM   1590 C CA  . ALA B 2 94  ? 22.233  38.803  47.189  1.00 76.35  ? 97  ALA B CA  1 
ATOM   1591 C C   . ALA B 2 94  ? 21.858  39.212  45.775  1.00 77.03  ? 97  ALA B C   1 
ATOM   1592 O O   . ALA B 2 94  ? 22.716  39.593  45.001  1.00 79.66  ? 97  ALA B O   1 
ATOM   1593 C CB  . ALA B 2 94  ? 22.724  40.036  47.971  1.00 78.96  ? 97  ALA B CB  1 
ATOM   1594 N N   . GLY B 2 95  ? 20.598  39.123  45.403  1.00 71.64  ? 98  GLY B N   1 
ATOM   1595 C CA  . GLY B 2 95  ? 20.304  39.504  44.047  1.00 69.77  ? 98  GLY B CA  1 
ATOM   1596 C C   . GLY B 2 95  ? 19.284  38.599  43.422  1.00 72.77  ? 98  GLY B C   1 
ATOM   1597 O O   . GLY B 2 95  ? 18.495  37.954  44.107  1.00 82.48  ? 98  GLY B O   1 
ATOM   1598 N N   . GLY B 2 96  ? 19.303  38.553  42.102  1.00 69.14  ? 99  GLY B N   1 
ATOM   1599 C CA  . GLY B 2 96  ? 18.348  37.747  41.381  1.00 60.82  ? 99  GLY B CA  1 
ATOM   1600 C C   . GLY B 2 96  ? 18.948  37.522  40.019  1.00 64.30  ? 99  GLY B C   1 
ATOM   1601 O O   . GLY B 2 96  ? 18.546  36.632  39.276  1.00 59.34  ? 99  GLY B O   1 
ATOM   1602 N N   . GLY B 2 97  ? 19.925  38.361  39.695  1.00 65.91  ? 100 GLY B N   1 
ATOM   1603 C CA  . GLY B 2 97  ? 20.617  38.245  38.430  1.00 66.06  ? 100 GLY B CA  1 
ATOM   1604 C C   . GLY B 2 97  ? 21.838  37.381  38.665  1.00 65.42  ? 100 GLY B C   1 
ATOM   1605 O O   . GLY B 2 97  ? 22.785  37.379  37.875  1.00 60.11  ? 100 GLY B O   1 
ATOM   1606 N N   . TYR B 2 98  ? 21.807  36.653  39.778  1.00 65.38  ? 104 TYR B N   1 
ATOM   1607 C CA  . TYR B 2 98  ? 22.890  35.759  40.160  1.00 67.92  ? 104 TYR B CA  1 
ATOM   1608 C C   . TYR B 2 98  ? 22.455  34.296  40.068  1.00 70.16  ? 104 TYR B C   1 
ATOM   1609 O O   . TYR B 2 98  ? 21.280  33.970  40.239  1.00 66.93  ? 104 TYR B O   1 
ATOM   1610 C CB  . TYR B 2 98  ? 23.345  36.064  41.588  1.00 64.92  ? 104 TYR B CB  1 
ATOM   1611 C CG  . TYR B 2 98  ? 23.910  37.448  41.757  1.00 66.33  ? 104 TYR B CG  1 
ATOM   1612 C CD1 . TYR B 2 98  ? 25.040  37.849  41.049  1.00 64.72  ? 104 TYR B CD1 1 
ATOM   1613 C CD2 . TYR B 2 98  ? 23.315  38.365  42.617  1.00 67.99  ? 104 TYR B CD2 1 
ATOM   1614 C CE1 . TYR B 2 98  ? 25.566  39.132  41.193  1.00 66.09  ? 104 TYR B CE1 1 
ATOM   1615 C CE2 . TYR B 2 98  ? 23.837  39.653  42.767  1.00 67.20  ? 104 TYR B CE2 1 
ATOM   1616 C CZ  . TYR B 2 98  ? 24.960  40.029  42.055  1.00 62.72  ? 104 TYR B CZ  1 
ATOM   1617 O OH  . TYR B 2 98  ? 25.484  41.294  42.199  1.00 60.05  ? 104 TYR B OH  1 
ATOM   1618 N N   . GLU B 2 99  ? 23.419  33.422  39.798  1.00 74.07  ? 105 GLU B N   1 
ATOM   1619 C CA  . GLU B 2 99  ? 23.164  31.994  39.690  1.00 70.68  ? 105 GLU B CA  1 
ATOM   1620 C C   . GLU B 2 99  ? 22.665  31.441  41.018  1.00 67.16  ? 105 GLU B C   1 
ATOM   1621 O O   . GLU B 2 99  ? 23.119  31.857  42.087  1.00 59.46  ? 105 GLU B O   1 
ATOM   1622 C CB  . GLU B 2 99  ? 24.450  31.272  39.280  1.00 74.75  ? 105 GLU B CB  1 
ATOM   1623 C CG  . GLU B 2 99  ? 24.401  29.756  39.413  1.00 84.42  ? 105 GLU B CG  1 
ATOM   1624 C CD  . GLU B 2 99  ? 25.695  29.093  38.972  1.00 86.22  ? 105 GLU B CD  1 
ATOM   1625 O OE1 . GLU B 2 99  ? 26.766  29.479  39.484  1.00 86.50  ? 105 GLU B OE1 1 
ATOM   1626 O OE2 . GLU B 2 99  ? 25.641  28.184  38.115  1.00 86.77  ? 105 GLU B OE2 1 
ATOM   1627 N N   . GLN B 2 100 ? 21.718  30.512  40.948  1.00 63.87  ? 106 GLN B N   1 
ATOM   1628 C CA  . GLN B 2 100 ? 21.189  29.898  42.157  1.00 67.96  ? 106 GLN B CA  1 
ATOM   1629 C C   . GLN B 2 100 ? 21.631  28.439  42.254  1.00 65.87  ? 106 GLN B C   1 
ATOM   1630 O O   . GLN B 2 100 ? 21.562  27.684  41.283  1.00 61.86  ? 106 GLN B O   1 
ATOM   1631 C CB  . GLN B 2 100 ? 19.659  29.995  42.194  1.00 71.74  ? 106 GLN B CB  1 
ATOM   1632 C CG  . GLN B 2 100 ? 19.129  31.355  42.632  1.00 71.25  ? 106 GLN B CG  1 
ATOM   1633 C CD  . GLN B 2 100 ? 17.616  31.378  42.773  1.00 73.37  ? 106 GLN B CD  1 
ATOM   1634 O OE1 . GLN B 2 100 ? 17.045  30.638  43.572  1.00 73.71  ? 106 GLN B OE1 1 
ATOM   1635 N NE2 . GLN B 2 100 ? 16.961  32.231  41.995  1.00 74.37  ? 106 GLN B NE2 1 
ATOM   1636 N N   . TYR B 2 101 ? 22.089  28.060  43.438  1.00 64.39  ? 107 TYR B N   1 
ATOM   1637 C CA  . TYR B 2 101 ? 22.566  26.713  43.693  1.00 67.26  ? 107 TYR B CA  1 
ATOM   1638 C C   . TYR B 2 101 ? 21.519  25.886  44.434  1.00 69.12  ? 107 TYR B C   1 
ATOM   1639 O O   . TYR B 2 101 ? 21.095  26.248  45.531  1.00 67.60  ? 107 TYR B O   1 
ATOM   1640 C CB  . TYR B 2 101 ? 23.861  26.798  44.494  1.00 69.29  ? 107 TYR B CB  1 
ATOM   1641 C CG  . TYR B 2 101 ? 24.953  27.528  43.746  1.00 75.98  ? 107 TYR B CG  1 
ATOM   1642 C CD1 . TYR B 2 101 ? 25.559  26.952  42.626  1.00 79.27  ? 107 TYR B CD1 1 
ATOM   1643 C CD2 . TYR B 2 101 ? 25.373  28.799  44.141  1.00 74.37  ? 107 TYR B CD2 1 
ATOM   1644 C CE1 . TYR B 2 101 ? 26.559  27.623  41.919  1.00 77.98  ? 107 TYR B CE1 1 
ATOM   1645 C CE2 . TYR B 2 101 ? 26.371  29.480  43.439  1.00 73.34  ? 107 TYR B CE2 1 
ATOM   1646 C CZ  . TYR B 2 101 ? 26.960  28.884  42.332  1.00 76.56  ? 107 TYR B CZ  1 
ATOM   1647 O OH  . TYR B 2 101 ? 27.957  29.534  41.642  1.00 71.01  ? 107 TYR B OH  1 
ATOM   1648 N N   . PHE B 2 102 ? 21.117  24.773  43.823  1.00 71.21  ? 108 PHE B N   1 
ATOM   1649 C CA  . PHE B 2 102 ? 20.099  23.880  44.381  1.00 71.59  ? 108 PHE B CA  1 
ATOM   1650 C C   . PHE B 2 102 ? 20.589  22.648  45.145  1.00 73.71  ? 108 PHE B C   1 
ATOM   1651 O O   . PHE B 2 102 ? 21.697  22.157  44.933  1.00 72.59  ? 108 PHE B O   1 
ATOM   1652 C CB  . PHE B 2 102 ? 19.178  23.403  43.264  1.00 66.13  ? 108 PHE B CB  1 
ATOM   1653 C CG  . PHE B 2 102 ? 18.266  24.457  42.746  1.00 70.14  ? 108 PHE B CG  1 
ATOM   1654 C CD1 . PHE B 2 102 ? 17.202  24.906  43.512  1.00 76.23  ? 108 PHE B CD1 1 
ATOM   1655 C CD2 . PHE B 2 102 ? 18.454  24.993  41.483  1.00 71.95  ? 108 PHE B CD2 1 
ATOM   1656 C CE1 . PHE B 2 102 ? 16.333  25.876  43.024  1.00 77.70  ? 108 PHE B CE1 1 
ATOM   1657 C CE2 . PHE B 2 102 ? 17.590  25.964  40.986  1.00 72.97  ? 108 PHE B CE2 1 
ATOM   1658 C CZ  . PHE B 2 102 ? 16.528  26.405  41.757  1.00 73.59  ? 108 PHE B CZ  1 
ATOM   1659 N N   . GLY B 2 103 ? 19.732  22.148  46.029  1.00 77.58  ? 109 GLY B N   1 
ATOM   1660 C CA  . GLY B 2 103 ? 20.052  20.962  46.795  1.00 79.12  ? 109 GLY B CA  1 
ATOM   1661 C C   . GLY B 2 103 ? 19.614  19.741  46.005  1.00 82.79  ? 109 GLY B C   1 
ATOM   1662 O O   . GLY B 2 103 ? 19.294  19.860  44.820  1.00 81.08  ? 109 GLY B O   1 
ATOM   1663 N N   . PRO B 2 104 ? 19.582  18.551  46.629  1.00 83.61  ? 110 PRO B N   1 
ATOM   1664 C CA  . PRO B 2 104 ? 19.175  17.318  45.948  1.00 82.69  ? 110 PRO B CA  1 
ATOM   1665 C C   . PRO B 2 104 ? 17.669  17.256  45.712  1.00 82.02  ? 110 PRO B C   1 
ATOM   1666 O O   . PRO B 2 104 ? 17.205  16.836  44.649  1.00 80.84  ? 110 PRO B O   1 
ATOM   1667 C CB  . PRO B 2 104 ? 19.650  16.236  46.908  1.00 83.19  ? 110 PRO B CB  1 
ATOM   1668 C CG  . PRO B 2 104 ? 19.407  16.870  48.243  1.00 82.76  ? 110 PRO B CG  1 
ATOM   1669 C CD  . PRO B 2 104 ? 19.940  18.276  48.034  1.00 85.27  ? 110 PRO B CD  1 
ATOM   1670 N N   . GLY B 2 105 ? 16.917  17.682  46.719  1.00 80.14  ? 111 GLY B N   1 
ATOM   1671 C CA  . GLY B 2 105 ? 15.472  17.669  46.632  1.00 79.14  ? 111 GLY B CA  1 
ATOM   1672 C C   . GLY B 2 105 ? 14.902  16.964  47.846  1.00 79.95  ? 111 GLY B C   1 
ATOM   1673 O O   . GLY B 2 105 ? 15.646  16.565  48.743  1.00 82.40  ? 111 GLY B O   1 
ATOM   1674 N N   . THR B 2 106 ? 13.584  16.811  47.876  1.00 78.86  ? 112 THR B N   1 
ATOM   1675 C CA  . THR B 2 106 ? 12.911  16.146  48.984  1.00 78.04  ? 112 THR B CA  1 
ATOM   1676 C C   . THR B 2 106 ? 11.486  15.813  48.586  1.00 80.76  ? 112 THR B C   1 
ATOM   1677 O O   . THR B 2 106 ? 10.696  16.705  48.285  1.00 80.38  ? 112 THR B O   1 
ATOM   1678 C CB  . THR B 2 106 ? 12.873  17.039  50.243  1.00 77.49  ? 112 THR B CB  1 
ATOM   1679 O OG1 . THR B 2 106 ? 14.206  17.238  50.730  1.00 72.93  ? 112 THR B OG1 1 
ATOM   1680 C CG2 . THR B 2 106 ? 12.029  16.391  51.335  1.00 78.52  ? 112 THR B CG2 1 
ATOM   1681 N N   . ARG B 2 107 ? 11.161  14.525  48.570  1.00 84.33  ? 113 ARG B N   1 
ATOM   1682 C CA  . ARG B 2 107 ? 9.815   14.101  48.216  1.00 86.13  ? 113 ARG B CA  1 
ATOM   1683 C C   . ARG B 2 107 ? 9.006   14.029  49.503  1.00 86.48  ? 113 ARG B C   1 
ATOM   1684 O O   . ARG B 2 107 ? 9.490   13.537  50.518  1.00 87.81  ? 113 ARG B O   1 
ATOM   1685 C CB  . ARG B 2 107 ? 9.853   12.736  47.513  1.00 88.58  ? 113 ARG B CB  1 
ATOM   1686 C CG  . ARG B 2 107 ? 8.485   12.197  47.098  1.00 90.36  ? 113 ARG B CG  1 
ATOM   1687 C CD  . ARG B 2 107 ? 8.582   11.244  45.908  1.00 89.55  ? 113 ARG B CD  1 
ATOM   1688 N NE  . ARG B 2 107 ? 9.083   11.924  44.713  1.00 93.04  ? 113 ARG B NE  1 
ATOM   1689 C CZ  . ARG B 2 107 ? 9.060   11.413  43.484  1.00 92.88  ? 113 ARG B CZ  1 
ATOM   1690 N NH1 . ARG B 2 107 ? 8.554   10.206  43.272  1.00 99.17  ? 113 ARG B NH1 1 
ATOM   1691 N NH2 . ARG B 2 107 ? 9.547   12.106  42.463  1.00 85.33  ? 113 ARG B NH2 1 
ATOM   1692 N N   . LEU B 2 108 ? 7.782   14.541  49.462  1.00 87.70  ? 114 LEU B N   1 
ATOM   1693 C CA  . LEU B 2 108 ? 6.912   14.539  50.633  1.00 91.13  ? 114 LEU B CA  1 
ATOM   1694 C C   . LEU B 2 108 ? 5.516   14.040  50.272  1.00 93.24  ? 114 LEU B C   1 
ATOM   1695 O O   . LEU B 2 108 ? 4.980   14.389  49.219  1.00 93.73  ? 114 LEU B O   1 
ATOM   1696 C CB  . LEU B 2 108 ? 6.814   15.954  51.208  1.00 90.98  ? 114 LEU B CB  1 
ATOM   1697 C CG  . LEU B 2 108 ? 5.886   16.147  52.407  1.00 91.43  ? 114 LEU B CG  1 
ATOM   1698 C CD1 . LEU B 2 108 ? 6.413   15.348  53.587  1.00 94.27  ? 114 LEU B CD1 1 
ATOM   1699 C CD2 . LEU B 2 108 ? 5.799   17.624  52.758  1.00 91.07  ? 114 LEU B CD2 1 
ATOM   1700 N N   . THR B 2 109 ? 4.930   13.227  51.148  1.00 93.73  ? 115 THR B N   1 
ATOM   1701 C CA  . THR B 2 109 ? 3.586   12.692  50.921  1.00 92.99  ? 115 THR B CA  1 
ATOM   1702 C C   . THR B 2 109 ? 2.761   12.796  52.206  1.00 91.49  ? 115 THR B C   1 
ATOM   1703 O O   . THR B 2 109 ? 3.230   12.416  53.280  1.00 93.19  ? 115 THR B O   1 
ATOM   1704 C CB  . THR B 2 109 ? 3.637   11.215  50.477  1.00 91.98  ? 115 THR B CB  1 
ATOM   1705 O OG1 . THR B 2 109 ? 4.536   11.069  49.368  1.00 88.60  ? 115 THR B OG1 1 
ATOM   1706 C CG2 . THR B 2 109 ? 2.256   10.751  50.055  1.00 93.93  ? 115 THR B CG2 1 
ATOM   1707 N N   . VAL B 2 110 ? 1.534   13.300  52.097  1.00 88.21  ? 116 VAL B N   1 
ATOM   1708 C CA  . VAL B 2 110 ? 0.676   13.464  53.271  1.00 91.24  ? 116 VAL B CA  1 
ATOM   1709 C C   . VAL B 2 110 ? -0.394  12.382  53.501  1.00 93.74  ? 116 VAL B C   1 
ATOM   1710 O O   . VAL B 2 110 ? -0.600  11.942  54.638  1.00 95.50  ? 116 VAL B O   1 
ATOM   1711 C CB  . VAL B 2 110 ? -0.026  14.838  53.248  1.00 90.55  ? 116 VAL B CB  1 
ATOM   1712 C CG1 . VAL B 2 110 ? 1.000   15.956  53.320  1.00 85.34  ? 116 VAL B CG1 1 
ATOM   1713 C CG2 . VAL B 2 110 ? -0.852  14.960  51.995  1.00 91.22  ? 116 VAL B CG2 1 
ATOM   1714 N N   . LEU B 2 111 ? -1.088  11.973  52.439  1.00 91.87  ? 117 LEU B N   1 
ATOM   1715 C CA  . LEU B 2 111 ? -2.128  10.937  52.536  1.00 91.84  ? 117 LEU B CA  1 
ATOM   1716 C C   . LEU B 2 111 ? -3.403  11.411  53.244  1.00 90.27  ? 117 LEU B C   1 
ATOM   1717 O O   . LEU B 2 111 ? -4.465  11.463  52.583  1.00 86.51  ? 117 LEU B O   1 
ATOM   1718 C CB  . LEU B 2 111 ? -1.584  9.701   53.269  1.00 87.90  ? 117 LEU B CB  1 
ATOM   1719 C CG  . LEU B 2 111 ? -0.258  9.102   52.787  1.00 86.78  ? 117 LEU B CG  1 
ATOM   1720 C CD1 . LEU B 2 111 ? 0.138   7.939   53.686  1.00 83.43  ? 117 LEU B CD1 1 
ATOM   1721 C CD2 . LEU B 2 111 ? -0.394  8.645   51.345  1.00 87.85  ? 117 LEU B CD2 1 
ATOM   1722 O OXT . LEU B 2 111 ? -3.325  11.713  54.456  1.00 89.74  ? 117 LEU B OXT 1 
ATOM   1723 N N   . ILE C 3 1   ? 30.315  65.218  38.152  1.00 99.10  ? 1   ILE C N   1 
ATOM   1724 C CA  . ILE C 3 1   ? 30.040  65.134  36.688  1.00 98.79  ? 1   ILE C CA  1 
ATOM   1725 C C   . ILE C 3 1   ? 28.901  66.094  36.323  1.00 101.83 ? 1   ILE C C   1 
ATOM   1726 O O   . ILE C 3 1   ? 28.281  66.691  37.204  1.00 100.83 ? 1   ILE C O   1 
ATOM   1727 C CB  . ILE C 3 1   ? 29.670  63.674  36.280  1.00 95.36  ? 1   ILE C CB  1 
ATOM   1728 C CG1 . ILE C 3 1   ? 30.839  62.722  36.564  1.00 92.31  ? 1   ILE C CG1 1 
ATOM   1729 C CG2 . ILE C 3 1   ? 29.370  63.600  34.846  1.00 91.00  ? 1   ILE C CG2 1 
ATOM   1730 C CD1 . ILE C 3 1   ? 31.173  62.537  38.032  1.00 88.77  ? 1   ILE C CD1 1 
ATOM   1731 N N   . GLU C 3 2   ? 28.639  66.247  35.026  1.00 105.22 ? 2   GLU C N   1 
ATOM   1732 C CA  . GLU C 3 2   ? 27.587  67.138  34.543  1.00 103.88 ? 2   GLU C CA  1 
ATOM   1733 C C   . GLU C 3 2   ? 26.592  66.434  33.614  1.00 102.71 ? 2   GLU C C   1 
ATOM   1734 O O   . GLU C 3 2   ? 26.872  65.348  33.101  1.00 105.94 ? 2   GLU C O   1 
ATOM   1735 C CB  . GLU C 3 2   ? 28.221  68.334  33.819  1.00 107.48 ? 2   GLU C CB  1 
ATOM   1736 C CG  . GLU C 3 2   ? 29.049  67.987  32.578  1.00 110.28 ? 2   GLU C CG  1 
ATOM   1737 C CD  . GLU C 3 2   ? 28.230  68.006  31.295  1.00 109.62 ? 2   GLU C CD  1 
ATOM   1738 O OE1 . GLU C 3 2   ? 27.673  69.077  30.964  1.00 104.22 ? 2   GLU C OE1 1 
ATOM   1739 O OE2 . GLU C 3 2   ? 28.146  66.955  30.620  1.00 109.35 ? 2   GLU C OE2 1 
ATOM   1740 N N   . ALA C 3 3   ? 25.434  67.063  33.406  1.00 98.96  ? 3   ALA C N   1 
ATOM   1741 C CA  . ALA C 3 3   ? 24.379  66.525  32.538  1.00 92.36  ? 3   ALA C CA  1 
ATOM   1742 C C   . ALA C 3 3   ? 23.177  67.482  32.438  1.00 85.29  ? 3   ALA C C   1 
ATOM   1743 O O   . ALA C 3 3   ? 23.231  68.614  32.916  1.00 88.33  ? 3   ALA C O   1 
ATOM   1744 C CB  . ALA C 3 3   ? 23.920  65.163  33.064  1.00 89.26  ? 3   ALA C CB  1 
ATOM   1745 N N   . ASP C 3 4   ? 22.106  67.031  31.793  1.00 74.18  ? 4   ASP C N   1 
ATOM   1746 C CA  . ASP C 3 4   ? 20.893  67.833  31.669  1.00 68.27  ? 4   ASP C CA  1 
ATOM   1747 C C   . ASP C 3 4   ? 19.915  67.239  32.666  1.00 65.15  ? 4   ASP C C   1 
ATOM   1748 O O   . ASP C 3 4   ? 18.965  67.891  33.084  1.00 64.36  ? 4   ASP C O   1 
ATOM   1749 C CB  . ASP C 3 4   ? 20.292  67.719  30.269  1.00 78.66  ? 4   ASP C CB  1 
ATOM   1750 C CG  . ASP C 3 4   ? 21.206  68.260  29.188  1.00 85.99  ? 4   ASP C CG  1 
ATOM   1751 O OD1 . ASP C 3 4   ? 22.430  68.014  29.255  1.00 83.20  ? 4   ASP C OD1 1 
ATOM   1752 O OD2 . ASP C 3 4   ? 20.691  68.917  28.258  1.00 91.51  ? 4   ASP C OD2 1 
ATOM   1753 N N   . HIS C 3 5   ? 20.159  65.984  33.029  1.00 57.91  ? 5   HIS C N   1 
ATOM   1754 C CA  . HIS C 3 5   ? 19.321  65.263  33.976  1.00 50.48  ? 5   HIS C CA  1 
ATOM   1755 C C   . HIS C 3 5   ? 20.171  64.262  34.717  1.00 48.45  ? 5   HIS C C   1 
ATOM   1756 O O   . HIS C 3 5   ? 21.133  63.734  34.163  1.00 48.02  ? 5   HIS C O   1 
ATOM   1757 C CB  . HIS C 3 5   ? 18.203  64.532  33.247  1.00 41.32  ? 5   HIS C CB  1 
ATOM   1758 C CG  . HIS C 3 5   ? 17.236  65.446  32.572  1.00 45.46  ? 5   HIS C CG  1 
ATOM   1759 N ND1 . HIS C 3 5   ? 16.392  66.280  33.273  1.00 45.19  ? 5   HIS C ND1 1 
ATOM   1760 C CD2 . HIS C 3 5   ? 17.011  65.697  31.262  1.00 47.93  ? 5   HIS C CD2 1 
ATOM   1761 C CE1 . HIS C 3 5   ? 15.690  67.007  32.424  1.00 43.33  ? 5   HIS C CE1 1 
ATOM   1762 N NE2 . HIS C 3 5   ? 16.047  66.673  31.197  1.00 49.96  ? 5   HIS C NE2 1 
ATOM   1763 N N   . VAL C 3 6   ? 19.818  64.006  35.972  1.00 45.64  ? 6   VAL C N   1 
ATOM   1764 C CA  . VAL C 3 6   ? 20.560  63.055  36.791  1.00 39.44  ? 6   VAL C CA  1 
ATOM   1765 C C   . VAL C 3 6   ? 19.605  62.143  37.540  1.00 39.00  ? 6   VAL C C   1 
ATOM   1766 O O   . VAL C 3 6   ? 18.709  62.604  38.246  1.00 42.93  ? 6   VAL C O   1 
ATOM   1767 C CB  . VAL C 3 6   ? 21.443  63.763  37.844  1.00 35.61  ? 6   VAL C CB  1 
ATOM   1768 C CG1 . VAL C 3 6   ? 22.417  62.761  38.447  1.00 32.29  ? 6   VAL C CG1 1 
ATOM   1769 C CG2 . VAL C 3 6   ? 22.182  64.940  37.221  1.00 37.96  ? 6   VAL C CG2 1 
ATOM   1770 N N   . GLY C 3 7   ? 19.803  60.844  37.396  1.00 40.71  ? 7   GLY C N   1 
ATOM   1771 C CA  . GLY C 3 7   ? 18.946  59.913  38.088  1.00 40.09  ? 7   GLY C CA  1 
ATOM   1772 C C   . GLY C 3 7   ? 19.718  59.045  39.056  1.00 42.86  ? 7   GLY C C   1 
ATOM   1773 O O   . GLY C 3 7   ? 20.802  58.565  38.742  1.00 45.00  ? 7   GLY C O   1 
ATOM   1774 N N   . SER C 3 8   ? 19.178  58.865  40.254  1.00 40.10  ? 8   SER C N   1 
ATOM   1775 C CA  . SER C 3 8   ? 19.810  58.000  41.235  1.00 39.93  ? 8   SER C CA  1 
ATOM   1776 C C   . SER C 3 8   ? 18.783  56.922  41.565  1.00 38.61  ? 8   SER C C   1 
ATOM   1777 O O   . SER C 3 8   ? 17.867  57.134  42.360  1.00 38.07  ? 8   SER C O   1 
ATOM   1778 C CB  . SER C 3 8   ? 20.207  58.797  42.469  1.00 35.07  ? 8   SER C CB  1 
ATOM   1779 O OG  . SER C 3 8   ? 21.354  59.571  42.179  1.00 37.09  ? 8   SER C OG  1 
ATOM   1780 N N   . TYR C 3 9   ? 18.935  55.769  40.927  1.00 37.13  ? 9   TYR C N   1 
ATOM   1781 C CA  . TYR C 3 9   ? 17.999  54.666  41.101  1.00 38.69  ? 9   TYR C CA  1 
ATOM   1782 C C   . TYR C 3 9   ? 18.478  53.560  42.029  1.00 39.80  ? 9   TYR C C   1 
ATOM   1783 O O   . TYR C 3 9   ? 18.936  52.514  41.574  1.00 41.24  ? 9   TYR C O   1 
ATOM   1784 C CB  . TYR C 3 9   ? 17.673  54.078  39.735  1.00 35.49  ? 9   TYR C CB  1 
ATOM   1785 C CG  . TYR C 3 9   ? 17.171  55.106  38.752  1.00 44.81  ? 9   TYR C CG  1 
ATOM   1786 C CD1 . TYR C 3 9   ? 16.024  55.850  39.025  1.00 44.36  ? 9   TYR C CD1 1 
ATOM   1787 C CD2 . TYR C 3 9   ? 17.816  55.314  37.532  1.00 41.92  ? 9   TYR C CD2 1 
ATOM   1788 C CE1 . TYR C 3 9   ? 15.521  56.773  38.106  1.00 47.72  ? 9   TYR C CE1 1 
ATOM   1789 C CE2 . TYR C 3 9   ? 17.320  56.240  36.602  1.00 42.34  ? 9   TYR C CE2 1 
ATOM   1790 C CZ  . TYR C 3 9   ? 16.166  56.961  36.897  1.00 46.50  ? 9   TYR C CZ  1 
ATOM   1791 O OH  . TYR C 3 9   ? 15.618  57.829  35.978  1.00 44.21  ? 9   TYR C OH  1 
ATOM   1792 N N   . GLY C 3 10  A 18.367  53.789  43.331  1.00 38.04  ? 9   GLY C N   1 
ATOM   1793 C CA  . GLY C 3 10  A 18.791  52.775  44.276  1.00 40.99  ? 9   GLY C CA  1 
ATOM   1794 C C   . GLY C 3 10  A 19.760  53.241  45.347  1.00 39.78  ? 9   GLY C C   1 
ATOM   1795 O O   . GLY C 3 10  A 20.636  52.486  45.757  1.00 38.57  ? 9   GLY C O   1 
ATOM   1796 N N   . ILE C 3 11  ? 19.621  54.479  45.804  1.00 37.00  ? 10  ILE C N   1 
ATOM   1797 C CA  . ILE C 3 11  ? 20.507  54.966  46.849  1.00 39.84  ? 10  ILE C CA  1 
ATOM   1798 C C   . ILE C 3 11  ? 20.259  54.159  48.117  1.00 45.20  ? 10  ILE C C   1 
ATOM   1799 O O   . ILE C 3 11  ? 19.123  54.073  48.594  1.00 47.00  ? 10  ILE C O   1 
ATOM   1800 C CB  . ILE C 3 11  ? 20.248  56.433  47.170  1.00 40.17  ? 10  ILE C CB  1 
ATOM   1801 C CG1 . ILE C 3 11  ? 20.404  57.273  45.903  1.00 42.30  ? 10  ILE C CG1 1 
ATOM   1802 C CG2 . ILE C 3 11  ? 21.207  56.891  48.247  1.00 35.33  ? 10  ILE C CG2 1 
ATOM   1803 C CD1 . ILE C 3 11  ? 20.045  58.723  46.083  1.00 44.05  ? 10  ILE C CD1 1 
ATOM   1804 N N   . VAL C 3 12  ? 21.316  53.556  48.653  1.00 39.75  ? 11  VAL C N   1 
ATOM   1805 C CA  . VAL C 3 12  ? 21.201  52.764  49.872  1.00 36.60  ? 11  VAL C CA  1 
ATOM   1806 C C   . VAL C 3 12  ? 22.012  53.364  51.023  1.00 41.08  ? 11  VAL C C   1 
ATOM   1807 O O   . VAL C 3 12  ? 23.190  53.671  50.859  1.00 41.67  ? 11  VAL C O   1 
ATOM   1808 C CB  . VAL C 3 12  ? 21.709  51.342  49.653  1.00 34.39  ? 11  VAL C CB  1 
ATOM   1809 C CG1 . VAL C 3 12  ? 21.508  50.524  50.923  1.00 33.61  ? 11  VAL C CG1 1 
ATOM   1810 C CG2 . VAL C 3 12  ? 20.998  50.718  48.475  1.00 43.93  ? 11  VAL C CG2 1 
ATOM   1811 N N   . VAL C 3 13  ? 21.384  53.510  52.184  1.00 36.77  ? 12  VAL C N   1 
ATOM   1812 C CA  . VAL C 3 13  ? 22.052  54.049  53.366  1.00 39.60  ? 12  VAL C CA  1 
ATOM   1813 C C   . VAL C 3 13  ? 21.793  53.125  54.555  1.00 42.52  ? 12  VAL C C   1 
ATOM   1814 O O   . VAL C 3 13  ? 20.670  53.065  55.048  1.00 44.32  ? 12  VAL C O   1 
ATOM   1815 C CB  . VAL C 3 13  ? 21.517  55.457  53.720  1.00 43.35  ? 12  VAL C CB  1 
ATOM   1816 C CG1 . VAL C 3 13  ? 22.111  55.932  55.025  1.00 45.51  ? 12  VAL C CG1 1 
ATOM   1817 C CG2 . VAL C 3 13  ? 21.853  56.437  52.608  1.00 47.55  ? 12  VAL C CG2 1 
ATOM   1818 N N   . TYR C 3 14  ? 22.816  52.403  55.014  1.00 41.97  ? 13  TYR C N   1 
ATOM   1819 C CA  . TYR C 3 14  ? 22.637  51.501  56.154  1.00 42.80  ? 13  TYR C CA  1 
ATOM   1820 C C   . TYR C 3 14  ? 23.599  51.829  57.293  1.00 48.28  ? 13  TYR C C   1 
ATOM   1821 O O   . TYR C 3 14  ? 24.816  51.873  57.106  1.00 50.07  ? 13  TYR C O   1 
ATOM   1822 C CB  . TYR C 3 14  ? 22.840  50.048  55.733  1.00 44.56  ? 13  TYR C CB  1 
ATOM   1823 C CG  . TYR C 3 14  ? 22.210  49.051  56.687  1.00 46.91  ? 13  TYR C CG  1 
ATOM   1824 C CD1 . TYR C 3 14  ? 20.855  48.752  56.616  1.00 51.39  ? 13  TYR C CD1 1 
ATOM   1825 C CD2 . TYR C 3 14  ? 22.973  48.394  57.648  1.00 54.41  ? 13  TYR C CD2 1 
ATOM   1826 C CE1 . TYR C 3 14  ? 20.274  47.818  57.471  1.00 54.84  ? 13  TYR C CE1 1 
ATOM   1827 C CE2 . TYR C 3 14  ? 22.398  47.458  58.513  1.00 54.16  ? 13  TYR C CE2 1 
ATOM   1828 C CZ  . TYR C 3 14  ? 21.051  47.174  58.415  1.00 54.90  ? 13  TYR C CZ  1 
ATOM   1829 O OH  . TYR C 3 14  ? 20.484  46.233  59.246  1.00 53.82  ? 13  TYR C OH  1 
ATOM   1830 N N   . GLN C 3 15  ? 23.056  52.044  58.483  1.00 48.26  ? 14  GLN C N   1 
ATOM   1831 C CA  . GLN C 3 15  ? 23.899  52.390  59.611  1.00 53.11  ? 14  GLN C CA  1 
ATOM   1832 C C   . GLN C 3 15  ? 23.626  51.611  60.889  1.00 54.89  ? 14  GLN C C   1 
ATOM   1833 O O   . GLN C 3 15  ? 22.535  51.080  61.089  1.00 57.93  ? 14  GLN C O   1 
ATOM   1834 C CB  . GLN C 3 15  ? 23.798  53.897  59.871  1.00 48.19  ? 14  GLN C CB  1 
ATOM   1835 C CG  . GLN C 3 15  ? 22.418  54.406  60.147  1.00 51.67  ? 14  GLN C CG  1 
ATOM   1836 C CD  . GLN C 3 15  ? 22.249  55.853  59.735  1.00 54.94  ? 14  GLN C CD  1 
ATOM   1837 O OE1 . GLN C 3 15  ? 23.113  56.692  59.993  1.00 61.97  ? 14  GLN C OE1 1 
ATOM   1838 N NE2 . GLN C 3 15  ? 21.124  56.157  59.101  1.00 51.76  ? 14  GLN C NE2 1 
ATOM   1839 N N   . SER C 3 16  ? 24.644  51.541  61.742  1.00 61.99  ? 15  SER C N   1 
ATOM   1840 C CA  . SER C 3 16  ? 24.568  50.843  63.022  1.00 66.88  ? 15  SER C CA  1 
ATOM   1841 C C   . SER C 3 16  ? 25.293  51.667  64.083  1.00 69.37  ? 15  SER C C   1 
ATOM   1842 O O   . SER C 3 16  ? 26.128  52.515  63.769  1.00 70.79  ? 15  SER C O   1 
ATOM   1843 C CB  . SER C 3 16  ? 25.234  49.471  62.932  1.00 65.87  ? 15  SER C CB  1 
ATOM   1844 O OG  . SER C 3 16  ? 26.644  49.618  62.867  1.00 70.27  ? 15  SER C OG  1 
ATOM   1845 N N   . PRO C 3 17  ? 24.987  51.416  65.361  1.00 72.12  ? 16  PRO C N   1 
ATOM   1846 C CA  . PRO C 3 17  ? 24.014  50.414  65.804  1.00 70.45  ? 16  PRO C CA  1 
ATOM   1847 C C   . PRO C 3 17  ? 22.584  50.791  65.418  1.00 70.45  ? 16  PRO C C   1 
ATOM   1848 O O   . PRO C 3 17  ? 22.316  51.921  64.997  1.00 65.58  ? 16  PRO C O   1 
ATOM   1849 C CB  . PRO C 3 17  ? 24.211  50.403  67.312  1.00 69.79  ? 16  PRO C CB  1 
ATOM   1850 C CG  . PRO C 3 17  ? 24.497  51.847  67.598  1.00 68.68  ? 16  PRO C CG  1 
ATOM   1851 C CD  . PRO C 3 17  ? 25.487  52.199  66.506  1.00 70.34  ? 16  PRO C CD  1 
ATOM   1852 N N   . GLY C 3 18  ? 21.672  49.837  65.561  1.00 67.27  ? 17  GLY C N   1 
ATOM   1853 C CA  . GLY C 3 18  ? 20.286  50.105  65.245  1.00 63.85  ? 17  GLY C CA  1 
ATOM   1854 C C   . GLY C 3 18  ? 19.829  49.544  63.921  1.00 60.92  ? 17  GLY C C   1 
ATOM   1855 O O   . GLY C 3 18  ? 18.626  49.455  63.673  1.00 61.04  ? 17  GLY C O   1 
ATOM   1856 N N   . ASP C 3 19  ? 20.775  49.154  63.074  1.00 58.93  ? 18  ASP C N   1 
ATOM   1857 C CA  . ASP C 3 19  ? 20.421  48.608  61.770  1.00 63.33  ? 18  ASP C CA  1 
ATOM   1858 C C   . ASP C 3 19  ? 19.417  49.549  61.133  1.00 59.30  ? 18  ASP C C   1 
ATOM   1859 O O   . ASP C 3 19  ? 18.323  49.143  60.759  1.00 58.54  ? 18  ASP C O   1 
ATOM   1860 C CB  . ASP C 3 19  ? 19.793  47.219  61.908  1.00 64.84  ? 18  ASP C CB  1 
ATOM   1861 C CG  . ASP C 3 19  ? 20.772  46.187  62.424  1.00 70.32  ? 18  ASP C CG  1 
ATOM   1862 O OD1 . ASP C 3 19  ? 21.867  46.051  61.829  1.00 71.32  ? 18  ASP C OD1 1 
ATOM   1863 O OD2 . ASP C 3 19  ? 20.443  45.512  63.424  1.00 73.38  ? 18  ASP C OD2 1 
ATOM   1864 N N   . ILE C 3 20  ? 19.803  50.815  61.038  1.00 59.02  ? 19  ILE C N   1 
ATOM   1865 C CA  . ILE C 3 20  ? 18.961  51.848  60.463  1.00 52.38  ? 19  ILE C CA  1 
ATOM   1866 C C   . ILE C 3 20  ? 19.248  51.936  58.975  1.00 51.71  ? 19  ILE C C   1 
ATOM   1867 O O   . ILE C 3 20  ? 20.405  52.045  58.573  1.00 50.62  ? 19  ILE C O   1 
ATOM   1868 C CB  . ILE C 3 20  ? 19.258  53.207  61.118  1.00 51.15  ? 19  ILE C CB  1 
ATOM   1869 C CG1 . ILE C 3 20  ? 19.144  53.071  62.639  1.00 49.34  ? 19  ILE C CG1 1 
ATOM   1870 C CG2 . ILE C 3 20  ? 18.295  54.261  60.594  1.00 41.10  ? 19  ILE C CG2 1 
ATOM   1871 C CD1 . ILE C 3 20  ? 19.402  54.349  63.400  1.00 54.33  ? 19  ILE C CD1 1 
ATOM   1872 N N   . GLY C 3 21  ? 18.199  51.891  58.160  1.00 47.10  ? 20  GLY C N   1 
ATOM   1873 C CA  . GLY C 3 21  ? 18.395  51.957  56.723  1.00 47.81  ? 20  GLY C CA  1 
ATOM   1874 C C   . GLY C 3 21  ? 17.470  52.889  55.966  1.00 48.43  ? 20  GLY C C   1 
ATOM   1875 O O   . GLY C 3 21  ? 16.451  53.346  56.485  1.00 56.60  ? 20  GLY C O   1 
ATOM   1876 N N   . GLN C 3 22  ? 17.848  53.183  54.727  1.00 47.47  ? 21  GLN C N   1 
ATOM   1877 C CA  . GLN C 3 22  ? 17.067  54.049  53.854  1.00 41.52  ? 21  GLN C CA  1 
ATOM   1878 C C   . GLN C 3 22  ? 17.321  53.698  52.388  1.00 42.17  ? 21  GLN C C   1 
ATOM   1879 O O   . GLN C 3 22  ? 18.466  53.581  51.955  1.00 41.03  ? 21  GLN C O   1 
ATOM   1880 C CB  . GLN C 3 22  ? 17.411  55.533  54.087  1.00 33.73  ? 21  GLN C CB  1 
ATOM   1881 C CG  . GLN C 3 22  ? 16.629  56.463  53.153  1.00 36.11  ? 21  GLN C CG  1 
ATOM   1882 C CD  . GLN C 3 22  ? 16.916  57.941  53.361  1.00 37.74  ? 21  GLN C CD  1 
ATOM   1883 O OE1 . GLN C 3 22  ? 16.479  58.550  54.336  1.00 38.68  ? 21  GLN C OE1 1 
ATOM   1884 N NE2 . GLN C 3 22  ? 17.651  58.526  52.430  1.00 40.46  ? 21  GLN C NE2 1 
ATOM   1885 N N   . TYR C 3 23  ? 16.243  53.521  51.633  1.00 40.26  ? 22  TYR C N   1 
ATOM   1886 C CA  . TYR C 3 23  ? 16.344  53.214  50.213  1.00 37.76  ? 22  TYR C CA  1 
ATOM   1887 C C   . TYR C 3 23  ? 15.512  54.253  49.464  1.00 35.10  ? 22  TYR C C   1 
ATOM   1888 O O   . TYR C 3 23  ? 14.318  54.398  49.730  1.00 37.39  ? 22  TYR C O   1 
ATOM   1889 C CB  . TYR C 3 23  ? 15.804  51.817  49.928  1.00 41.00  ? 22  TYR C CB  1 
ATOM   1890 C CG  . TYR C 3 23  ? 16.176  51.299  48.563  1.00 40.45  ? 22  TYR C CG  1 
ATOM   1891 C CD1 . TYR C 3 23  ? 17.443  50.777  48.321  1.00 35.11  ? 22  TYR C CD1 1 
ATOM   1892 C CD2 . TYR C 3 23  ? 15.271  51.360  47.502  1.00 38.38  ? 22  TYR C CD2 1 
ATOM   1893 C CE1 . TYR C 3 23  ? 17.805  50.325  47.049  1.00 42.79  ? 22  TYR C CE1 1 
ATOM   1894 C CE2 . TYR C 3 23  ? 15.621  50.913  46.227  1.00 43.58  ? 22  TYR C CE2 1 
ATOM   1895 C CZ  . TYR C 3 23  ? 16.890  50.397  46.009  1.00 42.72  ? 22  TYR C CZ  1 
ATOM   1896 O OH  . TYR C 3 23  ? 17.242  49.958  44.755  1.00 50.17  ? 22  TYR C OH  1 
ATOM   1897 N N   . THR C 3 24  ? 16.140  54.976  48.540  1.00 29.37  ? 23  THR C N   1 
ATOM   1898 C CA  . THR C 3 24  ? 15.449  56.011  47.778  1.00 35.05  ? 23  THR C CA  1 
ATOM   1899 C C   . THR C 3 24  ? 15.806  56.057  46.290  1.00 36.31  ? 23  THR C C   1 
ATOM   1900 O O   . THR C 3 24  ? 16.779  55.448  45.853  1.00 34.68  ? 23  THR C O   1 
ATOM   1901 C CB  . THR C 3 24  ? 15.737  57.422  48.371  1.00 27.67  ? 23  THR C CB  1 
ATOM   1902 O OG1 . THR C 3 24  ? 17.142  57.547  48.617  1.00 25.99  ? 23  THR C OG1 1 
ATOM   1903 C CG2 . THR C 3 24  ? 14.973  57.638  49.682  1.00 27.70  ? 23  THR C CG2 1 
ATOM   1904 N N   . PHE C 3 25  ? 14.984  56.791  45.539  1.00 34.00  ? 24  PHE C N   1 
ATOM   1905 C CA  . PHE C 3 25  ? 15.154  57.033  44.113  1.00 29.07  ? 24  PHE C CA  1 
ATOM   1906 C C   . PHE C 3 25  ? 15.065  58.555  43.941  1.00 35.14  ? 24  PHE C C   1 
ATOM   1907 O O   . PHE C 3 25  ? 14.076  59.175  44.345  1.00 38.47  ? 24  PHE C O   1 
ATOM   1908 C CB  . PHE C 3 25  ? 14.029  56.383  43.307  1.00 37.60  ? 24  PHE C CB  1 
ATOM   1909 C CG  . PHE C 3 25  ? 14.378  55.035  42.724  1.00 36.16  ? 24  PHE C CG  1 
ATOM   1910 C CD1 . PHE C 3 25  ? 15.080  54.089  43.467  1.00 39.44  ? 24  PHE C CD1 1 
ATOM   1911 C CD2 . PHE C 3 25  ? 13.921  54.682  41.458  1.00 30.11  ? 24  PHE C CD2 1 
ATOM   1912 C CE1 . PHE C 3 25  ? 15.315  52.807  42.958  1.00 43.39  ? 24  PHE C CE1 1 
ATOM   1913 C CE2 . PHE C 3 25  ? 14.150  53.406  40.941  1.00 37.82  ? 24  PHE C CE2 1 
ATOM   1914 C CZ  . PHE C 3 25  ? 14.848  52.465  41.695  1.00 34.66  ? 24  PHE C CZ  1 
ATOM   1915 N N   . GLU C 3 26  ? 16.094  59.158  43.359  1.00 28.61  ? 25  GLU C N   1 
ATOM   1916 C CA  . GLU C 3 26  ? 16.097  60.597  43.134  1.00 31.60  ? 25  GLU C CA  1 
ATOM   1917 C C   . GLU C 3 26  ? 16.184  60.915  41.649  1.00 33.86  ? 25  GLU C C   1 
ATOM   1918 O O   . GLU C 3 26  ? 16.750  60.157  40.869  1.00 36.55  ? 25  GLU C O   1 
ATOM   1919 C CB  . GLU C 3 26  ? 17.301  61.262  43.819  1.00 34.20  ? 25  GLU C CB  1 
ATOM   1920 C CG  . GLU C 3 26  ? 17.277  61.283  45.333  1.00 42.63  ? 25  GLU C CG  1 
ATOM   1921 C CD  . GLU C 3 26  ? 18.482  62.011  45.909  1.00 44.88  ? 25  GLU C CD  1 
ATOM   1922 O OE1 . GLU C 3 26  ? 19.087  62.814  45.165  1.00 45.33  ? 25  GLU C OE1 1 
ATOM   1923 O OE2 . GLU C 3 26  ? 18.818  61.798  47.099  1.00 35.96  ? 25  GLU C OE2 1 
ATOM   1924 N N   . PHE C 3 27  ? 15.620  62.043  41.258  1.00 36.49  ? 26  PHE C N   1 
ATOM   1925 C CA  . PHE C 3 27  ? 15.718  62.470  39.880  1.00 38.71  ? 26  PHE C CA  1 
ATOM   1926 C C   . PHE C 3 27  ? 15.843  63.990  39.878  1.00 35.86  ? 26  PHE C C   1 
ATOM   1927 O O   . PHE C 3 27  ? 14.971  64.700  40.375  1.00 33.68  ? 26  PHE C O   1 
ATOM   1928 C CB  . PHE C 3 27  ? 14.507  62.029  39.060  1.00 30.18  ? 26  PHE C CB  1 
ATOM   1929 C CG  . PHE C 3 27  ? 14.671  62.274  37.590  1.00 41.16  ? 26  PHE C CG  1 
ATOM   1930 C CD1 . PHE C 3 27  ? 15.469  61.430  36.815  1.00 45.13  ? 26  PHE C CD1 1 
ATOM   1931 C CD2 . PHE C 3 27  ? 14.069  63.374  36.982  1.00 40.94  ? 26  PHE C CD2 1 
ATOM   1932 C CE1 . PHE C 3 27  ? 15.666  61.679  35.454  1.00 40.34  ? 26  PHE C CE1 1 
ATOM   1933 C CE2 . PHE C 3 27  ? 14.260  63.631  35.626  1.00 40.86  ? 26  PHE C CE2 1 
ATOM   1934 C CZ  . PHE C 3 27  ? 15.060  62.780  34.860  1.00 45.99  ? 26  PHE C CZ  1 
ATOM   1935 N N   . ASP C 3 28  ? 16.943  64.481  39.319  1.00 35.13  ? 27  ASP C N   1 
ATOM   1936 C CA  . ASP C 3 28  ? 17.202  65.910  39.275  1.00 34.80  ? 27  ASP C CA  1 
ATOM   1937 C C   . ASP C 3 28  ? 17.118  66.502  40.672  1.00 33.85  ? 27  ASP C C   1 
ATOM   1938 O O   . ASP C 3 28  ? 16.555  67.570  40.888  1.00 40.08  ? 27  ASP C O   1 
ATOM   1939 C CB  . ASP C 3 28  ? 16.233  66.603  38.316  1.00 32.65  ? 27  ASP C CB  1 
ATOM   1940 C CG  . ASP C 3 28  ? 16.571  66.330  36.852  1.00 45.68  ? 27  ASP C CG  1 
ATOM   1941 O OD1 . ASP C 3 28  ? 17.676  65.795  36.582  1.00 40.62  ? 27  ASP C OD1 1 
ATOM   1942 O OD2 . ASP C 3 28  ? 15.742  66.661  35.974  1.00 42.88  ? 27  ASP C OD2 1 
ATOM   1943 N N   . GLY C 3 29  ? 17.679  65.766  41.625  1.00 38.25  ? 28  GLY C N   1 
ATOM   1944 C CA  . GLY C 3 29  ? 17.710  66.216  43.004  1.00 38.44  ? 28  GLY C CA  1 
ATOM   1945 C C   . GLY C 3 29  ? 16.433  66.182  43.821  1.00 34.53  ? 28  GLY C C   1 
ATOM   1946 O O   . GLY C 3 29  ? 16.408  66.708  44.927  1.00 33.98  ? 28  GLY C O   1 
ATOM   1947 N N   . ASP C 3 30  ? 15.372  65.595  43.287  1.00 29.70  ? 29  ASP C N   1 
ATOM   1948 C CA  . ASP C 3 30  ? 14.123  65.507  44.022  1.00 30.11  ? 29  ASP C CA  1 
ATOM   1949 C C   . ASP C 3 30  ? 13.773  64.059  44.317  1.00 29.47  ? 29  ASP C C   1 
ATOM   1950 O O   . ASP C 3 30  ? 14.127  63.164  43.561  1.00 32.57  ? 29  ASP C O   1 
ATOM   1951 C CB  . ASP C 3 30  ? 12.991  66.171  43.246  1.00 37.26  ? 29  ASP C CB  1 
ATOM   1952 C CG  . ASP C 3 30  ? 13.041  67.674  43.342  1.00 39.56  ? 29  ASP C CG  1 
ATOM   1953 O OD1 . ASP C 3 30  ? 13.184  68.178  44.476  1.00 54.35  ? 29  ASP C OD1 1 
ATOM   1954 O OD2 . ASP C 3 30  ? 12.933  68.354  42.302  1.00 40.12  ? 29  ASP C OD2 1 
ATOM   1955 N N   . GLU C 3 31  ? 13.072  63.837  45.421  1.00 32.01  ? 30  GLU C N   1 
ATOM   1956 C CA  . GLU C 3 31  ? 12.689  62.491  45.827  1.00 40.08  ? 30  GLU C CA  1 
ATOM   1957 C C   . GLU C 3 31  ? 11.549  61.897  44.999  1.00 38.26  ? 30  GLU C C   1 
ATOM   1958 O O   . GLU C 3 31  ? 10.439  62.432  44.979  1.00 43.12  ? 30  GLU C O   1 
ATOM   1959 C CB  . GLU C 3 31  ? 12.297  62.482  47.321  1.00 33.97  ? 30  GLU C CB  1 
ATOM   1960 C CG  . GLU C 3 31  ? 11.986  61.096  47.920  1.00 38.18  ? 30  GLU C CG  1 
ATOM   1961 C CD  . GLU C 3 31  ? 11.618  61.169  49.407  1.00 54.47  ? 30  GLU C CD  1 
ATOM   1962 O OE1 . GLU C 3 31  ? 12.376  61.798  50.178  1.00 63.86  ? 30  GLU C OE1 1 
ATOM   1963 O OE2 . GLU C 3 31  ? 10.578  60.603  49.814  1.00 47.24  ? 30  GLU C OE2 1 
ATOM   1964 N N   . LEU C 3 32  ? 11.836  60.799  44.307  1.00 34.71  ? 31  LEU C N   1 
ATOM   1965 C CA  . LEU C 3 32  ? 10.814  60.094  43.538  1.00 34.55  ? 31  LEU C CA  1 
ATOM   1966 C C   . LEU C 3 32  ? 10.069  59.286  44.599  1.00 35.74  ? 31  LEU C C   1 
ATOM   1967 O O   . LEU C 3 32  ? 8.842   59.331  44.719  1.00 27.96  ? 31  LEU C O   1 
ATOM   1968 C CB  . LEU C 3 32  ? 11.459  59.142  42.522  1.00 36.94  ? 31  LEU C CB  1 
ATOM   1969 C CG  . LEU C 3 32  ? 11.936  59.754  41.200  1.00 33.67  ? 31  LEU C CG  1 
ATOM   1970 C CD1 . LEU C 3 32  ? 12.807  58.761  40.475  1.00 35.30  ? 31  LEU C CD1 1 
ATOM   1971 C CD2 . LEU C 3 32  ? 10.729  60.138  40.337  1.00 30.88  ? 31  LEU C CD2 1 
ATOM   1972 N N   . PHE C 3 33  ? 10.836  58.560  45.398  1.00 33.14  ? 32  PHE C N   1 
ATOM   1973 C CA  . PHE C 3 33  ? 10.238  57.771  46.451  1.00 35.21  ? 32  PHE C CA  1 
ATOM   1974 C C   . PHE C 3 33  ? 11.269  57.206  47.405  1.00 35.65  ? 32  PHE C C   1 
ATOM   1975 O O   . PHE C 3 33  ? 12.483  57.361  47.215  1.00 28.26  ? 32  PHE C O   1 
ATOM   1976 C CB  . PHE C 3 33  ? 9.428   56.615  45.837  1.00 33.65  ? 32  PHE C CB  1 
ATOM   1977 C CG  . PHE C 3 33  ? 10.277  55.534  45.201  1.00 33.86  ? 32  PHE C CG  1 
ATOM   1978 C CD1 . PHE C 3 33  ? 11.055  54.687  45.981  1.00 30.37  ? 32  PHE C CD1 1 
ATOM   1979 C CD2 . PHE C 3 33  ? 10.300  55.373  43.826  1.00 32.31  ? 32  PHE C CD2 1 
ATOM   1980 C CE1 . PHE C 3 33  ? 11.843  53.702  45.398  1.00 34.01  ? 32  PHE C CE1 1 
ATOM   1981 C CE2 . PHE C 3 33  ? 11.084  54.392  43.239  1.00 31.36  ? 32  PHE C CE2 1 
ATOM   1982 C CZ  . PHE C 3 33  ? 11.856  53.556  44.028  1.00 36.02  ? 32  PHE C CZ  1 
ATOM   1983 N N   . TYR C 3 34  ? 10.757  56.560  48.446  1.00 36.28  ? 33  TYR C N   1 
ATOM   1984 C CA  . TYR C 3 34  ? 11.584  55.861  49.418  1.00 36.99  ? 33  TYR C CA  1 
ATOM   1985 C C   . TYR C 3 34  ? 10.777  54.601  49.679  1.00 36.32  ? 33  TYR C C   1 
ATOM   1986 O O   . TYR C 3 34  ? 9.545   54.622  49.608  1.00 35.70  ? 33  TYR C O   1 
ATOM   1987 C CB  . TYR C 3 34  ? 11.770  56.676  50.704  1.00 31.49  ? 33  TYR C CB  1 
ATOM   1988 C CG  . TYR C 3 34  ? 10.542  56.804  51.577  1.00 31.43  ? 33  TYR C CG  1 
ATOM   1989 C CD1 . TYR C 3 34  ? 10.158  55.768  52.431  1.00 30.76  ? 33  TYR C CD1 1 
ATOM   1990 C CD2 . TYR C 3 34  ? 9.761   57.959  51.552  1.00 24.04  ? 33  TYR C CD2 1 
ATOM   1991 C CE1 . TYR C 3 34  ? 9.027   55.881  53.238  1.00 29.24  ? 33  TYR C CE1 1 
ATOM   1992 C CE2 . TYR C 3 34  ? 8.630   58.083  52.351  1.00 33.41  ? 33  TYR C CE2 1 
ATOM   1993 C CZ  . TYR C 3 34  ? 8.266   57.036  53.194  1.00 36.49  ? 33  TYR C CZ  1 
ATOM   1994 O OH  . TYR C 3 34  ? 7.131   57.133  53.972  1.00 30.71  ? 33  TYR C OH  1 
ATOM   1995 N N   . VAL C 3 35  ? 11.461  53.495  49.929  1.00 33.55  ? 34  VAL C N   1 
ATOM   1996 C CA  . VAL C 3 35  ? 10.761  52.261  50.220  1.00 33.55  ? 34  VAL C CA  1 
ATOM   1997 C C   . VAL C 3 35  ? 10.593  52.122  51.733  1.00 40.49  ? 34  VAL C C   1 
ATOM   1998 O O   . VAL C 3 35  ? 11.582  52.142  52.480  1.00 34.23  ? 34  VAL C O   1 
ATOM   1999 C CB  . VAL C 3 35  ? 11.544  51.057  49.712  1.00 37.07  ? 34  VAL C CB  1 
ATOM   2000 C CG1 . VAL C 3 35  ? 10.877  49.759  50.174  1.00 30.30  ? 34  VAL C CG1 1 
ATOM   2001 C CG2 . VAL C 3 35  ? 11.630  51.112  48.219  1.00 42.00  ? 34  VAL C CG2 1 
ATOM   2002 N N   . ASP C 3 36  ? 9.347   52.003  52.186  1.00 43.27  ? 35  ASP C N   1 
ATOM   2003 C CA  . ASP C 3 36  ? 9.071   51.817  53.609  1.00 44.46  ? 35  ASP C CA  1 
ATOM   2004 C C   . ASP C 3 36  ? 9.506   50.380  53.903  1.00 47.54  ? 35  ASP C C   1 
ATOM   2005 O O   . ASP C 3 36  ? 8.860   49.431  53.459  1.00 48.43  ? 35  ASP C O   1 
ATOM   2006 C CB  . ASP C 3 36  ? 7.581   51.978  53.886  1.00 45.77  ? 35  ASP C CB  1 
ATOM   2007 C CG  . ASP C 3 36  ? 7.262   51.962  55.364  1.00 50.48  ? 35  ASP C CG  1 
ATOM   2008 O OD1 . ASP C 3 36  ? 7.628   50.978  56.041  1.00 48.48  ? 35  ASP C OD1 1 
ATOM   2009 O OD2 . ASP C 3 36  ? 6.643   52.935  55.848  1.00 54.25  ? 35  ASP C OD2 1 
ATOM   2010 N N   . LEU C 3 37  ? 10.599  50.225  54.645  1.00 48.39  ? 36  LEU C N   1 
ATOM   2011 C CA  . LEU C 3 37  ? 11.149  48.907  54.935  1.00 48.12  ? 36  LEU C CA  1 
ATOM   2012 C C   . LEU C 3 37  ? 10.345  48.023  55.878  1.00 53.12  ? 36  LEU C C   1 
ATOM   2013 O O   . LEU C 3 37  ? 10.599  46.823  55.961  1.00 55.38  ? 36  LEU C O   1 
ATOM   2014 C CB  . LEU C 3 37  ? 12.579  49.054  55.455  1.00 48.19  ? 36  LEU C CB  1 
ATOM   2015 C CG  . LEU C 3 37  ? 13.545  49.778  54.509  1.00 46.95  ? 36  LEU C CG  1 
ATOM   2016 C CD1 . LEU C 3 37  ? 14.877  50.006  55.202  1.00 43.77  ? 36  LEU C CD1 1 
ATOM   2017 C CD2 . LEU C 3 37  ? 13.736  48.962  53.245  1.00 47.35  ? 36  LEU C CD2 1 
ATOM   2018 N N   . ASP C 3 38  ? 9.382   48.605  56.588  1.00 56.08  ? 37  ASP C N   1 
ATOM   2019 C CA  . ASP C 3 38  ? 8.547   47.829  57.502  1.00 55.38  ? 37  ASP C CA  1 
ATOM   2020 C C   . ASP C 3 38  ? 7.261   47.421  56.797  1.00 56.38  ? 37  ASP C C   1 
ATOM   2021 O O   . ASP C 3 38  ? 6.790   46.294  56.938  1.00 57.34  ? 37  ASP C O   1 
ATOM   2022 C CB  . ASP C 3 38  ? 8.211   48.642  58.749  1.00 60.92  ? 37  ASP C CB  1 
ATOM   2023 C CG  . ASP C 3 38  ? 9.438   48.997  59.556  1.00 72.28  ? 37  ASP C CG  1 
ATOM   2024 O OD1 . ASP C 3 38  ? 10.172  48.067  59.950  1.00 78.18  ? 37  ASP C OD1 1 
ATOM   2025 O OD2 . ASP C 3 38  ? 9.669   50.201  59.801  1.00 80.35  ? 37  ASP C OD2 1 
ATOM   2026 N N   . LYS C 3 39  ? 6.690   48.348  56.037  1.00 51.24  ? 38  LYS C N   1 
ATOM   2027 C CA  . LYS C 3 39  ? 5.467   48.068  55.310  1.00 49.19  ? 38  LYS C CA  1 
ATOM   2028 C C   . LYS C 3 39  ? 5.798   47.310  54.029  1.00 45.79  ? 38  LYS C C   1 
ATOM   2029 O O   . LYS C 3 39  ? 4.931   46.655  53.456  1.00 48.85  ? 38  LYS C O   1 
ATOM   2030 C CB  . LYS C 3 39  ? 4.741   49.376  54.973  1.00 49.50  ? 38  LYS C CB  1 
ATOM   2031 C CG  . LYS C 3 39  ? 4.419   50.233  56.192  1.00 62.07  ? 38  LYS C CG  1 
ATOM   2032 C CD  . LYS C 3 39  ? 3.970   51.649  55.822  1.00 70.48  ? 38  LYS C CD  1 
ATOM   2033 C CE  . LYS C 3 39  ? 2.575   51.672  55.222  1.00 75.69  ? 38  LYS C CE  1 
ATOM   2034 N NZ  . LYS C 3 39  ? 1.539   51.279  56.221  1.00 84.47  ? 38  LYS C NZ  1 
ATOM   2035 N N   . LYS C 3 40  ? 7.089   47.378  53.601  1.00 42.60  ? 39  LYS C N   1 
ATOM   2036 C CA  . LYS C 3 40  ? 7.494   46.731  52.358  1.00 42.07  ? 39  LYS C CA  1 
ATOM   2037 C C   . LYS C 3 40  ? 6.707   47.409  51.240  1.00 40.67  ? 39  LYS C C   1 
ATOM   2038 O O   . LYS C 3 40  ? 6.160   46.734  50.360  1.00 41.19  ? 39  LYS C O   1 
ATOM   2039 C CB  . LYS C 3 40  ? 7.182   45.226  52.386  1.00 39.38  ? 39  LYS C CB  1 
ATOM   2040 C CG  . LYS C 3 40  ? 8.013   44.420  53.384  1.00 41.56  ? 39  LYS C CG  1 
ATOM   2041 C CD  . LYS C 3 40  ? 8.115   42.981  52.929  1.00 49.19  ? 39  LYS C CD  1 
ATOM   2042 C CE  . LYS C 3 40  ? 8.207   42.040  54.119  1.00 53.22  ? 39  LYS C CE  1 
ATOM   2043 N NZ  . LYS C 3 40  ? 9.626   41.714  54.453  1.00 69.79  ? 39  LYS C NZ  1 
ATOM   2044 N N   . GLU C 3 41  ? 6.673   48.732  51.277  1.00 43.55  ? 40  GLU C N   1 
ATOM   2045 C CA  . GLU C 3 41  ? 5.898   49.477  50.305  1.00 46.55  ? 40  GLU C CA  1 
ATOM   2046 C C   . GLU C 3 41  ? 6.650   50.676  49.721  1.00 43.21  ? 40  GLU C C   1 
ATOM   2047 O O   . GLU C 3 41  ? 7.381   51.376  50.423  1.00 44.38  ? 40  GLU C O   1 
ATOM   2048 C CB  . GLU C 3 41  ? 4.612   49.938  50.999  1.00 46.87  ? 40  GLU C CB  1 
ATOM   2049 C CG  . GLU C 3 41  ? 3.513   50.453  50.107  1.00 55.12  ? 40  GLU C CG  1 
ATOM   2050 C CD  . GLU C 3 41  ? 2.288   50.864  50.914  1.00 65.28  ? 40  GLU C CD  1 
ATOM   2051 O OE1 . GLU C 3 41  ? 1.875   50.082  51.803  1.00 66.91  ? 40  GLU C OE1 1 
ATOM   2052 O OE2 . GLU C 3 41  ? 1.741   51.962  50.658  1.00 68.21  ? 40  GLU C OE2 1 
ATOM   2053 N N   . THR C 3 42  ? 6.466   50.907  48.427  1.00 39.12  ? 41  THR C N   1 
ATOM   2054 C CA  . THR C 3 42  ? 7.104   52.039  47.768  1.00 42.90  ? 41  THR C CA  1 
ATOM   2055 C C   . THR C 3 42  ? 6.229   53.276  48.004  1.00 37.83  ? 41  THR C C   1 
ATOM   2056 O O   . THR C 3 42  ? 5.052   53.285  47.652  1.00 39.08  ? 41  THR C O   1 
ATOM   2057 C CB  . THR C 3 42  ? 7.247   51.771  46.266  1.00 42.39  ? 41  THR C CB  1 
ATOM   2058 O OG1 . THR C 3 42  ? 7.956   50.540  46.078  1.00 41.55  ? 41  THR C OG1 1 
ATOM   2059 C CG2 . THR C 3 42  ? 8.022   52.883  45.596  1.00 43.97  ? 41  THR C CG2 1 
ATOM   2060 N N   . ILE C 3 43  ? 6.802   54.312  48.605  1.00 34.30  ? 42  ILE C N   1 
ATOM   2061 C CA  . ILE C 3 43  ? 6.050   55.529  48.910  1.00 36.07  ? 42  ILE C CA  1 
ATOM   2062 C C   . ILE C 3 43  ? 6.432   56.685  47.976  1.00 38.65  ? 42  ILE C C   1 
ATOM   2063 O O   . ILE C 3 43  ? 7.427   57.366  48.197  1.00 38.41  ? 42  ILE C O   1 
ATOM   2064 C CB  . ILE C 3 43  ? 6.284   55.958  50.403  1.00 34.28  ? 42  ILE C CB  1 
ATOM   2065 C CG1 . ILE C 3 43  ? 6.049   54.761  51.339  1.00 32.76  ? 42  ILE C CG1 1 
ATOM   2066 C CG2 . ILE C 3 43  ? 5.354   57.094  50.793  1.00 24.22  ? 42  ILE C CG2 1 
ATOM   2067 C CD1 . ILE C 3 43  ? 4.702   54.066  51.148  1.00 21.65  ? 42  ILE C CD1 1 
ATOM   2068 N N   . TRP C 3 44  ? 5.628   56.905  46.941  1.00 37.67  ? 43  TRP C N   1 
ATOM   2069 C CA  . TRP C 3 44  ? 5.891   57.968  45.976  1.00 34.35  ? 43  TRP C CA  1 
ATOM   2070 C C   . TRP C 3 44  ? 5.520   59.340  46.498  1.00 37.40  ? 43  TRP C C   1 
ATOM   2071 O O   . TRP C 3 44  ? 4.379   59.558  46.890  1.00 36.39  ? 43  TRP C O   1 
ATOM   2072 C CB  . TRP C 3 44  ? 5.113   57.717  44.686  1.00 29.53  ? 43  TRP C CB  1 
ATOM   2073 C CG  . TRP C 3 44  ? 5.559   56.504  43.970  1.00 40.27  ? 43  TRP C CG  1 
ATOM   2074 C CD1 . TRP C 3 44  ? 5.174   55.213  44.212  1.00 39.54  ? 43  TRP C CD1 1 
ATOM   2075 C CD2 . TRP C 3 44  ? 6.544   56.445  42.932  1.00 40.70  ? 43  TRP C CD2 1 
ATOM   2076 N NE1 . TRP C 3 44  ? 5.861   54.353  43.389  1.00 44.18  ? 43  TRP C NE1 1 
ATOM   2077 C CE2 . TRP C 3 44  ? 6.708   55.079  42.590  1.00 47.80  ? 43  TRP C CE2 1 
ATOM   2078 C CE3 . TRP C 3 44  ? 7.301   57.413  42.251  1.00 35.21  ? 43  TRP C CE3 1 
ATOM   2079 C CZ2 . TRP C 3 44  ? 7.612   54.654  41.601  1.00 44.08  ? 43  TRP C CZ2 1 
ATOM   2080 C CZ3 . TRP C 3 44  ? 8.203   56.992  41.264  1.00 37.95  ? 43  TRP C CZ3 1 
ATOM   2081 C CH2 . TRP C 3 44  ? 8.347   55.622  40.949  1.00 44.83  ? 43  TRP C CH2 1 
ATOM   2082 N N   . MET C 3 45  ? 6.468   60.274  46.474  1.00 38.05  ? 44  MET C N   1 
ATOM   2083 C CA  . MET C 3 45  ? 6.183   61.623  46.948  1.00 34.10  ? 44  MET C CA  1 
ATOM   2084 C C   . MET C 3 45  ? 5.073   62.259  46.125  1.00 38.10  ? 44  MET C C   1 
ATOM   2085 O O   . MET C 3 45  ? 4.282   63.033  46.654  1.00 44.45  ? 44  MET C O   1 
ATOM   2086 C CB  . MET C 3 45  ? 7.426   62.506  46.902  1.00 34.16  ? 44  MET C CB  1 
ATOM   2087 C CG  . MET C 3 45  ? 7.220   63.827  47.625  1.00 36.12  ? 44  MET C CG  1 
ATOM   2088 S SD  . MET C 3 45  ? 8.639   64.892  47.625  1.00 42.16  ? 44  MET C SD  1 
ATOM   2089 C CE  . MET C 3 45  ? 9.586   64.203  48.924  1.00 33.38  ? 44  MET C CE  1 
ATOM   2090 N N   . LEU C 3 46  ? 5.018   61.946  44.831  1.00 39.83  ? 45  LEU C N   1 
ATOM   2091 C CA  . LEU C 3 46  ? 3.958   62.481  43.969  1.00 39.59  ? 45  LEU C CA  1 
ATOM   2092 C C   . LEU C 3 46  ? 3.035   61.323  43.571  1.00 43.53  ? 45  LEU C C   1 
ATOM   2093 O O   . LEU C 3 46  ? 3.353   60.526  42.692  1.00 35.98  ? 45  LEU C O   1 
ATOM   2094 C CB  . LEU C 3 46  ? 4.536   63.143  42.709  1.00 37.13  ? 45  LEU C CB  1 
ATOM   2095 C CG  . LEU C 3 46  ? 5.340   64.445  42.823  1.00 40.88  ? 45  LEU C CG  1 
ATOM   2096 C CD1 . LEU C 3 46  ? 5.724   64.900  41.422  1.00 35.08  ? 45  LEU C CD1 1 
ATOM   2097 C CD2 . LEU C 3 46  ? 4.532   65.534  43.519  1.00 37.71  ? 45  LEU C CD2 1 
ATOM   2098 N N   . PRO C 3 47  ? 1.873   61.219  44.224  1.00 50.30  ? 46  PRO C N   1 
ATOM   2099 C CA  . PRO C 3 47  ? 0.931   60.140  43.917  1.00 50.91  ? 46  PRO C CA  1 
ATOM   2100 C C   . PRO C 3 47  ? 0.693   59.946  42.429  1.00 51.97  ? 46  PRO C C   1 
ATOM   2101 O O   . PRO C 3 47  ? 0.779   58.827  41.927  1.00 63.20  ? 46  PRO C O   1 
ATOM   2102 C CB  . PRO C 3 47  ? -0.328  60.563  44.668  1.00 55.00  ? 46  PRO C CB  1 
ATOM   2103 C CG  . PRO C 3 47  ? 0.237   61.260  45.875  1.00 52.23  ? 46  PRO C CG  1 
ATOM   2104 C CD  . PRO C 3 47  ? 1.327   62.116  45.258  1.00 49.99  ? 46  PRO C CD  1 
ATOM   2105 N N   . GLU C 3 48  ? 0.397   61.033  41.725  1.00 50.77  ? 47  GLU C N   1 
ATOM   2106 C CA  . GLU C 3 48  ? 0.152   60.968  40.289  1.00 47.65  ? 47  GLU C CA  1 
ATOM   2107 C C   . GLU C 3 48  ? 1.178   60.082  39.582  1.00 45.41  ? 47  GLU C C   1 
ATOM   2108 O O   . GLU C 3 48  ? 0.813   59.235  38.768  1.00 44.69  ? 47  GLU C O   1 
ATOM   2109 C CB  . GLU C 3 48  ? 0.171   62.379  39.678  1.00 46.56  ? 47  GLU C CB  1 
ATOM   2110 C CG  . GLU C 3 48  ? 1.402   63.209  40.039  1.00 64.28  ? 47  GLU C CG  1 
ATOM   2111 C CD  . GLU C 3 48  ? 1.149   64.225  41.155  1.00 67.16  ? 47  GLU C CD  1 
ATOM   2112 O OE1 . GLU C 3 48  ? 0.553   63.846  42.192  1.00 67.65  ? 47  GLU C OE1 1 
ATOM   2113 O OE2 . GLU C 3 48  ? 1.561   65.401  40.994  1.00 57.22  ? 47  GLU C OE2 1 
ATOM   2114 N N   . PHE C 3 49  ? 2.456   60.270  39.902  1.00 37.06  ? 48  PHE C N   1 
ATOM   2115 C CA  . PHE C 3 49  ? 3.524   59.478  39.296  1.00 38.30  ? 48  PHE C CA  1 
ATOM   2116 C C   . PHE C 3 49  ? 3.305   57.969  39.425  1.00 41.40  ? 48  PHE C C   1 
ATOM   2117 O O   . PHE C 3 49  ? 3.511   57.220  38.465  1.00 42.44  ? 48  PHE C O   1 
ATOM   2118 C CB  . PHE C 3 49  ? 4.877   59.839  39.924  1.00 37.42  ? 48  PHE C CB  1 
ATOM   2119 C CG  . PHE C 3 49  ? 5.534   61.052  39.327  1.00 33.60  ? 48  PHE C CG  1 
ATOM   2120 C CD1 . PHE C 3 49  ? 4.778   62.072  38.753  1.00 36.53  ? 48  PHE C CD1 1 
ATOM   2121 C CD2 . PHE C 3 49  ? 6.917   61.195  39.378  1.00 38.30  ? 48  PHE C CD2 1 
ATOM   2122 C CE1 . PHE C 3 49  ? 5.385   63.212  38.243  1.00 27.87  ? 48  PHE C CE1 1 
ATOM   2123 C CE2 . PHE C 3 49  ? 7.537   62.333  38.872  1.00 31.77  ? 48  PHE C CE2 1 
ATOM   2124 C CZ  . PHE C 3 49  ? 6.763   63.348  38.302  1.00 34.90  ? 48  PHE C CZ  1 
ATOM   2125 N N   . ALA C 3 50  ? 2.893   57.522  40.608  1.00 44.48  ? 49  ALA C N   1 
ATOM   2126 C CA  . ALA C 3 50  ? 2.683   56.092  40.854  1.00 44.29  ? 49  ALA C CA  1 
ATOM   2127 C C   . ALA C 3 50  ? 1.671   55.490  39.900  1.00 45.80  ? 49  ALA C C   1 
ATOM   2128 O O   . ALA C 3 50  ? 1.640   54.279  39.695  1.00 46.53  ? 49  ALA C O   1 
ATOM   2129 C CB  . ALA C 3 50  ? 2.241   55.864  42.284  1.00 36.50  ? 49  ALA C CB  1 
ATOM   2130 N N   . GLN C 3 51  ? 0.840   56.343  39.318  1.00 50.91  ? 50  GLN C N   1 
ATOM   2131 C CA  . GLN C 3 51  ? -0.167  55.883  38.377  1.00 51.69  ? 50  GLN C CA  1 
ATOM   2132 C C   . GLN C 3 51  ? 0.481   55.516  37.054  1.00 46.75  ? 50  GLN C C   1 
ATOM   2133 O O   . GLN C 3 51  ? -0.077  54.745  36.296  1.00 52.74  ? 50  GLN C O   1 
ATOM   2134 C CB  . GLN C 3 51  ? -1.200  56.977  38.113  1.00 54.60  ? 50  GLN C CB  1 
ATOM   2135 C CG  . GLN C 3 51  ? -1.827  57.588  39.348  1.00 61.03  ? 50  GLN C CG  1 
ATOM   2136 C CD  . GLN C 3 51  ? -2.585  56.576  40.168  1.00 71.41  ? 50  GLN C CD  1 
ATOM   2137 O OE1 . GLN C 3 51  ? -2.956  55.506  39.670  1.00 69.33  ? 50  GLN C OE1 1 
ATOM   2138 N NE2 . GLN C 3 51  ? -2.836  56.909  41.434  1.00 75.56  ? 50  GLN C NE2 1 
ATOM   2139 N N   . LEU C 3 52  ? 1.657   56.069  36.778  1.00 43.25  ? 51  LEU C N   1 
ATOM   2140 C CA  . LEU C 3 52  ? 2.326   55.810  35.514  1.00 42.89  ? 51  LEU C CA  1 
ATOM   2141 C C   . LEU C 3 52  ? 3.563   54.926  35.578  1.00 48.38  ? 51  LEU C C   1 
ATOM   2142 O O   . LEU C 3 52  ? 3.895   54.259  34.602  1.00 55.12  ? 51  LEU C O   1 
ATOM   2143 C CB  . LEU C 3 52  ? 2.682   57.136  34.834  1.00 45.49  ? 51  LEU C CB  1 
ATOM   2144 C CG  . LEU C 3 52  ? 1.501   57.961  34.311  1.00 52.01  ? 51  LEU C CG  1 
ATOM   2145 C CD1 . LEU C 3 52  ? 0.638   58.428  35.466  1.00 59.34  ? 51  LEU C CD1 1 
ATOM   2146 C CD2 . LEU C 3 52  ? 2.011   59.155  33.539  1.00 54.13  ? 51  LEU C CD2 1 
ATOM   2147 N N   . ARG C 3 53  ? 4.262   54.926  36.705  1.00 45.74  ? 52  ARG C N   1 
ATOM   2148 C CA  . ARG C 3 53  ? 5.451   54.088  36.835  1.00 39.11  ? 52  ARG C CA  1 
ATOM   2149 C C   . ARG C 3 53  ? 5.381   53.367  38.168  1.00 42.74  ? 52  ARG C C   1 
ATOM   2150 O O   . ARG C 3 53  ? 4.530   53.664  39.011  1.00 43.69  ? 52  ARG C O   1 
ATOM   2151 C CB  . ARG C 3 53  ? 6.729   54.934  36.766  1.00 34.39  ? 52  ARG C CB  1 
ATOM   2152 C CG  . ARG C 3 53  ? 6.767   56.035  37.799  1.00 29.37  ? 52  ARG C CG  1 
ATOM   2153 C CD  . ARG C 3 53  ? 7.822   57.072  37.504  1.00 32.32  ? 52  ARG C CD  1 
ATOM   2154 N NE  . ARG C 3 53  ? 9.190   56.585  37.645  1.00 31.26  ? 52  ARG C NE  1 
ATOM   2155 C CZ  . ARG C 3 53  ? 10.248  57.392  37.660  1.00 33.94  ? 52  ARG C CZ  1 
ATOM   2156 N NH1 . ARG C 3 53  ? 10.077  58.699  37.539  1.00 32.69  ? 52  ARG C NH1 1 
ATOM   2157 N NH2 . ARG C 3 53  ? 11.468  56.909  37.808  1.00 37.04  ? 52  ARG C NH2 1 
ATOM   2158 N N   . SER C 3 54  ? 6.281   52.419  38.363  1.00 39.01  ? 53  SER C N   1 
ATOM   2159 C CA  . SER C 3 54  ? 6.289   51.673  39.601  1.00 37.14  ? 53  SER C CA  1 
ATOM   2160 C C   . SER C 3 54  ? 7.659   51.080  39.878  1.00 39.43  ? 53  SER C C   1 
ATOM   2161 O O   . SER C 3 54  ? 8.554   51.109  39.031  1.00 45.18  ? 53  SER C O   1 
ATOM   2162 C CB  . SER C 3 54  ? 5.251   50.554  39.521  1.00 37.75  ? 53  SER C CB  1 
ATOM   2163 O OG  . SER C 3 54  ? 5.562   49.665  38.462  1.00 40.56  ? 53  SER C OG  1 
ATOM   2164 N N   . PHE C 3 55  ? 7.821   50.556  41.082  1.00 37.62  ? 54  PHE C N   1 
ATOM   2165 C CA  . PHE C 3 55  ? 9.061   49.917  41.474  1.00 36.50  ? 54  PHE C CA  1 
ATOM   2166 C C   . PHE C 3 55  ? 8.676   48.904  42.534  1.00 40.29  ? 54  PHE C C   1 
ATOM   2167 O O   . PHE C 3 55  ? 7.940   49.226  43.471  1.00 41.68  ? 54  PHE C O   1 
ATOM   2168 C CB  . PHE C 3 55  ? 10.053  50.929  42.057  1.00 41.12  ? 54  PHE C CB  1 
ATOM   2169 C CG  . PHE C 3 55  ? 11.336  50.305  42.542  1.00 39.69  ? 54  PHE C CG  1 
ATOM   2170 C CD1 . PHE C 3 55  ? 12.319  49.904  41.643  1.00 40.13  ? 54  PHE C CD1 1 
ATOM   2171 C CD2 . PHE C 3 55  ? 11.551  50.098  43.898  1.00 38.32  ? 54  PHE C CD2 1 
ATOM   2172 C CE1 . PHE C 3 55  ? 13.500  49.301  42.096  1.00 40.27  ? 54  PHE C CE1 1 
ATOM   2173 C CE2 . PHE C 3 55  ? 12.725  49.498  44.362  1.00 36.98  ? 54  PHE C CE2 1 
ATOM   2174 C CZ  . PHE C 3 55  ? 13.700  49.101  43.461  1.00 36.56  ? 54  PHE C CZ  1 
ATOM   2175 N N   . ASP C 3 56  ? 9.160   47.680  42.362  1.00 41.62  ? 55  ASP C N   1 
ATOM   2176 C CA  . ASP C 3 56  ? 8.898   46.590  43.287  1.00 38.56  ? 55  ASP C CA  1 
ATOM   2177 C C   . ASP C 3 56  ? 9.684   46.831  44.583  1.00 33.94  ? 55  ASP C C   1 
ATOM   2178 O O   . ASP C 3 56  ? 10.905  46.751  44.588  1.00 35.19  ? 55  ASP C O   1 
ATOM   2179 C CB  . ASP C 3 56  ? 9.329   45.270  42.638  1.00 43.20  ? 55  ASP C CB  1 
ATOM   2180 C CG  . ASP C 3 56  ? 8.993   44.058  43.494  1.00 49.53  ? 55  ASP C CG  1 
ATOM   2181 O OD1 . ASP C 3 56  ? 8.826   44.233  44.723  1.00 47.27  ? 55  ASP C OD1 1 
ATOM   2182 O OD2 . ASP C 3 56  ? 8.906   42.937  42.939  1.00 47.37  ? 55  ASP C OD2 1 
ATOM   2183 N N   . PRO C 3 57  ? 8.985   47.093  45.703  1.00 36.31  ? 56  PRO C N   1 
ATOM   2184 C CA  . PRO C 3 57  ? 9.631   47.346  47.003  1.00 30.70  ? 56  PRO C CA  1 
ATOM   2185 C C   . PRO C 3 57  ? 10.684  46.293  47.368  1.00 38.33  ? 56  PRO C C   1 
ATOM   2186 O O   . PRO C 3 57  ? 11.628  46.563  48.127  1.00 43.37  ? 56  PRO C O   1 
ATOM   2187 C CB  . PRO C 3 57  ? 8.461   47.327  47.997  1.00 33.58  ? 56  PRO C CB  1 
ATOM   2188 C CG  . PRO C 3 57  ? 7.231   47.551  47.139  1.00 44.62  ? 56  PRO C CG  1 
ATOM   2189 C CD  . PRO C 3 57  ? 7.550   46.804  45.881  1.00 32.56  ? 56  PRO C CD  1 
ATOM   2190 N N   . GLN C 3 58  ? 10.514  45.084  46.844  1.00 32.33  ? 57  GLN C N   1 
ATOM   2191 C CA  . GLN C 3 58  ? 11.458  44.023  47.147  1.00 37.48  ? 57  GLN C CA  1 
ATOM   2192 C C   . GLN C 3 58  ? 12.871  44.387  46.689  1.00 41.81  ? 57  GLN C C   1 
ATOM   2193 O O   . GLN C 3 58  ? 13.850  43.951  47.290  1.00 40.41  ? 57  GLN C O   1 
ATOM   2194 C CB  . GLN C 3 58  ? 11.000  42.719  46.514  1.00 37.88  ? 57  GLN C CB  1 
ATOM   2195 C CG  . GLN C 3 58  ? 11.209  41.521  47.418  1.00 49.48  ? 57  GLN C CG  1 
ATOM   2196 C CD  . GLN C 3 58  ? 10.508  41.671  48.745  1.00 33.16  ? 57  GLN C CD  1 
ATOM   2197 O OE1 . GLN C 3 58  ? 9.305   41.887  48.800  1.00 41.89  ? 57  GLN C OE1 1 
ATOM   2198 N NE2 . GLN C 3 58  ? 11.260  41.560  49.822  1.00 37.56  ? 57  GLN C NE2 1 
ATOM   2199 N N   . GLY C 3 59  ? 12.977  45.199  45.640  1.00 35.18  ? 58  GLY C N   1 
ATOM   2200 C CA  . GLY C 3 59  ? 14.287  45.612  45.180  1.00 35.85  ? 58  GLY C CA  1 
ATOM   2201 C C   . GLY C 3 59  ? 15.017  46.405  46.259  1.00 37.93  ? 58  GLY C C   1 
ATOM   2202 O O   . GLY C 3 59  ? 16.229  46.283  46.416  1.00 33.06  ? 58  GLY C O   1 
ATOM   2203 N N   . GLY C 3 60  ? 14.278  47.229  47.002  1.00 40.79  ? 59  GLY C N   1 
ATOM   2204 C CA  . GLY C 3 60  ? 14.879  48.018  48.068  1.00 35.18  ? 59  GLY C CA  1 
ATOM   2205 C C   . GLY C 3 60  ? 15.309  47.143  49.236  1.00 33.47  ? 59  GLY C C   1 
ATOM   2206 O O   . GLY C 3 60  ? 16.404  47.313  49.776  1.00 36.37  ? 59  GLY C O   1 
ATOM   2207 N N   . LEU C 3 61  ? 14.453  46.196  49.610  1.00 36.90  ? 60  LEU C N   1 
ATOM   2208 C CA  . LEU C 3 61  ? 14.735  45.279  50.716  1.00 42.60  ? 60  LEU C CA  1 
ATOM   2209 C C   . LEU C 3 61  ? 15.959  44.411  50.424  1.00 44.17  ? 60  LEU C C   1 
ATOM   2210 O O   . LEU C 3 61  ? 16.810  44.183  51.293  1.00 37.46  ? 60  LEU C O   1 
ATOM   2211 C CB  . LEU C 3 61  ? 13.527  44.379  50.959  1.00 43.70  ? 60  LEU C CB  1 
ATOM   2212 C CG  . LEU C 3 61  ? 12.219  45.092  51.288  1.00 51.50  ? 60  LEU C CG  1 
ATOM   2213 C CD1 . LEU C 3 61  ? 11.069  44.101  51.257  1.00 48.87  ? 60  LEU C CD1 1 
ATOM   2214 C CD2 . LEU C 3 61  ? 12.330  45.739  52.645  1.00 43.53  ? 60  LEU C CD2 1 
ATOM   2215 N N   . GLN C 3 62  ? 16.028  43.919  49.192  1.00 45.28  ? 61  GLN C N   1 
ATOM   2216 C CA  . GLN C 3 62  ? 17.135  43.087  48.760  1.00 44.82  ? 61  GLN C CA  1 
ATOM   2217 C C   . GLN C 3 62  ? 18.435  43.854  48.882  1.00 46.56  ? 61  GLN C C   1 
ATOM   2218 O O   . GLN C 3 62  ? 19.431  43.326  49.372  1.00 50.19  ? 61  GLN C O   1 
ATOM   2219 C CB  . GLN C 3 62  ? 16.958  42.662  47.297  1.00 42.98  ? 61  GLN C CB  1 
ATOM   2220 C CG  . GLN C 3 62  ? 18.223  42.048  46.688  1.00 39.85  ? 61  GLN C CG  1 
ATOM   2221 C CD  . GLN C 3 62  ? 18.625  40.752  47.370  1.00 42.56  ? 61  GLN C CD  1 
ATOM   2222 O OE1 . GLN C 3 62  ? 18.062  39.692  47.091  1.00 42.98  ? 61  GLN C OE1 1 
ATOM   2223 N NE2 . GLN C 3 62  ? 19.589  40.834  48.283  1.00 36.72  ? 61  GLN C NE2 1 
ATOM   2224 N N   . ASN C 3 63  ? 18.424  45.101  48.427  1.00 42.71  ? 62  ASN C N   1 
ATOM   2225 C CA  . ASN C 3 63  ? 19.627  45.910  48.472  1.00 44.63  ? 62  ASN C CA  1 
ATOM   2226 C C   . ASN C 3 63  ? 19.913  46.515  49.836  1.00 43.93  ? 62  ASN C C   1 
ATOM   2227 O O   . ASN C 3 63  ? 21.066  46.814  50.146  1.00 44.81  ? 62  ASN C O   1 
ATOM   2228 C CB  . ASN C 3 63  ? 19.582  46.968  47.365  1.00 42.98  ? 62  ASN C CB  1 
ATOM   2229 C CG  . ASN C 3 63  ? 19.959  46.387  46.000  1.00 35.08  ? 62  ASN C CG  1 
ATOM   2230 O OD1 . ASN C 3 63  ? 21.132  46.153  45.717  1.00 47.36  ? 62  ASN C OD1 1 
ATOM   2231 N ND2 . ASN C 3 63  ? 18.965  46.130  45.170  1.00 31.31  ? 62  ASN C ND2 1 
ATOM   2232 N N   . ILE C 3 64  ? 18.881  46.688  50.658  1.00 41.49  ? 63  ILE C N   1 
ATOM   2233 C CA  . ILE C 3 64  ? 19.097  47.209  52.004  1.00 40.99  ? 63  ILE C CA  1 
ATOM   2234 C C   . ILE C 3 64  ? 19.840  46.111  52.773  1.00 47.51  ? 63  ILE C C   1 
ATOM   2235 O O   . ILE C 3 64  ? 20.624  46.391  53.683  1.00 47.88  ? 63  ILE C O   1 
ATOM   2236 C CB  . ILE C 3 64  ? 17.756  47.526  52.735  1.00 40.22  ? 63  ILE C CB  1 
ATOM   2237 C CG1 . ILE C 3 64  ? 17.295  48.948  52.405  1.00 39.03  ? 63  ILE C CG1 1 
ATOM   2238 C CG2 . ILE C 3 64  ? 17.917  47.367  54.243  1.00 25.59  ? 63  ILE C CG2 1 
ATOM   2239 C CD1 . ILE C 3 64  ? 18.243  50.034  52.859  1.00 36.13  ? 63  ILE C CD1 1 
ATOM   2240 N N   . ALA C 3 65  ? 19.593  44.858  52.395  1.00 48.03  ? 64  ALA C N   1 
ATOM   2241 C CA  . ALA C 3 65  ? 20.240  43.719  53.050  1.00 54.51  ? 64  ALA C CA  1 
ATOM   2242 C C   . ALA C 3 65  ? 21.727  43.722  52.725  1.00 54.66  ? 64  ALA C C   1 
ATOM   2243 O O   . ALA C 3 65  ? 22.571  43.497  53.596  1.00 55.99  ? 64  ALA C O   1 
ATOM   2244 C CB  . ALA C 3 65  ? 19.615  42.413  52.583  1.00 48.78  ? 64  ALA C CB  1 
ATOM   2245 N N   . THR C 3 66  ? 22.032  43.968  51.457  1.00 47.31  ? 65  THR C N   1 
ATOM   2246 C CA  . THR C 3 66  ? 23.406  44.029  51.000  1.00 48.44  ? 65  THR C CA  1 
ATOM   2247 C C   . THR C 3 66  ? 24.095  45.175  51.740  1.00 54.94  ? 65  THR C C   1 
ATOM   2248 O O   . THR C 3 66  ? 25.304  45.147  51.967  1.00 57.37  ? 65  THR C O   1 
ATOM   2249 C CB  . THR C 3 66  ? 23.452  44.272  49.480  1.00 41.28  ? 65  THR C CB  1 
ATOM   2250 O OG1 . THR C 3 66  ? 22.939  43.116  48.803  1.00 40.60  ? 65  THR C OG1 1 
ATOM   2251 C CG2 . THR C 3 66  ? 24.865  44.546  49.016  1.00 36.79  ? 65  THR C CG2 1 
ATOM   2252 N N   . GLY C 3 67  ? 23.312  46.181  52.121  1.00 56.57  ? 66  GLY C N   1 
ATOM   2253 C CA  . GLY C 3 67  ? 23.866  47.311  52.841  1.00 57.57  ? 66  GLY C CA  1 
ATOM   2254 C C   . GLY C 3 67  ? 24.292  46.849  54.215  1.00 57.97  ? 66  GLY C C   1 
ATOM   2255 O O   . GLY C 3 67  ? 25.318  47.274  54.735  1.00 58.78  ? 66  GLY C O   1 
ATOM   2256 N N   . LYS C 3 68  ? 23.491  45.966  54.802  1.00 62.48  ? 67  LYS C N   1 
ATOM   2257 C CA  . LYS C 3 68  ? 23.777  45.412  56.119  1.00 59.96  ? 67  LYS C CA  1 
ATOM   2258 C C   . LYS C 3 68  ? 25.046  44.567  56.019  1.00 61.14  ? 67  LYS C C   1 
ATOM   2259 O O   . LYS C 3 68  ? 25.879  44.556  56.930  1.00 57.04  ? 67  LYS C O   1 
ATOM   2260 C CB  . LYS C 3 68  ? 22.607  44.541  56.580  1.00 61.08  ? 67  LYS C CB  1 
ATOM   2261 C CG  . LYS C 3 68  ? 22.767  43.976  57.976  1.00 63.93  ? 67  LYS C CG  1 
ATOM   2262 C CD  . LYS C 3 68  ? 21.577  43.137  58.375  1.00 57.87  ? 67  LYS C CD  1 
ATOM   2263 C CE  . LYS C 3 68  ? 21.777  42.553  59.759  1.00 66.57  ? 67  LYS C CE  1 
ATOM   2264 N NZ  . LYS C 3 68  ? 20.667  41.632  60.128  1.00 73.61  ? 67  LYS C NZ  1 
ATOM   2265 N N   . HIS C 3 69  ? 25.177  43.871  54.891  1.00 60.76  ? 68  HIS C N   1 
ATOM   2266 C CA  . HIS C 3 69  ? 26.322  43.012  54.607  1.00 57.49  ? 68  HIS C CA  1 
ATOM   2267 C C   . HIS C 3 69  ? 27.606  43.807  54.372  1.00 59.94  ? 68  HIS C C   1 
ATOM   2268 O O   . HIS C 3 69  ? 28.590  43.611  55.079  1.00 63.91  ? 68  HIS C O   1 
ATOM   2269 C CB  . HIS C 3 69  ? 26.043  42.151  53.376  1.00 53.50  ? 68  HIS C CB  1 
ATOM   2270 C CG  . HIS C 3 69  ? 27.233  41.376  52.908  1.00 61.01  ? 68  HIS C CG  1 
ATOM   2271 N ND1 . HIS C 3 69  ? 27.698  40.256  53.564  1.00 62.56  ? 68  HIS C ND1 1 
ATOM   2272 C CD2 . HIS C 3 69  ? 28.079  41.585  51.871  1.00 59.67  ? 68  HIS C CD2 1 
ATOM   2273 C CE1 . HIS C 3 69  ? 28.780  39.810  52.950  1.00 63.55  ? 68  HIS C CE1 1 
ATOM   2274 N NE2 . HIS C 3 69  ? 29.033  40.599  51.920  1.00 56.96  ? 68  HIS C NE2 1 
ATOM   2275 N N   . ASN C 3 70  ? 27.610  44.684  53.367  1.00 57.89  ? 69  ASN C N   1 
ATOM   2276 C CA  . ASN C 3 70  ? 28.799  45.479  53.087  1.00 55.78  ? 69  ASN C CA  1 
ATOM   2277 C C   . ASN C 3 70  ? 29.204  46.252  54.326  1.00 54.99  ? 69  ASN C C   1 
ATOM   2278 O O   . ASN C 3 70  ? 30.389  46.360  54.632  1.00 59.30  ? 69  ASN C O   1 
ATOM   2279 C CB  . ASN C 3 70  ? 28.574  46.422  51.907  1.00 58.54  ? 69  ASN C CB  1 
ATOM   2280 C CG  . ASN C 3 70  ? 28.569  45.690  50.574  1.00 63.39  ? 69  ASN C CG  1 
ATOM   2281 O OD1 . ASN C 3 70  ? 29.354  44.763  50.357  1.00 64.18  ? 69  ASN C OD1 1 
ATOM   2282 N ND2 . ASN C 3 70  ? 27.694  46.110  49.671  1.00 62.76  ? 69  ASN C ND2 1 
ATOM   2283 N N   . LEU C 3 71  ? 28.237  46.816  55.040  1.00 53.35  ? 70  LEU C N   1 
ATOM   2284 C CA  . LEU C 3 71  ? 28.600  47.489  56.283  1.00 58.93  ? 70  LEU C CA  1 
ATOM   2285 C C   . LEU C 3 71  ? 28.994  46.290  57.133  1.00 64.88  ? 70  LEU C C   1 
ATOM   2286 O O   . LEU C 3 71  ? 28.479  45.198  56.926  1.00 73.50  ? 70  LEU C O   1 
ATOM   2287 C CB  . LEU C 3 71  ? 27.409  48.205  56.937  1.00 48.33  ? 70  LEU C CB  1 
ATOM   2288 C CG  . LEU C 3 71  ? 27.676  48.766  58.346  1.00 43.67  ? 70  LEU C CG  1 
ATOM   2289 C CD1 . LEU C 3 71  ? 28.494  50.047  58.274  1.00 39.91  ? 70  LEU C CD1 1 
ATOM   2290 C CD2 . LEU C 3 71  ? 26.362  49.025  59.067  1.00 36.84  ? 70  LEU C CD2 1 
ATOM   2291 N N   . GLY C 3 72  ? 29.884  46.472  58.094  1.00 66.18  ? 71  GLY C N   1 
ATOM   2292 C CA  . GLY C 3 72  ? 30.297  45.325  58.884  1.00 64.37  ? 71  GLY C CA  1 
ATOM   2293 C C   . GLY C 3 72  ? 31.571  44.816  58.242  1.00 63.63  ? 71  GLY C C   1 
ATOM   2294 O O   . GLY C 3 72  ? 32.625  44.788  58.874  1.00 68.10  ? 71  GLY C O   1 
ATOM   2295 N N   . VAL C 3 73  ? 31.478  44.401  56.984  1.00 58.15  ? 72  VAL C N   1 
ATOM   2296 C CA  . VAL C 3 73  ? 32.660  43.959  56.260  1.00 56.56  ? 72  VAL C CA  1 
ATOM   2297 C C   . VAL C 3 73  ? 33.606  45.153  56.298  1.00 62.20  ? 72  VAL C C   1 
ATOM   2298 O O   . VAL C 3 73  ? 34.787  45.017  56.604  1.00 70.94  ? 72  VAL C O   1 
ATOM   2299 C CB  . VAL C 3 73  ? 32.344  43.649  54.780  1.00 50.59  ? 72  VAL C CB  1 
ATOM   2300 C CG1 . VAL C 3 73  ? 33.632  43.521  53.984  1.00 39.60  ? 72  VAL C CG1 1 
ATOM   2301 C CG2 . VAL C 3 73  ? 31.536  42.372  54.679  1.00 58.47  ? 72  VAL C CG2 1 
ATOM   2302 N N   . LEU C 3 74  ? 33.060  46.327  55.991  1.00 64.19  ? 73  LEU C N   1 
ATOM   2303 C CA  . LEU C 3 74  ? 33.826  47.566  55.981  1.00 67.27  ? 73  LEU C CA  1 
ATOM   2304 C C   . LEU C 3 74  ? 34.109  48.091  57.379  1.00 69.97  ? 73  LEU C C   1 
ATOM   2305 O O   . LEU C 3 74  ? 35.092  48.795  57.584  1.00 75.22  ? 73  LEU C O   1 
ATOM   2306 C CB  . LEU C 3 74  ? 33.096  48.636  55.166  1.00 63.12  ? 73  LEU C CB  1 
ATOM   2307 C CG  . LEU C 3 74  ? 33.378  48.671  53.661  1.00 64.11  ? 73  LEU C CG  1 
ATOM   2308 C CD1 . LEU C 3 74  ? 34.810  49.105  53.448  1.00 60.98  ? 73  LEU C CD1 1 
ATOM   2309 C CD2 . LEU C 3 74  ? 33.125  47.312  53.022  1.00 60.57  ? 73  LEU C CD2 1 
ATOM   2310 N N   . THR C 3 75  ? 33.249  47.764  58.339  1.00 73.18  ? 74  THR C N   1 
ATOM   2311 C CA  . THR C 3 75  ? 33.458  48.207  59.715  1.00 75.19  ? 74  THR C CA  1 
ATOM   2312 C C   . THR C 3 75  ? 34.598  47.376  60.304  1.00 76.88  ? 74  THR C C   1 
ATOM   2313 O O   . THR C 3 75  ? 35.307  47.817  61.206  1.00 78.03  ? 74  THR C O   1 
ATOM   2314 C CB  . THR C 3 75  ? 32.197  47.997  60.579  1.00 75.24  ? 74  THR C CB  1 
ATOM   2315 O OG1 . THR C 3 75  ? 31.063  48.572  59.919  1.00 78.52  ? 74  THR C OG1 1 
ATOM   2316 C CG2 . THR C 3 75  ? 32.365  48.661  61.939  1.00 66.58  ? 74  THR C CG2 1 
ATOM   2317 N N   . LYS C 3 76  ? 34.760  46.169  59.770  1.00 78.11  ? 75  LYS C N   1 
ATOM   2318 C CA  . LYS C 3 76  ? 35.802  45.239  60.197  1.00 78.29  ? 75  LYS C CA  1 
ATOM   2319 C C   . LYS C 3 76  ? 37.122  45.626  59.534  1.00 75.88  ? 75  LYS C C   1 
ATOM   2320 O O   . LYS C 3 76  ? 38.170  45.663  60.179  1.00 75.12  ? 75  LYS C O   1 
ATOM   2321 C CB  . LYS C 3 76  ? 35.414  43.814  59.783  1.00 82.19  ? 75  LYS C CB  1 
ATOM   2322 C CG  . LYS C 3 76  ? 36.349  42.712  60.255  1.00 87.49  ? 75  LYS C CG  1 
ATOM   2323 C CD  . LYS C 3 76  ? 35.888  41.357  59.722  1.00 96.94  ? 75  LYS C CD  1 
ATOM   2324 C CE  . LYS C 3 76  ? 36.676  40.196  60.328  1.00 100.08 ? 75  LYS C CE  1 
ATOM   2325 N NZ  . LYS C 3 76  ? 36.438  40.033  61.796  1.00 96.92  ? 75  LYS C NZ  1 
ATOM   2326 N N   . ARG C 3 77  ? 37.047  45.922  58.239  1.00 69.77  ? 76  ARG C N   1 
ATOM   2327 C CA  . ARG C 3 77  ? 38.205  46.305  57.444  1.00 65.92  ? 76  ARG C CA  1 
ATOM   2328 C C   . ARG C 3 77  ? 38.796  47.651  57.847  1.00 67.64  ? 76  ARG C C   1 
ATOM   2329 O O   . ARG C 3 77  ? 40.005  47.785  57.998  1.00 69.47  ? 76  ARG C O   1 
ATOM   2330 C CB  . ARG C 3 77  ? 37.825  46.349  55.966  1.00 66.93  ? 76  ARG C CB  1 
ATOM   2331 C CG  . ARG C 3 77  ? 38.982  46.679  55.048  1.00 68.58  ? 76  ARG C CG  1 
ATOM   2332 C CD  . ARG C 3 77  ? 38.507  46.966  53.639  1.00 70.08  ? 76  ARG C CD  1 
ATOM   2333 N NE  . ARG C 3 77  ? 37.770  45.851  53.057  1.00 74.94  ? 76  ARG C NE  1 
ATOM   2334 C CZ  . ARG C 3 77  ? 37.203  45.885  51.854  1.00 79.47  ? 76  ARG C CZ  1 
ATOM   2335 N NH1 . ARG C 3 77  ? 37.290  46.980  51.105  1.00 76.93  ? 76  ARG C NH1 1 
ATOM   2336 N NH2 . ARG C 3 77  ? 36.545  44.828  51.400  1.00 78.92  ? 76  ARG C NH2 1 
ATOM   2337 N N   . SER C 3 78  ? 37.941  48.651  58.015  1.00 72.44  ? 77  SER C N   1 
ATOM   2338 C CA  . SER C 3 78  ? 38.388  49.988  58.393  1.00 73.32  ? 77  SER C CA  1 
ATOM   2339 C C   . SER C 3 78  ? 39.049  49.982  59.763  1.00 75.41  ? 77  SER C C   1 
ATOM   2340 O O   . SER C 3 78  ? 39.508  51.019  60.240  1.00 71.99  ? 77  SER C O   1 
ATOM   2341 C CB  . SER C 3 78  ? 37.204  50.946  58.453  1.00 74.07  ? 77  SER C CB  1 
ATOM   2342 O OG  . SER C 3 78  ? 36.491  50.770  59.669  1.00 68.30  ? 77  SER C OG  1 
ATOM   2343 N N   . ASN C 3 79  ? 39.087  48.815  60.395  1.00 79.49  ? 78  ASN C N   1 
ATOM   2344 C CA  . ASN C 3 79  ? 39.665  48.698  61.725  1.00 82.66  ? 78  ASN C CA  1 
ATOM   2345 C C   . ASN C 3 79  ? 38.706  49.440  62.655  1.00 78.13  ? 78  ASN C C   1 
ATOM   2346 O O   . ASN C 3 79  ? 39.125  50.147  63.568  1.00 81.09  ? 78  ASN C O   1 
ATOM   2347 C CB  . ASN C 3 79  ? 41.066  49.336  61.771  1.00 91.46  ? 78  ASN C CB  1 
ATOM   2348 C CG  . ASN C 3 79  ? 42.042  48.706  60.771  1.00 97.49  ? 78  ASN C CG  1 
ATOM   2349 O OD1 . ASN C 3 79  ? 42.422  47.540  60.901  1.00 96.16  ? 78  ASN C OD1 1 
ATOM   2350 N ND2 . ASN C 3 79  ? 42.450  49.483  59.769  1.00 97.87  ? 78  ASN C ND2 1 
ATOM   2351 N N   . SER C 3 80  ? 37.412  49.283  62.383  1.00 73.91  ? 79  SER C N   1 
ATOM   2352 C CA  . SER C 3 80  ? 36.335  49.896  63.165  1.00 71.10  ? 79  SER C CA  1 
ATOM   2353 C C   . SER C 3 80  ? 36.373  51.425  63.277  1.00 68.71  ? 79  SER C C   1 
ATOM   2354 O O   . SER C 3 80  ? 36.132  51.983  64.349  1.00 66.75  ? 79  SER C O   1 
ATOM   2355 C CB  . SER C 3 80  ? 36.307  49.281  64.567  1.00 73.47  ? 79  SER C CB  1 
ATOM   2356 O OG  . SER C 3 80  ? 35.237  49.801  65.333  1.00 70.74  ? 79  SER C OG  1 
ATOM   2357 N N   . THR C 3 81  ? 36.661  52.104  62.172  1.00 65.47  ? 80  THR C N   1 
ATOM   2358 C CA  . THR C 3 81  ? 36.716  53.564  62.178  1.00 66.54  ? 80  THR C CA  1 
ATOM   2359 C C   . THR C 3 81  ? 35.310  54.165  62.212  1.00 68.68  ? 80  THR C C   1 
ATOM   2360 O O   . THR C 3 81  ? 34.524  53.982  61.279  1.00 63.57  ? 80  THR C O   1 
ATOM   2361 C CB  . THR C 3 81  ? 37.430  54.093  60.935  1.00 66.29  ? 80  THR C CB  1 
ATOM   2362 O OG1 . THR C 3 81  ? 38.739  53.517  60.857  1.00 64.13  ? 80  THR C OG1 1 
ATOM   2363 C CG2 . THR C 3 81  ? 37.536  55.608  60.995  1.00 64.17  ? 80  THR C CG2 1 
ATOM   2364 N N   . PRO C 3 82  ? 34.975  54.888  63.295  1.00 68.76  ? 81  PRO C N   1 
ATOM   2365 C CA  . PRO C 3 82  ? 33.655  55.508  63.433  1.00 69.74  ? 81  PRO C CA  1 
ATOM   2366 C C   . PRO C 3 82  ? 33.505  56.756  62.574  1.00 71.14  ? 81  PRO C C   1 
ATOM   2367 O O   . PRO C 3 82  ? 34.495  57.330  62.116  1.00 74.53  ? 81  PRO C O   1 
ATOM   2368 C CB  . PRO C 3 82  ? 33.578  55.811  64.927  1.00 72.10  ? 81  PRO C CB  1 
ATOM   2369 C CG  . PRO C 3 82  ? 34.993  56.171  65.251  1.00 70.66  ? 81  PRO C CG  1 
ATOM   2370 C CD  . PRO C 3 82  ? 35.776  55.091  64.517  1.00 73.17  ? 81  PRO C CD  1 
ATOM   2371 N N   . ALA C 3 83  ? 32.259  57.166  62.355  1.00 69.66  ? 82  ALA C N   1 
ATOM   2372 C CA  . ALA C 3 83  ? 31.971  58.345  61.550  1.00 65.80  ? 82  ALA C CA  1 
ATOM   2373 C C   . ALA C 3 83  ? 32.169  59.603  62.380  1.00 65.81  ? 82  ALA C C   1 
ATOM   2374 O O   . ALA C 3 83  ? 31.904  59.616  63.584  1.00 61.85  ? 82  ALA C O   1 
ATOM   2375 C CB  . ALA C 3 83  ? 30.545  58.287  61.031  1.00 64.21  ? 82  ALA C CB  1 
ATOM   2376 N N   . THR C 3 84  ? 32.626  60.667  61.734  1.00 64.78  ? 83  THR C N   1 
ATOM   2377 C CA  . THR C 3 84  ? 32.845  61.913  62.446  1.00 66.75  ? 83  THR C CA  1 
ATOM   2378 C C   . THR C 3 84  ? 31.628  62.840  62.341  1.00 65.36  ? 83  THR C C   1 
ATOM   2379 O O   . THR C 3 84  ? 31.160  63.156  61.244  1.00 63.30  ? 83  THR C O   1 
ATOM   2380 C CB  . THR C 3 84  ? 34.105  62.617  61.914  1.00 69.70  ? 83  THR C CB  1 
ATOM   2381 O OG1 . THR C 3 84  ? 35.179  61.668  61.845  1.00 68.68  ? 83  THR C OG1 1 
ATOM   2382 C CG2 . THR C 3 84  ? 34.511  63.754  62.838  1.00 63.52  ? 83  THR C CG2 1 
ATOM   2383 N N   . ASN C 3 85  ? 31.132  63.265  63.501  1.00 60.93  ? 84  ASN C N   1 
ATOM   2384 C CA  . ASN C 3 85  ? 29.967  64.140  63.619  1.00 57.01  ? 84  ASN C CA  1 
ATOM   2385 C C   . ASN C 3 85  ? 30.106  65.551  63.055  1.00 60.93  ? 84  ASN C C   1 
ATOM   2386 O O   . ASN C 3 85  ? 30.984  66.310  63.459  1.00 62.23  ? 84  ASN C O   1 
ATOM   2387 C CB  . ASN C 3 85  ? 29.565  64.261  65.090  1.00 53.34  ? 84  ASN C CB  1 
ATOM   2388 C CG  . ASN C 3 85  ? 28.777  63.069  65.581  1.00 53.46  ? 84  ASN C CG  1 
ATOM   2389 O OD1 . ASN C 3 85  ? 28.704  62.041  64.911  1.00 57.60  ? 84  ASN C OD1 1 
ATOM   2390 N ND2 . ASN C 3 85  ? 28.183  63.199  66.766  1.00 60.20  ? 84  ASN C ND2 1 
ATOM   2391 N N   . GLU C 3 86  ? 29.222  65.909  62.130  1.00 59.25  ? 85  GLU C N   1 
ATOM   2392 C CA  . GLU C 3 86  ? 29.234  67.251  61.562  1.00 58.95  ? 85  GLU C CA  1 
ATOM   2393 C C   . GLU C 3 86  ? 28.141  68.039  62.260  1.00 59.09  ? 85  GLU C C   1 
ATOM   2394 O O   . GLU C 3 86  ? 27.323  67.469  62.981  1.00 62.88  ? 85  GLU C O   1 
ATOM   2395 C CB  . GLU C 3 86  ? 28.955  67.210  60.063  1.00 59.21  ? 85  GLU C CB  1 
ATOM   2396 C CG  . GLU C 3 86  ? 30.118  66.727  59.242  1.00 67.77  ? 85  GLU C CG  1 
ATOM   2397 C CD  . GLU C 3 86  ? 31.312  67.649  59.355  1.00 74.45  ? 85  GLU C CD  1 
ATOM   2398 O OE1 . GLU C 3 86  ? 31.135  68.867  59.141  1.00 76.12  ? 85  GLU C OE1 1 
ATOM   2399 O OE2 . GLU C 3 86  ? 32.423  67.157  59.653  1.00 75.65  ? 85  GLU C OE2 1 
ATOM   2400 N N   . ALA C 3 87  ? 28.120  69.347  62.052  1.00 55.89  ? 86  ALA C N   1 
ATOM   2401 C CA  . ALA C 3 87  ? 27.107  70.175  62.678  1.00 55.91  ? 86  ALA C CA  1 
ATOM   2402 C C   . ALA C 3 87  ? 26.136  70.682  61.617  1.00 56.87  ? 86  ALA C C   1 
ATOM   2403 O O   . ALA C 3 87  ? 26.526  71.395  60.693  1.00 61.86  ? 86  ALA C O   1 
ATOM   2404 C CB  . ALA C 3 87  ? 27.764  71.337  63.401  1.00 56.72  ? 86  ALA C CB  1 
ATOM   2405 N N   . PRO C 3 88  ? 24.854  70.310  61.738  1.00 54.14  ? 87  PRO C N   1 
ATOM   2406 C CA  . PRO C 3 88  ? 23.791  70.704  60.810  1.00 51.53  ? 87  PRO C CA  1 
ATOM   2407 C C   . PRO C 3 88  ? 23.557  72.205  60.741  1.00 48.73  ? 87  PRO C C   1 
ATOM   2408 O O   . PRO C 3 88  ? 23.856  72.943  61.680  1.00 45.29  ? 87  PRO C O   1 
ATOM   2409 C CB  . PRO C 3 88  ? 22.571  69.969  61.354  1.00 53.06  ? 87  PRO C CB  1 
ATOM   2410 C CG  . PRO C 3 88  ? 23.162  68.774  62.027  1.00 54.88  ? 87  PRO C CG  1 
ATOM   2411 C CD  . PRO C 3 88  ? 24.336  69.365  62.740  1.00 59.37  ? 87  PRO C CD  1 
ATOM   2412 N N   . GLN C 3 89  ? 22.999  72.643  59.622  1.00 45.68  ? 88  GLN C N   1 
ATOM   2413 C CA  . GLN C 3 89  ? 22.707  74.047  59.404  1.00 44.32  ? 88  GLN C CA  1 
ATOM   2414 C C   . GLN C 3 89  ? 21.263  74.100  58.949  1.00 42.26  ? 88  GLN C C   1 
ATOM   2415 O O   . GLN C 3 89  ? 20.842  73.286  58.132  1.00 50.57  ? 88  GLN C O   1 
ATOM   2416 C CB  . GLN C 3 89  ? 23.621  74.590  58.316  1.00 58.48  ? 88  GLN C CB  1 
ATOM   2417 C CG  . GLN C 3 89  ? 24.304  75.889  58.661  1.00 81.68  ? 88  GLN C CG  1 
ATOM   2418 C CD  . GLN C 3 89  ? 25.344  76.268  57.623  1.00 93.48  ? 88  GLN C CD  1 
ATOM   2419 O OE1 . GLN C 3 89  ? 26.176  75.438  57.229  1.00 92.09  ? 88  GLN C OE1 1 
ATOM   2420 N NE2 . GLN C 3 89  ? 25.310  77.525  57.179  1.00 96.05  ? 88  GLN C NE2 1 
ATOM   2421 N N   . ALA C 3 90  ? 20.496  75.047  59.467  1.00 38.22  ? 89  ALA C N   1 
ATOM   2422 C CA  . ALA C 3 90  ? 19.100  75.128  59.082  1.00 37.82  ? 89  ALA C CA  1 
ATOM   2423 C C   . ALA C 3 90  ? 18.699  76.498  58.579  1.00 44.16  ? 89  ALA C C   1 
ATOM   2424 O O   . ALA C 3 90  ? 19.228  77.522  59.018  1.00 46.10  ? 89  ALA C O   1 
ATOM   2425 C CB  . ALA C 3 90  ? 18.218  74.723  60.245  1.00 33.96  ? 89  ALA C CB  1 
ATOM   2426 N N   . THR C 3 91  ? 17.752  76.495  57.647  1.00 43.13  ? 90  THR C N   1 
ATOM   2427 C CA  . THR C 3 91  ? 17.241  77.711  57.041  1.00 38.30  ? 90  THR C CA  1 
ATOM   2428 C C   . THR C 3 91  ? 15.734  77.592  57.010  1.00 38.84  ? 90  THR C C   1 
ATOM   2429 O O   . THR C 3 91  ? 15.203  76.527  56.697  1.00 42.16  ? 90  THR C O   1 
ATOM   2430 C CB  . THR C 3 91  ? 17.749  77.849  55.600  1.00 42.00  ? 90  THR C CB  1 
ATOM   2431 O OG1 . THR C 3 91  ? 19.178  77.868  55.608  1.00 40.85  ? 90  THR C OG1 1 
ATOM   2432 C CG2 . THR C 3 91  ? 17.215  79.122  54.952  1.00 33.75  ? 90  THR C CG2 1 
ATOM   2433 N N   . VAL C 3 92  ? 15.038  78.676  57.327  1.00 36.75  ? 91  VAL C N   1 
ATOM   2434 C CA  . VAL C 3 92  ? 13.585  78.628  57.318  1.00 33.60  ? 91  VAL C CA  1 
ATOM   2435 C C   . VAL C 3 92  ? 13.004  79.673  56.388  1.00 29.25  ? 91  VAL C C   1 
ATOM   2436 O O   . VAL C 3 92  ? 13.378  80.842  56.437  1.00 30.30  ? 91  VAL C O   1 
ATOM   2437 C CB  . VAL C 3 92  ? 13.007  78.828  58.733  1.00 39.01  ? 91  VAL C CB  1 
ATOM   2438 C CG1 . VAL C 3 92  ? 11.473  78.778  58.689  1.00 32.74  ? 91  VAL C CG1 1 
ATOM   2439 C CG2 . VAL C 3 92  ? 13.556  77.742  59.661  1.00 41.67  ? 91  VAL C CG2 1 
ATOM   2440 N N   . PHE C 3 93  ? 12.074  79.242  55.542  1.00 32.29  ? 92  PHE C N   1 
ATOM   2441 C CA  . PHE C 3 93  ? 11.446  80.140  54.581  1.00 31.11  ? 92  PHE C CA  1 
ATOM   2442 C C   . PHE C 3 93  ? 10.082  79.605  54.165  1.00 29.54  ? 92  PHE C C   1 
ATOM   2443 O O   . PHE C 3 93  ? 9.869   78.393  54.102  1.00 29.05  ? 92  PHE C O   1 
ATOM   2444 C CB  . PHE C 3 93  ? 12.326  80.269  53.337  1.00 32.27  ? 92  PHE C CB  1 
ATOM   2445 C CG  . PHE C 3 93  ? 12.618  78.955  52.671  1.00 25.20  ? 92  PHE C CG  1 
ATOM   2446 C CD1 . PHE C 3 93  ? 13.632  78.131  53.139  1.00 29.41  ? 92  PHE C CD1 1 
ATOM   2447 C CD2 . PHE C 3 93  ? 11.848  78.521  51.596  1.00 26.35  ? 92  PHE C CD2 1 
ATOM   2448 C CE1 . PHE C 3 93  ? 13.875  76.893  52.553  1.00 25.80  ? 92  PHE C CE1 1 
ATOM   2449 C CE2 . PHE C 3 93  ? 12.086  77.278  51.002  1.00 31.87  ? 92  PHE C CE2 1 
ATOM   2450 C CZ  . PHE C 3 93  ? 13.098  76.467  51.482  1.00 26.17  ? 92  PHE C CZ  1 
ATOM   2451 N N   . PRO C 3 94  ? 9.141   80.510  53.865  1.00 27.77  ? 93  PRO C N   1 
ATOM   2452 C CA  . PRO C 3 94  ? 7.799   80.090  53.450  1.00 31.01  ? 93  PRO C CA  1 
ATOM   2453 C C   . PRO C 3 94  ? 7.716   79.621  51.981  1.00 39.55  ? 93  PRO C C   1 
ATOM   2454 O O   . PRO C 3 94  ? 8.454   80.105  51.105  1.00 37.62  ? 93  PRO C O   1 
ATOM   2455 C CB  . PRO C 3 94  ? 6.960   81.338  53.707  1.00 28.25  ? 93  PRO C CB  1 
ATOM   2456 C CG  . PRO C 3 94  ? 7.920   82.449  53.349  1.00 24.08  ? 93  PRO C CG  1 
ATOM   2457 C CD  . PRO C 3 94  ? 9.244   81.980  53.960  1.00 21.63  ? 93  PRO C CD  1 
ATOM   2458 N N   . LYS C 3 95  ? 6.822   78.669  51.728  1.00 36.54  ? 94  LYS C N   1 
ATOM   2459 C CA  . LYS C 3 95  ? 6.612   78.159  50.386  1.00 40.70  ? 94  LYS C CA  1 
ATOM   2460 C C   . LYS C 3 95  ? 6.084   79.294  49.504  1.00 40.01  ? 94  LYS C C   1 
ATOM   2461 O O   . LYS C 3 95  ? 6.574   79.507  48.400  1.00 43.66  ? 94  LYS C O   1 
ATOM   2462 C CB  . LYS C 3 95  ? 5.615   77.001  50.401  1.00 33.47  ? 94  LYS C CB  1 
ATOM   2463 C CG  . LYS C 3 95  ? 5.360   76.403  49.028  1.00 36.08  ? 94  LYS C CG  1 
ATOM   2464 C CD  . LYS C 3 95  ? 4.638   75.067  49.134  1.00 38.36  ? 94  LYS C CD  1 
ATOM   2465 C CE  . LYS C 3 95  ? 4.064   74.608  47.786  1.00 41.22  ? 94  LYS C CE  1 
ATOM   2466 N NZ  . LYS C 3 95  ? 5.118   74.343  46.764  1.00 38.11  ? 94  LYS C NZ  1 
ATOM   2467 N N   . SER C 3 96  ? 5.098   80.031  50.002  1.00 38.87  ? 95  SER C N   1 
ATOM   2468 C CA  . SER C 3 96  ? 4.523   81.139  49.248  1.00 42.12  ? 95  SER C CA  1 
ATOM   2469 C C   . SER C 3 96  ? 4.717   82.444  50.003  1.00 43.67  ? 95  SER C C   1 
ATOM   2470 O O   . SER C 3 96  ? 5.034   82.444  51.185  1.00 45.49  ? 95  SER C O   1 
ATOM   2471 C CB  . SER C 3 96  ? 3.031   80.915  49.023  1.00 35.72  ? 95  SER C CB  1 
ATOM   2472 O OG  . SER C 3 96  ? 2.791   79.628  48.491  1.00 57.54  ? 95  SER C OG  1 
ATOM   2473 N N   . PRO C 3 97  ? 4.540   83.578  49.319  1.00 45.20  ? 96  PRO C N   1 
ATOM   2474 C CA  . PRO C 3 97  ? 4.705   84.867  49.993  1.00 44.47  ? 96  PRO C CA  1 
ATOM   2475 C C   . PRO C 3 97  ? 3.674   84.907  51.123  1.00 43.79  ? 96  PRO C C   1 
ATOM   2476 O O   . PRO C 3 97  ? 2.554   84.444  50.947  1.00 33.63  ? 96  PRO C O   1 
ATOM   2477 C CB  . PRO C 3 97  ? 4.399   85.874  48.889  1.00 42.93  ? 96  PRO C CB  1 
ATOM   2478 C CG  . PRO C 3 97  ? 4.759   85.130  47.637  1.00 46.40  ? 96  PRO C CG  1 
ATOM   2479 C CD  . PRO C 3 97  ? 4.203   83.763  47.898  1.00 39.20  ? 96  PRO C CD  1 
ATOM   2480 N N   . VAL C 3 98  ? 4.060   85.442  52.275  1.00 43.03  ? 97  VAL C N   1 
ATOM   2481 C CA  . VAL C 3 98  ? 3.171   85.516  53.434  1.00 45.60  ? 97  VAL C CA  1 
ATOM   2482 C C   . VAL C 3 98  ? 2.027   86.541  53.334  1.00 48.31  ? 97  VAL C C   1 
ATOM   2483 O O   . VAL C 3 98  ? 2.253   87.728  53.101  1.00 51.80  ? 97  VAL C O   1 
ATOM   2484 C CB  . VAL C 3 98  ? 3.990   85.822  54.711  1.00 46.67  ? 97  VAL C CB  1 
ATOM   2485 C CG1 . VAL C 3 98  ? 3.066   86.179  55.865  1.00 56.27  ? 97  VAL C CG1 1 
ATOM   2486 C CG2 . VAL C 3 98  ? 4.843   84.620  55.078  1.00 50.50  ? 97  VAL C CG2 1 
ATOM   2487 N N   . LEU C 3 99  ? 0.798   86.070  53.505  1.00 46.99  ? 98  LEU C N   1 
ATOM   2488 C CA  . LEU C 3 99  ? -0.372  86.947  53.493  1.00 51.64  ? 98  LEU C CA  1 
ATOM   2489 C C   . LEU C 3 99  ? -1.235  86.607  54.709  1.00 52.22  ? 98  LEU C C   1 
ATOM   2490 O O   . LEU C 3 99  ? -1.646  85.456  54.892  1.00 54.82  ? 98  LEU C O   1 
ATOM   2491 C CB  . LEU C 3 99  ? -1.186  86.776  52.208  1.00 52.15  ? 98  LEU C CB  1 
ATOM   2492 C CG  . LEU C 3 99  ? -0.521  87.286  50.924  1.00 60.04  ? 98  LEU C CG  1 
ATOM   2493 C CD1 . LEU C 3 99  ? -1.455  87.068  49.738  1.00 57.37  ? 98  LEU C CD1 1 
ATOM   2494 C CD2 . LEU C 3 99  ? -0.185  88.768  51.070  1.00 54.71  ? 98  LEU C CD2 1 
ATOM   2495 N N   . LEU C 3 100 ? -1.501  87.608  55.541  1.00 53.76  ? 99  LEU C N   1 
ATOM   2496 C CA  . LEU C 3 100 ? -2.293  87.402  56.749  1.00 53.05  ? 99  LEU C CA  1 
ATOM   2497 C C   . LEU C 3 100 ? -3.575  86.623  56.523  1.00 47.47  ? 99  LEU C C   1 
ATOM   2498 O O   . LEU C 3 100 ? -4.431  87.023  55.738  1.00 50.81  ? 99  LEU C O   1 
ATOM   2499 C CB  . LEU C 3 100 ? -2.611  88.746  57.411  1.00 59.86  ? 99  LEU C CB  1 
ATOM   2500 C CG  . LEU C 3 100 ? -1.568  89.288  58.403  1.00 63.69  ? 99  LEU C CG  1 
ATOM   2501 C CD1 . LEU C 3 100 ? -0.162  89.253  57.807  1.00 59.54  ? 99  LEU C CD1 1 
ATOM   2502 C CD2 . LEU C 3 100 ? -1.956  90.709  58.789  1.00 69.68  ? 99  LEU C CD2 1 
ATOM   2503 N N   . GLY C 3 101 ? -3.688  85.495  57.217  1.00 45.70  ? 100 GLY C N   1 
ATOM   2504 C CA  . GLY C 3 101 ? -4.870  84.662  57.109  1.00 46.80  ? 100 GLY C CA  1 
ATOM   2505 C C   . GLY C 3 101 ? -4.925  83.693  55.941  1.00 49.46  ? 100 GLY C C   1 
ATOM   2506 O O   . GLY C 3 101 ? -5.877  82.918  55.818  1.00 47.38  ? 100 GLY C O   1 
ATOM   2507 N N   . GLN C 3 102 ? -3.925  83.719  55.071  1.00 48.95  ? 101 GLN C N   1 
ATOM   2508 C CA  . GLN C 3 102 ? -3.948  82.807  53.940  1.00 51.33  ? 101 GLN C CA  1 
ATOM   2509 C C   . GLN C 3 102 ? -3.087  81.564  54.192  1.00 49.02  ? 101 GLN C C   1 
ATOM   2510 O O   . GLN C 3 102 ? -1.922  81.662  54.569  1.00 47.02  ? 101 GLN C O   1 
ATOM   2511 C CB  . GLN C 3 102 ? -3.488  83.538  52.680  1.00 55.36  ? 101 GLN C CB  1 
ATOM   2512 C CG  . GLN C 3 102 ? -3.399  82.655  51.443  1.00 69.86  ? 101 GLN C CG  1 
ATOM   2513 C CD  . GLN C 3 102 ? -2.684  83.348  50.290  1.00 80.48  ? 101 GLN C CD  1 
ATOM   2514 O OE1 . GLN C 3 102 ? -3.222  84.278  49.678  1.00 87.14  ? 101 GLN C OE1 1 
ATOM   2515 N NE2 . GLN C 3 102 ? -1.457  82.909  50.001  1.00 69.11  ? 101 GLN C NE2 1 
ATOM   2516 N N   . PRO C 3 103 ? -3.666  80.371  54.002  1.00 44.37  ? 102 PRO C N   1 
ATOM   2517 C CA  . PRO C 3 103 ? -2.936  79.118  54.210  1.00 46.93  ? 102 PRO C CA  1 
ATOM   2518 C C   . PRO C 3 103 ? -1.603  79.088  53.470  1.00 48.92  ? 102 PRO C C   1 
ATOM   2519 O O   . PRO C 3 103 ? -1.534  79.380  52.277  1.00 49.46  ? 102 PRO C O   1 
ATOM   2520 C CB  . PRO C 3 103 ? -3.907  78.067  53.690  1.00 44.61  ? 102 PRO C CB  1 
ATOM   2521 C CG  . PRO C 3 103 ? -5.232  78.649  54.068  1.00 45.23  ? 102 PRO C CG  1 
ATOM   2522 C CD  . PRO C 3 103 ? -5.075  80.106  53.669  1.00 43.89  ? 102 PRO C CD  1 
ATOM   2523 N N   . ASN C 3 104 ? -0.547  78.733  54.193  1.00 46.03  ? 103 ASN C N   1 
ATOM   2524 C CA  . ASN C 3 104 ? 0.786   78.661  53.624  1.00 39.24  ? 103 ASN C CA  1 
ATOM   2525 C C   . ASN C 3 104 ? 1.485   77.432  54.191  1.00 39.44  ? 103 ASN C C   1 
ATOM   2526 O O   . ASN C 3 104 ? 0.853   76.571  54.799  1.00 43.30  ? 103 ASN C O   1 
ATOM   2527 C CB  . ASN C 3 104 ? 1.574   79.915  53.994  1.00 42.86  ? 103 ASN C CB  1 
ATOM   2528 C CG  . ASN C 3 104 ? 2.607   80.291  52.948  1.00 47.65  ? 103 ASN C CG  1 
ATOM   2529 O OD1 . ASN C 3 104 ? 3.346   79.434  52.441  1.00 40.94  ? 103 ASN C OD1 1 
ATOM   2530 N ND2 . ASN C 3 104 ? 2.674   81.583  52.626  1.00 38.22  ? 103 ASN C ND2 1 
ATOM   2531 N N   . THR C 3 105 ? 2.794   77.356  53.998  1.00 35.80  ? 104 THR C N   1 
ATOM   2532 C CA  . THR C 3 105 ? 3.578   76.234  54.497  1.00 28.22  ? 104 THR C CA  1 
ATOM   2533 C C   . THR C 3 105 ? 4.945   76.787  54.873  1.00 35.09  ? 104 THR C C   1 
ATOM   2534 O O   . THR C 3 105 ? 5.501   77.599  54.141  1.00 39.97  ? 104 THR C O   1 
ATOM   2535 C CB  . THR C 3 105 ? 3.742   75.150  53.405  1.00 31.53  ? 104 THR C CB  1 
ATOM   2536 O OG1 . THR C 3 105 ? 2.445   74.702  52.985  1.00 33.28  ? 104 THR C OG1 1 
ATOM   2537 C CG2 . THR C 3 105 ? 4.562   73.961  53.914  1.00 28.08  ? 104 THR C CG2 1 
ATOM   2538 N N   . LEU C 3 106 ? 5.467   76.391  56.028  1.00 35.71  ? 105 LEU C N   1 
ATOM   2539 C CA  . LEU C 3 106 ? 6.785   76.856  56.445  1.00 36.33  ? 105 LEU C CA  1 
ATOM   2540 C C   . LEU C 3 106 ? 7.725   75.705  56.151  1.00 35.06  ? 105 LEU C C   1 
ATOM   2541 O O   . LEU C 3 106 ? 7.413   74.553  56.444  1.00 36.83  ? 105 LEU C O   1 
ATOM   2542 C CB  . LEU C 3 106 ? 6.825   77.180  57.940  1.00 35.63  ? 105 LEU C CB  1 
ATOM   2543 C CG  . LEU C 3 106 ? 7.020   78.629  58.384  1.00 42.51  ? 105 LEU C CG  1 
ATOM   2544 C CD1 . LEU C 3 106 ? 7.234   78.648  59.892  1.00 32.89  ? 105 LEU C CD1 1 
ATOM   2545 C CD2 . LEU C 3 106 ? 8.211   79.256  57.675  1.00 42.79  ? 105 LEU C CD2 1 
ATOM   2546 N N   . ILE C 3 107 ? 8.873   76.016  55.570  1.00 34.60  ? 106 ILE C N   1 
ATOM   2547 C CA  . ILE C 3 107 ? 9.834   74.987  55.222  1.00 30.14  ? 106 ILE C CA  1 
ATOM   2548 C C   . ILE C 3 107 ? 11.129  75.172  55.963  1.00 28.96  ? 106 ILE C C   1 
ATOM   2549 O O   . ILE C 3 107 ? 11.666  76.285  56.032  1.00 36.39  ? 106 ILE C O   1 
ATOM   2550 C CB  . ILE C 3 107 ? 10.168  75.009  53.707  1.00 31.81  ? 106 ILE C CB  1 
ATOM   2551 C CG1 . ILE C 3 107 ? 8.883   74.862  52.888  1.00 31.94  ? 106 ILE C CG1 1 
ATOM   2552 C CG2 . ILE C 3 107 ? 11.166  73.889  53.376  1.00 16.79  ? 106 ILE C CG2 1 
ATOM   2553 C CD1 . ILE C 3 107 ? 9.039   75.227  51.456  1.00 31.99  ? 106 ILE C CD1 1 
ATOM   2554 N N   . CYS C 3 108 ? 11.624  74.072  56.515  1.00 24.17  ? 107 CYS C N   1 
ATOM   2555 C CA  . CYS C 3 108 ? 12.894  74.069  57.218  1.00 31.18  ? 107 CYS C CA  1 
ATOM   2556 C C   . CYS C 3 108 ? 13.826  73.136  56.444  1.00 34.02  ? 107 CYS C C   1 
ATOM   2557 O O   . CYS C 3 108 ? 13.627  71.921  56.398  1.00 37.16  ? 107 CYS C O   1 
ATOM   2558 C CB  . CYS C 3 108 ? 12.738  73.566  58.651  1.00 34.91  ? 107 CYS C CB  1 
ATOM   2559 S SG  . CYS C 3 108 ? 14.253  73.750  59.649  1.00 49.83  ? 107 CYS C SG  1 
ATOM   2560 N N   . PHE C 3 109 ? 14.832  73.734  55.824  1.00 30.83  ? 108 PHE C N   1 
ATOM   2561 C CA  . PHE C 3 109 ? 15.820  73.021  55.042  1.00 29.80  ? 108 PHE C CA  1 
ATOM   2562 C C   . PHE C 3 109 ? 17.034  72.849  55.934  1.00 30.39  ? 108 PHE C C   1 
ATOM   2563 O O   . PHE C 3 109 ? 17.632  73.831  56.365  1.00 36.85  ? 108 PHE C O   1 
ATOM   2564 C CB  . PHE C 3 109 ? 16.180  73.862  53.805  1.00 32.14  ? 108 PHE C CB  1 
ATOM   2565 C CG  . PHE C 3 109 ? 17.457  73.452  53.133  1.00 32.61  ? 108 PHE C CG  1 
ATOM   2566 C CD1 . PHE C 3 109 ? 17.498  72.348  52.297  1.00 35.45  ? 108 PHE C CD1 1 
ATOM   2567 C CD2 . PHE C 3 109 ? 18.621  74.176  53.335  1.00 40.66  ? 108 PHE C CD2 1 
ATOM   2568 C CE1 . PHE C 3 109 ? 18.677  71.972  51.669  1.00 35.80  ? 108 PHE C CE1 1 
ATOM   2569 C CE2 . PHE C 3 109 ? 19.811  73.803  52.712  1.00 40.21  ? 108 PHE C CE2 1 
ATOM   2570 C CZ  . PHE C 3 109 ? 19.833  72.700  51.879  1.00 36.67  ? 108 PHE C CZ  1 
ATOM   2571 N N   . VAL C 3 110 ? 17.388  71.606  56.228  1.00 37.44  ? 109 VAL C N   1 
ATOM   2572 C CA  . VAL C 3 110 ? 18.542  71.341  57.071  1.00 38.05  ? 109 VAL C CA  1 
ATOM   2573 C C   . VAL C 3 110 ? 19.622  70.712  56.222  1.00 36.09  ? 109 VAL C C   1 
ATOM   2574 O O   . VAL C 3 110 ? 19.403  69.683  55.591  1.00 36.99  ? 109 VAL C O   1 
ATOM   2575 C CB  . VAL C 3 110 ? 18.175  70.424  58.249  1.00 36.48  ? 109 VAL C CB  1 
ATOM   2576 C CG1 . VAL C 3 110 ? 19.394  70.158  59.104  1.00 40.62  ? 109 VAL C CG1 1 
ATOM   2577 C CG2 . VAL C 3 110 ? 17.111  71.090  59.085  1.00 36.43  ? 109 VAL C CG2 1 
ATOM   2578 N N   . ASP C 3 111 ? 20.792  71.340  56.212  1.00 41.63  ? 110 ASP C N   1 
ATOM   2579 C CA  . ASP C 3 111 ? 21.901  70.870  55.395  1.00 42.78  ? 110 ASP C CA  1 
ATOM   2580 C C   . ASP C 3 111 ? 23.104  70.424  56.205  1.00 37.52  ? 110 ASP C C   1 
ATOM   2581 O O   . ASP C 3 111 ? 23.168  70.651  57.406  1.00 41.20  ? 110 ASP C O   1 
ATOM   2582 C CB  . ASP C 3 111 ? 22.326  71.984  54.432  1.00 45.51  ? 110 ASP C CB  1 
ATOM   2583 C CG  . ASP C 3 111 ? 23.013  71.452  53.198  1.00 48.38  ? 110 ASP C CG  1 
ATOM   2584 O OD1 . ASP C 3 111 ? 23.367  70.252  53.201  1.00 50.89  ? 110 ASP C OD1 1 
ATOM   2585 O OD2 . ASP C 3 111 ? 23.198  72.226  52.229  1.00 49.82  ? 110 ASP C OD2 1 
ATOM   2586 N N   . ASN C 3 112 ? 24.058  69.790  55.525  1.00 40.42  ? 111 ASN C N   1 
ATOM   2587 C CA  . ASN C 3 112 ? 25.287  69.321  56.150  1.00 43.44  ? 111 ASN C CA  1 
ATOM   2588 C C   . ASN C 3 112 ? 24.955  68.390  57.322  1.00 47.55  ? 111 ASN C C   1 
ATOM   2589 O O   . ASN C 3 112 ? 25.410  68.595  58.452  1.00 51.22  ? 111 ASN C O   1 
ATOM   2590 C CB  . ASN C 3 112 ? 26.104  70.536  56.621  1.00 40.91  ? 111 ASN C CB  1 
ATOM   2591 C CG  . ASN C 3 112 ? 27.537  70.189  56.963  1.00 45.38  ? 111 ASN C CG  1 
ATOM   2592 O OD1 . ASN C 3 112 ? 28.248  69.570  56.166  1.00 41.08  ? 111 ASN C OD1 1 
ATOM   2593 N ND2 . ASN C 3 112 ? 27.978  70.600  58.148  1.00 40.73  ? 111 ASN C ND2 1 
ATOM   2594 N N   . ILE C 3 113 ? 24.151  67.367  57.041  1.00 42.73  ? 112 ILE C N   1 
ATOM   2595 C CA  . ILE C 3 113 ? 23.750  66.403  58.057  1.00 45.10  ? 112 ILE C CA  1 
ATOM   2596 C C   . ILE C 3 113 ? 24.613  65.155  57.952  1.00 47.36  ? 112 ILE C C   1 
ATOM   2597 O O   . ILE C 3 113 ? 24.667  64.516  56.903  1.00 51.78  ? 112 ILE C O   1 
ATOM   2598 C CB  . ILE C 3 113 ? 22.279  65.958  57.889  1.00 43.07  ? 112 ILE C CB  1 
ATOM   2599 C CG1 . ILE C 3 113 ? 21.359  67.166  57.778  1.00 47.00  ? 112 ILE C CG1 1 
ATOM   2600 C CG2 . ILE C 3 113 ? 21.852  65.118  59.076  1.00 44.07  ? 112 ILE C CG2 1 
ATOM   2601 C CD1 . ILE C 3 113 ? 19.909  66.794  57.515  1.00 51.21  ? 112 ILE C CD1 1 
ATOM   2602 N N   . PHE C 3 114 ? 25.287  64.814  59.043  1.00 49.17  ? 113 PHE C N   1 
ATOM   2603 C CA  . PHE C 3 114 ? 26.131  63.629  59.072  1.00 50.39  ? 113 PHE C CA  1 
ATOM   2604 C C   . PHE C 3 114 ? 26.581  63.270  60.497  1.00 50.54  ? 113 PHE C C   1 
ATOM   2605 O O   . PHE C 3 114 ? 27.129  64.099  61.225  1.00 51.80  ? 113 PHE C O   1 
ATOM   2606 C CB  . PHE C 3 114 ? 27.354  63.827  58.180  1.00 43.64  ? 113 PHE C CB  1 
ATOM   2607 C CG  . PHE C 3 114 ? 28.142  62.576  57.968  1.00 52.48  ? 113 PHE C CG  1 
ATOM   2608 C CD1 . PHE C 3 114 ? 27.794  61.688  56.957  1.00 53.34  ? 113 PHE C CD1 1 
ATOM   2609 C CD2 . PHE C 3 114 ? 29.198  62.249  58.820  1.00 50.47  ? 113 PHE C CD2 1 
ATOM   2610 C CE1 . PHE C 3 114 ? 28.486  60.485  56.797  1.00 55.80  ? 113 PHE C CE1 1 
ATOM   2611 C CE2 . PHE C 3 114 ? 29.897  61.049  58.671  1.00 45.09  ? 113 PHE C CE2 1 
ATOM   2612 C CZ  . PHE C 3 114 ? 29.541  60.166  57.660  1.00 55.29  ? 113 PHE C CZ  1 
ATOM   2613 N N   . PRO C 3 115 ? 26.328  62.027  60.919  1.00 46.94  ? 114 PRO C N   1 
ATOM   2614 C CA  . PRO C 3 115 ? 25.648  61.003  60.123  1.00 42.50  ? 114 PRO C CA  1 
ATOM   2615 C C   . PRO C 3 115 ? 24.150  61.308  59.963  1.00 46.82  ? 114 PRO C C   1 
ATOM   2616 O O   . PRO C 3 115 ? 23.618  62.192  60.639  1.00 42.48  ? 114 PRO C O   1 
ATOM   2617 C CB  . PRO C 3 115 ? 25.917  59.723  60.916  1.00 49.64  ? 114 PRO C CB  1 
ATOM   2618 C CG  . PRO C 3 115 ? 26.032  60.216  62.336  1.00 47.98  ? 114 PRO C CG  1 
ATOM   2619 C CD  . PRO C 3 115 ? 26.857  61.466  62.175  1.00 42.53  ? 114 PRO C CD  1 
ATOM   2620 N N   . PRO C 3 116 ? 23.455  60.579  59.060  1.00 47.97  ? 115 PRO C N   1 
ATOM   2621 C CA  . PRO C 3 116 ? 22.025  60.746  58.781  1.00 45.72  ? 115 PRO C CA  1 
ATOM   2622 C C   . PRO C 3 116 ? 21.076  60.253  59.865  1.00 42.98  ? 115 PRO C C   1 
ATOM   2623 O O   . PRO C 3 116 ? 20.346  59.281  59.687  1.00 45.79  ? 115 PRO C O   1 
ATOM   2624 C CB  . PRO C 3 116 ? 21.847  59.994  57.469  1.00 46.85  ? 115 PRO C CB  1 
ATOM   2625 C CG  . PRO C 3 116 ? 22.805  58.871  57.616  1.00 42.64  ? 115 PRO C CG  1 
ATOM   2626 C CD  . PRO C 3 116 ? 24.033  59.565  58.156  1.00 47.89  ? 115 PRO C CD  1 
ATOM   2627 N N   . VAL C 3 117 ? 21.104  60.946  60.990  1.00 44.37  ? 116 VAL C N   1 
ATOM   2628 C CA  . VAL C 3 117 ? 20.254  60.658  62.138  1.00 44.21  ? 116 VAL C CA  1 
ATOM   2629 C C   . VAL C 3 117 ? 19.959  62.040  62.682  1.00 40.91  ? 116 VAL C C   1 
ATOM   2630 O O   . VAL C 3 117 ? 20.879  62.796  62.982  1.00 39.89  ? 116 VAL C O   1 
ATOM   2631 C CB  . VAL C 3 117 ? 20.986  59.852  63.230  1.00 45.58  ? 116 VAL C CB  1 
ATOM   2632 C CG1 . VAL C 3 117 ? 20.022  59.560  64.374  1.00 41.69  ? 116 VAL C CG1 1 
ATOM   2633 C CG2 . VAL C 3 117 ? 21.541  58.563  62.650  1.00 42.16  ? 116 VAL C CG2 1 
ATOM   2634 N N   . ILE C 3 118 ? 18.688  62.381  62.822  1.00 39.37  ? 117 ILE C N   1 
ATOM   2635 C CA  . ILE C 3 118 ? 18.381  63.714  63.281  1.00 40.75  ? 117 ILE C CA  1 
ATOM   2636 C C   . ILE C 3 118 ? 16.918  63.825  63.665  1.00 38.65  ? 117 ILE C C   1 
ATOM   2637 O O   . ILE C 3 118 ? 16.090  63.051  63.202  1.00 35.18  ? 117 ILE C O   1 
ATOM   2638 C CB  . ILE C 3 118 ? 18.733  64.718  62.145  1.00 47.97  ? 117 ILE C CB  1 
ATOM   2639 C CG1 . ILE C 3 118 ? 18.729  66.155  62.656  1.00 43.29  ? 117 ILE C CG1 1 
ATOM   2640 C CG2 . ILE C 3 118 ? 17.757  64.547  60.974  1.00 47.09  ? 117 ILE C CG2 1 
ATOM   2641 C CD1 . ILE C 3 118 ? 19.263  67.138  61.616  1.00 44.85  ? 117 ILE C CD1 1 
ATOM   2642 N N   . ASN C 3 119 ? 16.619  64.781  64.534  1.00 40.93  ? 118 ASN C N   1 
ATOM   2643 C CA  . ASN C 3 119 ? 15.260  65.035  64.979  1.00 40.25  ? 118 ASN C CA  1 
ATOM   2644 C C   . ASN C 3 119 ? 15.026  66.489  64.597  1.00 40.57  ? 118 ASN C C   1 
ATOM   2645 O O   . ASN C 3 119 ? 15.784  67.372  64.996  1.00 46.10  ? 118 ASN C O   1 
ATOM   2646 C CB  . ASN C 3 119 ? 15.129  64.867  66.509  1.00 49.97  ? 118 ASN C CB  1 
ATOM   2647 C CG  . ASN C 3 119 ? 15.183  63.403  66.965  1.00 54.98  ? 118 ASN C CG  1 
ATOM   2648 O OD1 . ASN C 3 119 ? 15.427  63.113  68.146  1.00 56.69  ? 118 ASN C OD1 1 
ATOM   2649 N ND2 . ASN C 3 119 ? 14.941  62.481  66.038  1.00 53.70  ? 118 ASN C ND2 1 
ATOM   2650 N N   . ILE C 3 120 ? 13.987  66.734  63.811  1.00 41.17  ? 119 ILE C N   1 
ATOM   2651 C CA  . ILE C 3 120 ? 13.661  68.085  63.372  1.00 38.01  ? 119 ILE C CA  1 
ATOM   2652 C C   . ILE C 3 120 ? 12.229  68.364  63.798  1.00 34.17  ? 119 ILE C C   1 
ATOM   2653 O O   . ILE C 3 120 ? 11.332  67.614  63.435  1.00 35.35  ? 119 ILE C O   1 
ATOM   2654 C CB  . ILE C 3 120 ? 13.771  68.198  61.819  1.00 39.05  ? 119 ILE C CB  1 
ATOM   2655 C CG1 . ILE C 3 120 ? 15.205  67.904  61.374  1.00 33.66  ? 119 ILE C CG1 1 
ATOM   2656 C CG2 . ILE C 3 120 ? 13.360  69.582  61.352  1.00 33.45  ? 119 ILE C CG2 1 
ATOM   2657 C CD1 . ILE C 3 120 ? 15.382  67.893  59.879  1.00 46.68  ? 119 ILE C CD1 1 
ATOM   2658 N N   . THR C 3 121 ? 12.005  69.422  64.572  1.00 31.37  ? 120 THR C N   1 
ATOM   2659 C CA  . THR C 3 121 ? 10.640  69.724  64.998  1.00 32.85  ? 120 THR C CA  1 
ATOM   2660 C C   . THR C 3 121 ? 10.289  71.192  64.927  1.00 31.94  ? 120 THR C C   1 
ATOM   2661 O O   . THR C 3 121 ? 11.165  72.057  64.854  1.00 36.05  ? 120 THR C O   1 
ATOM   2662 C CB  . THR C 3 121 ? 10.352  69.221  66.428  1.00 37.01  ? 120 THR C CB  1 
ATOM   2663 O OG1 . THR C 3 121 ? 11.264  69.828  67.354  1.00 42.88  ? 120 THR C OG1 1 
ATOM   2664 C CG2 . THR C 3 121 ? 10.490  67.706  66.488  1.00 25.15  ? 120 THR C CG2 1 
ATOM   2665 N N   . TRP C 3 122 ? 8.991   71.461  64.956  1.00 31.53  ? 121 TRP C N   1 
ATOM   2666 C CA  . TRP C 3 122 ? 8.480   72.817  64.869  1.00 36.91  ? 121 TRP C CA  1 
ATOM   2667 C C   . TRP C 3 122 ? 7.917   73.398  66.171  1.00 39.92  ? 121 TRP C C   1 
ATOM   2668 O O   . TRP C 3 122 ? 7.248   72.711  66.938  1.00 31.30  ? 121 TRP C O   1 
ATOM   2669 C CB  . TRP C 3 122 ? 7.384   72.876  63.802  1.00 37.38  ? 121 TRP C CB  1 
ATOM   2670 C CG  . TRP C 3 122 ? 7.871   72.687  62.405  1.00 43.66  ? 121 TRP C CG  1 
ATOM   2671 C CD1 . TRP C 3 122 ? 7.840   71.535  61.663  1.00 43.34  ? 121 TRP C CD1 1 
ATOM   2672 C CD2 . TRP C 3 122 ? 8.448   73.689  61.570  1.00 35.02  ? 121 TRP C CD2 1 
ATOM   2673 N NE1 . TRP C 3 122 ? 8.362   71.763  60.415  1.00 46.99  ? 121 TRP C NE1 1 
ATOM   2674 C CE2 . TRP C 3 122 ? 8.746   73.077  60.329  1.00 44.83  ? 121 TRP C CE2 1 
ATOM   2675 C CE3 . TRP C 3 122 ? 8.748   75.047  61.749  1.00 33.83  ? 121 TRP C CE3 1 
ATOM   2676 C CZ2 . TRP C 3 122 ? 9.328   73.782  59.262  1.00 37.39  ? 121 TRP C CZ2 1 
ATOM   2677 C CZ3 . TRP C 3 122 ? 9.328   75.753  60.687  1.00 41.27  ? 121 TRP C CZ3 1 
ATOM   2678 C CH2 . TRP C 3 122 ? 9.614   75.115  59.461  1.00 35.51  ? 121 TRP C CH2 1 
ATOM   2679 N N   . LEU C 3 123 ? 8.170   74.684  66.389  1.00 43.13  ? 122 LEU C N   1 
ATOM   2680 C CA  . LEU C 3 123 ? 7.674   75.373  67.569  1.00 40.26  ? 122 LEU C CA  1 
ATOM   2681 C C   . LEU C 3 123 ? 6.916   76.625  67.159  1.00 40.24  ? 122 LEU C C   1 
ATOM   2682 O O   . LEU C 3 123 ? 7.466   77.500  66.472  1.00 36.18  ? 122 LEU C O   1 
ATOM   2683 C CB  . LEU C 3 123 ? 8.827   75.790  68.489  1.00 39.37  ? 122 LEU C CB  1 
ATOM   2684 C CG  . LEU C 3 123 ? 9.840   74.779  69.024  1.00 44.35  ? 122 LEU C CG  1 
ATOM   2685 C CD1 . LEU C 3 123 ? 10.789  75.523  69.935  1.00 44.90  ? 122 LEU C CD1 1 
ATOM   2686 C CD2 . LEU C 3 123 ? 9.164   73.656  69.781  1.00 50.16  ? 122 LEU C CD2 1 
ATOM   2687 N N   . ARG C 3 124 ? 5.645   76.681  67.552  1.00 36.71  ? 123 ARG C N   1 
ATOM   2688 C CA  . ARG C 3 124 ? 4.793   77.842  67.298  1.00 43.88  ? 123 ARG C CA  1 
ATOM   2689 C C   . ARG C 3 124 ? 4.876   78.580  68.621  1.00 50.98  ? 123 ARG C C   1 
ATOM   2690 O O   . ARG C 3 124 ? 4.421   78.104  69.669  1.00 56.74  ? 123 ARG C O   1 
ATOM   2691 C CB  . ARG C 3 124 ? 3.342   77.439  67.009  1.00 43.27  ? 123 ARG C CB  1 
ATOM   2692 C CG  . ARG C 3 124 ? 2.512   78.523  66.336  1.00 43.10  ? 123 ARG C CG  1 
ATOM   2693 C CD  . ARG C 3 124 ? 1.081   78.533  66.840  1.00 42.24  ? 123 ARG C CD  1 
ATOM   2694 N NE  . ARG C 3 124 ? 0.452   77.219  66.815  1.00 64.33  ? 123 ARG C NE  1 
ATOM   2695 C CZ  . ARG C 3 124 ? 0.314   76.467  65.727  1.00 71.67  ? 123 ARG C CZ  1 
ATOM   2696 N NH1 . ARG C 3 124 ? 0.767   76.891  64.548  1.00 69.02  ? 123 ARG C NH1 1 
ATOM   2697 N NH2 . ARG C 3 124 ? -0.290  75.289  65.819  1.00 74.30  ? 123 ARG C NH2 1 
ATOM   2698 N N   . ASN C 3 125 ? 5.480   79.748  68.568  1.00 58.60  ? 124 ASN C N   1 
ATOM   2699 C CA  . ASN C 3 125 ? 5.687   80.524  69.767  1.00 53.80  ? 124 ASN C CA  1 
ATOM   2700 C C   . ASN C 3 125 ? 6.493   79.747  70.781  1.00 58.51  ? 124 ASN C C   1 
ATOM   2701 O O   . ASN C 3 125 ? 6.293   80.039  71.930  1.00 67.62  ? 124 ASN C O   1 
ATOM   2702 C CB  . ASN C 3 125 ? 4.419   80.795  70.592  1.00 49.66  ? 124 ASN C CB  1 
ATOM   2703 C CG  . ASN C 3 125 ? 3.243   81.340  69.804  1.00 57.45  ? 124 ASN C CG  1 
ATOM   2704 O OD1 . ASN C 3 125 ? 3.341   82.369  69.142  1.00 48.13  ? 124 ASN C OD1 1 
ATOM   2705 N ND2 . ASN C 3 125 ? 2.091   80.666  69.924  1.00 58.62  ? 124 ASN C ND2 1 
ATOM   2706 N N   . SER C 3 126 ? 7.345   78.779  70.524  1.00 48.30  ? 125 SER C N   1 
ATOM   2707 C CA  . SER C 3 126 ? 7.877   78.256  71.776  1.00 51.35  ? 125 SER C CA  1 
ATOM   2708 C C   . SER C 3 126 ? 7.036   77.105  72.348  1.00 55.51  ? 125 SER C C   1 
ATOM   2709 O O   . SER C 3 126 ? 7.127   76.796  73.528  1.00 56.50  ? 125 SER C O   1 
ATOM   2710 C CB  . SER C 3 126 ? 7.967   79.388  72.831  1.00 59.26  ? 125 SER C CB  1 
ATOM   2711 O OG  . SER C 3 126 ? 8.942   80.354  72.480  1.00 60.90  ? 125 SER C OG  1 
ATOM   2712 N N   . LYS C 3 127 ? 6.195   76.481  71.542  1.00 53.62  ? 126 LYS C N   1 
ATOM   2713 C CA  . LYS C 3 127 ? 5.484   75.308  72.025  1.00 52.76  ? 126 LYS C CA  1 
ATOM   2714 C C   . LYS C 3 127 ? 5.505   74.375  70.829  1.00 50.47  ? 126 LYS C C   1 
ATOM   2715 O O   . LYS C 3 127 ? 5.187   74.779  69.720  1.00 57.00  ? 126 LYS C O   1 
ATOM   2716 C CB  . LYS C 3 127 ? 4.059   75.639  72.454  1.00 58.42  ? 126 LYS C CB  1 
ATOM   2717 C CG  . LYS C 3 127 ? 3.961   76.297  73.826  1.00 60.67  ? 126 LYS C CG  1 
ATOM   2718 C CD  . LYS C 3 127 ? 2.506   76.509  74.224  1.00 73.08  ? 126 LYS C CD  1 
ATOM   2719 C CE  . LYS C 3 127 ? 2.389   77.547  75.327  1.00 77.29  ? 126 LYS C CE  1 
ATOM   2720 N NZ  . LYS C 3 127 ? 0.974   77.741  75.754  1.00 78.90  ? 126 LYS C NZ  1 
ATOM   2721 N N   . SER C 3 128 ? 5.908   73.135  71.045  1.00 44.11  ? 127 SER C N   1 
ATOM   2722 C CA  . SER C 3 128 ? 6.007   72.152  69.977  1.00 41.54  ? 127 SER C CA  1 
ATOM   2723 C C   . SER C 3 128 ? 4.694   71.911  69.208  1.00 45.84  ? 127 SER C C   1 
ATOM   2724 O O   . SER C 3 128 ? 3.652   71.670  69.811  1.00 48.91  ? 127 SER C O   1 
ATOM   2725 C CB  . SER C 3 128 ? 6.515   70.848  70.595  1.00 44.21  ? 127 SER C CB  1 
ATOM   2726 O OG  . SER C 3 128 ? 6.847   69.884  69.622  1.00 62.82  ? 127 SER C OG  1 
ATOM   2727 N N   . VAL C 3 129 ? 4.736   71.993  67.877  1.00 44.33  ? 128 VAL C N   1 
ATOM   2728 C CA  . VAL C 3 129 ? 3.547   71.735  67.061  1.00 36.70  ? 128 VAL C CA  1 
ATOM   2729 C C   . VAL C 3 129 ? 3.811   70.454  66.289  1.00 39.78  ? 128 VAL C C   1 
ATOM   2730 O O   . VAL C 3 129 ? 4.825   70.338  65.603  1.00 44.91  ? 128 VAL C O   1 
ATOM   2731 C CB  . VAL C 3 129 ? 3.258   72.862  66.071  1.00 43.29  ? 128 VAL C CB  1 
ATOM   2732 C CG1 . VAL C 3 129 ? 2.015   72.512  65.248  1.00 42.57  ? 128 VAL C CG1 1 
ATOM   2733 C CG2 . VAL C 3 129 ? 3.040   74.161  66.819  1.00 44.18  ? 128 VAL C CG2 1 
ATOM   2734 N N   . ALA C 3 130 ? 2.897   69.496  66.395  1.00 39.62  ? 129 ALA C N   1 
ATOM   2735 C CA  . ALA C 3 130 ? 3.080   68.199  65.760  1.00 37.07  ? 129 ALA C CA  1 
ATOM   2736 C C   . ALA C 3 130 ? 2.113   67.858  64.644  1.00 38.29  ? 129 ALA C C   1 
ATOM   2737 O O   . ALA C 3 130 ? 2.309   66.867  63.960  1.00 40.38  ? 129 ALA C O   1 
ATOM   2738 C CB  . ALA C 3 130 ? 3.039   67.094  66.827  1.00 41.23  ? 129 ALA C CB  1 
ATOM   2739 N N   . ASP C 3 131 ? 1.068   68.656  64.468  1.00 45.42  ? 130 ASP C N   1 
ATOM   2740 C CA  . ASP C 3 131 ? 0.098   68.404  63.401  1.00 49.91  ? 130 ASP C CA  1 
ATOM   2741 C C   . ASP C 3 131 ? 0.409   69.287  62.178  1.00 49.15  ? 130 ASP C C   1 
ATOM   2742 O O   . ASP C 3 131 ? 0.873   70.425  62.319  1.00 51.66  ? 130 ASP C O   1 
ATOM   2743 C CB  . ASP C 3 131 ? -1.327  68.690  63.897  1.00 60.46  ? 130 ASP C CB  1 
ATOM   2744 C CG  . ASP C 3 131 ? -2.332  67.626  63.451  1.00 73.77  ? 130 ASP C CG  1 
ATOM   2745 O OD1 . ASP C 3 131 ? -2.466  67.393  62.227  1.00 73.56  ? 130 ASP C OD1 1 
ATOM   2746 O OD2 . ASP C 3 131 ? -2.990  67.021  64.332  1.00 81.79  ? 130 ASP C OD2 1 
ATOM   2747 N N   . GLY C 3 132 ? 0.154   68.762  60.981  1.00 41.46  ? 131 GLY C N   1 
ATOM   2748 C CA  . GLY C 3 132 ? 0.423   69.523  59.769  1.00 39.58  ? 131 GLY C CA  1 
ATOM   2749 C C   . GLY C 3 132 ? 1.905   69.545  59.445  1.00 36.56  ? 131 GLY C C   1 
ATOM   2750 O O   . GLY C 3 132 ? 2.398   70.464  58.798  1.00 41.43  ? 131 GLY C O   1 
ATOM   2751 N N   . VAL C 3 133 ? 2.613   68.519  59.905  1.00 39.64  ? 132 VAL C N   1 
ATOM   2752 C CA  . VAL C 3 133 ? 4.046   68.406  59.704  1.00 40.70  ? 132 VAL C CA  1 
ATOM   2753 C C   . VAL C 3 133 ? 4.416   67.246  58.784  1.00 44.61  ? 132 VAL C C   1 
ATOM   2754 O O   . VAL C 3 133 ? 3.901   66.139  58.930  1.00 36.22  ? 132 VAL C O   1 
ATOM   2755 C CB  . VAL C 3 133 ? 4.759   68.230  61.055  1.00 34.45  ? 132 VAL C CB  1 
ATOM   2756 C CG1 . VAL C 3 133 ? 6.225   67.891  60.839  1.00 33.83  ? 132 VAL C CG1 1 
ATOM   2757 C CG2 . VAL C 3 133 ? 4.613   69.500  61.873  1.00 31.19  ? 132 VAL C CG2 1 
ATOM   2758 N N   . TYR C 3 134 ? 5.305   67.523  57.831  1.00 40.70  ? 133 TYR C N   1 
ATOM   2759 C CA  . TYR C 3 134 ? 5.768   66.520  56.877  1.00 40.62  ? 133 TYR C CA  1 
ATOM   2760 C C   . TYR C 3 134 ? 7.283   66.604  56.786  1.00 38.13  ? 133 TYR C C   1 
ATOM   2761 O O   . TYR C 3 134 ? 7.859   67.688  56.884  1.00 38.04  ? 133 TYR C O   1 
ATOM   2762 C CB  . TYR C 3 134 ? 5.161   66.757  55.479  1.00 39.92  ? 133 TYR C CB  1 
ATOM   2763 C CG  . TYR C 3 134 ? 5.689   65.789  54.432  1.00 40.69  ? 133 TYR C CG  1 
ATOM   2764 C CD1 . TYR C 3 134 ? 5.311   64.440  54.437  1.00 43.72  ? 133 TYR C CD1 1 
ATOM   2765 C CD2 . TYR C 3 134 ? 6.615   66.207  53.475  1.00 39.61  ? 133 TYR C CD2 1 
ATOM   2766 C CE1 . TYR C 3 134 ? 5.846   63.533  53.513  1.00 42.38  ? 133 TYR C CE1 1 
ATOM   2767 C CE2 . TYR C 3 134 ? 7.160   65.314  52.555  1.00 39.35  ? 133 TYR C CE2 1 
ATOM   2768 C CZ  . TYR C 3 134 ? 6.776   63.981  52.574  1.00 47.02  ? 133 TYR C CZ  1 
ATOM   2769 O OH  . TYR C 3 134 ? 7.326   63.111  51.655  1.00 42.07  ? 133 TYR C OH  1 
ATOM   2770 N N   . GLU C 3 135 ? 7.920   65.459  56.573  1.00 36.97  ? 134 GLU C N   1 
ATOM   2771 C CA  . GLU C 3 135 ? 9.372   65.394  56.489  1.00 39.96  ? 134 GLU C CA  1 
ATOM   2772 C C   . GLU C 3 135 ? 9.795   64.589  55.257  1.00 42.35  ? 134 GLU C C   1 
ATOM   2773 O O   . GLU C 3 135 ? 9.120   63.622  54.883  1.00 42.84  ? 134 GLU C O   1 
ATOM   2774 C CB  . GLU C 3 135 ? 9.914   64.726  57.754  1.00 30.87  ? 134 GLU C CB  1 
ATOM   2775 C CG  . GLU C 3 135 ? 11.311  65.123  58.145  1.00 42.25  ? 134 GLU C CG  1 
ATOM   2776 C CD  . GLU C 3 135 ? 11.799  64.355  59.365  1.00 54.19  ? 134 GLU C CD  1 
ATOM   2777 O OE1 . GLU C 3 135 ? 12.124  63.155  59.221  1.00 52.31  ? 134 GLU C OE1 1 
ATOM   2778 O OE2 . GLU C 3 135 ? 11.847  64.947  60.469  1.00 50.41  ? 134 GLU C OE2 1 
ATOM   2779 N N   . THR C 3 136 ? 10.905  64.990  54.632  1.00 35.65  ? 135 THR C N   1 
ATOM   2780 C CA  . THR C 3 136 ? 11.424  64.297  53.454  1.00 34.21  ? 135 THR C CA  1 
ATOM   2781 C C   . THR C 3 136 ? 12.448  63.269  53.916  1.00 38.38  ? 135 THR C C   1 
ATOM   2782 O O   . THR C 3 136 ? 12.841  63.265  55.076  1.00 43.18  ? 135 THR C O   1 
ATOM   2783 C CB  . THR C 3 136 ? 12.173  65.262  52.478  1.00 25.88  ? 135 THR C CB  1 
ATOM   2784 O OG1 . THR C 3 136 ? 13.452  65.604  53.020  1.00 34.13  ? 135 THR C OG1 1 
ATOM   2785 C CG2 . THR C 3 136 ? 11.403  66.531  52.271  1.00 22.06  ? 135 THR C CG2 1 
ATOM   2786 N N   . SER C 3 137 ? 12.883  62.400  53.009  1.00 43.96  ? 136 SER C N   1 
ATOM   2787 C CA  . SER C 3 137 ? 13.910  61.417  53.338  1.00 38.30  ? 136 SER C CA  1 
ATOM   2788 C C   . SER C 3 137 ? 15.221  62.195  53.384  1.00 34.97  ? 136 SER C C   1 
ATOM   2789 O O   . SER C 3 137 ? 15.208  63.422  53.355  1.00 38.14  ? 136 SER C O   1 
ATOM   2790 C CB  . SER C 3 137 ? 14.006  60.354  52.247  1.00 34.45  ? 136 SER C CB  1 
ATOM   2791 O OG  . SER C 3 137 ? 12.790  59.647  52.120  1.00 40.12  ? 136 SER C OG  1 
ATOM   2792 N N   . PHE C 3 138 ? 16.343  61.486  53.455  1.00 39.58  ? 137 PHE C N   1 
ATOM   2793 C CA  . PHE C 3 138 ? 17.666  62.120  53.469  1.00 39.95  ? 137 PHE C CA  1 
ATOM   2794 C C   . PHE C 3 138 ? 18.201  62.209  52.039  1.00 41.03  ? 137 PHE C C   1 
ATOM   2795 O O   . PHE C 3 138 ? 18.369  61.191  51.369  1.00 38.23  ? 137 PHE C O   1 
ATOM   2796 C CB  . PHE C 3 138 ? 18.647  61.298  54.305  1.00 39.03  ? 137 PHE C CB  1 
ATOM   2797 C CG  . PHE C 3 138 ? 18.479  61.455  55.787  1.00 41.50  ? 137 PHE C CG  1 
ATOM   2798 C CD1 . PHE C 3 138 ? 19.033  62.548  56.448  1.00 32.74  ? 137 PHE C CD1 1 
ATOM   2799 C CD2 . PHE C 3 138 ? 17.793  60.496  56.529  1.00 38.35  ? 137 PHE C CD2 1 
ATOM   2800 C CE1 . PHE C 3 138 ? 18.916  62.686  57.831  1.00 31.08  ? 137 PHE C CE1 1 
ATOM   2801 C CE2 . PHE C 3 138 ? 17.667  60.624  57.916  1.00 35.99  ? 137 PHE C CE2 1 
ATOM   2802 C CZ  . PHE C 3 138 ? 18.232  61.724  58.568  1.00 35.65  ? 137 PHE C CZ  1 
ATOM   2803 N N   . PHE C 3 139 ? 18.463  63.422  51.568  1.00 40.17  ? 138 PHE C N   1 
ATOM   2804 C CA  . PHE C 3 139 ? 18.985  63.615  50.215  1.00 41.96  ? 138 PHE C CA  1 
ATOM   2805 C C   . PHE C 3 139 ? 20.512  63.546  50.226  1.00 40.81  ? 138 PHE C C   1 
ATOM   2806 O O   . PHE C 3 139 ? 21.151  64.043  51.151  1.00 45.46  ? 138 PHE C O   1 
ATOM   2807 C CB  . PHE C 3 139 ? 18.538  64.973  49.677  1.00 39.53  ? 138 PHE C CB  1 
ATOM   2808 C CG  . PHE C 3 139 ? 17.067  65.056  49.366  1.00 41.85  ? 138 PHE C CG  1 
ATOM   2809 C CD1 . PHE C 3 139 ? 16.557  64.504  48.194  1.00 41.87  ? 138 PHE C CD1 1 
ATOM   2810 C CD2 . PHE C 3 139 ? 16.190  65.698  50.238  1.00 37.01  ? 138 PHE C CD2 1 
ATOM   2811 C CE1 . PHE C 3 139 ? 15.177  64.593  47.888  1.00 44.98  ? 138 PHE C CE1 1 
ATOM   2812 C CE2 . PHE C 3 139 ? 14.810  65.795  49.946  1.00 37.78  ? 138 PHE C CE2 1 
ATOM   2813 C CZ  . PHE C 3 139 ? 14.304  65.239  48.767  1.00 29.53  ? 138 PHE C CZ  1 
ATOM   2814 N N   . VAL C 3 140 ? 21.100  62.929  49.207  1.00 39.16  ? 139 VAL C N   1 
ATOM   2815 C CA  . VAL C 3 140 ? 22.560  62.831  49.134  1.00 38.10  ? 139 VAL C CA  1 
ATOM   2816 C C   . VAL C 3 140 ? 23.215  64.158  48.703  1.00 43.68  ? 139 VAL C C   1 
ATOM   2817 O O   . VAL C 3 140 ? 22.696  64.871  47.845  1.00 40.89  ? 139 VAL C O   1 
ATOM   2818 C CB  . VAL C 3 140 ? 23.010  61.714  48.145  1.00 42.09  ? 139 VAL C CB  1 
ATOM   2819 C CG1 . VAL C 3 140 ? 22.557  60.336  48.661  1.00 34.30  ? 139 VAL C CG1 1 
ATOM   2820 C CG2 . VAL C 3 140 ? 22.448  61.981  46.733  1.00 29.88  ? 139 VAL C CG2 1 
ATOM   2821 N N   . ASN C 3 141 ? 24.338  64.498  49.328  1.00 45.61  ? 140 ASN C N   1 
ATOM   2822 C CA  . ASN C 3 141 ? 25.078  65.706  48.981  1.00 47.43  ? 140 ASN C CA  1 
ATOM   2823 C C   . ASN C 3 141 ? 26.320  65.273  48.212  1.00 52.44  ? 140 ASN C C   1 
ATOM   2824 O O   . ASN C 3 141 ? 26.702  64.100  48.241  1.00 53.73  ? 140 ASN C O   1 
ATOM   2825 C CB  . ASN C 3 141 ? 25.529  66.468  50.227  1.00 43.46  ? 140 ASN C CB  1 
ATOM   2826 C CG  . ASN C 3 141 ? 24.431  67.289  50.838  1.00 41.22  ? 140 ASN C CG  1 
ATOM   2827 O OD1 . ASN C 3 141 ? 23.602  67.860  50.132  1.00 49.58  ? 140 ASN C OD1 1 
ATOM   2828 N ND2 . ASN C 3 141 ? 24.428  67.380  52.164  1.00 52.34  ? 140 ASN C ND2 1 
ATOM   2829 N N   . ARG C 3 142 ? 26.967  66.214  47.539  1.00 51.16  ? 141 ARG C N   1 
ATOM   2830 C CA  . ARG C 3 142 ? 28.157  65.870  46.777  1.00 54.44  ? 141 ARG C CA  1 
ATOM   2831 C C   . ARG C 3 142 ? 29.293  65.384  47.691  1.00 49.84  ? 141 ARG C C   1 
ATOM   2832 O O   . ARG C 3 142 ? 30.044  64.475  47.332  1.00 47.52  ? 141 ARG C O   1 
ATOM   2833 C CB  . ARG C 3 142 ? 28.607  67.074  45.948  1.00 57.27  ? 141 ARG C CB  1 
ATOM   2834 C CG  . ARG C 3 142 ? 29.577  66.706  44.860  1.00 75.70  ? 141 ARG C CG  1 
ATOM   2835 C CD  . ARG C 3 142 ? 29.959  67.904  44.012  1.00 91.27  ? 141 ARG C CD  1 
ATOM   2836 N NE  . ARG C 3 142 ? 30.851  67.517  42.920  1.00 105.07 ? 141 ARG C NE  1 
ATOM   2837 C CZ  . ARG C 3 142 ? 31.400  68.371  42.062  1.00 111.20 ? 141 ARG C CZ  1 
ATOM   2838 N NH1 . ARG C 3 142 ? 31.151  69.671  42.168  1.00 115.63 ? 141 ARG C NH1 1 
ATOM   2839 N NH2 . ARG C 3 142 ? 32.194  67.926  41.094  1.00 112.07 ? 141 ARG C NH2 1 
ATOM   2840 N N   . ASP C 3 143 ? 29.394  65.971  48.881  1.00 44.24  ? 142 ASP C N   1 
ATOM   2841 C CA  . ASP C 3 143 ? 30.435  65.602  49.835  1.00 45.13  ? 142 ASP C CA  1 
ATOM   2842 C C   . ASP C 3 143 ? 30.063  64.408  50.714  1.00 47.54  ? 142 ASP C C   1 
ATOM   2843 O O   . ASP C 3 143 ? 30.774  64.075  51.664  1.00 48.05  ? 142 ASP C O   1 
ATOM   2844 C CB  . ASP C 3 143 ? 30.777  66.793  50.724  1.00 48.59  ? 142 ASP C CB  1 
ATOM   2845 C CG  . ASP C 3 143 ? 29.604  67.249  51.549  1.00 57.27  ? 142 ASP C CG  1 
ATOM   2846 O OD1 . ASP C 3 143 ? 28.536  66.612  51.453  1.00 55.32  ? 142 ASP C OD1 1 
ATOM   2847 O OD2 . ASP C 3 143 ? 29.749  68.242  52.293  1.00 61.63  ? 142 ASP C OD2 1 
ATOM   2848 N N   . TYR C 3 144 ? 28.940  63.779  50.397  1.00 45.37  ? 143 TYR C N   1 
ATOM   2849 C CA  . TYR C 3 144 ? 28.446  62.605  51.114  1.00 41.44  ? 143 TYR C CA  1 
ATOM   2850 C C   . TYR C 3 144 ? 27.767  62.835  52.456  1.00 41.55  ? 143 TYR C C   1 
ATOM   2851 O O   . TYR C 3 144 ? 27.488  61.890  53.193  1.00 46.30  ? 143 TYR C O   1 
ATOM   2852 C CB  . TYR C 3 144 ? 29.552  61.555  51.202  1.00 46.69  ? 143 TYR C CB  1 
ATOM   2853 C CG  . TYR C 3 144 ? 30.117  61.308  49.826  1.00 51.24  ? 143 TYR C CG  1 
ATOM   2854 C CD1 . TYR C 3 144 ? 29.269  61.285  48.709  1.00 45.87  ? 143 TYR C CD1 1 
ATOM   2855 C CD2 . TYR C 3 144 ? 31.486  61.164  49.618  1.00 34.74  ? 143 TYR C CD2 1 
ATOM   2856 C CE1 . TYR C 3 144 ? 29.768  61.136  47.429  1.00 48.36  ? 143 TYR C CE1 1 
ATOM   2857 C CE2 . TYR C 3 144 ? 31.995  61.013  48.330  1.00 47.11  ? 143 TYR C CE2 1 
ATOM   2858 C CZ  . TYR C 3 144 ? 31.129  61.001  47.243  1.00 47.13  ? 143 TYR C CZ  1 
ATOM   2859 O OH  . TYR C 3 144 ? 31.619  60.854  45.968  1.00 62.21  ? 143 TYR C OH  1 
ATOM   2860 N N   . SER C 3 145 ? 27.507  64.099  52.770  1.00 39.94  ? 144 SER C N   1 
ATOM   2861 C CA  . SER C 3 145 ? 26.748  64.429  53.966  1.00 38.73  ? 144 SER C CA  1 
ATOM   2862 C C   . SER C 3 145 ? 25.314  64.414  53.426  1.00 40.72  ? 144 SER C C   1 
ATOM   2863 O O   . SER C 3 145 ? 25.082  63.940  52.311  1.00 41.15  ? 144 SER C O   1 
ATOM   2864 C CB  . SER C 3 145 ? 27.103  65.820  54.503  1.00 42.09  ? 144 SER C CB  1 
ATOM   2865 O OG  . SER C 3 145 ? 26.808  66.852  53.577  1.00 36.76  ? 144 SER C OG  1 
ATOM   2866 N N   . PHE C 3 146 ? 24.346  64.920  54.176  1.00 39.35  ? 145 PHE C N   1 
ATOM   2867 C CA  . PHE C 3 146 ? 22.975  64.888  53.669  1.00 40.65  ? 145 PHE C CA  1 
ATOM   2868 C C   . PHE C 3 146 ? 22.176  66.139  54.018  1.00 40.20  ? 145 PHE C C   1 
ATOM   2869 O O   . PHE C 3 146 ? 22.565  66.909  54.898  1.00 40.27  ? 145 PHE C O   1 
ATOM   2870 C CB  . PHE C 3 146 ? 22.183  63.710  54.268  1.00 36.28  ? 145 PHE C CB  1 
ATOM   2871 C CG  . PHE C 3 146 ? 22.752  62.344  54.006  1.00 38.90  ? 145 PHE C CG  1 
ATOM   2872 C CD1 . PHE C 3 146 ? 23.784  61.822  54.782  1.00 46.93  ? 145 PHE C CD1 1 
ATOM   2873 C CD2 . PHE C 3 146 ? 22.212  61.552  52.998  1.00 45.03  ? 145 PHE C CD2 1 
ATOM   2874 C CE1 . PHE C 3 146 ? 24.243  60.504  54.569  1.00 41.73  ? 145 PHE C CE1 1 
ATOM   2875 C CE2 . PHE C 3 146 ? 22.661  60.246  52.780  1.00 46.27  ? 145 PHE C CE2 1 
ATOM   2876 C CZ  . PHE C 3 146 ? 23.685  59.726  53.558  1.00 38.34  ? 145 PHE C CZ  1 
ATOM   2877 N N   . HIS C 3 147 ? 21.060  66.339  53.314  1.00 37.66  ? 146 HIS C N   1 
ATOM   2878 C CA  . HIS C 3 147 ? 20.149  67.417  53.660  1.00 35.57  ? 146 HIS C CA  1 
ATOM   2879 C C   . HIS C 3 147 ? 18.784  66.760  53.801  1.00 29.37  ? 146 HIS C C   1 
ATOM   2880 O O   . HIS C 3 147 ? 18.601  65.600  53.440  1.00 25.13  ? 146 HIS C O   1 
ATOM   2881 C CB  . HIS C 3 147 ? 20.151  68.606  52.664  1.00 40.40  ? 146 HIS C CB  1 
ATOM   2882 C CG  . HIS C 3 147 ? 19.727  68.276  51.267  1.00 47.43  ? 146 HIS C CG  1 
ATOM   2883 N ND1 . HIS C 3 147 ? 20.587  67.737  50.334  1.00 40.31  ? 146 HIS C ND1 1 
ATOM   2884 C CD2 . HIS C 3 147 ? 18.565  68.518  50.613  1.00 37.62  ? 146 HIS C CD2 1 
ATOM   2885 C CE1 . HIS C 3 147 ? 19.976  67.670  49.165  1.00 37.19  ? 146 HIS C CE1 1 
ATOM   2886 N NE2 . HIS C 3 147 ? 18.749  68.138  49.307  1.00 36.36  ? 146 HIS C NE2 1 
ATOM   2887 N N   . LYS C 3 148 ? 17.838  67.477  54.380  1.00 32.78  ? 147 LYS C N   1 
ATOM   2888 C CA  . LYS C 3 148 ? 16.512  66.934  54.594  1.00 31.32  ? 147 LYS C CA  1 
ATOM   2889 C C   . LYS C 3 148 ? 15.644  68.136  54.848  1.00 30.03  ? 147 LYS C C   1 
ATOM   2890 O O   . LYS C 3 148 ? 16.121  69.141  55.368  1.00 33.90  ? 147 LYS C O   1 
ATOM   2891 C CB  . LYS C 3 148 ? 16.515  66.016  55.823  1.00 38.86  ? 147 LYS C CB  1 
ATOM   2892 C CG  . LYS C 3 148 ? 15.130  65.622  56.326  1.00 42.87  ? 147 LYS C CG  1 
ATOM   2893 C CD  . LYS C 3 148 ? 15.212  64.868  57.649  1.00 37.33  ? 147 LYS C CD  1 
ATOM   2894 C CE  . LYS C 3 148 ? 15.477  63.391  57.458  1.00 38.63  ? 147 LYS C CE  1 
ATOM   2895 N NZ  . LYS C 3 148 ? 14.204  62.624  57.387  1.00 37.06  ? 147 LYS C NZ  1 
ATOM   2896 N N   . LEU C 3 149 ? 14.379  68.063  54.469  1.00 26.20  ? 148 LEU C N   1 
ATOM   2897 C CA  . LEU C 3 149 ? 13.522  69.202  54.708  1.00 25.00  ? 148 LEU C CA  1 
ATOM   2898 C C   . LEU C 3 149 ? 12.281  68.765  55.492  1.00 32.73  ? 148 LEU C C   1 
ATOM   2899 O O   . LEU C 3 149 ? 11.841  67.612  55.392  1.00 32.47  ? 148 LEU C O   1 
ATOM   2900 C CB  . LEU C 3 149 ? 13.121  69.855  53.381  1.00 24.94  ? 148 LEU C CB  1 
ATOM   2901 C CG  . LEU C 3 149 ? 14.211  70.289  52.381  1.00 26.07  ? 148 LEU C CG  1 
ATOM   2902 C CD1 . LEU C 3 149 ? 14.455  69.187  51.345  1.00 25.08  ? 148 LEU C CD1 1 
ATOM   2903 C CD2 . LEU C 3 149 ? 13.767  71.560  51.665  1.00 23.30  ? 148 LEU C CD2 1 
ATOM   2904 N N   . SER C 3 150 ? 11.755  69.677  56.304  1.00 31.64  ? 149 SER C N   1 
ATOM   2905 C CA  . SER C 3 150 ? 10.553  69.416  57.080  1.00 36.60  ? 149 SER C CA  1 
ATOM   2906 C C   . SER C 3 150 ? 9.569   70.525  56.736  1.00 35.41  ? 149 SER C C   1 
ATOM   2907 O O   . SER C 3 150 ? 9.985   71.627  56.379  1.00 34.34  ? 149 SER C O   1 
ATOM   2908 C CB  . SER C 3 150 ? 10.837  69.428  58.577  1.00 38.66  ? 149 SER C CB  1 
ATOM   2909 O OG  . SER C 3 150 ? 9.638   69.155  59.282  1.00 38.24  ? 149 SER C OG  1 
ATOM   2910 N N   . TYR C 3 151 ? 8.275   70.244  56.859  1.00 30.19  ? 150 TYR C N   1 
ATOM   2911 C CA  . TYR C 3 151 ? 7.256   71.220  56.498  1.00 27.00  ? 150 TYR C CA  1 
ATOM   2912 C C   . TYR C 3 151 ? 6.185   71.415  57.551  1.00 29.63  ? 150 TYR C C   1 
ATOM   2913 O O   . TYR C 3 151 ? 5.791   70.482  58.244  1.00 40.69  ? 150 TYR C O   1 
ATOM   2914 C CB  . TYR C 3 151 ? 6.564   70.791  55.203  1.00 30.17  ? 150 TYR C CB  1 
ATOM   2915 C CG  . TYR C 3 151 ? 7.506   70.454  54.072  1.00 38.38  ? 150 TYR C CG  1 
ATOM   2916 C CD1 . TYR C 3 151 ? 8.120   69.205  53.993  1.00 32.62  ? 150 TYR C CD1 1 
ATOM   2917 C CD2 . TYR C 3 151 ? 7.797   71.392  53.088  1.00 36.07  ? 150 TYR C CD2 1 
ATOM   2918 C CE1 . TYR C 3 151 ? 8.996   68.903  52.971  1.00 34.23  ? 150 TYR C CE1 1 
ATOM   2919 C CE2 . TYR C 3 151 ? 8.667   71.102  52.062  1.00 42.89  ? 150 TYR C CE2 1 
ATOM   2920 C CZ  . TYR C 3 151 ? 9.266   69.860  52.004  1.00 43.76  ? 150 TYR C CZ  1 
ATOM   2921 O OH  . TYR C 3 151 ? 10.140  69.597  50.978  1.00 38.48  ? 150 TYR C OH  1 
ATOM   2922 N N   . LEU C 3 152 ? 5.685   72.633  57.640  1.00 34.92  ? 151 LEU C N   1 
ATOM   2923 C CA  . LEU C 3 152 ? 4.642   72.940  58.592  1.00 29.53  ? 151 LEU C CA  1 
ATOM   2924 C C   . LEU C 3 152 ? 3.586   73.814  57.944  1.00 27.28  ? 151 LEU C C   1 
ATOM   2925 O O   . LEU C 3 152 ? 3.870   74.922  57.507  1.00 30.06  ? 151 LEU C O   1 
ATOM   2926 C CB  . LEU C 3 152 ? 5.219   73.671  59.806  1.00 37.05  ? 151 LEU C CB  1 
ATOM   2927 C CG  . LEU C 3 152 ? 4.129   74.128  60.779  1.00 32.88  ? 151 LEU C CG  1 
ATOM   2928 C CD1 . LEU C 3 152 ? 3.399   72.914  61.337  1.00 30.00  ? 151 LEU C CD1 1 
ATOM   2929 C CD2 . LEU C 3 152 ? 4.736   74.959  61.874  1.00 38.45  ? 151 LEU C CD2 1 
ATOM   2930 N N   . THR C 3 153 ? 2.366   73.309  57.873  1.00 25.64  ? 152 THR C N   1 
ATOM   2931 C CA  . THR C 3 153 ? 1.281   74.080  57.299  1.00 37.02  ? 152 THR C CA  1 
ATOM   2932 C C   . THR C 3 153 ? 0.884   75.038  58.418  1.00 39.97  ? 152 THR C C   1 
ATOM   2933 O O   . THR C 3 153 ? 1.007   74.704  59.590  1.00 43.10  ? 152 THR C O   1 
ATOM   2934 C CB  . THR C 3 153 ? 0.115   73.158  56.908  1.00 40.05  ? 152 THR C CB  1 
ATOM   2935 O OG1 . THR C 3 153 ? -0.412  72.531  58.079  1.00 57.39  ? 152 THR C OG1 1 
ATOM   2936 C CG2 . THR C 3 153 ? 0.609   72.067  55.978  1.00 37.64  ? 152 THR C CG2 1 
ATOM   2937 N N   . PHE C 3 154 ? 0.442   76.235  58.071  1.00 38.32  ? 153 PHE C N   1 
ATOM   2938 C CA  . PHE C 3 154 ? 0.080   77.200  59.092  1.00 42.58  ? 153 PHE C CA  1 
ATOM   2939 C C   . PHE C 3 154 ? -0.638  78.395  58.494  1.00 48.37  ? 153 PHE C C   1 
ATOM   2940 O O   . PHE C 3 154 ? -0.608  78.608  57.283  1.00 52.24  ? 153 PHE C O   1 
ATOM   2941 C CB  . PHE C 3 154 ? 1.337   77.697  59.817  1.00 36.96  ? 153 PHE C CB  1 
ATOM   2942 C CG  . PHE C 3 154 ? 2.179   78.652  59.001  1.00 44.21  ? 153 PHE C CG  1 
ATOM   2943 C CD1 . PHE C 3 154 ? 2.849   78.219  57.859  1.00 42.39  ? 153 PHE C CD1 1 
ATOM   2944 C CD2 . PHE C 3 154 ? 2.329   79.980  59.396  1.00 42.63  ? 153 PHE C CD2 1 
ATOM   2945 C CE1 . PHE C 3 154 ? 3.662   79.088  57.126  1.00 38.56  ? 153 PHE C CE1 1 
ATOM   2946 C CE2 . PHE C 3 154 ? 3.139   80.859  58.670  1.00 47.87  ? 153 PHE C CE2 1 
ATOM   2947 C CZ  . PHE C 3 154 ? 3.810   80.404  57.527  1.00 35.26  ? 153 PHE C CZ  1 
ATOM   2948 N N   . ILE C 3 155 ? -1.291  79.169  59.353  1.00 48.33  ? 154 ILE C N   1 
ATOM   2949 C CA  . ILE C 3 155 ? -1.982  80.367  58.911  1.00 50.94  ? 154 ILE C CA  1 
ATOM   2950 C C   . ILE C 3 155 ? -1.160  81.501  59.494  1.00 52.08  ? 154 ILE C C   1 
ATOM   2951 O O   . ILE C 3 155 ? -0.909  81.520  60.698  1.00 52.13  ? 154 ILE C O   1 
ATOM   2952 C CB  . ILE C 3 155 ? -3.409  80.475  59.481  1.00 53.41  ? 154 ILE C CB  1 
ATOM   2953 C CG1 . ILE C 3 155 ? -4.078  79.099  59.563  1.00 54.95  ? 154 ILE C CG1 1 
ATOM   2954 C CG2 . ILE C 3 155 ? -4.226  81.386  58.594  1.00 53.29  ? 154 ILE C CG2 1 
ATOM   2955 C CD1 . ILE C 3 155 ? -4.283  78.422  58.228  1.00 62.92  ? 154 ILE C CD1 1 
ATOM   2956 N N   . PRO C 3 156 ? -0.702  82.443  58.650  1.00 56.76  ? 155 PRO C N   1 
ATOM   2957 C CA  . PRO C 3 156 ? 0.102   83.581  59.118  1.00 56.19  ? 155 PRO C CA  1 
ATOM   2958 C C   . PRO C 3 156 ? -0.695  84.548  59.995  1.00 59.75  ? 155 PRO C C   1 
ATOM   2959 O O   . PRO C 3 156 ? -1.794  84.972  59.622  1.00 58.03  ? 155 PRO C O   1 
ATOM   2960 C CB  . PRO C 3 156 ? 0.567   84.230  57.815  1.00 57.01  ? 155 PRO C CB  1 
ATOM   2961 C CG  . PRO C 3 156 ? 0.610   83.073  56.858  1.00 49.80  ? 155 PRO C CG  1 
ATOM   2962 C CD  . PRO C 3 156 ? -0.668  82.359  57.180  1.00 52.49  ? 155 PRO C CD  1 
ATOM   2963 N N   . SER C 3 157 ? -0.139  84.886  61.159  1.00 64.43  ? 156 SER C N   1 
ATOM   2964 C CA  . SER C 3 157 ? -0.787  85.808  62.100  1.00 64.34  ? 156 SER C CA  1 
ATOM   2965 C C   . SER C 3 157 ? 0.222   86.793  62.661  1.00 67.06  ? 156 SER C C   1 
ATOM   2966 O O   . SER C 3 157 ? 1.420   86.512  62.699  1.00 68.94  ? 156 SER C O   1 
ATOM   2967 C CB  . SER C 3 157 ? -1.399  85.047  63.273  1.00 59.32  ? 156 SER C CB  1 
ATOM   2968 O OG  . SER C 3 157 ? -2.292  84.044  62.828  1.00 75.45  ? 156 SER C OG  1 
ATOM   2969 N N   . ASP C 3 158 ? -0.264  87.943  63.110  1.00 71.10  ? 157 ASP C N   1 
ATOM   2970 C CA  . ASP C 3 158 ? 0.616   88.946  63.693  1.00 76.68  ? 157 ASP C CA  1 
ATOM   2971 C C   . ASP C 3 158 ? 1.057   88.476  65.073  1.00 75.33  ? 157 ASP C C   1 
ATOM   2972 O O   . ASP C 3 158 ? 2.128   88.845  65.556  1.00 75.61  ? 157 ASP C O   1 
ATOM   2973 C CB  . ASP C 3 158 ? -0.111  90.284  63.827  1.00 85.36  ? 157 ASP C CB  1 
ATOM   2974 C CG  . ASP C 3 158 ? -0.469  90.888  62.488  1.00 92.60  ? 157 ASP C CG  1 
ATOM   2975 O OD1 . ASP C 3 158 ? 0.464   91.245  61.731  1.00 96.15  ? 157 ASP C OD1 1 
ATOM   2976 O OD2 . ASP C 3 158 ? -1.681  91.001  62.197  1.00 91.11  ? 157 ASP C OD2 1 
ATOM   2977 N N   . ASP C 3 159 ? 0.224   87.649  65.697  1.00 76.23  ? 158 ASP C N   1 
ATOM   2978 C CA  . ASP C 3 159 ? 0.508   87.136  67.031  1.00 78.57  ? 158 ASP C CA  1 
ATOM   2979 C C   . ASP C 3 159 ? 1.202   85.780  67.049  1.00 75.09  ? 158 ASP C C   1 
ATOM   2980 O O   . ASP C 3 159 ? 1.096   85.044  68.031  1.00 72.36  ? 158 ASP C O   1 
ATOM   2981 C CB  . ASP C 3 159 ? -0.790  87.055  67.848  1.00 85.51  ? 158 ASP C CB  1 
ATOM   2982 C CG  . ASP C 3 159 ? -1.886  86.274  67.137  1.00 91.45  ? 158 ASP C CG  1 
ATOM   2983 O OD1 . ASP C 3 159 ? -2.314  86.704  66.046  1.00 97.95  ? 158 ASP C OD1 1 
ATOM   2984 O OD2 . ASP C 3 159 ? -2.322  85.231  67.671  1.00 95.64  ? 158 ASP C OD2 1 
ATOM   2985 N N   . ASP C 3 160 ? 1.922   85.451  65.980  1.00 73.74  ? 159 ASP C N   1 
ATOM   2986 C CA  . ASP C 3 160 ? 2.608   84.167  65.921  1.00 67.49  ? 159 ASP C CA  1 
ATOM   2987 C C   . ASP C 3 160 ? 4.044   84.168  65.429  1.00 62.98  ? 159 ASP C C   1 
ATOM   2988 O O   . ASP C 3 160 ? 4.374   84.743  64.393  1.00 64.05  ? 159 ASP C O   1 
ATOM   2989 C CB  . ASP C 3 160 ? 1.791   83.178  65.106  1.00 70.27  ? 159 ASP C CB  1 
ATOM   2990 C CG  . ASP C 3 160 ? 0.977   82.263  65.978  1.00 72.05  ? 159 ASP C CG  1 
ATOM   2991 O OD1 . ASP C 3 160 ? 0.135   82.759  66.752  1.00 77.73  ? 159 ASP C OD1 1 
ATOM   2992 O OD2 . ASP C 3 160 ? 1.188   81.042  65.899  1.00 79.94  ? 159 ASP C OD2 1 
ATOM   2993 N N   . ILE C 3 161 ? 4.882   83.488  66.201  1.00 53.66  ? 160 ILE C N   1 
ATOM   2994 C CA  . ILE C 3 161 ? 6.304   83.365  65.944  1.00 50.42  ? 160 ILE C CA  1 
ATOM   2995 C C   . ILE C 3 161 ? 6.648   81.890  65.761  1.00 47.56  ? 160 ILE C C   1 
ATOM   2996 O O   . ILE C 3 161 ? 6.000   81.027  66.348  1.00 45.08  ? 160 ILE C O   1 
ATOM   2997 C CB  . ILE C 3 161 ? 7.093   83.936  67.142  1.00 55.32  ? 160 ILE C CB  1 
ATOM   2998 C CG1 . ILE C 3 161 ? 7.407   85.404  66.893  1.00 60.72  ? 160 ILE C CG1 1 
ATOM   2999 C CG2 . ILE C 3 161 ? 8.329   83.111  67.425  1.00 60.45  ? 160 ILE C CG2 1 
ATOM   3000 C CD1 . ILE C 3 161 ? 6.177   86.285  66.906  1.00 60.74  ? 160 ILE C CD1 1 
ATOM   3001 N N   . TYR C 3 162 ? 7.662   81.595  64.952  1.00 40.69  ? 161 TYR C N   1 
ATOM   3002 C CA  . TYR C 3 162 ? 8.049   80.209  64.740  1.00 35.73  ? 161 TYR C CA  1 
ATOM   3003 C C   . TYR C 3 162 ? 9.538   79.942  64.903  1.00 34.56  ? 161 TYR C C   1 
ATOM   3004 O O   . TYR C 3 162 ? 10.363  80.850  64.840  1.00 41.84  ? 161 TYR C O   1 
ATOM   3005 C CB  . TYR C 3 162 ? 7.594   79.729  63.357  1.00 29.50  ? 161 TYR C CB  1 
ATOM   3006 C CG  . TYR C 3 162 ? 6.089   79.653  63.190  1.00 29.34  ? 161 TYR C CG  1 
ATOM   3007 C CD1 . TYR C 3 162 ? 5.342   80.779  62.834  1.00 34.49  ? 161 TYR C CD1 1 
ATOM   3008 C CD2 . TYR C 3 162 ? 5.406   78.458  63.412  1.00 30.87  ? 161 TYR C CD2 1 
ATOM   3009 C CE1 . TYR C 3 162 ? 3.946   80.711  62.705  1.00 25.88  ? 161 TYR C CE1 1 
ATOM   3010 C CE2 . TYR C 3 162 ? 4.024   78.381  63.287  1.00 27.03  ? 161 TYR C CE2 1 
ATOM   3011 C CZ  . TYR C 3 162 ? 3.301   79.511  62.931  1.00 31.78  ? 161 TYR C CZ  1 
ATOM   3012 O OH  . TYR C 3 162 ? 1.932   79.427  62.787  1.00 40.73  ? 161 TYR C OH  1 
ATOM   3013 N N   . ASP C 3 163 ? 9.861   78.674  65.128  1.00 37.31  ? 162 ASP C N   1 
ATOM   3014 C CA  . ASP C 3 163 ? 11.234  78.217  65.281  1.00 39.32  ? 162 ASP C CA  1 
ATOM   3015 C C   . ASP C 3 163 ? 11.316  76.796  64.754  1.00 38.39  ? 162 ASP C C   1 
ATOM   3016 O O   . ASP C 3 163 ? 10.364  76.022  64.882  1.00 40.99  ? 162 ASP C O   1 
ATOM   3017 C CB  . ASP C 3 163 ? 11.656  78.216  66.755  1.00 51.63  ? 162 ASP C CB  1 
ATOM   3018 C CG  . ASP C 3 163 ? 12.040  79.593  67.258  1.00 55.55  ? 162 ASP C CG  1 
ATOM   3019 O OD1 . ASP C 3 163 ? 13.036  80.147  66.753  1.00 59.09  ? 162 ASP C OD1 1 
ATOM   3020 O OD2 . ASP C 3 163 ? 11.351  80.121  68.155  1.00 58.10  ? 162 ASP C OD2 1 
ATOM   3021 N N   . CYS C 3 164 ? 12.443  76.464  64.139  1.00 36.83  ? 163 CYS C N   1 
ATOM   3022 C CA  . CYS C 3 164 ? 12.661  75.119  63.636  1.00 38.64  ? 163 CYS C CA  1 
ATOM   3023 C C   . CYS C 3 164 ? 13.735  74.582  64.573  1.00 41.16  ? 163 CYS C C   1 
ATOM   3024 O O   . CYS C 3 164 ? 14.797  75.182  64.711  1.00 45.05  ? 163 CYS C O   1 
ATOM   3025 C CB  . CYS C 3 164 ? 13.168  75.137  62.182  1.00 46.03  ? 163 CYS C CB  1 
ATOM   3026 S SG  . CYS C 3 164 ? 13.608  73.477  61.555  1.00 53.49  ? 163 CYS C SG  1 
ATOM   3027 N N   . LYS C 3 165 ? 13.454  73.467  65.233  1.00 39.27  ? 164 LYS C N   1 
ATOM   3028 C CA  . LYS C 3 165 ? 14.403  72.892  66.171  1.00 38.97  ? 164 LYS C CA  1 
ATOM   3029 C C   . LYS C 3 165 ? 15.081  71.649  65.617  1.00 39.60  ? 164 LYS C C   1 
ATOM   3030 O O   . LYS C 3 165 ? 14.426  70.660  65.276  1.00 44.66  ? 164 LYS C O   1 
ATOM   3031 C CB  . LYS C 3 165 ? 13.684  72.571  67.480  1.00 47.99  ? 164 LYS C CB  1 
ATOM   3032 C CG  . LYS C 3 165 ? 14.546  71.965  68.569  1.00 42.48  ? 164 LYS C CG  1 
ATOM   3033 C CD  . LYS C 3 165 ? 13.715  71.821  69.842  1.00 52.23  ? 164 LYS C CD  1 
ATOM   3034 C CE  . LYS C 3 165 ? 14.467  71.101  70.949  1.00 54.56  ? 164 LYS C CE  1 
ATOM   3035 N NZ  . LYS C 3 165 ? 13.622  71.015  72.170  1.00 64.52  ? 164 LYS C NZ  1 
ATOM   3036 N N   . VAL C 3 166 ? 16.404  71.709  65.536  1.00 39.09  ? 165 VAL C N   1 
ATOM   3037 C CA  . VAL C 3 166 ? 17.200  70.607  65.013  1.00 39.51  ? 165 VAL C CA  1 
ATOM   3038 C C   . VAL C 3 166 ? 18.049  69.997  66.139  1.00 41.89  ? 165 VAL C C   1 
ATOM   3039 O O   . VAL C 3 166 ? 18.729  70.715  66.872  1.00 37.44  ? 165 VAL C O   1 
ATOM   3040 C CB  . VAL C 3 166 ? 18.139  71.109  63.875  1.00 33.88  ? 165 VAL C CB  1 
ATOM   3041 C CG1 . VAL C 3 166 ? 18.745  69.938  63.143  1.00 31.84  ? 165 VAL C CG1 1 
ATOM   3042 C CG2 . VAL C 3 166 ? 17.367  71.977  62.904  1.00 34.97  ? 165 VAL C CG2 1 
ATOM   3043 N N   . GLU C 3 167 ? 17.995  68.675  66.265  1.00 40.22  ? 166 GLU C N   1 
ATOM   3044 C CA  . GLU C 3 167 ? 18.746  67.943  67.285  1.00 46.59  ? 166 GLU C CA  1 
ATOM   3045 C C   . GLU C 3 167 ? 19.667  66.974  66.577  1.00 47.36  ? 166 GLU C C   1 
ATOM   3046 O O   . GLU C 3 167 ? 19.216  66.139  65.798  1.00 53.40  ? 166 GLU C O   1 
ATOM   3047 C CB  . GLU C 3 167 ? 17.801  67.157  68.202  1.00 45.96  ? 166 GLU C CB  1 
ATOM   3048 C CG  . GLU C 3 167 ? 17.075  67.989  69.250  1.00 57.21  ? 166 GLU C CG  1 
ATOM   3049 C CD  . GLU C 3 167 ? 15.813  67.303  69.771  1.00 70.22  ? 166 GLU C CD  1 
ATOM   3050 O OE1 . GLU C 3 167 ? 15.863  66.080  70.060  1.00 71.75  ? 166 GLU C OE1 1 
ATOM   3051 O OE2 . GLU C 3 167 ? 14.773  67.992  69.894  1.00 63.49  ? 166 GLU C OE2 1 
ATOM   3052 N N   . HIS C 3 168 ? 20.956  67.070  66.865  1.00 50.32  ? 167 HIS C N   1 
ATOM   3053 C CA  . HIS C 3 168 ? 21.936  66.212  66.223  1.00 49.45  ? 167 HIS C CA  1 
ATOM   3054 C C   . HIS C 3 168 ? 23.134  65.979  67.136  1.00 51.16  ? 167 HIS C C   1 
ATOM   3055 O O   . HIS C 3 168 ? 23.493  66.849  67.935  1.00 52.17  ? 167 HIS C O   1 
ATOM   3056 C CB  . HIS C 3 168 ? 22.410  66.874  64.930  1.00 46.67  ? 167 HIS C CB  1 
ATOM   3057 C CG  . HIS C 3 168 ? 23.273  65.995  64.083  1.00 45.08  ? 167 HIS C CG  1 
ATOM   3058 N ND1 . HIS C 3 168 ? 22.755  65.123  63.150  1.00 47.28  ? 167 HIS C ND1 1 
ATOM   3059 C CD2 . HIS C 3 168 ? 24.617  65.856  64.021  1.00 36.24  ? 167 HIS C CD2 1 
ATOM   3060 C CE1 . HIS C 3 168 ? 23.743  64.489  62.546  1.00 41.98  ? 167 HIS C CE1 1 
ATOM   3061 N NE2 . HIS C 3 168 ? 24.883  64.916  63.057  1.00 47.93  ? 167 HIS C NE2 1 
ATOM   3062 N N   . TRP C 3 169 ? 23.761  64.813  67.001  1.00 45.59  ? 168 TRP C N   1 
ATOM   3063 C CA  . TRP C 3 169 ? 24.922  64.478  67.812  1.00 52.24  ? 168 TRP C CA  1 
ATOM   3064 C C   . TRP C 3 169 ? 26.099  65.409  67.551  1.00 55.27  ? 168 TRP C C   1 
ATOM   3065 O O   . TRP C 3 169 ? 27.111  65.338  68.242  1.00 62.01  ? 168 TRP C O   1 
ATOM   3066 C CB  . TRP C 3 169 ? 25.377  63.045  67.547  1.00 48.96  ? 168 TRP C CB  1 
ATOM   3067 C CG  . TRP C 3 169 ? 24.326  62.021  67.747  1.00 48.00  ? 168 TRP C CG  1 
ATOM   3068 C CD1 . TRP C 3 169 ? 23.313  62.045  68.665  1.00 45.44  ? 168 TRP C CD1 1 
ATOM   3069 C CD2 . TRP C 3 169 ? 24.201  60.784  67.041  1.00 48.09  ? 168 TRP C CD2 1 
ATOM   3070 N NE1 . TRP C 3 169 ? 22.563  60.896  68.570  1.00 48.73  ? 168 TRP C NE1 1 
ATOM   3071 C CE2 . TRP C 3 169 ? 23.084  60.107  67.577  1.00 51.48  ? 168 TRP C CE2 1 
ATOM   3072 C CE3 . TRP C 3 169 ? 24.921  60.185  65.999  1.00 47.60  ? 168 TRP C CE3 1 
ATOM   3073 C CZ2 . TRP C 3 169 ? 22.677  58.853  67.113  1.00 52.31  ? 168 TRP C CZ2 1 
ATOM   3074 C CZ3 . TRP C 3 169 ? 24.519  58.940  65.538  1.00 45.12  ? 168 TRP C CZ3 1 
ATOM   3075 C CH2 . TRP C 3 169 ? 23.402  58.290  66.092  1.00 51.65  ? 168 TRP C CH2 1 
ATOM   3076 N N   . GLY C 3 170 ? 25.970  66.265  66.544  1.00 57.74  ? 169 GLY C N   1 
ATOM   3077 C CA  . GLY C 3 170 ? 27.039  67.191  66.204  1.00 51.95  ? 169 GLY C CA  1 
ATOM   3078 C C   . GLY C 3 170 ? 26.835  68.567  66.812  1.00 53.48  ? 169 GLY C C   1 
ATOM   3079 O O   . GLY C 3 170 ? 27.654  69.471  66.631  1.00 48.54  ? 169 GLY C O   1 
ATOM   3080 N N   . LEU C 3 171 ? 25.725  68.731  67.521  1.00 54.54  ? 170 LEU C N   1 
ATOM   3081 C CA  . LEU C 3 171 ? 25.425  69.992  68.177  1.00 55.50  ? 170 LEU C CA  1 
ATOM   3082 C C   . LEU C 3 171 ? 25.556  69.751  69.673  1.00 60.70  ? 170 LEU C C   1 
ATOM   3083 O O   . LEU C 3 171 ? 25.287  68.650  70.159  1.00 56.39  ? 170 LEU C O   1 
ATOM   3084 C CB  . LEU C 3 171 ? 24.004  70.446  67.853  1.00 50.30  ? 170 LEU C CB  1 
ATOM   3085 C CG  . LEU C 3 171 ? 23.615  70.635  66.387  1.00 50.52  ? 170 LEU C CG  1 
ATOM   3086 C CD1 . LEU C 3 171 ? 22.135  70.958  66.325  1.00 47.24  ? 170 LEU C CD1 1 
ATOM   3087 C CD2 . LEU C 3 171 ? 24.430  71.747  65.748  1.00 44.76  ? 170 LEU C CD2 1 
ATOM   3088 N N   . GLU C 3 172 ? 25.988  70.776  70.397  1.00 70.20  ? 171 GLU C N   1 
ATOM   3089 C CA  . GLU C 3 172 ? 26.149  70.661  71.837  1.00 81.17  ? 171 GLU C CA  1 
ATOM   3090 C C   . GLU C 3 172 ? 24.826  71.043  72.481  1.00 83.22  ? 171 GLU C C   1 
ATOM   3091 O O   . GLU C 3 172 ? 24.497  70.605  73.585  1.00 86.31  ? 171 GLU C O   1 
ATOM   3092 C CB  . GLU C 3 172 ? 27.269  71.588  72.324  1.00 88.21  ? 171 GLU C CB  1 
ATOM   3093 C CG  . GLU C 3 172 ? 27.587  71.453  73.815  1.00 97.24  ? 171 GLU C CG  1 
ATOM   3094 C CD  . GLU C 3 172 ? 27.933  70.026  74.221  1.00 99.29  ? 171 GLU C CD  1 
ATOM   3095 O OE1 . GLU C 3 172 ? 28.962  69.499  73.745  1.00 98.05  ? 171 GLU C OE1 1 
ATOM   3096 O OE2 . GLU C 3 172 ? 27.172  69.432  75.016  1.00 102.18 ? 171 GLU C OE2 1 
ATOM   3097 N N   . GLU C 3 173 ? 24.065  71.860  71.767  1.00 82.47  ? 172 GLU C N   1 
ATOM   3098 C CA  . GLU C 3 173 ? 22.771  72.311  72.244  1.00 79.56  ? 172 GLU C CA  1 
ATOM   3099 C C   . GLU C 3 173 ? 21.876  72.449  71.020  1.00 74.46  ? 172 GLU C C   1 
ATOM   3100 O O   . GLU C 3 173 ? 22.288  73.006  70.000  1.00 70.53  ? 172 GLU C O   1 
ATOM   3101 C CB  . GLU C 3 173 ? 22.920  73.661  72.954  1.00 84.26  ? 172 GLU C CB  1 
ATOM   3102 C CG  . GLU C 3 173 ? 21.755  74.057  73.859  1.00 93.53  ? 172 GLU C CG  1 
ATOM   3103 C CD  . GLU C 3 173 ? 21.629  73.170  75.096  1.00 99.19  ? 172 GLU C CD  1 
ATOM   3104 O OE1 . GLU C 3 173 ? 22.664  72.912  75.755  1.00 102.05 ? 172 GLU C OE1 1 
ATOM   3105 O OE2 . GLU C 3 173 ? 20.496  72.741  75.415  1.00 92.26  ? 172 GLU C OE2 1 
ATOM   3106 N N   . PRO C 3 174 ? 20.649  71.914  71.095  1.00 69.07  ? 173 PRO C N   1 
ATOM   3107 C CA  . PRO C 3 174 ? 19.705  71.992  69.982  1.00 66.05  ? 173 PRO C CA  1 
ATOM   3108 C C   . PRO C 3 174 ? 19.711  73.369  69.333  1.00 62.19  ? 173 PRO C C   1 
ATOM   3109 O O   . PRO C 3 174 ? 19.728  74.395  70.013  1.00 58.60  ? 173 PRO C O   1 
ATOM   3110 C CB  . PRO C 3 174 ? 18.376  71.662  70.648  1.00 67.07  ? 173 PRO C CB  1 
ATOM   3111 C CG  . PRO C 3 174 ? 18.782  70.604  71.622  1.00 69.86  ? 173 PRO C CG  1 
ATOM   3112 C CD  . PRO C 3 174 ? 20.064  71.164  72.221  1.00 69.55  ? 173 PRO C CD  1 
ATOM   3113 N N   . VAL C 3 175 ? 19.706  73.382  68.009  1.00 62.97  ? 174 VAL C N   1 
ATOM   3114 C CA  . VAL C 3 175 ? 19.710  74.628  67.258  1.00 62.45  ? 174 VAL C CA  1 
ATOM   3115 C C   . VAL C 3 175 ? 18.293  75.096  66.964  1.00 58.23  ? 174 VAL C C   1 
ATOM   3116 O O   . VAL C 3 175 ? 17.473  74.328  66.463  1.00 59.34  ? 174 VAL C O   1 
ATOM   3117 C CB  . VAL C 3 175 ? 20.467  74.465  65.908  1.00 59.30  ? 174 VAL C CB  1 
ATOM   3118 C CG1 . VAL C 3 175 ? 20.143  75.618  64.975  1.00 62.64  ? 174 VAL C CG1 1 
ATOM   3119 C CG2 . VAL C 3 175 ? 21.962  74.402  66.158  1.00 60.69  ? 174 VAL C CG2 1 
ATOM   3120 N N   . LEU C 3 176 ? 18.005  76.353  67.285  1.00 53.14  ? 175 LEU C N   1 
ATOM   3121 C CA  . LEU C 3 176 ? 16.693  76.914  66.999  1.00 52.29  ? 175 LEU C CA  1 
ATOM   3122 C C   . LEU C 3 176 ? 16.806  77.932  65.868  1.00 48.98  ? 175 LEU C C   1 
ATOM   3123 O O   . LEU C 3 176 ? 17.456  78.963  66.015  1.00 52.36  ? 175 LEU C O   1 
ATOM   3124 C CB  . LEU C 3 176 ? 16.090  77.608  68.227  1.00 47.39  ? 175 LEU C CB  1 
ATOM   3125 C CG  . LEU C 3 176 ? 15.655  76.821  69.465  1.00 51.79  ? 175 LEU C CG  1 
ATOM   3126 C CD1 . LEU C 3 176 ? 14.715  77.714  70.257  1.00 57.43  ? 175 LEU C CD1 1 
ATOM   3127 C CD2 . LEU C 3 176 ? 14.926  75.539  69.098  1.00 49.06  ? 175 LEU C CD2 1 
ATOM   3128 N N   . LYS C 3 177 ? 16.194  77.637  64.729  1.00 50.92  ? 176 LYS C N   1 
ATOM   3129 C CA  . LYS C 3 177 ? 16.217  78.580  63.629  1.00 45.93  ? 176 LYS C CA  1 
ATOM   3130 C C   . LYS C 3 177 ? 14.892  79.305  63.713  1.00 45.02  ? 176 LYS C C   1 
ATOM   3131 O O   . LYS C 3 177 ? 13.826  78.713  63.526  1.00 47.24  ? 176 LYS C O   1 
ATOM   3132 C CB  . LYS C 3 177 ? 16.351  77.869  62.290  1.00 50.13  ? 176 LYS C CB  1 
ATOM   3133 C CG  . LYS C 3 177 ? 16.808  78.800  61.195  1.00 53.13  ? 176 LYS C CG  1 
ATOM   3134 C CD  . LYS C 3 177 ? 18.181  79.377  61.517  1.00 54.49  ? 176 LYS C CD  1 
ATOM   3135 C CE  . LYS C 3 177 ? 18.629  80.373  60.455  1.00 58.66  ? 176 LYS C CE  1 
ATOM   3136 N NZ  . LYS C 3 177 ? 20.081  80.682  60.573  1.00 64.85  ? 176 LYS C NZ  1 
ATOM   3137 N N   . HIS C 3 178 ? 14.968  80.595  64.002  1.00 42.60  ? 177 HIS C N   1 
ATOM   3138 C CA  . HIS C 3 178 ? 13.787  81.422  64.175  1.00 39.41  ? 177 HIS C CA  1 
ATOM   3139 C C   . HIS C 3 178 ? 13.220  82.012  62.891  1.00 41.17  ? 177 HIS C C   1 
ATOM   3140 O O   . HIS C 3 178 ? 13.951  82.303  61.951  1.00 45.11  ? 177 HIS C O   1 
ATOM   3141 C CB  . HIS C 3 178 ? 14.129  82.550  65.149  1.00 39.76  ? 177 HIS C CB  1 
ATOM   3142 C CG  . HIS C 3 178 ? 12.960  83.396  65.529  1.00 43.05  ? 177 HIS C CG  1 
ATOM   3143 N ND1 . HIS C 3 178 ? 11.940  82.938  66.332  1.00 48.17  ? 177 HIS C ND1 1 
ATOM   3144 C CD2 . HIS C 3 178 ? 12.647  84.675  65.214  1.00 51.64  ? 177 HIS C CD2 1 
ATOM   3145 C CE1 . HIS C 3 178 ? 11.050  83.900  66.497  1.00 52.00  ? 177 HIS C CE1 1 
ATOM   3146 N NE2 . HIS C 3 178 ? 11.454  84.964  65.830  1.00 51.91  ? 177 HIS C NE2 1 
ATOM   3147 N N   . TRP C 3 179 ? 11.906  82.203  62.869  1.00 40.19  ? 178 TRP C N   1 
ATOM   3148 C CA  . TRP C 3 179 ? 11.236  82.782  61.716  1.00 47.02  ? 178 TRP C CA  1 
ATOM   3149 C C   . TRP C 3 179 ? 9.901   83.384  62.127  1.00 51.93  ? 178 TRP C C   1 
ATOM   3150 O O   . TRP C 3 179 ? 9.201   82.836  62.977  1.00 54.30  ? 178 TRP C O   1 
ATOM   3151 C CB  . TRP C 3 179 ? 10.981  81.720  60.647  1.00 46.78  ? 178 TRP C CB  1 
ATOM   3152 C CG  . TRP C 3 179 ? 10.346  82.290  59.414  1.00 47.11  ? 178 TRP C CG  1 
ATOM   3153 C CD1 . TRP C 3 179 ? 10.992  82.765  58.306  1.00 44.88  ? 178 TRP C CD1 1 
ATOM   3154 C CD2 . TRP C 3 179 ? 8.952   82.560  59.212  1.00 43.95  ? 178 TRP C CD2 1 
ATOM   3155 N NE1 . TRP C 3 179 ? 10.087  83.311  57.427  1.00 41.53  ? 178 TRP C NE1 1 
ATOM   3156 C CE2 . TRP C 3 179 ? 8.828   83.192  57.952  1.00 45.66  ? 178 TRP C CE2 1 
ATOM   3157 C CE3 . TRP C 3 179 ? 7.794   82.308  59.962  1.00 46.87  ? 178 TRP C CE3 1 
ATOM   3158 C CZ2 . TRP C 3 179 ? 7.594   83.615  57.442  1.00 42.41  ? 178 TRP C CZ2 1 
ATOM   3159 C CZ3 . TRP C 3 179 ? 6.560   82.729  59.453  1.00 45.82  ? 178 TRP C CZ3 1 
ATOM   3160 C CH2 . TRP C 3 179 ? 6.472   83.363  58.198  1.00 47.37  ? 178 TRP C CH2 1 
ATOM   3161 N N   . GLU C 3 180 ? 9.543   84.509  61.519  1.00 56.59  ? 179 GLU C N   1 
ATOM   3162 C CA  . GLU C 3 180 ? 8.266   85.148  61.811  1.00 62.99  ? 179 GLU C CA  1 
ATOM   3163 C C   . GLU C 3 180 ? 7.827   86.060  60.662  1.00 63.81  ? 179 GLU C C   1 
ATOM   3164 O O   . GLU C 3 180 ? 8.652   86.693  60.011  1.00 66.03  ? 179 GLU C O   1 
ATOM   3165 C CB  . GLU C 3 180 ? 8.350   85.927  63.131  1.00 62.42  ? 179 GLU C CB  1 
ATOM   3166 C CG  . GLU C 3 180 ? 9.398   87.022  63.171  1.00 68.55  ? 179 GLU C CG  1 
ATOM   3167 C CD  . GLU C 3 180 ? 9.466   87.720  64.527  1.00 70.22  ? 179 GLU C CD  1 
ATOM   3168 O OE1 . GLU C 3 180 ? 10.075  87.165  65.467  1.00 58.41  ? 179 GLU C OE1 1 
ATOM   3169 O OE2 . GLU C 3 180 ? 8.899   88.828  64.651  1.00 72.83  ? 179 GLU C OE2 1 
ATOM   3170 N N   . PRO C 3 181 ? 6.514   86.120  60.385  1.00 68.84  ? 180 PRO C N   1 
ATOM   3171 C CA  . PRO C 3 181 ? 6.040   86.976  59.295  1.00 72.71  ? 180 PRO C CA  1 
ATOM   3172 C C   . PRO C 3 181 ? 6.575   88.384  59.449  1.00 77.74  ? 180 PRO C C   1 
ATOM   3173 O O   . PRO C 3 181 ? 6.289   89.078  60.423  1.00 77.23  ? 180 PRO C O   1 
ATOM   3174 C CB  . PRO C 3 181 ? 4.518   86.892  59.415  1.00 72.66  ? 180 PRO C CB  1 
ATOM   3175 C CG  . PRO C 3 181 ? 4.299   86.570  60.861  1.00 73.26  ? 180 PRO C CG  1 
ATOM   3176 C CD  . PRO C 3 181 ? 5.381   85.563  61.143  1.00 71.83  ? 180 PRO C CD  1 
ATOM   3177 N N   . GLU C 3 182 ? 7.367   88.790  58.470  1.00 86.64  ? 181 GLU C N   1 
ATOM   3178 C CA  . GLU C 3 182 ? 7.987   90.101  58.471  1.00 94.49  ? 181 GLU C CA  1 
ATOM   3179 C C   . GLU C 3 182 ? 7.047   91.145  57.858  1.00 96.10  ? 181 GLU C C   1 
ATOM   3180 O O   . GLU C 3 182 ? 7.478   91.876  56.941  1.00 96.07  ? 181 GLU C O   1 
ATOM   3181 C CB  . GLU C 3 182 ? 9.307   90.003  57.695  1.00 100.66 ? 181 GLU C CB  1 
ATOM   3182 C CG  . GLU C 3 182 ? 10.283  91.149  57.885  1.00 106.90 ? 181 GLU C CG  1 
ATOM   3183 C CD  . GLU C 3 182 ? 11.709  90.738  57.552  1.00 109.57 ? 181 GLU C CD  1 
ATOM   3184 O OE1 . GLU C 3 182 ? 11.899  89.954  56.597  1.00 108.15 ? 181 GLU C OE1 1 
ATOM   3185 O OE2 . GLU C 3 182 ? 12.640  91.204  58.242  1.00 111.54 ? 181 GLU C OE2 1 
ATOM   3186 O OXT . GLU C 3 182 ? 5.883   91.221  58.314  1.00 94.51  ? 181 GLU C OXT 1 
ATOM   3187 N N   . GLY D 4 1   ? 32.526  49.830  68.674  1.00 124.34 ? 1   GLY D N   1 
ATOM   3188 C CA  . GLY D 4 1   ? 31.077  49.704  68.988  1.00 126.55 ? 1   GLY D CA  1 
ATOM   3189 C C   . GLY D 4 1   ? 30.792  49.985  70.446  1.00 128.06 ? 1   GLY D C   1 
ATOM   3190 O O   . GLY D 4 1   ? 29.708  49.688  70.950  1.00 128.67 ? 1   GLY D O   1 
ATOM   3191 N N   . ASP D 4 2   ? 31.780  50.558  71.123  1.00 130.10 ? 2   ASP D N   1 
ATOM   3192 C CA  . ASP D 4 2   ? 31.648  50.904  72.525  1.00 131.61 ? 2   ASP D CA  1 
ATOM   3193 C C   . ASP D 4 2   ? 30.421  51.779  72.870  1.00 132.77 ? 2   ASP D C   1 
ATOM   3194 O O   . ASP D 4 2   ? 29.430  51.250  73.364  1.00 132.28 ? 2   ASP D O   1 
ATOM   3195 C CB  . ASP D 4 2   ? 32.910  51.626  73.028  1.00 130.41 ? 2   ASP D CB  1 
ATOM   3196 C CG  . ASP D 4 2   ? 34.191  50.855  72.756  1.00 130.15 ? 2   ASP D CG  1 
ATOM   3197 O OD1 . ASP D 4 2   ? 34.312  49.708  73.236  1.00 125.55 ? 2   ASP D OD1 1 
ATOM   3198 O OD2 . ASP D 4 2   ? 35.080  51.406  72.068  1.00 130.45 ? 2   ASP D OD2 1 
ATOM   3199 N N   . SER D 4 3   ? 30.463  53.093  72.589  1.00 132.96 ? 3   SER D N   1 
ATOM   3200 C CA  . SER D 4 3   ? 29.375  54.014  73.017  1.00 132.93 ? 3   SER D CA  1 
ATOM   3201 C C   . SER D 4 3   ? 28.712  54.995  72.024  1.00 129.75 ? 3   SER D C   1 
ATOM   3202 O O   . SER D 4 3   ? 27.496  54.952  71.835  1.00 128.70 ? 3   SER D O   1 
ATOM   3203 C CB  . SER D 4 3   ? 29.875  54.812  74.228  1.00 136.14 ? 3   SER D CB  1 
ATOM   3204 O OG  . SER D 4 3   ? 30.875  55.739  73.839  1.00 138.65 ? 3   SER D OG  1 
ATOM   3205 N N   . GLU D 4 4   ? 29.478  55.926  71.461  1.00 125.14 ? 4   GLU D N   1 
ATOM   3206 C CA  . GLU D 4 4   ? 28.930  56.822  70.445  1.00 118.91 ? 4   GLU D CA  1 
ATOM   3207 C C   . GLU D 4 4   ? 29.769  56.536  69.210  1.00 113.72 ? 4   GLU D C   1 
ATOM   3208 O O   . GLU D 4 4   ? 30.261  57.446  68.548  1.00 114.13 ? 4   GLU D O   1 
ATOM   3209 C CB  . GLU D 4 4   ? 29.044  58.302  70.837  1.00 121.54 ? 4   GLU D CB  1 
ATOM   3210 C CG  . GLU D 4 4   ? 27.718  59.075  70.764  1.00 121.47 ? 4   GLU D CG  1 
ATOM   3211 C CD  . GLU D 4 4   ? 27.161  59.219  69.355  1.00 119.22 ? 4   GLU D CD  1 
ATOM   3212 O OE1 . GLU D 4 4   ? 27.849  59.811  68.496  1.00 119.40 ? 4   GLU D OE1 1 
ATOM   3213 O OE2 . GLU D 4 4   ? 26.029  58.746  69.114  1.00 114.16 ? 4   GLU D OE2 1 
ATOM   3214 N N   . ARG D 4 5   ? 29.927  55.249  68.914  1.00 107.76 ? 5   ARG D N   1 
ATOM   3215 C CA  . ARG D 4 5   ? 30.704  54.809  67.763  1.00 102.85 ? 5   ARG D CA  1 
ATOM   3216 C C   . ARG D 4 5   ? 29.724  54.429  66.655  1.00 94.82  ? 5   ARG D C   1 
ATOM   3217 O O   . ARG D 4 5   ? 29.303  53.280  66.542  1.00 91.44  ? 5   ARG D O   1 
ATOM   3218 C CB  . ARG D 4 5   ? 31.582  53.613  68.150  1.00 106.01 ? 5   ARG D CB  1 
ATOM   3219 C CG  . ARG D 4 5   ? 32.437  53.847  69.397  1.00 112.04 ? 5   ARG D CG  1 
ATOM   3220 C CD  . ARG D 4 5   ? 33.436  52.713  69.632  1.00 114.22 ? 5   ARG D CD  1 
ATOM   3221 N NE  . ARG D 4 5   ? 34.469  52.666  68.600  1.00 119.20 ? 5   ARG D NE  1 
ATOM   3222 C CZ  . ARG D 4 5   ? 35.369  53.624  68.397  1.00 120.90 ? 5   ARG D CZ  1 
ATOM   3223 N NH1 . ARG D 4 5   ? 35.371  54.711  69.159  1.00 122.38 ? 5   ARG D NH1 1 
ATOM   3224 N NH2 . ARG D 4 5   ? 36.265  53.501  67.425  1.00 118.29 ? 5   ARG D NH2 1 
ATOM   3225 N N   . HIS D 4 6   ? 29.361  55.417  65.847  1.00 85.17  ? 6   HIS D N   1 
ATOM   3226 C CA  . HIS D 4 6   ? 28.415  55.229  64.760  1.00 76.45  ? 6   HIS D CA  1 
ATOM   3227 C C   . HIS D 4 6   ? 29.100  54.794  63.460  1.00 70.18  ? 6   HIS D C   1 
ATOM   3228 O O   . HIS D 4 6   ? 30.162  55.305  63.102  1.00 61.44  ? 6   HIS D O   1 
ATOM   3229 C CB  . HIS D 4 6   ? 27.647  56.534  64.538  1.00 76.37  ? 6   HIS D CB  1 
ATOM   3230 C CG  . HIS D 4 6   ? 26.441  56.387  63.669  1.00 76.63  ? 6   HIS D CG  1 
ATOM   3231 N ND1 . HIS D 4 6   ? 25.255  55.857  64.127  1.00 75.70  ? 6   HIS D ND1 1 
ATOM   3232 C CD2 . HIS D 4 6   ? 26.244  56.682  62.362  1.00 75.60  ? 6   HIS D CD2 1 
ATOM   3233 C CE1 . HIS D 4 6   ? 24.378  55.832  63.139  1.00 75.48  ? 6   HIS D CE1 1 
ATOM   3234 N NE2 . HIS D 4 6   ? 24.953  56.327  62.057  1.00 74.66  ? 6   HIS D NE2 1 
ATOM   3235 N N   . PHE D 4 7   ? 28.475  53.853  62.758  1.00 64.86  ? 7   PHE D N   1 
ATOM   3236 C CA  . PHE D 4 7   ? 29.005  53.327  61.501  1.00 66.81  ? 7   PHE D CA  1 
ATOM   3237 C C   . PHE D 4 7   ? 27.894  53.262  60.454  1.00 65.15  ? 7   PHE D C   1 
ATOM   3238 O O   . PHE D 4 7   ? 26.793  52.807  60.740  1.00 64.73  ? 7   PHE D O   1 
ATOM   3239 C CB  . PHE D 4 7   ? 29.572  51.922  61.726  1.00 67.58  ? 7   PHE D CB  1 
ATOM   3240 C CG  . PHE D 4 7   ? 30.595  51.852  62.824  1.00 76.81  ? 7   PHE D CG  1 
ATOM   3241 C CD1 . PHE D 4 7   ? 31.907  52.273  62.604  1.00 75.63  ? 7   PHE D CD1 1 
ATOM   3242 C CD2 . PHE D 4 7   ? 30.238  51.406  64.095  1.00 76.37  ? 7   PHE D CD2 1 
ATOM   3243 C CE1 . PHE D 4 7   ? 32.848  52.255  63.641  1.00 72.93  ? 7   PHE D CE1 1 
ATOM   3244 C CE2 . PHE D 4 7   ? 31.170  51.385  65.137  1.00 76.88  ? 7   PHE D CE2 1 
ATOM   3245 C CZ  . PHE D 4 7   ? 32.478  51.812  64.908  1.00 73.85  ? 7   PHE D CZ  1 
ATOM   3246 N N   . VAL D 4 8   ? 28.184  53.709  59.240  1.00 58.66  ? 8   VAL D N   1 
ATOM   3247 C CA  . VAL D 4 8   ? 27.193  53.692  58.170  1.00 58.58  ? 8   VAL D CA  1 
ATOM   3248 C C   . VAL D 4 8   ? 27.893  53.427  56.842  1.00 50.91  ? 8   VAL D C   1 
ATOM   3249 O O   . VAL D 4 8   ? 29.103  53.547  56.764  1.00 50.10  ? 8   VAL D O   1 
ATOM   3250 C CB  . VAL D 4 8   ? 26.418  55.065  58.099  1.00 61.98  ? 8   VAL D CB  1 
ATOM   3251 C CG1 . VAL D 4 8   ? 27.380  56.228  57.898  1.00 61.60  ? 8   VAL D CG1 1 
ATOM   3252 C CG2 . VAL D 4 8   ? 25.407  55.039  56.972  1.00 73.44  ? 8   VAL D CG2 1 
ATOM   3253 N N   . VAL D 4 9   ? 27.141  53.019  55.824  1.00 51.69  ? 9   VAL D N   1 
ATOM   3254 C CA  . VAL D 4 9   ? 27.687  52.802  54.480  1.00 50.29  ? 9   VAL D CA  1 
ATOM   3255 C C   . VAL D 4 9   ? 26.712  53.457  53.513  1.00 52.07  ? 9   VAL D C   1 
ATOM   3256 O O   . VAL D 4 9   ? 25.525  53.582  53.813  1.00 56.79  ? 9   VAL D O   1 
ATOM   3257 C CB  . VAL D 4 9   ? 27.830  51.309  54.096  1.00 48.71  ? 9   VAL D CB  1 
ATOM   3258 C CG1 . VAL D 4 9   ? 28.827  50.636  55.008  1.00 59.62  ? 9   VAL D CG1 1 
ATOM   3259 C CG2 . VAL D 4 9   ? 26.494  50.611  54.158  1.00 51.11  ? 9   VAL D CG2 1 
ATOM   3260 N N   . GLN D 4 10  ? 27.213  53.884  52.362  1.00 52.34  ? 10  GLN D N   1 
ATOM   3261 C CA  . GLN D 4 10  ? 26.380  54.541  51.370  1.00 43.65  ? 10  GLN D CA  1 
ATOM   3262 C C   . GLN D 4 10  ? 26.611  53.984  49.960  1.00 48.68  ? 10  GLN D C   1 
ATOM   3263 O O   . GLN D 4 10  ? 27.746  53.798  49.534  1.00 46.93  ? 10  GLN D O   1 
ATOM   3264 C CB  . GLN D 4 10  ? 26.680  56.045  51.343  1.00 42.88  ? 10  GLN D CB  1 
ATOM   3265 C CG  . GLN D 4 10  ? 26.440  56.818  52.632  1.00 40.68  ? 10  GLN D CG  1 
ATOM   3266 C CD  . GLN D 4 10  ? 26.658  58.325  52.450  1.00 50.02  ? 10  GLN D CD  1 
ATOM   3267 O OE1 . GLN D 4 10  ? 26.038  58.956  51.585  1.00 48.54  ? 10  GLN D OE1 1 
ATOM   3268 N NE2 . GLN D 4 10  ? 27.536  58.903  53.263  1.00 41.62  ? 10  GLN D NE2 1 
ATOM   3269 N N   . PHE D 4 11  ? 25.527  53.709  49.247  1.00 46.59  ? 11  PHE D N   1 
ATOM   3270 C CA  . PHE D 4 11  ? 25.612  53.248  47.867  1.00 47.30  ? 11  PHE D CA  1 
ATOM   3271 C C   . PHE D 4 11  ? 24.922  54.364  47.089  1.00 47.80  ? 11  PHE D C   1 
ATOM   3272 O O   . PHE D 4 11  ? 23.773  54.711  47.378  1.00 41.62  ? 11  PHE D O   1 
ATOM   3273 C CB  . PHE D 4 11  ? 24.861  51.922  47.659  1.00 48.29  ? 11  PHE D CB  1 
ATOM   3274 C CG  . PHE D 4 11  ? 24.792  51.485  46.213  1.00 43.89  ? 11  PHE D CG  1 
ATOM   3275 C CD1 . PHE D 4 11  ? 25.956  51.288  45.471  1.00 46.62  ? 11  PHE D CD1 1 
ATOM   3276 C CD2 . PHE D 4 11  ? 23.566  51.292  45.588  1.00 39.63  ? 11  PHE D CD2 1 
ATOM   3277 C CE1 . PHE D 4 11  ? 25.899  50.908  44.124  1.00 41.38  ? 11  PHE D CE1 1 
ATOM   3278 C CE2 . PHE D 4 11  ? 23.499  50.915  44.238  1.00 44.11  ? 11  PHE D CE2 1 
ATOM   3279 C CZ  . PHE D 4 11  ? 24.672  50.723  43.505  1.00 36.14  ? 11  PHE D CZ  1 
ATOM   3280 N N   . GLN D 4 12  ? 25.620  54.941  46.120  1.00 44.03  ? 12  GLN D N   1 
ATOM   3281 C CA  . GLN D 4 12  ? 25.039  56.026  45.351  1.00 43.49  ? 12  GLN D CA  1 
ATOM   3282 C C   . GLN D 4 12  ? 25.156  55.849  43.844  1.00 45.77  ? 12  GLN D C   1 
ATOM   3283 O O   . GLN D 4 12  ? 26.177  56.175  43.249  1.00 50.75  ? 12  GLN D O   1 
ATOM   3284 C CB  . GLN D 4 12  ? 25.680  57.352  45.761  1.00 42.24  ? 12  GLN D CB  1 
ATOM   3285 C CG  . GLN D 4 12  ? 25.248  57.850  47.124  1.00 40.78  ? 12  GLN D CG  1 
ATOM   3286 C CD  . GLN D 4 12  ? 25.751  59.255  47.406  1.00 40.45  ? 12  GLN D CD  1 
ATOM   3287 O OE1 . GLN D 4 12  ? 25.890  60.065  46.489  1.00 41.36  ? 12  GLN D OE1 1 
ATOM   3288 N NE2 . GLN D 4 12  ? 26.012  59.558  48.680  1.00 28.72  ? 12  GLN D NE2 1 
ATOM   3289 N N   . PRO D 4 13  ? 24.107  55.318  43.206  1.00 47.18  ? 13  PRO D N   1 
ATOM   3290 C CA  . PRO D 4 13  ? 24.153  55.127  41.755  1.00 46.47  ? 13  PRO D CA  1 
ATOM   3291 C C   . PRO D 4 13  ? 23.807  56.433  41.026  1.00 46.76  ? 13  PRO D C   1 
ATOM   3292 O O   . PRO D 4 13  ? 22.977  57.213  41.499  1.00 48.29  ? 13  PRO D O   1 
ATOM   3293 C CB  . PRO D 4 13  ? 23.119  54.034  41.530  1.00 41.46  ? 13  PRO D CB  1 
ATOM   3294 C CG  . PRO D 4 13  ? 22.090  54.353  42.573  1.00 46.84  ? 13  PRO D CG  1 
ATOM   3295 C CD  . PRO D 4 13  ? 22.936  54.643  43.792  1.00 41.59  ? 13  PRO D CD  1 
ATOM   3296 N N   . PHE D 4 14  ? 24.444  56.671  39.883  1.00 39.29  ? 14  PHE D N   1 
ATOM   3297 C CA  . PHE D 4 14  ? 24.188  57.890  39.127  1.00 42.09  ? 14  PHE D CA  1 
ATOM   3298 C C   . PHE D 4 14  ? 24.045  57.670  37.630  1.00 44.47  ? 14  PHE D C   1 
ATOM   3299 O O   . PHE D 4 14  ? 24.916  57.087  36.987  1.00 51.12  ? 14  PHE D O   1 
ATOM   3300 C CB  . PHE D 4 14  ? 25.305  58.917  39.367  1.00 35.67  ? 14  PHE D CB  1 
ATOM   3301 C CG  . PHE D 4 14  ? 25.258  59.560  40.719  1.00 31.53  ? 14  PHE D CG  1 
ATOM   3302 C CD1 . PHE D 4 14  ? 24.414  60.636  40.961  1.00 30.55  ? 14  PHE D CD1 1 
ATOM   3303 C CD2 . PHE D 4 14  ? 26.037  59.070  41.765  1.00 31.52  ? 14  PHE D CD2 1 
ATOM   3304 C CE1 . PHE D 4 14  ? 24.347  61.217  42.228  1.00 37.66  ? 14  PHE D CE1 1 
ATOM   3305 C CE2 . PHE D 4 14  ? 25.976  59.643  43.036  1.00 32.35  ? 14  PHE D CE2 1 
ATOM   3306 C CZ  . PHE D 4 14  ? 25.128  60.718  43.269  1.00 27.11  ? 14  PHE D CZ  1 
ATOM   3307 N N   . CYS D 4 15  ? 22.930  58.138  37.086  1.00 43.55  ? 15  CYS D N   1 
ATOM   3308 C CA  . CYS D 4 15  ? 22.677  58.048  35.658  1.00 47.98  ? 15  CYS D CA  1 
ATOM   3309 C C   . CYS D 4 15  ? 22.687  59.487  35.143  1.00 46.53  ? 15  CYS D C   1 
ATOM   3310 O O   . CYS D 4 15  ? 21.679  60.187  35.230  1.00 50.32  ? 15  CYS D O   1 
ATOM   3311 C CB  . CYS D 4 15  ? 21.307  57.418  35.355  1.00 39.26  ? 15  CYS D CB  1 
ATOM   3312 S SG  . CYS D 4 15  ? 21.075  55.632  35.671  1.00 56.04  ? 15  CYS D SG  1 
ATOM   3313 N N   . TYR D 4 16  ? 23.836  59.925  34.633  1.00 47.38  ? 16  TYR D N   1 
ATOM   3314 C CA  . TYR D 4 16  ? 23.995  61.269  34.079  1.00 45.38  ? 16  TYR D CA  1 
ATOM   3315 C C   . TYR D 4 16  ? 23.541  61.270  32.615  1.00 48.11  ? 16  TYR D C   1 
ATOM   3316 O O   . TYR D 4 16  ? 24.144  60.602  31.777  1.00 50.96  ? 16  TYR D O   1 
ATOM   3317 C CB  . TYR D 4 16  ? 25.458  61.684  34.159  1.00 43.24  ? 16  TYR D CB  1 
ATOM   3318 C CG  . TYR D 4 16  ? 26.003  61.747  35.570  1.00 47.50  ? 16  TYR D CG  1 
ATOM   3319 C CD1 . TYR D 4 16  ? 25.615  62.762  36.446  1.00 40.66  ? 16  TYR D CD1 1 
ATOM   3320 C CD2 . TYR D 4 16  ? 26.924  60.803  36.021  1.00 47.22  ? 16  TYR D CD2 1 
ATOM   3321 C CE1 . TYR D 4 16  ? 26.136  62.837  37.739  1.00 45.01  ? 16  TYR D CE1 1 
ATOM   3322 C CE2 . TYR D 4 16  ? 27.451  60.869  37.315  1.00 51.45  ? 16  TYR D CE2 1 
ATOM   3323 C CZ  . TYR D 4 16  ? 27.054  61.888  38.170  1.00 53.66  ? 16  TYR D CZ  1 
ATOM   3324 O OH  . TYR D 4 16  ? 27.571  61.951  39.452  1.00 57.05  ? 16  TYR D OH  1 
ATOM   3325 N N   . PHE D 4 17  ? 22.479  62.015  32.311  1.00 49.81  ? 17  PHE D N   1 
ATOM   3326 C CA  . PHE D 4 17  ? 21.949  62.083  30.952  1.00 54.05  ? 17  PHE D CA  1 
ATOM   3327 C C   . PHE D 4 17  ? 22.271  63.394  30.260  1.00 54.77  ? 17  PHE D C   1 
ATOM   3328 O O   . PHE D 4 17  ? 22.076  64.464  30.830  1.00 57.78  ? 17  PHE D O   1 
ATOM   3329 C CB  . PHE D 4 17  ? 20.434  61.923  30.970  1.00 51.49  ? 17  PHE D CB  1 
ATOM   3330 C CG  . PHE D 4 17  ? 19.976  60.635  31.545  1.00 56.01  ? 17  PHE D CG  1 
ATOM   3331 C CD1 . PHE D 4 17  ? 19.761  59.535  30.728  1.00 49.99  ? 17  PHE D CD1 1 
ATOM   3332 C CD2 . PHE D 4 17  ? 19.772  60.510  32.915  1.00 53.72  ? 17  PHE D CD2 1 
ATOM   3333 C CE1 . PHE D 4 17  ? 19.347  58.325  31.265  1.00 50.38  ? 17  PHE D CE1 1 
ATOM   3334 C CE2 . PHE D 4 17  ? 19.360  59.308  33.459  1.00 47.80  ? 17  PHE D CE2 1 
ATOM   3335 C CZ  . PHE D 4 17  ? 19.146  58.211  32.631  1.00 50.29  ? 17  PHE D CZ  1 
ATOM   3336 N N   . THR D 4 18  ? 22.751  63.307  29.025  1.00 57.61  ? 18  THR D N   1 
ATOM   3337 C CA  . THR D 4 18  ? 23.061  64.499  28.249  1.00 57.51  ? 18  THR D CA  1 
ATOM   3338 C C   . THR D 4 18  ? 22.309  64.411  26.921  1.00 61.08  ? 18  THR D C   1 
ATOM   3339 O O   . THR D 4 18  ? 22.463  63.437  26.179  1.00 63.76  ? 18  THR D O   1 
ATOM   3340 C CB  . THR D 4 18  ? 24.571  64.618  27.995  1.00 57.82  ? 18  THR D CB  1 
ATOM   3341 O OG1 . THR D 4 18  ? 25.260  64.741  29.250  1.00 62.85  ? 18  THR D OG1 1 
ATOM   3342 C CG2 . THR D 4 18  ? 24.864  65.837  27.140  1.00 50.43  ? 18  THR D CG2 1 
ATOM   3343 N N   . ASN D 4 19  ? 21.485  65.418  26.638  1.00 59.61  ? 19  ASN D N   1 
ATOM   3344 C CA  . ASN D 4 19  ? 20.694  65.448  25.412  1.00 64.72  ? 19  ASN D CA  1 
ATOM   3345 C C   . ASN D 4 19  ? 19.886  64.155  25.331  1.00 68.09  ? 19  ASN D C   1 
ATOM   3346 O O   . ASN D 4 19  ? 20.208  63.262  24.544  1.00 71.02  ? 19  ASN D O   1 
ATOM   3347 C CB  . ASN D 4 19  ? 21.613  65.564  24.188  1.00 69.95  ? 19  ASN D CB  1 
ATOM   3348 C CG  . ASN D 4 19  ? 20.843  65.670  22.876  1.00 77.22  ? 19  ASN D CG  1 
ATOM   3349 O OD1 . ASN D 4 19  ? 19.660  65.327  22.803  1.00 81.21  ? 19  ASN D OD1 1 
ATOM   3350 N ND2 . ASN D 4 19  ? 21.521  66.134  21.826  1.00 84.16  ? 19  ASN D ND2 1 
ATOM   3351 N N   . GLY D 4 20  ? 18.831  64.059  26.137  1.00 71.02  ? 20  GLY D N   1 
ATOM   3352 C CA  . GLY D 4 20  ? 18.019  62.851  26.141  1.00 68.03  ? 20  GLY D CA  1 
ATOM   3353 C C   . GLY D 4 20  ? 18.925  61.694  26.513  1.00 66.60  ? 20  GLY D C   1 
ATOM   3354 O O   . GLY D 4 20  ? 19.607  61.742  27.538  1.00 61.83  ? 20  GLY D O   1 
ATOM   3355 N N   . THR D 4 21  ? 18.951  60.657  25.682  1.00 66.67  ? 21  THR D N   1 
ATOM   3356 C CA  . THR D 4 21  ? 19.824  59.521  25.951  1.00 66.87  ? 21  THR D CA  1 
ATOM   3357 C C   . THR D 4 21  ? 20.995  59.432  24.957  1.00 67.73  ? 21  THR D C   1 
ATOM   3358 O O   . THR D 4 21  ? 21.708  58.423  24.917  1.00 63.25  ? 21  THR D O   1 
ATOM   3359 C CB  . THR D 4 21  ? 19.031  58.194  25.955  1.00 62.45  ? 21  THR D CB  1 
ATOM   3360 O OG1 . THR D 4 21  ? 18.216  58.105  24.780  1.00 55.56  ? 21  THR D OG1 1 
ATOM   3361 C CG2 . THR D 4 21  ? 18.149  58.123  27.184  1.00 61.92  ? 21  THR D CG2 1 
ATOM   3362 N N   . GLN D 4 22  ? 21.202  60.497  24.176  1.00 65.81  ? 22  GLN D N   1 
ATOM   3363 C CA  . GLN D 4 22  ? 22.290  60.522  23.201  1.00 66.88  ? 22  GLN D CA  1 
ATOM   3364 C C   . GLN D 4 22  ? 23.603  60.222  23.883  1.00 64.39  ? 22  GLN D C   1 
ATOM   3365 O O   . GLN D 4 22  ? 24.522  59.686  23.274  1.00 64.14  ? 22  GLN D O   1 
ATOM   3366 C CB  . GLN D 4 22  ? 22.392  61.878  22.496  1.00 74.50  ? 22  GLN D CB  1 
ATOM   3367 C CG  . GLN D 4 22  ? 21.381  62.080  21.372  1.00 85.85  ? 22  GLN D CG  1 
ATOM   3368 C CD  . GLN D 4 22  ? 21.909  62.972  20.254  1.00 89.85  ? 22  GLN D CD  1 
ATOM   3369 O OE1 . GLN D 4 22  ? 22.380  64.089  20.495  1.00 92.32  ? 22  GLN D OE1 1 
ATOM   3370 N NE2 . GLN D 4 22  ? 21.825  62.481  19.021  1.00 89.50  ? 22  GLN D NE2 1 
ATOM   3371 N N   . ARG D 4 23  ? 23.700  60.581  25.153  1.00 63.27  ? 23  ARG D N   1 
ATOM   3372 C CA  . ARG D 4 23  ? 24.913  60.303  25.895  1.00 61.51  ? 23  ARG D CA  1 
ATOM   3373 C C   . ARG D 4 23  ? 24.597  60.028  27.354  1.00 55.26  ? 23  ARG D C   1 
ATOM   3374 O O   . ARG D 4 23  ? 23.980  60.843  28.045  1.00 57.18  ? 23  ARG D O   1 
ATOM   3375 C CB  . ARG D 4 23  ? 25.902  61.465  25.789  1.00 66.32  ? 23  ARG D CB  1 
ATOM   3376 C CG  . ARG D 4 23  ? 27.228  61.187  26.483  1.00 73.99  ? 23  ARG D CG  1 
ATOM   3377 C CD  . ARG D 4 23  ? 27.904  62.472  26.916  1.00 84.44  ? 23  ARG D CD  1 
ATOM   3378 N NE  . ARG D 4 23  ? 28.640  62.286  28.163  1.00 91.81  ? 23  ARG D NE  1 
ATOM   3379 C CZ  . ARG D 4 23  ? 28.968  63.275  28.990  1.00 98.26  ? 23  ARG D CZ  1 
ATOM   3380 N NH1 . ARG D 4 23  ? 28.628  64.526  28.698  1.00 96.10  ? 23  ARG D NH1 1 
ATOM   3381 N NH2 . ARG D 4 23  ? 29.617  63.010  30.119  1.00 100.37 ? 23  ARG D NH2 1 
ATOM   3382 N N   . ILE D 4 24  ? 25.024  58.865  27.814  1.00 48.86  ? 24  ILE D N   1 
ATOM   3383 C CA  . ILE D 4 24  ? 24.808  58.479  29.188  1.00 49.50  ? 24  ILE D CA  1 
ATOM   3384 C C   . ILE D 4 24  ? 26.136  58.135  29.828  1.00 50.97  ? 24  ILE D C   1 
ATOM   3385 O O   . ILE D 4 24  ? 27.033  57.608  29.178  1.00 53.57  ? 24  ILE D O   1 
ATOM   3386 C CB  . ILE D 4 24  ? 23.911  57.229  29.308  1.00 48.84  ? 24  ILE D CB  1 
ATOM   3387 C CG1 . ILE D 4 24  ? 22.540  57.484  28.689  1.00 45.08  ? 24  ILE D CG1 1 
ATOM   3388 C CG2 . ILE D 4 24  ? 23.748  56.858  30.768  1.00 48.40  ? 24  ILE D CG2 1 
ATOM   3389 C CD1 . ILE D 4 24  ? 21.599  56.314  28.856  1.00 44.78  ? 24  ILE D CD1 1 
ATOM   3390 N N   . ARG D 4 25  ? 26.254  58.459  31.108  1.00 53.34  ? 25  ARG D N   1 
ATOM   3391 C CA  . ARG D 4 25  ? 27.438  58.140  31.876  1.00 47.59  ? 25  ARG D CA  1 
ATOM   3392 C C   . ARG D 4 25  ? 26.872  57.501  33.129  1.00 50.58  ? 25  ARG D C   1 
ATOM   3393 O O   . ARG D 4 25  ? 26.020  58.089  33.794  1.00 55.21  ? 25  ARG D O   1 
ATOM   3394 C CB  . ARG D 4 25  ? 28.234  59.396  32.233  1.00 45.71  ? 25  ARG D CB  1 
ATOM   3395 C CG  . ARG D 4 25  ? 29.392  59.094  33.164  1.00 49.03  ? 25  ARG D CG  1 
ATOM   3396 C CD  . ARG D 4 25  ? 30.431  60.192  33.175  1.00 56.61  ? 25  ARG D CD  1 
ATOM   3397 N NE  . ARG D 4 25  ? 31.552  59.857  34.048  1.00 63.86  ? 25  ARG D NE  1 
ATOM   3398 C CZ  . ARG D 4 25  ? 32.634  60.615  34.194  1.00 73.35  ? 25  ARG D CZ  1 
ATOM   3399 N NH1 . ARG D 4 25  ? 32.731  61.751  33.515  1.00 78.73  ? 25  ARG D NH1 1 
ATOM   3400 N NH2 . ARG D 4 25  ? 33.614  60.243  35.013  1.00 56.59  ? 25  ARG D NH2 1 
ATOM   3401 N N   . TYR D 4 26  ? 27.324  56.290  33.436  1.00 48.70  ? 26  TYR D N   1 
ATOM   3402 C CA  . TYR D 4 26  ? 26.846  55.568  34.610  1.00 44.09  ? 26  TYR D CA  1 
ATOM   3403 C C   . TYR D 4 26  ? 27.918  55.520  35.687  1.00 43.90  ? 26  TYR D C   1 
ATOM   3404 O O   . TYR D 4 26  ? 29.015  55.020  35.465  1.00 48.15  ? 26  TYR D O   1 
ATOM   3405 C CB  . TYR D 4 26  ? 26.429  54.151  34.208  1.00 47.47  ? 26  TYR D CB  1 
ATOM   3406 C CG  . TYR D 4 26  ? 25.826  53.310  35.317  1.00 56.99  ? 26  TYR D CG  1 
ATOM   3407 C CD1 . TYR D 4 26  ? 24.901  53.849  36.213  1.00 50.94  ? 26  TYR D CD1 1 
ATOM   3408 C CD2 . TYR D 4 26  ? 26.146  51.954  35.437  1.00 55.04  ? 26  TYR D CD2 1 
ATOM   3409 C CE1 . TYR D 4 26  ? 24.311  53.058  37.196  1.00 56.02  ? 26  TYR D CE1 1 
ATOM   3410 C CE2 . TYR D 4 26  ? 25.561  51.156  36.414  1.00 58.23  ? 26  TYR D CE2 1 
ATOM   3411 C CZ  . TYR D 4 26  ? 24.644  51.711  37.288  1.00 61.70  ? 26  TYR D CZ  1 
ATOM   3412 O OH  . TYR D 4 26  ? 24.046  50.912  38.236  1.00 61.69  ? 26  TYR D OH  1 
ATOM   3413 N N   . VAL D 4 27  ? 27.605  56.053  36.857  1.00 41.68  ? 27  VAL D N   1 
ATOM   3414 C CA  . VAL D 4 27  ? 28.565  56.051  37.941  1.00 44.77  ? 27  VAL D CA  1 
ATOM   3415 C C   . VAL D 4 27  ? 27.974  55.437  39.194  1.00 46.79  ? 27  VAL D C   1 
ATOM   3416 O O   . VAL D 4 27  ? 26.900  55.829  39.639  1.00 45.09  ? 27  VAL D O   1 
ATOM   3417 C CB  . VAL D 4 27  ? 29.033  57.473  38.273  1.00 50.46  ? 27  VAL D CB  1 
ATOM   3418 C CG1 . VAL D 4 27  ? 29.944  57.445  39.501  1.00 42.62  ? 27  VAL D CG1 1 
ATOM   3419 C CG2 . VAL D 4 27  ? 29.757  58.074  37.069  1.00 53.79  ? 27  VAL D CG2 1 
ATOM   3420 N N   . THR D 4 28  ? 28.697  54.478  39.759  1.00 41.69  ? 28  THR D N   1 
ATOM   3421 C CA  . THR D 4 28  ? 28.277  53.790  40.966  1.00 49.19  ? 28  THR D CA  1 
ATOM   3422 C C   . THR D 4 28  ? 29.296  54.052  42.074  1.00 47.78  ? 28  THR D C   1 
ATOM   3423 O O   . THR D 4 28  ? 30.428  53.589  41.997  1.00 51.42  ? 28  THR D O   1 
ATOM   3424 C CB  . THR D 4 28  ? 28.186  52.283  40.707  1.00 55.05  ? 28  THR D CB  1 
ATOM   3425 O OG1 . THR D 4 28  ? 27.108  52.011  39.800  1.00 66.78  ? 28  THR D OG1 1 
ATOM   3426 C CG2 . THR D 4 28  ? 27.955  51.556  41.985  1.00 58.52  ? 28  THR D CG2 1 
ATOM   3427 N N   . ARG D 4 29  ? 28.900  54.782  43.110  1.00 46.23  ? 29  ARG D N   1 
ATOM   3428 C CA  . ARG D 4 29  ? 29.833  55.092  44.189  1.00 45.94  ? 29  ARG D CA  1 
ATOM   3429 C C   . ARG D 4 29  ? 29.622  54.255  45.443  1.00 44.69  ? 29  ARG D C   1 
ATOM   3430 O O   . ARG D 4 29  ? 28.495  54.093  45.904  1.00 47.10  ? 29  ARG D O   1 
ATOM   3431 C CB  . ARG D 4 29  ? 29.737  56.576  44.557  1.00 40.58  ? 29  ARG D CB  1 
ATOM   3432 C CG  . ARG D 4 29  ? 29.758  57.525  43.373  1.00 40.92  ? 29  ARG D CG  1 
ATOM   3433 C CD  . ARG D 4 29  ? 29.696  58.967  43.861  1.00 54.43  ? 29  ARG D CD  1 
ATOM   3434 N NE  . ARG D 4 29  ? 29.530  59.934  42.779  1.00 55.19  ? 29  ARG D NE  1 
ATOM   3435 C CZ  . ARG D 4 29  ? 30.495  60.304  41.944  1.00 55.55  ? 29  ARG D CZ  1 
ATOM   3436 N NH1 . ARG D 4 29  ? 31.711  59.784  42.063  1.00 45.45  ? 29  ARG D NH1 1 
ATOM   3437 N NH2 . ARG D 4 29  ? 30.246  61.202  40.996  1.00 50.32  ? 29  ARG D NH2 1 
ATOM   3438 N N   . TYR D 4 30  ? 30.716  53.733  45.992  1.00 46.17  ? 30  TYR D N   1 
ATOM   3439 C CA  . TYR D 4 30  ? 30.673  52.924  47.213  1.00 46.89  ? 30  TYR D CA  1 
ATOM   3440 C C   . TYR D 4 30  ? 31.348  53.688  48.345  1.00 49.20  ? 30  TYR D C   1 
ATOM   3441 O O   . TYR D 4 30  ? 32.572  53.807  48.390  1.00 57.76  ? 30  TYR D O   1 
ATOM   3442 C CB  . TYR D 4 30  ? 31.395  51.587  47.012  1.00 38.08  ? 30  TYR D CB  1 
ATOM   3443 C CG  . TYR D 4 30  ? 30.641  50.617  46.150  1.00 44.40  ? 30  TYR D CG  1 
ATOM   3444 C CD1 . TYR D 4 30  ? 30.496  50.842  44.778  1.00 38.54  ? 30  TYR D CD1 1 
ATOM   3445 C CD2 . TYR D 4 30  ? 29.996  49.513  46.715  1.00 34.32  ? 30  TYR D CD2 1 
ATOM   3446 C CE1 . TYR D 4 30  ? 29.721  50.000  43.995  1.00 35.10  ? 30  TYR D CE1 1 
ATOM   3447 C CE2 . TYR D 4 30  ? 29.215  48.668  45.938  1.00 37.76  ? 30  TYR D CE2 1 
ATOM   3448 C CZ  . TYR D 4 30  ? 29.077  48.919  44.578  1.00 41.27  ? 30  TYR D CZ  1 
ATOM   3449 O OH  . TYR D 4 30  ? 28.278  48.107  43.807  1.00 39.56  ? 30  TYR D OH  1 
ATOM   3450 N N   . ILE D 4 31  ? 30.548  54.202  49.264  1.00 51.44  ? 31  ILE D N   1 
ATOM   3451 C CA  . ILE D 4 31  ? 31.077  54.967  50.379  1.00 49.11  ? 31  ILE D CA  1 
ATOM   3452 C C   . ILE D 4 31  ? 31.079  54.156  51.667  1.00 51.92  ? 31  ILE D C   1 
ATOM   3453 O O   . ILE D 4 31  ? 30.183  53.342  51.885  1.00 46.86  ? 31  ILE D O   1 
ATOM   3454 C CB  . ILE D 4 31  ? 30.238  56.248  50.592  1.00 45.50  ? 31  ILE D CB  1 
ATOM   3455 C CG1 . ILE D 4 31  ? 30.508  57.245  49.457  1.00 48.90  ? 31  ILE D CG1 1 
ATOM   3456 C CG2 . ILE D 4 31  ? 30.545  56.868  51.956  1.00 43.86  ? 31  ILE D CG2 1 
ATOM   3457 C CD1 . ILE D 4 31  ? 29.910  56.859  48.115  1.00 52.22  ? 31  ILE D CD1 1 
ATOM   3458 N N   . TYR D 4 32  ? 32.089  54.357  52.515  1.00 58.71  ? 32  TYR D N   1 
ATOM   3459 C CA  . TYR D 4 32  ? 32.104  53.642  53.783  1.00 59.11  ? 32  TYR D CA  1 
ATOM   3460 C C   . TYR D 4 32  ? 31.385  54.511  54.793  1.00 62.22  ? 32  TYR D C   1 
ATOM   3461 O O   . TYR D 4 32  ? 30.217  54.274  55.057  1.00 74.95  ? 32  TYR D O   1 
ATOM   3462 C CB  . TYR D 4 32  ? 33.516  53.306  54.269  1.00 57.26  ? 32  TYR D CB  1 
ATOM   3463 C CG  . TYR D 4 32  ? 33.515  52.799  55.699  1.00 57.88  ? 32  TYR D CG  1 
ATOM   3464 C CD1 . TYR D 4 32  ? 32.575  51.861  56.130  1.00 52.18  ? 32  TYR D CD1 1 
ATOM   3465 C CD2 . TYR D 4 32  ? 34.389  53.330  56.645  1.00 56.64  ? 32  TYR D CD2 1 
ATOM   3466 C CE1 . TYR D 4 32  ? 32.499  51.483  57.469  1.00 58.98  ? 32  TYR D CE1 1 
ATOM   3467 C CE2 . TYR D 4 32  ? 34.324  52.955  57.978  1.00 51.47  ? 32  TYR D CE2 1 
ATOM   3468 C CZ  . TYR D 4 32  ? 33.379  52.040  58.390  1.00 58.55  ? 32  TYR D CZ  1 
ATOM   3469 O OH  . TYR D 4 32  ? 33.307  51.710  59.731  1.00 61.27  ? 32  TYR D OH  1 
ATOM   3470 N N   . ASN D 4 33  ? 32.038  55.515  55.364  1.00 61.54  ? 33  ASN D N   1 
ATOM   3471 C CA  . ASN D 4 33  ? 31.309  56.364  56.304  1.00 65.53  ? 33  ASN D CA  1 
ATOM   3472 C C   . ASN D 4 33  ? 30.864  57.600  55.558  1.00 67.43  ? 33  ASN D C   1 
ATOM   3473 O O   . ASN D 4 33  ? 29.677  57.918  55.488  1.00 65.42  ? 33  ASN D O   1 
ATOM   3474 C CB  . ASN D 4 33  ? 32.177  56.786  57.485  1.00 70.00  ? 33  ASN D CB  1 
ATOM   3475 C CG  . ASN D 4 33  ? 32.098  55.817  58.633  1.00 75.66  ? 33  ASN D CG  1 
ATOM   3476 O OD1 . ASN D 4 33  ? 31.015  55.369  59.007  1.00 78.11  ? 33  ASN D OD1 1 
ATOM   3477 N ND2 . ASN D 4 33  ? 33.244  55.493  59.213  1.00 82.26  ? 33  ASN D ND2 1 
ATOM   3478 N N   . ARG D 4 34  ? 31.852  58.282  54.997  1.00 68.40  ? 34  ARG D N   1 
ATOM   3479 C CA  . ARG D 4 34  ? 31.661  59.498  54.227  1.00 65.70  ? 34  ARG D CA  1 
ATOM   3480 C C   . ARG D 4 34  ? 32.780  59.458  53.189  1.00 62.59  ? 34  ARG D C   1 
ATOM   3481 O O   . ARG D 4 34  ? 32.932  60.364  52.368  1.00 65.50  ? 34  ARG D O   1 
ATOM   3482 C CB  . ARG D 4 34  ? 31.797  60.721  55.150  1.00 66.79  ? 34  ARG D CB  1 
ATOM   3483 C CG  . ARG D 4 34  ? 32.499  61.901  54.516  1.00 72.58  ? 34  ARG D CG  1 
ATOM   3484 C CD  . ARG D 4 34  ? 31.588  63.084  54.300  1.00 67.53  ? 34  ARG D CD  1 
ATOM   3485 N NE  . ARG D 4 34  ? 31.546  63.933  55.480  1.00 59.47  ? 34  ARG D NE  1 
ATOM   3486 C CZ  . ARG D 4 34  ? 31.199  65.213  55.457  1.00 55.19  ? 34  ARG D CZ  1 
ATOM   3487 N NH1 . ARG D 4 34  ? 30.864  65.789  54.310  1.00 51.69  ? 34  ARG D NH1 1 
ATOM   3488 N NH2 . ARG D 4 34  ? 31.198  65.917  56.580  1.00 54.27  ? 34  ARG D NH2 1 
ATOM   3489 N N   . GLU D 4 35  ? 33.543  58.368  53.231  1.00 63.20  ? 35  GLU D N   1 
ATOM   3490 C CA  . GLU D 4 35  ? 34.673  58.154  52.333  1.00 59.79  ? 35  GLU D CA  1 
ATOM   3491 C C   . GLU D 4 35  ? 34.326  57.256  51.146  1.00 57.53  ? 35  GLU D C   1 
ATOM   3492 O O   . GLU D 4 35  ? 33.883  56.121  51.331  1.00 54.36  ? 35  GLU D O   1 
ATOM   3493 C CB  . GLU D 4 35  ? 35.821  57.520  53.118  1.00 66.00  ? 35  GLU D CB  1 
ATOM   3494 C CG  . GLU D 4 35  ? 37.132  57.400  52.352  1.00 74.17  ? 35  GLU D CG  1 
ATOM   3495 C CD  . GLU D 4 35  ? 38.066  56.364  52.959  1.00 78.49  ? 35  GLU D CD  1 
ATOM   3496 O OE1 . GLU D 4 35  ? 38.272  56.386  54.195  1.00 77.09  ? 35  GLU D OE1 1 
ATOM   3497 O OE2 . GLU D 4 35  ? 38.595  55.528  52.191  1.00 76.25  ? 35  GLU D OE2 1 
ATOM   3498 N N   . GLU D 4 36  ? 34.521  57.761  49.932  1.00 53.70  ? 36  GLU D N   1 
ATOM   3499 C CA  . GLU D 4 36  ? 34.248  56.966  48.739  1.00 54.52  ? 36  GLU D CA  1 
ATOM   3500 C C   . GLU D 4 36  ? 35.448  56.053  48.493  1.00 60.06  ? 36  GLU D C   1 
ATOM   3501 O O   . GLU D 4 36  ? 36.506  56.530  48.089  1.00 62.30  ? 36  GLU D O   1 
ATOM   3502 C CB  . GLU D 4 36  ? 34.057  57.866  47.526  1.00 46.39  ? 36  GLU D CB  1 
ATOM   3503 C CG  . GLU D 4 36  ? 34.010  57.081  46.228  1.00 52.26  ? 36  GLU D CG  1 
ATOM   3504 C CD  . GLU D 4 36  ? 33.764  57.952  45.013  1.00 55.43  ? 36  GLU D CD  1 
ATOM   3505 O OE1 . GLU D 4 36  ? 34.421  59.007  44.894  1.00 56.28  ? 36  GLU D OE1 1 
ATOM   3506 O OE2 . GLU D 4 36  ? 32.923  57.574  44.172  1.00 51.10  ? 36  GLU D OE2 1 
ATOM   3507 N N   . TYR D 4 37  ? 35.291  54.749  48.721  1.00 59.40  ? 37  TYR D N   1 
ATOM   3508 C CA  . TYR D 4 37  ? 36.408  53.822  48.545  1.00 61.31  ? 37  TYR D CA  1 
ATOM   3509 C C   . TYR D 4 37  ? 36.434  53.034  47.234  1.00 61.34  ? 37  TYR D C   1 
ATOM   3510 O O   . TYR D 4 37  ? 37.504  52.670  46.747  1.00 61.75  ? 37  TYR D O   1 
ATOM   3511 C CB  . TYR D 4 37  ? 36.478  52.856  49.738  1.00 63.05  ? 37  TYR D CB  1 
ATOM   3512 C CG  . TYR D 4 37  ? 35.288  51.933  49.874  1.00 67.74  ? 37  TYR D CG  1 
ATOM   3513 C CD1 . TYR D 4 37  ? 35.084  50.893  48.967  1.00 65.77  ? 37  TYR D CD1 1 
ATOM   3514 C CD2 . TYR D 4 37  ? 34.357  52.103  50.905  1.00 67.76  ? 37  TYR D CD2 1 
ATOM   3515 C CE1 . TYR D 4 37  ? 33.987  50.044  49.074  1.00 67.89  ? 37  TYR D CE1 1 
ATOM   3516 C CE2 . TYR D 4 37  ? 33.251  51.258  51.022  1.00 69.14  ? 37  TYR D CE2 1 
ATOM   3517 C CZ  . TYR D 4 37  ? 33.072  50.229  50.100  1.00 68.39  ? 37  TYR D CZ  1 
ATOM   3518 O OH  . TYR D 4 37  ? 31.983  49.388  50.182  1.00 63.00  ? 37  TYR D OH  1 
ATOM   3519 N N   . LEU D 4 38  ? 35.268  52.761  46.664  1.00 61.73  ? 38  LEU D N   1 
ATOM   3520 C CA  . LEU D 4 38  ? 35.206  52.023  45.407  1.00 58.19  ? 38  LEU D CA  1 
ATOM   3521 C C   . LEU D 4 38  ? 34.279  52.731  44.433  1.00 57.05  ? 38  LEU D C   1 
ATOM   3522 O O   . LEU D 4 38  ? 33.307  53.359  44.841  1.00 62.50  ? 38  LEU D O   1 
ATOM   3523 C CB  . LEU D 4 38  ? 34.718  50.599  45.660  1.00 60.43  ? 38  LEU D CB  1 
ATOM   3524 C CG  . LEU D 4 38  ? 34.543  49.686  44.444  1.00 65.10  ? 38  LEU D CG  1 
ATOM   3525 C CD1 . LEU D 4 38  ? 35.850  49.568  43.662  1.00 61.20  ? 38  LEU D CD1 1 
ATOM   3526 C CD2 . LEU D 4 38  ? 34.079  48.319  44.932  1.00 60.39  ? 38  LEU D CD2 1 
ATOM   3527 N N   . ARG D 4 39  ? 34.572  52.635  43.143  1.00 58.29  ? 39  ARG D N   1 
ATOM   3528 C CA  . ARG D 4 39  ? 33.737  53.308  42.163  1.00 55.58  ? 39  ARG D CA  1 
ATOM   3529 C C   . ARG D 4 39  ? 33.712  52.688  40.783  1.00 54.09  ? 39  ARG D C   1 
ATOM   3530 O O   . ARG D 4 39  ? 34.748  52.316  40.241  1.00 61.33  ? 39  ARG D O   1 
ATOM   3531 C CB  . ARG D 4 39  ? 34.179  54.768  42.013  1.00 59.31  ? 39  ARG D CB  1 
ATOM   3532 C CG  . ARG D 4 39  ? 33.470  55.511  40.880  1.00 56.65  ? 39  ARG D CG  1 
ATOM   3533 C CD  . ARG D 4 39  ? 34.243  56.735  40.448  1.00 54.66  ? 39  ARG D CD  1 
ATOM   3534 N NE  . ARG D 4 39  ? 34.473  57.649  41.559  1.00 60.48  ? 39  ARG D NE  1 
ATOM   3535 C CZ  . ARG D 4 39  ? 35.415  58.587  41.566  1.00 59.59  ? 39  ARG D CZ  1 
ATOM   3536 N NH1 . ARG D 4 39  ? 36.215  58.730  40.519  1.00 57.84  ? 39  ARG D NH1 1 
ATOM   3537 N NH2 . ARG D 4 39  ? 35.561  59.377  42.618  1.00 50.64  ? 39  ARG D NH2 1 
ATOM   3538 N N   . PHE D 4 40  ? 32.518  52.577  40.214  1.00 51.43  ? 40  PHE D N   1 
ATOM   3539 C CA  . PHE D 4 40  ? 32.399  52.080  38.858  1.00 55.52  ? 40  PHE D CA  1 
ATOM   3540 C C   . PHE D 4 40  ? 32.103  53.326  38.046  1.00 60.90  ? 40  PHE D C   1 
ATOM   3541 O O   . PHE D 4 40  ? 31.323  54.178  38.476  1.00 66.13  ? 40  PHE D O   1 
ATOM   3542 C CB  . PHE D 4 40  ? 31.241  51.106  38.675  1.00 56.59  ? 40  PHE D CB  1 
ATOM   3543 C CG  . PHE D 4 40  ? 30.974  50.784  37.230  1.00 53.52  ? 40  PHE D CG  1 
ATOM   3544 C CD1 . PHE D 4 40  ? 31.713  49.807  36.570  1.00 54.05  ? 40  PHE D CD1 1 
ATOM   3545 C CD2 . PHE D 4 40  ? 30.044  51.525  36.501  1.00 47.30  ? 40  PHE D CD2 1 
ATOM   3546 C CE1 . PHE D 4 40  ? 31.533  49.578  35.204  1.00 53.51  ? 40  PHE D CE1 1 
ATOM   3547 C CE2 . PHE D 4 40  ? 29.857  51.306  35.144  1.00 46.66  ? 40  PHE D CE2 1 
ATOM   3548 C CZ  . PHE D 4 40  ? 30.600  50.334  34.491  1.00 53.66  ? 40  PHE D CZ  1 
ATOM   3549 N N   . ASP D 4 41  ? 32.713  53.425  36.871  1.00 63.55  ? 41  ASP D N   1 
ATOM   3550 C CA  . ASP D 4 41  ? 32.525  54.579  36.006  1.00 58.78  ? 41  ASP D CA  1 
ATOM   3551 C C   . ASP D 4 41  ? 32.487  54.109  34.557  1.00 57.05  ? 41  ASP D C   1 
ATOM   3552 O O   . ASP D 4 41  ? 33.494  53.639  34.030  1.00 56.17  ? 41  ASP D O   1 
ATOM   3553 C CB  . ASP D 4 41  ? 33.685  55.551  36.206  1.00 58.57  ? 41  ASP D CB  1 
ATOM   3554 C CG  . ASP D 4 41  ? 33.423  56.905  35.594  1.00 57.64  ? 41  ASP D CG  1 
ATOM   3555 O OD1 . ASP D 4 41  ? 32.716  56.975  34.567  1.00 59.06  ? 41  ASP D OD1 1 
ATOM   3556 O OD2 . ASP D 4 41  ? 33.942  57.900  36.137  1.00 63.88  ? 41  ASP D OD2 1 
ATOM   3557 N N   . SER D 4 42  ? 31.333  54.240  33.913  1.00 54.68  ? 42  SER D N   1 
ATOM   3558 C CA  . SER D 4 42  ? 31.189  53.805  32.529  1.00 56.98  ? 42  SER D CA  1 
ATOM   3559 C C   . SER D 4 42  ? 32.249  54.430  31.612  1.00 63.34  ? 42  SER D C   1 
ATOM   3560 O O   . SER D 4 42  ? 32.664  53.817  30.626  1.00 63.93  ? 42  SER D O   1 
ATOM   3561 C CB  . SER D 4 42  ? 29.788  54.130  32.017  1.00 46.35  ? 42  SER D CB  1 
ATOM   3562 O OG  . SER D 4 42  ? 29.622  55.522  31.845  1.00 61.21  ? 42  SER D OG  1 
ATOM   3563 N N   . ASP D 4 43  ? 32.678  55.651  31.924  1.00 65.85  ? 43  ASP D N   1 
ATOM   3564 C CA  . ASP D 4 43  ? 33.713  56.297  31.122  1.00 71.56  ? 43  ASP D CA  1 
ATOM   3565 C C   . ASP D 4 43  ? 34.960  55.409  31.186  1.00 74.00  ? 43  ASP D C   1 
ATOM   3566 O O   . ASP D 4 43  ? 35.544  55.049  30.160  1.00 75.78  ? 43  ASP D O   1 
ATOM   3567 C CB  . ASP D 4 43  ? 34.040  57.696  31.667  1.00 73.96  ? 43  ASP D CB  1 
ATOM   3568 C CG  . ASP D 4 43  ? 33.079  58.768  31.159  1.00 81.22  ? 43  ASP D CG  1 
ATOM   3569 O OD1 . ASP D 4 43  ? 32.210  58.439  30.318  1.00 80.73  ? 43  ASP D OD1 1 
ATOM   3570 O OD2 . ASP D 4 43  ? 33.200  59.939  31.596  1.00 72.04  ? 43  ASP D OD2 1 
ATOM   3571 N N   . VAL D 4 44  ? 35.350  55.051  32.405  1.00 66.46  ? 44  VAL D N   1 
ATOM   3572 C CA  . VAL D 4 44  ? 36.502  54.197  32.630  1.00 61.38  ? 44  VAL D CA  1 
ATOM   3573 C C   . VAL D 4 44  ? 36.168  52.745  32.285  1.00 66.85  ? 44  VAL D C   1 
ATOM   3574 O O   . VAL D 4 44  ? 37.054  51.958  31.951  1.00 71.21  ? 44  VAL D O   1 
ATOM   3575 C CB  . VAL D 4 44  ? 36.942  54.272  34.092  1.00 56.15  ? 44  VAL D CB  1 
ATOM   3576 C CG1 . VAL D 4 44  ? 38.001  53.244  34.373  1.00 58.89  ? 44  VAL D CG1 1 
ATOM   3577 C CG2 . VAL D 4 44  ? 37.468  55.648  34.386  1.00 58.96  ? 44  VAL D CG2 1 
ATOM   3578 N N   . GLY D 4 45  ? 34.887  52.398  32.377  1.00 65.60  ? 45  GLY D N   1 
ATOM   3579 C CA  . GLY D 4 45  ? 34.446  51.050  32.067  1.00 56.55  ? 45  GLY D CA  1 
ATOM   3580 C C   . GLY D 4 45  ? 34.890  49.966  33.029  1.00 55.85  ? 45  GLY D C   1 
ATOM   3581 O O   . GLY D 4 45  ? 34.795  48.788  32.706  1.00 55.05  ? 45  GLY D O   1 
ATOM   3582 N N   . GLU D 4 46  ? 35.349  50.340  34.220  1.00 60.46  ? 46  GLU D N   1 
ATOM   3583 C CA  . GLU D 4 46  ? 35.817  49.344  35.182  1.00 63.93  ? 46  GLU D CA  1 
ATOM   3584 C C   . GLU D 4 46  ? 35.720  49.774  36.645  1.00 62.25  ? 46  GLU D C   1 
ATOM   3585 O O   . GLU D 4 46  ? 35.766  50.960  36.969  1.00 68.33  ? 46  GLU D O   1 
ATOM   3586 C CB  . GLU D 4 46  ? 37.269  48.980  34.849  1.00 74.75  ? 46  GLU D CB  1 
ATOM   3587 C CG  . GLU D 4 46  ? 37.986  48.150  35.899  1.00 83.17  ? 46  GLU D CG  1 
ATOM   3588 C CD  . GLU D 4 46  ? 39.457  47.948  35.576  1.00 87.16  ? 46  GLU D CD  1 
ATOM   3589 O OE1 . GLU D 4 46  ? 40.182  48.956  35.450  1.00 87.10  ? 46  GLU D OE1 1 
ATOM   3590 O OE2 . GLU D 4 46  ? 39.888  46.781  35.451  1.00 93.35  ? 46  GLU D OE2 1 
ATOM   3591 N N   . TYR D 4 47  ? 35.602  48.789  37.526  1.00 61.58  ? 47  TYR D N   1 
ATOM   3592 C CA  . TYR D 4 47  ? 35.514  49.023  38.966  1.00 65.37  ? 47  TYR D CA  1 
ATOM   3593 C C   . TYR D 4 47  ? 36.852  49.391  39.618  1.00 69.96  ? 47  TYR D C   1 
ATOM   3594 O O   . TYR D 4 47  ? 37.424  48.575  40.346  1.00 78.03  ? 47  TYR D O   1 
ATOM   3595 C CB  . TYR D 4 47  ? 34.990  47.767  39.670  1.00 59.39  ? 47  TYR D CB  1 
ATOM   3596 C CG  . TYR D 4 47  ? 33.492  47.628  39.741  1.00 57.37  ? 47  TYR D CG  1 
ATOM   3597 C CD1 . TYR D 4 47  ? 32.741  48.404  40.624  1.00 61.68  ? 47  TYR D CD1 1 
ATOM   3598 C CD2 . TYR D 4 47  ? 32.829  46.689  38.961  1.00 52.74  ? 47  TYR D CD2 1 
ATOM   3599 C CE1 . TYR D 4 47  ? 31.363  48.237  40.730  1.00 58.57  ? 47  TYR D CE1 1 
ATOM   3600 C CE2 . TYR D 4 47  ? 31.462  46.518  39.056  1.00 52.92  ? 47  TYR D CE2 1 
ATOM   3601 C CZ  . TYR D 4 47  ? 30.734  47.290  39.943  1.00 54.14  ? 47  TYR D CZ  1 
ATOM   3602 O OH  . TYR D 4 47  ? 29.382  47.096  40.051  1.00 57.67  ? 47  TYR D OH  1 
ATOM   3603 N N   . ARG D 4 48  ? 37.359  50.598  39.384  1.00 68.84  ? 48  ARG D N   1 
ATOM   3604 C CA  . ARG D 4 48  ? 38.625  50.982  40.016  1.00 68.04  ? 48  ARG D CA  1 
ATOM   3605 C C   . ARG D 4 48  ? 38.422  51.392  41.472  1.00 62.63  ? 48  ARG D C   1 
ATOM   3606 O O   . ARG D 4 48  ? 37.418  52.008  41.810  1.00 62.14  ? 48  ARG D O   1 
ATOM   3607 C CB  . ARG D 4 48  ? 39.294  52.138  39.261  1.00 71.75  ? 48  ARG D CB  1 
ATOM   3608 C CG  . ARG D 4 48  ? 39.910  51.754  37.917  1.00 75.66  ? 48  ARG D CG  1 
ATOM   3609 C CD  . ARG D 4 48  ? 41.222  52.507  37.680  1.00 76.93  ? 48  ARG D CD  1 
ATOM   3610 N NE  . ARG D 4 48  ? 41.229  53.236  36.414  1.00 74.78  ? 48  ARG D NE  1 
ATOM   3611 C CZ  . ARG D 4 48  ? 41.066  52.669  35.222  1.00 73.29  ? 48  ARG D CZ  1 
ATOM   3612 N NH1 . ARG D 4 48  ? 40.882  51.359  35.130  1.00 64.83  ? 48  ARG D NH1 1 
ATOM   3613 N NH2 . ARG D 4 48  ? 41.089  53.412  34.119  1.00 71.27  ? 48  ARG D NH2 1 
ATOM   3614 N N   . ALA D 4 49  ? 39.370  51.034  42.333  1.00 62.76  ? 49  ALA D N   1 
ATOM   3615 C CA  . ALA D 4 49  ? 39.288  51.400  43.744  1.00 61.01  ? 49  ALA D CA  1 
ATOM   3616 C C   . ALA D 4 49  ? 39.669  52.872  43.842  1.00 65.08  ? 49  ALA D C   1 
ATOM   3617 O O   . ALA D 4 49  ? 40.605  53.318  43.177  1.00 66.59  ? 49  ALA D O   1 
ATOM   3618 C CB  . ALA D 4 49  ? 40.241  50.551  44.574  1.00 53.41  ? 49  ALA D CB  1 
ATOM   3619 N N   . VAL D 4 50  ? 38.936  53.625  44.660  1.00 67.79  ? 50  VAL D N   1 
ATOM   3620 C CA  . VAL D 4 50  ? 39.175  55.057  44.829  1.00 61.25  ? 50  VAL D CA  1 
ATOM   3621 C C   . VAL D 4 50  ? 40.254  55.348  45.858  1.00 63.07  ? 50  VAL D C   1 
ATOM   3622 O O   . VAL D 4 50  ? 41.138  56.176  45.629  1.00 62.51  ? 50  VAL D O   1 
ATOM   3623 C CB  . VAL D 4 50  ? 37.886  55.779  45.265  1.00 60.07  ? 50  VAL D CB  1 
ATOM   3624 C CG1 . VAL D 4 50  ? 38.140  57.276  45.404  1.00 52.19  ? 50  VAL D CG1 1 
ATOM   3625 C CG2 . VAL D 4 50  ? 36.777  55.506  44.266  1.00 58.47  ? 50  VAL D CG2 1 
ATOM   3626 N N   . THR D 4 51  ? 40.168  54.673  47.000  1.00 68.13  ? 51  THR D N   1 
ATOM   3627 C CA  . THR D 4 51  ? 41.139  54.858  48.072  1.00 71.21  ? 51  THR D CA  1 
ATOM   3628 C C   . THR D 4 51  ? 41.635  53.528  48.625  1.00 73.79  ? 51  THR D C   1 
ATOM   3629 O O   . THR D 4 51  ? 41.147  52.458  48.257  1.00 72.07  ? 51  THR D O   1 
ATOM   3630 C CB  . THR D 4 51  ? 40.540  55.650  49.236  1.00 70.44  ? 51  THR D CB  1 
ATOM   3631 O OG1 . THR D 4 51  ? 39.667  54.803  49.992  1.00 68.15  ? 51  THR D OG1 1 
ATOM   3632 C CG2 . THR D 4 51  ? 39.763  56.848  48.709  1.00 75.10  ? 51  THR D CG2 1 
ATOM   3633 N N   . GLU D 4 52  ? 42.611  53.612  49.519  1.00 77.15  ? 52  GLU D N   1 
ATOM   3634 C CA  . GLU D 4 52  ? 43.190  52.434  50.138  1.00 81.41  ? 52  GLU D CA  1 
ATOM   3635 C C   . GLU D 4 52  ? 42.078  51.496  50.610  1.00 79.59  ? 52  GLU D C   1 
ATOM   3636 O O   . GLU D 4 52  ? 42.009  50.344  50.183  1.00 75.69  ? 52  GLU D O   1 
ATOM   3637 C CB  . GLU D 4 52  ? 44.073  52.863  51.321  1.00 90.98  ? 52  GLU D CB  1 
ATOM   3638 C CG  . GLU D 4 52  ? 44.988  51.776  51.897  1.00 105.20 ? 52  GLU D CG  1 
ATOM   3639 C CD  . GLU D 4 52  ? 44.237  50.684  52.649  1.00 112.21 ? 52  GLU D CD  1 
ATOM   3640 O OE1 . GLU D 4 52  ? 43.486  51.015  53.595  1.00 114.30 ? 52  GLU D OE1 1 
ATOM   3641 O OE2 . GLU D 4 52  ? 44.408  49.494  52.297  1.00 114.28 ? 52  GLU D OE2 1 
ATOM   3642 N N   . LEU D 4 53  ? 41.200  52.010  51.470  1.00 75.98  ? 53  LEU D N   1 
ATOM   3643 C CA  . LEU D 4 53  ? 40.092  51.242  52.036  1.00 65.79  ? 53  LEU D CA  1 
ATOM   3644 C C   . LEU D 4 53  ? 39.392  50.326  51.034  1.00 63.52  ? 53  LEU D C   1 
ATOM   3645 O O   . LEU D 4 53  ? 38.832  49.301  51.413  1.00 55.22  ? 53  LEU D O   1 
ATOM   3646 C CB  . LEU D 4 53  ? 39.063  52.195  52.644  1.00 67.42  ? 53  LEU D CB  1 
ATOM   3647 C CG  . LEU D 4 53  ? 38.352  51.789  53.937  1.00 66.99  ? 53  LEU D CG  1 
ATOM   3648 C CD1 . LEU D 4 53  ? 37.136  52.677  54.120  1.00 65.25  ? 53  LEU D CD1 1 
ATOM   3649 C CD2 . LEU D 4 53  ? 37.924  50.342  53.893  1.00 65.74  ? 53  LEU D CD2 1 
ATOM   3650 N N   . GLY D 4 54  ? 39.420  50.697  49.759  1.00 65.84  ? 54  GLY D N   1 
ATOM   3651 C CA  . GLY D 4 54  ? 38.766  49.885  48.748  1.00 74.49  ? 54  GLY D CA  1 
ATOM   3652 C C   . GLY D 4 54  ? 39.701  49.013  47.932  1.00 81.27  ? 54  GLY D C   1 
ATOM   3653 O O   . GLY D 4 54  ? 39.318  48.481  46.888  1.00 86.45  ? 54  GLY D O   1 
ATOM   3654 N N   . ARG D 4 55  ? 40.928  48.858  48.410  1.00 82.30  ? 55  ARG D N   1 
ATOM   3655 C CA  . ARG D 4 55  ? 41.930  48.052  47.723  1.00 80.05  ? 55  ARG D CA  1 
ATOM   3656 C C   . ARG D 4 55  ? 41.472  46.599  47.521  1.00 74.49  ? 55  ARG D C   1 
ATOM   3657 O O   . ARG D 4 55  ? 41.568  46.055  46.422  1.00 73.22  ? 55  ARG D O   1 
ATOM   3658 C CB  . ARG D 4 55  ? 43.241  48.071  48.522  1.00 83.64  ? 55  ARG D CB  1 
ATOM   3659 C CG  . ARG D 4 55  ? 44.494  47.857  47.690  1.00 92.46  ? 55  ARG D CG  1 
ATOM   3660 C CD  . ARG D 4 55  ? 44.999  49.170  47.100  1.00 93.77  ? 55  ARG D CD  1 
ATOM   3661 N NE  . ARG D 4 55  ? 45.477  50.074  48.143  1.00 95.98  ? 55  ARG D NE  1 
ATOM   3662 C CZ  . ARG D 4 55  ? 46.006  51.271  47.914  1.00 98.86  ? 55  ARG D CZ  1 
ATOM   3663 N NH1 . ARG D 4 55  ? 46.127  51.718  46.671  1.00 99.03  ? 55  ARG D NH1 1 
ATOM   3664 N NH2 . ARG D 4 55  ? 46.416  52.021  48.930  1.00 98.77  ? 55  ARG D NH2 1 
ATOM   3665 N N   . PRO D 4 56  ? 40.955  45.958  48.581  1.00 67.28  ? 56  PRO D N   1 
ATOM   3666 C CA  . PRO D 4 56  ? 40.492  44.566  48.518  1.00 69.36  ? 56  PRO D CA  1 
ATOM   3667 C C   . PRO D 4 56  ? 39.286  44.231  47.628  1.00 70.15  ? 56  PRO D C   1 
ATOM   3668 O O   . PRO D 4 56  ? 38.991  43.053  47.417  1.00 69.73  ? 56  PRO D O   1 
ATOM   3669 C CB  . PRO D 4 56  ? 40.201  44.231  49.985  1.00 66.03  ? 56  PRO D CB  1 
ATOM   3670 C CG  . PRO D 4 56  ? 41.070  45.182  50.751  1.00 63.91  ? 56  PRO D CG  1 
ATOM   3671 C CD  . PRO D 4 56  ? 40.913  46.450  49.969  1.00 65.22  ? 56  PRO D CD  1 
ATOM   3672 N N   . ASP D 4 57  ? 38.599  45.240  47.097  1.00 69.21  ? 57  ASP D N   1 
ATOM   3673 C CA  . ASP D 4 57  ? 37.405  44.979  46.290  1.00 66.67  ? 57  ASP D CA  1 
ATOM   3674 C C   . ASP D 4 57  ? 37.536  44.982  44.770  1.00 64.46  ? 57  ASP D C   1 
ATOM   3675 O O   . ASP D 4 57  ? 36.855  44.212  44.090  1.00 63.26  ? 57  ASP D O   1 
ATOM   3676 C CB  . ASP D 4 57  ? 36.282  45.956  46.680  1.00 66.01  ? 57  ASP D CB  1 
ATOM   3677 C CG  . ASP D 4 57  ? 35.761  45.725  48.092  1.00 66.20  ? 57  ASP D CG  1 
ATOM   3678 O OD1 . ASP D 4 57  ? 35.279  44.606  48.381  1.00 68.97  ? 57  ASP D OD1 1 
ATOM   3679 O OD2 . ASP D 4 57  ? 35.830  46.665  48.911  1.00 57.94  ? 57  ASP D OD2 1 
ATOM   3680 N N   . ALA D 4 58  ? 38.397  45.841  44.239  1.00 63.42  ? 58  ALA D N   1 
ATOM   3681 C CA  . ALA D 4 58  ? 38.571  45.961  42.791  1.00 68.63  ? 58  ALA D CA  1 
ATOM   3682 C C   . ALA D 4 58  ? 38.540  44.659  41.983  1.00 73.05  ? 58  ALA D C   1 
ATOM   3683 O O   . ALA D 4 58  ? 37.616  44.429  41.199  1.00 70.92  ? 58  ALA D O   1 
ATOM   3684 C CB  . ALA D 4 58  ? 39.853  46.719  42.488  1.00 70.38  ? 58  ALA D CB  1 
ATOM   3685 N N   . GLU D 4 59  ? 39.554  43.818  42.167  1.00 77.05  ? 59  GLU D N   1 
ATOM   3686 C CA  . GLU D 4 59  ? 39.649  42.562  41.430  1.00 79.25  ? 59  GLU D CA  1 
ATOM   3687 C C   . GLU D 4 59  ? 38.344  41.771  41.488  1.00 75.95  ? 59  GLU D C   1 
ATOM   3688 O O   . GLU D 4 59  ? 37.722  41.503  40.456  1.00 71.48  ? 59  GLU D O   1 
ATOM   3689 C CB  . GLU D 4 59  ? 40.805  41.713  41.983  1.00 84.52  ? 59  GLU D CB  1 
ATOM   3690 C CG  . GLU D 4 59  ? 41.112  40.450  41.167  1.00 92.62  ? 59  GLU D CG  1 
ATOM   3691 C CD  . GLU D 4 59  ? 42.176  39.555  41.811  1.00 98.55  ? 59  GLU D CD  1 
ATOM   3692 O OE1 . GLU D 4 59  ? 43.314  40.030  42.026  1.00 96.46  ? 59  GLU D OE1 1 
ATOM   3693 O OE2 . GLU D 4 59  ? 41.873  38.373  42.098  1.00 97.16  ? 59  GLU D OE2 1 
ATOM   3694 N N   . TYR D 4 60  ? 37.940  41.407  42.702  1.00 73.88  ? 60  TYR D N   1 
ATOM   3695 C CA  . TYR D 4 60  ? 36.723  40.635  42.925  1.00 72.71  ? 60  TYR D CA  1 
ATOM   3696 C C   . TYR D 4 60  ? 35.510  41.237  42.214  1.00 73.56  ? 60  TYR D C   1 
ATOM   3697 O O   . TYR D 4 60  ? 34.780  40.533  41.515  1.00 75.68  ? 60  TYR D O   1 
ATOM   3698 C CB  . TYR D 4 60  ? 36.444  40.538  44.426  1.00 73.64  ? 60  TYR D CB  1 
ATOM   3699 C CG  . TYR D 4 60  ? 35.235  39.703  44.767  1.00 79.38  ? 60  TYR D CG  1 
ATOM   3700 C CD1 . TYR D 4 60  ? 35.285  38.313  44.710  1.00 79.32  ? 60  TYR D CD1 1 
ATOM   3701 C CD2 . TYR D 4 60  ? 34.030  40.305  45.123  1.00 82.35  ? 60  TYR D CD2 1 
ATOM   3702 C CE1 . TYR D 4 60  ? 34.163  37.542  44.999  1.00 79.41  ? 60  TYR D CE1 1 
ATOM   3703 C CE2 . TYR D 4 60  ? 32.904  39.545  45.412  1.00 80.68  ? 60  TYR D CE2 1 
ATOM   3704 C CZ  . TYR D 4 60  ? 32.976  38.166  45.348  1.00 81.86  ? 60  TYR D CZ  1 
ATOM   3705 O OH  . TYR D 4 60  ? 31.856  37.417  45.626  1.00 88.25  ? 60  TYR D OH  1 
ATOM   3706 N N   . TYR D 4 61  ? 35.301  42.539  42.398  1.00 71.35  ? 61  TYR D N   1 
ATOM   3707 C CA  . TYR D 4 61  ? 34.179  43.234  41.780  1.00 70.24  ? 61  TYR D CA  1 
ATOM   3708 C C   . TYR D 4 61  ? 34.178  43.178  40.261  1.00 71.01  ? 61  TYR D C   1 
ATOM   3709 O O   . TYR D 4 61  ? 33.128  42.984  39.644  1.00 73.61  ? 61  TYR D O   1 
ATOM   3710 C CB  . TYR D 4 61  ? 34.143  44.697  42.226  1.00 69.21  ? 61  TYR D CB  1 
ATOM   3711 C CG  . TYR D 4 61  ? 33.363  44.918  43.496  1.00 63.88  ? 61  TYR D CG  1 
ATOM   3712 C CD1 . TYR D 4 61  ? 33.725  44.278  44.677  1.00 65.78  ? 61  TYR D CD1 1 
ATOM   3713 C CD2 . TYR D 4 61  ? 32.264  45.769  43.521  1.00 62.10  ? 61  TYR D CD2 1 
ATOM   3714 C CE1 . TYR D 4 61  ? 33.013  44.482  45.854  1.00 62.07  ? 61  TYR D CE1 1 
ATOM   3715 C CE2 . TYR D 4 61  ? 31.542  45.982  44.696  1.00 57.39  ? 61  TYR D CE2 1 
ATOM   3716 C CZ  . TYR D 4 61  ? 31.926  45.336  45.857  1.00 60.07  ? 61  TYR D CZ  1 
ATOM   3717 O OH  . TYR D 4 61  ? 31.247  45.561  47.031  1.00 62.48  ? 61  TYR D OH  1 
ATOM   3718 N N   . ASN D 4 62  ? 35.343  43.368  39.653  1.00 66.33  ? 62  ASN D N   1 
ATOM   3719 C CA  . ASN D 4 62  ? 35.426  43.317  38.203  1.00 65.17  ? 62  ASN D CA  1 
ATOM   3720 C C   . ASN D 4 62  ? 35.168  41.895  37.728  1.00 68.57  ? 62  ASN D C   1 
ATOM   3721 O O   . ASN D 4 62  ? 34.693  41.685  36.614  1.00 70.84  ? 62  ASN D O   1 
ATOM   3722 C CB  . ASN D 4 62  ? 36.797  43.780  37.734  1.00 61.86  ? 62  ASN D CB  1 
ATOM   3723 C CG  . ASN D 4 62  ? 36.996  45.261  37.912  1.00 61.84  ? 62  ASN D CG  1 
ATOM   3724 O OD1 . ASN D 4 62  ? 36.333  46.062  37.255  1.00 65.86  ? 62  ASN D OD1 1 
ATOM   3725 N ND2 . ASN D 4 62  ? 37.909  45.640  38.806  1.00 47.74  ? 62  ASN D ND2 1 
ATOM   3726 N N   . LYS D 4 63  ? 35.491  40.918  38.572  1.00 70.05  ? 63  LYS D N   1 
ATOM   3727 C CA  . LYS D 4 63  ? 35.265  39.519  38.225  1.00 70.60  ? 63  LYS D CA  1 
ATOM   3728 C C   . LYS D 4 63  ? 33.771  39.272  38.246  1.00 68.01  ? 63  LYS D C   1 
ATOM   3729 O O   . LYS D 4 63  ? 33.115  39.142  37.210  1.00 66.30  ? 63  LYS D O   1 
ATOM   3730 C CB  . LYS D 4 63  ? 35.886  38.568  39.254  1.00 73.63  ? 63  LYS D CB  1 
ATOM   3731 C CG  . LYS D 4 63  ? 37.395  38.570  39.371  1.00 87.06  ? 63  LYS D CG  1 
ATOM   3732 C CD  . LYS D 4 63  ? 37.827  37.509  40.392  1.00 90.09  ? 63  LYS D CD  1 
ATOM   3733 C CE  . LYS D 4 63  ? 39.328  37.535  40.674  1.00 93.26  ? 63  LYS D CE  1 
ATOM   3734 N NZ  . LYS D 4 63  ? 40.161  37.196  39.483  1.00 93.78  ? 63  LYS D NZ  1 
ATOM   3735 N N   . GLN D 4 64  ? 33.247  39.232  39.464  1.00 62.67  ? 64  GLN D N   1 
ATOM   3736 C CA  . GLN D 4 64  ? 31.847  38.955  39.711  1.00 59.22  ? 64  GLN D CA  1 
ATOM   3737 C C   . GLN D 4 64  ? 30.802  39.878  39.096  1.00 57.23  ? 64  GLN D C   1 
ATOM   3738 O O   . GLN D 4 64  ? 29.751  39.400  38.689  1.00 54.66  ? 64  GLN D O   1 
ATOM   3739 C CB  . GLN D 4 64  ? 31.612  38.895  41.217  1.00 63.55  ? 64  GLN D CB  1 
ATOM   3740 C CG  . GLN D 4 64  ? 32.601  38.027  41.938  1.00 72.42  ? 64  GLN D CG  1 
ATOM   3741 C CD  . GLN D 4 64  ? 32.343  36.508  41.807  1.00 76.35  ? 64  GLN D CD  1 
ATOM   3742 O OE1 . GLN D 4 64  ? 32.948  35.748  42.527  1.00 80.70  ? 64  GLN D OE1 1 
ATOM   3743 N NE2 . GLN D 4 64  ? 31.463  36.081  40.903  1.00 77.97  ? 64  GLN D NE2 1 
ATOM   3744 N N   . TYR D 4 65  ? 31.082  41.178  38.996  1.00 56.43  ? 67  TYR D N   1 
ATOM   3745 C CA  . TYR D 4 65  ? 30.078  42.122  38.508  1.00 55.33  ? 67  TYR D CA  1 
ATOM   3746 C C   . TYR D 4 65  ? 30.301  42.924  37.230  1.00 57.58  ? 67  TYR D C   1 
ATOM   3747 O O   . TYR D 4 65  ? 29.339  43.278  36.563  1.00 61.53  ? 67  TYR D O   1 
ATOM   3748 C CB  . TYR D 4 65  ? 29.774  43.109  39.636  1.00 47.08  ? 67  TYR D CB  1 
ATOM   3749 C CG  . TYR D 4 65  ? 29.749  42.458  40.995  1.00 46.21  ? 67  TYR D CG  1 
ATOM   3750 C CD1 . TYR D 4 65  ? 28.878  41.405  41.258  1.00 45.56  ? 67  TYR D CD1 1 
ATOM   3751 C CD2 . TYR D 4 65  ? 30.593  42.889  42.018  1.00 43.93  ? 67  TYR D CD2 1 
ATOM   3752 C CE1 . TYR D 4 65  ? 28.844  40.795  42.502  1.00 47.47  ? 67  TYR D CE1 1 
ATOM   3753 C CE2 . TYR D 4 65  ? 30.568  42.285  43.270  1.00 46.11  ? 67  TYR D CE2 1 
ATOM   3754 C CZ  . TYR D 4 65  ? 29.688  41.236  43.504  1.00 49.58  ? 67  TYR D CZ  1 
ATOM   3755 O OH  . TYR D 4 65  ? 29.647  40.628  44.741  1.00 55.48  ? 67  TYR D OH  1 
ATOM   3756 N N   . LEU D 4 66  ? 31.545  43.223  36.879  1.00 60.14  ? 68  LEU D N   1 
ATOM   3757 C CA  . LEU D 4 66  ? 31.801  44.049  35.698  1.00 60.46  ? 68  LEU D CA  1 
ATOM   3758 C C   . LEU D 4 66  ? 30.772  43.951  34.571  1.00 59.69  ? 68  LEU D C   1 
ATOM   3759 O O   . LEU D 4 66  ? 30.267  44.965  34.088  1.00 61.14  ? 68  LEU D O   1 
ATOM   3760 C CB  . LEU D 4 66  ? 33.192  43.762  35.117  1.00 70.07  ? 68  LEU D CB  1 
ATOM   3761 C CG  . LEU D 4 66  ? 34.066  44.976  34.742  1.00 79.10  ? 68  LEU D CG  1 
ATOM   3762 C CD1 . LEU D 4 66  ? 35.146  44.554  33.752  1.00 77.26  ? 68  LEU D CD1 1 
ATOM   3763 C CD2 . LEU D 4 66  ? 33.217  46.080  34.130  1.00 78.87  ? 68  LEU D CD2 1 
ATOM   3764 N N   . GLU D 4 67  ? 30.450  42.737  34.148  1.00 61.07  ? 69  GLU D N   1 
ATOM   3765 C CA  . GLU D 4 67  ? 29.505  42.581  33.052  1.00 64.20  ? 69  GLU D CA  1 
ATOM   3766 C C   . GLU D 4 67  ? 28.083  42.971  33.438  1.00 63.79  ? 69  GLU D C   1 
ATOM   3767 O O   . GLU D 4 67  ? 27.350  43.581  32.649  1.00 59.64  ? 69  GLU D O   1 
ATOM   3768 C CB  . GLU D 4 67  ? 29.523  41.142  32.542  1.00 70.41  ? 69  GLU D CB  1 
ATOM   3769 C CG  . GLU D 4 67  ? 28.986  41.002  31.124  1.00 81.11  ? 69  GLU D CG  1 
ATOM   3770 C CD  . GLU D 4 67  ? 28.708  39.559  30.742  1.00 89.29  ? 69  GLU D CD  1 
ATOM   3771 O OE1 . GLU D 4 67  ? 29.548  38.685  31.052  1.00 94.09  ? 69  GLU D OE1 1 
ATOM   3772 O OE2 . GLU D 4 67  ? 27.651  39.302  30.125  1.00 88.84  ? 69  GLU D OE2 1 
ATOM   3773 N N   . ARG D 4 68  ? 27.694  42.617  34.655  1.00 59.20  ? 70  ARG D N   1 
ATOM   3774 C CA  . ARG D 4 68  ? 26.357  42.925  35.128  1.00 58.56  ? 70  ARG D CA  1 
ATOM   3775 C C   . ARG D 4 68  ? 26.141  44.422  35.322  1.00 57.36  ? 70  ARG D C   1 
ATOM   3776 O O   . ARG D 4 68  ? 25.035  44.926  35.143  1.00 59.71  ? 70  ARG D O   1 
ATOM   3777 C CB  . ARG D 4 68  ? 26.081  42.179  36.431  1.00 58.67  ? 70  ARG D CB  1 
ATOM   3778 C CG  . ARG D 4 68  ? 25.995  40.667  36.267  1.00 54.34  ? 70  ARG D CG  1 
ATOM   3779 C CD  . ARG D 4 68  ? 25.472  40.028  37.535  1.00 59.69  ? 70  ARG D CD  1 
ATOM   3780 N NE  . ARG D 4 68  ? 25.234  38.596  37.389  1.00 61.59  ? 70  ARG D NE  1 
ATOM   3781 C CZ  . ARG D 4 68  ? 26.041  37.651  37.860  1.00 59.54  ? 70  ARG D CZ  1 
ATOM   3782 N NH1 . ARG D 4 68  ? 27.150  37.980  38.513  1.00 48.68  ? 70  ARG D NH1 1 
ATOM   3783 N NH2 . ARG D 4 68  ? 25.730  36.373  37.690  1.00 64.21  ? 70  ARG D NH2 1 
ATOM   3784 N N   . THR D 4 69  ? 27.200  45.135  35.676  1.00 51.47  ? 71  THR D N   1 
ATOM   3785 C CA  . THR D 4 69  ? 27.094  46.562  35.887  1.00 48.56  ? 71  THR D CA  1 
ATOM   3786 C C   . THR D 4 69  ? 27.096  47.345  34.574  1.00 53.93  ? 71  THR D C   1 
ATOM   3787 O O   . THR D 4 69  ? 26.226  48.188  34.352  1.00 53.46  ? 71  THR D O   1 
ATOM   3788 C CB  . THR D 4 69  ? 28.221  47.054  36.803  1.00 49.15  ? 71  THR D CB  1 
ATOM   3789 O OG1 . THR D 4 69  ? 28.182  46.314  38.029  1.00 42.35  ? 71  THR D OG1 1 
ATOM   3790 C CG2 . THR D 4 69  ? 28.046  48.530  37.119  1.00 49.13  ? 71  THR D CG2 1 
ATOM   3791 N N   . ARG D 4 70  ? 28.058  47.074  33.701  1.00 53.99  ? 72  ARG D N   1 
ATOM   3792 C CA  . ARG D 4 70  ? 28.102  47.777  32.425  1.00 56.03  ? 72  ARG D CA  1 
ATOM   3793 C C   . ARG D 4 70  ? 26.712  47.755  31.799  1.00 59.18  ? 72  ARG D C   1 
ATOM   3794 O O   . ARG D 4 70  ? 26.249  48.753  31.248  1.00 60.26  ? 72  ARG D O   1 
ATOM   3795 C CB  . ARG D 4 70  ? 29.102  47.116  31.466  1.00 61.90  ? 72  ARG D CB  1 
ATOM   3796 C CG  . ARG D 4 70  ? 30.434  47.853  31.304  1.00 63.25  ? 72  ARG D CG  1 
ATOM   3797 C CD  . ARG D 4 70  ? 31.174  47.401  30.034  1.00 69.20  ? 72  ARG D CD  1 
ATOM   3798 N NE  . ARG D 4 70  ? 32.092  46.285  30.263  1.00 72.00  ? 72  ARG D NE  1 
ATOM   3799 C CZ  . ARG D 4 70  ? 33.371  46.424  30.607  1.00 75.34  ? 72  ARG D CZ  1 
ATOM   3800 N NH1 . ARG D 4 70  ? 33.889  47.636  30.759  1.00 70.90  ? 72  ARG D NH1 1 
ATOM   3801 N NH2 . ARG D 4 70  ? 34.133  45.353  30.799  1.00 70.23  ? 72  ARG D NH2 1 
ATOM   3802 N N   . ALA D 4 71  ? 26.043  46.613  31.906  1.00 59.24  ? 73  ALA D N   1 
ATOM   3803 C CA  . ALA D 4 71  ? 24.711  46.451  31.335  1.00 59.89  ? 73  ALA D CA  1 
ATOM   3804 C C   . ALA D 4 71  ? 23.653  47.396  31.916  1.00 57.97  ? 73  ALA D C   1 
ATOM   3805 O O   . ALA D 4 71  ? 22.765  47.860  31.195  1.00 53.36  ? 73  ALA D O   1 
ATOM   3806 C CB  . ALA D 4 71  ? 24.257  45.000  31.497  1.00 57.24  ? 73  ALA D CB  1 
ATOM   3807 N N   . GLU D 4 72  ? 23.746  47.677  33.213  1.00 55.76  ? 74  GLU D N   1 
ATOM   3808 C CA  . GLU D 4 72  ? 22.773  48.543  33.873  1.00 52.13  ? 74  GLU D CA  1 
ATOM   3809 C C   . GLU D 4 72  ? 22.615  49.887  33.183  1.00 52.07  ? 74  GLU D C   1 
ATOM   3810 O O   . GLU D 4 72  ? 21.563  50.527  33.280  1.00 51.06  ? 74  GLU D O   1 
ATOM   3811 C CB  . GLU D 4 72  ? 23.144  48.733  35.350  1.00 49.17  ? 74  GLU D CB  1 
ATOM   3812 C CG  . GLU D 4 72  ? 23.016  47.437  36.143  1.00 48.30  ? 74  GLU D CG  1 
ATOM   3813 C CD  . GLU D 4 72  ? 23.116  47.624  37.638  1.00 50.38  ? 74  GLU D CD  1 
ATOM   3814 O OE1 . GLU D 4 72  ? 24.172  48.093  38.112  1.00 46.20  ? 74  GLU D OE1 1 
ATOM   3815 O OE2 . GLU D 4 72  ? 22.133  47.292  38.341  1.00 54.44  ? 74  GLU D OE2 1 
ATOM   3816 N N   . LEU D 4 73  ? 23.654  50.305  32.471  1.00 49.40  ? 75  LEU D N   1 
ATOM   3817 C CA  . LEU D 4 73  ? 23.610  51.570  31.760  1.00 48.32  ? 75  LEU D CA  1 
ATOM   3818 C C   . LEU D 4 73  ? 22.452  51.549  30.768  1.00 46.96  ? 75  LEU D C   1 
ATOM   3819 O O   . LEU D 4 73  ? 21.871  52.587  30.451  1.00 49.40  ? 75  LEU D O   1 
ATOM   3820 C CB  . LEU D 4 73  ? 24.937  51.819  31.035  1.00 48.18  ? 75  LEU D CB  1 
ATOM   3821 C CG  . LEU D 4 73  ? 25.090  53.187  30.363  1.00 45.83  ? 75  LEU D CG  1 
ATOM   3822 C CD1 . LEU D 4 73  ? 26.545  53.632  30.428  1.00 44.16  ? 75  LEU D CD1 1 
ATOM   3823 C CD2 . LEU D 4 73  ? 24.593  53.113  28.929  1.00 41.24  ? 75  LEU D CD2 1 
ATOM   3824 N N   . ASP D 4 74  ? 22.106  50.363  30.288  1.00 41.75  ? 76  ASP D N   1 
ATOM   3825 C CA  . ASP D 4 74  ? 21.007  50.240  29.344  1.00 49.20  ? 76  ASP D CA  1 
ATOM   3826 C C   . ASP D 4 74  ? 19.733  49.756  30.011  1.00 48.33  ? 76  ASP D C   1 
ATOM   3827 O O   . ASP D 4 74  ? 18.652  50.303  29.776  1.00 46.93  ? 76  ASP D O   1 
ATOM   3828 C CB  . ASP D 4 74  ? 21.367  49.279  28.209  1.00 55.75  ? 76  ASP D CB  1 
ATOM   3829 C CG  . ASP D 4 74  ? 21.551  49.991  26.883  1.00 67.38  ? 76  ASP D CG  1 
ATOM   3830 O OD1 . ASP D 4 74  ? 22.688  50.449  26.596  1.00 60.92  ? 76  ASP D OD1 1 
ATOM   3831 O OD2 . ASP D 4 74  ? 20.546  50.102  26.139  1.00 66.03  ? 76  ASP D OD2 1 
ATOM   3832 N N   . THR D 4 75  ? 19.867  48.722  30.835  1.00 54.41  ? 77  THR D N   1 
ATOM   3833 C CA  . THR D 4 75  ? 18.722  48.148  31.533  1.00 55.43  ? 77  THR D CA  1 
ATOM   3834 C C   . THR D 4 75  ? 18.217  48.984  32.714  1.00 52.06  ? 77  THR D C   1 
ATOM   3835 O O   . THR D 4 75  ? 17.082  48.805  33.155  1.00 48.26  ? 77  THR D O   1 
ATOM   3836 C CB  . THR D 4 75  ? 19.033  46.730  32.024  1.00 49.85  ? 77  THR D CB  1 
ATOM   3837 O OG1 . THR D 4 75  ? 20.159  46.763  32.911  1.00 52.79  ? 77  THR D OG1 1 
ATOM   3838 C CG2 . THR D 4 75  ? 19.327  45.835  30.847  1.00 49.89  ? 77  THR D CG2 1 
ATOM   3839 N N   . VAL D 4 76  ? 19.048  49.887  33.228  1.00 46.21  ? 78  VAL D N   1 
ATOM   3840 C CA  . VAL D 4 76  ? 18.610  50.735  34.322  1.00 49.27  ? 78  VAL D CA  1 
ATOM   3841 C C   . VAL D 4 76  ? 18.509  52.202  33.899  1.00 51.37  ? 78  VAL D C   1 
ATOM   3842 O O   . VAL D 4 76  ? 17.432  52.799  33.963  1.00 49.58  ? 78  VAL D O   1 
ATOM   3843 C CB  . VAL D 4 76  ? 19.547  50.643  35.549  1.00 53.24  ? 78  VAL D CB  1 
ATOM   3844 C CG1 . VAL D 4 76  ? 19.034  51.569  36.654  1.00 47.71  ? 78  VAL D CG1 1 
ATOM   3845 C CG2 . VAL D 4 76  ? 19.613  49.218  36.062  1.00 31.15  ? 78  VAL D CG2 1 
ATOM   3846 N N   . CYS D 4 77  ? 19.626  52.776  33.457  1.00 49.44  ? 79  CYS D N   1 
ATOM   3847 C CA  . CYS D 4 77  ? 19.647  54.174  33.059  1.00 43.54  ? 79  CYS D CA  1 
ATOM   3848 C C   . CYS D 4 77  ? 18.782  54.511  31.857  1.00 43.37  ? 79  CYS D C   1 
ATOM   3849 O O   . CYS D 4 77  ? 17.778  55.197  32.001  1.00 48.11  ? 79  CYS D O   1 
ATOM   3850 C CB  . CYS D 4 77  ? 21.076  54.631  32.786  1.00 45.96  ? 79  CYS D CB  1 
ATOM   3851 S SG  . CYS D 4 77  ? 22.174  54.678  34.239  1.00 60.66  ? 79  CYS D SG  1 
ATOM   3852 N N   . ARG D 4 78  ? 19.169  54.042  30.674  1.00 47.94  ? 80  ARG D N   1 
ATOM   3853 C CA  . ARG D 4 78  ? 18.407  54.340  29.461  1.00 50.04  ? 80  ARG D CA  1 
ATOM   3854 C C   . ARG D 4 78  ? 16.948  53.927  29.596  1.00 48.10  ? 80  ARG D C   1 
ATOM   3855 O O   . ARG D 4 78  ? 16.040  54.665  29.206  1.00 52.14  ? 80  ARG D O   1 
ATOM   3856 C CB  . ARG D 4 78  ? 19.024  53.640  28.241  1.00 51.64  ? 80  ARG D CB  1 
ATOM   3857 C CG  . ARG D 4 78  ? 18.126  53.663  26.993  1.00 48.40  ? 80  ARG D CG  1 
ATOM   3858 C CD  . ARG D 4 78  ? 18.794  53.049  25.757  1.00 54.64  ? 80  ARG D CD  1 
ATOM   3859 N NE  . ARG D 4 78  ? 19.912  53.868  25.293  1.00 62.89  ? 80  ARG D NE  1 
ATOM   3860 C CZ  . ARG D 4 78  ? 21.168  53.730  25.704  1.00 61.51  ? 80  ARG D CZ  1 
ATOM   3861 N NH1 . ARG D 4 78  ? 21.485  52.790  26.584  1.00 67.68  ? 80  ARG D NH1 1 
ATOM   3862 N NH2 . ARG D 4 78  ? 22.102  54.554  25.260  1.00 61.55  ? 80  ARG D NH2 1 
ATOM   3863 N N   . TYR D 4 79  ? 16.737  52.743  30.157  1.00 45.20  ? 81  TYR D N   1 
ATOM   3864 C CA  . TYR D 4 79  ? 15.402  52.195  30.352  1.00 48.30  ? 81  TYR D CA  1 
ATOM   3865 C C   . TYR D 4 79  ? 14.501  53.069  31.235  1.00 46.87  ? 81  TYR D C   1 
ATOM   3866 O O   . TYR D 4 79  ? 13.381  53.413  30.848  1.00 42.10  ? 81  TYR D O   1 
ATOM   3867 C CB  . TYR D 4 79  ? 15.516  50.797  30.966  1.00 48.42  ? 81  TYR D CB  1 
ATOM   3868 C CG  . TYR D 4 79  ? 14.188  50.134  31.220  1.00 51.45  ? 81  TYR D CG  1 
ATOM   3869 C CD1 . TYR D 4 79  ? 13.503  49.490  30.194  1.00 57.21  ? 81  TYR D CD1 1 
ATOM   3870 C CD2 . TYR D 4 79  ? 13.611  50.154  32.488  1.00 51.09  ? 81  TYR D CD2 1 
ATOM   3871 C CE1 . TYR D 4 79  ? 12.272  48.877  30.430  1.00 67.01  ? 81  TYR D CE1 1 
ATOM   3872 C CE2 . TYR D 4 79  ? 12.382  49.548  32.734  1.00 57.33  ? 81  TYR D CE2 1 
ATOM   3873 C CZ  . TYR D 4 79  ? 11.719  48.911  31.703  1.00 60.61  ? 81  TYR D CZ  1 
ATOM   3874 O OH  . TYR D 4 79  ? 10.510  48.303  31.943  1.00 67.04  ? 81  TYR D OH  1 
ATOM   3875 N N   . ASN D 4 80  ? 14.982  53.415  32.425  1.00 45.47  ? 82  ASN D N   1 
ATOM   3876 C CA  . ASN D 4 80  ? 14.184  54.230  33.336  1.00 50.22  ? 82  ASN D CA  1 
ATOM   3877 C C   . ASN D 4 80  ? 13.859  55.587  32.735  1.00 51.90  ? 82  ASN D C   1 
ATOM   3878 O O   . ASN D 4 80  ? 12.750  56.092  32.905  1.00 51.22  ? 82  ASN D O   1 
ATOM   3879 C CB  . ASN D 4 80  ? 14.901  54.412  34.683  1.00 45.79  ? 82  ASN D CB  1 
ATOM   3880 C CG  . ASN D 4 80  ? 14.840  53.161  35.553  1.00 44.68  ? 82  ASN D CG  1 
ATOM   3881 O OD1 . ASN D 4 80  ? 14.259  52.147  35.159  1.00 48.28  ? 82  ASN D OD1 1 
ATOM   3882 N ND2 . ASN D 4 80  ? 15.440  53.228  36.743  1.00 28.26  ? 82  ASN D ND2 1 
ATOM   3883 N N   . TYR D 4 81  ? 14.820  56.170  32.020  1.00 50.41  ? 83  TYR D N   1 
ATOM   3884 C CA  . TYR D 4 81  ? 14.610  57.477  31.408  1.00 48.39  ? 83  TYR D CA  1 
ATOM   3885 C C   . TYR D 4 81  ? 13.522  57.406  30.358  1.00 49.24  ? 83  TYR D C   1 
ATOM   3886 O O   . TYR D 4 81  ? 12.499  58.082  30.460  1.00 48.18  ? 83  TYR D O   1 
ATOM   3887 C CB  . TYR D 4 81  ? 15.901  57.983  30.767  1.00 45.77  ? 83  TYR D CB  1 
ATOM   3888 C CG  . TYR D 4 81  ? 15.837  59.411  30.267  1.00 45.91  ? 83  TYR D CG  1 
ATOM   3889 C CD1 . TYR D 4 81  ? 15.064  59.751  29.164  1.00 46.22  ? 83  TYR D CD1 1 
ATOM   3890 C CD2 . TYR D 4 81  ? 16.576  60.424  30.886  1.00 48.70  ? 83  TYR D CD2 1 
ATOM   3891 C CE1 . TYR D 4 81  ? 15.028  61.062  28.681  1.00 43.73  ? 83  TYR D CE1 1 
ATOM   3892 C CE2 . TYR D 4 81  ? 16.545  61.738  30.410  1.00 42.43  ? 83  TYR D CE2 1 
ATOM   3893 C CZ  . TYR D 4 81  ? 15.768  62.048  29.305  1.00 45.63  ? 83  TYR D CZ  1 
ATOM   3894 O OH  . TYR D 4 81  ? 15.720  63.338  28.817  1.00 45.03  ? 83  TYR D OH  1 
ATOM   3895 N N   . GLU D 4 82  ? 13.729  56.562  29.359  1.00 53.08  ? 84  GLU D N   1 
ATOM   3896 C CA  . GLU D 4 82  ? 12.765  56.438  28.276  1.00 57.21  ? 84  GLU D CA  1 
ATOM   3897 C C   . GLU D 4 82  ? 11.433  55.804  28.665  1.00 54.59  ? 84  GLU D C   1 
ATOM   3898 O O   . GLU D 4 82  ? 10.391  56.162  28.121  1.00 53.30  ? 84  GLU D O   1 
ATOM   3899 C CB  . GLU D 4 82  ? 13.401  55.667  27.119  1.00 58.69  ? 84  GLU D CB  1 
ATOM   3900 C CG  . GLU D 4 82  ? 14.692  56.311  26.631  1.00 71.98  ? 84  GLU D CG  1 
ATOM   3901 C CD  . GLU D 4 82  ? 15.282  55.618  25.419  1.00 80.16  ? 84  GLU D CD  1 
ATOM   3902 O OE1 . GLU D 4 82  ? 15.584  54.409  25.507  1.00 79.32  ? 84  GLU D OE1 1 
ATOM   3903 O OE2 . GLU D 4 82  ? 15.448  56.287  24.375  1.00 87.96  ? 84  GLU D OE2 1 
ATOM   3904 N N   . GLU D 4 83  A 11.452  54.886  29.622  1.00 57.84  ? 84  GLU D N   1 
ATOM   3905 C CA  . GLU D 4 83  A 10.220  54.218  30.017  1.00 54.70  ? 84  GLU D CA  1 
ATOM   3906 C C   . GLU D 4 83  A 9.469   54.805  31.217  1.00 50.88  ? 84  GLU D C   1 
ATOM   3907 O O   . GLU D 4 83  A 8.246   54.676  31.284  1.00 48.07  ? 84  GLU D O   1 
ATOM   3908 C CB  . GLU D 4 83  A 10.497  52.732  30.259  1.00 60.89  ? 84  GLU D CB  1 
ATOM   3909 C CG  . GLU D 4 83  A 9.421   51.817  29.685  1.00 70.98  ? 84  GLU D CG  1 
ATOM   3910 C CD  . GLU D 4 83  A 9.163   52.084  28.204  1.00 74.36  ? 84  GLU D CD  1 
ATOM   3911 O OE1 . GLU D 4 83  A 10.131  52.043  27.407  1.00 60.92  ? 84  GLU D OE1 1 
ATOM   3912 O OE2 . GLU D 4 83  A 7.991   52.337  27.840  1.00 73.80  ? 84  GLU D OE2 1 
ATOM   3913 N N   . THR D 4 84  ? 10.170  55.436  32.161  1.00 40.11  ? 85  THR D N   1 
ATOM   3914 C CA  . THR D 4 84  ? 9.474   56.000  33.319  1.00 45.10  ? 85  THR D CA  1 
ATOM   3915 C C   . THR D 4 84  ? 9.628   57.509  33.536  1.00 44.61  ? 85  THR D C   1 
ATOM   3916 O O   . THR D 4 84  ? 8.697   58.155  34.019  1.00 44.83  ? 85  THR D O   1 
ATOM   3917 C CB  . THR D 4 84  ? 9.845   55.257  34.639  1.00 43.12  ? 85  THR D CB  1 
ATOM   3918 O OG1 . THR D 4 84  ? 11.183  55.572  35.034  1.00 41.55  ? 85  THR D OG1 1 
ATOM   3919 C CG2 . THR D 4 84  ? 9.721   53.751  34.445  1.00 41.97  ? 85  THR D CG2 1 
ATOM   3920 N N   . GLU D 4 85  ? 10.778  58.079  33.182  1.00 42.91  ? 86  GLU D N   1 
ATOM   3921 C CA  . GLU D 4 85  ? 10.966  59.515  33.360  1.00 39.77  ? 86  GLU D CA  1 
ATOM   3922 C C   . GLU D 4 85  ? 10.147  60.291  32.331  1.00 45.26  ? 86  GLU D C   1 
ATOM   3923 O O   . GLU D 4 85  ? 9.442   61.241  32.674  1.00 42.37  ? 86  GLU D O   1 
ATOM   3924 C CB  . GLU D 4 85  ? 12.438  59.916  33.216  1.00 40.39  ? 86  GLU D CB  1 
ATOM   3925 C CG  . GLU D 4 85  ? 13.416  59.370  34.266  1.00 48.99  ? 86  GLU D CG  1 
ATOM   3926 C CD  . GLU D 4 85  ? 12.902  59.441  35.700  1.00 47.63  ? 86  GLU D CD  1 
ATOM   3927 O OE1 . GLU D 4 85  ? 12.035  60.293  36.009  1.00 39.98  ? 86  GLU D OE1 1 
ATOM   3928 O OE2 . GLU D 4 85  ? 13.383  58.636  36.527  1.00 45.57  ? 86  GLU D OE2 1 
ATOM   3929 N N   . VAL D 4 86  ? 10.246  59.881  31.070  1.00 42.71  ? 87  VAL D N   1 
ATOM   3930 C CA  . VAL D 4 86  ? 9.530   60.545  29.988  1.00 37.19  ? 87  VAL D CA  1 
ATOM   3931 C C   . VAL D 4 86  ? 8.067   60.848  30.332  1.00 37.16  ? 87  VAL D C   1 
ATOM   3932 O O   . VAL D 4 86  ? 7.607   61.975  30.165  1.00 44.38  ? 87  VAL D O   1 
ATOM   3933 C CB  . VAL D 4 86  ? 9.623   59.707  28.679  1.00 39.21  ? 87  VAL D CB  1 
ATOM   3934 C CG1 . VAL D 4 86  ? 8.608   60.183  27.665  1.00 31.64  ? 87  VAL D CG1 1 
ATOM   3935 C CG2 . VAL D 4 86  ? 11.019  59.831  28.093  1.00 31.18  ? 87  VAL D CG2 1 
ATOM   3936 N N   . PRO D 4 87  ? 7.319   59.854  30.821  1.00 38.51  ? 88  PRO D N   1 
ATOM   3937 C CA  . PRO D 4 87  ? 5.912   60.097  31.169  1.00 37.83  ? 88  PRO D CA  1 
ATOM   3938 C C   . PRO D 4 87  ? 5.663   60.825  32.506  1.00 41.49  ? 88  PRO D C   1 
ATOM   3939 O O   . PRO D 4 87  ? 4.548   61.279  32.758  1.00 45.14  ? 88  PRO D O   1 
ATOM   3940 C CB  . PRO D 4 87  ? 5.316   58.696  31.172  1.00 34.96  ? 88  PRO D CB  1 
ATOM   3941 C CG  . PRO D 4 87  ? 6.460   57.866  31.703  1.00 32.35  ? 88  PRO D CG  1 
ATOM   3942 C CD  . PRO D 4 87  ? 7.647   58.419  30.921  1.00 40.91  ? 88  PRO D CD  1 
ATOM   3943 N N   . THR D 4 88  ? 6.673   60.947  33.367  1.00 35.08  ? 89  THR D N   1 
ATOM   3944 C CA  . THR D 4 88  ? 6.439   61.629  34.648  1.00 39.33  ? 89  THR D CA  1 
ATOM   3945 C C   . THR D 4 88  ? 7.202   62.920  34.946  1.00 35.85  ? 89  THR D C   1 
ATOM   3946 O O   . THR D 4 88  ? 6.663   64.010  34.787  1.00 36.04  ? 89  THR D O   1 
ATOM   3947 C CB  . THR D 4 88  ? 6.648   60.680  35.849  1.00 34.25  ? 89  THR D CB  1 
ATOM   3948 O OG1 . THR D 4 88  ? 7.946   60.074  35.782  1.00 36.07  ? 89  THR D OG1 1 
ATOM   3949 C CG2 . THR D 4 88  ? 5.569   59.619  35.859  1.00 28.95  ? 89  THR D CG2 1 
ATOM   3950 N N   . SER D 4 89  ? 8.443   62.807  35.394  1.00 29.58  ? 90  SER D N   1 
ATOM   3951 C CA  . SER D 4 89  ? 9.208   63.995  35.723  1.00 35.31  ? 90  SER D CA  1 
ATOM   3952 C C   . SER D 4 89  ? 9.515   64.903  34.526  1.00 44.15  ? 90  SER D C   1 
ATOM   3953 O O   . SER D 4 89  ? 9.498   66.131  34.647  1.00 44.88  ? 90  SER D O   1 
ATOM   3954 C CB  . SER D 4 89  ? 10.499  63.590  36.415  1.00 37.18  ? 90  SER D CB  1 
ATOM   3955 O OG  . SER D 4 89  ? 11.272  62.771  35.579  1.00 47.93  ? 90  SER D OG  1 
ATOM   3956 N N   . LEU D 4 90  ? 9.789   64.302  33.373  1.00 46.10  ? 91  LEU D N   1 
ATOM   3957 C CA  . LEU D 4 90  ? 10.107  65.067  32.171  1.00 43.60  ? 91  LEU D CA  1 
ATOM   3958 C C   . LEU D 4 90  ? 8.864   65.692  31.560  1.00 43.57  ? 91  LEU D C   1 
ATOM   3959 O O   . LEU D 4 90  ? 8.939   66.435  30.592  1.00 41.67  ? 91  LEU D O   1 
ATOM   3960 C CB  . LEU D 4 90  ? 10.786  64.158  31.153  1.00 40.68  ? 91  LEU D CB  1 
ATOM   3961 C CG  . LEU D 4 90  ? 12.095  63.594  31.699  1.00 48.20  ? 91  LEU D CG  1 
ATOM   3962 C CD1 . LEU D 4 90  ? 12.665  62.574  30.722  1.00 50.95  ? 91  LEU D CD1 1 
ATOM   3963 C CD2 . LEU D 4 90  ? 13.084  64.737  31.945  1.00 44.09  ? 91  LEU D CD2 1 
ATOM   3964 N N   . ARG D 4 91  ? 7.715   65.390  32.140  1.00 39.80  ? 92  ARG D N   1 
ATOM   3965 C CA  . ARG D 4 91  ? 6.467   65.925  31.641  1.00 40.20  ? 92  ARG D CA  1 
ATOM   3966 C C   . ARG D 4 91  ? 5.851   66.918  32.639  1.00 42.89  ? 92  ARG D C   1 
ATOM   3967 O O   . ARG D 4 91  ? 4.880   67.611  32.334  1.00 40.90  ? 92  ARG D O   1 
ATOM   3968 C CB  . ARG D 4 91  ? 5.512   64.763  31.360  1.00 42.90  ? 92  ARG D CB  1 
ATOM   3969 C CG  . ARG D 4 91  ? 4.220   65.164  30.697  1.00 60.37  ? 92  ARG D CG  1 
ATOM   3970 C CD  . ARG D 4 91  ? 3.720   64.087  29.733  1.00 81.14  ? 92  ARG D CD  1 
ATOM   3971 N NE  . ARG D 4 91  ? 3.516   62.787  30.373  1.00 95.74  ? 92  ARG D NE  1 
ATOM   3972 C CZ  . ARG D 4 91  ? 2.939   61.747  29.777  1.00 102.97 ? 92  ARG D CZ  1 
ATOM   3973 N NH1 . ARG D 4 91  ? 2.511   61.859  28.525  1.00 110.47 ? 92  ARG D NH1 1 
ATOM   3974 N NH2 . ARG D 4 91  ? 2.784   60.599  30.427  1.00 102.26 ? 92  ARG D NH2 1 
ATOM   3975 N N   . ARG D 4 92  ? 6.437   66.999  33.829  1.00 44.83  ? 93  ARG D N   1 
ATOM   3976 C CA  . ARG D 4 92  ? 5.943   67.894  34.868  1.00 42.52  ? 93  ARG D CA  1 
ATOM   3977 C C   . ARG D 4 92  ? 6.159   69.382  34.550  1.00 40.27  ? 93  ARG D C   1 
ATOM   3978 O O   . ARG D 4 92  ? 7.292   69.850  34.384  1.00 36.59  ? 93  ARG D O   1 
ATOM   3979 C CB  . ARG D 4 92  ? 6.609   67.551  36.209  1.00 39.79  ? 93  ARG D CB  1 
ATOM   3980 C CG  . ARG D 4 92  ? 6.072   68.342  37.399  1.00 40.33  ? 93  ARG D CG  1 
ATOM   3981 C CD  . ARG D 4 92  ? 6.782   67.937  38.689  1.00 36.74  ? 93  ARG D CD  1 
ATOM   3982 N NE  . ARG D 4 92  ? 6.416   68.761  39.849  1.00 24.47  ? 93  ARG D NE  1 
ATOM   3983 C CZ  . ARG D 4 92  ? 5.231   68.738  40.464  1.00 35.37  ? 93  ARG D CZ  1 
ATOM   3984 N NH1 . ARG D 4 92  ? 4.262   67.932  40.038  1.00 30.38  ? 93  ARG D NH1 1 
ATOM   3985 N NH2 . ARG D 4 92  ? 5.021   69.508  41.530  1.00 23.80  ? 93  ARG D NH2 1 
ATOM   3986 N N   . LEU D 4 93  ? 5.058   70.118  34.463  1.00 38.29  ? 94  LEU D N   1 
ATOM   3987 C CA  . LEU D 4 93  ? 5.117   71.550  34.209  1.00 39.49  ? 94  LEU D CA  1 
ATOM   3988 C C   . LEU D 4 93  ? 4.225   72.280  35.221  1.00 34.74  ? 94  LEU D C   1 
ATOM   3989 O O   . LEU D 4 93  ? 3.008   72.217  35.139  1.00 40.38  ? 94  LEU D O   1 
ATOM   3990 C CB  . LEU D 4 93  ? 4.659   71.870  32.776  1.00 34.20  ? 94  LEU D CB  1 
ATOM   3991 C CG  . LEU D 4 93  ? 5.542   71.382  31.625  1.00 32.58  ? 94  LEU D CG  1 
ATOM   3992 C CD1 . LEU D 4 93  ? 4.834   71.622  30.331  1.00 22.74  ? 94  LEU D CD1 1 
ATOM   3993 C CD2 . LEU D 4 93  ? 6.880   72.100  31.629  1.00 24.78  ? 94  LEU D CD2 1 
ATOM   3994 N N   . GLU D 4 94  ? 4.829   72.950  36.191  1.00 28.46  ? 95  GLU D N   1 
ATOM   3995 C CA  . GLU D 4 94  ? 4.044   73.691  37.167  1.00 32.54  ? 95  GLU D CA  1 
ATOM   3996 C C   . GLU D 4 94  ? 4.332   75.154  36.889  1.00 31.27  ? 95  GLU D C   1 
ATOM   3997 O O   . GLU D 4 94  ? 5.485   75.562  36.828  1.00 27.29  ? 95  GLU D O   1 
ATOM   3998 C CB  . GLU D 4 94  ? 4.475   73.361  38.601  1.00 39.04  ? 95  GLU D CB  1 
ATOM   3999 C CG  . GLU D 4 94  ? 4.257   71.931  39.044  1.00 35.53  ? 95  GLU D CG  1 
ATOM   4000 C CD  . GLU D 4 94  ? 2.795   71.585  39.214  1.00 43.45  ? 95  GLU D CD  1 
ATOM   4001 O OE1 . GLU D 4 94  ? 2.095   72.312  39.954  1.00 35.01  ? 95  GLU D OE1 1 
ATOM   4002 O OE2 . GLU D 4 94  ? 2.347   70.580  38.616  1.00 39.37  ? 95  GLU D OE2 1 
ATOM   4003 N N   . GLN D 4 95  ? 3.279   75.936  36.721  1.00 29.65  ? 96  GLN D N   1 
ATOM   4004 C CA  . GLN D 4 95  ? 3.421   77.352  36.443  1.00 32.22  ? 96  GLN D CA  1 
ATOM   4005 C C   . GLN D 4 95  ? 3.791   78.205  37.645  1.00 35.05  ? 96  GLN D C   1 
ATOM   4006 O O   . GLN D 4 95  ? 3.417   77.863  38.775  1.00 41.82  ? 96  GLN D O   1 
ATOM   4007 C CB  . GLN D 4 95  ? 2.105   77.886  35.877  1.00 32.77  ? 96  GLN D CB  1 
ATOM   4008 C CG  . GLN D 4 95  ? 1.794   77.360  34.497  1.00 34.44  ? 96  GLN D CG  1 
ATOM   4009 C CD  . GLN D 4 95  ? 0.359   77.596  34.079  1.00 41.05  ? 96  GLN D CD  1 
ATOM   4010 O OE1 . GLN D 4 95  ? -0.178  78.702  34.224  1.00 33.71  ? 96  GLN D OE1 1 
ATOM   4011 N NE2 . GLN D 4 95  ? -0.270  76.556  33.546  1.00 38.27  ? 96  GLN D NE2 1 
ATOM   4012 N N   . PRO D 4 96  ? 4.623   79.258  37.427  1.00 38.44  ? 97  PRO D N   1 
ATOM   4013 C CA  . PRO D 4 96  ? 5.045   80.204  38.459  1.00 35.95  ? 97  PRO D CA  1 
ATOM   4014 C C   . PRO D 4 96  ? 3.925   81.110  38.975  1.00 38.06  ? 97  PRO D C   1 
ATOM   4015 O O   . PRO D 4 96  ? 2.997   81.450  38.252  1.00 36.94  ? 97  PRO D O   1 
ATOM   4016 C CB  . PRO D 4 96  ? 6.097   81.050  37.741  1.00 31.14  ? 97  PRO D CB  1 
ATOM   4017 C CG  . PRO D 4 96  ? 6.817   80.063  36.958  1.00 30.60  ? 97  PRO D CG  1 
ATOM   4018 C CD  . PRO D 4 96  ? 5.843   78.893  36.672  1.00 35.92  ? 97  PRO D CD  1 
ATOM   4019 N N   . ASN D 4 97  ? 3.991   81.459  40.251  1.00 40.28  ? 98  ASN D N   1 
ATOM   4020 C CA  . ASN D 4 97  ? 3.062   82.440  40.776  1.00 41.87  ? 98  ASN D CA  1 
ATOM   4021 C C   . ASN D 4 97  ? 4.007   83.639  40.818  1.00 35.68  ? 98  ASN D C   1 
ATOM   4022 O O   . ASN D 4 97  ? 5.185   83.475  41.125  1.00 29.17  ? 98  ASN D O   1 
ATOM   4023 C CB  . ASN D 4 97  ? 2.568   82.088  42.173  1.00 42.12  ? 98  ASN D CB  1 
ATOM   4024 C CG  . ASN D 4 97  ? 1.077   81.819  42.195  1.00 44.85  ? 98  ASN D CG  1 
ATOM   4025 O OD1 . ASN D 4 97  ? 0.288   82.612  41.681  1.00 50.27  ? 98  ASN D OD1 1 
ATOM   4026 N ND2 . ASN D 4 97  ? 0.685   80.695  42.779  1.00 45.41  ? 98  ASN D ND2 1 
ATOM   4027 N N   . VAL D 4 98  ? 3.519   84.831  40.502  1.00 34.72  ? 99  VAL D N   1 
ATOM   4028 C CA  . VAL D 4 98  ? 4.397   85.995  40.472  1.00 29.73  ? 99  VAL D CA  1 
ATOM   4029 C C   . VAL D 4 98  ? 3.756   87.193  41.156  1.00 32.54  ? 99  VAL D C   1 
ATOM   4030 O O   . VAL D 4 98  ? 2.679   87.636  40.758  1.00 30.44  ? 99  VAL D O   1 
ATOM   4031 C CB  . VAL D 4 98  ? 4.734   86.365  38.985  1.00 31.71  ? 99  VAL D CB  1 
ATOM   4032 C CG1 . VAL D 4 98  ? 5.791   87.440  38.919  1.00 27.50  ? 99  VAL D CG1 1 
ATOM   4033 C CG2 . VAL D 4 98  ? 5.204   85.122  38.229  1.00 27.85  ? 99  VAL D CG2 1 
ATOM   4034 N N   . VAL D 4 99  ? 4.405   87.714  42.192  1.00 33.31  ? 100 VAL D N   1 
ATOM   4035 C CA  . VAL D 4 99  ? 3.871   88.886  42.882  1.00 35.31  ? 100 VAL D CA  1 
ATOM   4036 C C   . VAL D 4 99  ? 4.972   89.864  43.236  1.00 36.79  ? 100 VAL D C   1 
ATOM   4037 O O   . VAL D 4 99  ? 6.112   89.476  43.533  1.00 35.97  ? 100 VAL D O   1 
ATOM   4038 C CB  . VAL D 4 99  ? 3.106   88.523  44.192  1.00 36.14  ? 100 VAL D CB  1 
ATOM   4039 C CG1 . VAL D 4 99  ? 1.953   87.587  43.882  1.00 43.40  ? 100 VAL D CG1 1 
ATOM   4040 C CG2 . VAL D 4 99  ? 4.050   87.887  45.204  1.00 31.26  ? 100 VAL D CG2 1 
ATOM   4041 N N   . ILE D 4 100 ? 4.623   91.141  43.200  1.00 35.36  ? 101 ILE D N   1 
ATOM   4042 C CA  . ILE D 4 100 ? 5.565   92.184  43.532  1.00 36.00  ? 101 ILE D CA  1 
ATOM   4043 C C   . ILE D 4 100 ? 5.128   92.795  44.848  1.00 40.96  ? 101 ILE D C   1 
ATOM   4044 O O   . ILE D 4 100 ? 3.929   92.934  45.104  1.00 41.75  ? 101 ILE D O   1 
ATOM   4045 C CB  . ILE D 4 100 ? 5.573   93.262  42.458  1.00 34.89  ? 101 ILE D CB  1 
ATOM   4046 C CG1 . ILE D 4 100 ? 5.850   92.620  41.094  1.00 38.80  ? 101 ILE D CG1 1 
ATOM   4047 C CG2 . ILE D 4 100 ? 6.613   94.318  42.803  1.00 36.08  ? 101 ILE D CG2 1 
ATOM   4048 C CD1 . ILE D 4 100 ? 5.679   93.570  39.903  1.00 36.88  ? 101 ILE D CD1 1 
ATOM   4049 N N   . SER D 4 101 ? 6.098   93.146  45.684  1.00 40.96  ? 102 SER D N   1 
ATOM   4050 C CA  . SER D 4 101 ? 5.817   93.753  46.981  1.00 43.55  ? 102 SER D CA  1 
ATOM   4051 C C   . SER D 4 101 ? 6.944   94.722  47.350  1.00 47.36  ? 102 SER D C   1 
ATOM   4052 O O   . SER D 4 101 ? 8.086   94.527  46.938  1.00 47.87  ? 102 SER D O   1 
ATOM   4053 C CB  . SER D 4 101 ? 5.684   92.665  48.047  1.00 36.93  ? 102 SER D CB  1 
ATOM   4054 O OG  . SER D 4 101 ? 6.884   91.921  48.162  1.00 43.46  ? 102 SER D OG  1 
ATOM   4055 N N   . LEU D 4 102 ? 6.624   95.766  48.111  1.00 50.01  ? 103 LEU D N   1 
ATOM   4056 C CA  . LEU D 4 102 ? 7.620   96.754  48.521  1.00 54.25  ? 103 LEU D CA  1 
ATOM   4057 C C   . LEU D 4 102 ? 8.176   96.350  49.880  1.00 60.25  ? 103 LEU D C   1 
ATOM   4058 O O   . LEU D 4 102 ? 7.439   95.844  50.719  1.00 70.70  ? 103 LEU D O   1 
ATOM   4059 C CB  . LEU D 4 102 ? 6.980   98.145  48.593  1.00 49.06  ? 103 LEU D CB  1 
ATOM   4060 C CG  . LEU D 4 102 ? 7.905   99.365  48.723  1.00 55.41  ? 103 LEU D CG  1 
ATOM   4061 C CD1 . LEU D 4 102 ? 8.913   99.397  47.587  1.00 49.76  ? 103 LEU D CD1 1 
ATOM   4062 C CD2 . LEU D 4 102 ? 7.073   100.635 48.714  1.00 50.61  ? 103 LEU D CD2 1 
ATOM   4063 N N   . SER D 4 103 ? 9.468   96.569  50.103  1.00 72.64  ? 104 SER D N   1 
ATOM   4064 C CA  . SER D 4 103 ? 10.088  96.187  51.370  1.00 85.96  ? 104 SER D CA  1 
ATOM   4065 C C   . SER D 4 103 ? 9.825   97.107  52.551  1.00 97.20  ? 104 SER D C   1 
ATOM   4066 O O   . SER D 4 103 ? 9.664   96.633  53.678  1.00 98.82  ? 104 SER D O   1 
ATOM   4067 C CB  . SER D 4 103 ? 11.596  96.022  51.193  1.00 87.24  ? 104 SER D CB  1 
ATOM   4068 O OG  . SER D 4 103 ? 11.888  94.819  50.503  1.00 94.95  ? 104 SER D OG  1 
ATOM   4069 N N   . ARG D 4 104 ? 9.784   98.415  52.309  1.00 109.97 ? 105 ARG D N   1 
ATOM   4070 C CA  . ARG D 4 104 ? 9.539   99.365  53.393  1.00 123.04 ? 105 ARG D CA  1 
ATOM   4071 C C   . ARG D 4 104 ? 8.158   100.040 53.316  1.00 131.43 ? 105 ARG D C   1 
ATOM   4072 O O   . ARG D 4 104 ? 7.173   99.394  52.940  1.00 133.69 ? 105 ARG D O   1 
ATOM   4073 C CB  . ARG D 4 104 ? 10.662  100.409 53.431  1.00 120.57 ? 105 ARG D CB  1 
ATOM   4074 C CG  . ARG D 4 104 ? 12.045  99.783  53.301  1.00 122.78 ? 105 ARG D CG  1 
ATOM   4075 C CD  . ARG D 4 104 ? 13.130  100.593 53.993  1.00 124.22 ? 105 ARG D CD  1 
ATOM   4076 N NE  . ARG D 4 104 ? 12.995  100.561 55.448  1.00 123.83 ? 105 ARG D NE  1 
ATOM   4077 C CZ  . ARG D 4 104 ? 13.950  100.929 56.297  1.00 123.87 ? 105 ARG D CZ  1 
ATOM   4078 N NH1 . ARG D 4 104 ? 15.122  101.359 55.844  1.00 121.07 ? 105 ARG D NH1 1 
ATOM   4079 N NH2 . ARG D 4 104 ? 13.733  100.869 57.604  1.00 122.14 ? 105 ARG D NH2 1 
ATOM   4080 N N   . THR D 4 105 ? 8.079   101.324 53.673  1.00 137.62 ? 106 THR D N   1 
ATOM   4081 C CA  . THR D 4 105 ? 6.799   102.046 53.662  1.00 141.78 ? 106 THR D CA  1 
ATOM   4082 C C   . THR D 4 105 ? 6.461   102.734 52.328  1.00 144.21 ? 106 THR D C   1 
ATOM   4083 O O   . THR D 4 105 ? 7.353   103.186 51.604  1.00 143.24 ? 106 THR D O   1 
ATOM   4084 C CB  . THR D 4 105 ? 6.746   103.112 54.800  1.00 141.64 ? 106 THR D CB  1 
ATOM   4085 O OG1 . THR D 4 105 ? 7.044   102.491 56.059  1.00 137.83 ? 106 THR D OG1 1 
ATOM   4086 C CG2 . THR D 4 105 ? 5.354   103.746 54.880  1.00 139.05 ? 106 THR D CG2 1 
ATOM   4087 N N   . GLU D 4 106 ? 5.167   102.797 52.010  1.00 145.94 ? 107 GLU D N   1 
ATOM   4088 C CA  . GLU D 4 106 ? 4.681   103.435 50.776  1.00 147.81 ? 107 GLU D CA  1 
ATOM   4089 C C   . GLU D 4 106 ? 4.527   104.963 51.015  1.00 149.68 ? 107 GLU D C   1 
ATOM   4090 O O   . GLU D 4 106 ? 3.626   105.372 51.741  1.00 148.20 ? 107 GLU D O   1 
ATOM   4091 C CB  . GLU D 4 106 ? 3.330   102.813 50.385  1.00 147.80 ? 107 GLU D CB  1 
ATOM   4092 C CG  . GLU D 4 106 ? 2.730   103.419 49.137  1.00 147.29 ? 107 GLU D CG  1 
ATOM   4093 C CD  . GLU D 4 106 ? 3.451   102.971 47.882  1.00 147.06 ? 107 GLU D CD  1 
ATOM   4094 O OE1 . GLU D 4 106 ? 3.298   101.789 47.507  1.00 145.51 ? 107 GLU D OE1 1 
ATOM   4095 O OE2 . GLU D 4 106 ? 4.175   103.791 47.277  1.00 146.32 ? 107 GLU D OE2 1 
ATOM   4096 N N   . ALA D 4 107 ? 5.388   105.800 50.421  1.00 152.31 ? 108 ALA D N   1 
ATOM   4097 C CA  . ALA D 4 107 ? 5.339   107.265 50.647  1.00 153.68 ? 108 ALA D CA  1 
ATOM   4098 C C   . ALA D 4 107 ? 5.742   107.970 49.361  1.00 154.45 ? 108 ALA D C   1 
ATOM   4099 O O   . ALA D 4 107 ? 5.610   107.362 48.324  1.00 154.37 ? 108 ALA D O   1 
ATOM   4100 C CB  . ALA D 4 107 ? 6.246   107.650 51.817  1.00 152.98 ? 108 ALA D CB  1 
ATOM   4101 N N   . LEU D 4 108 ? 6.246   109.184 49.299  1.00 154.62 ? 109 LEU D N   1 
ATOM   4102 C CA  . LEU D 4 108 ? 6.421   109.551 47.899  1.00 153.79 ? 109 LEU D CA  1 
ATOM   4103 C C   . LEU D 4 108 ? 7.829   109.654 47.408  1.00 153.15 ? 109 LEU D C   1 
ATOM   4104 O O   . LEU D 4 108 ? 8.077   110.227 46.350  1.00 152.73 ? 109 LEU D O   1 
ATOM   4105 C CB  . LEU D 4 108 ? 5.685   110.843 47.587  1.00 152.09 ? 109 LEU D CB  1 
ATOM   4106 C CG  . LEU D 4 108 ? 4.177   110.885 47.812  1.00 150.25 ? 109 LEU D CG  1 
ATOM   4107 C CD1 . LEU D 4 108 ? 3.771   112.314 48.123  1.00 145.95 ? 109 LEU D CD1 1 
ATOM   4108 C CD2 . LEU D 4 108 ? 3.448   110.355 46.586  1.00 150.09 ? 109 LEU D CD2 1 
ATOM   4109 N N   . ASN D 4 109 ? 8.756   109.098 48.173  1.00 152.49 ? 110 ASN D N   1 
ATOM   4110 C CA  . ASN D 4 109 ? 10.161  109.172 47.806  1.00 151.81 ? 110 ASN D CA  1 
ATOM   4111 C C   . ASN D 4 109 ? 11.034  108.444 48.821  1.00 150.44 ? 110 ASN D C   1 
ATOM   4112 O O   . ASN D 4 109 ? 11.465  109.031 49.814  1.00 149.88 ? 110 ASN D O   1 
ATOM   4113 C CB  . ASN D 4 109 ? 10.584  110.644 47.710  1.00 152.85 ? 110 ASN D CB  1 
ATOM   4114 C CG  . ASN D 4 109 ? 12.059  110.813 47.418  1.00 153.58 ? 110 ASN D CG  1 
ATOM   4115 O OD1 . ASN D 4 109 ? 12.547  110.428 46.355  1.00 155.53 ? 110 ASN D OD1 1 
ATOM   4116 N ND2 . ASN D 4 109 ? 12.779  111.393 48.367  1.00 153.55 ? 110 ASN D ND2 1 
ATOM   4117 N N   . HIS D 4 110 ? 11.292  107.165 48.558  1.00 147.98 ? 111 HIS D N   1 
ATOM   4118 C CA  . HIS D 4 110 ? 12.115  106.328 49.431  1.00 143.02 ? 111 HIS D CA  1 
ATOM   4119 C C   . HIS D 4 110 ? 12.999  105.365 48.628  1.00 137.27 ? 111 HIS D C   1 
ATOM   4120 O O   . HIS D 4 110 ? 12.592  104.870 47.576  1.00 135.50 ? 111 HIS D O   1 
ATOM   4121 C CB  . HIS D 4 110 ? 11.226  105.496 50.368  1.00 146.25 ? 111 HIS D CB  1 
ATOM   4122 C CG  . HIS D 4 110 ? 10.771  106.218 51.605  1.00 148.47 ? 111 HIS D CG  1 
ATOM   4123 N ND1 . HIS D 4 110 ? 11.644  106.751 52.528  1.00 149.85 ? 111 HIS D ND1 1 
ATOM   4124 C CD2 . HIS D 4 110 ? 9.526   106.453 52.086  1.00 148.91 ? 111 HIS D CD2 1 
ATOM   4125 C CE1 . HIS D 4 110 ? 10.957  107.285 53.526  1.00 151.28 ? 111 HIS D CE1 1 
ATOM   4126 N NE2 . HIS D 4 110 ? 9.672   107.117 53.281  1.00 150.05 ? 111 HIS D NE2 1 
ATOM   4127 N N   . HIS D 4 111 ? 14.201  105.098 49.134  1.00 129.33 ? 112 HIS D N   1 
ATOM   4128 C CA  . HIS D 4 111 ? 15.124  104.175 48.475  1.00 116.79 ? 112 HIS D CA  1 
ATOM   4129 C C   . HIS D 4 111 ? 14.755  102.773 48.948  1.00 107.66 ? 112 HIS D C   1 
ATOM   4130 O O   . HIS D 4 111 ? 15.477  102.145 49.728  1.00 104.28 ? 112 HIS D O   1 
ATOM   4131 C CB  . HIS D 4 111 ? 16.573  104.498 48.857  1.00 115.39 ? 112 HIS D CB  1 
ATOM   4132 C CG  . HIS D 4 111 ? 17.591  103.804 48.007  1.00 112.18 ? 112 HIS D CG  1 
ATOM   4133 N ND1 . HIS D 4 111 ? 17.787  102.441 48.043  1.00 110.79 ? 112 HIS D ND1 1 
ATOM   4134 C CD2 . HIS D 4 111 ? 18.463  104.286 47.089  1.00 110.92 ? 112 HIS D CD2 1 
ATOM   4135 C CE1 . HIS D 4 111 ? 18.736  102.112 47.185  1.00 111.06 ? 112 HIS D CE1 1 
ATOM   4136 N NE2 . HIS D 4 111 ? 19.162  103.214 46.593  1.00 110.54 ? 112 HIS D NE2 1 
ATOM   4137 N N   . ASN D 4 112 ? 13.609  102.299 48.471  1.00 97.37  ? 113 ASN D N   1 
ATOM   4138 C CA  . ASN D 4 112 ? 13.105  100.990 48.844  1.00 88.73  ? 113 ASN D CA  1 
ATOM   4139 C C   . ASN D 4 112 ? 13.572  99.857  47.946  1.00 78.11  ? 113 ASN D C   1 
ATOM   4140 O O   . ASN D 4 112 ? 14.411  100.023 47.059  1.00 73.55  ? 113 ASN D O   1 
ATOM   4141 C CB  . ASN D 4 112 ? 11.577  101.004 48.863  1.00 96.06  ? 113 ASN D CB  1 
ATOM   4142 C CG  . ASN D 4 112 ? 11.016  101.948 49.901  1.00 101.54 ? 113 ASN D CG  1 
ATOM   4143 O OD1 . ASN D 4 112 ? 11.246  101.781 51.100  1.00 104.27 ? 113 ASN D OD1 1 
ATOM   4144 N ND2 . ASN D 4 112 ? 10.271  102.949 49.446  1.00 102.92 ? 113 ASN D ND2 1 
ATOM   4145 N N   . THR D 4 113 ? 12.987  98.697  48.184  1.00 64.37  ? 114 THR D N   1 
ATOM   4146 C CA  . THR D 4 113 ? 13.326  97.519  47.435  1.00 56.72  ? 114 THR D CA  1 
ATOM   4147 C C   . THR D 4 113 ? 12.073  96.798  46.966  1.00 54.04  ? 114 THR D C   1 
ATOM   4148 O O   . THR D 4 113 ? 11.218  96.437  47.771  1.00 48.93  ? 114 THR D O   1 
ATOM   4149 C CB  . THR D 4 113 ? 14.148  96.563  48.306  1.00 56.60  ? 114 THR D CB  1 
ATOM   4150 O OG1 . THR D 4 113 ? 15.324  97.239  48.762  1.00 57.95  ? 114 THR D OG1 1 
ATOM   4151 C CG2 . THR D 4 113 ? 14.538  95.316  47.522  1.00 54.65  ? 114 THR D CG2 1 
ATOM   4152 N N   . LEU D 4 114 ? 11.954  96.612  45.657  1.00 50.97  ? 115 LEU D N   1 
ATOM   4153 C CA  . LEU D 4 114 ? 10.820  95.882  45.114  1.00 45.53  ? 115 LEU D CA  1 
ATOM   4154 C C   . LEU D 4 114 ? 11.275  94.436  45.019  1.00 43.39  ? 115 LEU D C   1 
ATOM   4155 O O   . LEU D 4 114 ? 12.381  94.145  44.559  1.00 45.41  ? 115 LEU D O   1 
ATOM   4156 C CB  . LEU D 4 114 ? 10.424  96.400  43.728  1.00 37.36  ? 115 LEU D CB  1 
ATOM   4157 C CG  . LEU D 4 114 ? 9.709   97.750  43.700  1.00 39.66  ? 115 LEU D CG  1 
ATOM   4158 C CD1 . LEU D 4 114 ? 9.446   98.170  42.270  1.00 43.69  ? 115 LEU D CD1 1 
ATOM   4159 C CD2 . LEU D 4 114 ? 8.400   97.645  44.459  1.00 45.06  ? 115 LEU D CD2 1 
ATOM   4160 N N   . VAL D 4 115 ? 10.432  93.533  45.490  1.00 36.91  ? 116 VAL D N   1 
ATOM   4161 C CA  . VAL D 4 115 ? 10.748  92.123  45.450  1.00 33.32  ? 116 VAL D CA  1 
ATOM   4162 C C   . VAL D 4 115 ? 9.773   91.434  44.521  1.00 34.79  ? 116 VAL D C   1 
ATOM   4163 O O   . VAL D 4 115 ? 8.560   91.604  44.656  1.00 37.90  ? 116 VAL D O   1 
ATOM   4164 C CB  . VAL D 4 115 ? 10.607  91.463  46.851  1.00 36.51  ? 116 VAL D CB  1 
ATOM   4165 C CG1 . VAL D 4 115 ? 10.956  89.963  46.765  1.00 22.64  ? 116 VAL D CG1 1 
ATOM   4166 C CG2 . VAL D 4 115 ? 11.504  92.174  47.858  1.00 34.80  ? 116 VAL D CG2 1 
ATOM   4167 N N   . CYS D 4 116 ? 10.292  90.673  43.564  1.00 32.72  ? 117 CYS D N   1 
ATOM   4168 C CA  . CYS D 4 116 ? 9.405   89.939  42.679  1.00 32.28  ? 117 CYS D CA  1 
ATOM   4169 C C   . CYS D 4 116 ? 9.516   88.471  43.090  1.00 31.32  ? 117 CYS D C   1 
ATOM   4170 O O   . CYS D 4 116 ? 10.548  87.833  42.891  1.00 34.29  ? 117 CYS D O   1 
ATOM   4171 C CB  . CYS D 4 116 ? 9.787   90.117  41.208  1.00 32.79  ? 117 CYS D CB  1 
ATOM   4172 S SG  . CYS D 4 116 ? 8.622   89.230  40.124  1.00 48.87  ? 117 CYS D SG  1 
ATOM   4173 N N   . SER D 4 117 ? 8.452   87.952  43.691  1.00 26.13  ? 118 SER D N   1 
ATOM   4174 C CA  . SER D 4 117 ? 8.425   86.574  44.143  1.00 29.38  ? 118 SER D CA  1 
ATOM   4175 C C   . SER D 4 117 ? 7.865   85.664  43.062  1.00 28.51  ? 118 SER D C   1 
ATOM   4176 O O   . SER D 4 117 ? 6.703   85.784  42.679  1.00 30.63  ? 118 SER D O   1 
ATOM   4177 C CB  . SER D 4 117 ? 7.555   86.441  45.399  1.00 32.11  ? 118 SER D CB  1 
ATOM   4178 O OG  . SER D 4 117 ? 7.966   87.347  46.399  1.00 43.27  ? 118 SER D OG  1 
ATOM   4179 N N   . VAL D 4 118 ? 8.690   84.734  42.602  1.00 29.69  ? 119 VAL D N   1 
ATOM   4180 C CA  . VAL D 4 118 ? 8.304   83.781  41.563  1.00 25.69  ? 119 VAL D CA  1 
ATOM   4181 C C   . VAL D 4 118 ? 8.301   82.408  42.243  1.00 23.01  ? 119 VAL D C   1 
ATOM   4182 O O   . VAL D 4 118 ? 9.350   81.854  42.538  1.00 27.88  ? 119 VAL D O   1 
ATOM   4183 C CB  . VAL D 4 118 ? 9.330   83.870  40.410  1.00 24.21  ? 119 VAL D CB  1 
ATOM   4184 C CG1 . VAL D 4 118 ? 8.912   82.990  39.252  1.00 25.97  ? 119 VAL D CG1 1 
ATOM   4185 C CG2 . VAL D 4 118 ? 9.448   85.359  39.969  1.00 17.61  ? 119 VAL D CG2 1 
ATOM   4186 N N   . THR D 4 119 ? 7.117   81.840  42.453  1.00 31.05  ? 120 THR D N   1 
ATOM   4187 C CA  . THR D 4 119 ? 7.021   80.596  43.220  1.00 29.20  ? 120 THR D CA  1 
ATOM   4188 C C   . THR D 4 119 ? 6.200   79.416  42.702  1.00 30.21  ? 120 THR D C   1 
ATOM   4189 O O   . THR D 4 119 ? 5.283   79.582  41.903  1.00 32.12  ? 120 THR D O   1 
ATOM   4190 C CB  . THR D 4 119 ? 6.469   80.936  44.623  1.00 33.11  ? 120 THR D CB  1 
ATOM   4191 O OG1 . THR D 4 119 ? 5.122   81.414  44.486  1.00 35.59  ? 120 THR D OG1 1 
ATOM   4192 C CG2 . THR D 4 119 ? 7.281   82.054  45.274  1.00 19.27  ? 120 THR D CG2 1 
ATOM   4193 N N   . ASP D 4 120 ? 6.536   78.228  43.215  1.00 29.44  ? 121 ASP D N   1 
ATOM   4194 C CA  . ASP D 4 120 ? 5.858   76.962  42.900  1.00 30.29  ? 121 ASP D CA  1 
ATOM   4195 C C   . ASP D 4 120 ? 5.926   76.499  41.452  1.00 33.16  ? 121 ASP D C   1 
ATOM   4196 O O   . ASP D 4 120 ? 4.977   75.911  40.925  1.00 31.29  ? 121 ASP D O   1 
ATOM   4197 C CB  . ASP D 4 120 ? 4.386   77.024  43.325  1.00 29.68  ? 121 ASP D CB  1 
ATOM   4198 C CG  . ASP D 4 120 ? 4.210   77.147  44.832  1.00 40.35  ? 121 ASP D CG  1 
ATOM   4199 O OD1 . ASP D 4 120 ? 5.164   76.834  45.582  1.00 40.69  ? 121 ASP D OD1 1 
ATOM   4200 O OD2 . ASP D 4 120 ? 3.105   77.545  45.268  1.00 41.22  ? 121 ASP D OD2 1 
ATOM   4201 N N   . PHE D 4 121 ? 7.057   76.743  40.810  1.00 30.99  ? 122 PHE D N   1 
ATOM   4202 C CA  . PHE D 4 121 ? 7.214   76.344  39.427  1.00 31.05  ? 122 PHE D CA  1 
ATOM   4203 C C   . PHE D 4 121 ? 8.129   75.154  39.257  1.00 31.38  ? 122 PHE D C   1 
ATOM   4204 O O   . PHE D 4 121 ? 8.950   74.860  40.116  1.00 34.90  ? 122 PHE D O   1 
ATOM   4205 C CB  . PHE D 4 121 ? 7.747   77.508  38.604  1.00 26.57  ? 122 PHE D CB  1 
ATOM   4206 C CG  . PHE D 4 121 ? 9.092   78.000  39.043  1.00 26.58  ? 122 PHE D CG  1 
ATOM   4207 C CD1 . PHE D 4 121 ? 10.253  77.327  38.668  1.00 26.58  ? 122 PHE D CD1 1 
ATOM   4208 C CD2 . PHE D 4 121 ? 9.204   79.155  39.816  1.00 28.18  ? 122 PHE D CD2 1 
ATOM   4209 C CE1 . PHE D 4 121 ? 11.495  77.799  39.054  1.00 22.78  ? 122 PHE D CE1 1 
ATOM   4210 C CE2 . PHE D 4 121 ? 10.449  79.635  40.209  1.00 20.72  ? 122 PHE D CE2 1 
ATOM   4211 C CZ  . PHE D 4 121 ? 11.595  78.957  39.826  1.00 25.96  ? 122 PHE D CZ  1 
ATOM   4212 N N   . TYR D 4 122 ? 7.951   74.468  38.138  1.00 33.80  ? 123 TYR D N   1 
ATOM   4213 C CA  . TYR D 4 122 ? 8.757   73.324  37.777  1.00 31.38  ? 123 TYR D CA  1 
ATOM   4214 C C   . TYR D 4 122 ? 8.590   73.191  36.269  1.00 33.18  ? 123 TYR D C   1 
ATOM   4215 O O   . TYR D 4 122 ? 7.484   73.354  35.749  1.00 29.28  ? 123 TYR D O   1 
ATOM   4216 C CB  . TYR D 4 122 ? 8.271   72.062  38.491  1.00 32.28  ? 123 TYR D CB  1 
ATOM   4217 C CG  . TYR D 4 122 ? 9.216   70.892  38.326  1.00 33.59  ? 123 TYR D CG  1 
ATOM   4218 C CD1 . TYR D 4 122 ? 9.166   70.077  37.192  1.00 30.66  ? 123 TYR D CD1 1 
ATOM   4219 C CD2 . TYR D 4 122 ? 10.184  70.620  39.288  1.00 31.42  ? 123 TYR D CD2 1 
ATOM   4220 C CE1 . TYR D 4 122 ? 10.058  69.023  37.025  1.00 20.30  ? 123 TYR D CE1 1 
ATOM   4221 C CE2 . TYR D 4 122 ? 11.080  69.570  39.131  1.00 33.41  ? 123 TYR D CE2 1 
ATOM   4222 C CZ  . TYR D 4 122 ? 11.011  68.776  37.996  1.00 32.16  ? 123 TYR D CZ  1 
ATOM   4223 O OH  . TYR D 4 122 ? 11.897  67.742  37.844  1.00 33.60  ? 123 TYR D OH  1 
ATOM   4224 N N   . PRO D 4 123 ? 9.679   72.876  35.551  1.00 33.72  ? 124 PRO D N   1 
ATOM   4225 C CA  . PRO D 4 123 ? 11.019  72.640  36.095  1.00 31.26  ? 124 PRO D CA  1 
ATOM   4226 C C   . PRO D 4 123 ? 11.861  73.877  36.401  1.00 29.60  ? 124 PRO D C   1 
ATOM   4227 O O   . PRO D 4 123 ? 11.361  75.000  36.414  1.00 32.23  ? 124 PRO D O   1 
ATOM   4228 C CB  . PRO D 4 123 ? 11.655  71.738  35.038  1.00 31.83  ? 124 PRO D CB  1 
ATOM   4229 C CG  . PRO D 4 123 ? 11.076  72.280  33.786  1.00 27.13  ? 124 PRO D CG  1 
ATOM   4230 C CD  . PRO D 4 123 ? 9.621   72.491  34.129  1.00 34.04  ? 124 PRO D CD  1 
ATOM   4231 N N   . ALA D 4 124 ? 13.151  73.639  36.634  1.00 30.29  ? 125 ALA D N   1 
ATOM   4232 C CA  . ALA D 4 124 ? 14.136  74.667  36.989  1.00 38.01  ? 125 ALA D CA  1 
ATOM   4233 C C   . ALA D 4 124 ? 14.388  75.844  36.035  1.00 34.57  ? 125 ALA D C   1 
ATOM   4234 O O   . ALA D 4 124 ? 14.524  76.977  36.479  1.00 38.36  ? 125 ALA D O   1 
ATOM   4235 C CB  . ALA D 4 124 ? 15.467  73.986  37.303  1.00 34.47  ? 125 ALA D CB  1 
ATOM   4236 N N   . LYS D 4 125 ? 14.479  75.574  34.738  1.00 40.54  ? 126 LYS D N   1 
ATOM   4237 C CA  . LYS D 4 125 ? 14.736  76.617  33.743  1.00 36.95  ? 126 LYS D CA  1 
ATOM   4238 C C   . LYS D 4 125 ? 13.720  77.728  33.878  1.00 38.71  ? 126 LYS D C   1 
ATOM   4239 O O   . LYS D 4 125 ? 12.524  77.474  33.866  1.00 40.52  ? 126 LYS D O   1 
ATOM   4240 C CB  . LYS D 4 125 ? 14.640  76.029  32.340  1.00 51.44  ? 126 LYS D CB  1 
ATOM   4241 C CG  . LYS D 4 125 ? 14.968  77.000  31.220  1.00 63.50  ? 126 LYS D CG  1 
ATOM   4242 C CD  . LYS D 4 125 ? 14.827  76.325  29.858  1.00 73.93  ? 126 LYS D CD  1 
ATOM   4243 C CE  . LYS D 4 125 ? 15.696  76.989  28.795  1.00 75.90  ? 126 LYS D CE  1 
ATOM   4244 N NZ  . LYS D 4 125 ? 15.412  78.441  28.647  1.00 81.91  ? 126 LYS D NZ  1 
ATOM   4245 N N   . ILE D 4 126 ? 14.186  78.961  34.005  1.00 34.03  ? 127 ILE D N   1 
ATOM   4246 C CA  . ILE D 4 126 ? 13.268  80.079  34.140  1.00 33.43  ? 127 ILE D CA  1 
ATOM   4247 C C   . ILE D 4 126 ? 14.029  81.370  33.917  1.00 33.99  ? 127 ILE D C   1 
ATOM   4248 O O   . ILE D 4 126 ? 15.244  81.407  34.102  1.00 30.70  ? 127 ILE D O   1 
ATOM   4249 C CB  . ILE D 4 126 ? 12.645  80.121  35.558  1.00 38.25  ? 127 ILE D CB  1 
ATOM   4250 C CG1 . ILE D 4 126 ? 11.443  81.066  35.580  1.00 29.76  ? 127 ILE D CG1 1 
ATOM   4251 C CG2 . ILE D 4 126 ? 13.698  80.613  36.577  1.00 31.34  ? 127 ILE D CG2 1 
ATOM   4252 C CD1 . ILE D 4 126 ? 10.579  80.942  36.841  1.00 28.66  ? 127 ILE D CD1 1 
ATOM   4253 N N   . LYS D 4 127 ? 13.314  82.425  33.536  1.00 28.43  ? 128 LYS D N   1 
ATOM   4254 C CA  . LYS D 4 127 ? 13.934  83.725  33.316  1.00 32.96  ? 128 LYS D CA  1 
ATOM   4255 C C   . LYS D 4 127 ? 13.052  84.829  33.905  1.00 25.69  ? 128 LYS D C   1 
ATOM   4256 O O   . LYS D 4 127 ? 11.875  84.931  33.586  1.00 35.11  ? 128 LYS D O   1 
ATOM   4257 C CB  . LYS D 4 127 ? 14.172  83.982  31.818  1.00 30.57  ? 128 LYS D CB  1 
ATOM   4258 C CG  . LYS D 4 127 ? 14.830  85.343  31.556  1.00 46.61  ? 128 LYS D CG  1 
ATOM   4259 C CD  . LYS D 4 127 ? 15.349  85.508  30.134  1.00 48.05  ? 128 LYS D CD  1 
ATOM   4260 C CE  . LYS D 4 127 ? 14.233  85.714  29.129  1.00 50.90  ? 128 LYS D CE  1 
ATOM   4261 N NZ  . LYS D 4 127 ? 14.788  85.661  27.755  1.00 50.75  ? 128 LYS D NZ  1 
ATOM   4262 N N   . VAL D 4 128 ? 13.638  85.654  34.764  1.00 28.35  ? 129 VAL D N   1 
ATOM   4263 C CA  . VAL D 4 128 ? 12.910  86.726  35.419  1.00 22.83  ? 129 VAL D CA  1 
ATOM   4264 C C   . VAL D 4 128 ? 13.656  88.035  35.238  1.00 30.07  ? 129 VAL D C   1 
ATOM   4265 O O   . VAL D 4 128 ? 14.855  88.104  35.492  1.00 28.75  ? 129 VAL D O   1 
ATOM   4266 C CB  . VAL D 4 128 ? 12.753  86.435  36.933  1.00 25.26  ? 129 VAL D CB  1 
ATOM   4267 C CG1 . VAL D 4 128 ? 11.767  87.392  37.527  1.00 24.51  ? 129 VAL D CG1 1 
ATOM   4268 C CG2 . VAL D 4 128 ? 12.280  84.975  37.157  1.00 16.99  ? 129 VAL D CG2 1 
ATOM   4269 N N   . ARG D 4 129 ? 12.938  89.076  34.807  1.00 29.69  ? 130 ARG D N   1 
ATOM   4270 C CA  . ARG D 4 129 ? 13.558  90.374  34.570  1.00 29.52  ? 130 ARG D CA  1 
ATOM   4271 C C   . ARG D 4 129 ? 12.716  91.534  35.040  1.00 30.04  ? 130 ARG D C   1 
ATOM   4272 O O   . ARG D 4 129 ? 11.483  91.450  35.115  1.00 23.89  ? 130 ARG D O   1 
ATOM   4273 C CB  . ARG D 4 129 ? 13.846  90.560  33.085  1.00 30.88  ? 130 ARG D CB  1 
ATOM   4274 C CG  . ARG D 4 129 ? 14.814  89.545  32.529  1.00 43.53  ? 130 ARG D CG  1 
ATOM   4275 C CD  . ARG D 4 129 ? 14.981  89.753  31.049  1.00 49.94  ? 130 ARG D CD  1 
ATOM   4276 N NE  . ARG D 4 129 ? 13.789  89.380  30.302  1.00 44.16  ? 130 ARG D NE  1 
ATOM   4277 C CZ  . ARG D 4 129 ? 13.591  89.708  29.032  1.00 47.49  ? 130 ARG D CZ  1 
ATOM   4278 N NH1 . ARG D 4 129 ? 14.513  90.425  28.401  1.00 42.33  ? 130 ARG D NH1 1 
ATOM   4279 N NH2 . ARG D 4 129 ? 12.502  89.298  28.386  1.00 33.74  ? 130 ARG D NH2 1 
ATOM   4280 N N   . TRP D 4 130 ? 13.407  92.628  35.328  1.00 27.41  ? 131 TRP D N   1 
ATOM   4281 C CA  . TRP D 4 130 ? 12.781  93.853  35.798  1.00 37.19  ? 131 TRP D CA  1 
ATOM   4282 C C   . TRP D 4 130 ? 12.821  94.956  34.753  1.00 35.91  ? 131 TRP D C   1 
ATOM   4283 O O   . TRP D 4 130 ? 13.820  95.163  34.069  1.00 32.26  ? 131 TRP D O   1 
ATOM   4284 C CB  . TRP D 4 130 ? 13.486  94.367  37.058  1.00 38.78  ? 131 TRP D CB  1 
ATOM   4285 C CG  . TRP D 4 130 ? 12.947  93.841  38.354  1.00 38.53  ? 131 TRP D CG  1 
ATOM   4286 C CD1 . TRP D 4 130 ? 13.598  93.040  39.255  1.00 38.68  ? 131 TRP D CD1 1 
ATOM   4287 C CD2 . TRP D 4 130 ? 11.693  94.180  38.951  1.00 32.43  ? 131 TRP D CD2 1 
ATOM   4288 N NE1 . TRP D 4 130 ? 12.827  92.871  40.386  1.00 38.08  ? 131 TRP D NE1 1 
ATOM   4289 C CE2 . TRP D 4 130 ? 11.655  93.562  40.227  1.00 33.42  ? 131 TRP D CE2 1 
ATOM   4290 C CE3 . TRP D 4 130 ? 10.600  94.954  38.537  1.00 24.46  ? 131 TRP D CE3 1 
ATOM   4291 C CZ2 . TRP D 4 130 ? 10.570  93.697  41.088  1.00 27.70  ? 131 TRP D CZ2 1 
ATOM   4292 C CZ3 . TRP D 4 130 ? 9.527   95.092  39.389  1.00 29.44  ? 131 TRP D CZ3 1 
ATOM   4293 C CH2 . TRP D 4 130 ? 9.518   94.465  40.657  1.00 30.86  ? 131 TRP D CH2 1 
ATOM   4294 N N   . PHE D 4 131 ? 11.719  95.671  34.644  1.00 37.32  ? 132 PHE D N   1 
ATOM   4295 C CA  . PHE D 4 131 ? 11.641  96.777  33.720  1.00 37.93  ? 132 PHE D CA  1 
ATOM   4296 C C   . PHE D 4 131 ? 11.071  97.974  34.458  1.00 44.38  ? 132 PHE D C   1 
ATOM   4297 O O   . PHE D 4 131 ? 10.241  97.830  35.366  1.00 40.58  ? 132 PHE D O   1 
ATOM   4298 C CB  . PHE D 4 131 ? 10.746  96.428  32.526  1.00 35.38  ? 132 PHE D CB  1 
ATOM   4299 C CG  . PHE D 4 131 ? 11.301  95.341  31.658  1.00 39.87  ? 132 PHE D CG  1 
ATOM   4300 C CD1 . PHE D 4 131 ? 11.155  94.007  32.015  1.00 35.32  ? 132 PHE D CD1 1 
ATOM   4301 C CD2 . PHE D 4 131 ? 12.020  95.656  30.503  1.00 32.96  ? 132 PHE D CD2 1 
ATOM   4302 C CE1 . PHE D 4 131 ? 11.718  92.999  31.238  1.00 43.90  ? 132 PHE D CE1 1 
ATOM   4303 C CE2 . PHE D 4 131 ? 12.587  94.661  29.722  1.00 34.96  ? 132 PHE D CE2 1 
ATOM   4304 C CZ  . PHE D 4 131 ? 12.438  93.327  30.088  1.00 43.49  ? 132 PHE D CZ  1 
ATOM   4305 N N   . ARG D 4 132 ? 11.550  99.149  34.072  1.00 48.51  ? 133 ARG D N   1 
ATOM   4306 C CA  . ARG D 4 132 ? 11.102  100.422 34.622  1.00 49.71  ? 133 ARG D CA  1 
ATOM   4307 C C   . ARG D 4 132 ? 10.703  101.192 33.364  1.00 49.56  ? 133 ARG D C   1 
ATOM   4308 O O   . ARG D 4 132 ? 11.536  101.445 32.489  1.00 48.25  ? 133 ARG D O   1 
ATOM   4309 C CB  . ARG D 4 132 ? 12.253  101.111 35.350  1.00 55.52  ? 133 ARG D CB  1 
ATOM   4310 C CG  . ARG D 4 132 ? 11.924  102.478 35.914  1.00 65.38  ? 133 ARG D CG  1 
ATOM   4311 C CD  . ARG D 4 132 ? 13.138  103.061 36.630  1.00 73.27  ? 133 ARG D CD  1 
ATOM   4312 N NE  . ARG D 4 132 ? 13.068  104.514 36.692  1.00 83.88  ? 133 ARG D NE  1 
ATOM   4313 C CZ  . ARG D 4 132 ? 13.112  105.305 35.623  1.00 90.81  ? 133 ARG D CZ  1 
ATOM   4314 N NH1 . ARG D 4 132 ? 13.233  104.776 34.411  1.00 90.52  ? 133 ARG D NH1 1 
ATOM   4315 N NH2 . ARG D 4 132 ? 13.021  106.623 35.762  1.00 92.79  ? 133 ARG D NH2 1 
ATOM   4316 N N   . ASN D 4 133 ? 9.422   101.527 33.264  1.00 51.15  ? 134 ASN D N   1 
ATOM   4317 C CA  . ASN D 4 133 ? 8.883   102.226 32.098  1.00 52.31  ? 134 ASN D CA  1 
ATOM   4318 C C   . ASN D 4 133 ? 9.309   101.560 30.781  1.00 52.30  ? 134 ASN D C   1 
ATOM   4319 O O   . ASN D 4 133 ? 9.757   102.226 29.840  1.00 51.39  ? 134 ASN D O   1 
ATOM   4320 C CB  . ASN D 4 133 ? 9.298   103.702 32.108  1.00 54.10  ? 134 ASN D CB  1 
ATOM   4321 C CG  . ASN D 4 133 ? 8.696   104.469 33.275  1.00 51.90  ? 134 ASN D CG  1 
ATOM   4322 O OD1 . ASN D 4 133 ? 7.570   104.197 33.698  1.00 46.03  ? 134 ASN D OD1 1 
ATOM   4323 N ND2 . ASN D 4 133 ? 9.438   105.441 33.790  1.00 44.99  ? 134 ASN D ND2 1 
ATOM   4324 N N   . GLY D 4 134 ? 9.171   100.237 30.732  1.00 40.99  ? 135 GLY D N   1 
ATOM   4325 C CA  . GLY D 4 134 ? 9.520   99.502  29.534  1.00 42.40  ? 135 GLY D CA  1 
ATOM   4326 C C   . GLY D 4 134 ? 10.995  99.256  29.280  1.00 43.47  ? 135 GLY D C   1 
ATOM   4327 O O   . GLY D 4 134 ? 11.352  98.566  28.330  1.00 46.95  ? 135 GLY D O   1 
ATOM   4328 N N   . GLN D 4 135 ? 11.867  99.818  30.102  1.00 46.92  ? 136 GLN D N   1 
ATOM   4329 C CA  . GLN D 4 135 ? 13.289  99.597  29.892  1.00 48.19  ? 136 GLN D CA  1 
ATOM   4330 C C   . GLN D 4 135 ? 13.797  98.668  30.977  1.00 47.24  ? 136 GLN D C   1 
ATOM   4331 O O   . GLN D 4 135 ? 13.492  98.861  32.155  1.00 48.63  ? 136 GLN D O   1 
ATOM   4332 C CB  . GLN D 4 135 ? 14.042  100.927 29.921  1.00 52.22  ? 136 GLN D CB  1 
ATOM   4333 C CG  . GLN D 4 135 ? 13.740  101.831 28.731  1.00 71.09  ? 136 GLN D CG  1 
ATOM   4334 C CD  . GLN D 4 135 ? 14.249  101.261 27.408  1.00 84.83  ? 136 GLN D CD  1 
ATOM   4335 O OE1 . GLN D 4 135 ? 15.465  101.192 27.168  1.00 85.42  ? 136 GLN D OE1 1 
ATOM   4336 N NE2 . GLN D 4 135 ? 13.319  100.847 26.542  1.00 85.90  ? 136 GLN D NE2 1 
ATOM   4337 N N   . GLU D 4 136 ? 14.571  97.663  30.583  1.00 35.12  ? 137 GLU D N   1 
ATOM   4338 C CA  . GLU D 4 136 ? 15.089  96.706  31.548  1.00 37.96  ? 137 GLU D CA  1 
ATOM   4339 C C   . GLU D 4 136 ? 16.112  97.272  32.524  1.00 36.11  ? 137 GLU D C   1 
ATOM   4340 O O   . GLU D 4 136 ? 17.034  97.985  32.147  1.00 42.67  ? 137 GLU D O   1 
ATOM   4341 C CB  . GLU D 4 136 ? 15.690  95.487  30.834  1.00 39.95  ? 137 GLU D CB  1 
ATOM   4342 C CG  . GLU D 4 136 ? 16.308  94.478  31.791  1.00 43.69  ? 137 GLU D CG  1 
ATOM   4343 C CD  . GLU D 4 136 ? 16.789  93.210  31.112  1.00 44.89  ? 137 GLU D CD  1 
ATOM   4344 O OE1 . GLU D 4 136 ? 17.279  93.273  29.963  1.00 52.89  ? 137 GLU D OE1 1 
ATOM   4345 O OE2 . GLU D 4 136 ? 16.694  92.142  31.747  1.00 48.03  ? 137 GLU D OE2 1 
ATOM   4346 N N   . GLU D 4 137 ? 15.922  96.949  33.792  1.00 34.27  ? 138 GLU D N   1 
ATOM   4347 C CA  . GLU D 4 137 ? 16.836  97.372  34.839  1.00 38.33  ? 138 GLU D CA  1 
ATOM   4348 C C   . GLU D 4 137 ? 17.742  96.182  35.171  1.00 33.72  ? 138 GLU D C   1 
ATOM   4349 O O   . GLU D 4 137 ? 17.264  95.060  35.353  1.00 27.08  ? 138 GLU D O   1 
ATOM   4350 C CB  . GLU D 4 137 ? 16.054  97.799  36.086  1.00 39.52  ? 138 GLU D CB  1 
ATOM   4351 C CG  . GLU D 4 137 ? 15.433  99.181  35.983  1.00 55.06  ? 138 GLU D CG  1 
ATOM   4352 C CD  . GLU D 4 137 ? 16.452  100.287 36.215  1.00 63.04  ? 138 GLU D CD  1 
ATOM   4353 O OE1 . GLU D 4 137 ? 17.662  100.043 35.995  1.00 62.40  ? 138 GLU D OE1 1 
ATOM   4354 O OE2 . GLU D 4 137 ? 16.040  101.401 36.613  1.00 70.43  ? 138 GLU D OE2 1 
ATOM   4355 N N   . THR D 4 138 ? 19.046  96.419  35.227  1.00 30.01  ? 139 THR D N   1 
ATOM   4356 C CA  . THR D 4 138 ? 19.975  95.356  35.562  1.00 27.81  ? 139 THR D CA  1 
ATOM   4357 C C   . THR D 4 138 ? 20.956  95.780  36.642  1.00 32.18  ? 139 THR D C   1 
ATOM   4358 O O   . THR D 4 138 ? 21.648  94.939  37.211  1.00 33.95  ? 139 THR D O   1 
ATOM   4359 C CB  . THR D 4 138 ? 20.782  94.892  34.322  1.00 34.61  ? 139 THR D CB  1 
ATOM   4360 O OG1 . THR D 4 138 ? 21.497  96.006  33.755  1.00 31.63  ? 139 THR D OG1 1 
ATOM   4361 C CG2 . THR D 4 138 ? 19.844  94.281  33.288  1.00 23.22  ? 139 THR D CG2 1 
ATOM   4362 N N   . VAL D 4 139 ? 21.004  97.077  36.936  1.00 29.89  ? 140 VAL D N   1 
ATOM   4363 C CA  . VAL D 4 139 ? 21.932  97.592  37.929  1.00 37.98  ? 140 VAL D CA  1 
ATOM   4364 C C   . VAL D 4 139 ? 21.649  97.329  39.419  1.00 40.39  ? 140 VAL D C   1 
ATOM   4365 O O   . VAL D 4 139 ? 22.489  96.756  40.107  1.00 52.08  ? 140 VAL D O   1 
ATOM   4366 C CB  . VAL D 4 139 ? 22.187  99.094  37.685  1.00 41.54  ? 140 VAL D CB  1 
ATOM   4367 C CG1 . VAL D 4 139 ? 22.883  99.741  38.883  1.00 40.07  ? 140 VAL D CG1 1 
ATOM   4368 C CG2 . VAL D 4 139 ? 23.055  99.239  36.454  1.00 37.12  ? 140 VAL D CG2 1 
ATOM   4369 N N   . GLY D 4 140 ? 20.515  97.726  39.961  1.00 33.34  ? 141 GLY D N   1 
ATOM   4370 C CA  . GLY D 4 140 ? 20.351  97.417  41.384  1.00 35.48  ? 141 GLY D CA  1 
ATOM   4371 C C   . GLY D 4 140 ? 19.524  96.164  41.543  1.00 33.38  ? 141 GLY D C   1 
ATOM   4372 O O   . GLY D 4 140 ? 18.678  96.076  42.427  1.00 32.45  ? 141 GLY D O   1 
ATOM   4373 N N   . VAL D 4 141 ? 19.780  95.194  40.669  1.00 29.96  ? 142 VAL D N   1 
ATOM   4374 C CA  . VAL D 4 141 ? 19.014  93.962  40.636  1.00 22.08  ? 142 VAL D CA  1 
ATOM   4375 C C   . VAL D 4 141 ? 19.765  92.741  41.108  1.00 27.22  ? 142 VAL D C   1 
ATOM   4376 O O   . VAL D 4 141 ? 20.951  92.571  40.829  1.00 33.16  ? 142 VAL D O   1 
ATOM   4377 C CB  . VAL D 4 141 ? 18.494  93.684  39.194  1.00 28.85  ? 142 VAL D CB  1 
ATOM   4378 C CG1 . VAL D 4 141 ? 17.677  92.381  39.147  1.00 22.54  ? 142 VAL D CG1 1 
ATOM   4379 C CG2 . VAL D 4 141 ? 17.646  94.839  38.727  1.00 23.81  ? 142 VAL D CG2 1 
ATOM   4380 N N   . SER D 4 142 ? 19.060  91.880  41.828  1.00 27.41  ? 143 SER D N   1 
ATOM   4381 C CA  . SER D 4 142 ? 19.673  90.657  42.320  1.00 29.09  ? 143 SER D CA  1 
ATOM   4382 C C   . SER D 4 142 ? 18.613  89.633  42.594  1.00 30.42  ? 143 SER D C   1 
ATOM   4383 O O   . SER D 4 142 ? 17.489  89.950  43.001  1.00 33.72  ? 143 SER D O   1 
ATOM   4384 C CB  . SER D 4 142 ? 20.513  90.900  43.586  1.00 33.04  ? 143 SER D CB  1 
ATOM   4385 O OG  . SER D 4 142 ? 19.815  91.655  44.554  1.00 46.68  ? 143 SER D OG  1 
ATOM   4386 N N   . SER D 4 143 ? 18.970  88.391  42.332  1.00 28.09  ? 144 SER D N   1 
ATOM   4387 C CA  . SER D 4 143 ? 18.052  87.304  42.551  1.00 34.00  ? 144 SER D CA  1 
ATOM   4388 C C   . SER D 4 143 ? 18.755  86.249  43.365  1.00 32.72  ? 144 SER D C   1 
ATOM   4389 O O   . SER D 4 143 ? 19.974  86.103  43.321  1.00 28.72  ? 144 SER D O   1 
ATOM   4390 C CB  . SER D 4 143 ? 17.608  86.710  41.221  1.00 33.70  ? 144 SER D CB  1 
ATOM   4391 O OG  . SER D 4 143 ? 18.738  86.293  40.491  1.00 34.74  ? 144 SER D OG  1 
ATOM   4392 N N   . THR D 4 144 ? 17.965  85.519  44.123  1.00 32.53  ? 145 THR D N   1 
ATOM   4393 C CA  . THR D 4 144 ? 18.491  84.458  44.940  1.00 33.37  ? 145 THR D CA  1 
ATOM   4394 C C   . THR D 4 144 ? 18.840  83.374  43.943  1.00 33.72  ? 145 THR D C   1 
ATOM   4395 O O   . THR D 4 144 ? 18.488  83.468  42.777  1.00 33.18  ? 145 THR D O   1 
ATOM   4396 C CB  . THR D 4 144 ? 17.392  83.916  45.865  1.00 29.82  ? 145 THR D CB  1 
ATOM   4397 O OG1 . THR D 4 144 ? 16.386  83.270  45.068  1.00 32.21  ? 145 THR D OG1 1 
ATOM   4398 C CG2 . THR D 4 144 ? 16.728  85.055  46.631  1.00 30.75  ? 145 THR D CG2 1 
ATOM   4399 N N   . GLN D 4 145 ? 19.540  82.348  44.398  1.00 41.46  ? 146 GLN D N   1 
ATOM   4400 C CA  . GLN D 4 145 ? 19.823  81.222  43.536  1.00 36.41  ? 146 GLN D CA  1 
ATOM   4401 C C   . GLN D 4 145 ? 18.503  80.478  43.484  1.00 33.89  ? 146 GLN D C   1 
ATOM   4402 O O   . GLN D 4 145 ? 17.509  80.890  44.084  1.00 27.44  ? 146 GLN D O   1 
ATOM   4403 C CB  . GLN D 4 145 ? 20.878  80.304  44.147  1.00 39.91  ? 146 GLN D CB  1 
ATOM   4404 C CG  . GLN D 4 145 ? 22.239  80.956  44.287  1.00 50.96  ? 146 GLN D CG  1 
ATOM   4405 C CD  . GLN D 4 145 ? 23.346  79.951  44.473  1.00 43.92  ? 146 GLN D CD  1 
ATOM   4406 O OE1 . GLN D 4 145 ? 24.474  80.311  44.776  1.00 57.44  ? 146 GLN D OE1 1 
ATOM   4407 N NE2 . GLN D 4 145 ? 23.030  78.683  44.281  1.00 51.75  ? 146 GLN D NE2 1 
ATOM   4408 N N   . LEU D 4 146 ? 18.490  79.366  42.779  1.00 36.11  ? 147 LEU D N   1 
ATOM   4409 C CA  . LEU D 4 146 ? 17.274  78.598  42.679  1.00 35.75  ? 147 LEU D CA  1 
ATOM   4410 C C   . LEU D 4 146 ? 17.015  77.972  44.050  1.00 35.59  ? 147 LEU D C   1 
ATOM   4411 O O   . LEU D 4 146 ? 17.908  77.347  44.634  1.00 29.77  ? 147 LEU D O   1 
ATOM   4412 C CB  . LEU D 4 146 ? 17.453  77.529  41.602  1.00 35.85  ? 147 LEU D CB  1 
ATOM   4413 C CG  . LEU D 4 146 ? 16.194  76.946  40.961  1.00 39.84  ? 147 LEU D CG  1 
ATOM   4414 C CD1 . LEU D 4 146 ? 15.309  78.049  40.418  1.00 30.38  ? 147 LEU D CD1 1 
ATOM   4415 C CD2 . LEU D 4 146 ? 16.608  76.004  39.844  1.00 42.92  ? 147 LEU D CD2 1 
ATOM   4416 N N   . ILE D 4 147 ? 15.807  78.161  44.573  1.00 34.55  ? 148 ILE D N   1 
ATOM   4417 C CA  . ILE D 4 147 ? 15.443  77.589  45.873  1.00 31.59  ? 148 ILE D CA  1 
ATOM   4418 C C   . ILE D 4 147 ? 14.593  76.339  45.655  1.00 33.60  ? 148 ILE D C   1 
ATOM   4419 O O   . ILE D 4 147 ? 13.468  76.410  45.144  1.00 36.40  ? 148 ILE D O   1 
ATOM   4420 C CB  . ILE D 4 147 ? 14.659  78.613  46.727  1.00 33.98  ? 148 ILE D CB  1 
ATOM   4421 C CG1 . ILE D 4 147 ? 15.578  79.767  47.105  1.00 23.60  ? 148 ILE D CG1 1 
ATOM   4422 C CG2 . ILE D 4 147 ? 14.102  77.962  47.985  1.00 27.43  ? 148 ILE D CG2 1 
ATOM   4423 C CD1 . ILE D 4 147 ? 14.831  80.988  47.582  1.00 32.89  ? 148 ILE D CD1 1 
ATOM   4424 N N   . ARG D 4 148 ? 15.146  75.193  46.033  1.00 31.27  ? 149 ARG D N   1 
ATOM   4425 C CA  . ARG D 4 148 ? 14.459  73.918  45.880  1.00 32.19  ? 149 ARG D CA  1 
ATOM   4426 C C   . ARG D 4 148 ? 13.557  73.682  47.100  1.00 33.84  ? 149 ARG D C   1 
ATOM   4427 O O   . ARG D 4 148 ? 14.050  73.575  48.223  1.00 34.97  ? 149 ARG D O   1 
ATOM   4428 C CB  . ARG D 4 148 ? 15.508  72.806  45.745  1.00 33.33  ? 149 ARG D CB  1 
ATOM   4429 C CG  . ARG D 4 148 ? 14.948  71.429  45.428  1.00 37.92  ? 149 ARG D CG  1 
ATOM   4430 C CD  . ARG D 4 148 ? 16.075  70.400  45.399  1.00 46.07  ? 149 ARG D CD  1 
ATOM   4431 N NE  . ARG D 4 148 ? 16.989  70.561  44.261  1.00 49.92  ? 149 ARG D NE  1 
ATOM   4432 C CZ  . ARG D 4 148 ? 16.694  70.235  43.000  1.00 48.47  ? 149 ARG D CZ  1 
ATOM   4433 N NH1 . ARG D 4 148 ? 15.500  69.730  42.695  1.00 44.20  ? 149 ARG D NH1 1 
ATOM   4434 N NH2 . ARG D 4 148 ? 17.598  70.399  42.040  1.00 47.74  ? 149 ARG D NH2 1 
ATOM   4435 N N   . ASN D 4 149 ? 12.242  73.615  46.875  1.00 27.74  ? 150 ASN D N   1 
ATOM   4436 C CA  . ASN D 4 149 ? 11.272  73.417  47.954  1.00 28.91  ? 150 ASN D CA  1 
ATOM   4437 C C   . ASN D 4 149 ? 11.201  71.975  48.464  1.00 35.18  ? 150 ASN D C   1 
ATOM   4438 O O   . ASN D 4 149 ? 10.650  71.716  49.536  1.00 32.03  ? 150 ASN D O   1 
ATOM   4439 C CB  . ASN D 4 149 ? 9.877   73.864  47.506  1.00 27.34  ? 150 ASN D CB  1 
ATOM   4440 C CG  . ASN D 4 149 ? 9.764   75.373  47.328  1.00 33.79  ? 150 ASN D CG  1 
ATOM   4441 O OD1 . ASN D 4 149 ? 9.039   75.848  46.450  1.00 39.33  ? 150 ASN D OD1 1 
ATOM   4442 N ND2 . ASN D 4 149 ? 10.465  76.135  48.171  1.00 34.70  ? 150 ASN D ND2 1 
ATOM   4443 N N   . GLY D 4 150 ? 11.761  71.044  47.697  1.00 35.34  ? 151 GLY D N   1 
ATOM   4444 C CA  . GLY D 4 150 ? 11.767  69.645  48.095  1.00 24.93  ? 151 GLY D CA  1 
ATOM   4445 C C   . GLY D 4 150 ? 10.469  68.915  47.800  1.00 30.46  ? 151 GLY D C   1 
ATOM   4446 O O   . GLY D 4 150 ? 10.353  67.712  48.029  1.00 31.73  ? 151 GLY D O   1 
ATOM   4447 N N   . ASP D 4 151 ? 9.481   69.648  47.303  1.00 25.71  ? 152 ASP D N   1 
ATOM   4448 C CA  . ASP D 4 151 ? 8.186   69.058  46.985  1.00 31.50  ? 152 ASP D CA  1 
ATOM   4449 C C   . ASP D 4 151 ? 7.968   69.099  45.464  1.00 33.58  ? 152 ASP D C   1 
ATOM   4450 O O   . ASP D 4 151 ? 6.836   69.126  44.974  1.00 33.07  ? 152 ASP D O   1 
ATOM   4451 C CB  . ASP D 4 151 ? 7.080   69.836  47.713  1.00 24.06  ? 152 ASP D CB  1 
ATOM   4452 C CG  . ASP D 4 151 ? 7.021   71.295  47.289  1.00 35.43  ? 152 ASP D CG  1 
ATOM   4453 O OD1 . ASP D 4 151 ? 7.948   71.743  46.576  1.00 44.93  ? 152 ASP D OD1 1 
ATOM   4454 O OD2 . ASP D 4 151 ? 6.054   71.993  47.665  1.00 40.14  ? 152 ASP D OD2 1 
ATOM   4455 N N   . TRP D 4 152 ? 9.076   69.093  44.733  1.00 35.17  ? 153 TRP D N   1 
ATOM   4456 C CA  . TRP D 4 152 ? 9.076   69.148  43.281  1.00 33.39  ? 153 TRP D CA  1 
ATOM   4457 C C   . TRP D 4 152 ? 8.598   70.483  42.738  1.00 34.60  ? 153 TRP D C   1 
ATOM   4458 O O   . TRP D 4 152 ? 7.833   70.533  41.775  1.00 39.38  ? 153 TRP D O   1 
ATOM   4459 C CB  . TRP D 4 152 ? 8.249   68.006  42.668  1.00 26.48  ? 153 TRP D CB  1 
ATOM   4460 C CG  . TRP D 4 152 ? 8.876   66.646  42.832  1.00 31.24  ? 153 TRP D CG  1 
ATOM   4461 C CD1 . TRP D 4 152 ? 8.916   65.893  43.971  1.00 32.78  ? 153 TRP D CD1 1 
ATOM   4462 C CD2 . TRP D 4 152 ? 9.533   65.870  41.818  1.00 34.48  ? 153 TRP D CD2 1 
ATOM   4463 N NE1 . TRP D 4 152 ? 9.550   64.694  43.730  1.00 28.98  ? 153 TRP D NE1 1 
ATOM   4464 C CE2 . TRP D 4 152 ? 9.939   64.654  42.418  1.00 30.55  ? 153 TRP D CE2 1 
ATOM   4465 C CE3 . TRP D 4 152 ? 9.814   66.083  40.459  1.00 28.93  ? 153 TRP D CE3 1 
ATOM   4466 C CZ2 . TRP D 4 152 ? 10.614  63.654  41.708  1.00 25.52  ? 153 TRP D CZ2 1 
ATOM   4467 C CZ3 . TRP D 4 152 ? 10.483  65.094  39.752  1.00 28.66  ? 153 TRP D CZ3 1 
ATOM   4468 C CH2 . TRP D 4 152 ? 10.877  63.889  40.380  1.00 38.20  ? 153 TRP D CH2 1 
ATOM   4469 N N   . THR D 4 153 ? 9.022   71.563  43.386  1.00 33.27  ? 154 THR D N   1 
ATOM   4470 C CA  . THR D 4 153 ? 8.720   72.916  42.913  1.00 35.25  ? 154 THR D CA  1 
ATOM   4471 C C   . THR D 4 153 ? 9.866   73.800  43.371  1.00 34.70  ? 154 THR D C   1 
ATOM   4472 O O   . THR D 4 153 ? 10.587  73.458  44.306  1.00 35.12  ? 154 THR D O   1 
ATOM   4473 C CB  . THR D 4 153 ? 7.412   73.509  43.467  1.00 36.35  ? 154 THR D CB  1 
ATOM   4474 O OG1 . THR D 4 153 ? 7.524   73.687  44.884  1.00 33.98  ? 154 THR D OG1 1 
ATOM   4475 C CG2 . THR D 4 153 ? 6.229   72.619  43.113  1.00 31.22  ? 154 THR D CG2 1 
ATOM   4476 N N   . PHE D 4 154 ? 10.039  74.930  42.702  1.00 30.33  ? 155 PHE D N   1 
ATOM   4477 C CA  . PHE D 4 154 ? 11.113  75.855  43.032  1.00 29.32  ? 155 PHE D CA  1 
ATOM   4478 C C   . PHE D 4 154 ? 10.532  77.226  43.229  1.00 29.26  ? 155 PHE D C   1 
ATOM   4479 O O   . PHE D 4 154 ? 9.350   77.464  42.974  1.00 34.49  ? 155 PHE D O   1 
ATOM   4480 C CB  . PHE D 4 154 ? 12.091  75.984  41.868  1.00 23.97  ? 155 PHE D CB  1 
ATOM   4481 C CG  . PHE D 4 154 ? 12.842  74.734  41.550  1.00 35.61  ? 155 PHE D CG  1 
ATOM   4482 C CD1 . PHE D 4 154 ? 13.955  74.359  42.309  1.00 32.32  ? 155 PHE D CD1 1 
ATOM   4483 C CD2 . PHE D 4 154 ? 12.471  73.949  40.466  1.00 28.41  ? 155 PHE D CD2 1 
ATOM   4484 C CE1 . PHE D 4 154 ? 14.687  73.225  41.984  1.00 36.11  ? 155 PHE D CE1 1 
ATOM   4485 C CE2 . PHE D 4 154 ? 13.200  72.807  40.129  1.00 27.12  ? 155 PHE D CE2 1 
ATOM   4486 C CZ  . PHE D 4 154 ? 14.310  72.445  40.888  1.00 30.72  ? 155 PHE D CZ  1 
ATOM   4487 N N   . GLN D 4 155 ? 11.386  78.134  43.671  1.00 30.94  ? 156 GLN D N   1 
ATOM   4488 C CA  . GLN D 4 155 ? 11.004  79.525  43.803  1.00 29.70  ? 156 GLN D CA  1 
ATOM   4489 C C   . GLN D 4 155 ? 12.285  80.320  43.681  1.00 25.92  ? 156 GLN D C   1 
ATOM   4490 O O   . GLN D 4 155 ? 13.387  79.807  43.945  1.00 23.94  ? 156 GLN D O   1 
ATOM   4491 C CB  . GLN D 4 155 ? 10.310  79.834  45.146  1.00 31.50  ? 156 GLN D CB  1 
ATOM   4492 C CG  . GLN D 4 155 ? 11.151  79.613  46.414  1.00 33.40  ? 156 GLN D CG  1 
ATOM   4493 C CD  . GLN D 4 155 ? 10.403  80.003  47.702  1.00 24.67  ? 156 GLN D CD  1 
ATOM   4494 O OE1 . GLN D 4 155 ? 10.287  81.178  48.033  1.00 31.03  ? 156 GLN D OE1 1 
ATOM   4495 N NE2 . GLN D 4 155 ? 9.890   79.008  48.418  1.00 25.98  ? 156 GLN D NE2 1 
ATOM   4496 N N   . VAL D 4 156 ? 12.141  81.558  43.234  1.00 15.50  ? 157 VAL D N   1 
ATOM   4497 C CA  . VAL D 4 156 ? 13.271  82.442  43.141  1.00 19.91  ? 157 VAL D CA  1 
ATOM   4498 C C   . VAL D 4 156 ? 12.721  83.805  43.489  1.00 18.93  ? 157 VAL D C   1 
ATOM   4499 O O   . VAL D 4 156 ? 11.588  84.138  43.119  1.00 26.98  ? 157 VAL D O   1 
ATOM   4500 C CB  . VAL D 4 156 ? 13.935  82.425  41.720  1.00 29.79  ? 157 VAL D CB  1 
ATOM   4501 C CG1 . VAL D 4 156 ? 12.975  82.913  40.635  1.00 27.13  ? 157 VAL D CG1 1 
ATOM   4502 C CG2 . VAL D 4 156 ? 15.143  83.316  41.734  1.00 39.02  ? 157 VAL D CG2 1 
ATOM   4503 N N   . LEU D 4 157 ? 13.495  84.575  44.249  1.00 28.60  ? 158 LEU D N   1 
ATOM   4504 C CA  . LEU D 4 157 ? 13.095  85.933  44.640  1.00 25.10  ? 158 LEU D CA  1 
ATOM   4505 C C   . LEU D 4 157 ? 14.062  86.906  43.981  1.00 26.76  ? 158 LEU D C   1 
ATOM   4506 O O   . LEU D 4 157 ? 15.284  86.718  44.047  1.00 29.38  ? 158 LEU D O   1 
ATOM   4507 C CB  . LEU D 4 157 ? 13.154  86.085  46.165  1.00 31.34  ? 158 LEU D CB  1 
ATOM   4508 C CG  . LEU D 4 157 ? 12.343  85.026  46.922  1.00 40.84  ? 158 LEU D CG  1 
ATOM   4509 C CD1 . LEU D 4 157 ? 12.453  85.223  48.436  1.00 22.87  ? 158 LEU D CD1 1 
ATOM   4510 C CD2 . LEU D 4 157 ? 10.898  85.106  46.459  1.00 29.43  ? 158 LEU D CD2 1 
ATOM   4511 N N   . VAL D 4 158 ? 13.527  87.948  43.357  1.00 22.14  ? 159 VAL D N   1 
ATOM   4512 C CA  . VAL D 4 158 ? 14.377  88.910  42.665  1.00 26.93  ? 159 VAL D CA  1 
ATOM   4513 C C   . VAL D 4 158 ? 14.138  90.328  43.155  1.00 25.21  ? 159 VAL D C   1 
ATOM   4514 O O   . VAL D 4 158 ? 13.052  90.873  43.004  1.00 32.57  ? 159 VAL D O   1 
ATOM   4515 C CB  . VAL D 4 158 ? 14.146  88.837  41.115  1.00 36.39  ? 159 VAL D CB  1 
ATOM   4516 C CG1 . VAL D 4 158 ? 15.164  89.710  40.379  1.00 29.48  ? 159 VAL D CG1 1 
ATOM   4517 C CG2 . VAL D 4 158 ? 14.263  87.390  40.637  1.00 25.75  ? 159 VAL D CG2 1 
ATOM   4518 N N   . MET D 4 159 ? 15.171  90.919  43.740  1.00 30.07  ? 160 MET D N   1 
ATOM   4519 C CA  . MET D 4 159 ? 15.092  92.273  44.292  1.00 30.41  ? 160 MET D CA  1 
ATOM   4520 C C   . MET D 4 159 ? 15.562  93.365  43.330  1.00 33.76  ? 160 MET D C   1 
ATOM   4521 O O   . MET D 4 159 ? 16.525  93.185  42.562  1.00 38.81  ? 160 MET D O   1 
ATOM   4522 C CB  . MET D 4 159 ? 15.949  92.387  45.576  1.00 41.83  ? 160 MET D CB  1 
ATOM   4523 C CG  . MET D 4 159 ? 15.424  91.724  46.860  1.00 51.22  ? 160 MET D CG  1 
ATOM   4524 S SD  . MET D 4 159 ? 15.130  89.929  46.778  1.00 70.22  ? 160 MET D SD  1 
ATOM   4525 C CE  . MET D 4 159 ? 16.816  89.268  46.870  1.00 60.35  ? 160 MET D CE  1 
ATOM   4526 N N   . LEU D 4 160 ? 14.877  94.500  43.385  1.00 28.92  ? 161 LEU D N   1 
ATOM   4527 C CA  . LEU D 4 160 ? 15.246  95.673  42.594  1.00 32.93  ? 161 LEU D CA  1 
ATOM   4528 C C   . LEU D 4 160 ? 15.313  96.883  43.534  1.00 32.30  ? 161 LEU D C   1 
ATOM   4529 O O   . LEU D 4 160 ? 14.310  97.271  44.127  1.00 34.20  ? 161 LEU D O   1 
ATOM   4530 C CB  . LEU D 4 160 ? 14.222  95.955  41.493  1.00 22.69  ? 161 LEU D CB  1 
ATOM   4531 C CG  . LEU D 4 160 ? 14.396  97.367  40.920  1.00 27.90  ? 161 LEU D CG  1 
ATOM   4532 C CD1 . LEU D 4 160 ? 15.765  97.466  40.291  1.00 26.78  ? 161 LEU D CD1 1 
ATOM   4533 C CD2 . LEU D 4 160 ? 13.330  97.680  39.897  1.00 32.24  ? 161 LEU D CD2 1 
ATOM   4534 N N   . GLU D 4 161 ? 16.494  97.463  43.692  1.00 38.64  ? 162 GLU D N   1 
ATOM   4535 C CA  . GLU D 4 161 ? 16.642  98.644  44.541  1.00 47.74  ? 162 GLU D CA  1 
ATOM   4536 C C   . GLU D 4 161 ? 16.114  99.826  43.720  1.00 47.94  ? 162 GLU D C   1 
ATOM   4537 O O   . GLU D 4 161 ? 16.546  100.037 42.594  1.00 44.87  ? 162 GLU D O   1 
ATOM   4538 C CB  . GLU D 4 161 ? 18.118  98.883  44.873  1.00 53.22  ? 162 GLU D CB  1 
ATOM   4539 C CG  . GLU D 4 161 ? 18.894  97.661  45.380  1.00 62.72  ? 162 GLU D CG  1 
ATOM   4540 C CD  . GLU D 4 161 ? 18.579  97.287  46.822  1.00 70.39  ? 162 GLU D CD  1 
ATOM   4541 O OE1 . GLU D 4 161 ? 18.769  98.135  47.729  1.00 73.80  ? 162 GLU D OE1 1 
ATOM   4542 O OE2 . GLU D 4 161 ? 18.153  96.132  47.045  1.00 73.01  ? 162 GLU D OE2 1 
ATOM   4543 N N   . MET D 4 162 ? 15.178  100.597 44.257  1.00 52.94  ? 163 MET D N   1 
ATOM   4544 C CA  . MET D 4 162 ? 14.665  101.723 43.486  1.00 58.66  ? 163 MET D CA  1 
ATOM   4545 C C   . MET D 4 162 ? 14.105  102.856 44.323  1.00 64.19  ? 163 MET D C   1 
ATOM   4546 O O   . MET D 4 162 ? 13.958  102.739 45.542  1.00 61.06  ? 163 MET D O   1 
ATOM   4547 C CB  . MET D 4 162 ? 13.584  101.250 42.516  1.00 55.03  ? 163 MET D CB  1 
ATOM   4548 C CG  . MET D 4 162 ? 12.481  100.422 43.165  1.00 67.19  ? 163 MET D CG  1 
ATOM   4549 S SD  . MET D 4 162 ? 11.501  101.224 44.477  1.00 75.87  ? 163 MET D SD  1 
ATOM   4550 C CE  . MET D 4 162 ? 10.126  101.910 43.521  1.00 69.11  ? 163 MET D CE  1 
ATOM   4551 N N   . THR D 4 163 ? 13.787  103.953 43.645  1.00 68.68  ? 164 THR D N   1 
ATOM   4552 C CA  . THR D 4 163 ? 13.218  105.126 44.291  1.00 74.98  ? 164 THR D CA  1 
ATOM   4553 C C   . THR D 4 163 ? 11.932  105.475 43.531  1.00 78.80  ? 164 THR D C   1 
ATOM   4554 O O   . THR D 4 163 ? 11.975  106.091 42.462  1.00 79.92  ? 164 THR D O   1 
ATOM   4555 C CB  . THR D 4 163 ? 14.208  106.302 44.239  1.00 77.10  ? 164 THR D CB  1 
ATOM   4556 O OG1 . THR D 4 163 ? 15.518  105.837 44.593  1.00 75.30  ? 164 THR D OG1 1 
ATOM   4557 C CG2 . THR D 4 163 ? 13.794  107.387 45.221  1.00 79.37  ? 164 THR D CG2 1 
ATOM   4558 N N   . PRO D 4 164 ? 10.767  105.082 44.077  1.00 81.59  ? 165 PRO D N   1 
ATOM   4559 C CA  . PRO D 4 164 ? 9.474   105.347 43.440  1.00 85.11  ? 165 PRO D CA  1 
ATOM   4560 C C   . PRO D 4 164 ? 9.177   106.812 43.146  1.00 90.28  ? 165 PRO D C   1 
ATOM   4561 O O   . PRO D 4 164 ? 9.599   107.708 43.879  1.00 92.63  ? 165 PRO D O   1 
ATOM   4562 C CB  . PRO D 4 164 ? 8.475   104.730 44.418  1.00 82.71  ? 165 PRO D CB  1 
ATOM   4563 C CG  . PRO D 4 164 ? 9.143   104.915 45.734  1.00 84.67  ? 165 PRO D CG  1 
ATOM   4564 C CD  . PRO D 4 164 ? 10.575  104.534 45.432  1.00 84.32  ? 165 PRO D CD  1 
ATOM   4565 N N   . ARG D 4 165 ? 8.450   107.042 42.058  1.00 91.36  ? 166 ARG D N   1 
ATOM   4566 C CA  . ARG D 4 165 ? 8.079   108.388 41.654  1.00 95.77  ? 166 ARG D CA  1 
ATOM   4567 C C   . ARG D 4 165 ? 6.680   108.379 41.051  1.00 97.59  ? 166 ARG D C   1 
ATOM   4568 O O   . ARG D 4 165 ? 5.994   107.356 41.079  1.00 97.65  ? 166 ARG D O   1 
ATOM   4569 C CB  . ARG D 4 165 ? 9.097   108.932 40.649  1.00 97.99  ? 166 ARG D CB  1 
ATOM   4570 C CG  . ARG D 4 165 ? 10.512  108.952 41.203  1.00 103.64 ? 166 ARG D CG  1 
ATOM   4571 C CD  . ARG D 4 165 ? 11.460  109.773 40.347  1.00 110.17 ? 166 ARG D CD  1 
ATOM   4572 N NE  . ARG D 4 165 ? 12.781  109.903 40.965  1.00 113.96 ? 166 ARG D NE  1 
ATOM   4573 C CZ  . ARG D 4 165 ? 13.003  110.423 42.172  1.00 116.15 ? 166 ARG D CZ  1 
ATOM   4574 N NH1 . ARG D 4 165 ? 11.992  110.868 42.907  1.00 113.32 ? 166 ARG D NH1 1 
ATOM   4575 N NH2 . ARG D 4 165 ? 14.241  110.507 42.645  1.00 119.25 ? 166 ARG D NH2 1 
ATOM   4576 N N   . ARG D 4 166 ? 6.255   109.517 40.512  1.00 99.63  ? 167 ARG D N   1 
ATOM   4577 C CA  . ARG D 4 166 ? 4.928   109.622 39.917  1.00 101.12 ? 167 ARG D CA  1 
ATOM   4578 C C   . ARG D 4 166 ? 4.892   109.072 38.489  1.00 100.45 ? 167 ARG D C   1 
ATOM   4579 O O   . ARG D 4 166 ? 5.812   109.305 37.698  1.00 100.80 ? 167 ARG D O   1 
ATOM   4580 C CB  . ARG D 4 166 ? 4.456   111.085 39.922  1.00 106.32 ? 167 ARG D CB  1 
ATOM   4581 C CG  . ARG D 4 166 ? 5.161   111.998 38.918  1.00 107.29 ? 167 ARG D CG  1 
ATOM   4582 C CD  . ARG D 4 166 ? 4.679   113.447 39.014  1.00 107.87 ? 167 ARG D CD  1 
ATOM   4583 N NE  . ARG D 4 166 ? 5.333   114.198 40.089  1.00 112.68 ? 167 ARG D NE  1 
ATOM   4584 C CZ  . ARG D 4 166 ? 5.062   114.078 41.387  1.00 111.76 ? 167 ARG D CZ  1 
ATOM   4585 N NH1 . ARG D 4 166 ? 4.132   113.232 41.809  1.00 113.41 ? 167 ARG D NH1 1 
ATOM   4586 N NH2 . ARG D 4 166 ? 5.728   114.809 42.272  1.00 108.10 ? 167 ARG D NH2 1 
ATOM   4587 N N   . GLY D 4 167 ? 3.824   108.341 38.173  1.00 96.84  ? 168 GLY D N   1 
ATOM   4588 C CA  . GLY D 4 167 ? 3.656   107.768 36.847  1.00 91.45  ? 168 GLY D CA  1 
ATOM   4589 C C   . GLY D 4 167 ? 4.776   106.835 36.428  1.00 86.89  ? 168 GLY D C   1 
ATOM   4590 O O   . GLY D 4 167 ? 5.041   106.657 35.238  1.00 88.52  ? 168 GLY D O   1 
ATOM   4591 N N   . GLU D 4 168 ? 5.436   106.234 37.409  1.00 80.23  ? 169 GLU D N   1 
ATOM   4592 C CA  . GLU D 4 168 ? 6.535   105.321 37.141  1.00 70.49  ? 169 GLU D CA  1 
ATOM   4593 C C   . GLU D 4 168 ? 6.004   103.889 37.222  1.00 63.19  ? 169 GLU D C   1 
ATOM   4594 O O   . GLU D 4 168 ? 5.443   103.479 38.238  1.00 61.29  ? 169 GLU D O   1 
ATOM   4595 C CB  . GLU D 4 168 ? 7.635   105.566 38.170  1.00 73.31  ? 169 GLU D CB  1 
ATOM   4596 C CG  . GLU D 4 168 ? 9.027   105.199 37.717  1.00 77.97  ? 169 GLU D CG  1 
ATOM   4597 C CD  . GLU D 4 168 ? 10.092  105.753 38.647  1.00 78.50  ? 169 GLU D CD  1 
ATOM   4598 O OE1 . GLU D 4 168 ? 9.947   105.591 39.881  1.00 78.37  ? 169 GLU D OE1 1 
ATOM   4599 O OE2 . GLU D 4 168 ? 11.071  106.345 38.143  1.00 72.43  ? 169 GLU D OE2 1 
ATOM   4600 N N   . VAL D 4 169 ? 6.173   103.134 36.143  1.00 56.85  ? 170 VAL D N   1 
ATOM   4601 C CA  . VAL D 4 169 ? 5.681   101.761 36.093  1.00 51.57  ? 170 VAL D CA  1 
ATOM   4602 C C   . VAL D 4 169 ? 6.762   100.676 36.090  1.00 45.55  ? 170 VAL D C   1 
ATOM   4603 O O   . VAL D 4 169 ? 7.571   100.591 35.170  1.00 40.78  ? 170 VAL D O   1 
ATOM   4604 C CB  . VAL D 4 169 ? 4.792   101.559 34.849  1.00 51.91  ? 170 VAL D CB  1 
ATOM   4605 C CG1 . VAL D 4 169 ? 4.193   100.160 34.845  1.00 48.82  ? 170 VAL D CG1 1 
ATOM   4606 C CG2 . VAL D 4 169 ? 3.701   102.609 34.829  1.00 59.48  ? 170 VAL D CG2 1 
ATOM   4607 N N   . TYR D 4 170 ? 6.769   99.838  37.121  1.00 39.92  ? 171 TYR D N   1 
ATOM   4608 C CA  . TYR D 4 170 ? 7.743   98.760  37.182  1.00 37.02  ? 171 TYR D CA  1 
ATOM   4609 C C   . TYR D 4 170 ? 7.049   97.480  36.779  1.00 35.85  ? 171 TYR D C   1 
ATOM   4610 O O   . TYR D 4 170 ? 5.880   97.281  37.088  1.00 41.89  ? 171 TYR D O   1 
ATOM   4611 C CB  . TYR D 4 170 ? 8.332   98.621  38.585  1.00 42.70  ? 171 TYR D CB  1 
ATOM   4612 C CG  . TYR D 4 170 ? 9.164   99.810  39.009  1.00 44.14  ? 171 TYR D CG  1 
ATOM   4613 C CD1 . TYR D 4 170 ? 8.558   100.987 39.454  1.00 49.61  ? 171 TYR D CD1 1 
ATOM   4614 C CD2 . TYR D 4 170 ? 10.556  99.761  38.964  1.00 44.40  ? 171 TYR D CD2 1 
ATOM   4615 C CE1 . TYR D 4 170 ? 9.315   102.080 39.849  1.00 45.35  ? 171 TYR D CE1 1 
ATOM   4616 C CE2 . TYR D 4 170 ? 11.327  100.852 39.352  1.00 49.56  ? 171 TYR D CE2 1 
ATOM   4617 C CZ  . TYR D 4 170 ? 10.698  102.009 39.797  1.00 54.44  ? 171 TYR D CZ  1 
ATOM   4618 O OH  . TYR D 4 170 ? 11.451  103.092 40.199  1.00 59.86  ? 171 TYR D OH  1 
ATOM   4619 N N   . THR D 4 171 ? 7.770   96.619  36.072  1.00 41.13  ? 172 THR D N   1 
ATOM   4620 C CA  . THR D 4 171 ? 7.206   95.362  35.604  1.00 33.69  ? 172 THR D CA  1 
ATOM   4621 C C   . THR D 4 171 ? 8.144   94.201  35.866  1.00 26.71  ? 172 THR D C   1 
ATOM   4622 O O   . THR D 4 171 ? 9.352   94.349  35.745  1.00 30.52  ? 172 THR D O   1 
ATOM   4623 C CB  . THR D 4 171 ? 6.911   95.437  34.082  1.00 37.02  ? 172 THR D CB  1 
ATOM   4624 O OG1 . THR D 4 171 ? 5.828   96.343  33.853  1.00 43.42  ? 172 THR D OG1 1 
ATOM   4625 C CG2 . THR D 4 171 ? 6.538   94.074  33.527  1.00 32.70  ? 172 THR D CG2 1 
ATOM   4626 N N   . CYS D 4 172 ? 7.572   93.061  36.251  1.00 29.46  ? 173 CYS D N   1 
ATOM   4627 C CA  . CYS D 4 172 ? 8.329   91.830  36.487  1.00 31.72  ? 173 CYS D CA  1 
ATOM   4628 C C   . CYS D 4 172 ? 7.921   90.899  35.339  1.00 31.92  ? 173 CYS D C   1 
ATOM   4629 O O   . CYS D 4 172 ? 6.738   90.595  35.157  1.00 37.33  ? 173 CYS D O   1 
ATOM   4630 C CB  . CYS D 4 172 ? 7.966   91.190  37.838  1.00 27.65  ? 173 CYS D CB  1 
ATOM   4631 S SG  . CYS D 4 172 ? 9.060   89.784  38.219  1.00 47.17  ? 173 CYS D SG  1 
ATOM   4632 N N   . HIS D 4 173 ? 8.898   90.449  34.569  1.00 30.18  ? 174 HIS D N   1 
ATOM   4633 C CA  . HIS D 4 173 ? 8.637   89.606  33.409  1.00 30.14  ? 174 HIS D CA  1 
ATOM   4634 C C   . HIS D 4 173 ? 9.180   88.208  33.644  1.00 29.71  ? 174 HIS D C   1 
ATOM   4635 O O   . HIS D 4 173 ? 10.360  88.031  33.926  1.00 34.66  ? 174 HIS D O   1 
ATOM   4636 C CB  . HIS D 4 173 ? 9.312   90.246  32.192  1.00 39.67  ? 174 HIS D CB  1 
ATOM   4637 C CG  . HIS D 4 173 ? 8.959   89.610  30.889  1.00 44.70  ? 174 HIS D CG  1 
ATOM   4638 N ND1 . HIS D 4 173 ? 7.827   89.948  30.179  1.00 49.58  ? 174 HIS D ND1 1 
ATOM   4639 C CD2 . HIS D 4 173 ? 9.601   88.673  30.152  1.00 41.30  ? 174 HIS D CD2 1 
ATOM   4640 C CE1 . HIS D 4 173 ? 7.789   89.250  29.058  1.00 42.27  ? 174 HIS D CE1 1 
ATOM   4641 N NE2 . HIS D 4 173 ? 8.854   88.469  29.018  1.00 43.16  ? 174 HIS D NE2 1 
ATOM   4642 N N   . VAL D 4 174 ? 8.329   87.205  33.500  1.00 25.57  ? 175 VAL D N   1 
ATOM   4643 C CA  . VAL D 4 174 ? 8.761   85.842  33.748  1.00 26.56  ? 175 VAL D CA  1 
ATOM   4644 C C   . VAL D 4 174 ? 8.472   84.919  32.583  1.00 27.01  ? 175 VAL D C   1 
ATOM   4645 O O   . VAL D 4 174 ? 7.370   84.910  32.044  1.00 35.34  ? 175 VAL D O   1 
ATOM   4646 C CB  . VAL D 4 174 ? 8.070   85.282  35.045  1.00 28.58  ? 175 VAL D CB  1 
ATOM   4647 C CG1 . VAL D 4 174 ? 8.469   83.833  35.300  1.00 24.88  ? 175 VAL D CG1 1 
ATOM   4648 C CG2 . VAL D 4 174 ? 8.449   86.142  36.241  1.00 23.21  ? 175 VAL D CG2 1 
ATOM   4649 N N   . GLU D 4 175 ? 9.475   84.141  32.194  1.00 28.06  ? 176 GLU D N   1 
ATOM   4650 C CA  . GLU D 4 175 ? 9.334   83.188  31.099  1.00 31.68  ? 176 GLU D CA  1 
ATOM   4651 C C   . GLU D 4 175 ? 9.670   81.815  31.621  1.00 29.93  ? 176 GLU D C   1 
ATOM   4652 O O   . GLU D 4 175 ? 10.732  81.607  32.212  1.00 31.47  ? 176 GLU D O   1 
ATOM   4653 C CB  . GLU D 4 175 ? 10.256  83.564  29.930  1.00 30.70  ? 176 GLU D CB  1 
ATOM   4654 C CG  . GLU D 4 175 ? 9.670   84.671  29.059  1.00 41.73  ? 176 GLU D CG  1 
ATOM   4655 C CD  . GLU D 4 175 ? 10.650  85.217  28.036  1.00 53.01  ? 176 GLU D CD  1 
ATOM   4656 O OE1 . GLU D 4 175 ? 11.394  84.418  27.423  1.00 56.82  ? 176 GLU D OE1 1 
ATOM   4657 O OE2 . GLU D 4 175 ? 10.663  86.452  27.835  1.00 57.07  ? 176 GLU D OE2 1 
ATOM   4658 N N   . HIS D 4 176 ? 8.776   80.868  31.383  1.00 27.49  ? 177 HIS D N   1 
ATOM   4659 C CA  . HIS D 4 176 ? 8.971   79.521  31.882  1.00 23.28  ? 177 HIS D CA  1 
ATOM   4660 C C   . HIS D 4 176 ? 8.336   78.533  30.918  1.00 21.03  ? 177 HIS D C   1 
ATOM   4661 O O   . HIS D 4 176 ? 7.314   78.824  30.318  1.00 29.98  ? 177 HIS D O   1 
ATOM   4662 C CB  . HIS D 4 176 ? 8.308   79.420  33.271  1.00 23.38  ? 177 HIS D CB  1 
ATOM   4663 C CG  . HIS D 4 176 ? 8.540   78.119  33.967  1.00 15.85  ? 177 HIS D CG  1 
ATOM   4664 N ND1 . HIS D 4 176 ? 9.741   77.792  34.554  1.00 35.14  ? 177 HIS D ND1 1 
ATOM   4665 C CD2 . HIS D 4 176 ? 7.732   77.047  34.144  1.00 24.16  ? 177 HIS D CD2 1 
ATOM   4666 C CE1 . HIS D 4 176 ? 9.665   76.576  35.066  1.00 24.64  ? 177 HIS D CE1 1 
ATOM   4667 N NE2 . HIS D 4 176 ? 8.456   76.101  34.829  1.00 31.29  ? 177 HIS D NE2 1 
ATOM   4668 N N   . PRO D 4 177 ? 8.922   77.333  30.790  1.00 24.22  ? 178 PRO D N   1 
ATOM   4669 C CA  . PRO D 4 177 ? 8.464   76.250  29.914  1.00 22.26  ? 178 PRO D CA  1 
ATOM   4670 C C   . PRO D 4 177 ? 6.995   75.920  30.052  1.00 34.51  ? 178 PRO D C   1 
ATOM   4671 O O   . PRO D 4 177 ? 6.381   75.401  29.114  1.00 31.52  ? 178 PRO D O   1 
ATOM   4672 C CB  . PRO D 4 177 ? 9.323   75.062  30.335  1.00 25.09  ? 178 PRO D CB  1 
ATOM   4673 C CG  . PRO D 4 177 ? 10.583  75.699  30.795  1.00 30.76  ? 178 PRO D CG  1 
ATOM   4674 C CD  . PRO D 4 177 ? 10.119  76.927  31.544  1.00 17.54  ? 178 PRO D CD  1 
ATOM   4675 N N   . SER D 4 178 ? 6.429   76.203  31.221  1.00 35.68  ? 179 SER D N   1 
ATOM   4676 C CA  . SER D 4 178 ? 5.019   75.886  31.456  1.00 34.21  ? 179 SER D CA  1 
ATOM   4677 C C   . SER D 4 178 ? 4.081   76.973  30.975  1.00 30.90  ? 179 SER D C   1 
ATOM   4678 O O   . SER D 4 178 ? 2.873   76.788  30.977  1.00 31.08  ? 179 SER D O   1 
ATOM   4679 C CB  . SER D 4 178 ? 4.767   75.625  32.946  1.00 33.37  ? 179 SER D CB  1 
ATOM   4680 O OG  . SER D 4 178 ? 5.045   76.782  33.713  1.00 31.06  ? 179 SER D OG  1 
ATOM   4681 N N   . LEU D 4 179 ? 4.637   78.107  30.568  1.00 27.68  ? 180 LEU D N   1 
ATOM   4682 C CA  . LEU D 4 179 ? 3.824   79.216  30.094  1.00 33.25  ? 180 LEU D CA  1 
ATOM   4683 C C   . LEU D 4 179 ? 3.919   79.382  28.578  1.00 36.96  ? 180 LEU D C   1 
ATOM   4684 O O   . LEU D 4 179 ? 4.996   79.589  28.040  1.00 39.61  ? 180 LEU D O   1 
ATOM   4685 C CB  . LEU D 4 179 ? 4.275   80.510  30.764  1.00 28.65  ? 180 LEU D CB  1 
ATOM   4686 C CG  . LEU D 4 179 ? 4.251   80.515  32.285  1.00 31.90  ? 180 LEU D CG  1 
ATOM   4687 C CD1 . LEU D 4 179 ? 4.871   81.796  32.787  1.00 24.73  ? 180 LEU D CD1 1 
ATOM   4688 C CD2 . LEU D 4 179 ? 2.815   80.385  32.777  1.00 30.08  ? 180 LEU D CD2 1 
ATOM   4689 N N   . LYS D 4 180 ? 2.797   79.284  27.885  1.00 40.15  ? 181 LYS D N   1 
ATOM   4690 C CA  . LYS D 4 180 ? 2.824   79.474  26.449  1.00 35.94  ? 181 LYS D CA  1 
ATOM   4691 C C   . LYS D 4 180 ? 3.186   80.947  26.207  1.00 37.29  ? 181 LYS D C   1 
ATOM   4692 O O   . LYS D 4 180 ? 3.864   81.266  25.234  1.00 41.90  ? 181 LYS D O   1 
ATOM   4693 C CB  . LYS D 4 180 ? 1.463   79.123  25.837  1.00 36.90  ? 181 LYS D CB  1 
ATOM   4694 C CG  . LYS D 4 180 ? 1.383   79.342  24.333  1.00 40.05  ? 181 LYS D CG  1 
ATOM   4695 C CD  . LYS D 4 180 ? 0.044   78.878  23.756  1.00 41.85  ? 181 LYS D CD  1 
ATOM   4696 C CE  . LYS D 4 180 ? -0.094  77.353  23.797  1.00 39.67  ? 181 LYS D CE  1 
ATOM   4697 N NZ  . LYS D 4 180 ? -1.377  76.891  23.190  1.00 34.60  ? 181 LYS D NZ  1 
ATOM   4698 N N   . SER D 4 181 ? 2.746   81.833  27.101  1.00 29.03  ? 182 SER D N   1 
ATOM   4699 C CA  . SER D 4 181 ? 3.046   83.269  27.001  1.00 30.19  ? 182 SER D CA  1 
ATOM   4700 C C   . SER D 4 181 ? 3.612   83.768  28.330  1.00 28.53  ? 182 SER D C   1 
ATOM   4701 O O   . SER D 4 181 ? 3.104   83.438  29.392  1.00 35.87  ? 182 SER D O   1 
ATOM   4702 C CB  . SER D 4 181 ? 1.787   84.078  26.674  1.00 31.68  ? 182 SER D CB  1 
ATOM   4703 O OG  . SER D 4 181 ? 1.222   83.705  25.435  1.00 52.69  ? 182 SER D OG  1 
ATOM   4704 N N   . PRO D 4 182 ? 4.650   84.601  28.285  1.00 35.11  ? 183 PRO D N   1 
ATOM   4705 C CA  . PRO D 4 182 ? 5.283   85.138  29.496  1.00 35.05  ? 183 PRO D CA  1 
ATOM   4706 C C   . PRO D 4 182 ? 4.328   85.883  30.410  1.00 36.23  ? 183 PRO D C   1 
ATOM   4707 O O   . PRO D 4 182 ? 3.337   86.445  29.964  1.00 41.90  ? 183 PRO D O   1 
ATOM   4708 C CB  . PRO D 4 182 ? 6.358   86.073  28.947  1.00 40.42  ? 183 PRO D CB  1 
ATOM   4709 C CG  . PRO D 4 182 ? 6.607   85.550  27.552  1.00 37.91  ? 183 PRO D CG  1 
ATOM   4710 C CD  . PRO D 4 182 ? 5.235   85.202  27.078  1.00 38.87  ? 183 PRO D CD  1 
ATOM   4711 N N   . ILE D 4 183 ? 4.643   85.888  31.698  1.00 37.76  ? 184 ILE D N   1 
ATOM   4712 C CA  . ILE D 4 183 ? 3.833   86.584  32.680  1.00 29.30  ? 184 ILE D CA  1 
ATOM   4713 C C   . ILE D 4 183 ? 4.453   87.922  33.001  1.00 32.16  ? 184 ILE D C   1 
ATOM   4714 O O   . ILE D 4 183 ? 5.669   88.032  33.127  1.00 35.67  ? 184 ILE D O   1 
ATOM   4715 C CB  . ILE D 4 183 ? 3.747   85.807  33.975  1.00 33.86  ? 184 ILE D CB  1 
ATOM   4716 C CG1 . ILE D 4 183 ? 2.872   84.574  33.771  1.00 24.42  ? 184 ILE D CG1 1 
ATOM   4717 C CG2 . ILE D 4 183 ? 3.187   86.703  35.074  1.00 24.29  ? 184 ILE D CG2 1 
ATOM   4718 C CD1 . ILE D 4 183 ? 2.885   83.632  34.962  1.00 36.07  ? 184 ILE D CD1 1 
ATOM   4719 N N   . THR D 4 184 ? 3.618   88.942  33.135  1.00 32.01  ? 185 THR D N   1 
ATOM   4720 C CA  . THR D 4 184 ? 4.109   90.274  33.459  1.00 30.96  ? 185 THR D CA  1 
ATOM   4721 C C   . THR D 4 184 ? 3.266   90.857  34.582  1.00 37.91  ? 185 THR D C   1 
ATOM   4722 O O   . THR D 4 184 ? 2.044   90.905  34.496  1.00 38.23  ? 185 THR D O   1 
ATOM   4723 C CB  . THR D 4 184 ? 4.025   91.218  32.244  1.00 35.76  ? 185 THR D CB  1 
ATOM   4724 O OG1 . THR D 4 184 ? 2.793   90.981  31.558  1.00 48.11  ? 185 THR D OG1 1 
ATOM   4725 C CG2 . THR D 4 184 ? 5.174   90.981  31.288  1.00 33.80  ? 185 THR D CG2 1 
ATOM   4726 N N   . VAL D 4 185 ? 3.921   91.286  35.648  1.00 37.32  ? 186 VAL D N   1 
ATOM   4727 C CA  . VAL D 4 185 ? 3.207   91.881  36.761  1.00 31.78  ? 186 VAL D CA  1 
ATOM   4728 C C   . VAL D 4 185 ? 3.669   93.319  36.854  1.00 32.83  ? 186 VAL D C   1 
ATOM   4729 O O   . VAL D 4 185 ? 4.848   93.614  36.649  1.00 32.52  ? 186 VAL D O   1 
ATOM   4730 C CB  . VAL D 4 185 ? 3.504   91.142  38.069  1.00 35.47  ? 186 VAL D CB  1 
ATOM   4731 C CG1 . VAL D 4 185 ? 2.889   91.882  39.218  1.00 38.35  ? 186 VAL D CG1 1 
ATOM   4732 C CG2 . VAL D 4 185 ? 2.939   89.728  38.000  1.00 30.13  ? 186 VAL D CG2 1 
ATOM   4733 N N   . GLU D 4 186 ? 2.729   94.212  37.141  1.00 37.27  ? 187 GLU D N   1 
ATOM   4734 C CA  . GLU D 4 186 ? 3.007   95.633  37.233  1.00 39.31  ? 187 GLU D CA  1 
ATOM   4735 C C   . GLU D 4 186 ? 2.883   96.178  38.639  1.00 41.45  ? 187 GLU D C   1 
ATOM   4736 O O   . GLU D 4 186 ? 2.100   95.675  39.445  1.00 45.68  ? 187 GLU D O   1 
ATOM   4737 C CB  . GLU D 4 186 ? 2.044   96.413  36.337  1.00 42.67  ? 187 GLU D CB  1 
ATOM   4738 C CG  . GLU D 4 186 ? 2.484   96.575  34.900  1.00 62.19  ? 187 GLU D CG  1 
ATOM   4739 C CD  . GLU D 4 186 ? 1.527   97.460  34.109  1.00 75.28  ? 187 GLU D CD  1 
ATOM   4740 O OE1 . GLU D 4 186 ? 1.027   98.457  34.682  1.00 77.46  ? 187 GLU D OE1 1 
ATOM   4741 O OE2 . GLU D 4 186 ? 1.286   97.164  32.916  1.00 73.28  ? 187 GLU D OE2 1 
ATOM   4742 N N   . TRP D 4 187 ? 3.652   97.226  38.915  1.00 41.55  ? 188 TRP D N   1 
ATOM   4743 C CA  . TRP D 4 187 ? 3.617   97.896  40.207  1.00 43.13  ? 188 TRP D CA  1 
ATOM   4744 C C   . TRP D 4 187 ? 3.784   99.407  40.005  1.00 49.40  ? 188 TRP D C   1 
ATOM   4745 O O   . TRP D 4 187 ? 4.626   99.848  39.219  1.00 51.16  ? 188 TRP D O   1 
ATOM   4746 C CB  . TRP D 4 187 ? 4.722   97.371  41.113  1.00 39.95  ? 188 TRP D CB  1 
ATOM   4747 C CG  . TRP D 4 187 ? 4.619   97.862  42.512  1.00 44.03  ? 188 TRP D CG  1 
ATOM   4748 C CD1 . TRP D 4 187 ? 4.012   97.232  43.556  1.00 51.38  ? 188 TRP D CD1 1 
ATOM   4749 C CD2 . TRP D 4 187 ? 5.165   99.080  43.037  1.00 44.78  ? 188 TRP D CD2 1 
ATOM   4750 N NE1 . TRP D 4 187 ? 4.151   97.978  44.707  1.00 55.09  ? 188 TRP D NE1 1 
ATOM   4751 C CE2 . TRP D 4 187 ? 4.853   99.118  44.413  1.00 48.16  ? 188 TRP D CE2 1 
ATOM   4752 C CE3 . TRP D 4 187 ? 5.889   100.140 42.478  1.00 47.69  ? 188 TRP D CE3 1 
ATOM   4753 C CZ2 . TRP D 4 187 ? 5.243   100.173 45.240  1.00 48.49  ? 188 TRP D CZ2 1 
ATOM   4754 C CZ3 . TRP D 4 187 ? 6.277   101.191 43.300  1.00 52.16  ? 188 TRP D CZ3 1 
ATOM   4755 C CH2 . TRP D 4 187 ? 5.952   101.199 44.668  1.00 49.25  ? 188 TRP D CH2 1 
ATOM   4756 N N   . ARG D 4 188 ? 2.968   100.183 40.717  1.00 60.41  ? 189 ARG D N   1 
ATOM   4757 C CA  . ARG D 4 188 ? 2.984   101.645 40.650  1.00 66.76  ? 189 ARG D CA  1 
ATOM   4758 C C   . ARG D 4 188 ? 2.946   102.226 42.061  1.00 70.51  ? 189 ARG D C   1 
ATOM   4759 O O   . ARG D 4 188 ? 2.539   101.547 43.009  1.00 68.31  ? 189 ARG D O   1 
ATOM   4760 C CB  . ARG D 4 188 ? 1.761   102.155 39.887  1.00 67.67  ? 189 ARG D CB  1 
ATOM   4761 C CG  . ARG D 4 188 ? 1.670   101.707 38.445  1.00 75.43  ? 189 ARG D CG  1 
ATOM   4762 C CD  . ARG D 4 188 ? 0.235   101.826 37.946  1.00 81.08  ? 189 ARG D CD  1 
ATOM   4763 N NE  . ARG D 4 188 ? 0.121   101.565 36.514  1.00 82.49  ? 189 ARG D NE  1 
ATOM   4764 C CZ  . ARG D 4 188 ? 0.349   102.469 35.567  1.00 81.83  ? 189 ARG D CZ  1 
ATOM   4765 N NH1 . ARG D 4 188 ? 0.703   103.709 35.892  1.00 73.11  ? 189 ARG D NH1 1 
ATOM   4766 N NH2 . ARG D 4 188 ? 0.228   102.130 34.291  1.00 79.41  ? 189 ARG D NH2 1 
ATOM   4767 N N   . ALA D 4 189 ? 3.350   103.489 42.188  1.00 75.36  ? 190 ALA D N   1 
ATOM   4768 C CA  . ALA D 4 189 ? 3.362   104.177 43.479  1.00 79.48  ? 190 ALA D CA  1 
ATOM   4769 C C   . ALA D 4 189 ? 1.971   104.180 44.122  1.00 81.36  ? 190 ALA D C   1 
ATOM   4770 O O   . ALA D 4 189 ? 1.814   103.522 45.175  1.00 80.52  ? 190 ALA D O   1 
ATOM   4771 C CB  . ALA D 4 189 ? 3.860   105.617 43.303  1.00 75.77  ? 190 ALA D CB  1 
ATOM   4772 O OXT . ALA D 4 189 ? 1.057   104.834 43.568  1.00 79.00  ? 190 ALA D OXT 1 
ATOM   4773 N N   . SER E 5 1   ? 6.519   50.427  32.347  1.00 72.40  ? -3  SER P N   1 
ATOM   4774 C CA  . SER E 5 1   ? 6.250   51.297  33.529  1.00 67.23  ? -3  SER P CA  1 
ATOM   4775 C C   . SER E 5 1   ? 6.956   50.816  34.811  1.00 63.28  ? -3  SER P C   1 
ATOM   4776 O O   . SER E 5 1   ? 6.951   51.515  35.826  1.00 63.67  ? -3  SER P O   1 
ATOM   4777 C CB  . SER E 5 1   ? 4.732   51.402  33.770  1.00 70.92  ? -3  SER P CB  1 
ATOM   4778 O OG  . SER E 5 1   ? 4.151   50.154  34.123  1.00 71.56  ? -3  SER P OG  1 
ATOM   4779 N N   . ARG E 5 2   ? 7.565   49.631  34.766  1.00 57.51  ? -2  ARG P N   1 
ATOM   4780 C CA  . ARG E 5 2   ? 8.264   49.088  35.933  1.00 53.76  ? -2  ARG P CA  1 
ATOM   4781 C C   . ARG E 5 2   ? 9.719   49.517  35.929  1.00 49.46  ? -2  ARG P C   1 
ATOM   4782 O O   . ARG E 5 2   ? 10.514  49.063  35.102  1.00 49.96  ? -2  ARG P O   1 
ATOM   4783 C CB  . ARG E 5 2   ? 8.181   47.561  35.955  1.00 52.71  ? -2  ARG P CB  1 
ATOM   4784 C CG  . ARG E 5 2   ? 6.771   47.035  36.002  1.00 61.06  ? -2  ARG P CG  1 
ATOM   4785 C CD  . ARG E 5 2   ? 6.738   45.533  36.194  1.00 71.37  ? -2  ARG P CD  1 
ATOM   4786 N NE  . ARG E 5 2   ? 5.371   45.032  36.070  1.00 84.82  ? -2  ARG P NE  1 
ATOM   4787 C CZ  . ARG E 5 2   ? 5.006   43.763  36.233  1.00 88.20  ? -2  ARG P CZ  1 
ATOM   4788 N NH1 . ARG E 5 2   ? 5.905   42.835  36.535  1.00 88.25  ? -2  ARG P NH1 1 
ATOM   4789 N NH2 . ARG E 5 2   ? 3.731   43.422  36.088  1.00 88.21  ? -2  ARG P NH2 1 
ATOM   4790 N N   . GLY E 5 3   ? 10.070  50.390  36.865  1.00 43.18  ? -1  GLY P N   1 
ATOM   4791 C CA  . GLY E 5 3   ? 11.431  50.888  36.923  1.00 39.73  ? -1  GLY P CA  1 
ATOM   4792 C C   . GLY E 5 3   ? 12.466  49.895  37.403  1.00 39.55  ? -1  GLY P C   1 
ATOM   4793 O O   . GLY E 5 3   ? 12.162  48.948  38.125  1.00 44.76  ? -1  GLY P O   1 
ATOM   4794 N N   . GLY E 5 4   ? 13.704  50.102  36.981  1.00 38.18  ? 0   GLY P N   1 
ATOM   4795 C CA  . GLY E 5 4   ? 14.775  49.230  37.410  1.00 36.10  ? 0   GLY P CA  1 
ATOM   4796 C C   . GLY E 5 4   ? 15.617  50.016  38.397  1.00 43.16  ? 0   GLY P C   1 
ATOM   4797 O O   . GLY E 5 4   ? 15.380  51.211  38.626  1.00 42.74  ? 0   GLY P O   1 
ATOM   4798 N N   . ALA E 5 5   ? 16.600  49.358  38.995  1.00 41.26  ? 1   ALA P N   1 
ATOM   4799 C CA  . ALA E 5 5   ? 17.465  50.038  39.944  1.00 38.48  ? 1   ALA P CA  1 
ATOM   4800 C C   . ALA E 5 5   ? 18.872  49.501  39.834  1.00 40.99  ? 1   ALA P C   1 
ATOM   4801 O O   . ALA E 5 5   ? 19.085  48.362  39.423  1.00 35.16  ? 1   ALA P O   1 
ATOM   4802 C CB  . ALA E 5 5   ? 16.948  49.845  41.367  1.00 35.95  ? 1   ALA P CB  1 
ATOM   4803 N N   . SER E 5 6   ? 19.830  50.342  40.193  1.00 40.71  ? 2   SER P N   1 
ATOM   4804 C CA  . SER E 5 6   ? 21.222  49.950  40.176  1.00 46.20  ? 2   SER P CA  1 
ATOM   4805 C C   . SER E 5 6   ? 21.414  49.015  41.366  1.00 51.18  ? 2   SER P C   1 
ATOM   4806 O O   . SER E 5 6   ? 21.077  49.361  42.501  1.00 50.21  ? 2   SER P O   1 
ATOM   4807 C CB  . SER E 5 6   ? 22.107  51.178  40.336  1.00 38.96  ? 2   SER P CB  1 
ATOM   4808 O OG  . SER E 5 6   ? 21.770  52.149  39.369  1.00 40.66  ? 2   SER P OG  1 
ATOM   4809 N N   . GLN E 5 7   ? 21.954  47.830  41.116  1.00 49.37  ? 3   GLN P N   1 
ATOM   4810 C CA  . GLN E 5 7   ? 22.161  46.886  42.200  1.00 48.75  ? 3   GLN P CA  1 
ATOM   4811 C C   . GLN E 5 7   ? 23.405  47.204  43.023  1.00 46.79  ? 3   GLN P C   1 
ATOM   4812 O O   . GLN E 5 7   ? 24.466  47.498  42.486  1.00 49.08  ? 3   GLN P O   1 
ATOM   4813 C CB  . GLN E 5 7   ? 22.241  45.462  41.645  1.00 48.70  ? 3   GLN P CB  1 
ATOM   4814 C CG  . GLN E 5 7   ? 21.002  45.034  40.857  1.00 45.49  ? 3   GLN P CG  1 
ATOM   4815 C CD  . GLN E 5 7   ? 19.720  45.574  41.464  1.00 51.42  ? 3   GLN P CD  1 
ATOM   4816 O OE1 . GLN E 5 7   ? 18.787  45.939  40.744  1.00 47.94  ? 3   GLN P OE1 1 
ATOM   4817 N NE2 . GLN E 5 7   ? 19.664  45.625  42.794  1.00 47.36  ? 3   GLN P NE2 1 
ATOM   4818 N N   . TYR E 5 8   ? 23.245  47.157  44.338  1.00 47.43  ? 4   TYR P N   1 
ATOM   4819 C CA  . TYR E 5 8   ? 24.329  47.405  45.277  1.00 47.79  ? 4   TYR P CA  1 
ATOM   4820 C C   . TYR E 5 8   ? 25.061  46.064  45.383  1.00 51.61  ? 4   TYR P C   1 
ATOM   4821 O O   . TYR E 5 8   ? 24.491  45.086  45.871  1.00 54.78  ? 4   TYR P O   1 
ATOM   4822 C CB  . TYR E 5 8   ? 23.714  47.805  46.617  1.00 45.92  ? 4   TYR P CB  1 
ATOM   4823 C CG  . TYR E 5 8   ? 24.664  48.271  47.699  1.00 46.97  ? 4   TYR P CG  1 
ATOM   4824 C CD1 . TYR E 5 8   ? 25.935  48.758  47.394  1.00 45.71  ? 4   TYR P CD1 1 
ATOM   4825 C CD2 . TYR E 5 8   ? 24.249  48.308  49.033  1.00 41.56  ? 4   TYR P CD2 1 
ATOM   4826 C CE1 . TYR E 5 8   ? 26.767  49.281  48.398  1.00 42.71  ? 4   TYR P CE1 1 
ATOM   4827 C CE2 . TYR E 5 8   ? 25.066  48.824  50.030  1.00 43.99  ? 4   TYR P CE2 1 
ATOM   4828 C CZ  . TYR E 5 8   ? 26.321  49.311  49.708  1.00 37.41  ? 4   TYR P CZ  1 
ATOM   4829 O OH  . TYR E 5 8   ? 27.112  49.835  50.701  1.00 45.71  ? 4   TYR P OH  1 
ATOM   4830 N N   . ARG E 5 9   ? 26.310  46.018  44.917  1.00 52.93  ? 5   ARG P N   1 
ATOM   4831 C CA  . ARG E 5 9   ? 27.117  44.784  44.921  1.00 54.57  ? 5   ARG P CA  1 
ATOM   4832 C C   . ARG E 5 9   ? 27.847  44.464  46.229  1.00 55.32  ? 5   ARG P C   1 
ATOM   4833 O O   . ARG E 5 9   ? 28.578  45.297  46.759  1.00 60.13  ? 5   ARG P O   1 
ATOM   4834 C CB  . ARG E 5 9   ? 28.151  44.847  43.800  1.00 43.97  ? 5   ARG P CB  1 
ATOM   4835 C CG  . ARG E 5 9   ? 27.591  45.303  42.477  1.00 41.51  ? 5   ARG P CG  1 
ATOM   4836 C CD  . ARG E 5 9   ? 26.595  44.313  41.916  1.00 39.15  ? 5   ARG P CD  1 
ATOM   4837 N NE  . ARG E 5 9   ? 26.108  44.765  40.617  1.00 46.27  ? 5   ARG P NE  1 
ATOM   4838 C CZ  . ARG E 5 9   ? 25.268  44.077  39.852  1.00 44.23  ? 5   ARG P CZ  1 
ATOM   4839 N NH1 . ARG E 5 9   ? 24.816  42.895  40.249  1.00 48.31  ? 5   ARG P NH1 1 
ATOM   4840 N NH2 . ARG E 5 9   ? 24.874  44.578  38.694  1.00 39.33  ? 5   ARG P NH2 1 
ATOM   4841 N N   . PRO E 5 10  ? 27.668  43.239  46.757  1.00 56.33  ? 6   PRO P N   1 
ATOM   4842 C CA  . PRO E 5 10  ? 28.320  42.820  48.007  1.00 58.46  ? 6   PRO P CA  1 
ATOM   4843 C C   . PRO E 5 10  ? 29.818  42.572  47.832  1.00 59.18  ? 6   PRO P C   1 
ATOM   4844 O O   . PRO E 5 10  ? 30.281  42.311  46.718  1.00 58.64  ? 6   PRO P O   1 
ATOM   4845 C CB  . PRO E 5 10  ? 27.555  41.552  48.382  1.00 60.18  ? 6   PRO P CB  1 
ATOM   4846 C CG  . PRO E 5 10  ? 27.177  40.990  47.047  1.00 57.06  ? 6   PRO P CG  1 
ATOM   4847 C CD  . PRO E 5 10  ? 26.733  42.205  46.277  1.00 53.10  ? 6   PRO P CD  1 
ATOM   4848 N N   . SER E 5 11  ? 30.572  42.655  48.927  1.00 59.44  ? 7   SER P N   1 
ATOM   4849 C CA  . SER E 5 11  ? 32.020  42.452  48.869  1.00 70.83  ? 7   SER P CA  1 
ATOM   4850 C C   . SER E 5 11  ? 32.497  41.084  49.369  1.00 76.35  ? 7   SER P C   1 
ATOM   4851 O O   . SER E 5 11  ? 31.694  40.168  49.558  1.00 75.42  ? 7   SER P O   1 
ATOM   4852 C CB  . SER E 5 11  ? 32.747  43.564  49.644  1.00 74.51  ? 7   SER P CB  1 
ATOM   4853 O OG  . SER E 5 11  ? 32.459  43.530  51.034  1.00 72.24  ? 7   SER P OG  1 
ATOM   4854 N N   . GLN E 5 12  ? 33.812  40.975  49.578  1.00 81.34  ? 8   GLN P N   1 
ATOM   4855 C CA  . GLN E 5 12  ? 34.484  39.755  50.037  1.00 83.72  ? 8   GLN P CA  1 
ATOM   4856 C C   . GLN E 5 12  ? 34.681  38.732  48.922  1.00 90.21  ? 8   GLN P C   1 
ATOM   4857 O O   . GLN E 5 12  ? 34.104  37.629  49.031  1.00 92.71  ? 8   GLN P O   1 
ATOM   4858 C CB  . GLN E 5 12  ? 33.730  39.094  51.195  1.00 78.24  ? 8   GLN P CB  1 
ATOM   4859 C CG  . GLN E 5 12  ? 34.098  39.622  52.566  1.00 77.83  ? 8   GLN P CG  1 
ATOM   4860 C CD  . GLN E 5 12  ? 33.979  38.554  53.643  1.00 82.95  ? 8   GLN P CD  1 
ATOM   4861 O OE1 . GLN E 5 12  ? 32.936  37.909  53.785  1.00 80.06  ? 8   GLN P OE1 1 
ATOM   4862 N NE2 . GLN E 5 12  ? 35.054  38.359  54.406  1.00 80.31  ? 8   GLN P NE2 1 
ATOM   4863 O OXT . GLN E 5 12  ? 35.414  39.042  47.955  1.00 96.77  ? 8   GLN P OXT 1 
ATOM   4864 N N   . GLN F 1 1   ? -8.648  18.902  95.709  1.00 82.66  ? 2   GLN E N   1 
ATOM   4865 C CA  . GLN F 1 1   ? -8.585  17.413  95.621  1.00 82.86  ? 2   GLN E CA  1 
ATOM   4866 C C   . GLN F 1 1   ? -9.821  16.747  96.225  1.00 83.64  ? 2   GLN E C   1 
ATOM   4867 O O   . GLN F 1 1   ? -10.400 17.242  97.195  1.00 86.63  ? 2   GLN E O   1 
ATOM   4868 C CB  . GLN F 1 1   ? -7.335  16.902  96.328  1.00 80.83  ? 2   GLN E CB  1 
ATOM   4869 C CG  . GLN F 1 1   ? -7.223  15.398  96.354  1.00 83.89  ? 2   GLN E CG  1 
ATOM   4870 C CD  . GLN F 1 1   ? -5.961  14.940  97.041  1.00 89.63  ? 2   GLN E CD  1 
ATOM   4871 O OE1 . GLN F 1 1   ? -5.652  15.383  98.148  1.00 92.10  ? 2   GLN E OE1 1 
ATOM   4872 N NE2 . GLN F 1 1   ? -5.222  14.045  96.393  1.00 89.86  ? 2   GLN E NE2 1 
ATOM   4873 N N   . VAL F 1 2   ? -10.210 15.615  95.649  1.00 81.16  ? 3   VAL E N   1 
ATOM   4874 C CA  . VAL F 1 2   ? -11.382 14.875  96.105  1.00 81.89  ? 3   VAL E CA  1 
ATOM   4875 C C   . VAL F 1 2   ? -10.994 13.644  96.912  1.00 82.11  ? 3   VAL E C   1 
ATOM   4876 O O   . VAL F 1 2   ? -10.037 12.950  96.568  1.00 82.47  ? 3   VAL E O   1 
ATOM   4877 C CB  . VAL F 1 2   ? -12.226 14.421  94.910  1.00 83.68  ? 3   VAL E CB  1 
ATOM   4878 C CG1 . VAL F 1 2   ? -13.473 13.722  95.396  1.00 87.35  ? 3   VAL E CG1 1 
ATOM   4879 C CG2 . VAL F 1 2   ? -12.575 15.619  94.042  1.00 88.65  ? 3   VAL E CG2 1 
ATOM   4880 N N   . ARG F 1 3   ? -11.750 13.364  97.973  1.00 82.87  ? 4   ARG E N   1 
ATOM   4881 C CA  . ARG F 1 3   ? -11.460 12.210  98.826  1.00 88.99  ? 4   ARG E CA  1 
ATOM   4882 C C   . ARG F 1 3   ? -12.654 11.283  99.077  1.00 89.88  ? 4   ARG E C   1 
ATOM   4883 O O   . ARG F 1 3   ? -13.582 11.639  99.809  1.00 89.77  ? 4   ARG E O   1 
ATOM   4884 C CB  . ARG F 1 3   ? -10.923 12.677  100.185 1.00 92.21  ? 4   ARG E CB  1 
ATOM   4885 C CG  . ARG F 1 3   ? -9.764  13.665  100.127 1.00 99.34  ? 4   ARG E CG  1 
ATOM   4886 C CD  . ARG F 1 3   ? -9.231  13.969  101.528 1.00 100.08 ? 4   ARG E CD  1 
ATOM   4887 N NE  . ARG F 1 3   ? -8.298  15.096  101.544 1.00 103.03 ? 4   ARG E NE  1 
ATOM   4888 C CZ  . ARG F 1 3   ? -7.167  15.150  100.846 1.00 104.21 ? 4   ARG E CZ  1 
ATOM   4889 N NH1 . ARG F 1 3   ? -6.816  14.135  100.066 1.00 104.34 ? 4   ARG E NH1 1 
ATOM   4890 N NH2 . ARG F 1 3   ? -6.386  16.222  100.923 1.00 102.00 ? 4   ARG E NH2 1 
ATOM   4891 N N   . GLN F 1 4   ? -12.624 10.090  98.485  1.00 89.70  ? 5   GLN E N   1 
ATOM   4892 C CA  . GLN F 1 4   ? -13.700 9.118   98.683  1.00 89.45  ? 5   GLN E CA  1 
ATOM   4893 C C   . GLN F 1 4   ? -13.406 8.302   99.943  1.00 91.55  ? 5   GLN E C   1 
ATOM   4894 O O   . GLN F 1 4   ? -12.352 7.679   100.050 1.00 93.57  ? 5   GLN E O   1 
ATOM   4895 C CB  . GLN F 1 4   ? -13.819 8.208   97.463  1.00 83.77  ? 5   GLN E CB  1 
ATOM   4896 C CG  . GLN F 1 4   ? -14.161 8.962   96.193  1.00 79.73  ? 5   GLN E CG  1 
ATOM   4897 C CD  . GLN F 1 4   ? -14.757 8.072   95.121  1.00 83.62  ? 5   GLN E CD  1 
ATOM   4898 O OE1 . GLN F 1 4   ? -15.766 7.400   95.345  1.00 82.88  ? 5   GLN E OE1 1 
ATOM   4899 N NE2 . GLN F 1 4   ? -14.141 8.069   93.942  1.00 82.96  ? 5   GLN E NE2 1 
ATOM   4900 N N   . SER F 1 5   ? -14.347 8.302   100.887 1.00 93.48  ? 6   SER E N   1 
ATOM   4901 C CA  . SER F 1 5   ? -14.171 7.618   102.168 1.00 96.27  ? 6   SER E CA  1 
ATOM   4902 C C   . SER F 1 5   ? -14.033 6.091   102.185 1.00 97.17  ? 6   SER E C   1 
ATOM   4903 O O   . SER F 1 5   ? -12.913 5.580   102.254 1.00 100.61 ? 6   SER E O   1 
ATOM   4904 C CB  . SER F 1 5   ? -15.271 8.059   103.145 1.00 99.82  ? 6   SER E CB  1 
ATOM   4905 O OG  . SER F 1 5   ? -15.067 7.507   104.436 1.00 101.47 ? 6   SER E OG  1 
ATOM   4906 N N   . PRO F 1 6   ? -15.147 5.334   102.135 1.00 94.62  ? 7   PRO E N   1 
ATOM   4907 C CA  . PRO F 1 6   ? -14.916 3.884   102.164 1.00 90.72  ? 7   PRO E CA  1 
ATOM   4908 C C   . PRO F 1 6   ? -13.991 3.353   101.068 1.00 88.30  ? 7   PRO E C   1 
ATOM   4909 O O   . PRO F 1 6   ? -14.382 3.220   99.908  1.00 90.19  ? 7   PRO E O   1 
ATOM   4910 C CB  . PRO F 1 6   ? -16.325 3.312   102.085 1.00 90.65  ? 7   PRO E CB  1 
ATOM   4911 C CG  . PRO F 1 6   ? -17.132 4.355   102.832 1.00 94.65  ? 7   PRO E CG  1 
ATOM   4912 C CD  . PRO F 1 6   ? -16.588 5.633   102.231 1.00 94.53  ? 7   PRO E CD  1 
ATOM   4913 N N   . GLN F 1 7   ? -12.757 3.053   101.465 1.00 87.73  ? 8   GLN E N   1 
ATOM   4914 C CA  . GLN F 1 7   ? -11.727 2.545   100.563 1.00 86.26  ? 8   GLN E CA  1 
ATOM   4915 C C   . GLN F 1 7   ? -12.210 1.346   99.738  1.00 86.98  ? 8   GLN E C   1 
ATOM   4916 O O   . GLN F 1 7   ? -11.884 1.213   98.556  1.00 85.29  ? 8   GLN E O   1 
ATOM   4917 C CB  . GLN F 1 7   ? -10.471 2.186   101.374 1.00 85.10  ? 8   GLN E CB  1 
ATOM   4918 C CG  . GLN F 1 7   ? -10.675 2.124   102.906 1.00 84.65  ? 8   GLN E CG  1 
ATOM   4919 C CD  . GLN F 1 7   ? -10.906 3.489   103.560 1.00 74.50  ? 8   GLN E CD  1 
ATOM   4920 O OE1 . GLN F 1 7   ? -10.220 4.456   103.254 1.00 75.76  ? 8   GLN E OE1 1 
ATOM   4921 N NE2 . GLN F 1 7   ? -11.865 3.557   104.478 1.00 69.83  ? 8   GLN E NE2 1 
ATOM   4922 N N   . SER F 1 8   ? -12.993 0.483   100.371 1.00 86.85  ? 9   SER E N   1 
ATOM   4923 C CA  . SER F 1 8   ? -13.558 -0.695  99.722  1.00 83.59  ? 9   SER E CA  1 
ATOM   4924 C C   . SER F 1 8   ? -14.804 -1.036  100.514 1.00 81.61  ? 9   SER E C   1 
ATOM   4925 O O   . SER F 1 8   ? -14.819 -0.881  101.735 1.00 74.51  ? 9   SER E O   1 
ATOM   4926 C CB  . SER F 1 8   ? -12.583 -1.869  99.769  1.00 88.36  ? 9   SER E CB  1 
ATOM   4927 O OG  . SER F 1 8   ? -13.173 -3.035  99.215  1.00 89.62  ? 9   SER E OG  1 
ATOM   4928 N N   . LEU F 1 9   ? -15.845 -1.496  99.826  1.00 82.14  ? 10  LEU E N   1 
ATOM   4929 C CA  . LEU F 1 9   ? -17.098 -1.823  100.493 1.00 82.16  ? 10  LEU E CA  1 
ATOM   4930 C C   . LEU F 1 9   ? -17.817 -3.017  99.885  1.00 84.07  ? 10  LEU E C   1 
ATOM   4931 O O   . LEU F 1 9   ? -18.044 -3.071  98.674  1.00 81.33  ? 10  LEU E O   1 
ATOM   4932 C CB  . LEU F 1 9   ? -18.031 -0.609  100.460 1.00 80.86  ? 10  LEU E CB  1 
ATOM   4933 C CG  . LEU F 1 9   ? -19.403 -0.734  101.127 1.00 75.82  ? 10  LEU E CG  1 
ATOM   4934 C CD1 . LEU F 1 9   ? -19.245 -0.797  102.640 1.00 76.81  ? 10  LEU E CD1 1 
ATOM   4935 C CD2 . LEU F 1 9   ? -20.259 0.456   100.731 1.00 76.91  ? 10  LEU E CD2 1 
ATOM   4936 N N   . THR F 1 10  ? -18.169 -3.973  100.740 1.00 86.71  ? 11  THR E N   1 
ATOM   4937 C CA  . THR F 1 10  ? -18.899 -5.163  100.318 1.00 88.93  ? 11  THR E CA  1 
ATOM   4938 C C   . THR F 1 10  ? -20.171 -5.192  101.160 1.00 89.48  ? 11  THR E C   1 
ATOM   4939 O O   . THR F 1 10  ? -20.120 -5.012  102.381 1.00 83.46  ? 11  THR E O   1 
ATOM   4940 C CB  . THR F 1 10  ? -18.081 -6.466  100.551 1.00 89.47  ? 11  THR E CB  1 
ATOM   4941 O OG1 . THR F 1 10  ? -16.912 -6.465  99.718  1.00 88.99  ? 11  THR E OG1 1 
ATOM   4942 C CG2 . THR F 1 10  ? -18.922 -7.686  100.207 1.00 88.82  ? 11  THR E CG2 1 
ATOM   4943 N N   . VAL F 1 11  ? -21.309 -5.393  100.497 1.00 91.52  ? 12  VAL E N   1 
ATOM   4944 C CA  . VAL F 1 11  ? -22.607 -5.424  101.166 1.00 94.51  ? 12  VAL E CA  1 
ATOM   4945 C C   . VAL F 1 11  ? -23.572 -6.414  100.504 1.00 94.74  ? 12  VAL E C   1 
ATOM   4946 O O   . VAL F 1 11  ? -23.494 -6.667  99.298  1.00 93.98  ? 12  VAL E O   1 
ATOM   4947 C CB  . VAL F 1 11  ? -23.248 -4.007  101.178 1.00 98.12  ? 12  VAL E CB  1 
ATOM   4948 C CG1 . VAL F 1 11  ? -24.701 -4.083  101.596 1.00 102.01 ? 12  VAL E CG1 1 
ATOM   4949 C CG2 . VAL F 1 11  ? -22.489 -3.105  102.139 1.00 100.52 ? 12  VAL E CG2 1 
ATOM   4950 N N   . TRP F 1 12  ? -24.480 -6.967  101.307 1.00 94.58  ? 13  TRP E N   1 
ATOM   4951 C CA  . TRP F 1 12  ? -25.459 -7.934  100.821 1.00 95.19  ? 13  TRP E CA  1 
ATOM   4952 C C   . TRP F 1 12  ? -26.560 -7.319  99.978  1.00 91.81  ? 13  TRP E C   1 
ATOM   4953 O O   . TRP F 1 12  ? -27.223 -6.368  100.391 1.00 88.59  ? 13  TRP E O   1 
ATOM   4954 C CB  . TRP F 1 12  ? -26.125 -8.673  101.982 1.00 100.07 ? 13  TRP E CB  1 
ATOM   4955 C CG  . TRP F 1 12  ? -25.242 -9.598  102.738 1.00 106.28 ? 13  TRP E CG  1 
ATOM   4956 C CD1 . TRP F 1 12  ? -24.501 -10.626 102.231 1.00 107.05 ? 13  TRP E CD1 1 
ATOM   4957 C CD2 . TRP F 1 12  ? -25.067 -9.635  104.159 1.00 111.02 ? 13  TRP E CD2 1 
ATOM   4958 N NE1 . TRP F 1 12  ? -23.876 -11.305 103.251 1.00 112.92 ? 13  TRP E NE1 1 
ATOM   4959 C CE2 . TRP F 1 12  ? -24.203 -10.716 104.445 1.00 113.45 ? 13  TRP E CE2 1 
ATOM   4960 C CE3 . TRP F 1 12  ? -25.551 -8.856  105.220 1.00 109.55 ? 13  TRP E CE3 1 
ATOM   4961 C CZ2 . TRP F 1 12  ? -23.821 -11.046 105.752 1.00 112.42 ? 13  TRP E CZ2 1 
ATOM   4962 C CZ3 . TRP F 1 12  ? -25.171 -9.183  106.520 1.00 111.62 ? 13  TRP E CZ3 1 
ATOM   4963 C CH2 . TRP F 1 12  ? -24.311 -10.268 106.772 1.00 111.51 ? 13  TRP E CH2 1 
ATOM   4964 N N   . GLU F 1 13  ? -26.755 -7.897  98.801  1.00 91.06  ? 14  GLU E N   1 
ATOM   4965 C CA  . GLU F 1 13  ? -27.783 -7.472  97.866  1.00 90.81  ? 14  GLU E CA  1 
ATOM   4966 C C   . GLU F 1 13  ? -29.064 -7.021  98.574  1.00 92.27  ? 14  GLU E C   1 
ATOM   4967 O O   . GLU F 1 13  ? -29.458 -7.593  99.594  1.00 89.06  ? 14  GLU E O   1 
ATOM   4968 C CB  . GLU F 1 13  ? -28.084 -8.635  96.922  1.00 87.17  ? 14  GLU E CB  1 
ATOM   4969 C CG  . GLU F 1 13  ? -29.413 -8.570  96.217  1.00 90.31  ? 14  GLU E CG  1 
ATOM   4970 C CD  . GLU F 1 13  ? -29.657 -9.804  95.380  1.00 94.11  ? 14  GLU E CD  1 
ATOM   4971 O OE1 . GLU F 1 13  ? -29.510 -10.921 95.921  1.00 96.50  ? 14  GLU E OE1 1 
ATOM   4972 O OE2 . GLU F 1 13  ? -29.996 -9.662  94.185  1.00 93.36  ? 14  GLU E OE2 1 
ATOM   4973 N N   . GLY F 1 14  ? -29.701 -5.985  98.033  1.00 90.32  ? 15  GLY E N   1 
ATOM   4974 C CA  . GLY F 1 14  ? -30.933 -5.489  98.620  1.00 90.63  ? 15  GLY E CA  1 
ATOM   4975 C C   . GLY F 1 14  ? -30.776 -4.346  99.604  1.00 90.62  ? 15  GLY E C   1 
ATOM   4976 O O   . GLY F 1 14  ? -31.706 -3.565  99.796  1.00 92.45  ? 15  GLY E O   1 
ATOM   4977 N N   . GLU F 1 15  ? -29.612 -4.251  100.239 1.00 92.02  ? 16  GLU E N   1 
ATOM   4978 C CA  . GLU F 1 15  ? -29.355 -3.183  101.203 1.00 94.57  ? 16  GLU E CA  1 
ATOM   4979 C C   . GLU F 1 15  ? -29.110 -1.865  100.479 1.00 92.64  ? 16  GLU E C   1 
ATOM   4980 O O   . GLU F 1 15  ? -29.187 -1.789  99.250  1.00 90.86  ? 16  GLU E O   1 
ATOM   4981 C CB  . GLU F 1 15  ? -28.116 -3.497  102.040 1.00 97.44  ? 16  GLU E CB  1 
ATOM   4982 C CG  . GLU F 1 15  ? -28.174 -4.773  102.846 1.00 102.72 ? 16  GLU E CG  1 
ATOM   4983 C CD  . GLU F 1 15  ? -26.842 -5.075  103.508 1.00 107.31 ? 16  GLU E CD  1 
ATOM   4984 O OE1 . GLU F 1 15  ? -26.314 -4.187  104.213 1.00 107.85 ? 16  GLU E OE1 1 
ATOM   4985 O OE2 . GLU F 1 15  ? -26.318 -6.194  103.319 1.00 108.07 ? 16  GLU E OE2 1 
ATOM   4986 N N   . THR F 1 16  ? -28.812 -0.827  101.254 1.00 89.74  ? 17  THR E N   1 
ATOM   4987 C CA  . THR F 1 16  ? -28.517 0.481   100.691 1.00 84.71  ? 17  THR E CA  1 
ATOM   4988 C C   . THR F 1 16  ? -27.030 0.746   100.882 1.00 78.98  ? 17  THR E C   1 
ATOM   4989 O O   . THR F 1 16  ? -26.568 0.999   101.995 1.00 72.60  ? 17  THR E O   1 
ATOM   4990 C CB  . THR F 1 16  ? -29.315 1.594   101.381 1.00 88.75  ? 17  THR E CB  1 
ATOM   4991 O OG1 . THR F 1 16  ? -30.718 1.352   101.220 1.00 90.85  ? 17  THR E OG1 1 
ATOM   4992 C CG2 . THR F 1 16  ? -28.968 2.941   100.768 1.00 93.23  ? 17  THR E CG2 1 
ATOM   4993 N N   . ALA F 1 17  ? -26.283 0.662   99.789  1.00 78.07  ? 18  ALA E N   1 
ATOM   4994 C CA  . ALA F 1 17  ? -24.847 0.889   99.826  1.00 78.04  ? 18  ALA E CA  1 
ATOM   4995 C C   . ALA F 1 17  ? -24.561 2.380   99.736  1.00 79.31  ? 18  ALA E C   1 
ATOM   4996 O O   . ALA F 1 17  ? -24.964 3.031   98.772  1.00 79.51  ? 18  ALA E O   1 
ATOM   4997 C CB  . ALA F 1 17  ? -24.170 0.159   98.667  1.00 72.20  ? 18  ALA E CB  1 
ATOM   4998 N N   . ILE F 1 18  ? -23.873 2.909   100.747 1.00 80.17  ? 19  ILE E N   1 
ATOM   4999 C CA  . ILE F 1 18  ? -23.499 4.325   100.799 1.00 78.14  ? 19  ILE E CA  1 
ATOM   5000 C C   . ILE F 1 18  ? -22.065 4.506   100.280 1.00 78.03  ? 19  ILE E C   1 
ATOM   5001 O O   . ILE F 1 18  ? -21.244 3.593   100.363 1.00 77.48  ? 19  ILE E O   1 
ATOM   5002 C CB  . ILE F 1 18  ? -23.551 4.870   102.243 1.00 70.65  ? 19  ILE E CB  1 
ATOM   5003 C CG1 . ILE F 1 18  ? -24.937 4.647   102.843 1.00 69.30  ? 19  ILE E CG1 1 
ATOM   5004 C CG2 . ILE F 1 18  ? -23.211 6.347   102.250 1.00 70.28  ? 19  ILE E CG2 1 
ATOM   5005 C CD1 . ILE F 1 18  ? -25.041 5.085   104.293 1.00 61.58  ? 19  ILE E CD1 1 
ATOM   5006 N N   . LEU F 1 19  ? -21.767 5.684   99.746  1.00 76.69  ? 20  LEU E N   1 
ATOM   5007 C CA  . LEU F 1 19  ? -20.432 5.964   99.232  1.00 77.53  ? 20  LEU E CA  1 
ATOM   5008 C C   . LEU F 1 19  ? -20.100 7.430   99.483  1.00 79.01  ? 20  LEU E C   1 
ATOM   5009 O O   . LEU F 1 19  ? -20.601 8.318   98.796  1.00 78.52  ? 20  LEU E O   1 
ATOM   5010 C CB  . LEU F 1 19  ? -20.363 5.659   97.734  1.00 77.13  ? 20  LEU E CB  1 
ATOM   5011 C CG  . LEU F 1 19  ? -20.663 4.231   97.266  1.00 73.16  ? 20  LEU E CG  1 
ATOM   5012 C CD1 . LEU F 1 19  ? -20.516 4.152   95.747  1.00 70.80  ? 20  LEU E CD1 1 
ATOM   5013 C CD2 . LEU F 1 19  ? -19.715 3.255   97.938  1.00 69.73  ? 20  LEU E CD2 1 
ATOM   5014 N N   . ASN F 1 20  ? -19.246 7.674   100.470 1.00 79.88  ? 21  ASN E N   1 
ATOM   5015 C CA  . ASN F 1 20  ? -18.867 9.031   100.838 1.00 79.41  ? 21  ASN E CA  1 
ATOM   5016 C C   . ASN F 1 20  ? -17.839 9.690   99.931  1.00 79.09  ? 21  ASN E C   1 
ATOM   5017 O O   . ASN F 1 20  ? -17.042 9.017   99.275  1.00 79.60  ? 21  ASN E O   1 
ATOM   5018 C CB  . ASN F 1 20  ? -18.363 9.037   102.273 1.00 78.83  ? 21  ASN E CB  1 
ATOM   5019 C CG  . ASN F 1 20  ? -19.280 8.282   103.192 1.00 83.16  ? 21  ASN E CG  1 
ATOM   5020 O OD1 . ASN F 1 20  ? -20.471 8.583   103.280 1.00 85.80  ? 21  ASN E OD1 1 
ATOM   5021 N ND2 . ASN F 1 20  ? -18.739 7.283   103.877 1.00 85.00  ? 21  ASN E ND2 1 
ATOM   5022 N N   . CYS F 1 21  ? -17.877 11.020  99.912  1.00 78.25  ? 22  CYS E N   1 
ATOM   5023 C CA  . CYS F 1 21  ? -16.976 11.842  99.110  1.00 74.23  ? 22  CYS E CA  1 
ATOM   5024 C C   . CYS F 1 21  ? -16.796 13.163  99.855  1.00 75.08  ? 22  CYS E C   1 
ATOM   5025 O O   . CYS F 1 21  ? -17.692 13.598  100.578 1.00 74.84  ? 22  CYS E O   1 
ATOM   5026 C CB  . CYS F 1 21  ? -17.588 12.105  97.723  1.00 69.09  ? 22  CYS E CB  1 
ATOM   5027 S SG  . CYS F 1 21  ? -16.425 12.786  96.488  1.00 63.09  ? 22  CYS E SG  1 
ATOM   5028 N N   . SER F 1 22  ? -15.637 13.792  99.701  1.00 76.24  ? 23  SER E N   1 
ATOM   5029 C CA  . SER F 1 22  ? -15.390 15.074  100.360 1.00 78.51  ? 23  SER E CA  1 
ATOM   5030 C C   . SER F 1 22  ? -14.305 15.872  99.641  1.00 79.02  ? 23  SER E C   1 
ATOM   5031 O O   . SER F 1 22  ? -13.534 15.328  98.843  1.00 80.19  ? 23  SER E O   1 
ATOM   5032 C CB  . SER F 1 22  ? -15.023 14.873  101.839 1.00 74.30  ? 23  SER E CB  1 
ATOM   5033 O OG  . SER F 1 22  ? -13.830 14.129  101.992 1.00 74.12  ? 23  SER E OG  1 
ATOM   5034 N N   . TYR F 1 23  ? -14.250 17.167  99.930  1.00 77.68  ? 24  TYR E N   1 
ATOM   5035 C CA  . TYR F 1 23  ? -13.285 18.040  99.281  1.00 73.76  ? 24  TYR E CA  1 
ATOM   5036 C C   . TYR F 1 23  ? -13.129 19.312  100.104 1.00 73.97  ? 24  TYR E C   1 
ATOM   5037 O O   . TYR F 1 23  ? -13.954 19.589  100.975 1.00 71.74  ? 24  TYR E O   1 
ATOM   5038 C CB  . TYR F 1 23  ? -13.803 18.374  97.886  1.00 67.59  ? 24  TYR E CB  1 
ATOM   5039 C CG  . TYR F 1 23  ? -15.146 19.070  97.913  1.00 59.53  ? 24  TYR E CG  1 
ATOM   5040 C CD1 . TYR F 1 23  ? -15.229 20.454  98.037  1.00 61.94  ? 24  TYR E CD1 1 
ATOM   5041 C CD2 . TYR F 1 23  ? -16.335 18.344  97.858  1.00 60.17  ? 24  TYR E CD2 1 
ATOM   5042 C CE1 . TYR F 1 23  ? -16.456 21.100  98.105  1.00 63.28  ? 24  TYR E CE1 1 
ATOM   5043 C CE2 . TYR F 1 23  ? -17.574 18.982  97.929  1.00 56.35  ? 24  TYR E CE2 1 
ATOM   5044 C CZ  . TYR F 1 23  ? -17.623 20.362  98.054  1.00 63.73  ? 24  TYR E CZ  1 
ATOM   5045 O OH  . TYR F 1 23  ? -18.828 21.016  98.143  1.00 70.20  ? 24  TYR E OH  1 
ATOM   5046 N N   . GLU F 1 24  ? -12.077 20.082  99.833  1.00 76.39  ? 25  GLU E N   1 
ATOM   5047 C CA  . GLU F 1 24  ? -11.857 21.322  100.571 1.00 82.79  ? 25  GLU E CA  1 
ATOM   5048 C C   . GLU F 1 24  ? -11.662 22.548  99.678  1.00 83.18  ? 25  GLU E C   1 
ATOM   5049 O O   . GLU F 1 24  ? -10.914 23.468  100.017 1.00 86.24  ? 25  GLU E O   1 
ATOM   5050 C CB  . GLU F 1 24  ? -10.673 21.165  101.537 1.00 86.86  ? 25  GLU E CB  1 
ATOM   5051 C CG  . GLU F 1 24  ? -9.359  20.737  100.903 1.00 96.95  ? 25  GLU E CG  1 
ATOM   5052 C CD  . GLU F 1 24  ? -8.307  20.361  101.945 1.00 102.38 ? 25  GLU E CD  1 
ATOM   5053 O OE1 . GLU F 1 24  ? -7.989  21.204  102.813 1.00 105.19 ? 25  GLU E OE1 1 
ATOM   5054 O OE2 . GLU F 1 24  ? -7.798  19.218  101.894 1.00 102.13 ? 25  GLU E OE2 1 
ATOM   5055 N N   . ASN F 1 25  ? -12.343 22.551  98.534  1.00 80.98  ? 26  ASN E N   1 
ATOM   5056 C CA  . ASN F 1 25  ? -12.287 23.664  97.589  1.00 75.35  ? 26  ASN E CA  1 
ATOM   5057 C C   . ASN F 1 25  ? -13.702 24.183  97.388  1.00 73.04  ? 26  ASN E C   1 
ATOM   5058 O O   . ASN F 1 25  ? -14.424 23.737  96.490  1.00 70.40  ? 26  ASN E O   1 
ATOM   5059 C CB  . ASN F 1 25  ? -11.724 23.215  96.241  1.00 76.86  ? 26  ASN E CB  1 
ATOM   5060 C CG  . ASN F 1 25  ? -11.562 24.369  95.263  1.00 77.56  ? 26  ASN E CG  1 
ATOM   5061 O OD1 . ASN F 1 25  ? -10.916 24.229  94.222  1.00 68.23  ? 26  ASN E OD1 1 
ATOM   5062 N ND2 . ASN F 1 25  ? -12.149 25.514  95.593  1.00 72.94  ? 26  ASN E ND2 1 
ATOM   5063 N N   . SER F 1 26  ? -14.092 25.127  98.233  1.00 66.78  ? 27  SER E N   1 
ATOM   5064 C CA  . SER F 1 26  ? -15.423 25.717  98.183  1.00 65.65  ? 27  SER E CA  1 
ATOM   5065 C C   . SER F 1 26  ? -15.922 26.175  96.801  1.00 64.83  ? 27  SER E C   1 
ATOM   5066 O O   . SER F 1 26  ? -17.119 26.402  96.615  1.00 62.90  ? 27  SER E O   1 
ATOM   5067 C CB  . SER F 1 26  ? -15.473 26.882  99.169  1.00 62.04  ? 27  SER E CB  1 
ATOM   5068 O OG  . SER F 1 26  ? -14.239 27.578  99.175  1.00 62.90  ? 27  SER E OG  1 
ATOM   5069 N N   . ALA F 1 27  ? -15.014 26.302  95.836  1.00 61.47  ? 28  ALA E N   1 
ATOM   5070 C CA  . ALA F 1 27  ? -15.384 26.747  94.496  1.00 61.39  ? 28  ALA E CA  1 
ATOM   5071 C C   . ALA F 1 27  ? -15.968 25.652  93.604  1.00 62.96  ? 28  ALA E C   1 
ATOM   5072 O O   . ALA F 1 27  ? -16.451 25.945  92.507  1.00 62.72  ? 28  ALA E O   1 
ATOM   5073 C CB  . ALA F 1 27  ? -14.180 27.391  93.804  1.00 55.12  ? 28  ALA E CB  1 
ATOM   5074 N N   . PHE F 1 28  ? -15.920 24.398  94.058  1.00 63.21  ? 29  PHE E N   1 
ATOM   5075 C CA  . PHE F 1 28  ? -16.468 23.292  93.272  1.00 57.51  ? 29  PHE E CA  1 
ATOM   5076 C C   . PHE F 1 28  ? -17.991 23.394  93.246  1.00 55.94  ? 29  PHE E C   1 
ATOM   5077 O O   . PHE F 1 28  ? -18.619 23.642  94.282  1.00 43.38  ? 29  PHE E O   1 
ATOM   5078 C CB  . PHE F 1 28  ? -16.056 21.944  93.864  1.00 59.07  ? 29  PHE E CB  1 
ATOM   5079 C CG  . PHE F 1 28  ? -14.628 21.565  93.592  1.00 57.51  ? 29  PHE E CG  1 
ATOM   5080 C CD1 . PHE F 1 28  ? -14.084 21.711  92.318  1.00 56.11  ? 29  PHE E CD1 1 
ATOM   5081 C CD2 . PHE F 1 28  ? -13.841 21.004  94.598  1.00 59.34  ? 29  PHE E CD2 1 
ATOM   5082 C CE1 . PHE F 1 28  ? -12.775 21.300  92.046  1.00 58.61  ? 29  PHE E CE1 1 
ATOM   5083 C CE2 . PHE F 1 28  ? -12.532 20.587  94.341  1.00 59.96  ? 29  PHE E CE2 1 
ATOM   5084 C CZ  . PHE F 1 28  ? -11.998 20.735  93.059  1.00 60.94  ? 29  PHE E CZ  1 
ATOM   5085 N N   . ASP F 1 29  ? -18.586 23.195  92.070  1.00 50.84  ? 30  ASP E N   1 
ATOM   5086 C CA  . ASP F 1 29  ? -20.034 23.304  91.954  1.00 59.82  ? 30  ASP E CA  1 
ATOM   5087 C C   . ASP F 1 29  ? -20.721 22.154  91.202  1.00 62.54  ? 30  ASP E C   1 
ATOM   5088 O O   . ASP F 1 29  ? -21.941 21.996  91.283  1.00 63.89  ? 30  ASP E O   1 
ATOM   5089 C CB  . ASP F 1 29  ? -20.395 24.658  91.310  1.00 57.82  ? 30  ASP E CB  1 
ATOM   5090 C CG  . ASP F 1 29  ? -19.977 24.752  89.841  1.00 63.97  ? 30  ASP E CG  1 
ATOM   5091 O OD1 . ASP F 1 29  ? -18.809 24.447  89.519  1.00 64.78  ? 30  ASP E OD1 1 
ATOM   5092 O OD2 . ASP F 1 29  ? -20.821 25.143  89.003  1.00 65.21  ? 30  ASP E OD2 1 
ATOM   5093 N N   . TYR F 1 30  ? -19.942 21.360  90.473  1.00 65.11  ? 31  TYR E N   1 
ATOM   5094 C CA  . TYR F 1 30  ? -20.472 20.227  89.709  1.00 66.59  ? 31  TYR E CA  1 
ATOM   5095 C C   . TYR F 1 30  ? -19.819 18.947  90.225  1.00 69.89  ? 31  TYR E C   1 
ATOM   5096 O O   . TYR F 1 30  ? -18.592 18.864  90.303  1.00 70.06  ? 31  TYR E O   1 
ATOM   5097 C CB  . TYR F 1 30  ? -20.157 20.419  88.226  1.00 63.89  ? 31  TYR E CB  1 
ATOM   5098 C CG  . TYR F 1 30  ? -20.537 19.265  87.321  1.00 70.22  ? 31  TYR E CG  1 
ATOM   5099 C CD1 . TYR F 1 30  ? -21.853 18.811  87.244  1.00 73.24  ? 31  TYR E CD1 1 
ATOM   5100 C CD2 . TYR F 1 30  ? -19.587 18.673  86.481  1.00 65.60  ? 31  TYR E CD2 1 
ATOM   5101 C CE1 . TYR F 1 30  ? -22.220 17.797  86.343  1.00 74.18  ? 31  TYR E CE1 1 
ATOM   5102 C CE2 . TYR F 1 30  ? -19.940 17.664  85.579  1.00 68.19  ? 31  TYR E CE2 1 
ATOM   5103 C CZ  . TYR F 1 30  ? -21.259 17.232  85.511  1.00 71.78  ? 31  TYR E CZ  1 
ATOM   5104 O OH  . TYR F 1 30  ? -21.621 16.266  84.593  1.00 68.26  ? 31  TYR E OH  1 
ATOM   5105 N N   . PHE F 1 31  ? -20.630 17.951  90.576  1.00 69.61  ? 32  PHE E N   1 
ATOM   5106 C CA  . PHE F 1 31  ? -20.093 16.703  91.108  1.00 65.41  ? 32  PHE E CA  1 
ATOM   5107 C C   . PHE F 1 31  ? -20.651 15.456  90.442  1.00 65.89  ? 32  PHE E C   1 
ATOM   5108 O O   . PHE F 1 31  ? -21.576 14.831  90.952  1.00 64.94  ? 32  PHE E O   1 
ATOM   5109 C CB  . PHE F 1 31  ? -20.353 16.626  92.612  1.00 65.51  ? 32  PHE E CB  1 
ATOM   5110 C CG  . PHE F 1 31  ? -19.882 17.834  93.372  1.00 65.68  ? 32  PHE E CG  1 
ATOM   5111 C CD1 . PHE F 1 31  ? -20.555 19.048  93.268  1.00 69.70  ? 32  PHE E CD1 1 
ATOM   5112 C CD2 . PHE F 1 31  ? -18.763 17.759  94.196  1.00 67.86  ? 32  PHE E CD2 1 
ATOM   5113 C CE1 . PHE F 1 31  ? -20.121 20.171  93.974  1.00 68.58  ? 32  PHE E CE1 1 
ATOM   5114 C CE2 . PHE F 1 31  ? -18.321 18.875  94.906  1.00 68.01  ? 32  PHE E CE2 1 
ATOM   5115 C CZ  . PHE F 1 31  ? -19.001 20.083  94.796  1.00 67.17  ? 32  PHE E CZ  1 
ATOM   5116 N N   . PRO F 1 32  ? -20.094 15.078  89.287  1.00 65.94  ? 33  PRO E N   1 
ATOM   5117 C CA  . PRO F 1 32  ? -20.554 13.887  88.567  1.00 70.31  ? 33  PRO E CA  1 
ATOM   5118 C C   . PRO F 1 32  ? -19.967 12.593  89.153  1.00 75.45  ? 33  PRO E C   1 
ATOM   5119 O O   . PRO F 1 32  ? -18.807 12.563  89.572  1.00 74.47  ? 33  PRO E O   1 
ATOM   5120 C CB  . PRO F 1 32  ? -20.065 14.145  87.146  1.00 68.46  ? 33  PRO E CB  1 
ATOM   5121 C CG  . PRO F 1 32  ? -18.760 14.835  87.383  1.00 64.78  ? 33  PRO E CG  1 
ATOM   5122 C CD  . PRO F 1 32  ? -19.107 15.824  88.486  1.00 64.94  ? 33  PRO E CD  1 
ATOM   5123 N N   . TRP F 1 33  ? -20.774 11.532  89.187  1.00 75.91  ? 34  TRP E N   1 
ATOM   5124 C CA  . TRP F 1 33  ? -20.324 10.235  89.694  1.00 71.84  ? 34  TRP E CA  1 
ATOM   5125 C C   . TRP F 1 33  ? -20.268 9.252   88.543  1.00 72.87  ? 34  TRP E C   1 
ATOM   5126 O O   . TRP F 1 33  ? -21.258 9.070   87.836  1.00 75.63  ? 34  TRP E O   1 
ATOM   5127 C CB  . TRP F 1 33  ? -21.281 9.688   90.744  1.00 64.25  ? 34  TRP E CB  1 
ATOM   5128 C CG  . TRP F 1 33  ? -21.177 10.337  92.068  1.00 67.49  ? 34  TRP E CG  1 
ATOM   5129 C CD1 . TRP F 1 33  ? -21.694 11.540  92.429  1.00 73.92  ? 34  TRP E CD1 1 
ATOM   5130 C CD2 . TRP F 1 33  ? -20.531 9.808   93.232  1.00 69.77  ? 34  TRP E CD2 1 
ATOM   5131 N NE1 . TRP F 1 33  ? -21.429 11.792  93.756  1.00 78.11  ? 34  TRP E NE1 1 
ATOM   5132 C CE2 . TRP F 1 33  ? -20.728 10.736  94.275  1.00 69.55  ? 34  TRP E CE2 1 
ATOM   5133 C CE3 . TRP F 1 33  ? -19.839 8.620   93.505  1.00 72.07  ? 34  TRP E CE3 1 
ATOM   5134 C CZ2 . TRP F 1 33  ? -20.218 10.539  95.560  1.00 68.99  ? 34  TRP E CZ2 1 
ATOM   5135 C CZ3 . TRP F 1 33  ? -19.335 8.421   94.782  1.00 68.35  ? 34  TRP E CZ3 1 
ATOM   5136 C CH2 . TRP F 1 33  ? -19.543 9.369   95.799  1.00 69.08  ? 34  TRP E CH2 1 
ATOM   5137 N N   . TYR F 1 34  ? -19.118 8.613   88.354  1.00 72.58  ? 35  TYR E N   1 
ATOM   5138 C CA  . TYR F 1 34  ? -18.973 7.654   87.269  1.00 76.71  ? 35  TYR E CA  1 
ATOM   5139 C C   . TYR F 1 34  ? -18.943 6.212   87.773  1.00 80.54  ? 35  TYR E C   1 
ATOM   5140 O O   . TYR F 1 34  ? -18.501 5.940   88.890  1.00 78.95  ? 35  TYR E O   1 
ATOM   5141 C CB  . TYR F 1 34  ? -17.697 7.939   86.475  1.00 77.19  ? 35  TYR E CB  1 
ATOM   5142 C CG  . TYR F 1 34  ? -17.663 9.285   85.781  1.00 80.78  ? 35  TYR E CG  1 
ATOM   5143 C CD1 . TYR F 1 34  ? -17.611 10.476  86.512  1.00 76.67  ? 35  TYR E CD1 1 
ATOM   5144 C CD2 . TYR F 1 34  ? -17.655 9.367   84.386  1.00 81.65  ? 35  TYR E CD2 1 
ATOM   5145 C CE1 . TYR F 1 34  ? -17.547 11.715  85.870  1.00 79.97  ? 35  TYR E CE1 1 
ATOM   5146 C CE2 . TYR F 1 34  ? -17.591 10.598  83.733  1.00 80.40  ? 35  TYR E CE2 1 
ATOM   5147 C CZ  . TYR F 1 34  ? -17.535 11.766  84.479  1.00 84.42  ? 35  TYR E CZ  1 
ATOM   5148 O OH  . TYR F 1 34  ? -17.457 12.977  83.827  1.00 85.53  ? 35  TYR E OH  1 
ATOM   5149 N N   . GLN F 1 35  ? -19.419 5.295   86.936  1.00 80.27  ? 36  GLN E N   1 
ATOM   5150 C CA  . GLN F 1 35  ? -19.444 3.873   87.263  1.00 79.15  ? 36  GLN E CA  1 
ATOM   5151 C C   . GLN F 1 35  ? -18.519 3.123   86.310  1.00 81.23  ? 36  GLN E C   1 
ATOM   5152 O O   . GLN F 1 35  ? -18.578 3.320   85.095  1.00 81.37  ? 36  GLN E O   1 
ATOM   5153 C CB  . GLN F 1 35  ? -20.867 3.334   87.133  1.00 79.89  ? 36  GLN E CB  1 
ATOM   5154 C CG  . GLN F 1 35  ? -20.952 1.829   86.922  1.00 81.31  ? 36  GLN E CG  1 
ATOM   5155 C CD  . GLN F 1 35  ? -22.374 1.357   86.703  1.00 80.95  ? 36  GLN E CD  1 
ATOM   5156 O OE1 . GLN F 1 35  ? -23.126 1.151   87.659  1.00 71.64  ? 36  GLN E OE1 1 
ATOM   5157 N NE2 . GLN F 1 35  ? -22.760 1.200   85.436  1.00 74.96  ? 36  GLN E NE2 1 
ATOM   5158 N N   . GLN F 1 36  ? -17.667 2.259   86.854  1.00 81.97  ? 37  GLN E N   1 
ATOM   5159 C CA  . GLN F 1 36  ? -16.743 1.511   86.014  1.00 80.94  ? 37  GLN E CA  1 
ATOM   5160 C C   . GLN F 1 36  ? -16.718 0.013   86.296  1.00 83.71  ? 37  GLN E C   1 
ATOM   5161 O O   . GLN F 1 36  ? -16.474 -0.421  87.425  1.00 80.92  ? 37  GLN E O   1 
ATOM   5162 C CB  . GLN F 1 36  ? -15.327 2.082   86.152  1.00 80.11  ? 37  GLN E CB  1 
ATOM   5163 C CG  . GLN F 1 36  ? -14.259 1.342   85.357  1.00 65.95  ? 37  GLN E CG  1 
ATOM   5164 C CD  . GLN F 1 36  ? -12.862 1.854   85.657  1.00 66.46  ? 37  GLN E CD  1 
ATOM   5165 O OE1 . GLN F 1 36  ? -12.532 2.140   86.809  1.00 59.06  ? 37  GLN E OE1 1 
ATOM   5166 N NE2 . GLN F 1 36  ? -12.030 1.958   84.625  1.00 60.14  ? 37  GLN E NE2 1 
ATOM   5167 N N   . PHE F 1 37  ? -16.972 -0.759  85.241  1.00 85.99  ? 38  PHE E N   1 
ATOM   5168 C CA  . PHE F 1 37  ? -16.966 -2.216  85.297  1.00 83.41  ? 38  PHE E CA  1 
ATOM   5169 C C   . PHE F 1 37  ? -15.638 -2.682  84.722  1.00 83.68  ? 38  PHE E C   1 
ATOM   5170 O O   . PHE F 1 37  ? -15.273 -2.305  83.600  1.00 78.88  ? 38  PHE E O   1 
ATOM   5171 C CB  . PHE F 1 37  ? -18.105 -2.800  84.456  1.00 80.65  ? 38  PHE E CB  1 
ATOM   5172 C CG  . PHE F 1 37  ? -19.471 -2.440  84.954  1.00 75.64  ? 38  PHE E CG  1 
ATOM   5173 C CD1 . PHE F 1 37  ? -19.841 -2.721  86.266  1.00 71.99  ? 38  PHE E CD1 1 
ATOM   5174 C CD2 . PHE F 1 37  ? -20.384 -1.812  84.114  1.00 72.24  ? 38  PHE E CD2 1 
ATOM   5175 C CE1 . PHE F 1 37  ? -21.100 -2.379  86.738  1.00 70.98  ? 38  PHE E CE1 1 
ATOM   5176 C CE2 . PHE F 1 37  ? -21.646 -1.466  84.574  1.00 70.21  ? 38  PHE E CE2 1 
ATOM   5177 C CZ  . PHE F 1 37  ? -22.006 -1.750  85.889  1.00 72.35  ? 38  PHE E CZ  1 
ATOM   5178 N N   . PRO F 1 38  ? -14.901 -3.512  85.482  1.00 83.66  ? 39  PRO E N   1 
ATOM   5179 C CA  . PRO F 1 38  ? -13.602 -4.034  85.047  1.00 81.50  ? 39  PRO E CA  1 
ATOM   5180 C C   . PRO F 1 38  ? -13.513 -4.304  83.543  1.00 81.17  ? 39  PRO E C   1 
ATOM   5181 O O   . PRO F 1 38  ? -14.395 -4.935  82.958  1.00 81.40  ? 39  PRO E O   1 
ATOM   5182 C CB  . PRO F 1 38  ? -13.429 -5.298  85.902  1.00 78.62  ? 39  PRO E CB  1 
ATOM   5183 C CG  . PRO F 1 38  ? -14.819 -5.593  86.429  1.00 76.75  ? 39  PRO E CG  1 
ATOM   5184 C CD  . PRO F 1 38  ? -15.365 -4.229  86.681  1.00 78.74  ? 39  PRO E CD  1 
ATOM   5185 N N   . GLY F 1 39  ? -12.451 -3.800  82.921  1.00 79.68  ? 40  GLY E N   1 
ATOM   5186 C CA  . GLY F 1 39  ? -12.267 -3.993  81.495  1.00 83.99  ? 40  GLY E CA  1 
ATOM   5187 C C   . GLY F 1 39  ? -12.765 -2.834  80.652  1.00 86.87  ? 40  GLY E C   1 
ATOM   5188 O O   . GLY F 1 39  ? -12.243 -2.579  79.565  1.00 86.00  ? 40  GLY E O   1 
ATOM   5189 N N   . GLU F 1 40  ? -13.774 -2.125  81.146  1.00 89.22  ? 41  GLU E N   1 
ATOM   5190 C CA  . GLU F 1 40  ? -14.329 -0.994  80.410  1.00 93.42  ? 41  GLU E CA  1 
ATOM   5191 C C   . GLU F 1 40  ? -13.980 0.310   81.111  1.00 94.10  ? 41  GLU E C   1 
ATOM   5192 O O   . GLU F 1 40  ? -13.617 0.311   82.290  1.00 96.00  ? 41  GLU E O   1 
ATOM   5193 C CB  . GLU F 1 40  ? -15.847 -1.115  80.322  1.00 95.77  ? 41  GLU E CB  1 
ATOM   5194 C CG  . GLU F 1 40  ? -16.359 -2.535  80.351  1.00 102.76 ? 41  GLU E CG  1 
ATOM   5195 C CD  . GLU F 1 40  ? -17.869 -2.593  80.338  1.00 108.86 ? 41  GLU E CD  1 
ATOM   5196 O OE1 . GLU F 1 40  ? -18.463 -2.287  79.281  1.00 109.93 ? 41  GLU E OE1 1 
ATOM   5197 O OE2 . GLU F 1 40  ? -18.461 -2.934  81.387  1.00 110.74 ? 41  GLU E OE2 1 
ATOM   5198 N N   . GLY F 1 41  ? -14.099 1.418   80.385  1.00 90.48  ? 42  GLY E N   1 
ATOM   5199 C CA  . GLY F 1 41  ? -13.805 2.714   80.971  1.00 87.53  ? 42  GLY E CA  1 
ATOM   5200 C C   . GLY F 1 41  ? -14.939 3.156   81.880  1.00 83.67  ? 42  GLY E C   1 
ATOM   5201 O O   . GLY F 1 41  ? -15.960 2.474   81.954  1.00 83.19  ? 42  GLY E O   1 
ATOM   5202 N N   . PRO F 1 42  ? -14.789 4.278   82.605  1.00 80.88  ? 43  PRO E N   1 
ATOM   5203 C CA  . PRO F 1 42  ? -15.861 4.745   83.491  1.00 74.29  ? 43  PRO E CA  1 
ATOM   5204 C C   . PRO F 1 42  ? -17.019 5.351   82.693  1.00 69.41  ? 43  PRO E C   1 
ATOM   5205 O O   . PRO F 1 42  ? -16.840 5.783   81.551  1.00 64.33  ? 43  PRO E O   1 
ATOM   5206 C CB  . PRO F 1 42  ? -15.162 5.788   84.365  1.00 77.26  ? 43  PRO E CB  1 
ATOM   5207 C CG  . PRO F 1 42  ? -13.732 5.345   84.358  1.00 80.80  ? 43  PRO E CG  1 
ATOM   5208 C CD  . PRO F 1 42  ? -13.526 4.968   82.913  1.00 80.89  ? 43  PRO E CD  1 
ATOM   5209 N N   . ALA F 1 43  ? -18.202 5.375   83.300  1.00 65.19  ? 44  ALA E N   1 
ATOM   5210 C CA  . ALA F 1 43  ? -19.392 5.924   82.658  1.00 64.78  ? 44  ALA E CA  1 
ATOM   5211 C C   . ALA F 1 43  ? -20.185 6.757   83.662  1.00 66.53  ? 44  ALA E C   1 
ATOM   5212 O O   . ALA F 1 43  ? -20.293 6.391   84.836  1.00 60.49  ? 44  ALA E O   1 
ATOM   5213 C CB  . ALA F 1 43  ? -20.261 4.794   82.106  1.00 61.17  ? 44  ALA E CB  1 
ATOM   5214 N N   . LEU F 1 44  ? -20.730 7.880   83.197  1.00 67.51  ? 45  LEU E N   1 
ATOM   5215 C CA  . LEU F 1 44  ? -21.506 8.758   84.063  1.00 63.78  ? 45  LEU E CA  1 
ATOM   5216 C C   . LEU F 1 44  ? -22.724 8.034   84.607  1.00 60.64  ? 45  LEU E C   1 
ATOM   5217 O O   . LEU F 1 44  ? -23.476 7.416   83.859  1.00 58.27  ? 45  LEU E O   1 
ATOM   5218 C CB  . LEU F 1 44  ? -21.959 10.012  83.306  1.00 66.20  ? 45  LEU E CB  1 
ATOM   5219 C CG  . LEU F 1 44  ? -22.878 10.957  84.099  1.00 62.53  ? 45  LEU E CG  1 
ATOM   5220 C CD1 . LEU F 1 44  ? -22.195 11.378  85.390  1.00 59.95  ? 45  LEU E CD1 1 
ATOM   5221 C CD2 . LEU F 1 44  ? -23.231 12.175  83.259  1.00 65.88  ? 45  LEU E CD2 1 
ATOM   5222 N N   . LEU F 1 45  ? -22.917 8.128   85.915  1.00 63.05  ? 46  LEU E N   1 
ATOM   5223 C CA  . LEU F 1 45  ? -24.039 7.485   86.570  1.00 67.15  ? 46  LEU E CA  1 
ATOM   5224 C C   . LEU F 1 45  ? -25.106 8.503   86.946  1.00 70.90  ? 46  LEU E C   1 
ATOM   5225 O O   . LEU F 1 45  ? -26.282 8.351   86.607  1.00 70.63  ? 46  LEU E O   1 
ATOM   5226 C CB  . LEU F 1 45  ? -23.562 6.773   87.833  1.00 71.14  ? 46  LEU E CB  1 
ATOM   5227 C CG  . LEU F 1 45  ? -24.658 6.090   88.650  1.00 74.53  ? 46  LEU E CG  1 
ATOM   5228 C CD1 . LEU F 1 45  ? -25.235 4.939   87.836  1.00 74.30  ? 46  LEU E CD1 1 
ATOM   5229 C CD2 . LEU F 1 45  ? -24.093 5.596   89.975  1.00 71.80  ? 46  LEU E CD2 1 
ATOM   5230 N N   . ILE F 1 46  ? -24.681 9.549   87.644  1.00 71.72  ? 47  ILE E N   1 
ATOM   5231 C CA  . ILE F 1 46  ? -25.592 10.588  88.097  1.00 70.97  ? 47  ILE E CA  1 
ATOM   5232 C C   . ILE F 1 46  ? -24.784 11.779  88.632  1.00 74.36  ? 47  ILE E C   1 
ATOM   5233 O O   . ILE F 1 46  ? -23.832 11.599  89.393  1.00 80.14  ? 47  ILE E O   1 
ATOM   5234 C CB  . ILE F 1 46  ? -26.505 10.016  89.201  1.00 63.77  ? 47  ILE E CB  1 
ATOM   5235 C CG1 . ILE F 1 46  ? -27.312 11.131  89.863  1.00 69.09  ? 47  ILE E CG1 1 
ATOM   5236 C CG2 . ILE F 1 46  ? -25.663 9.253   90.207  1.00 57.21  ? 47  ILE E CG2 1 
ATOM   5237 C CD1 . ILE F 1 46  ? -28.197 10.652  91.008  1.00 72.95  ? 47  ILE E CD1 1 
ATOM   5238 N N   . SER F 1 47  ? -25.155 12.992  88.229  1.00 74.34  ? 48  SER E N   1 
ATOM   5239 C CA  . SER F 1 47  ? -24.444 14.187  88.677  1.00 69.71  ? 48  SER E CA  1 
ATOM   5240 C C   . SER F 1 47  ? -25.362 15.165  89.388  1.00 68.44  ? 48  SER E C   1 
ATOM   5241 O O   . SER F 1 47  ? -26.585 15.098  89.258  1.00 70.91  ? 48  SER E O   1 
ATOM   5242 C CB  . SER F 1 47  ? -23.774 14.890  87.491  1.00 74.34  ? 48  SER E CB  1 
ATOM   5243 O OG  . SER F 1 47  ? -24.725 15.324  86.533  1.00 75.32  ? 48  SER E OG  1 
ATOM   5244 N N   . ILE F 1 48  ? -24.760 16.084  90.132  1.00 64.99  ? 49  ILE E N   1 
ATOM   5245 C CA  . ILE F 1 48  ? -25.513 17.080  90.879  1.00 58.15  ? 49  ILE E CA  1 
ATOM   5246 C C   . ILE F 1 48  ? -24.771 18.418  90.908  1.00 59.79  ? 49  ILE E C   1 
ATOM   5247 O O   . ILE F 1 48  ? -23.548 18.462  90.780  1.00 58.64  ? 49  ILE E O   1 
ATOM   5248 C CB  . ILE F 1 48  ? -25.741 16.599  92.329  1.00 51.66  ? 49  ILE E CB  1 
ATOM   5249 C CG1 . ILE F 1 48  ? -26.646 17.577  93.071  1.00 53.64  ? 49  ILE E CG1 1 
ATOM   5250 C CG2 . ILE F 1 48  ? -24.412 16.487  93.057  1.00 49.12  ? 49  ILE E CG2 1 
ATOM   5251 C CD1 . ILE F 1 48  ? -26.958 17.153  94.491  1.00 57.03  ? 49  ILE E CD1 1 
ATOM   5252 N N   . LEU F 1 49  ? -25.515 19.509  91.060  1.00 58.06  ? 50  LEU E N   1 
ATOM   5253 C CA  . LEU F 1 49  ? -24.914 20.833  91.135  1.00 60.14  ? 50  LEU E CA  1 
ATOM   5254 C C   . LEU F 1 49  ? -25.039 21.311  92.579  1.00 64.31  ? 50  LEU E C   1 
ATOM   5255 O O   . LEU F 1 49  ? -26.040 21.044  93.241  1.00 66.21  ? 50  LEU E O   1 
ATOM   5256 C CB  . LEU F 1 49  ? -25.623 21.800  90.185  1.00 62.18  ? 50  LEU E CB  1 
ATOM   5257 C CG  . LEU F 1 49  ? -25.356 21.600  88.689  1.00 64.77  ? 50  LEU E CG  1 
ATOM   5258 C CD1 . LEU F 1 49  ? -26.394 22.357  87.878  1.00 66.25  ? 50  LEU E CD1 1 
ATOM   5259 C CD2 . LEU F 1 49  ? -23.950 22.075  88.336  1.00 60.35  ? 50  LEU E CD2 1 
ATOM   5260 N N   . SER F 1 50  ? -24.016 22.009  93.064  1.00 67.06  ? 51  SER E N   1 
ATOM   5261 C CA  . SER F 1 50  ? -23.994 22.503  94.437  1.00 67.73  ? 51  SER E CA  1 
ATOM   5262 C C   . SER F 1 50  ? -25.228 23.313  94.811  1.00 70.05  ? 51  SER E C   1 
ATOM   5263 O O   . SER F 1 50  ? -25.370 23.743  95.954  1.00 69.44  ? 51  SER E O   1 
ATOM   5264 C CB  . SER F 1 50  ? -22.734 23.341  94.670  1.00 69.45  ? 51  SER E CB  1 
ATOM   5265 O OG  . SER F 1 50  ? -22.611 24.368  93.697  1.00 74.08  ? 51  SER E OG  1 
ATOM   5266 N N   . VAL F 1 51  ? -26.118 23.517  93.846  1.00 74.15  ? 52  VAL E N   1 
ATOM   5267 C CA  . VAL F 1 51  ? -27.343 24.273  94.080  1.00 77.74  ? 52  VAL E CA  1 
ATOM   5268 C C   . VAL F 1 51  ? -28.384 23.432  94.818  1.00 75.06  ? 52  VAL E C   1 
ATOM   5269 O O   . VAL F 1 51  ? -29.016 23.905  95.761  1.00 75.95  ? 52  VAL E O   1 
ATOM   5270 C CB  . VAL F 1 51  ? -27.947 24.774  92.750  1.00 78.11  ? 52  VAL E CB  1 
ATOM   5271 C CG1 . VAL F 1 51  ? -29.289 25.434  93.008  1.00 86.26  ? 52  VAL E CG1 1 
ATOM   5272 C CG2 . VAL F 1 51  ? -26.992 25.758  92.085  1.00 77.50  ? 52  VAL E CG2 1 
ATOM   5273 N N   . SER F 1 52  ? -28.568 22.190  94.382  1.00 75.14  ? 53  SER E N   1 
ATOM   5274 C CA  . SER F 1 52  ? -29.525 21.290  95.023  1.00 78.78  ? 53  SER E CA  1 
ATOM   5275 C C   . SER F 1 52  ? -28.777 20.356  95.970  1.00 78.58  ? 53  SER E C   1 
ATOM   5276 O O   . SER F 1 52  ? -27.644 19.960  95.694  1.00 75.59  ? 53  SER E O   1 
ATOM   5277 C CB  . SER F 1 52  ? -30.291 20.476  93.972  1.00 79.02  ? 53  SER E CB  1 
ATOM   5278 O OG  . SER F 1 52  ? -29.408 19.773  93.114  1.00 76.00  ? 53  SER E OG  1 
ATOM   5279 N N   . ASP F 1 53  ? -29.410 20.007  97.086  1.00 78.37  ? 54  ASP E N   1 
ATOM   5280 C CA  . ASP F 1 53  ? -28.776 19.135  98.069  1.00 79.31  ? 54  ASP E CA  1 
ATOM   5281 C C   . ASP F 1 53  ? -29.265 17.693  97.962  1.00 76.82  ? 54  ASP E C   1 
ATOM   5282 O O   . ASP F 1 53  ? -28.914 16.837  98.778  1.00 75.35  ? 54  ASP E O   1 
ATOM   5283 C CB  . ASP F 1 53  ? -29.027 19.680  99.479  1.00 82.13  ? 54  ASP E CB  1 
ATOM   5284 C CG  . ASP F 1 53  ? -30.486 19.610  99.880  1.00 89.92  ? 54  ASP E CG  1 
ATOM   5285 O OD1 . ASP F 1 53  ? -31.355 19.739  98.988  1.00 91.63  ? 54  ASP E OD1 1 
ATOM   5286 O OD2 . ASP F 1 53  ? -30.764 19.439  101.088 1.00 89.90  ? 54  ASP E OD2 1 
ATOM   5287 N N   . LYS F 1 54  ? -30.063 17.423  96.938  1.00 75.64  ? 55  LYS E N   1 
ATOM   5288 C CA  . LYS F 1 54  ? -30.600 16.092  96.733  1.00 71.86  ? 55  LYS E CA  1 
ATOM   5289 C C   . LYS F 1 54  ? -30.867 15.882  95.254  1.00 69.99  ? 55  LYS E C   1 
ATOM   5290 O O   . LYS F 1 54  ? -31.427 16.752  94.592  1.00 71.46  ? 55  LYS E O   1 
ATOM   5291 C CB  . LYS F 1 54  ? -31.897 15.933  97.530  1.00 78.51  ? 55  LYS E CB  1 
ATOM   5292 C CG  . LYS F 1 54  ? -32.503 14.540  97.495  1.00 84.17  ? 55  LYS E CG  1 
ATOM   5293 C CD  . LYS F 1 54  ? -33.827 14.502  98.244  1.00 89.97  ? 55  LYS E CD  1 
ATOM   5294 C CE  . LYS F 1 54  ? -34.478 13.129  98.158  1.00 93.80  ? 55  LYS E CE  1 
ATOM   5295 N NZ  . LYS F 1 54  ? -35.819 13.106  98.808  1.00 96.39  ? 55  LYS E NZ  1 
ATOM   5296 N N   . LYS F 1 55  ? -30.457 14.727  94.741  1.00 70.51  ? 56  LYS E N   1 
ATOM   5297 C CA  . LYS F 1 55  ? -30.654 14.384  93.338  1.00 68.26  ? 56  LYS E CA  1 
ATOM   5298 C C   . LYS F 1 55  ? -30.825 12.880  93.220  1.00 72.78  ? 56  LYS E C   1 
ATOM   5299 O O   . LYS F 1 55  ? -29.875 12.121  93.426  1.00 73.60  ? 56  LYS E O   1 
ATOM   5300 C CB  . LYS F 1 55  ? -29.453 14.824  92.510  1.00 68.06  ? 56  LYS E CB  1 
ATOM   5301 C CG  . LYS F 1 55  ? -29.498 14.404  91.044  1.00 70.97  ? 56  LYS E CG  1 
ATOM   5302 C CD  . LYS F 1 55  ? -30.623 15.084  90.283  1.00 70.06  ? 56  LYS E CD  1 
ATOM   5303 C CE  . LYS F 1 55  ? -30.500 14.832  88.788  1.00 66.05  ? 56  LYS E CE  1 
ATOM   5304 N NZ  . LYS F 1 55  ? -29.236 15.401  88.235  1.00 62.67  ? 56  LYS E NZ  1 
ATOM   5305 N N   . GLU F 1 56  ? -32.036 12.447  92.892  1.00 75.71  ? 57  GLU E N   1 
ATOM   5306 C CA  . GLU F 1 56  ? -32.309 11.026  92.759  1.00 79.65  ? 57  GLU E CA  1 
ATOM   5307 C C   . GLU F 1 56  ? -32.793 10.637  91.375  1.00 79.78  ? 57  GLU E C   1 
ATOM   5308 O O   . GLU F 1 56  ? -33.506 11.390  90.714  1.00 77.06  ? 57  GLU E O   1 
ATOM   5309 C CB  . GLU F 1 56  ? -33.323 10.578  93.811  1.00 82.65  ? 57  GLU E CB  1 
ATOM   5310 C CG  . GLU F 1 56  ? -34.588 11.403  93.867  1.00 88.40  ? 57  GLU E CG  1 
ATOM   5311 C CD  . GLU F 1 56  ? -35.512 10.939  94.971  1.00 93.96  ? 57  GLU E CD  1 
ATOM   5312 O OE1 . GLU F 1 56  ? -36.021 9.800   94.877  1.00 93.30  ? 57  GLU E OE1 1 
ATOM   5313 O OE2 . GLU F 1 56  ? -35.721 11.709  95.935  1.00 93.09  ? 57  GLU E OE2 1 
ATOM   5314 N N   . ASP F 1 57  ? -32.384 9.446   90.952  1.00 82.56  ? 58  ASP E N   1 
ATOM   5315 C CA  . ASP F 1 57  ? -32.737 8.899   89.652  1.00 84.68  ? 58  ASP E CA  1 
ATOM   5316 C C   . ASP F 1 57  ? -32.663 7.382   89.789  1.00 87.36  ? 58  ASP E C   1 
ATOM   5317 O O   . ASP F 1 57  ? -31.607 6.780   89.584  1.00 87.95  ? 58  ASP E O   1 
ATOM   5318 C CB  . ASP F 1 57  ? -31.743 9.393   88.597  1.00 90.08  ? 58  ASP E CB  1 
ATOM   5319 C CG  . ASP F 1 57  ? -32.130 8.983   87.187  1.00 99.21  ? 58  ASP E CG  1 
ATOM   5320 O OD1 . ASP F 1 57  ? -33.254 9.318   86.756  1.00 105.49 ? 58  ASP E OD1 1 
ATOM   5321 O OD2 . ASP F 1 57  ? -31.307 8.334   86.504  1.00 102.71 ? 58  ASP E OD2 1 
ATOM   5322 N N   . GLY F 1 58  ? -33.785 6.770   90.155  1.00 86.22  ? 59  GLY E N   1 
ATOM   5323 C CA  . GLY F 1 58  ? -33.814 5.330   90.331  1.00 84.54  ? 59  GLY E CA  1 
ATOM   5324 C C   . GLY F 1 58  ? -33.387 4.967   91.741  1.00 86.58  ? 59  GLY E C   1 
ATOM   5325 O O   . GLY F 1 58  ? -33.789 5.629   92.706  1.00 85.23  ? 59  GLY E O   1 
ATOM   5326 N N   . ARG F 1 59  ? -32.573 3.922   91.867  1.00 83.40  ? 61  ARG E N   1 
ATOM   5327 C CA  . ARG F 1 59  ? -32.094 3.488   93.178  1.00 82.93  ? 61  ARG E CA  1 
ATOM   5328 C C   . ARG F 1 59  ? -30.997 4.431   93.672  1.00 81.01  ? 61  ARG E C   1 
ATOM   5329 O O   . ARG F 1 59  ? -30.798 4.599   94.878  1.00 79.83  ? 61  ARG E O   1 
ATOM   5330 C CB  . ARG F 1 59  ? -31.526 2.066   93.103  1.00 84.89  ? 61  ARG E CB  1 
ATOM   5331 C CG  . ARG F 1 59  ? -32.462 1.019   92.531  1.00 76.67  ? 61  ARG E CG  1 
ATOM   5332 C CD  . ARG F 1 59  ? -31.934 -0.385  92.808  1.00 67.64  ? 61  ARG E CD  1 
ATOM   5333 N NE  . ARG F 1 59  ? -30.666 -0.686  92.140  1.00 66.42  ? 61  ARG E NE  1 
ATOM   5334 C CZ  . ARG F 1 59  ? -30.537 -0.887  90.830  1.00 65.27  ? 61  ARG E CZ  1 
ATOM   5335 N NH1 . ARG F 1 59  ? -31.599 -0.816  90.033  1.00 62.87  ? 61  ARG E NH1 1 
ATOM   5336 N NH2 . ARG F 1 59  ? -29.351 -1.176  90.318  1.00 50.58  ? 61  ARG E NH2 1 
ATOM   5337 N N   . PHE F 1 60  ? -30.296 5.035   92.717  1.00 77.04  ? 62  PHE E N   1 
ATOM   5338 C CA  . PHE F 1 60  ? -29.199 5.964   92.987  1.00 74.47  ? 62  PHE E CA  1 
ATOM   5339 C C   . PHE F 1 60  ? -29.686 7.352   93.417  1.00 73.51  ? 62  PHE E C   1 
ATOM   5340 O O   . PHE F 1 60  ? -30.539 7.955   92.760  1.00 71.69  ? 62  PHE E O   1 
ATOM   5341 C CB  . PHE F 1 60  ? -28.352 6.112   91.731  1.00 73.72  ? 62  PHE E CB  1 
ATOM   5342 C CG  . PHE F 1 60  ? -28.063 4.815   91.036  1.00 73.29  ? 62  PHE E CG  1 
ATOM   5343 C CD1 . PHE F 1 60  ? -27.102 3.940   91.533  1.00 76.11  ? 62  PHE E CD1 1 
ATOM   5344 C CD2 . PHE F 1 60  ? -28.740 4.479   89.869  1.00 70.26  ? 62  PHE E CD2 1 
ATOM   5345 C CE1 . PHE F 1 60  ? -26.816 2.749   90.876  1.00 77.93  ? 62  PHE E CE1 1 
ATOM   5346 C CE2 . PHE F 1 60  ? -28.464 3.295   89.203  1.00 76.26  ? 62  PHE E CE2 1 
ATOM   5347 C CZ  . PHE F 1 60  ? -27.497 2.425   89.706  1.00 79.23  ? 62  PHE E CZ  1 
ATOM   5348 N N   . THR F 1 61  ? -29.123 7.866   94.507  1.00 73.96  ? 63  THR E N   1 
ATOM   5349 C CA  . THR F 1 61  ? -29.513 9.176   95.019  1.00 75.72  ? 63  THR E CA  1 
ATOM   5350 C C   . THR F 1 61  ? -28.352 9.941   95.647  1.00 76.88  ? 63  THR E C   1 
ATOM   5351 O O   . THR F 1 61  ? -27.872 9.581   96.724  1.00 81.07  ? 63  THR E O   1 
ATOM   5352 C CB  . THR F 1 61  ? -30.615 9.037   96.076  1.00 74.77  ? 63  THR E CB  1 
ATOM   5353 O OG1 . THR F 1 61  ? -31.732 8.353   95.502  1.00 82.83  ? 63  THR E OG1 1 
ATOM   5354 C CG2 . THR F 1 61  ? -31.063 10.406  96.569  1.00 77.26  ? 63  THR E CG2 1 
ATOM   5355 N N   . ILE F 1 62  ? -27.908 11.003  94.982  1.00 72.37  ? 64  ILE E N   1 
ATOM   5356 C CA  . ILE F 1 62  ? -26.811 11.804  95.509  1.00 68.19  ? 64  ILE E CA  1 
ATOM   5357 C C   . ILE F 1 62  ? -27.319 12.771  96.566  1.00 67.23  ? 64  ILE E C   1 
ATOM   5358 O O   . ILE F 1 62  ? -28.341 13.424  96.375  1.00 68.09  ? 64  ILE E O   1 
ATOM   5359 C CB  . ILE F 1 62  ? -26.125 12.647  94.411  1.00 67.63  ? 64  ILE E CB  1 
ATOM   5360 C CG1 . ILE F 1 62  ? -25.636 11.750  93.275  1.00 69.36  ? 64  ILE E CG1 1 
ATOM   5361 C CG2 . ILE F 1 62  ? -24.944 13.409  95.004  1.00 62.97  ? 64  ILE E CG2 1 
ATOM   5362 C CD1 . ILE F 1 62  ? -25.009 12.524  92.126  1.00 66.55  ? 64  ILE E CD1 1 
ATOM   5363 N N   . PHE F 1 63  ? -26.610 12.843  97.687  1.00 70.00  ? 65  PHE E N   1 
ATOM   5364 C CA  . PHE F 1 63  ? -26.949 13.766  98.765  1.00 71.34  ? 65  PHE E CA  1 
ATOM   5365 C C   . PHE F 1 63  ? -25.740 14.672  98.889  1.00 73.49  ? 65  PHE E C   1 
ATOM   5366 O O   . PHE F 1 63  ? -24.637 14.207  99.188  1.00 70.56  ? 65  PHE E O   1 
ATOM   5367 C CB  . PHE F 1 63  ? -27.164 13.039  100.090 1.00 74.14  ? 65  PHE E CB  1 
ATOM   5368 C CG  . PHE F 1 63  ? -28.400 12.200  100.130 1.00 80.25  ? 65  PHE E CG  1 
ATOM   5369 C CD1 . PHE F 1 63  ? -28.504 11.051  99.352  1.00 78.49  ? 65  PHE E CD1 1 
ATOM   5370 C CD2 . PHE F 1 63  ? -29.469 12.560  100.945 1.00 83.48  ? 65  PHE E CD2 1 
ATOM   5371 C CE1 . PHE F 1 63  ? -29.656 10.274  99.383  1.00 81.63  ? 65  PHE E CE1 1 
ATOM   5372 C CE2 . PHE F 1 63  ? -30.627 11.789  100.984 1.00 86.32  ? 65  PHE E CE2 1 
ATOM   5373 C CZ  . PHE F 1 63  ? -30.721 10.642  100.200 1.00 84.21  ? 65  PHE E CZ  1 
ATOM   5374 N N   . PHE F 1 64  ? -25.948 15.961  98.653  1.00 73.69  ? 66  PHE E N   1 
ATOM   5375 C CA  . PHE F 1 64  ? -24.870 16.935  98.714  1.00 73.65  ? 66  PHE E CA  1 
ATOM   5376 C C   . PHE F 1 64  ? -24.993 17.843  99.928  1.00 69.10  ? 66  PHE E C   1 
ATOM   5377 O O   . PHE F 1 64  ? -26.034 18.444  100.149 1.00 66.85  ? 66  PHE E O   1 
ATOM   5378 C CB  . PHE F 1 64  ? -24.880 17.788  97.442  1.00 78.37  ? 66  PHE E CB  1 
ATOM   5379 C CG  . PHE F 1 64  ? -23.781 18.806  97.386  1.00 84.94  ? 66  PHE E CG  1 
ATOM   5380 C CD1 . PHE F 1 64  ? -22.521 18.460  96.915  1.00 90.03  ? 66  PHE E CD1 1 
ATOM   5381 C CD2 . PHE F 1 64  ? -23.995 20.104  97.835  1.00 87.80  ? 66  PHE E CD2 1 
ATOM   5382 C CE1 . PHE F 1 64  ? -21.486 19.395  96.893  1.00 93.22  ? 66  PHE E CE1 1 
ATOM   5383 C CE2 . PHE F 1 64  ? -22.967 21.046  97.817  1.00 92.44  ? 66  PHE E CE2 1 
ATOM   5384 C CZ  . PHE F 1 64  ? -21.711 20.691  97.346  1.00 92.38  ? 66  PHE E CZ  1 
ATOM   5385 N N   . ASN F 1 65  ? -23.933 17.939  100.719 1.00 70.67  ? 67  ASN E N   1 
ATOM   5386 C CA  . ASN F 1 65  ? -23.959 18.818  101.879 1.00 78.61  ? 67  ASN E CA  1 
ATOM   5387 C C   . ASN F 1 65  ? -23.038 20.002  101.602 1.00 85.04  ? 67  ASN E C   1 
ATOM   5388 O O   . ASN F 1 65  ? -21.826 19.922  101.809 1.00 81.08  ? 67  ASN E O   1 
ATOM   5389 C CB  . ASN F 1 65  ? -23.495 18.092  103.140 1.00 79.45  ? 67  ASN E CB  1 
ATOM   5390 C CG  . ASN F 1 65  ? -23.581 18.968  104.381 1.00 82.37  ? 67  ASN E CG  1 
ATOM   5391 O OD1 . ASN F 1 65  ? -23.101 18.594  105.449 1.00 88.32  ? 67  ASN E OD1 1 
ATOM   5392 N ND2 . ASN F 1 65  ? -24.199 20.138  104.245 1.00 79.65  ? 67  ASN E ND2 1 
ATOM   5393 N N   . LYS F 1 66  ? -23.632 21.094  101.124 1.00 91.66  ? 68  LYS E N   1 
ATOM   5394 C CA  . LYS F 1 66  ? -22.911 22.320  100.797 1.00 93.02  ? 68  LYS E CA  1 
ATOM   5395 C C   . LYS F 1 66  ? -21.824 22.614  101.820 1.00 92.35  ? 68  LYS E C   1 
ATOM   5396 O O   . LYS F 1 66  ? -20.642 22.388  101.563 1.00 93.91  ? 68  LYS E O   1 
ATOM   5397 C CB  . LYS F 1 66  ? -23.893 23.493  100.728 1.00 96.82  ? 68  LYS E CB  1 
ATOM   5398 C CG  . LYS F 1 66  ? -23.289 24.795  100.227 1.00 100.95 ? 68  LYS E CG  1 
ATOM   5399 C CD  . LYS F 1 66  ? -22.812 24.676  98.787  1.00 101.71 ? 68  LYS E CD  1 
ATOM   5400 C CE  . LYS F 1 66  ? -22.273 26.003  98.288  1.00 102.70 ? 68  LYS E CE  1 
ATOM   5401 N NZ  . LYS F 1 66  ? -23.312 27.066  98.367  1.00 102.69 ? 68  LYS E NZ  1 
ATOM   5402 N N   . ARG F 1 67  ? -22.222 23.125  102.979 1.00 91.76  ? 69  ARG E N   1 
ATOM   5403 C CA  . ARG F 1 67  ? -21.255 23.420  104.022 1.00 95.10  ? 69  ARG E CA  1 
ATOM   5404 C C   . ARG F 1 67  ? -20.683 22.080  104.460 1.00 98.47  ? 69  ARG E C   1 
ATOM   5405 O O   . ARG F 1 67  ? -21.254 21.034  104.160 1.00 100.23 ? 69  ARG E O   1 
ATOM   5406 C CB  . ARG F 1 67  ? -21.933 24.125  105.193 1.00 96.29  ? 69  ARG E CB  1 
ATOM   5407 C CG  . ARG F 1 67  ? -23.090 23.355  105.789 1.00 103.52 ? 69  ARG E CG  1 
ATOM   5408 C CD  . ARG F 1 67  ? -23.804 24.193  106.829 1.00 106.64 ? 69  ARG E CD  1 
ATOM   5409 N NE  . ARG F 1 67  ? -22.907 24.600  107.905 1.00 110.00 ? 69  ARG E NE  1 
ATOM   5410 C CZ  . ARG F 1 67  ? -23.246 25.429  108.887 1.00 113.51 ? 69  ARG E CZ  1 
ATOM   5411 N NH1 . ARG F 1 67  ? -24.469 25.948  108.930 1.00 114.52 ? 69  ARG E NH1 1 
ATOM   5412 N NH2 . ARG F 1 67  ? -22.365 25.739  109.829 1.00 115.09 ? 69  ARG E NH2 1 
ATOM   5413 N N   . GLU F 1 68  ? -19.560 22.105  105.164 1.00 99.95  ? 70  GLU E N   1 
ATOM   5414 C CA  . GLU F 1 68  ? -18.911 20.875  105.608 1.00 102.61 ? 70  GLU E CA  1 
ATOM   5415 C C   . GLU F 1 68  ? -18.348 20.145  104.382 1.00 97.98  ? 70  GLU E C   1 
ATOM   5416 O O   . GLU F 1 68  ? -17.559 19.208  104.514 1.00 95.83  ? 70  GLU E O   1 
ATOM   5417 C CB  . GLU F 1 68  ? -19.900 19.983  106.379 1.00 106.19 ? 70  GLU E CB  1 
ATOM   5418 C CG  . GLU F 1 68  ? -19.206 18.967  107.270 1.00 114.67 ? 70  GLU E CG  1 
ATOM   5419 C CD  . GLU F 1 68  ? -20.120 18.379  108.325 1.00 121.82 ? 70  GLU E CD  1 
ATOM   5420 O OE1 . GLU F 1 68  ? -21.261 18.003  107.978 1.00 124.53 ? 70  GLU E OE1 1 
ATOM   5421 O OE2 . GLU F 1 68  ? -19.691 18.281  109.499 1.00 122.33 ? 70  GLU E OE2 1 
ATOM   5422 N N   . LYS F 1 69  ? -18.739 20.622  103.198 1.00 96.77  ? 71  LYS E N   1 
ATOM   5423 C CA  . LYS F 1 69  ? -18.310 20.076  101.910 1.00 95.59  ? 71  LYS E CA  1 
ATOM   5424 C C   . LYS F 1 69  ? -18.244 18.554  101.863 1.00 93.34  ? 71  LYS E C   1 
ATOM   5425 O O   . LYS F 1 69  ? -17.266 17.976  101.378 1.00 89.88  ? 71  LYS E O   1 
ATOM   5426 C CB  . LYS F 1 69  ? -16.959 20.666  101.506 1.00 94.04  ? 71  LYS E CB  1 
ATOM   5427 C CG  . LYS F 1 69  ? -17.003 22.159  101.242 1.00 97.58  ? 71  LYS E CG  1 
ATOM   5428 C CD  . LYS F 1 69  ? -15.602 22.737  101.104 1.00 99.49  ? 71  LYS E CD  1 
ATOM   5429 C CE  . LYS F 1 69  ? -14.901 22.838  102.447 1.00 97.28  ? 71  LYS E CE  1 
ATOM   5430 N NZ  . LYS F 1 69  ? -13.586 23.518  102.315 1.00 97.85  ? 71  LYS E NZ  1 
ATOM   5431 N N   . LYS F 1 70  ? -19.286 17.916  102.392 1.00 91.87  ? 72  LYS E N   1 
ATOM   5432 C CA  . LYS F 1 70  ? -19.401 16.462  102.372 1.00 87.16  ? 72  LYS E CA  1 
ATOM   5433 C C   . LYS F 1 70  ? -20.307 16.098  101.198 1.00 80.83  ? 72  LYS E C   1 
ATOM   5434 O O   . LYS F 1 70  ? -21.014 16.942  100.658 1.00 81.91  ? 72  LYS E O   1 
ATOM   5435 C CB  . LYS F 1 70  ? -20.006 15.929  103.675 1.00 89.75  ? 72  LYS E CB  1 
ATOM   5436 C CG  . LYS F 1 70  ? -19.106 16.072  104.890 1.00 89.55  ? 72  LYS E CG  1 
ATOM   5437 C CD  . LYS F 1 70  ? -19.707 15.383  106.108 1.00 91.75  ? 72  LYS E CD  1 
ATOM   5438 C CE  . LYS F 1 70  ? -18.806 15.535  107.326 1.00 95.28  ? 72  LYS E CE  1 
ATOM   5439 N NZ  . LYS F 1 70  ? -17.426 15.039  107.064 1.00 93.29  ? 72  LYS E NZ  1 
ATOM   5440 N N   . LEU F 1 71  ? -20.300 14.833  100.820 1.00 77.99  ? 73  LEU E N   1 
ATOM   5441 C CA  . LEU F 1 71  ? -21.091 14.382  99.691  1.00 76.09  ? 73  LEU E CA  1 
ATOM   5442 C C   . LEU F 1 71  ? -21.135 12.856  99.707  1.00 77.29  ? 73  LEU E C   1 
ATOM   5443 O O   . LEU F 1 71  ? -20.099 12.209  99.831  1.00 76.50  ? 73  LEU E O   1 
ATOM   5444 C CB  . LEU F 1 71  ? -20.424 14.880  98.409  1.00 73.79  ? 73  LEU E CB  1 
ATOM   5445 C CG  . LEU F 1 71  ? -20.965 14.434  97.055  1.00 80.93  ? 73  LEU E CG  1 
ATOM   5446 C CD1 . LEU F 1 71  ? -22.359 15.000  96.847  1.00 86.57  ? 73  LEU E CD1 1 
ATOM   5447 C CD2 . LEU F 1 71  ? -20.030 14.908  95.955  1.00 80.80  ? 73  LEU E CD2 1 
ATOM   5448 N N   . SER F 1 72  ? -22.322 12.274  99.590  1.00 79.36  ? 74  SER E N   1 
ATOM   5449 C CA  . SER F 1 72  ? -22.426 10.816  99.591  1.00 83.11  ? 74  SER E CA  1 
ATOM   5450 C C   . SER F 1 72  ? -23.436 10.278  98.578  1.00 81.04  ? 74  SER E C   1 
ATOM   5451 O O   . SER F 1 72  ? -24.465 10.905  98.322  1.00 84.59  ? 74  SER E O   1 
ATOM   5452 C CB  . SER F 1 72  ? -22.785 10.311  100.992 1.00 81.04  ? 74  SER E CB  1 
ATOM   5453 O OG  . SER F 1 72  ? -24.027 10.834  101.420 1.00 85.03  ? 74  SER E OG  1 
ATOM   5454 N N   . LEU F 1 73  ? -23.125 9.121   97.998  1.00 76.78  ? 75  LEU E N   1 
ATOM   5455 C CA  . LEU F 1 73  ? -24.006 8.477   97.023  1.00 74.92  ? 75  LEU E CA  1 
ATOM   5456 C C   . LEU F 1 73  ? -24.663 7.231   97.614  1.00 77.28  ? 75  LEU E C   1 
ATOM   5457 O O   . LEU F 1 73  ? -23.972 6.327   98.086  1.00 77.80  ? 75  LEU E O   1 
ATOM   5458 C CB  . LEU F 1 73  ? -23.227 8.065   95.777  1.00 65.20  ? 75  LEU E CB  1 
ATOM   5459 C CG  . LEU F 1 73  ? -24.034 7.166   94.838  1.00 66.76  ? 75  LEU E CG  1 
ATOM   5460 C CD1 . LEU F 1 73  ? -25.214 7.952   94.271  1.00 65.53  ? 75  LEU E CD1 1 
ATOM   5461 C CD2 . LEU F 1 73  ? -23.146 6.648   93.719  1.00 64.47  ? 75  LEU E CD2 1 
ATOM   5462 N N   . HIS F 1 74  ? -25.992 7.181   97.584  1.00 74.70  ? 76  HIS E N   1 
ATOM   5463 C CA  . HIS F 1 74  ? -26.705 6.027   98.113  1.00 72.50  ? 76  HIS E CA  1 
ATOM   5464 C C   . HIS F 1 74  ? -27.313 5.181   97.009  1.00 75.18  ? 76  HIS E C   1 
ATOM   5465 O O   . HIS F 1 74  ? -28.094 5.672   96.197  1.00 74.32  ? 76  HIS E O   1 
ATOM   5466 C CB  . HIS F 1 74  ? -27.824 6.450   99.065  1.00 63.92  ? 76  HIS E CB  1 
ATOM   5467 C CG  . HIS F 1 74  ? -27.347 7.194   100.271 1.00 65.11  ? 76  HIS E CG  1 
ATOM   5468 N ND1 . HIS F 1 74  ? -28.154 7.429   101.363 1.00 60.98  ? 76  HIS E ND1 1 
ATOM   5469 C CD2 . HIS F 1 74  ? -26.162 7.788   100.545 1.00 67.89  ? 76  HIS E CD2 1 
ATOM   5470 C CE1 . HIS F 1 74  ? -27.488 8.137   102.258 1.00 61.23  ? 76  HIS E CE1 1 
ATOM   5471 N NE2 . HIS F 1 74  ? -26.277 8.369   101.786 1.00 66.90  ? 76  HIS E NE2 1 
ATOM   5472 N N   . ILE F 1 75  ? -26.932 3.908   96.974  1.00 80.59  ? 77  ILE E N   1 
ATOM   5473 C CA  . ILE F 1 75  ? -27.485 2.976   96.003  1.00 82.47  ? 77  ILE E CA  1 
ATOM   5474 C C   . ILE F 1 75  ? -28.433 2.110   96.823  1.00 85.26  ? 77  ILE E C   1 
ATOM   5475 O O   . ILE F 1 75  ? -28.012 1.139   97.455  1.00 83.37  ? 77  ILE E O   1 
ATOM   5476 C CB  . ILE F 1 75  ? -26.409 2.068   95.365  1.00 79.77  ? 77  ILE E CB  1 
ATOM   5477 C CG1 . ILE F 1 75  ? -25.320 2.914   94.704  1.00 75.79  ? 77  ILE E CG1 1 
ATOM   5478 C CG2 . ILE F 1 75  ? -27.052 1.168   94.317  1.00 71.62  ? 77  ILE E CG2 1 
ATOM   5479 C CD1 . ILE F 1 75  ? -24.206 2.097   94.069  1.00 69.58  ? 77  ILE E CD1 1 
ATOM   5480 N N   . ALA F 1 76  ? -29.706 2.495   96.836  1.00 89.79  ? 78  ALA E N   1 
ATOM   5481 C CA  . ALA F 1 76  ? -30.733 1.771   97.577  1.00 91.85  ? 78  ALA E CA  1 
ATOM   5482 C C   . ALA F 1 76  ? -31.088 0.490   96.834  1.00 93.20  ? 78  ALA E C   1 
ATOM   5483 O O   . ALA F 1 76  ? -30.970 0.423   95.605  1.00 87.00  ? 78  ALA E O   1 
ATOM   5484 C CB  . ALA F 1 76  ? -31.973 2.646   97.737  1.00 93.53  ? 78  ALA E CB  1 
ATOM   5485 N N   . ASP F 1 77  ? -31.520 -0.524  97.578  1.00 94.23  ? 79  ASP E N   1 
ATOM   5486 C CA  . ASP F 1 77  ? -31.877 -1.794  96.963  1.00 97.34  ? 79  ASP E CA  1 
ATOM   5487 C C   . ASP F 1 77  ? -30.716 -2.196  96.050  1.00 98.61  ? 79  ASP E C   1 
ATOM   5488 O O   . ASP F 1 77  ? -30.804 -2.092  94.827  1.00 100.44 ? 79  ASP E O   1 
ATOM   5489 C CB  . ASP F 1 77  ? -33.166 -1.628  96.151  1.00 99.29  ? 79  ASP E CB  1 
ATOM   5490 C CG  . ASP F 1 77  ? -33.642 -2.927  95.525  1.00 103.01 ? 79  ASP E CG  1 
ATOM   5491 O OD1 . ASP F 1 77  ? -32.915 -3.493  94.679  1.00 105.10 ? 79  ASP E OD1 1 
ATOM   5492 O OD2 . ASP F 1 77  ? -34.750 -3.380  95.879  1.00 105.44 ? 79  ASP E OD2 1 
ATOM   5493 N N   . SER F 1 78  ? -29.620 -2.642  96.658  1.00 97.72  ? 80  SER E N   1 
ATOM   5494 C CA  . SER F 1 78  ? -28.436 -3.041  95.908  1.00 95.99  ? 80  SER E CA  1 
ATOM   5495 C C   . SER F 1 78  ? -28.739 -4.129  94.892  1.00 94.74  ? 80  SER E C   1 
ATOM   5496 O O   . SER F 1 78  ? -29.900 -4.399  94.589  1.00 96.42  ? 80  SER E O   1 
ATOM   5497 C CB  . SER F 1 78  ? -27.346 -3.516  96.867  1.00 97.79  ? 80  SER E CB  1 
ATOM   5498 O OG  . SER F 1 78  ? -27.015 -2.493  97.792  1.00 98.00  ? 80  SER E OG  1 
ATOM   5499 N N   . GLN F 1 79  ? -27.692 -4.757  94.369  1.00 91.90  ? 81  GLN E N   1 
ATOM   5500 C CA  . GLN F 1 79  ? -27.874 -5.800  93.374  1.00 93.28  ? 81  GLN E CA  1 
ATOM   5501 C C   . GLN F 1 79  ? -26.545 -6.299  92.815  1.00 93.11  ? 81  GLN E C   1 
ATOM   5502 O O   . GLN F 1 79  ? -25.662 -5.511  92.498  1.00 91.63  ? 81  GLN E O   1 
ATOM   5503 C CB  . GLN F 1 79  ? -28.743 -5.259  92.238  1.00 96.00  ? 81  GLN E CB  1 
ATOM   5504 C CG  . GLN F 1 79  ? -28.976 -6.215  91.087  1.00 104.52 ? 81  GLN E CG  1 
ATOM   5505 C CD  . GLN F 1 79  ? -29.918 -5.635  90.048  1.00 107.81 ? 81  GLN E CD  1 
ATOM   5506 O OE1 . GLN F 1 79  ? -30.121 -6.216  88.982  1.00 109.65 ? 81  GLN E OE1 1 
ATOM   5507 N NE2 . GLN F 1 79  ? -30.502 -4.482  90.358  1.00 108.39 ? 81  GLN E NE2 1 
ATOM   5508 N N   . PRO F 1 80  ? -26.383 -7.626  92.700  1.00 94.65  ? 82  PRO E N   1 
ATOM   5509 C CA  . PRO F 1 80  ? -25.138 -8.181  92.166  1.00 95.88  ? 82  PRO E CA  1 
ATOM   5510 C C   . PRO F 1 80  ? -24.998 -7.822  90.693  1.00 96.21  ? 82  PRO E C   1 
ATOM   5511 O O   . PRO F 1 80  ? -24.941 -8.691  89.826  1.00 100.86 ? 82  PRO E O   1 
ATOM   5512 C CB  . PRO F 1 80  ? -25.308 -9.681  92.388  1.00 93.89  ? 82  PRO E CB  1 
ATOM   5513 C CG  . PRO F 1 80  ? -26.781 -9.867  92.231  1.00 94.85  ? 82  PRO E CG  1 
ATOM   5514 C CD  . PRO F 1 80  ? -27.327 -8.705  93.037  1.00 96.11  ? 82  PRO E CD  1 
ATOM   5515 N N   . GLY F 1 81  ? -24.963 -6.525  90.428  1.00 94.26  ? 83  GLY E N   1 
ATOM   5516 C CA  . GLY F 1 81  ? -24.820 -6.018  89.078  1.00 93.29  ? 83  GLY E CA  1 
ATOM   5517 C C   . GLY F 1 81  ? -24.213 -4.647  89.255  1.00 91.71  ? 83  GLY E C   1 
ATOM   5518 O O   . GLY F 1 81  ? -23.519 -4.129  88.382  1.00 89.03  ? 83  GLY E O   1 
ATOM   5519 N N   . ASP F 1 82  ? -24.479 -4.077  90.429  1.00 93.65  ? 84  ASP E N   1 
ATOM   5520 C CA  . ASP F 1 82  ? -23.989 -2.757  90.816  1.00 96.31  ? 84  ASP E CA  1 
ATOM   5521 C C   . ASP F 1 82  ? -22.592 -2.911  91.369  1.00 97.91  ? 84  ASP E C   1 
ATOM   5522 O O   . ASP F 1 82  ? -22.076 -2.075  92.124  1.00 99.85  ? 84  ASP E O   1 
ATOM   5523 C CB  . ASP F 1 82  ? -24.895 -2.142  91.882  1.00 92.72  ? 84  ASP E CB  1 
ATOM   5524 C CG  . ASP F 1 82  ? -26.363 -2.173  91.488  1.00 95.36  ? 84  ASP E CG  1 
ATOM   5525 O OD1 . ASP F 1 82  ? -26.669 -1.967  90.292  1.00 95.43  ? 84  ASP E OD1 1 
ATOM   5526 O OD2 . ASP F 1 82  ? -27.214 -2.389  92.379  1.00 94.64  ? 84  ASP E OD2 1 
ATOM   5527 N N   . SER F 1 83  ? -21.969 -3.989  90.939  1.00 96.12  ? 85  SER E N   1 
ATOM   5528 C CA  . SER F 1 83  ? -20.648 -4.302  91.392  1.00 96.34  ? 85  SER E CA  1 
ATOM   5529 C C   . SER F 1 83  ? -19.490 -3.804  90.544  1.00 94.44  ? 85  SER E C   1 
ATOM   5530 O O   . SER F 1 83  ? -19.073 -4.476  89.611  1.00 95.96  ? 85  SER E O   1 
ATOM   5531 C CB  . SER F 1 83  ? -20.524 -5.813  91.552  1.00 99.24  ? 85  SER E CB  1 
ATOM   5532 O OG  . SER F 1 83  ? -20.742 -6.224  92.891  1.00 95.59  ? 85  SER E OG  1 
ATOM   5533 N N   . ALA F 1 84  ? -18.961 -2.634  90.861  1.00 94.09  ? 86  ALA E N   1 
ATOM   5534 C CA  . ALA F 1 84  ? -17.786 -2.136  90.153  1.00 91.45  ? 86  ALA E CA  1 
ATOM   5535 C C   . ALA F 1 84  ? -17.233 -1.001  90.988  1.00 88.66  ? 86  ALA E C   1 
ATOM   5536 O O   . ALA F 1 84  ? -17.517 -0.916  92.187  1.00 86.78  ? 86  ALA E O   1 
ATOM   5537 C CB  . ALA F 1 84  ? -18.138 -1.661  88.749  1.00 86.38  ? 86  ALA E CB  1 
ATOM   5538 N N   . THR F 1 85  ? -16.439 -0.134  90.377  1.00 87.01  ? 87  THR E N   1 
ATOM   5539 C CA  . THR F 1 85  ? -15.883 0.986   91.121  1.00 86.53  ? 87  THR E CA  1 
ATOM   5540 C C   . THR F 1 85  ? -16.619 2.276   90.772  1.00 82.82  ? 87  THR E C   1 
ATOM   5541 O O   . THR F 1 85  ? -16.944 2.528   89.606  1.00 74.56  ? 87  THR E O   1 
ATOM   5542 C CB  . THR F 1 85  ? -14.374 1.154   90.845  1.00 88.74  ? 87  THR E CB  1 
ATOM   5543 O OG1 . THR F 1 85  ? -13.676 -0.026  91.266  1.00 88.95  ? 87  THR E OG1 1 
ATOM   5544 C CG2 . THR F 1 85  ? -13.825 2.351   91.612  1.00 89.60  ? 87  THR E CG2 1 
ATOM   5545 N N   . TYR F 1 86  ? -16.887 3.080   91.799  1.00 82.34  ? 88  TYR E N   1 
ATOM   5546 C CA  . TYR F 1 86  ? -17.592 4.348   91.640  1.00 82.58  ? 88  TYR E CA  1 
ATOM   5547 C C   . TYR F 1 86  ? -16.710 5.547   91.974  1.00 79.80  ? 88  TYR E C   1 
ATOM   5548 O O   . TYR F 1 86  ? -16.307 5.740   93.121  1.00 83.52  ? 88  TYR E O   1 
ATOM   5549 C CB  . TYR F 1 86  ? -18.858 4.356   92.511  1.00 80.91  ? 88  TYR E CB  1 
ATOM   5550 C CG  . TYR F 1 86  ? -19.881 3.344   92.049  1.00 86.34  ? 88  TYR E CG  1 
ATOM   5551 C CD1 . TYR F 1 86  ? -20.435 3.425   90.769  1.00 86.75  ? 88  TYR E CD1 1 
ATOM   5552 C CD2 . TYR F 1 86  ? -20.241 2.260   92.855  1.00 87.66  ? 88  TYR E CD2 1 
ATOM   5553 C CE1 . TYR F 1 86  ? -21.311 2.450   90.297  1.00 87.94  ? 88  TYR E CE1 1 
ATOM   5554 C CE2 . TYR F 1 86  ? -21.121 1.275   92.390  1.00 82.40  ? 88  TYR E CE2 1 
ATOM   5555 C CZ  . TYR F 1 86  ? -21.646 1.378   91.109  1.00 85.29  ? 88  TYR E CZ  1 
ATOM   5556 O OH  . TYR F 1 86  ? -22.487 0.410   90.621  1.00 77.82  ? 88  TYR E OH  1 
ATOM   5557 N N   . PHE F 1 87  ? -16.413 6.346   90.956  1.00 74.93  ? 89  PHE E N   1 
ATOM   5558 C CA  . PHE F 1 87  ? -15.582 7.532   91.118  1.00 76.34  ? 89  PHE E CA  1 
ATOM   5559 C C   . PHE F 1 87  ? -16.415 8.789   91.324  1.00 74.60  ? 89  PHE E C   1 
ATOM   5560 O O   . PHE F 1 87  ? -17.405 9.018   90.623  1.00 76.18  ? 89  PHE E O   1 
ATOM   5561 C CB  . PHE F 1 87  ? -14.696 7.724   89.889  1.00 78.65  ? 89  PHE E CB  1 
ATOM   5562 C CG  . PHE F 1 87  ? -13.620 6.696   89.751  1.00 78.24  ? 89  PHE E CG  1 
ATOM   5563 C CD1 . PHE F 1 87  ? -12.509 6.721   90.586  1.00 80.11  ? 89  PHE E CD1 1 
ATOM   5564 C CD2 . PHE F 1 87  ? -13.714 5.699   88.787  1.00 78.32  ? 89  PHE E CD2 1 
ATOM   5565 C CE1 . PHE F 1 87  ? -11.503 5.765   90.462  1.00 83.84  ? 89  PHE E CE1 1 
ATOM   5566 C CE2 . PHE F 1 87  ? -12.715 4.737   88.653  1.00 80.66  ? 89  PHE E CE2 1 
ATOM   5567 C CZ  . PHE F 1 87  ? -11.606 4.770   89.492  1.00 78.98  ? 89  PHE E CZ  1 
ATOM   5568 N N   . CYS F 1 88  ? -16.000 9.603   92.288  1.00 71.94  ? 90  CYS E N   1 
ATOM   5569 C CA  . CYS F 1 88  ? -16.676 10.859  92.601  1.00 70.20  ? 90  CYS E CA  1 
ATOM   5570 C C   . CYS F 1 88  ? -15.805 12.011  92.122  1.00 69.24  ? 90  CYS E C   1 
ATOM   5571 O O   . CYS F 1 88  ? -14.702 12.214  92.626  1.00 72.40  ? 90  CYS E O   1 
ATOM   5572 C CB  . CYS F 1 88  ? -16.905 10.967  94.106  1.00 68.57  ? 90  CYS E CB  1 
ATOM   5573 S SG  . CYS F 1 88  ? -17.391 12.616  94.702  1.00 71.40  ? 90  CYS E SG  1 
ATOM   5574 N N   . ALA F 1 89  ? -16.300 12.756  91.142  1.00 65.73  ? 91  ALA E N   1 
ATOM   5575 C CA  . ALA F 1 89  ? -15.553 13.872  90.588  1.00 65.14  ? 91  ALA E CA  1 
ATOM   5576 C C   . ALA F 1 89  ? -16.150 15.223  90.984  1.00 65.25  ? 91  ALA E C   1 
ATOM   5577 O O   . ALA F 1 89  ? -17.257 15.294  91.529  1.00 63.05  ? 91  ALA E O   1 
ATOM   5578 C CB  . ALA F 1 89  ? -15.487 13.745  89.064  1.00 68.46  ? 91  ALA E CB  1 
ATOM   5579 N N   . ALA F 1 90  ? -15.398 16.288  90.707  1.00 60.78  ? 92  ALA E N   1 
ATOM   5580 C CA  . ALA F 1 90  ? -15.809 17.652  91.020  1.00 54.78  ? 92  ALA E CA  1 
ATOM   5581 C C   . ALA F 1 90  ? -15.102 18.627  90.091  1.00 50.90  ? 92  ALA E C   1 
ATOM   5582 O O   . ALA F 1 90  ? -13.999 18.356  89.621  1.00 51.69  ? 92  ALA E O   1 
ATOM   5583 C CB  . ALA F 1 90  ? -15.470 17.979  92.464  1.00 50.30  ? 92  ALA E CB  1 
ATOM   5584 N N   . SER F 1 91  ? -15.747 19.758  89.824  1.00 49.52  ? 93  SER E N   1 
ATOM   5585 C CA  . SER F 1 91  ? -15.177 20.781  88.958  1.00 52.43  ? 93  SER E CA  1 
ATOM   5586 C C   . SER F 1 91  ? -15.519 22.141  89.549  1.00 52.24  ? 93  SER E C   1 
ATOM   5587 O O   . SER F 1 91  ? -16.563 22.299  90.183  1.00 54.22  ? 93  SER E O   1 
ATOM   5588 C CB  . SER F 1 91  ? -15.737 20.661  87.540  1.00 54.74  ? 93  SER E CB  1 
ATOM   5589 O OG  . SER F 1 91  ? -17.078 21.105  87.485  1.00 65.90  ? 93  SER E OG  1 
ATOM   5590 N N   . ALA F 1 92  ? -14.634 23.115  89.341  1.00 54.20  ? 98  ALA E N   1 
ATOM   5591 C CA  . ALA F 1 92  ? -14.814 24.466  89.883  1.00 52.99  ? 98  ALA E CA  1 
ATOM   5592 C C   . ALA F 1 92  ? -15.702 25.377  89.043  1.00 50.23  ? 98  ALA E C   1 
ATOM   5593 O O   . ALA F 1 92  ? -15.910 25.129  87.858  1.00 48.98  ? 98  ALA E O   1 
ATOM   5594 C CB  . ALA F 1 92  ? -13.448 25.119  90.083  1.00 47.05  ? 98  ALA E CB  1 
ATOM   5595 N N   . ASN F 1 93  ? -16.215 26.434  89.674  1.00 52.37  ? 99  ASN E N   1 
ATOM   5596 C CA  . ASN F 1 93  ? -17.080 27.414  89.011  1.00 53.91  ? 99  ASN E CA  1 
ATOM   5597 C C   . ASN F 1 93  ? -16.297 28.177  87.948  1.00 53.17  ? 99  ASN E C   1 
ATOM   5598 O O   . ASN F 1 93  ? -16.878 28.843  87.088  1.00 53.99  ? 99  ASN E O   1 
ATOM   5599 C CB  . ASN F 1 93  ? -17.643 28.398  90.028  1.00 48.97  ? 99  ASN E CB  1 
ATOM   5600 C CG  . ASN F 1 93  ? -16.576 28.963  90.917  1.00 49.72  ? 99  ASN E CG  1 
ATOM   5601 O OD1 . ASN F 1 93  ? -15.388 28.799  90.641  1.00 46.40  ? 99  ASN E OD1 1 
ATOM   5602 N ND2 . ASN F 1 93  ? -16.982 29.637  91.991  1.00 47.31  ? 99  ASN E ND2 1 
ATOM   5603 N N   . SER F 1 94  ? -14.972 28.124  88.035  1.00 52.16  ? 100 SER E N   1 
ATOM   5604 C CA  . SER F 1 94  ? -14.144 28.760  87.002  1.00 55.36  ? 100 SER E CA  1 
ATOM   5605 C C   . SER F 1 94  ? -14.298 27.728  85.864  1.00 62.39  ? 100 SER E C   1 
ATOM   5606 O O   . SER F 1 94  ? -14.853 26.706  86.112  1.00 63.29  ? 100 SER E O   1 
ATOM   5607 C CB  . SER F 1 94  ? -12.705 28.899  87.485  1.00 55.27  ? 100 SER E CB  1 
ATOM   5608 O OG  . SER F 1 94  ? -12.198 27.677  87.980  1.00 52.25  ? 100 SER E OG  1 
ATOM   5609 N N   . GLY F 1 95  ? -13.884 27.810  84.627  1.00 64.61  ? 101 GLY E N   1 
ATOM   5610 C CA  . GLY F 1 95  ? -14.358 26.600  83.928  1.00 81.93  ? 101 GLY E CA  1 
ATOM   5611 C C   . GLY F 1 95  ? -13.324 25.485  83.810  1.00 86.63  ? 101 GLY E C   1 
ATOM   5612 O O   . GLY F 1 95  ? -13.211 24.860  82.750  1.00 94.76  ? 101 GLY E O   1 
ATOM   5613 N N   . THR F 1 96  ? -12.559 25.291  84.896  1.00 81.06  ? 102 THR E N   1 
ATOM   5614 C CA  . THR F 1 96  ? -11.429 24.343  85.058  1.00 76.66  ? 102 THR E CA  1 
ATOM   5615 C C   . THR F 1 96  ? -11.835 22.891  84.943  1.00 74.90  ? 102 THR E C   1 
ATOM   5616 O O   . THR F 1 96  ? -12.986 22.551  85.145  1.00 75.29  ? 102 THR E O   1 
ATOM   5617 C CB  . THR F 1 96  ? -10.763 24.514  86.431  1.00 71.18  ? 102 THR E CB  1 
ATOM   5618 O OG1 . THR F 1 96  ? -11.788 24.655  87.415  1.00 76.31  ? 102 THR E OG1 1 
ATOM   5619 C CG2 . THR F 1 96  ? -9.868  25.730  86.462  1.00 70.27  ? 102 THR E CG2 1 
ATOM   5620 N N   . TYR F 1 97  ? -10.882 22.023  84.652  1.00 73.43  ? 103 TYR E N   1 
ATOM   5621 C CA  . TYR F 1 97  ? -11.208 20.624  84.466  1.00 70.24  ? 103 TYR E CA  1 
ATOM   5622 C C   . TYR F 1 97  ? -11.541 19.808  85.708  1.00 66.46  ? 103 TYR E C   1 
ATOM   5623 O O   . TYR F 1 97  ? -11.167 20.168  86.819  1.00 67.83  ? 103 TYR E O   1 
ATOM   5624 C CB  . TYR F 1 97  ? -10.078 19.967  83.692  1.00 69.74  ? 103 TYR E CB  1 
ATOM   5625 C CG  . TYR F 1 97  ? -8.771  19.868  84.448  1.00 71.41  ? 103 TYR E CG  1 
ATOM   5626 C CD1 . TYR F 1 97  ? -8.634  18.996  85.524  1.00 69.26  ? 103 TYR E CD1 1 
ATOM   5627 C CD2 . TYR F 1 97  ? -7.658  20.617  84.061  1.00 72.44  ? 103 TYR E CD2 1 
ATOM   5628 C CE1 . TYR F 1 97  ? -7.423  18.865  86.194  1.00 72.75  ? 103 TYR E CE1 1 
ATOM   5629 C CE2 . TYR F 1 97  ? -6.440  20.494  84.726  1.00 69.43  ? 103 TYR E CE2 1 
ATOM   5630 C CZ  . TYR F 1 97  ? -6.330  19.615  85.792  1.00 72.73  ? 103 TYR E CZ  1 
ATOM   5631 O OH  . TYR F 1 97  ? -5.132  19.479  86.457  1.00 75.15  ? 103 TYR E OH  1 
ATOM   5632 N N   . GLN F 1 98  ? -12.249 18.700  85.488  1.00 66.40  ? 104 GLN E N   1 
ATOM   5633 C CA  . GLN F 1 98  ? -12.675 17.772  86.542  1.00 63.62  ? 104 GLN E CA  1 
ATOM   5634 C C   . GLN F 1 98  ? -11.550 17.078  87.303  1.00 58.09  ? 104 GLN E C   1 
ATOM   5635 O O   . GLN F 1 98  ? -10.591 16.588  86.710  1.00 52.00  ? 104 GLN E O   1 
ATOM   5636 C CB  . GLN F 1 98  ? -13.562 16.679  85.944  1.00 70.28  ? 104 GLN E CB  1 
ATOM   5637 C CG  . GLN F 1 98  ? -14.967 17.096  85.618  1.00 73.70  ? 104 GLN E CG  1 
ATOM   5638 C CD  . GLN F 1 98  ? -15.698 16.033  84.828  1.00 77.64  ? 104 GLN E CD  1 
ATOM   5639 O OE1 . GLN F 1 98  ? -15.752 14.866  85.226  1.00 82.26  ? 104 GLN E OE1 1 
ATOM   5640 N NE2 . GLN F 1 98  ? -16.265 16.431  83.698  1.00 79.06  ? 104 GLN E NE2 1 
ATOM   5641 N N   . ARG F 1 99  ? -11.692 17.015  88.620  1.00 54.19  ? 105 ARG E N   1 
ATOM   5642 C CA  . ARG F 1 99  ? -10.706 16.355  89.457  1.00 60.51  ? 105 ARG E CA  1 
ATOM   5643 C C   . ARG F 1 99  ? -11.389 15.079  89.917  1.00 63.99  ? 105 ARG E C   1 
ATOM   5644 O O   . ARG F 1 99  ? -12.475 15.138  90.498  1.00 63.33  ? 105 ARG E O   1 
ATOM   5645 C CB  . ARG F 1 99  ? -10.368 17.218  90.675  1.00 67.24  ? 105 ARG E CB  1 
ATOM   5646 C CG  . ARG F 1 99  ? -10.172 18.700  90.373  1.00 80.91  ? 105 ARG E CG  1 
ATOM   5647 C CD  . ARG F 1 99  ? -8.852  18.999  89.673  1.00 83.81  ? 105 ARG E CD  1 
ATOM   5648 N NE  . ARG F 1 99  ? -8.799  20.387  89.210  1.00 91.45  ? 105 ARG E NE  1 
ATOM   5649 C CZ  . ARG F 1 99  ? -7.699  20.993  88.774  1.00 91.97  ? 105 ARG E CZ  1 
ATOM   5650 N NH1 . ARG F 1 99  ? -6.545  20.339  88.742  1.00 96.51  ? 105 ARG E NH1 1 
ATOM   5651 N NH2 . ARG F 1 99  ? -7.755  22.252  88.362  1.00 86.96  ? 105 ARG E NH2 1 
ATOM   5652 N N   . PHE F 1 100 ? -10.771 13.931  89.649  1.00 65.62  ? 106 PHE E N   1 
ATOM   5653 C CA  . PHE F 1 100 ? -11.350 12.651  90.053  1.00 65.17  ? 106 PHE E CA  1 
ATOM   5654 C C   . PHE F 1 100 ? -10.854 12.176  91.410  1.00 65.00  ? 106 PHE E C   1 
ATOM   5655 O O   . PHE F 1 100 ? -9.701  12.402  91.774  1.00 67.64  ? 106 PHE E O   1 
ATOM   5656 C CB  . PHE F 1 100 ? -11.058 11.571  89.012  1.00 61.03  ? 106 PHE E CB  1 
ATOM   5657 C CG  . PHE F 1 100 ? -11.906 11.673  87.775  1.00 68.55  ? 106 PHE E CG  1 
ATOM   5658 C CD1 . PHE F 1 100 ? -11.511 12.467  86.701  1.00 71.44  ? 106 PHE E CD1 1 
ATOM   5659 C CD2 . PHE F 1 100 ? -13.101 10.962  87.678  1.00 67.33  ? 106 PHE E CD2 1 
ATOM   5660 C CE1 . PHE F 1 100 ? -12.294 12.547  85.548  1.00 70.10  ? 106 PHE E CE1 1 
ATOM   5661 C CE2 . PHE F 1 100 ? -13.888 11.036  86.533  1.00 64.31  ? 106 PHE E CE2 1 
ATOM   5662 C CZ  . PHE F 1 100 ? -13.484 11.827  85.466  1.00 67.00  ? 106 PHE E CZ  1 
ATOM   5663 N N   . GLY F 1 101 ? -11.732 11.507  92.150  1.00 69.52  ? 107 GLY E N   1 
ATOM   5664 C CA  . GLY F 1 101 ? -11.371 10.999  93.462  1.00 72.43  ? 107 GLY E CA  1 
ATOM   5665 C C   . GLY F 1 101 ? -10.635 9.668   93.424  1.00 74.23  ? 107 GLY E C   1 
ATOM   5666 O O   . GLY F 1 101 ? -10.318 9.143   92.354  1.00 67.22  ? 107 GLY E O   1 
ATOM   5667 N N   . THR F 1 102 ? -10.359 9.126   94.606  1.00 82.40  ? 108 THR E N   1 
ATOM   5668 C CA  . THR F 1 102 ? -9.656  7.852   94.746  1.00 87.08  ? 108 THR E CA  1 
ATOM   5669 C C   . THR F 1 102 ? -10.457 6.709   94.132  1.00 89.35  ? 108 THR E C   1 
ATOM   5670 O O   . THR F 1 102 ? -9.950  5.960   93.298  1.00 90.70  ? 108 THR E O   1 
ATOM   5671 C CB  . THR F 1 102 ? -9.412  7.515   96.229  1.00 88.34  ? 108 THR E CB  1 
ATOM   5672 O OG1 . THR F 1 102 ? -8.554  8.504   96.808  1.00 86.52  ? 108 THR E OG1 1 
ATOM   5673 C CG2 . THR F 1 102 ? -8.775  6.141   96.367  1.00 90.53  ? 108 THR E CG2 1 
ATOM   5674 N N   . GLY F 1 103 ? -11.708 6.579   94.562  1.00 89.05  ? 109 GLY E N   1 
ATOM   5675 C CA  . GLY F 1 103 ? -12.564 5.527   94.051  1.00 88.61  ? 109 GLY E CA  1 
ATOM   5676 C C   . GLY F 1 103 ? -12.910 4.529   95.135  1.00 88.12  ? 109 GLY E C   1 
ATOM   5677 O O   . GLY F 1 103 ? -12.101 4.275   96.032  1.00 86.09  ? 109 GLY E O   1 
ATOM   5678 N N   . THR F 1 104 ? -14.119 3.975   95.056  1.00 87.81  ? 110 THR E N   1 
ATOM   5679 C CA  . THR F 1 104 ? -14.597 2.985   96.020  1.00 83.46  ? 110 THR E CA  1 
ATOM   5680 C C   . THR F 1 104 ? -15.064 1.736   95.290  1.00 85.90  ? 110 THR E C   1 
ATOM   5681 O O   . THR F 1 104 ? -15.881 1.818   94.373  1.00 83.62  ? 110 THR E O   1 
ATOM   5682 C CB  . THR F 1 104 ? -15.788 3.511   96.842  1.00 76.78  ? 110 THR E CB  1 
ATOM   5683 O OG1 . THR F 1 104 ? -15.353 4.556   97.717  1.00 72.16  ? 110 THR E OG1 1 
ATOM   5684 C CG2 . THR F 1 104 ? -16.390 2.398   97.662  1.00 74.79  ? 110 THR E CG2 1 
ATOM   5685 N N   . LYS F 1 105 ? -14.535 0.583   95.692  1.00 91.42  ? 111 LYS E N   1 
ATOM   5686 C CA  . LYS F 1 105 ? -14.927 -0.685  95.083  1.00 90.52  ? 111 LYS E CA  1 
ATOM   5687 C C   . LYS F 1 105 ? -16.094 -1.245  95.892  1.00 89.46  ? 111 LYS E C   1 
ATOM   5688 O O   . LYS F 1 105 ? -16.005 -1.384  97.115  1.00 79.58  ? 111 LYS E O   1 
ATOM   5689 C CB  . LYS F 1 105 ? -13.753 -1.672  95.079  1.00 89.99  ? 111 LYS E CB  1 
ATOM   5690 C CG  . LYS F 1 105 ? -12.572 -1.208  94.230  1.00 98.29  ? 111 LYS E CG  1 
ATOM   5691 C CD  . LYS F 1 105 ? -11.396 -2.190  94.260  1.00 99.73  ? 111 LYS E CD  1 
ATOM   5692 C CE  . LYS F 1 105 ? -10.176 -1.619  93.517  1.00 100.57 ? 111 LYS E CE  1 
ATOM   5693 N NZ  . LYS F 1 105 ? -8.979  -2.520  93.518  1.00 91.80  ? 111 LYS E NZ  1 
ATOM   5694 N N   . LEU F 1 106 ? -17.192 -1.544  95.200  1.00 93.84  ? 112 LEU E N   1 
ATOM   5695 C CA  . LEU F 1 106 ? -18.393 -2.079  95.842  1.00 98.55  ? 112 LEU E CA  1 
ATOM   5696 C C   . LEU F 1 106 ? -18.738 -3.497  95.385  1.00 99.92  ? 112 LEU E C   1 
ATOM   5697 O O   . LEU F 1 106 ? -18.702 -3.807  94.189  1.00 98.24  ? 112 LEU E O   1 
ATOM   5698 C CB  . LEU F 1 106 ? -19.593 -1.165  95.568  1.00 95.56  ? 112 LEU E CB  1 
ATOM   5699 C CG  . LEU F 1 106 ? -20.942 -1.603  96.155  1.00 94.04  ? 112 LEU E CG  1 
ATOM   5700 C CD1 . LEU F 1 106 ? -20.910 -1.519  97.681  1.00 88.42  ? 112 LEU E CD1 1 
ATOM   5701 C CD2 . LEU F 1 106 ? -22.041 -0.717  95.597  1.00 92.78  ? 112 LEU E CD2 1 
ATOM   5702 N N   . GLN F 1 107 ? -19.079 -4.346  96.354  1.00 101.74 ? 113 GLN E N   1 
ATOM   5703 C CA  . GLN F 1 107 ? -19.455 -5.731  96.087  1.00 99.24  ? 113 GLN E CA  1 
ATOM   5704 C C   . GLN F 1 107 ? -20.848 -6.029  96.614  1.00 94.91  ? 113 GLN E C   1 
ATOM   5705 O O   . GLN F 1 107 ? -21.138 -5.806  97.792  1.00 86.49  ? 113 GLN E O   1 
ATOM   5706 C CB  . GLN F 1 107 ? -18.491 -6.712  96.756  1.00 102.98 ? 113 GLN E CB  1 
ATOM   5707 C CG  . GLN F 1 107 ? -17.107 -6.785  96.164  1.00 111.30 ? 113 GLN E CG  1 
ATOM   5708 C CD  . GLN F 1 107 ? -16.347 -7.987  96.685  1.00 116.27 ? 113 GLN E CD  1 
ATOM   5709 O OE1 . GLN F 1 107 ? -16.685 -9.129  96.370  1.00 117.68 ? 113 GLN E OE1 1 
ATOM   5710 N NE2 . GLN F 1 107 ? -15.325 -7.739  97.499  1.00 114.57 ? 113 GLN E NE2 1 
ATOM   5711 N N   . VAL F 1 108 ? -21.704 -6.534  95.736  1.00 95.69  ? 114 VAL E N   1 
ATOM   5712 C CA  . VAL F 1 108 ? -23.055 -6.906  96.125  1.00 96.84  ? 114 VAL E CA  1 
ATOM   5713 C C   . VAL F 1 108 ? -23.101 -8.429  96.085  1.00 95.32  ? 114 VAL E C   1 
ATOM   5714 O O   . VAL F 1 108 ? -23.073 -9.037  95.013  1.00 90.04  ? 114 VAL E O   1 
ATOM   5715 C CB  . VAL F 1 108 ? -24.106 -6.343  95.156  1.00 98.26  ? 114 VAL E CB  1 
ATOM   5716 C CG1 . VAL F 1 108 ? -25.499 -6.557  95.725  1.00 95.98  ? 114 VAL E CG1 1 
ATOM   5717 C CG2 . VAL F 1 108 ? -23.849 -4.868  94.917  1.00 102.02 ? 114 VAL E CG2 1 
ATOM   5718 N N   . VAL F 1 109 ? -23.148 -9.039  97.264  1.00 95.89  ? 115 VAL E N   1 
ATOM   5719 C CA  . VAL F 1 109 ? -23.181 -10.491 97.383  1.00 95.42  ? 115 VAL E CA  1 
ATOM   5720 C C   . VAL F 1 109 ? -24.596 -11.013 97.612  1.00 92.75  ? 115 VAL E C   1 
ATOM   5721 O O   . VAL F 1 109 ? -25.346 -10.463 98.421  1.00 89.93  ? 115 VAL E O   1 
ATOM   5722 C CB  . VAL F 1 109 ? -22.289 -10.957 98.545  1.00 96.36  ? 115 VAL E CB  1 
ATOM   5723 C CG1 . VAL F 1 109 ? -22.465 -12.445 98.769  1.00 99.87  ? 115 VAL E CG1 1 
ATOM   5724 C CG2 . VAL F 1 109 ? -20.837 -10.627 98.245  1.00 95.59  ? 115 VAL E CG2 1 
ATOM   5725 N N   . PRO F 1 110 ? -24.975 -12.091 96.901  1.00 90.57  ? 116 PRO E N   1 
ATOM   5726 C CA  . PRO F 1 110 ? -26.305 -12.701 97.018  1.00 89.37  ? 116 PRO E CA  1 
ATOM   5727 C C   . PRO F 1 110 ? -26.694 -13.031 98.464  1.00 88.94  ? 116 PRO E C   1 
ATOM   5728 O O   . PRO F 1 110 ? -25.789 -13.053 99.326  1.00 88.11  ? 116 PRO E O   1 
ATOM   5729 C CB  . PRO F 1 110 ? -26.179 -13.951 96.151  1.00 89.23  ? 116 PRO E CB  1 
ATOM   5730 C CG  . PRO F 1 110 ? -25.241 -13.507 95.077  1.00 89.42  ? 116 PRO E CG  1 
ATOM   5731 C CD  . PRO F 1 110 ? -24.179 -12.776 95.867  1.00 88.87  ? 116 PRO E CD  1 
ATOM   5732 O OXT . PRO F 1 110 ? -27.898 -13.272 98.713  1.00 84.15  ? 116 PRO E OXT 1 
ATOM   5733 N N   . ALA G 2 1   ? -18.695 6.320   72.999  1.00 85.96  ? 3   ALA F N   1 
ATOM   5734 C CA  . ALA G 2 1   ? -18.397 6.319   71.535  1.00 90.57  ? 3   ALA F CA  1 
ATOM   5735 C C   . ALA G 2 1   ? -16.991 6.849   71.247  1.00 89.07  ? 3   ALA F C   1 
ATOM   5736 O O   . ALA G 2 1   ? -16.783 7.622   70.309  1.00 86.51  ? 3   ALA F O   1 
ATOM   5737 C CB  . ALA G 2 1   ? -19.435 7.159   70.794  1.00 93.41  ? 3   ALA F CB  1 
ATOM   5738 N N   . VAL G 2 2   ? -16.028 6.417   72.055  1.00 88.79  ? 4   VAL F N   1 
ATOM   5739 C CA  . VAL G 2 2   ? -14.641 6.843   71.907  1.00 84.99  ? 4   VAL F CA  1 
ATOM   5740 C C   . VAL G 2 2   ? -13.749 5.639   71.597  1.00 83.05  ? 4   VAL F C   1 
ATOM   5741 O O   . VAL G 2 2   ? -13.984 4.546   72.108  1.00 80.20  ? 4   VAL F O   1 
ATOM   5742 C CB  . VAL G 2 2   ? -14.150 7.506   73.198  1.00 83.26  ? 4   VAL F CB  1 
ATOM   5743 C CG1 . VAL G 2 2   ? -12.857 8.249   72.942  1.00 86.50  ? 4   VAL F CG1 1 
ATOM   5744 C CG2 . VAL G 2 2   ? -15.219 8.442   73.730  1.00 87.96  ? 4   VAL F CG2 1 
ATOM   5745 N N   . THR G 2 3   ? -12.722 5.842   70.774  1.00 81.93  ? 5   THR F N   1 
ATOM   5746 C CA  . THR G 2 3   ? -11.823 4.750   70.398  1.00 85.25  ? 5   THR F CA  1 
ATOM   5747 C C   . THR G 2 3   ? -10.342 4.958   70.712  1.00 87.14  ? 5   THR F C   1 
ATOM   5748 O O   . THR G 2 3   ? -9.801  6.046   70.519  1.00 88.92  ? 5   THR F O   1 
ATOM   5749 C CB  . THR G 2 3   ? -11.923 4.459   68.903  1.00 82.63  ? 5   THR F CB  1 
ATOM   5750 O OG1 . THR G 2 3   ? -13.285 4.183   68.564  1.00 88.75  ? 5   THR F OG1 1 
ATOM   5751 C CG2 . THR G 2 3   ? -11.058 3.265   68.539  1.00 86.89  ? 5   THR F CG2 1 
ATOM   5752 N N   . GLN G 2 4   ? -9.691  3.898   71.185  1.00 86.01  ? 6   GLN F N   1 
ATOM   5753 C CA  . GLN G 2 4   ? -8.265  3.945   71.501  1.00 85.20  ? 6   GLN F CA  1 
ATOM   5754 C C   . GLN G 2 4   ? -7.558  2.815   70.763  1.00 87.71  ? 6   GLN F C   1 
ATOM   5755 O O   . GLN G 2 4   ? -7.895  1.643   70.938  1.00 84.99  ? 6   GLN F O   1 
ATOM   5756 C CB  . GLN G 2 4   ? -8.031  3.782   73.000  1.00 77.15  ? 6   GLN F CB  1 
ATOM   5757 C CG  . GLN G 2 4   ? -8.869  4.690   73.866  1.00 69.84  ? 6   GLN F CG  1 
ATOM   5758 C CD  . GLN G 2 4   ? -8.535  4.538   75.331  1.00 71.92  ? 6   GLN F CD  1 
ATOM   5759 O OE1 . GLN G 2 4   ? -9.281  4.982   76.200  1.00 76.75  ? 6   GLN F OE1 1 
ATOM   5760 N NE2 . GLN G 2 4   ? -7.400  3.911   75.615  1.00 74.45  ? 6   GLN F NE2 1 
ATOM   5761 N N   . SER G 2 5   ? -6.573  3.175   69.947  1.00 91.93  ? 7   SER F N   1 
ATOM   5762 C CA  . SER G 2 5   ? -5.829  2.199   69.173  1.00 93.64  ? 7   SER F CA  1 
ATOM   5763 C C   . SER G 2 5   ? -5.169  1.122   70.040  1.00 94.97  ? 7   SER F C   1 
ATOM   5764 O O   . SER G 2 5   ? -5.823  0.141   70.387  1.00 101.44 ? 7   SER F O   1 
ATOM   5765 C CB  . SER G 2 5   ? -4.803  2.912   68.287  1.00 96.76  ? 7   SER F CB  1 
ATOM   5766 O OG  . SER G 2 5   ? -4.044  1.984   67.532  1.00 102.69 ? 7   SER F OG  1 
ATOM   5767 N N   . PRO G 2 6   ? -3.891  1.287   70.433  1.00 91.67  ? 8   PRO F N   1 
ATOM   5768 C CA  . PRO G 2 6   ? -3.358  0.191   71.247  1.00 87.62  ? 8   PRO F CA  1 
ATOM   5769 C C   . PRO G 2 6   ? -4.293  -0.209  72.381  1.00 87.67  ? 8   PRO F C   1 
ATOM   5770 O O   . PRO G 2 6   ? -4.469  0.538   73.338  1.00 91.70  ? 8   PRO F O   1 
ATOM   5771 C CB  . PRO G 2 6   ? -2.033  0.753   71.753  1.00 88.49  ? 8   PRO F CB  1 
ATOM   5772 C CG  . PRO G 2 6   ? -1.628  1.675   70.651  1.00 89.36  ? 8   PRO F CG  1 
ATOM   5773 C CD  . PRO G 2 6   ? -2.926  2.400   70.396  1.00 90.46  ? 8   PRO F CD  1 
ATOM   5774 N N   . ARG G 2 7   ? -4.900  -1.385  72.262  1.00 84.17  ? 9   ARG F N   1 
ATOM   5775 C CA  . ARG G 2 7   ? -5.814  -1.863  73.291  1.00 82.00  ? 9   ARG F CA  1 
ATOM   5776 C C   . ARG G 2 7   ? -5.031  -2.665  74.329  1.00 79.90  ? 9   ARG F C   1 
ATOM   5777 O O   . ARG G 2 7   ? -5.435  -2.764  75.486  1.00 76.17  ? 9   ARG F O   1 
ATOM   5778 C CB  . ARG G 2 7   ? -6.914  -2.725  72.666  1.00 84.61  ? 9   ARG F CB  1 
ATOM   5779 C CG  . ARG G 2 7   ? -8.309  -2.492  73.254  1.00 94.50  ? 9   ARG F CG  1 
ATOM   5780 C CD  . ARG G 2 7   ? -8.384  -2.841  74.743  1.00 102.29 ? 9   ARG F CD  1 
ATOM   5781 N NE  . ARG G 2 7   ? -9.728  -2.658  75.297  1.00 107.76 ? 9   ARG F NE  1 
ATOM   5782 C CZ  . ARG G 2 7   ? -10.067 -2.951  76.552  1.00 110.73 ? 9   ARG F CZ  1 
ATOM   5783 N NH1 . ARG G 2 7   ? -9.161  -3.443  77.388  1.00 109.43 ? 9   ARG F NH1 1 
ATOM   5784 N NH2 . ARG G 2 7   ? -11.312 -2.755  76.975  1.00 110.24 ? 9   ARG F NH2 1 
ATOM   5785 N N   . ASN G 2 8   ? -3.901  -3.222  73.901  1.00 81.13  ? 10  ASN F N   1 
ATOM   5786 C CA  . ASN G 2 8   ? -3.023  -4.013  74.764  1.00 80.67  ? 10  ASN F CA  1 
ATOM   5787 C C   . ASN G 2 8   ? -1.622  -4.022  74.163  1.00 83.40  ? 10  ASN F C   1 
ATOM   5788 O O   . ASN G 2 8   ? -1.325  -4.828  73.285  1.00 88.28  ? 10  ASN F O   1 
ATOM   5789 C CB  . ASN G 2 8   ? -3.537  -5.449  74.882  1.00 76.78  ? 10  ASN F CB  1 
ATOM   5790 C CG  . ASN G 2 8   ? -3.942  -5.805  76.297  1.00 74.69  ? 10  ASN F CG  1 
ATOM   5791 O OD1 . ASN G 2 8   ? -3.129  -5.753  77.219  1.00 75.85  ? 10  ASN F OD1 1 
ATOM   5792 N ND2 . ASN G 2 8   ? -5.205  -6.167  76.477  1.00 71.17  ? 10  ASN F ND2 1 
ATOM   5793 N N   . LYS G 2 9   ? -0.763  -3.126  74.638  1.00 87.06  ? 11  LYS F N   1 
ATOM   5794 C CA  . LYS G 2 9   ? 0.598   -3.024  74.117  1.00 87.58  ? 11  LYS F CA  1 
ATOM   5795 C C   . LYS G 2 9   ? 1.643   -3.298  75.193  1.00 86.92  ? 11  LYS F C   1 
ATOM   5796 O O   . LYS G 2 9   ? 1.450   -2.964  76.363  1.00 85.19  ? 11  LYS F O   1 
ATOM   5797 C CB  . LYS G 2 9   ? 0.821   -1.624  73.528  1.00 89.47  ? 11  LYS F CB  1 
ATOM   5798 C CG  . LYS G 2 9   ? 1.834   -1.543  72.388  1.00 89.74  ? 11  LYS F CG  1 
ATOM   5799 C CD  . LYS G 2 9   ? 3.278   -1.677  72.850  1.00 91.87  ? 11  LYS F CD  1 
ATOM   5800 C CE  . LYS G 2 9   ? 4.235   -1.570  71.662  1.00 95.22  ? 11  LYS F CE  1 
ATOM   5801 N NZ  . LYS G 2 9   ? 5.664   -1.814  72.024  1.00 94.19  ? 11  LYS F NZ  1 
ATOM   5802 N N   . VAL G 2 10  ? 2.744   -3.920  74.781  1.00 87.06  ? 12  VAL F N   1 
ATOM   5803 C CA  . VAL G 2 10  ? 3.851   -4.236  75.677  1.00 88.49  ? 12  VAL F CA  1 
ATOM   5804 C C   . VAL G 2 10  ? 5.148   -3.860  74.974  1.00 89.82  ? 12  VAL F C   1 
ATOM   5805 O O   . VAL G 2 10  ? 5.394   -4.299  73.848  1.00 91.69  ? 12  VAL F O   1 
ATOM   5806 C CB  . VAL G 2 10  ? 3.897   -5.735  76.018  1.00 89.82  ? 12  VAL F CB  1 
ATOM   5807 C CG1 . VAL G 2 10  ? 5.133   -6.038  76.851  1.00 88.91  ? 12  VAL F CG1 1 
ATOM   5808 C CG2 . VAL G 2 10  ? 2.642   -6.135  76.775  1.00 91.78  ? 12  VAL F CG2 1 
ATOM   5809 N N   . ALA G 2 11  ? 5.975   -3.050  75.630  1.00 87.89  ? 13  ALA F N   1 
ATOM   5810 C CA  . ALA G 2 11  ? 7.236   -2.625  75.029  1.00 86.41  ? 13  ALA F CA  1 
ATOM   5811 C C   . ALA G 2 11  ? 8.434   -2.733  75.960  1.00 86.56  ? 13  ALA F C   1 
ATOM   5812 O O   . ALA G 2 11  ? 8.306   -3.067  77.139  1.00 77.16  ? 13  ALA F O   1 
ATOM   5813 C CB  . ALA G 2 11  ? 7.116   -1.198  74.514  1.00 87.30  ? 13  ALA F CB  1 
ATOM   5814 N N   . VAL G 2 12  ? 9.601   -2.434  75.401  1.00 90.88  ? 14  VAL F N   1 
ATOM   5815 C CA  . VAL G 2 12  ? 10.866  -2.488  76.121  1.00 92.60  ? 14  VAL F CA  1 
ATOM   5816 C C   . VAL G 2 12  ? 11.069  -1.185  76.883  1.00 93.35  ? 14  VAL F C   1 
ATOM   5817 O O   . VAL G 2 12  ? 10.665  -0.124  76.404  1.00 96.30  ? 14  VAL F O   1 
ATOM   5818 C CB  . VAL G 2 12  ? 12.046  -2.661  75.130  1.00 92.16  ? 14  VAL F CB  1 
ATOM   5819 C CG1 . VAL G 2 12  ? 13.314  -3.071  75.877  1.00 92.59  ? 14  VAL F CG1 1 
ATOM   5820 C CG2 . VAL G 2 12  ? 11.679  -3.677  74.060  1.00 88.92  ? 14  VAL F CG2 1 
ATOM   5821 N N   . THR G 2 13  ? 11.690  -1.268  78.060  1.00 91.66  ? 15  THR F N   1 
ATOM   5822 C CA  . THR G 2 13  ? 11.968  -0.085  78.878  1.00 88.21  ? 15  THR F CA  1 
ATOM   5823 C C   . THR G 2 13  ? 12.895  0.852   78.111  1.00 86.81  ? 15  THR F C   1 
ATOM   5824 O O   . THR G 2 13  ? 14.108  0.828   78.308  1.00 86.99  ? 15  THR F O   1 
ATOM   5825 C CB  . THR G 2 13  ? 12.660  -0.461  80.216  1.00 88.02  ? 15  THR F CB  1 
ATOM   5826 O OG1 . THR G 2 13  ? 11.752  -1.199  81.041  1.00 87.81  ? 15  THR F OG1 1 
ATOM   5827 C CG2 . THR G 2 13  ? 13.106  0.789   80.963  1.00 85.29  ? 15  THR F CG2 1 
ATOM   5828 N N   . GLY G 2 14  ? 12.315  1.671   77.238  1.00 87.92  ? 16  GLY F N   1 
ATOM   5829 C CA  . GLY G 2 14  ? 13.096  2.601   76.444  1.00 85.36  ? 16  GLY F CA  1 
ATOM   5830 C C   . GLY G 2 14  ? 12.485  2.820   75.071  1.00 88.29  ? 16  GLY F C   1 
ATOM   5831 O O   . GLY G 2 14  ? 12.977  3.630   74.282  1.00 86.70  ? 16  GLY F O   1 
ATOM   5832 N N   . GLU G 2 15  ? 11.404  2.100   74.787  1.00 89.69  ? 17  GLU F N   1 
ATOM   5833 C CA  . GLU G 2 15  ? 10.745  2.219   73.493  1.00 92.56  ? 17  GLU F CA  1 
ATOM   5834 C C   . GLU G 2 15  ? 9.888   3.478   73.425  1.00 94.30  ? 17  GLU F C   1 
ATOM   5835 O O   . GLU G 2 15  ? 9.564   4.078   74.444  1.00 95.06  ? 17  GLU F O   1 
ATOM   5836 C CB  . GLU G 2 15  ? 9.895   0.979   73.208  1.00 20.00  ? 17  GLU F CB  1 
ATOM   5837 C CG  . GLU G 2 15  ? 9.359   0.907   71.787  1.00 20.00  ? 17  GLU F CG  1 
ATOM   5838 C CD  . GLU G 2 15  ? 8.514   -0.328  71.545  1.00 20.00  ? 17  GLU F CD  1 
ATOM   5839 O OE1 . GLU G 2 15  ? 8.343   -1.125  72.491  1.00 20.00  ? 17  GLU F OE1 1 
ATOM   5840 O OE2 . GLU G 2 15  ? 8.025   -0.500  70.409  1.00 20.00  ? 17  GLU F OE2 1 
ATOM   5841 N N   . LYS G 2 16  ? 9.523   3.863   72.199  1.00 94.84  ? 18  LYS F N   1 
ATOM   5842 C CA  . LYS G 2 16  ? 8.693   5.044   71.958  1.00 92.43  ? 18  LYS F CA  1 
ATOM   5843 C C   . LYS G 2 16  ? 7.254   4.591   71.704  1.00 92.14  ? 18  LYS F C   1 
ATOM   5844 O O   . LYS G 2 16  ? 6.889   4.243   70.578  1.00 93.63  ? 18  LYS F O   1 
ATOM   5845 C CB  . LYS G 2 16  ? 9.251   5.842   70.769  1.00 91.87  ? 18  LYS F CB  1 
ATOM   5846 C CG  . LYS G 2 16  ? 8.441   7.084   70.378  1.00 90.49  ? 18  LYS F CG  1 
ATOM   5847 C CD  . LYS G 2 16  ? 8.832   7.593   69.001  1.00 90.87  ? 18  LYS F CD  1 
ATOM   5848 C CE  . LYS G 2 16  ? 8.342   9.022   68.766  1.00 89.41  ? 18  LYS F CE  1 
ATOM   5849 N NZ  . LYS G 2 16  ? 9.221   10.027  69.429  1.00 83.35  ? 18  LYS F NZ  1 
ATOM   5850 N N   . VAL G 2 17  ? 6.440   4.592   72.755  1.00 89.82  ? 19  VAL F N   1 
ATOM   5851 C CA  . VAL G 2 17  ? 5.047   4.171   72.643  1.00 87.25  ? 19  VAL F CA  1 
ATOM   5852 C C   . VAL G 2 17  ? 4.159   5.336   72.216  1.00 85.31  ? 19  VAL F C   1 
ATOM   5853 O O   . VAL G 2 17  ? 4.494   6.498   72.443  1.00 87.28  ? 19  VAL F O   1 
ATOM   5854 C CB  . VAL G 2 17  ? 4.526   3.622   73.989  1.00 87.00  ? 19  VAL F CB  1 
ATOM   5855 C CG1 . VAL G 2 17  ? 3.210   2.889   73.779  1.00 83.81  ? 19  VAL F CG1 1 
ATOM   5856 C CG2 . VAL G 2 17  ? 5.567   2.702   74.616  1.00 89.04  ? 19  VAL F CG2 1 
ATOM   5857 N N   . THR G 2 18  ? 3.026   5.022   71.597  1.00 84.75  ? 20  THR F N   1 
ATOM   5858 C CA  . THR G 2 18  ? 2.095   6.053   71.150  1.00 83.50  ? 20  THR F CA  1 
ATOM   5859 C C   . THR G 2 18  ? 0.648   5.564   71.151  1.00 84.24  ? 20  THR F C   1 
ATOM   5860 O O   . THR G 2 18  ? 0.151   5.031   70.155  1.00 84.58  ? 20  THR F O   1 
ATOM   5861 C CB  . THR G 2 18  ? 2.448   6.553   69.733  1.00 82.69  ? 20  THR F CB  1 
ATOM   5862 O OG1 . THR G 2 18  ? 3.792   7.048   69.722  1.00 81.01  ? 20  THR F OG1 1 
ATOM   5863 C CG2 . THR G 2 18  ? 1.500   7.669   69.311  1.00 78.89  ? 20  THR F CG2 1 
ATOM   5864 N N   . LEU G 2 19  ? -0.024  5.752   72.280  1.00 80.81  ? 21  LEU F N   1 
ATOM   5865 C CA  . LEU G 2 19  ? -1.412  5.347   72.413  1.00 78.76  ? 21  LEU F CA  1 
ATOM   5866 C C   . LEU G 2 19  ? -2.276  6.420   71.776  1.00 81.91  ? 21  LEU F C   1 
ATOM   5867 O O   . LEU G 2 19  ? -2.539  7.442   72.400  1.00 89.64  ? 21  LEU F O   1 
ATOM   5868 C CB  . LEU G 2 19  ? -1.789  5.218   73.888  1.00 73.49  ? 21  LEU F CB  1 
ATOM   5869 C CG  . LEU G 2 19  ? -1.026  4.221   74.761  1.00 74.34  ? 21  LEU F CG  1 
ATOM   5870 C CD1 . LEU G 2 19  ? 0.446   4.576   74.800  1.00 75.14  ? 21  LEU F CD1 1 
ATOM   5871 C CD2 . LEU G 2 19  ? -1.611  4.239   76.165  1.00 71.49  ? 21  LEU F CD2 1 
ATOM   5872 N N   . SER G 2 20  ? -2.714  6.204   70.539  1.00 81.81  ? 22  SER F N   1 
ATOM   5873 C CA  . SER G 2 20  ? -3.556  7.193   69.868  1.00 80.57  ? 22  SER F CA  1 
ATOM   5874 C C   . SER G 2 20  ? -5.039  7.015   70.210  1.00 76.15  ? 22  SER F C   1 
ATOM   5875 O O   . SER G 2 20  ? -5.469  5.937   70.618  1.00 73.03  ? 22  SER F O   1 
ATOM   5876 C CB  . SER G 2 20  ? -3.342  7.127   68.355  1.00 80.29  ? 22  SER F CB  1 
ATOM   5877 O OG  . SER G 2 20  ? -3.396  5.790   67.900  1.00 83.05  ? 22  SER F OG  1 
ATOM   5878 N N   . CYS G 2 21  ? -5.815  8.084   70.051  1.00 75.77  ? 23  CYS F N   1 
ATOM   5879 C CA  . CYS G 2 21  ? -7.240  8.053   70.368  1.00 70.50  ? 23  CYS F CA  1 
ATOM   5880 C C   . CYS G 2 21  ? -8.093  8.725   69.308  1.00 67.23  ? 23  CYS F C   1 
ATOM   5881 O O   . CYS G 2 21  ? -7.597  9.507   68.499  1.00 70.81  ? 23  CYS F O   1 
ATOM   5882 C CB  . CYS G 2 21  ? -7.494  8.740   71.704  1.00 68.43  ? 23  CYS F CB  1 
ATOM   5883 S SG  . CYS G 2 21  ? -9.241  8.748   72.215  1.00 73.41  ? 23  CYS F SG  1 
ATOM   5884 N N   . ASN G 2 22  ? -9.389  8.433   69.337  1.00 64.10  ? 24  ASN F N   1 
ATOM   5885 C CA  . ASN G 2 22  ? -10.318 8.995   68.370  1.00 58.34  ? 24  ASN F CA  1 
ATOM   5886 C C   . ASN G 2 22  ? -11.743 8.999   68.909  1.00 54.26  ? 24  ASN F C   1 
ATOM   5887 O O   . ASN G 2 22  ? -12.164 8.043   69.547  1.00 56.36  ? 24  ASN F O   1 
ATOM   5888 C CB  . ASN G 2 22  ? -10.258 8.178   67.089  1.00 58.20  ? 24  ASN F CB  1 
ATOM   5889 C CG  . ASN G 2 22  ? -11.187 8.699   66.034  1.00 63.76  ? 24  ASN F CG  1 
ATOM   5890 O OD1 . ASN G 2 22  ? -10.787 9.481   65.173  1.00 66.87  ? 24  ASN F OD1 1 
ATOM   5891 N ND2 . ASN G 2 22  ? -12.449 8.282   66.099  1.00 62.38  ? 24  ASN F ND2 1 
ATOM   5892 N N   . GLN G 2 23  ? -12.481 10.077  68.649  1.00 63.27  ? 25  GLN F N   1 
ATOM   5893 C CA  . GLN G 2 23  ? -13.871 10.209  69.108  1.00 64.33  ? 25  GLN F CA  1 
ATOM   5894 C C   . GLN G 2 23  ? -14.764 10.900  68.072  1.00 65.51  ? 25  GLN F C   1 
ATOM   5895 O O   . GLN G 2 23  ? -14.366 11.890  67.458  1.00 62.42  ? 25  GLN F O   1 
ATOM   5896 C CB  . GLN G 2 23  ? -13.920 10.982  70.432  1.00 66.13  ? 25  GLN F CB  1 
ATOM   5897 C CG  . GLN G 2 23  ? -13.246 12.360  70.403  1.00 68.19  ? 25  GLN F CG  1 
ATOM   5898 C CD  . GLN G 2 23  ? -14.224 13.508  70.198  1.00 69.99  ? 25  GLN F CD  1 
ATOM   5899 O OE1 . GLN G 2 23  ? -15.254 13.593  70.876  1.00 68.47  ? 25  GLN F OE1 1 
ATOM   5900 N NE2 . GLN G 2 23  ? -13.898 14.407  69.273  1.00 57.49  ? 25  GLN F NE2 1 
ATOM   5901 N N   . THR G 2 24  ? -15.977 10.378  67.894  1.00 70.82  ? 26  THR F N   1 
ATOM   5902 C CA  . THR G 2 24  ? -16.922 10.924  66.917  1.00 72.54  ? 26  THR F CA  1 
ATOM   5903 C C   . THR G 2 24  ? -17.982 11.829  67.544  1.00 72.37  ? 26  THR F C   1 
ATOM   5904 O O   . THR G 2 24  ? -18.858 12.336  66.848  1.00 69.12  ? 26  THR F O   1 
ATOM   5905 C CB  . THR G 2 24  ? -17.639 9.780   66.149  1.00 76.46  ? 26  THR F CB  1 
ATOM   5906 O OG1 . THR G 2 24  ? -16.662 8.922   65.549  1.00 74.34  ? 26  THR F OG1 1 
ATOM   5907 C CG2 . THR G 2 24  ? -18.533 10.339  65.046  1.00 81.19  ? 26  THR F CG2 1 
ATOM   5908 N N   . ASN G 2 25  ? -17.897 12.031  68.856  1.00 77.24  ? 27  ASN F N   1 
ATOM   5909 C CA  . ASN G 2 25  ? -18.850 12.875  69.579  1.00 76.92  ? 27  ASN F CA  1 
ATOM   5910 C C   . ASN G 2 25  ? -18.778 14.333  69.137  1.00 76.00  ? 27  ASN F C   1 
ATOM   5911 O O   . ASN G 2 25  ? -19.622 15.150  69.508  1.00 74.08  ? 27  ASN F O   1 
ATOM   5912 C CB  . ASN G 2 25  ? -18.578 12.788  71.077  1.00 83.16  ? 27  ASN F CB  1 
ATOM   5913 C CG  . ASN G 2 25  ? -18.689 11.375  71.604  1.00 92.53  ? 27  ASN F CG  1 
ATOM   5914 O OD1 . ASN G 2 25  ? -19.773 10.790  71.620  1.00 97.17  ? 27  ASN F OD1 1 
ATOM   5915 N ND2 . ASN G 2 25  ? -17.563 10.812  72.032  1.00 96.28  ? 27  ASN F ND2 1 
ATOM   5916 N N   . ASN G 2 26  ? -17.762 14.652  68.346  1.00 78.14  ? 28  ASN F N   1 
ATOM   5917 C CA  . ASN G 2 26  ? -17.565 16.007  67.849  1.00 80.07  ? 28  ASN F CA  1 
ATOM   5918 C C   . ASN G 2 26  ? -17.444 16.985  69.020  1.00 77.00  ? 28  ASN F C   1 
ATOM   5919 O O   . ASN G 2 26  ? -17.823 18.157  68.916  1.00 75.72  ? 28  ASN F O   1 
ATOM   5920 C CB  . ASN G 2 26  ? -18.727 16.410  66.934  1.00 85.62  ? 28  ASN F CB  1 
ATOM   5921 C CG  . ASN G 2 26  ? -18.361 17.544  65.990  1.00 92.51  ? 28  ASN F CG  1 
ATOM   5922 O OD1 . ASN G 2 26  ? -18.010 18.642  66.425  1.00 97.41  ? 28  ASN F OD1 1 
ATOM   5923 N ND2 . ASN G 2 26  ? -18.439 17.280  64.689  1.00 93.92  ? 28  ASN F ND2 1 
ATOM   5924 N N   . HIS G 2 27  ? -16.925 16.484  70.139  1.00 71.89  ? 29  HIS F N   1 
ATOM   5925 C CA  . HIS G 2 27  ? -16.719 17.297  71.332  1.00 67.40  ? 29  HIS F CA  1 
ATOM   5926 C C   . HIS G 2 27  ? -15.494 18.168  71.101  1.00 67.29  ? 29  HIS F C   1 
ATOM   5927 O O   . HIS G 2 27  ? -14.595 17.790  70.350  1.00 66.82  ? 29  HIS F O   1 
ATOM   5928 C CB  . HIS G 2 27  ? -16.491 16.414  72.558  1.00 63.23  ? 29  HIS F CB  1 
ATOM   5929 C CG  . HIS G 2 27  ? -17.719 15.701  73.030  1.00 66.84  ? 29  HIS F CG  1 
ATOM   5930 N ND1 . HIS G 2 27  ? -18.982 16.011  72.572  1.00 68.09  ? 29  HIS F ND1 1 
ATOM   5931 C CD2 . HIS G 2 27  ? -17.883 14.723  73.953  1.00 62.44  ? 29  HIS F CD2 1 
ATOM   5932 C CE1 . HIS G 2 27  ? -19.871 15.257  73.194  1.00 70.49  ? 29  HIS F CE1 1 
ATOM   5933 N NE2 . HIS G 2 27  ? -19.230 14.467  74.037  1.00 68.21  ? 29  HIS F NE2 1 
ATOM   5934 N N   . ASN G 2 28  ? -15.447 19.330  71.743  1.00 69.08  ? 30  ASN F N   1 
ATOM   5935 C CA  . ASN G 2 28  ? -14.308 20.217  71.547  1.00 66.91  ? 30  ASN F CA  1 
ATOM   5936 C C   . ASN G 2 28  ? -13.031 19.820  72.268  1.00 60.63  ? 30  ASN F C   1 
ATOM   5937 O O   . ASN G 2 28  ? -11.946 19.986  71.719  1.00 56.03  ? 30  ASN F O   1 
ATOM   5938 C CB  . ASN G 2 28  ? -14.676 21.660  71.889  1.00 66.14  ? 30  ASN F CB  1 
ATOM   5939 C CG  . ASN G 2 28  ? -15.467 22.323  70.784  1.00 67.80  ? 30  ASN F CG  1 
ATOM   5940 O OD1 . ASN G 2 28  ? -15.585 21.786  69.679  1.00 66.17  ? 30  ASN F OD1 1 
ATOM   5941 N ND2 . ASN G 2 28  ? -16.008 23.497  71.070  1.00 69.18  ? 30  ASN F ND2 1 
ATOM   5942 N N   . ASN G 2 29  ? -13.122 19.294  73.480  1.00 55.02  ? 31  ASN F N   1 
ATOM   5943 C CA  . ASN G 2 29  ? -11.880 18.920  74.125  1.00 63.55  ? 31  ASN F CA  1 
ATOM   5944 C C   . ASN G 2 29  ? -11.755 17.445  74.517  1.00 67.94  ? 31  ASN F C   1 
ATOM   5945 O O   . ASN G 2 29  ? -12.744 16.772  74.825  1.00 67.65  ? 31  ASN F O   1 
ATOM   5946 C CB  . ASN G 2 29  ? -11.589 19.866  75.305  1.00 66.09  ? 31  ASN F CB  1 
ATOM   5947 C CG  . ASN G 2 29  ? -12.606 19.782  76.418  1.00 68.14  ? 31  ASN F CG  1 
ATOM   5948 O OD1 . ASN G 2 29  ? -12.664 20.672  77.272  1.00 62.54  ? 31  ASN F OD1 1 
ATOM   5949 N ND2 . ASN G 2 29  ? -13.397 18.715  76.436  1.00 71.63  ? 31  ASN F ND2 1 
ATOM   5950 N N   . MET G 2 30  ? -10.523 16.944  74.451  1.00 69.25  ? 32  MET F N   1 
ATOM   5951 C CA  . MET G 2 30  ? -10.216 15.556  74.784  1.00 68.84  ? 32  MET F CA  1 
ATOM   5952 C C   . MET G 2 30  ? -9.210  15.475  75.932  1.00 70.90  ? 32  MET F C   1 
ATOM   5953 O O   . MET G 2 30  ? -8.532  16.454  76.259  1.00 70.58  ? 32  MET F O   1 
ATOM   5954 C CB  . MET G 2 30  ? -9.660  14.827  73.556  1.00 65.28  ? 32  MET F CB  1 
ATOM   5955 C CG  . MET G 2 30  ? -10.589 14.847  72.353  1.00 63.85  ? 32  MET F CG  1 
ATOM   5956 S SD  . MET G 2 30  ? -10.047 13.748  71.026  1.00 78.62  ? 32  MET F SD  1 
ATOM   5957 C CE  . MET G 2 30  ? -9.319  14.854  69.891  1.00 67.05  ? 32  MET F CE  1 
ATOM   5958 N N   . TYR G 2 31  ? -9.114  14.299  76.542  1.00 71.37  ? 33  TYR F N   1 
ATOM   5959 C CA  . TYR G 2 31  ? -8.209  14.099  77.663  1.00 70.75  ? 33  TYR F CA  1 
ATOM   5960 C C   . TYR G 2 31  ? -7.387  12.823  77.505  1.00 72.05  ? 33  TYR F C   1 
ATOM   5961 O O   . TYR G 2 31  ? -7.451  12.155  76.473  1.00 73.08  ? 33  TYR F O   1 
ATOM   5962 C CB  . TYR G 2 31  ? -9.006  14.031  78.968  1.00 68.35  ? 33  TYR F CB  1 
ATOM   5963 C CG  . TYR G 2 31  ? -9.984  15.173  79.170  1.00 73.84  ? 33  TYR F CG  1 
ATOM   5964 C CD1 . TYR G 2 31  ? -11.077 15.343  78.315  1.00 74.25  ? 33  TYR F CD1 1 
ATOM   5965 C CD2 . TYR G 2 31  ? -9.830  16.073  80.230  1.00 72.11  ? 33  TYR F CD2 1 
ATOM   5966 C CE1 . TYR G 2 31  ? -11.991 16.377  78.511  1.00 78.00  ? 33  TYR F CE1 1 
ATOM   5967 C CE2 . TYR G 2 31  ? -10.740 17.109  80.435  1.00 71.15  ? 33  TYR F CE2 1 
ATOM   5968 C CZ  . TYR G 2 31  ? -11.818 17.254  79.573  1.00 75.46  ? 33  TYR F CZ  1 
ATOM   5969 O OH  . TYR G 2 31  ? -12.737 18.259  79.780  1.00 81.22  ? 33  TYR F OH  1 
ATOM   5970 N N   . TRP G 2 32  ? -6.615  12.505  78.544  1.00 70.44  ? 34  TRP F N   1 
ATOM   5971 C CA  . TRP G 2 32  ? -5.757  11.318  78.589  1.00 66.11  ? 34  TRP F CA  1 
ATOM   5972 C C   . TRP G 2 32  ? -5.354  11.049  80.036  1.00 65.26  ? 34  TRP F C   1 
ATOM   5973 O O   . TRP G 2 32  ? -4.471  11.721  80.573  1.00 68.86  ? 34  TRP F O   1 
ATOM   5974 C CB  . TRP G 2 32  ? -4.495  11.525  77.746  1.00 62.74  ? 34  TRP F CB  1 
ATOM   5975 C CG  . TRP G 2 32  ? -4.523  10.873  76.381  1.00 70.96  ? 34  TRP F CG  1 
ATOM   5976 C CD1 . TRP G 2 32  ? -4.192  11.458  75.188  1.00 75.45  ? 34  TRP F CD1 1 
ATOM   5977 C CD2 . TRP G 2 32  ? -4.836  9.506   76.079  1.00 73.34  ? 34  TRP F CD2 1 
ATOM   5978 N NE1 . TRP G 2 32  ? -4.279  10.542  74.165  1.00 74.07  ? 34  TRP F NE1 1 
ATOM   5979 C CE2 . TRP G 2 32  ? -4.675  9.337   74.682  1.00 74.72  ? 34  TRP F CE2 1 
ATOM   5980 C CE3 . TRP G 2 32  ? -5.244  8.408   76.850  1.00 77.42  ? 34  TRP F CE3 1 
ATOM   5981 C CZ2 . TRP G 2 32  ? -4.898  8.111   74.040  1.00 75.04  ? 34  TRP F CZ2 1 
ATOM   5982 C CZ3 . TRP G 2 32  ? -5.468  7.186   76.211  1.00 80.62  ? 34  TRP F CZ3 1 
ATOM   5983 C CH2 . TRP G 2 32  ? -5.297  7.052   74.817  1.00 77.20  ? 34  TRP F CH2 1 
ATOM   5984 N N   . TYR G 2 33  ? -6.010  10.073  80.663  1.00 64.70  ? 35  TYR F N   1 
ATOM   5985 C CA  . TYR G 2 33  ? -5.727  9.709   82.049  1.00 67.53  ? 35  TYR F CA  1 
ATOM   5986 C C   . TYR G 2 33  ? -4.958  8.399   82.118  1.00 71.91  ? 35  TYR F C   1 
ATOM   5987 O O   . TYR G 2 33  ? -4.562  7.827   81.101  1.00 71.69  ? 35  TYR F O   1 
ATOM   5988 C CB  . TYR G 2 33  ? -7.017  9.492   82.841  1.00 71.21  ? 35  TYR F CB  1 
ATOM   5989 C CG  . TYR G 2 33  ? -8.002  10.635  82.869  1.00 77.33  ? 35  TYR F CG  1 
ATOM   5990 C CD1 . TYR G 2 33  ? -8.703  11.011  81.724  1.00 75.47  ? 35  TYR F CD1 1 
ATOM   5991 C CD2 . TYR G 2 33  ? -8.287  11.296  84.063  1.00 77.56  ? 35  TYR F CD2 1 
ATOM   5992 C CE1 . TYR G 2 33  ? -9.669  12.015  81.773  1.00 76.26  ? 35  TYR F CE1 1 
ATOM   5993 C CE2 . TYR G 2 33  ? -9.248  12.298  84.123  1.00 76.56  ? 35  TYR F CE2 1 
ATOM   5994 C CZ  . TYR G 2 33  ? -9.936  12.652  82.979  1.00 74.71  ? 35  TYR F CZ  1 
ATOM   5995 O OH  . TYR G 2 33  ? -10.895 13.632  83.051  1.00 69.69  ? 35  TYR F OH  1 
ATOM   5996 N N   . ARG G 2 34  ? -4.763  7.930   83.344  1.00 74.77  ? 36  ARG F N   1 
ATOM   5997 C CA  . ARG G 2 34  ? -4.105  6.656   83.604  1.00 74.22  ? 36  ARG F CA  1 
ATOM   5998 C C   . ARG G 2 34  ? -4.564  6.187   84.979  1.00 72.70  ? 36  ARG F C   1 
ATOM   5999 O O   . ARG G 2 34  ? -4.368  6.866   85.985  1.00 73.66  ? 36  ARG F O   1 
ATOM   6000 C CB  . ARG G 2 34  ? -2.575  6.778   83.548  1.00 70.33  ? 36  ARG F CB  1 
ATOM   6001 C CG  . ARG G 2 34  ? -1.963  7.770   84.511  1.00 75.72  ? 36  ARG F CG  1 
ATOM   6002 C CD  . ARG G 2 34  ? -0.463  7.544   84.634  1.00 69.60  ? 36  ARG F CD  1 
ATOM   6003 N NE  . ARG G 2 34  ? -0.159  6.320   85.368  1.00 69.81  ? 36  ARG F NE  1 
ATOM   6004 C CZ  . ARG G 2 34  ? 1.069   5.860   85.588  1.00 70.58  ? 36  ARG F CZ  1 
ATOM   6005 N NH1 . ARG G 2 34  ? 2.125   6.521   85.129  1.00 64.58  ? 36  ARG F NH1 1 
ATOM   6006 N NH2 . ARG G 2 34  ? 1.242   4.735   86.270  1.00 68.41  ? 36  ARG F NH2 1 
ATOM   6007 N N   . GLN G 2 35  ? -5.210  5.031   85.013  1.00 76.89  ? 37  GLN F N   1 
ATOM   6008 C CA  . GLN G 2 35  ? -5.703  4.494   86.265  1.00 78.23  ? 37  GLN F CA  1 
ATOM   6009 C C   . GLN G 2 35  ? -4.647  3.599   86.892  1.00 79.22  ? 37  GLN F C   1 
ATOM   6010 O O   . GLN G 2 35  ? -3.984  2.819   86.199  1.00 76.61  ? 37  GLN F O   1 
ATOM   6011 C CB  . GLN G 2 35  ? -6.992  3.710   86.022  1.00 83.05  ? 37  GLN F CB  1 
ATOM   6012 C CG  . GLN G 2 35  ? -7.789  3.415   87.282  1.00 81.89  ? 37  GLN F CG  1 
ATOM   6013 C CD  . GLN G 2 35  ? -9.180  2.899   86.976  1.00 80.29  ? 37  GLN F CD  1 
ATOM   6014 O OE1 . GLN G 2 35  ? -10.003 2.745   87.873  1.00 80.43  ? 37  GLN F OE1 1 
ATOM   6015 N NE2 . GLN G 2 35  ? -9.447  2.626   85.703  1.00 77.37  ? 37  GLN F NE2 1 
ATOM   6016 N N   . ASP G 2 36  ? -4.494  3.729   88.206  1.00 77.61  ? 38  ASP F N   1 
ATOM   6017 C CA  . ASP G 2 36  ? -3.526  2.953   88.966  1.00 80.82  ? 38  ASP F CA  1 
ATOM   6018 C C   . ASP G 2 36  ? -4.089  2.734   90.360  1.00 85.24  ? 38  ASP F C   1 
ATOM   6019 O O   . ASP G 2 36  ? -4.522  3.686   91.007  1.00 87.87  ? 38  ASP F O   1 
ATOM   6020 C CB  . ASP G 2 36  ? -2.205  3.717   89.075  1.00 78.23  ? 38  ASP F CB  1 
ATOM   6021 C CG  . ASP G 2 36  ? -1.623  4.069   87.727  1.00 86.58  ? 38  ASP F CG  1 
ATOM   6022 O OD1 . ASP G 2 36  ? -1.255  3.140   86.986  1.00 88.74  ? 38  ASP F OD1 1 
ATOM   6023 O OD2 . ASP G 2 36  ? -1.535  5.273   87.405  1.00 88.73  ? 38  ASP F OD2 1 
ATOM   6024 N N   . THR G 2 37  ? -4.090  1.487   90.822  1.00 90.88  ? 39  THR F N   1 
ATOM   6025 C CA  . THR G 2 37  ? -4.602  1.188   92.157  1.00 94.05  ? 39  THR F CA  1 
ATOM   6026 C C   . THR G 2 37  ? -3.971  2.132   93.182  1.00 93.17  ? 39  THR F C   1 
ATOM   6027 O O   . THR G 2 37  ? -2.746  2.207   93.313  1.00 89.09  ? 39  THR F O   1 
ATOM   6028 C CB  . THR G 2 37  ? -4.330  -0.290  92.557  1.00 94.84  ? 39  THR F CB  1 
ATOM   6029 O OG1 . THR G 2 37  ? -3.119  -0.748  91.938  1.00 93.83  ? 39  THR F OG1 1 
ATOM   6030 C CG2 . THR G 2 37  ? -5.495  -1.180  92.133  1.00 94.95  ? 39  THR F CG2 1 
ATOM   6031 N N   . GLY G 2 38  ? -4.824  2.862   93.893  1.00 92.17  ? 40  GLY F N   1 
ATOM   6032 C CA  . GLY G 2 38  ? -4.348  3.808   94.884  1.00 96.24  ? 40  GLY F CA  1 
ATOM   6033 C C   . GLY G 2 38  ? -4.844  5.202   94.549  1.00 97.46  ? 40  GLY F C   1 
ATOM   6034 O O   . GLY G 2 38  ? -5.577  5.815   95.322  1.00 97.01  ? 40  GLY F O   1 
ATOM   6035 N N   . HIS G 2 39  ? -4.443  5.701   93.385  1.00 98.66  ? 41  HIS F N   1 
ATOM   6036 C CA  . HIS G 2 39  ? -4.854  7.021   92.931  1.00 100.20 ? 41  HIS F CA  1 
ATOM   6037 C C   . HIS G 2 39  ? -5.630  6.938   91.618  1.00 97.91  ? 41  HIS F C   1 
ATOM   6038 O O   . HIS G 2 39  ? -5.077  7.152   90.536  1.00 96.20  ? 41  HIS F O   1 
ATOM   6039 C CB  . HIS G 2 39  ? -3.645  7.970   92.780  1.00 104.83 ? 41  HIS F CB  1 
ATOM   6040 C CG  . HIS G 2 39  ? -2.314  7.284   92.665  1.00 106.43 ? 41  HIS F CG  1 
ATOM   6041 N ND1 . HIS G 2 39  ? -1.139  7.986   92.504  1.00 107.77 ? 41  HIS F ND1 1 
ATOM   6042 C CD2 . HIS G 2 39  ? -1.965  5.976   92.711  1.00 109.36 ? 41  HIS F CD2 1 
ATOM   6043 C CE1 . HIS G 2 39  ? -0.124  7.140   92.459  1.00 109.23 ? 41  HIS F CE1 1 
ATOM   6044 N NE2 . HIS G 2 39  ? -0.598  5.914   92.583  1.00 109.83 ? 41  HIS F NE2 1 
ATOM   6045 N N   . GLY G 2 40  ? -6.920  6.630   91.750  1.00 92.81  ? 42  GLY F N   1 
ATOM   6046 C CA  . GLY G 2 40  ? -7.826  6.494   90.621  1.00 84.68  ? 42  GLY F CA  1 
ATOM   6047 C C   . GLY G 2 40  ? -7.366  7.018   89.278  1.00 80.37  ? 42  GLY F C   1 
ATOM   6048 O O   . GLY G 2 40  ? -6.349  6.579   88.739  1.00 79.88  ? 42  GLY F O   1 
ATOM   6049 N N   . LEU G 2 41  ? -8.139  7.943   88.718  1.00 78.12  ? 43  LEU F N   1 
ATOM   6050 C CA  . LEU G 2 41  ? -7.798  8.530   87.431  1.00 71.91  ? 43  LEU F CA  1 
ATOM   6051 C C   . LEU G 2 41  ? -7.016  9.809   87.676  1.00 69.51  ? 43  LEU F C   1 
ATOM   6052 O O   . LEU G 2 41  ? -7.466  10.693  88.402  1.00 69.12  ? 43  LEU F O   1 
ATOM   6053 C CB  . LEU G 2 41  ? -9.057  8.871   86.621  1.00 75.12  ? 43  LEU F CB  1 
ATOM   6054 C CG  . LEU G 2 41  ? -10.096 7.814   86.241  1.00 77.47  ? 43  LEU F CG  1 
ATOM   6055 C CD1 . LEU G 2 41  ? -9.413  6.633   85.564  1.00 75.64  ? 43  LEU F CD1 1 
ATOM   6056 C CD2 . LEU G 2 41  ? -10.849 7.375   87.483  1.00 78.53  ? 43  LEU F CD2 1 
ATOM   6057 N N   . ARG G 2 42  ? -5.837  9.897   87.083  1.00 64.23  ? 44  ARG F N   1 
ATOM   6058 C CA  . ARG G 2 42  ? -5.012  11.080  87.219  1.00 64.53  ? 44  ARG F CA  1 
ATOM   6059 C C   . ARG G 2 42  ? -4.873  11.629  85.814  1.00 65.05  ? 44  ARG F C   1 
ATOM   6060 O O   . ARG G 2 42  ? -4.512  10.900  84.889  1.00 71.31  ? 44  ARG F O   1 
ATOM   6061 C CB  . ARG G 2 42  ? -3.644  10.719  87.795  1.00 65.09  ? 44  ARG F CB  1 
ATOM   6062 C CG  . ARG G 2 42  ? -3.671  10.337  89.272  1.00 68.19  ? 44  ARG F CG  1 
ATOM   6063 C CD  . ARG G 2 42  ? -2.668  9.227   89.569  1.00 76.27  ? 44  ARG F CD  1 
ATOM   6064 N NE  . ARG G 2 42  ? -1.331  9.549   89.078  1.00 78.92  ? 44  ARG F NE  1 
ATOM   6065 C CZ  . ARG G 2 42  ? -0.313  8.694   89.049  1.00 80.76  ? 44  ARG F CZ  1 
ATOM   6066 N NH1 . ARG G 2 42  ? -0.472  7.454   89.486  1.00 84.27  ? 44  ARG F NH1 1 
ATOM   6067 N NH2 . ARG G 2 42  ? 0.866   9.078   88.575  1.00 86.87  ? 44  ARG F NH2 1 
ATOM   6068 N N   . LEU G 2 43  ? -5.187  12.907  85.649  1.00 62.73  ? 45  LEU F N   1 
ATOM   6069 C CA  . LEU G 2 43  ? -5.103  13.541  84.343  1.00 63.27  ? 45  LEU F CA  1 
ATOM   6070 C C   . LEU G 2 43  ? -3.643  13.755  83.967  1.00 61.46  ? 45  LEU F C   1 
ATOM   6071 O O   . LEU G 2 43  ? -2.831  14.107  84.818  1.00 66.28  ? 45  LEU F O   1 
ATOM   6072 C CB  . LEU G 2 43  ? -5.846  14.878  84.375  1.00 59.24  ? 45  LEU F CB  1 
ATOM   6073 C CG  . LEU G 2 43  ? -5.906  15.662  83.065  1.00 64.96  ? 45  LEU F CG  1 
ATOM   6074 C CD1 . LEU G 2 43  ? -6.528  14.816  81.963  1.00 66.87  ? 45  LEU F CD1 1 
ATOM   6075 C CD2 . LEU G 2 43  ? -6.705  16.949  83.238  1.00 59.52  ? 45  LEU F CD2 1 
ATOM   6076 N N   . ILE G 2 44  ? -3.310  13.538  82.698  1.00 60.20  ? 46  ILE F N   1 
ATOM   6077 C CA  . ILE G 2 44  ? -1.934  13.709  82.235  1.00 63.65  ? 46  ILE F CA  1 
ATOM   6078 C C   . ILE G 2 44  ? -1.794  14.904  81.292  1.00 64.49  ? 46  ILE F C   1 
ATOM   6079 O O   . ILE G 2 44  ? -1.074  15.855  81.587  1.00 68.85  ? 46  ILE F O   1 
ATOM   6080 C CB  . ILE G 2 44  ? -1.423  12.428  81.523  1.00 60.86  ? 46  ILE F CB  1 
ATOM   6081 C CG1 . ILE G 2 44  ? -1.433  11.244  82.495  1.00 61.11  ? 46  ILE F CG1 1 
ATOM   6082 C CG2 . ILE G 2 44  ? -0.026  12.632  80.965  1.00 54.20  ? 46  ILE F CG2 1 
ATOM   6083 C CD1 . ILE G 2 44  ? -1.094  9.918   81.844  1.00 61.70  ? 46  ILE F CD1 1 
ATOM   6084 N N   . TYR G 2 45  ? -2.482  14.841  80.166  1.00 67.05  ? 47  TYR F N   1 
ATOM   6085 C CA  . TYR G 2 45  ? -2.475  15.914  79.180  1.00 70.55  ? 47  TYR F CA  1 
ATOM   6086 C C   . TYR G 2 45  ? -3.859  16.016  78.559  1.00 70.16  ? 47  TYR F C   1 
ATOM   6087 O O   . TYR G 2 45  ? -4.493  14.983  78.315  1.00 72.69  ? 47  TYR F O   1 
ATOM   6088 C CB  . TYR G 2 45  ? -1.414  15.680  78.103  1.00 75.66  ? 47  TYR F CB  1 
ATOM   6089 C CG  . TYR G 2 45  ? -0.115  16.417  78.351  1.00 90.34  ? 47  TYR F CG  1 
ATOM   6090 C CD1 . TYR G 2 45  ? 0.917   15.823  79.062  1.00 20.00  ? 47  TYR F CD1 1 
ATOM   6091 C CD2 . TYR G 2 45  ? 0.077   17.707  77.873  1.00 92.77  ? 47  TYR F CD2 1 
ATOM   6092 C CE1 . TYR G 2 45  ? 2.105   16.489  79.290  1.00 91.65  ? 47  TYR F CE1 1 
ATOM   6093 C CE2 . TYR G 2 45  ? 1.263   18.382  78.094  1.00 20.00  ? 47  TYR F CE2 1 
ATOM   6094 C CZ  . TYR G 2 45  ? 2.273   17.769  78.803  1.00 20.00  ? 47  TYR F CZ  1 
ATOM   6095 O OH  . TYR G 2 45  ? 3.455   18.438  79.027  1.00 20.00  ? 47  TYR F OH  1 
ATOM   6096 N N   . TYR G 2 46  ? -4.327  17.246  78.309  1.00 66.12  ? 48  TYR F N   1 
ATOM   6097 C CA  . TYR G 2 46  ? -5.651  17.427  77.718  1.00 65.42  ? 48  TYR F CA  1 
ATOM   6098 C C   . TYR G 2 46  ? -5.617  18.529  76.663  1.00 66.08  ? 48  TYR F C   1 
ATOM   6099 O O   . TYR G 2 46  ? -4.685  19.330  76.632  1.00 69.96  ? 48  TYR F O   1 
ATOM   6100 C CB  . TYR G 2 46  ? -6.702  17.709  78.805  1.00 60.06  ? 48  TYR F CB  1 
ATOM   6101 C CG  . TYR G 2 46  ? -6.496  18.960  79.631  1.00 65.67  ? 48  TYR F CG  1 
ATOM   6102 C CD1 . TYR G 2 46  ? -7.214  20.122  79.358  1.00 65.70  ? 48  TYR F CD1 1 
ATOM   6103 C CD2 . TYR G 2 46  ? -5.610  18.974  80.710  1.00 70.38  ? 48  TYR F CD2 1 
ATOM   6104 C CE1 . TYR G 2 46  ? -7.062  21.269  80.139  1.00 69.14  ? 48  TYR F CE1 1 
ATOM   6105 C CE2 . TYR G 2 46  ? -5.445  20.118  81.498  1.00 68.30  ? 48  TYR F CE2 1 
ATOM   6106 C CZ  . TYR G 2 46  ? -6.178  21.262  81.206  1.00 70.84  ? 48  TYR F CZ  1 
ATOM   6107 O OH  . TYR G 2 46  ? -6.037  22.392  81.982  1.00 64.12  ? 48  TYR F OH  1 
ATOM   6108 N N   . SER G 2 47  ? -6.619  18.564  75.788  1.00 61.61  ? 49  SER F N   1 
ATOM   6109 C CA  . SER G 2 47  ? -6.637  19.553  74.713  1.00 58.12  ? 49  SER F CA  1 
ATOM   6110 C C   . SER G 2 47  ? -7.948  20.310  74.564  1.00 60.24  ? 49  SER F C   1 
ATOM   6111 O O   . SER G 2 47  ? -8.997  19.812  74.947  1.00 63.34  ? 49  SER F O   1 
ATOM   6112 C CB  . SER G 2 47  ? -6.272  18.864  73.392  1.00 52.24  ? 49  SER F CB  1 
ATOM   6113 O OG  . SER G 2 47  ? -6.437  19.740  72.293  1.00 61.55  ? 49  SER F OG  1 
ATOM   6114 N N   . TYR G 2 48  ? -7.880  21.514  73.999  1.00 58.99  ? 50  TYR F N   1 
ATOM   6115 C CA  . TYR G 2 48  ? -9.071  22.329  73.794  1.00 56.18  ? 50  TYR F CA  1 
ATOM   6116 C C   . TYR G 2 48  ? -9.566  22.287  72.356  1.00 60.01  ? 50  TYR F C   1 
ATOM   6117 O O   . TYR G 2 48  ? -10.654 22.790  72.075  1.00 57.90  ? 50  TYR F O   1 
ATOM   6118 C CB  . TYR G 2 48  ? -8.823  23.791  74.180  1.00 58.65  ? 50  TYR F CB  1 
ATOM   6119 C CG  . TYR G 2 48  ? -8.651  24.045  75.659  1.00 51.01  ? 50  TYR F CG  1 
ATOM   6120 C CD1 . TYR G 2 48  ? -9.529  23.492  76.587  1.00 46.66  ? 50  TYR F CD1 1 
ATOM   6121 C CD2 . TYR G 2 48  ? -7.610  24.849  76.131  1.00 46.72  ? 50  TYR F CD2 1 
ATOM   6122 C CE1 . TYR G 2 48  ? -9.373  23.729  77.956  1.00 49.59  ? 50  TYR F CE1 1 
ATOM   6123 C CE2 . TYR G 2 48  ? -7.444  25.094  77.499  1.00 44.03  ? 50  TYR F CE2 1 
ATOM   6124 C CZ  . TYR G 2 48  ? -8.327  24.528  78.404  1.00 51.32  ? 50  TYR F CZ  1 
ATOM   6125 O OH  . TYR G 2 48  ? -8.150  24.733  79.756  1.00 53.82  ? 50  TYR F OH  1 
ATOM   6126 N N   . GLY G 2 49  ? -8.775  21.716  71.444  1.00 62.54  ? 51  GLY F N   1 
ATOM   6127 C CA  . GLY G 2 49  ? -9.223  21.631  70.068  1.00 70.38  ? 51  GLY F CA  1 
ATOM   6128 C C   . GLY G 2 49  ? -8.227  21.581  68.920  1.00 79.33  ? 51  GLY F C   1 
ATOM   6129 O O   . GLY G 2 49  ? -7.852  20.515  68.445  1.00 80.84  ? 51  GLY F O   1 
ATOM   6130 N N   . ALA G 2 50  ? -7.781  22.754  68.493  1.00 88.59  ? 52  ALA F N   1 
ATOM   6131 C CA  . ALA G 2 50  ? -6.925  22.898  67.327  1.00 88.94  ? 52  ALA F CA  1 
ATOM   6132 C C   . ALA G 2 50  ? -5.533  22.353  67.305  1.00 88.10  ? 52  ALA F C   1 
ATOM   6133 O O   . ALA G 2 50  ? -5.181  21.535  66.475  1.00 91.50  ? 52  ALA F O   1 
ATOM   6134 C CB  . ALA G 2 50  ? -6.879  24.363  66.926  1.00 91.62  ? 52  ALA F CB  1 
ATOM   6135 N N   . GLY G 2 51  ? -4.695  22.833  68.179  1.00 86.19  ? 53  GLY F N   1 
ATOM   6136 C CA  . GLY G 2 51  ? -3.346  22.332  68.110  1.00 78.77  ? 53  GLY F CA  1 
ATOM   6137 C C   . GLY G 2 51  ? -2.959  22.684  69.486  1.00 77.29  ? 53  GLY F C   1 
ATOM   6138 O O   . GLY G 2 51  ? -1.854  23.127  69.798  1.00 78.47  ? 53  GLY F O   1 
ATOM   6139 N N   . SER G 2 52  ? -3.977  22.479  70.300  1.00 72.28  ? 54  SER F N   1 
ATOM   6140 C CA  . SER G 2 52  ? -3.966  22.761  71.700  1.00 67.82  ? 54  SER F CA  1 
ATOM   6141 C C   . SER G 2 52  ? -3.579  21.582  72.553  1.00 66.81  ? 54  SER F C   1 
ATOM   6142 O O   . SER G 2 52  ? -3.971  20.451  72.289  1.00 69.11  ? 54  SER F O   1 
ATOM   6143 C CB  . SER G 2 52  ? -5.357  23.241  72.101  1.00 64.14  ? 54  SER F CB  1 
ATOM   6144 O OG  . SER G 2 52  ? -5.544  23.139  73.497  1.00 53.78  ? 54  SER F OG  1 
ATOM   6145 N N   . THR G 2 53  ? -2.806  21.869  73.590  1.00 67.62  ? 55  THR F N   1 
ATOM   6146 C CA  . THR G 2 53  ? -2.373  20.859  74.542  1.00 69.48  ? 55  THR F CA  1 
ATOM   6147 C C   . THR G 2 53  ? -2.025  21.541  75.859  1.00 69.11  ? 55  THR F C   1 
ATOM   6148 O O   . THR G 2 53  ? -1.229  22.478  75.892  1.00 73.97  ? 55  THR F O   1 
ATOM   6149 C CB  . THR G 2 53  ? -1.149  20.082  74.035  1.00 68.47  ? 55  THR F CB  1 
ATOM   6150 O OG1 . THR G 2 53  ? -1.519  19.289  72.898  1.00 71.58  ? 55  THR F OG1 1 
ATOM   6151 C CG2 . THR G 2 53  ? -0.621  19.168  75.128  1.00 67.76  ? 55  THR F CG2 1 
ATOM   6152 N N   . GLU G 2 54  ? -2.632  21.072  76.942  1.00 64.92  ? 56  GLU F N   1 
ATOM   6153 C CA  . GLU G 2 54  ? -2.390  21.643  78.259  1.00 67.26  ? 56  GLU F CA  1 
ATOM   6154 C C   . GLU G 2 54  ? -2.009  20.543  79.247  1.00 66.56  ? 56  GLU F C   1 
ATOM   6155 O O   . GLU G 2 54  ? -2.604  19.467  79.249  1.00 70.76  ? 56  GLU F O   1 
ATOM   6156 C CB  . GLU G 2 54  ? -3.646  22.371  78.767  1.00 70.69  ? 56  GLU F CB  1 
ATOM   6157 C CG  . GLU G 2 54  ? -4.175  23.498  77.867  1.00 74.99  ? 56  GLU F CG  1 
ATOM   6158 C CD  . GLU G 2 54  ? -3.232  24.687  77.768  1.00 77.56  ? 56  GLU F CD  1 
ATOM   6159 O OE1 . GLU G 2 54  ? -2.758  25.163  78.821  1.00 81.56  ? 56  GLU F OE1 1 
ATOM   6160 O OE2 . GLU G 2 54  ? -2.971  25.154  76.639  1.00 78.07  ? 56  GLU F OE2 1 
ATOM   6161 N N   . LYS G 2 55  ? -1.017  20.817  80.086  1.00 61.61  ? 57  LYS F N   1 
ATOM   6162 C CA  . LYS G 2 55  ? -0.576  19.845  81.073  1.00 59.57  ? 57  LYS F CA  1 
ATOM   6163 C C   . LYS G 2 55  ? -1.658  19.604  82.118  1.00 59.72  ? 57  LYS F C   1 
ATOM   6164 O O   . LYS G 2 55  ? -2.415  20.510  82.465  1.00 55.47  ? 57  LYS F O   1 
ATOM   6165 C CB  . LYS G 2 55  ? 0.695   20.331  81.772  1.00 60.13  ? 57  LYS F CB  1 
ATOM   6166 C CG  . LYS G 2 55  ? 1.908   20.459  80.867  1.00 62.68  ? 57  LYS F CG  1 
ATOM   6167 C CD  . LYS G 2 55  ? 3.152   20.775  81.690  1.00 64.95  ? 57  LYS F CD  1 
ATOM   6168 C CE  . LYS G 2 55  ? 4.423   20.667  80.861  1.00 66.60  ? 57  LYS F CE  1 
ATOM   6169 N NZ  . LYS G 2 55  ? 5.648   20.834  81.693  1.00 69.72  ? 57  LYS F NZ  1 
ATOM   6170 N N   . GLY G 2 56  ? -1.730  18.372  82.609  1.00 56.83  ? 58  GLY F N   1 
ATOM   6171 C CA  . GLY G 2 56  ? -2.702  18.032  83.628  1.00 60.15  ? 58  GLY F CA  1 
ATOM   6172 C C   . GLY G 2 56  ? -1.972  17.977  84.954  1.00 66.17  ? 58  GLY F C   1 
ATOM   6173 O O   . GLY G 2 56  ? -1.383  18.967  85.380  1.00 73.44  ? 58  GLY F O   1 
ATOM   6174 N N   . ASP G 2 57  ? -1.987  16.824  85.609  1.00 70.55  ? 59  ASP F N   1 
ATOM   6175 C CA  . ASP G 2 57  ? -1.294  16.696  86.883  1.00 74.61  ? 59  ASP F CA  1 
ATOM   6176 C C   . ASP G 2 57  ? 0.031   15.949  86.747  1.00 74.63  ? 59  ASP F C   1 
ATOM   6177 O O   . ASP G 2 57  ? 1.036   16.365  87.311  1.00 79.91  ? 59  ASP F O   1 
ATOM   6178 C CB  . ASP G 2 57  ? -2.194  15.998  87.900  1.00 75.22  ? 59  ASP F CB  1 
ATOM   6179 C CG  . ASP G 2 57  ? -3.514  16.719  88.093  1.00 79.39  ? 59  ASP F CG  1 
ATOM   6180 O OD1 . ASP G 2 57  ? -3.493  17.912  88.457  1.00 80.72  ? 59  ASP F OD1 1 
ATOM   6181 O OD2 . ASP G 2 57  ? -4.575  16.097  87.878  1.00 85.35  ? 59  ASP F OD2 1 
ATOM   6182 N N   . ILE G 2 58  ? 0.043   14.862  85.983  1.00 72.09  ? 60  ILE F N   1 
ATOM   6183 C CA  . ILE G 2 58  ? 1.262   14.085  85.813  1.00 69.73  ? 60  ILE F CA  1 
ATOM   6184 C C   . ILE G 2 58  ? 1.704   14.042  84.358  1.00 69.69  ? 60  ILE F C   1 
ATOM   6185 O O   . ILE G 2 58  ? 1.887   12.968  83.790  1.00 72.22  ? 60  ILE F O   1 
ATOM   6186 C CB  . ILE G 2 58  ? 1.057   12.639  86.294  1.00 74.80  ? 60  ILE F CB  1 
ATOM   6187 C CG1 . ILE G 2 58  ? 0.303   12.637  87.626  1.00 75.77  ? 60  ILE F CG1 1 
ATOM   6188 C CG2 . ILE G 2 58  ? 2.390   11.944  86.447  1.00 80.51  ? 60  ILE F CG2 1 
ATOM   6189 C CD1 . ILE G 2 58  ? 0.957   13.458  88.720  1.00 70.47  ? 60  ILE F CD1 1 
ATOM   6190 N N   . PRO G 2 59  ? 1.890   15.212  83.735  1.00 66.71  ? 61  PRO F N   1 
ATOM   6191 C CA  . PRO G 2 59  ? 2.311   15.254  82.332  1.00 69.05  ? 61  PRO F CA  1 
ATOM   6192 C C   . PRO G 2 59  ? 3.756   14.811  82.125  1.00 70.60  ? 61  PRO F C   1 
ATOM   6193 O O   . PRO G 2 59  ? 4.217   14.686  80.989  1.00 69.04  ? 61  PRO F O   1 
ATOM   6194 C CB  . PRO G 2 59  ? 2.110   16.717  81.966  1.00 67.35  ? 61  PRO F CB  1 
ATOM   6195 C CG  . PRO G 2 59  ? 2.494   17.407  83.241  1.00 67.25  ? 61  PRO F CG  1 
ATOM   6196 C CD  . PRO G 2 59  ? 1.771   16.572  84.285  1.00 66.80  ? 61  PRO F CD  1 
ATOM   6197 N N   . ASP G 2 60  ? 4.459   14.574  83.229  1.00 74.58  ? 62  ASP F N   1 
ATOM   6198 C CA  . ASP G 2 60  ? 5.865   14.168  83.190  1.00 77.01  ? 62  ASP F CA  1 
ATOM   6199 C C   . ASP G 2 60  ? 6.114   12.845  82.473  1.00 74.09  ? 62  ASP F C   1 
ATOM   6200 O O   . ASP G 2 60  ? 5.524   11.817  82.813  1.00 69.89  ? 62  ASP F O   1 
ATOM   6201 C CB  . ASP G 2 60  ? 6.416   14.082  84.611  1.00 78.50  ? 62  ASP F CB  1 
ATOM   6202 C CG  . ASP G 2 60  ? 6.037   15.280  85.447  1.00 86.16  ? 62  ASP F CG  1 
ATOM   6203 O OD1 . ASP G 2 60  ? 4.821   15.464  85.686  1.00 84.28  ? 62  ASP F OD1 1 
ATOM   6204 O OD2 . ASP G 2 60  ? 6.946   16.036  85.858  1.00 85.72  ? 62  ASP F OD2 1 
ATOM   6205 N N   . GLY G 2 61  ? 7.001   12.885  81.483  1.00 73.00  ? 63  GLY F N   1 
ATOM   6206 C CA  . GLY G 2 61  ? 7.337   11.690  80.733  1.00 75.59  ? 63  GLY F CA  1 
ATOM   6207 C C   . GLY G 2 61  ? 6.519   11.532  79.473  1.00 77.18  ? 63  GLY F C   1 
ATOM   6208 O O   . GLY G 2 61  ? 6.821   10.692  78.625  1.00 73.17  ? 63  GLY F O   1 
ATOM   6209 N N   . TYR G 2 62  ? 5.476   12.342  79.344  1.00 78.36  ? 65  TYR F N   1 
ATOM   6210 C CA  . TYR G 2 62  ? 4.622   12.266  78.173  1.00 77.79  ? 65  TYR F CA  1 
ATOM   6211 C C   . TYR G 2 62  ? 4.512   13.586  77.433  1.00 78.12  ? 65  TYR F C   1 
ATOM   6212 O O   . TYR G 2 62  ? 5.042   14.618  77.847  1.00 78.70  ? 65  TYR F O   1 
ATOM   6213 C CB  . TYR G 2 62  ? 3.208   11.834  78.557  1.00 75.56  ? 65  TYR F CB  1 
ATOM   6214 C CG  . TYR G 2 62  ? 3.118   10.727  79.575  1.00 74.22  ? 65  TYR F CG  1 
ATOM   6215 C CD1 . TYR G 2 62  ? 3.284   10.987  80.939  1.00 70.31  ? 65  TYR F CD1 1 
ATOM   6216 C CD2 . TYR G 2 62  ? 2.812   9.424   79.181  1.00 70.27  ? 65  TYR F CD2 1 
ATOM   6217 C CE1 . TYR G 2 62  ? 3.138   9.974   81.886  1.00 69.24  ? 65  TYR F CE1 1 
ATOM   6218 C CE2 . TYR G 2 62  ? 2.666   8.405   80.115  1.00 69.06  ? 65  TYR F CE2 1 
ATOM   6219 C CZ  . TYR G 2 62  ? 2.825   8.684   81.462  1.00 71.07  ? 65  TYR F CZ  1 
ATOM   6220 O OH  . TYR G 2 62  ? 2.655   7.674   82.377  1.00 66.28  ? 65  TYR F OH  1 
ATOM   6221 N N   . LYS G 2 63  ? 3.795   13.523  76.323  1.00 77.38  ? 66  LYS F N   1 
ATOM   6222 C CA  . LYS G 2 63  ? 3.526   14.671  75.486  1.00 81.15  ? 66  LYS F CA  1 
ATOM   6223 C C   . LYS G 2 63  ? 2.260   14.282  74.754  1.00 78.24  ? 66  LYS F C   1 
ATOM   6224 O O   . LYS G 2 63  ? 1.936   13.100  74.665  1.00 79.53  ? 66  LYS F O   1 
ATOM   6225 C CB  . LYS G 2 63  ? 4.660   14.912  74.488  1.00 84.62  ? 66  LYS F CB  1 
ATOM   6226 C CG  . LYS G 2 63  ? 5.960   15.406  75.111  1.00 92.04  ? 66  LYS F CG  1 
ATOM   6227 C CD  . LYS G 2 63  ? 6.882   16.010  74.054  1.00 98.78  ? 66  LYS F CD  1 
ATOM   6228 C CE  . LYS G 2 63  ? 7.159   15.034  72.910  1.00 101.31 ? 66  LYS F CE  1 
ATOM   6229 N NZ  . LYS G 2 63  ? 7.928   15.670  71.800  1.00 100.06 ? 66  LYS F NZ  1 
ATOM   6230 N N   . ALA G 2 64  ? 1.533   15.265  74.244  1.00 74.52  ? 67  ALA F N   1 
ATOM   6231 C CA  . ALA G 2 64  ? 0.307   14.972  73.526  1.00 67.60  ? 67  ALA F CA  1 
ATOM   6232 C C   . ALA G 2 64  ? 0.247   15.725  72.207  1.00 68.40  ? 67  ALA F C   1 
ATOM   6233 O O   . ALA G 2 64  ? 0.906   16.751  72.025  1.00 66.09  ? 67  ALA F O   1 
ATOM   6234 C CB  . ALA G 2 64  ? -0.890  15.315  74.385  1.00 64.60  ? 67  ALA F CB  1 
ATOM   6235 N N   . SER G 2 65  ? -0.539  15.192  71.282  1.00 70.77  ? 68  SER F N   1 
ATOM   6236 C CA  . SER G 2 65  ? -0.710  15.799  69.974  1.00 72.91  ? 68  SER F CA  1 
ATOM   6237 C C   . SER G 2 65  ? -2.183  15.697  69.612  1.00 77.28  ? 68  SER F C   1 
ATOM   6238 O O   . SER G 2 65  ? -2.747  14.604  69.608  1.00 80.97  ? 68  SER F O   1 
ATOM   6239 C CB  . SER G 2 65  ? 0.138   15.060  68.940  1.00 72.80  ? 68  SER F CB  1 
ATOM   6240 O OG  . SER G 2 65  ? -0.054  15.594  67.643  1.00 70.51  ? 68  SER F OG  1 
ATOM   6241 N N   . ARG G 2 66  ? -2.806  16.839  69.327  1.00 78.53  ? 69  ARG F N   1 
ATOM   6242 C CA  . ARG G 2 66  ? -4.224  16.885  68.965  1.00 75.28  ? 69  ARG F CA  1 
ATOM   6243 C C   . ARG G 2 66  ? -4.319  17.548  67.591  1.00 73.66  ? 69  ARG F C   1 
ATOM   6244 O O   . ARG G 2 66  ? -4.821  18.667  67.458  1.00 73.50  ? 69  ARG F O   1 
ATOM   6245 C CB  . ARG G 2 66  ? -4.997  17.690  70.019  1.00 70.70  ? 69  ARG F CB  1 
ATOM   6246 C CG  . ARG G 2 66  ? -6.434  17.236  70.259  1.00 69.83  ? 69  ARG F CG  1 
ATOM   6247 C CD  . ARG G 2 66  ? -7.400  17.878  69.281  1.00 69.95  ? 69  ARG F CD  1 
ATOM   6248 N NE  . ARG G 2 66  ? -8.808  17.613  69.593  1.00 69.14  ? 69  ARG F NE  1 
ATOM   6249 C CZ  . ARG G 2 66  ? -9.417  17.945  70.731  1.00 61.75  ? 69  ARG F CZ  1 
ATOM   6250 N NH1 . ARG G 2 66  ? -8.754  18.564  71.696  1.00 58.30  ? 69  ARG F NH1 1 
ATOM   6251 N NH2 . ARG G 2 66  ? -10.699 17.657  70.905  1.00 58.70  ? 69  ARG F NH2 1 
ATOM   6252 N N   . PRO G 2 67  ? -3.840  16.847  66.547  1.00 71.26  ? 70  PRO F N   1 
ATOM   6253 C CA  . PRO G 2 67  ? -3.809  17.273  65.144  1.00 68.78  ? 70  PRO F CA  1 
ATOM   6254 C C   . PRO G 2 67  ? -5.159  17.562  64.504  1.00 68.33  ? 70  PRO F C   1 
ATOM   6255 O O   . PRO G 2 67  ? -5.220  18.170  63.430  1.00 67.14  ? 70  PRO F O   1 
ATOM   6256 C CB  . PRO G 2 67  ? -3.099  16.116  64.459  1.00 72.52  ? 70  PRO F CB  1 
ATOM   6257 C CG  . PRO G 2 67  ? -3.601  14.943  65.238  1.00 65.36  ? 70  PRO F CG  1 
ATOM   6258 C CD  . PRO G 2 67  ? -3.452  15.429  66.656  1.00 68.39  ? 70  PRO F CD  1 
ATOM   6259 N N   . SER G 2 68  ? -6.234  17.119  65.151  1.00 66.40  ? 71  SER F N   1 
ATOM   6260 C CA  . SER G 2 68  ? -7.577  17.339  64.622  1.00 66.47  ? 71  SER F CA  1 
ATOM   6261 C C   . SER G 2 68  ? -8.658  17.155  65.675  1.00 63.69  ? 71  SER F C   1 
ATOM   6262 O O   . SER G 2 68  ? -8.407  16.634  66.755  1.00 62.51  ? 71  SER F O   1 
ATOM   6263 C CB  . SER G 2 68  ? -7.845  16.399  63.435  1.00 72.69  ? 71  SER F CB  1 
ATOM   6264 O OG  . SER G 2 68  ? -7.772  15.033  63.813  1.00 72.51  ? 71  SER F OG  1 
ATOM   6265 N N   . GLN G 2 69  ? -9.867  17.587  65.339  1.00 66.12  ? 72  GLN F N   1 
ATOM   6266 C CA  . GLN G 2 69  ? -11.008 17.498  66.236  1.00 71.48  ? 72  GLN F CA  1 
ATOM   6267 C C   . GLN G 2 69  ? -11.174 16.158  66.939  1.00 72.66  ? 72  GLN F C   1 
ATOM   6268 O O   . GLN G 2 69  ? -11.395 16.118  68.149  1.00 72.36  ? 72  GLN F O   1 
ATOM   6269 C CB  . GLN G 2 69  ? -12.296 17.821  65.472  1.00 73.60  ? 72  GLN F CB  1 
ATOM   6270 C CG  . GLN G 2 69  ? -12.934 19.152  65.835  1.00 82.05  ? 72  GLN F CG  1 
ATOM   6271 C CD  . GLN G 2 69  ? -13.403 19.209  67.281  1.00 85.60  ? 72  GLN F CD  1 
ATOM   6272 O OE1 . GLN G 2 69  ? -14.266 18.433  67.700  1.00 75.67  ? 72  GLN F OE1 1 
ATOM   6273 N NE2 . GLN G 2 69  ? -12.835 20.136  68.050  1.00 84.81  ? 72  GLN F NE2 1 
ATOM   6274 N N   . GLU G 2 70  ? -11.067 15.062  66.191  1.00 74.17  ? 73  GLU F N   1 
ATOM   6275 C CA  . GLU G 2 70  ? -11.258 13.734  66.778  1.00 78.50  ? 73  GLU F CA  1 
ATOM   6276 C C   . GLU G 2 70  ? -10.014 12.874  67.020  1.00 76.27  ? 73  GLU F C   1 
ATOM   6277 O O   . GLU G 2 70  ? -10.135 11.699  67.361  1.00 77.38  ? 73  GLU F O   1 
ATOM   6278 C CB  . GLU G 2 70  ? -12.273 12.937  65.942  1.00 79.61  ? 73  GLU F CB  1 
ATOM   6279 C CG  . GLU G 2 70  ? -11.850 12.641  64.512  1.00 86.48  ? 73  GLU F CG  1 
ATOM   6280 C CD  . GLU G 2 70  ? -11.508 13.895  63.733  1.00 94.28  ? 73  GLU F CD  1 
ATOM   6281 O OE1 . GLU G 2 70  ? -12.344 14.824  63.697  1.00 94.00  ? 73  GLU F OE1 1 
ATOM   6282 O OE2 . GLU G 2 70  ? -10.402 13.953  63.154  1.00 97.93  ? 73  GLU F OE2 1 
ATOM   6283 N N   . ASN G 2 71  ? -8.826  13.451  66.862  1.00 75.16  ? 74  ASN F N   1 
ATOM   6284 C CA  . ASN G 2 71  ? -7.585  12.704  67.078  1.00 76.64  ? 74  ASN F CA  1 
ATOM   6285 C C   . ASN G 2 71  ? -6.722  13.289  68.197  1.00 75.87  ? 74  ASN F C   1 
ATOM   6286 O O   . ASN G 2 71  ? -6.243  14.426  68.109  1.00 73.58  ? 74  ASN F O   1 
ATOM   6287 C CB  . ASN G 2 71  ? -6.771  12.650  65.784  1.00 76.98  ? 74  ASN F CB  1 
ATOM   6288 C CG  . ASN G 2 71  ? -7.445  11.831  64.703  1.00 77.32  ? 74  ASN F CG  1 
ATOM   6289 O OD1 . ASN G 2 71  ? -7.137  11.979  63.520  1.00 77.20  ? 74  ASN F OD1 1 
ATOM   6290 N ND2 . ASN G 2 71  ? -8.361  10.952  65.105  1.00 70.80  ? 74  ASN F ND2 1 
ATOM   6291 N N   . PHE G 2 72  ? -6.518  12.502  69.247  1.00 72.62  ? 75  PHE F N   1 
ATOM   6292 C CA  . PHE G 2 72  ? -5.712  12.941  70.376  1.00 67.92  ? 75  PHE F CA  1 
ATOM   6293 C C   . PHE G 2 72  ? -4.822  11.798  70.862  1.00 69.24  ? 75  PHE F C   1 
ATOM   6294 O O   . PHE G 2 72  ? -5.269  10.912  71.595  1.00 68.53  ? 75  PHE F O   1 
ATOM   6295 C CB  . PHE G 2 72  ? -6.628  13.421  71.497  1.00 65.02  ? 75  PHE F CB  1 
ATOM   6296 C CG  . PHE G 2 72  ? -5.909  14.105  72.617  1.00 64.26  ? 75  PHE F CG  1 
ATOM   6297 C CD1 . PHE G 2 72  ? -4.823  14.937  72.359  1.00 61.86  ? 75  PHE F CD1 1 
ATOM   6298 C CD2 . PHE G 2 72  ? -6.351  13.963  73.929  1.00 62.27  ? 75  PHE F CD2 1 
ATOM   6299 C CE1 . PHE G 2 72  ? -4.189  15.619  73.394  1.00 63.85  ? 75  PHE F CE1 1 
ATOM   6300 C CE2 . PHE G 2 72  ? -5.724  14.643  74.972  1.00 62.13  ? 75  PHE F CE2 1 
ATOM   6301 C CZ  . PHE G 2 72  ? -4.643  15.472  74.705  1.00 54.13  ? 75  PHE F CZ  1 
ATOM   6302 N N   . SER G 2 73  ? -3.558  11.830  70.453  1.00 65.70  ? 76  SER F N   1 
ATOM   6303 C CA  . SER G 2 73  ? -2.613  10.788  70.822  1.00 70.86  ? 76  SER F CA  1 
ATOM   6304 C C   . SER G 2 73  ? -1.708  11.138  71.994  1.00 73.01  ? 76  SER F C   1 
ATOM   6305 O O   . SER G 2 73  ? -1.445  12.305  72.279  1.00 73.35  ? 76  SER F O   1 
ATOM   6306 C CB  . SER G 2 73  ? -1.739  10.425  69.621  1.00 76.85  ? 76  SER F CB  1 
ATOM   6307 O OG  . SER G 2 73  ? -0.850  11.484  69.303  1.00 75.23  ? 76  SER F OG  1 
ATOM   6308 N N   . LEU G 2 74  ? -1.233  10.094  72.663  1.00 73.18  ? 77  LEU F N   1 
ATOM   6309 C CA  . LEU G 2 74  ? -0.334  10.225  73.799  1.00 73.00  ? 77  LEU F CA  1 
ATOM   6310 C C   . LEU G 2 74  ? 0.946   9.485   73.412  1.00 76.04  ? 77  LEU F C   1 
ATOM   6311 O O   . LEU G 2 74  ? 0.902   8.311   73.039  1.00 77.39  ? 77  LEU F O   1 
ATOM   6312 C CB  . LEU G 2 74  ? -0.962  9.591   75.042  1.00 61.55  ? 77  LEU F CB  1 
ATOM   6313 C CG  . LEU G 2 74  ? -0.265  9.882   76.369  1.00 60.41  ? 77  LEU F CG  1 
ATOM   6314 C CD1 . LEU G 2 74  ? -0.124  11.390  76.565  1.00 57.38  ? 77  LEU F CD1 1 
ATOM   6315 C CD2 . LEU G 2 74  ? -1.073  9.278   77.498  1.00 60.23  ? 77  LEU F CD2 1 
ATOM   6316 N N   . THR G 2 75  ? 2.081   10.173  73.493  1.00 76.29  ? 78  THR F N   1 
ATOM   6317 C CA  . THR G 2 75  ? 3.356   9.578   73.120  1.00 74.21  ? 78  THR F CA  1 
ATOM   6318 C C   . THR G 2 75  ? 4.407   9.574   74.224  1.00 76.83  ? 78  THR F C   1 
ATOM   6319 O O   . THR G 2 75  ? 4.741   10.617  74.786  1.00 74.04  ? 78  THR F O   1 
ATOM   6320 C CB  . THR G 2 75  ? 3.941   10.302  71.912  1.00 74.95  ? 78  THR F CB  1 
ATOM   6321 O OG1 . THR G 2 75  ? 2.974   10.314  70.856  1.00 74.79  ? 78  THR F OG1 1 
ATOM   6322 C CG2 . THR G 2 75  ? 5.205   9.605   71.438  1.00 77.86  ? 78  THR F CG2 1 
ATOM   6323 N N   . LEU G 2 76  ? 4.926   8.386   74.523  1.00 80.25  ? 79  LEU F N   1 
ATOM   6324 C CA  . LEU G 2 76  ? 5.960   8.211   75.540  1.00 83.57  ? 79  LEU F CA  1 
ATOM   6325 C C   . LEU G 2 76  ? 7.262   7.973   74.789  1.00 86.67  ? 79  LEU F C   1 
ATOM   6326 O O   . LEU G 2 76  ? 7.468   6.907   74.217  1.00 91.59  ? 79  LEU F O   1 
ATOM   6327 C CB  . LEU G 2 76  ? 5.646   7.005   76.430  1.00 78.33  ? 79  LEU F CB  1 
ATOM   6328 C CG  . LEU G 2 76  ? 4.319   7.029   77.193  1.00 75.54  ? 79  LEU F CG  1 
ATOM   6329 C CD1 . LEU G 2 76  ? 3.161   6.854   76.225  1.00 66.67  ? 79  LEU F CD1 1 
ATOM   6330 C CD2 . LEU G 2 76  ? 4.314   5.919   78.232  1.00 74.97  ? 79  LEU F CD2 1 
ATOM   6331 N N   . GLU G 2 77  ? 8.139   8.969   74.793  1.00 91.34  ? 80  GLU F N   1 
ATOM   6332 C CA  . GLU G 2 77  ? 9.404   8.884   74.072  1.00 95.11  ? 80  GLU F CA  1 
ATOM   6333 C C   . GLU G 2 77  ? 10.423  7.894   74.624  1.00 92.70  ? 80  GLU F C   1 
ATOM   6334 O O   . GLU G 2 77  ? 11.352  7.504   73.923  1.00 90.88  ? 80  GLU F O   1 
ATOM   6335 C CB  . GLU G 2 77  ? 10.021  10.275  73.988  1.00 98.76  ? 80  GLU F CB  1 
ATOM   6336 C CG  . GLU G 2 77  ? 9.028   11.314  73.508  1.00 107.78 ? 80  GLU F CG  1 
ATOM   6337 C CD  . GLU G 2 77  ? 9.515   12.060  72.293  1.00 114.72 ? 80  GLU F CD  1 
ATOM   6338 O OE1 . GLU G 2 77  ? 10.541  12.764  72.406  1.00 120.02 ? 80  GLU F OE1 1 
ATOM   6339 O OE2 . GLU G 2 77  ? 8.876   11.940  71.225  1.00 119.24 ? 80  GLU F OE2 1 
ATOM   6340 N N   . SER G 2 78  ? 10.253  7.491   75.877  1.00 93.48  ? 81  SER F N   1 
ATOM   6341 C CA  . SER G 2 78  ? 11.168  6.539   76.495  1.00 91.51  ? 81  SER F CA  1 
ATOM   6342 C C   . SER G 2 78  ? 10.449  5.772   77.595  1.00 88.49  ? 81  SER F C   1 
ATOM   6343 O O   . SER G 2 78  ? 10.634  6.047   78.783  1.00 86.45  ? 81  SER F O   1 
ATOM   6344 C CB  . SER G 2 78  ? 12.382  7.269   77.075  1.00 96.35  ? 81  SER F CB  1 
ATOM   6345 O OG  . SER G 2 78  ? 13.314  6.353   77.628  1.00 101.00 ? 81  SER F OG  1 
ATOM   6346 N N   . ALA G 2 79  ? 9.626   4.810   77.185  1.00 84.52  ? 82  ALA F N   1 
ATOM   6347 C CA  . ALA G 2 79  ? 8.857   3.995   78.114  1.00 81.08  ? 82  ALA F CA  1 
ATOM   6348 C C   . ALA G 2 79  ? 9.664   3.680   79.366  1.00 80.74  ? 82  ALA F C   1 
ATOM   6349 O O   . ALA G 2 79  ? 10.857  3.407   79.290  1.00 82.57  ? 82  ALA F O   1 
ATOM   6350 C CB  . ALA G 2 79  ? 8.418   2.709   77.430  1.00 78.20  ? 82  ALA F CB  1 
ATOM   6351 N N   . THR G 2 80  ? 9.005   3.732   80.517  1.00 84.42  ? 83  THR F N   1 
ATOM   6352 C CA  . THR G 2 80  ? 9.650   3.458   81.799  1.00 85.50  ? 83  THR F CA  1 
ATOM   6353 C C   . THR G 2 80  ? 8.771   2.543   82.644  1.00 89.20  ? 83  THR F C   1 
ATOM   6354 O O   . THR G 2 80  ? 7.545   2.592   82.561  1.00 90.29  ? 83  THR F O   1 
ATOM   6355 C CB  . THR G 2 80  ? 9.914   4.771   82.582  1.00 84.71  ? 83  THR F CB  1 
ATOM   6356 O OG1 . THR G 2 80  ? 10.905  5.540   81.890  1.00 88.88  ? 83  THR F OG1 1 
ATOM   6357 C CG2 . THR G 2 80  ? 10.398  4.484   84.004  1.00 73.00  ? 83  THR F CG2 1 
ATOM   6358 N N   . PRO G 2 81  ? 9.394   1.685   83.463  1.00 92.06  ? 84  PRO F N   1 
ATOM   6359 C CA  . PRO G 2 81  ? 8.669   0.754   84.327  1.00 92.56  ? 84  PRO F CA  1 
ATOM   6360 C C   . PRO G 2 81  ? 7.539   1.385   85.139  1.00 90.22  ? 84  PRO F C   1 
ATOM   6361 O O   . PRO G 2 81  ? 6.541   0.726   85.432  1.00 89.05  ? 84  PRO F O   1 
ATOM   6362 C CB  . PRO G 2 81  ? 9.774   0.183   85.202  1.00 95.77  ? 84  PRO F CB  1 
ATOM   6363 C CG  . PRO G 2 81  ? 10.918  0.102   84.240  1.00 97.34  ? 84  PRO F CG  1 
ATOM   6364 C CD  . PRO G 2 81  ? 10.847  1.441   83.540  1.00 95.24  ? 84  PRO F CD  1 
ATOM   6365 N N   . SER G 2 82  ? 7.690   2.655   85.504  1.00 87.23  ? 85  SER F N   1 
ATOM   6366 C CA  . SER G 2 82  ? 6.658   3.335   86.282  1.00 84.62  ? 85  SER F CA  1 
ATOM   6367 C C   . SER G 2 82  ? 5.489   3.780   85.403  1.00 81.98  ? 85  SER F C   1 
ATOM   6368 O O   . SER G 2 82  ? 4.382   4.007   85.896  1.00 76.84  ? 85  SER F O   1 
ATOM   6369 C CB  . SER G 2 82  ? 7.247   4.544   87.012  1.00 84.09  ? 85  SER F CB  1 
ATOM   6370 O OG  . SER G 2 82  ? 7.801   5.471   86.097  1.00 85.68  ? 85  SER F OG  1 
ATOM   6371 N N   . GLN G 2 83  ? 5.734   3.895   84.102  1.00 81.54  ? 86  GLN F N   1 
ATOM   6372 C CA  . GLN G 2 83  ? 4.689   4.303   83.172  1.00 85.66  ? 86  GLN F CA  1 
ATOM   6373 C C   . GLN G 2 83  ? 3.792   3.115   82.760  1.00 89.58  ? 86  GLN F C   1 
ATOM   6374 O O   . GLN G 2 83  ? 3.143   3.187   81.720  1.00 94.88  ? 86  GLN F O   1 
ATOM   6375 C CB  . GLN G 2 83  ? 5.312   4.920   81.906  1.00 84.33  ? 86  GLN F CB  1 
ATOM   6376 C CG  . GLN G 2 83  ? 6.241   6.098   82.146  1.00 88.19  ? 86  GLN F CG  1 
ATOM   6377 C CD  . GLN G 2 83  ? 6.658   6.779   80.852  1.00 90.72  ? 86  GLN F CD  1 
ATOM   6378 O OE1 . GLN G 2 83  ? 7.076   6.122   79.896  1.00 86.11  ? 86  GLN F OE1 1 
ATOM   6379 N NE2 . GLN G 2 83  ? 6.552   8.103   80.820  1.00 92.45  ? 86  GLN F NE2 1 
ATOM   6380 N N   . THR G 2 84  ? 3.713   2.054   83.570  1.00 88.43  ? 87  THR F N   1 
ATOM   6381 C CA  . THR G 2 84  ? 2.926   0.848   83.214  1.00 86.11  ? 87  THR F CA  1 
ATOM   6382 C C   . THR G 2 84  ? 1.540   0.667   83.837  1.00 85.86  ? 87  THR F C   1 
ATOM   6383 O O   . THR G 2 84  ? 1.423   0.137   84.943  1.00 81.64  ? 87  THR F O   1 
ATOM   6384 C CB  . THR G 2 84  ? 3.715   -0.414  83.557  1.00 87.22  ? 87  THR F CB  1 
ATOM   6385 O OG1 . THR G 2 84  ? 4.920   -0.448  82.786  1.00 86.48  ? 87  THR F OG1 1 
ATOM   6386 C CG2 . THR G 2 84  ? 2.881   -1.653  83.277  1.00 82.63  ? 87  THR F CG2 1 
ATOM   6387 N N   . SER G 2 85  ? 0.488   1.047   83.121  1.00 87.01  ? 88  SER F N   1 
ATOM   6388 C CA  . SER G 2 85  ? -0.851  0.941   83.684  1.00 87.82  ? 88  SER F CA  1 
ATOM   6389 C C   . SER G 2 85  ? -1.856  1.385   82.665  1.00 89.68  ? 88  SER F C   1 
ATOM   6390 O O   . SER G 2 85  ? -1.562  2.162   81.786  1.00 89.74  ? 88  SER F O   1 
ATOM   6391 C CB  . SER G 2 85  ? -0.990  1.859   84.883  1.00 88.05  ? 88  SER F CB  1 
ATOM   6392 O OG  . SER G 2 85  ? -1.460  3.137   84.475  1.00 78.71  ? 88  SER F OG  1 
ATOM   6393 N N   . VAL G 2 86  ? -3.077  0.939   82.814  1.00 90.42  ? 89  VAL F N   1 
ATOM   6394 C CA  . VAL G 2 86  ? -4.086  1.300   81.849  1.00 90.51  ? 89  VAL F CA  1 
ATOM   6395 C C   . VAL G 2 86  ? -4.386  2.801   81.617  1.00 87.91  ? 89  VAL F C   1 
ATOM   6396 O O   . VAL G 2 86  ? -4.721  3.541   82.544  1.00 83.98  ? 89  VAL F O   1 
ATOM   6397 C CB  . VAL G 2 86  ? -5.356  0.562   82.217  1.00 94.65  ? 89  VAL F CB  1 
ATOM   6398 C CG1 . VAL G 2 86  ? -6.331  0.598   81.070  1.00 94.11  ? 89  VAL F CG1 1 
ATOM   6399 C CG2 . VAL G 2 86  ? -5.004  -0.874  82.600  1.00 96.15  ? 89  VAL F CG2 1 
ATOM   6400 N N   . TYR G 2 87  ? -4.273  3.231   80.361  1.00 85.22  ? 90  TYR F N   1 
ATOM   6401 C CA  . TYR G 2 87  ? -4.553  4.610   79.985  1.00 81.26  ? 90  TYR F CA  1 
ATOM   6402 C C   . TYR G 2 87  ? -5.920  4.748   79.320  1.00 79.50  ? 90  TYR F C   1 
ATOM   6403 O O   . TYR G 2 87  ? -6.266  4.000   78.406  1.00 75.48  ? 90  TYR F O   1 
ATOM   6404 C CB  . TYR G 2 87  ? -3.474  5.130   79.038  1.00 83.88  ? 90  TYR F CB  1 
ATOM   6405 C CG  . TYR G 2 87  ? -2.106  5.182   79.665  1.00 85.28  ? 90  TYR F CG  1 
ATOM   6406 C CD1 . TYR G 2 87  ? -1.491  4.028   80.125  1.00 85.08  ? 90  TYR F CD1 1 
ATOM   6407 C CD2 . TYR G 2 87  ? -1.429  6.388   79.810  1.00 85.98  ? 90  TYR F CD2 1 
ATOM   6408 C CE1 . TYR G 2 87  ? -0.233  4.066   80.719  1.00 87.19  ? 90  TYR F CE1 1 
ATOM   6409 C CE2 . TYR G 2 87  ? -0.170  6.439   80.401  1.00 90.92  ? 90  TYR F CE2 1 
ATOM   6410 C CZ  . TYR G 2 87  ? 0.421   5.271   80.853  1.00 89.94  ? 90  TYR F CZ  1 
ATOM   6411 O OH  . TYR G 2 87  ? 1.669   5.308   81.431  1.00 92.81  ? 90  TYR F OH  1 
ATOM   6412 N N   . PHE G 2 88  ? -6.692  5.718   79.790  1.00 78.88  ? 91  PHE F N   1 
ATOM   6413 C CA  . PHE G 2 88  ? -8.014  5.967   79.245  1.00 77.60  ? 91  PHE F CA  1 
ATOM   6414 C C   . PHE G 2 88  ? -8.049  7.287   78.494  1.00 75.13  ? 91  PHE F C   1 
ATOM   6415 O O   . PHE G 2 88  ? -7.381  8.248   78.864  1.00 77.03  ? 91  PHE F O   1 
ATOM   6416 C CB  . PHE G 2 88  ? -9.053  5.981   80.368  1.00 75.40  ? 91  PHE F CB  1 
ATOM   6417 C CG  . PHE G 2 88  ? -9.275  4.640   81.002  1.00 77.17  ? 91  PHE F CG  1 
ATOM   6418 C CD1 . PHE G 2 88  ? -9.877  3.608   80.284  1.00 80.69  ? 91  PHE F CD1 1 
ATOM   6419 C CD2 . PHE G 2 88  ? -8.877  4.401   82.315  1.00 78.83  ? 91  PHE F CD2 1 
ATOM   6420 C CE1 . PHE G 2 88  ? -10.079 2.355   80.867  1.00 80.39  ? 91  PHE F CE1 1 
ATOM   6421 C CE2 . PHE G 2 88  ? -9.074  3.154   82.909  1.00 77.32  ? 91  PHE F CE2 1 
ATOM   6422 C CZ  . PHE G 2 88  ? -9.676  2.129   82.184  1.00 78.69  ? 91  PHE F CZ  1 
ATOM   6423 N N   . CYS G 2 89  ? -8.830  7.317   77.426  1.00 73.62  ? 92  CYS F N   1 
ATOM   6424 C CA  . CYS G 2 89  ? -8.985  8.510   76.618  1.00 68.11  ? 92  CYS F CA  1 
ATOM   6425 C C   . CYS G 2 89  ? -10.372 9.063   76.894  1.00 70.10  ? 92  CYS F C   1 
ATOM   6426 O O   . CYS G 2 89  ? -11.266 8.319   77.291  1.00 72.28  ? 92  CYS F O   1 
ATOM   6427 C CB  . CYS G 2 89  ? -8.869  8.156   75.150  1.00 63.06  ? 92  CYS F CB  1 
ATOM   6428 S SG  . CYS G 2 89  ? -9.166  9.575   74.067  1.00 69.75  ? 92  CYS F SG  1 
ATOM   6429 N N   . ALA G 2 90  ? -10.565 10.360  76.686  1.00 68.53  ? 93  ALA F N   1 
ATOM   6430 C CA  . ALA G 2 90  ? -11.877 10.944  76.937  1.00 66.53  ? 93  ALA F CA  1 
ATOM   6431 C C   . ALA G 2 90  ? -12.157 12.187  76.111  1.00 64.10  ? 93  ALA F C   1 
ATOM   6432 O O   . ALA G 2 90  ? -11.244 12.876  75.666  1.00 63.51  ? 93  ALA F O   1 
ATOM   6433 C CB  . ALA G 2 90  ? -12.030 11.263  78.425  1.00 62.53  ? 93  ALA F CB  1 
ATOM   6434 N N   . SER G 2 91  ? -13.438 12.456  75.896  1.00 65.73  ? 94  SER F N   1 
ATOM   6435 C CA  . SER G 2 91  ? -13.857 13.629  75.149  1.00 64.08  ? 94  SER F CA  1 
ATOM   6436 C C   . SER G 2 91  ? -15.036 14.234  75.897  1.00 62.13  ? 94  SER F C   1 
ATOM   6437 O O   . SER G 2 91  ? -15.752 13.526  76.608  1.00 56.98  ? 94  SER F O   1 
ATOM   6438 C CB  . SER G 2 91  ? -14.259 13.256  73.713  1.00 61.63  ? 94  SER F CB  1 
ATOM   6439 O OG  . SER G 2 91  ? -15.490 12.561  73.666  1.00 62.34  ? 94  SER F OG  1 
ATOM   6440 N N   . GLY G 2 92  ? -15.215 15.544  75.751  1.00 66.52  ? 95  GLY F N   1 
ATOM   6441 C CA  . GLY G 2 92  ? -16.304 16.238  76.417  1.00 65.59  ? 95  GLY F CA  1 
ATOM   6442 C C   . GLY G 2 92  ? -16.460 17.633  75.848  1.00 68.12  ? 95  GLY F C   1 
ATOM   6443 O O   . GLY G 2 92  ? -15.661 18.057  75.010  1.00 65.50  ? 95  GLY F O   1 
ATOM   6444 N N   . ASP G 2 93  ? -17.484 18.351  76.299  1.00 68.95  ? 96  ASP F N   1 
ATOM   6445 C CA  . ASP G 2 93  ? -17.730 19.706  75.818  1.00 72.52  ? 96  ASP F CA  1 
ATOM   6446 C C   . ASP G 2 93  ? -16.750 20.696  76.458  1.00 73.89  ? 96  ASP F C   1 
ATOM   6447 O O   . ASP G 2 93  ? -16.371 20.544  77.621  1.00 71.89  ? 96  ASP F O   1 
ATOM   6448 C CB  . ASP G 2 93  ? -19.171 20.116  76.126  1.00 73.09  ? 96  ASP F CB  1 
ATOM   6449 C CG  . ASP G 2 93  ? -19.786 20.946  75.020  1.00 74.72  ? 96  ASP F CG  1 
ATOM   6450 O OD1 . ASP G 2 93  ? -19.100 21.179  74.002  1.00 68.75  ? 96  ASP F OD1 1 
ATOM   6451 O OD2 . ASP G 2 93  ? -20.956 21.360  75.168  1.00 76.95  ? 96  ASP F OD2 1 
ATOM   6452 N N   . ALA G 2 94  ? -16.345 21.704  75.686  1.00 75.67  ? 97  ALA F N   1 
ATOM   6453 C CA  . ALA G 2 94  ? -15.394 22.722  76.140  1.00 74.74  ? 97  ALA F CA  1 
ATOM   6454 C C   . ALA G 2 94  ? -15.771 23.344  77.474  1.00 74.25  ? 97  ALA F C   1 
ATOM   6455 O O   . ALA G 2 94  ? -16.378 24.414  77.518  1.00 79.17  ? 97  ALA F O   1 
ATOM   6456 C CB  . ALA G 2 94  ? -15.262 23.811  75.088  1.00 69.49  ? 97  ALA F CB  1 
ATOM   6457 N N   . GLY G 2 95  ? -15.398 22.683  78.563  1.00 70.52  ? 98  GLY F N   1 
ATOM   6458 C CA  . GLY G 2 95  ? -15.731 23.215  79.865  1.00 72.51  ? 98  GLY F CA  1 
ATOM   6459 C C   . GLY G 2 95  ? -15.053 22.527  81.030  1.00 73.56  ? 98  GLY F C   1 
ATOM   6460 O O   . GLY G 2 95  ? -13.997 22.962  81.496  1.00 81.22  ? 98  GLY F O   1 
ATOM   6461 N N   . GLY G 2 96  ? -15.659 21.446  81.500  1.00 68.08  ? 99  GLY F N   1 
ATOM   6462 C CA  . GLY G 2 96  ? -15.119 20.730  82.639  1.00 70.07  ? 99  GLY F CA  1 
ATOM   6463 C C   . GLY G 2 96  ? -16.285 20.430  83.554  1.00 67.33  ? 99  GLY F C   1 
ATOM   6464 O O   . GLY G 2 96  ? -16.252 19.493  84.347  1.00 68.91  ? 99  GLY F O   1 
ATOM   6465 N N   . GLY G 2 97  ? -17.321 21.253  83.441  1.00 67.13  ? 100 GLY F N   1 
ATOM   6466 C CA  . GLY G 2 97  ? -18.521 21.059  84.227  1.00 64.67  ? 100 GLY F CA  1 
ATOM   6467 C C   . GLY G 2 97  ? -19.475 20.237  83.380  1.00 68.28  ? 100 GLY F C   1 
ATOM   6468 O O   . GLY G 2 97  ? -20.681 20.199  83.629  1.00 69.94  ? 100 GLY F O   1 
ATOM   6469 N N   . TYR G 2 98  ? -18.917 19.579  82.367  1.00 63.89  ? 104 TYR F N   1 
ATOM   6470 C CA  . TYR G 2 98  ? -19.685 18.743  81.455  1.00 67.61  ? 104 TYR F CA  1 
ATOM   6471 C C   . TYR G 2 98  ? -19.289 17.277  81.607  1.00 73.85  ? 104 TYR F C   1 
ATOM   6472 O O   . TYR G 2 98  ? -18.169 16.962  82.007  1.00 74.51  ? 104 TYR F O   1 
ATOM   6473 C CB  . TYR G 2 98  ? -19.433 19.161  80.009  1.00 68.65  ? 104 TYR F CB  1 
ATOM   6474 C CG  . TYR G 2 98  ? -19.781 20.595  79.690  1.00 74.45  ? 104 TYR F CG  1 
ATOM   6475 C CD1 . TYR G 2 98  ? -21.098 21.043  79.749  1.00 70.98  ? 104 TYR F CD1 1 
ATOM   6476 C CD2 . TYR G 2 98  ? -18.796 21.492  79.281  1.00 72.58  ? 104 TYR F CD2 1 
ATOM   6477 C CE1 . TYR G 2 98  ? -21.427 22.346  79.400  1.00 75.44  ? 104 TYR F CE1 1 
ATOM   6478 C CE2 . TYR G 2 98  ? -19.114 22.794  78.932  1.00 75.90  ? 104 TYR F CE2 1 
ATOM   6479 C CZ  . TYR G 2 98  ? -20.431 23.215  78.990  1.00 75.25  ? 104 TYR F CZ  1 
ATOM   6480 O OH  . TYR G 2 98  ? -20.749 24.500  78.620  1.00 78.61  ? 104 TYR F OH  1 
ATOM   6481 N N   . GLU G 2 99  ? -20.213 16.385  81.270  1.00 76.05  ? 105 GLU F N   1 
ATOM   6482 C CA  . GLU G 2 99  ? -19.970 14.953  81.351  1.00 75.29  ? 105 GLU F CA  1 
ATOM   6483 C C   . GLU G 2 99  ? -18.861 14.529  80.393  1.00 73.33  ? 105 GLU F C   1 
ATOM   6484 O O   . GLU G 2 99  ? -18.790 15.000  79.256  1.00 70.61  ? 105 GLU F O   1 
ATOM   6485 C CB  . GLU G 2 99  ? -21.262 14.194  81.028  1.00 80.12  ? 105 GLU F CB  1 
ATOM   6486 C CG  . GLU G 2 99  ? -21.046 12.843  80.364  1.00 88.81  ? 105 GLU F CG  1 
ATOM   6487 C CD  . GLU G 2 99  ? -22.342 12.094  80.111  1.00 94.15  ? 105 GLU F CD  1 
ATOM   6488 O OE1 . GLU G 2 99  ? -23.302 12.712  79.601  1.00 96.51  ? 105 GLU F OE1 1 
ATOM   6489 O OE2 . GLU G 2 99  ? -22.396 10.882  80.413  1.00 96.39  ? 105 GLU F OE2 1 
ATOM   6490 N N   . GLN G 2 100 ? -17.989 13.640  80.854  1.00 73.13  ? 106 GLN F N   1 
ATOM   6491 C CA  . GLN G 2 100 ? -16.907 13.160  80.008  1.00 74.24  ? 106 GLN F CA  1 
ATOM   6492 C C   . GLN G 2 100 ? -17.151 11.727  79.550  1.00 73.19  ? 106 GLN F C   1 
ATOM   6493 O O   . GLN G 2 100 ? -17.645 10.887  80.307  1.00 68.31  ? 106 GLN F O   1 
ATOM   6494 C CB  . GLN G 2 100 ? -15.561 13.275  80.735  1.00 77.75  ? 106 GLN F CB  1 
ATOM   6495 C CG  . GLN G 2 100 ? -15.038 14.709  80.802  1.00 84.34  ? 106 GLN F CG  1 
ATOM   6496 C CD  . GLN G 2 100 ? -13.614 14.807  81.320  1.00 86.33  ? 106 GLN F CD  1 
ATOM   6497 O OE1 . GLN G 2 100 ? -12.730 14.069  80.882  1.00 85.72  ? 106 GLN F OE1 1 
ATOM   6498 N NE2 . GLN G 2 100 ? -13.381 15.735  82.245  1.00 86.52  ? 106 GLN F NE2 1 
ATOM   6499 N N   . TYR G 2 101 ? -16.810 11.467  78.293  1.00 71.37  ? 107 TYR F N   1 
ATOM   6500 C CA  . TYR G 2 101 ? -16.989 10.155  77.693  1.00 69.45  ? 107 TYR F CA  1 
ATOM   6501 C C   . TYR G 2 101 ? -15.659 9.445   77.522  1.00 72.29  ? 107 TYR F C   1 
ATOM   6502 O O   . TYR G 2 101 ? -14.840 9.823   76.683  1.00 67.21  ? 107 TYR F O   1 
ATOM   6503 C CB  . TYR G 2 101 ? -17.692 10.311  76.351  1.00 66.68  ? 107 TYR F CB  1 
ATOM   6504 C CG  . TYR G 2 101 ? -19.075 10.882  76.517  1.00 74.36  ? 107 TYR F CG  1 
ATOM   6505 C CD1 . TYR G 2 101 ? -20.072 10.152  77.164  1.00 76.64  ? 107 TYR F CD1 1 
ATOM   6506 C CD2 . TYR G 2 101 ? -19.382 12.167  76.071  1.00 80.31  ? 107 TYR F CD2 1 
ATOM   6507 C CE1 . TYR G 2 101 ? -21.343 10.686  77.365  1.00 75.77  ? 107 TYR F CE1 1 
ATOM   6508 C CE2 . TYR G 2 101 ? -20.653 12.713  76.268  1.00 77.04  ? 107 TYR F CE2 1 
ATOM   6509 C CZ  . TYR G 2 101 ? -21.627 11.964  76.915  1.00 76.95  ? 107 TYR F CZ  1 
ATOM   6510 O OH  . TYR G 2 101 ? -22.885 12.483  77.110  1.00 76.38  ? 107 TYR F OH  1 
ATOM   6511 N N   . PHE G 2 102 ? -15.460 8.408   78.330  1.00 73.05  ? 108 PHE F N   1 
ATOM   6512 C CA  . PHE G 2 102 ? -14.229 7.628   78.316  1.00 76.18  ? 108 PHE F CA  1 
ATOM   6513 C C   . PHE G 2 102 ? -14.148 6.562   77.227  1.00 76.52  ? 108 PHE F C   1 
ATOM   6514 O O   . PHE G 2 102 ? -15.162 6.111   76.704  1.00 76.78  ? 108 PHE F O   1 
ATOM   6515 C CB  . PHE G 2 102 ? -14.043 6.970   79.676  1.00 77.11  ? 108 PHE F CB  1 
ATOM   6516 C CG  . PHE G 2 102 ? -13.808 7.942   80.786  1.00 79.39  ? 108 PHE F CG  1 
ATOM   6517 C CD1 . PHE G 2 102 ? -12.562 8.540   80.948  1.00 76.97  ? 108 PHE F CD1 1 
ATOM   6518 C CD2 . PHE G 2 102 ? -14.831 8.262   81.673  1.00 80.72  ? 108 PHE F CD2 1 
ATOM   6519 C CE1 . PHE G 2 102 ? -12.337 9.441   81.981  1.00 80.07  ? 108 PHE F CE1 1 
ATOM   6520 C CE2 . PHE G 2 102 ? -14.617 9.165   82.711  1.00 82.07  ? 108 PHE F CE2 1 
ATOM   6521 C CZ  . PHE G 2 102 ? -13.368 9.755   82.866  1.00 81.69  ? 108 PHE F CZ  1 
ATOM   6522 N N   . GLY G 2 103 ? -12.926 6.159   76.894  1.00 78.29  ? 109 GLY F N   1 
ATOM   6523 C CA  . GLY G 2 103 ? -12.734 5.132   75.888  1.00 83.24  ? 109 GLY F CA  1 
ATOM   6524 C C   . GLY G 2 103 ? -12.677 3.759   76.538  1.00 87.96  ? 109 GLY F C   1 
ATOM   6525 O O   . GLY G 2 103 ? -12.737 3.654   77.767  1.00 91.44  ? 109 GLY F O   1 
ATOM   6526 N N   . PRO G 2 104 ? -12.556 2.681   75.747  1.00 87.62  ? 110 PRO F N   1 
ATOM   6527 C CA  . PRO G 2 104 ? -12.498 1.339   76.333  1.00 87.16  ? 110 PRO F CA  1 
ATOM   6528 C C   . PRO G 2 104 ? -11.373 1.201   77.359  1.00 89.38  ? 110 PRO F C   1 
ATOM   6529 O O   . PRO G 2 104 ? -11.605 0.808   78.504  1.00 91.19  ? 110 PRO F O   1 
ATOM   6530 C CB  . PRO G 2 104 ? -12.295 0.443   75.113  1.00 85.85  ? 110 PRO F CB  1 
ATOM   6531 C CG  . PRO G 2 104 ? -11.536 1.334   74.160  1.00 84.35  ? 110 PRO F CG  1 
ATOM   6532 C CD  . PRO G 2 104 ? -12.276 2.638   74.300  1.00 86.80  ? 110 PRO F CD  1 
ATOM   6533 N N   . GLY G 2 105 ? -10.156 1.537   76.941  1.00 87.89  ? 111 GLY F N   1 
ATOM   6534 C CA  . GLY G 2 105 ? -9.013  1.443   77.829  1.00 85.85  ? 111 GLY F CA  1 
ATOM   6535 C C   . GLY G 2 105 ? -7.786  0.994   77.064  1.00 86.02  ? 111 GLY F C   1 
ATOM   6536 O O   . GLY G 2 105 ? -7.862  0.754   75.859  1.00 86.20  ? 111 GLY F O   1 
ATOM   6537 N N   . THR G 2 106 ? -6.655  0.883   77.757  1.00 86.05  ? 112 THR F N   1 
ATOM   6538 C CA  . THR G 2 106 ? -5.402  0.452   77.136  1.00 85.24  ? 112 THR F CA  1 
ATOM   6539 C C   . THR G 2 106 ? -4.378  0.001   78.178  1.00 88.49  ? 112 THR F C   1 
ATOM   6540 O O   . THR G 2 106 ? -3.883  0.814   78.961  1.00 88.22  ? 112 THR F O   1 
ATOM   6541 C CB  . THR G 2 106 ? -4.779  1.583   76.297  1.00 80.31  ? 112 THR F CB  1 
ATOM   6542 O OG1 . THR G 2 106 ? -5.609  1.846   75.161  1.00 81.24  ? 112 THR F OG1 1 
ATOM   6543 C CG2 . THR G 2 106 ? -3.383  1.198   75.831  1.00 71.36  ? 112 THR F CG2 1 
ATOM   6544 N N   . ARG G 2 107 ? -4.061  -1.293  78.183  1.00 91.07  ? 113 ARG F N   1 
ATOM   6545 C CA  . ARG G 2 107 ? -3.093  -1.831  79.135  1.00 92.20  ? 113 ARG F CA  1 
ATOM   6546 C C   . ARG G 2 107 ? -1.707  -1.906  78.510  1.00 92.91  ? 113 ARG F C   1 
ATOM   6547 O O   . ARG G 2 107 ? -1.499  -2.573  77.494  1.00 91.71  ? 113 ARG F O   1 
ATOM   6548 C CB  . ARG G 2 107 ? -3.529  -3.215  79.627  1.00 92.32  ? 113 ARG F CB  1 
ATOM   6549 C CG  . ARG G 2 107 ? -2.554  -3.857  80.605  1.00 95.47  ? 113 ARG F CG  1 
ATOM   6550 C CD  . ARG G 2 107 ? -3.263  -4.789  81.587  1.00 98.00  ? 113 ARG F CD  1 
ATOM   6551 N NE  . ARG G 2 107 ? -4.082  -4.055  82.555  1.00 101.80 ? 113 ARG F NE  1 
ATOM   6552 C CZ  . ARG G 2 107 ? -4.752  -4.619  83.558  1.00 102.51 ? 113 ARG F CZ  1 
ATOM   6553 N NH1 . ARG G 2 107 ? -4.706  -5.932  83.732  1.00 106.52 ? 113 ARG F NH1 1 
ATOM   6554 N NH2 . ARG G 2 107 ? -5.464  -3.871  84.396  1.00 97.16  ? 113 ARG F NH2 1 
ATOM   6555 N N   . LEU G 2 108 ? -0.763  -1.207  79.131  1.00 93.50  ? 114 LEU F N   1 
ATOM   6556 C CA  . LEU G 2 108 ? 0.606   -1.164  78.646  1.00 92.94  ? 114 LEU F CA  1 
ATOM   6557 C C   . LEU G 2 108 ? 1.555   -1.696  79.705  1.00 93.77  ? 114 LEU F C   1 
ATOM   6558 O O   . LEU G 2 108 ? 1.411   -1.388  80.891  1.00 89.05  ? 114 LEU F O   1 
ATOM   6559 C CB  . LEU G 2 108 ? 0.987   0.274   78.293  1.00 94.59  ? 114 LEU F CB  1 
ATOM   6560 C CG  . LEU G 2 108 ? 2.340   0.513   77.617  1.00 96.78  ? 114 LEU F CG  1 
ATOM   6561 C CD1 . LEU G 2 108 ? 2.370   -0.180  76.261  1.00 99.38  ? 114 LEU F CD1 1 
ATOM   6562 C CD2 . LEU G 2 108 ? 2.565   2.006   77.448  1.00 95.26  ? 114 LEU F CD2 1 
ATOM   6563 N N   . THR G 2 109 ? 2.520   -2.499  79.262  1.00 97.32  ? 115 THR F N   1 
ATOM   6564 C CA  . THR G 2 109 ? 3.522   -3.088  80.146  1.00 98.89  ? 115 THR F CA  1 
ATOM   6565 C C   . THR G 2 109 ? 4.906   -2.942  79.495  1.00 99.16  ? 115 THR F C   1 
ATOM   6566 O O   . THR G 2 109 ? 5.131   -3.413  78.376  1.00 96.75  ? 115 THR F O   1 
ATOM   6567 C CB  . THR G 2 109 ? 3.216   -4.585  80.409  1.00 98.88  ? 115 THR F CB  1 
ATOM   6568 O OG1 . THR G 2 109 ? 1.887   -4.718  80.930  1.00 95.87  ? 115 THR F OG1 1 
ATOM   6569 C CG2 . THR G 2 109 ? 4.193   -5.162  81.419  1.00 101.10 ? 115 THR F CG2 1 
ATOM   6570 N N   . VAL G 2 110 ? 5.822   -2.280  80.200  1.00 99.67  ? 116 VAL F N   1 
ATOM   6571 C CA  . VAL G 2 110 ? 7.175   -2.048  79.698  1.00 102.89 ? 116 VAL F CA  1 
ATOM   6572 C C   . VAL G 2 110 ? 8.196   -3.086  80.172  1.00 104.95 ? 116 VAL F C   1 
ATOM   6573 O O   . VAL G 2 110 ? 9.106   -3.464  79.425  1.00 105.31 ? 116 VAL F O   1 
ATOM   6574 C CB  . VAL G 2 110 ? 7.678   -0.652  80.111  1.00 104.75 ? 116 VAL F CB  1 
ATOM   6575 C CG1 . VAL G 2 110 ? 6.805   0.428   79.484  1.00 104.40 ? 116 VAL F CG1 1 
ATOM   6576 C CG2 . VAL G 2 110 ? 7.664   -0.531  81.620  1.00 101.45 ? 116 VAL F CG2 1 
ATOM   6577 N N   . LEU G 2 111 ? 8.046   -3.529  81.419  1.00 104.30 ? 117 LEU F N   1 
ATOM   6578 C CA  . LEU G 2 111 ? 8.934   -4.530  82.011  1.00 102.57 ? 117 LEU F CA  1 
ATOM   6579 C C   . LEU G 2 111 ? 10.346  -3.991  82.241  1.00 102.20 ? 117 LEU F C   1 
ATOM   6580 O O   . LEU G 2 111 ? 10.739  -3.859  83.420  1.00 101.54 ? 117 LEU F O   1 
ATOM   6581 C CB  . LEU G 2 111 ? 9.001   -5.775  81.115  1.00 99.42  ? 117 LEU F CB  1 
ATOM   6582 C CG  . LEU G 2 111 ? 7.694   -6.503  80.774  1.00 97.10  ? 117 LEU F CG  1 
ATOM   6583 C CD1 . LEU G 2 111 ? 7.978   -7.610  79.766  1.00 91.94  ? 117 LEU F CD1 1 
ATOM   6584 C CD2 . LEU G 2 111 ? 7.061   -7.072  82.041  1.00 92.71  ? 117 LEU F CD2 1 
ATOM   6585 O OXT . LEU G 2 111 ? 11.040  -3.708  81.241  1.00 100.11 ? 117 LEU F OXT 1 
ATOM   6586 N N   . ILE H 3 1   ? -30.179 47.529  81.799  1.00 83.17  ? 1   ILE G N   1 
ATOM   6587 C CA  . ILE H 3 1   ? -30.633 47.249  83.191  1.00 86.41  ? 1   ILE G CA  1 
ATOM   6588 C C   . ILE H 3 1   ? -29.935 48.192  84.161  1.00 89.46  ? 1   ILE G C   1 
ATOM   6589 O O   . ILE H 3 1   ? -28.923 48.804  83.820  1.00 90.33  ? 1   ILE G O   1 
ATOM   6590 C CB  . ILE H 3 1   ? -30.316 45.788  83.615  1.00 84.03  ? 1   ILE G CB  1 
ATOM   6591 C CG1 . ILE H 3 1   ? -31.082 44.792  82.735  1.00 86.13  ? 1   ILE G CG1 1 
ATOM   6592 C CG2 . ILE H 3 1   ? -30.710 45.568  85.070  1.00 84.91  ? 1   ILE G CG2 1 
ATOM   6593 C CD1 . ILE H 3 1   ? -30.611 44.721  81.294  1.00 88.59  ? 1   ILE G CD1 1 
ATOM   6594 N N   . GLU H 3 2   ? -30.484 48.308  85.367  1.00 92.26  ? 2   GLU G N   1 
ATOM   6595 C CA  . GLU H 3 2   ? -29.914 49.167  86.399  1.00 93.52  ? 2   GLU G CA  1 
ATOM   6596 C C   . GLU H 3 2   ? -29.712 48.386  87.694  1.00 90.12  ? 2   GLU G C   1 
ATOM   6597 O O   . GLU H 3 2   ? -30.568 47.588  88.083  1.00 90.28  ? 2   GLU G O   1 
ATOM   6598 C CB  . GLU H 3 2   ? -30.832 50.368  86.649  1.00 98.97  ? 2   GLU G CB  1 
ATOM   6599 C CG  . GLU H 3 2   ? -32.271 50.007  86.999  1.00 108.20 ? 2   GLU G CG  1 
ATOM   6600 C CD  . GLU H 3 2   ? -32.619 50.305  88.446  1.00 113.88 ? 2   GLU G CD  1 
ATOM   6601 O OE1 . GLU H 3 2   ? -32.448 51.469  88.870  1.00 115.56 ? 2   GLU G OE1 1 
ATOM   6602 O OE2 . GLU H 3 2   ? -33.069 49.378  89.156  1.00 117.95 ? 2   GLU G OE2 1 
ATOM   6603 N N   . ALA H 3 3   ? -28.578 48.621  88.353  1.00 84.68  ? 3   ALA G N   1 
ATOM   6604 C CA  . ALA H 3 3   ? -28.241 47.941  89.607  1.00 79.05  ? 3   ALA G CA  1 
ATOM   6605 C C   . ALA H 3 3   ? -27.222 48.757  90.404  1.00 74.29  ? 3   ALA G C   1 
ATOM   6606 O O   . ALA H 3 3   ? -26.606 49.669  89.863  1.00 79.34  ? 3   ALA G O   1 
ATOM   6607 C CB  . ALA H 3 3   ? -27.675 46.556  89.307  1.00 78.04  ? 3   ALA G CB  1 
ATOM   6608 N N   . ASP H 3 4   ? -27.039 48.428  91.682  1.00 66.27  ? 4   ASP G N   1 
ATOM   6609 C CA  . ASP H 3 4   ? -26.077 49.149  92.515  1.00 62.59  ? 4   ASP G CA  1 
ATOM   6610 C C   . ASP H 3 4   ? -24.664 48.680  92.208  1.00 60.13  ? 4   ASP G C   1 
ATOM   6611 O O   . ASP H 3 4   ? -23.688 49.368  92.513  1.00 54.19  ? 4   ASP G O   1 
ATOM   6612 C CB  . ASP H 3 4   ? -26.348 48.919  94.001  1.00 66.94  ? 4   ASP G CB  1 
ATOM   6613 C CG  . ASP H 3 4   ? -27.799 49.125  94.370  1.00 70.80  ? 4   ASP G CG  1 
ATOM   6614 O OD1 . ASP H 3 4   ? -28.540 49.739  93.566  1.00 63.46  ? 4   ASP G OD1 1 
ATOM   6615 O OD2 . ASP H 3 4   ? -28.190 48.675  95.472  1.00 66.42  ? 4   ASP G OD2 1 
ATOM   6616 N N   . HIS H 3 5   ? -24.563 47.495  91.616  1.00 49.48  ? 5   HIS G N   1 
ATOM   6617 C CA  . HIS H 3 5   ? -23.278 46.927  91.258  1.00 41.38  ? 5   HIS G CA  1 
ATOM   6618 C C   . HIS H 3 5   ? -23.435 46.005  90.068  1.00 38.40  ? 5   HIS G C   1 
ATOM   6619 O O   . HIS H 3 5   ? -24.473 45.378  89.894  1.00 41.93  ? 5   HIS G O   1 
ATOM   6620 C CB  . HIS H 3 5   ? -22.699 46.169  92.443  1.00 39.06  ? 5   HIS G CB  1 
ATOM   6621 C CG  . HIS H 3 5   ? -22.287 47.055  93.575  1.00 41.08  ? 5   HIS G CG  1 
ATOM   6622 N ND1 . HIS H 3 5   ? -21.282 47.990  93.456  1.00 44.50  ? 5   HIS G ND1 1 
ATOM   6623 C CD2 . HIS H 3 5   ? -22.762 47.170  94.838  1.00 42.88  ? 5   HIS G CD2 1 
ATOM   6624 C CE1 . HIS H 3 5   ? -21.155 48.644  94.597  1.00 38.55  ? 5   HIS G CE1 1 
ATOM   6625 N NE2 . HIS H 3 5   ? -22.042 48.165  95.452  1.00 50.33  ? 5   HIS G NE2 1 
ATOM   6626 N N   . VAL H 3 6   ? -22.401 45.925  89.244  1.00 38.31  ? 6   VAL G N   1 
ATOM   6627 C CA  . VAL H 3 6   ? -22.446 45.087  88.054  1.00 38.76  ? 6   VAL G CA  1 
ATOM   6628 C C   . VAL H 3 6   ? -21.146 44.311  87.863  1.00 34.75  ? 6   VAL G C   1 
ATOM   6629 O O   . VAL H 3 6   ? -20.074 44.897  87.725  1.00 40.01  ? 6   VAL G O   1 
ATOM   6630 C CB  . VAL H 3 6   ? -22.706 45.950  86.802  1.00 36.99  ? 6   VAL G CB  1 
ATOM   6631 C CG1 . VAL H 3 6   ? -22.731 45.079  85.557  1.00 40.39  ? 6   VAL G CG1 1 
ATOM   6632 C CG2 . VAL H 3 6   ? -24.025 46.691  86.961  1.00 48.67  ? 6   VAL G CG2 1 
ATOM   6633 N N   . GLY H 3 7   ? -21.249 42.990  87.853  1.00 39.13  ? 7   GLY G N   1 
ATOM   6634 C CA  . GLY H 3 7   ? -20.068 42.171  87.681  1.00 39.48  ? 7   GLY G CA  1 
ATOM   6635 C C   . GLY H 3 7   ? -20.047 41.433  86.357  1.00 41.32  ? 7   GLY G C   1 
ATOM   6636 O O   . GLY H 3 7   ? -21.023 40.795  85.988  1.00 45.18  ? 7   GLY G O   1 
ATOM   6637 N N   . SER H 3 8   ? -18.939 41.544  85.631  1.00 40.45  ? 8   SER G N   1 
ATOM   6638 C CA  . SER H 3 8   ? -18.769 40.860  84.358  1.00 40.77  ? 8   SER G CA  1 
ATOM   6639 C C   . SER H 3 8   ? -17.635 39.878  84.558  1.00 42.15  ? 8   SER G C   1 
ATOM   6640 O O   . SER H 3 8   ? -16.477 40.187  84.312  1.00 52.49  ? 8   SER G O   1 
ATOM   6641 C CB  . SER H 3 8   ? -18.406 41.846  83.246  1.00 38.67  ? 8   SER G CB  1 
ATOM   6642 O OG  . SER H 3 8   ? -19.563 42.461  82.707  1.00 42.56  ? 8   SER G OG  1 
ATOM   6643 N N   . TYR H 3 9   ? -17.975 38.685  85.010  1.00 44.28  ? 9   TYR G N   1 
ATOM   6644 C CA  . TYR H 3 9   ? -16.973 37.670  85.274  1.00 40.93  ? 9   TYR G CA  1 
ATOM   6645 C C   . TYR H 3 9   ? -16.674 36.763  84.104  1.00 43.38  ? 9   TYR G C   1 
ATOM   6646 O O   . TYR H 3 9   ? -17.237 35.673  84.006  1.00 42.96  ? 9   TYR G O   1 
ATOM   6647 C CB  . TYR H 3 9   ? -17.421 36.832  86.465  1.00 38.70  ? 9   TYR G CB  1 
ATOM   6648 C CG  . TYR H 3 9   ? -17.724 37.680  87.676  1.00 42.22  ? 9   TYR G CG  1 
ATOM   6649 C CD1 . TYR H 3 9   ? -16.741 38.513  88.223  1.00 41.67  ? 9   TYR G CD1 1 
ATOM   6650 C CD2 . TYR H 3 9   ? -18.981 37.654  88.279  1.00 36.11  ? 9   TYR G CD2 1 
ATOM   6651 C CE1 . TYR H 3 9   ? -16.996 39.291  89.336  1.00 35.63  ? 9   TYR G CE1 1 
ATOM   6652 C CE2 . TYR H 3 9   ? -19.251 38.437  89.410  1.00 42.33  ? 9   TYR G CE2 1 
ATOM   6653 C CZ  . TYR H 3 9   ? -18.244 39.251  89.930  1.00 40.08  ? 9   TYR G CZ  1 
ATOM   6654 O OH  . TYR H 3 9   ? -18.457 40.004  91.059  1.00 41.79  ? 9   TYR G OH  1 
ATOM   6655 N N   . GLY H 3 10  A -15.797 37.210  83.208  1.00 41.77  ? 9   GLY G N   1 
ATOM   6656 C CA  . GLY H 3 10  A -15.436 36.361  82.086  1.00 42.67  ? 9   GLY G CA  1 
ATOM   6657 C C   . GLY H 3 10  A -15.737 36.833  80.679  1.00 43.24  ? 9   GLY G C   1 
ATOM   6658 O O   . GLY H 3 10  A -16.153 36.039  79.844  1.00 41.51  ? 9   GLY G O   1 
ATOM   6659 N N   . ILE H 3 11  ? -15.522 38.114  80.406  1.00 44.19  ? 10  ILE G N   1 
ATOM   6660 C CA  . ILE H 3 11  ? -15.756 38.654  79.068  1.00 38.75  ? 10  ILE G CA  1 
ATOM   6661 C C   . ILE H 3 11  ? -14.787 38.020  78.076  1.00 39.42  ? 10  ILE G C   1 
ATOM   6662 O O   . ILE H 3 11  ? -13.573 38.040  78.292  1.00 39.06  ? 10  ILE G O   1 
ATOM   6663 C CB  . ILE H 3 11  ? -15.524 40.171  79.025  1.00 34.67  ? 10  ILE G CB  1 
ATOM   6664 C CG1 . ILE H 3 11  ? -16.532 40.878  79.929  1.00 31.85  ? 10  ILE G CG1 1 
ATOM   6665 C CG2 . ILE H 3 11  ? -15.614 40.662  77.594  1.00 30.56  ? 10  ILE G CG2 1 
ATOM   6666 C CD1 . ILE H 3 11  ? -16.244 42.372  80.131  1.00 25.98  ? 10  ILE G CD1 1 
ATOM   6667 N N   . VAL H 3 12  ? -15.319 37.456  76.995  1.00 35.54  ? 11  VAL G N   1 
ATOM   6668 C CA  . VAL H 3 12  ? -14.471 36.847  75.980  1.00 38.56  ? 11  VAL G CA  1 
ATOM   6669 C C   . VAL H 3 12  ? -14.542 37.653  74.683  1.00 38.60  ? 11  VAL G C   1 
ATOM   6670 O O   . VAL H 3 12  ? -15.604 38.130  74.294  1.00 44.18  ? 11  VAL G O   1 
ATOM   6671 C CB  . VAL H 3 12  ? -14.892 35.381  75.678  1.00 42.15  ? 11  VAL G CB  1 
ATOM   6672 C CG1 . VAL H 3 12  ? -14.083 34.833  74.513  1.00 39.16  ? 11  VAL G CG1 1 
ATOM   6673 C CG2 . VAL H 3 12  ? -14.687 34.514  76.901  1.00 42.46  ? 11  VAL G CG2 1 
ATOM   6674 N N   . VAL H 3 13  ? -13.402 37.816  74.027  1.00 40.30  ? 12  VAL G N   1 
ATOM   6675 C CA  . VAL H 3 13  ? -13.340 38.532  72.758  1.00 46.17  ? 12  VAL G CA  1 
ATOM   6676 C C   . VAL H 3 13  ? -12.407 37.762  71.830  1.00 47.18  ? 12  VAL G C   1 
ATOM   6677 O O   . VAL H 3 13  ? -11.207 37.690  72.087  1.00 48.68  ? 12  VAL G O   1 
ATOM   6678 C CB  . VAL H 3 13  ? -12.773 39.957  72.912  1.00 39.88  ? 12  VAL G CB  1 
ATOM   6679 C CG1 . VAL H 3 13  ? -12.563 40.565  71.533  1.00 48.12  ? 12  VAL G CG1 1 
ATOM   6680 C CG2 . VAL H 3 13  ? -13.717 40.827  73.724  1.00 43.73  ? 12  VAL G CG2 1 
ATOM   6681 N N   . TYR H 3 14  ? -12.944 37.176  70.762  1.00 48.19  ? 13  TYR G N   1 
ATOM   6682 C CA  . TYR H 3 14  ? -12.092 36.429  69.842  1.00 47.42  ? 13  TYR G CA  1 
ATOM   6683 C C   . TYR H 3 14  ? -12.287 36.889  68.415  1.00 45.54  ? 13  TYR G C   1 
ATOM   6684 O O   . TYR H 3 14  ? -13.408 36.963  67.922  1.00 49.01  ? 13  TYR G O   1 
ATOM   6685 C CB  . TYR H 3 14  ? -12.362 34.938  69.951  1.00 45.10  ? 13  TYR G CB  1 
ATOM   6686 C CG  . TYR H 3 14  ? -11.178 34.108  69.518  1.00 55.96  ? 13  TYR G CG  1 
ATOM   6687 C CD1 . TYR H 3 14  ? -10.897 33.899  68.163  1.00 45.76  ? 13  TYR G CD1 1 
ATOM   6688 C CD2 . TYR H 3 14  ? -10.339 33.519  70.468  1.00 52.20  ? 13  TYR G CD2 1 
ATOM   6689 C CE1 . TYR H 3 14  ? -9.817  33.120  67.768  1.00 49.90  ? 13  TYR G CE1 1 
ATOM   6690 C CE2 . TYR H 3 14  ? -9.257  32.739  70.083  1.00 54.27  ? 13  TYR G CE2 1 
ATOM   6691 C CZ  . TYR H 3 14  ? -9.003  32.539  68.734  1.00 55.33  ? 13  TYR G CZ  1 
ATOM   6692 O OH  . TYR H 3 14  ? -7.957  31.730  68.363  1.00 60.25  ? 13  TYR G OH  1 
ATOM   6693 N N   . GLN H 3 15  ? -11.185 37.199  67.750  1.00 47.40  ? 14  GLN G N   1 
ATOM   6694 C CA  . GLN H 3 15  ? -11.260 37.692  66.388  1.00 56.08  ? 14  GLN G CA  1 
ATOM   6695 C C   . GLN H 3 15  ? -10.202 37.113  65.454  1.00 60.50  ? 14  GLN G C   1 
ATOM   6696 O O   . GLN H 3 15  ? -9.164  36.612  65.896  1.00 57.22  ? 14  GLN G O   1 
ATOM   6697 C CB  . GLN H 3 15  ? -11.182 39.228  66.404  1.00 55.07  ? 14  GLN G CB  1 
ATOM   6698 C CG  . GLN H 3 15  ? -9.913  39.809  67.009  1.00 53.89  ? 14  GLN G CG  1 
ATOM   6699 C CD  . GLN H 3 15  ? -10.100 41.241  67.519  1.00 55.32  ? 14  GLN G CD  1 
ATOM   6700 O OE1 . GLN H 3 15  ? -10.876 42.016  66.960  1.00 46.05  ? 14  GLN G OE1 1 
ATOM   6701 N NE2 . GLN H 3 15  ? -9.371  41.596  68.579  1.00 45.08  ? 14  GLN G NE2 1 
ATOM   6702 N N   . SER H 3 16  ? -10.488 37.174  64.155  1.00 61.50  ? 15  SER G N   1 
ATOM   6703 C CA  . SER H 3 16  ? -9.576  36.672  63.136  1.00 59.63  ? 15  SER G CA  1 
ATOM   6704 C C   . SER H 3 16  ? -9.624  37.599  61.934  1.00 59.41  ? 15  SER G C   1 
ATOM   6705 O O   . SER H 3 16  ? -10.621 38.294  61.708  1.00 51.04  ? 15  SER G O   1 
ATOM   6706 C CB  . SER H 3 16  ? -9.982  35.270  62.705  1.00 58.43  ? 15  SER G CB  1 
ATOM   6707 O OG  . SER H 3 16  ? -11.267 35.307  62.113  1.00 68.78  ? 15  SER G OG  1 
ATOM   6708 N N   . PRO H 3 17  ? -8.564  37.587  61.115  1.00 60.09  ? 16  PRO G N   1 
ATOM   6709 C CA  . PRO H 3 17  ? -7.364  36.757  61.270  1.00 59.01  ? 16  PRO G CA  1 
ATOM   6710 C C   . PRO H 3 17  ? -6.469  37.098  62.454  1.00 55.55  ? 16  PRO G C   1 
ATOM   6711 O O   . PRO H 3 17  ? -6.577  38.176  63.033  1.00 60.24  ? 16  PRO G O   1 
ATOM   6712 C CB  . PRO H 3 17  ? -6.643  36.955  59.942  1.00 60.87  ? 16  PRO G CB  1 
ATOM   6713 C CG  . PRO H 3 17  ? -6.980  38.367  59.601  1.00 61.66  ? 16  PRO G CG  1 
ATOM   6714 C CD  . PRO H 3 17  ? -8.462  38.423  59.906  1.00 60.95  ? 16  PRO G CD  1 
ATOM   6715 N N   . GLY H 3 18  ? -5.585  36.158  62.789  1.00 51.99  ? 17  GLY G N   1 
ATOM   6716 C CA  . GLY H 3 18  ? -4.644  36.337  63.880  1.00 51.28  ? 17  GLY G CA  1 
ATOM   6717 C C   . GLY H 3 18  ? -4.993  35.633  65.179  1.00 54.09  ? 17  GLY G C   1 
ATOM   6718 O O   . GLY H 3 18  ? -4.171  35.592  66.094  1.00 56.85  ? 17  GLY G O   1 
ATOM   6719 N N   . ASP H 3 19  ? -6.199  35.074  65.266  1.00 55.39  ? 18  ASP G N   1 
ATOM   6720 C CA  . ASP H 3 19  ? -6.651  34.394  66.481  1.00 58.70  ? 18  ASP G CA  1 
ATOM   6721 C C   . ASP H 3 19  ? -6.370  35.280  67.700  1.00 59.75  ? 18  ASP G C   1 
ATOM   6722 O O   . ASP H 3 19  ? -5.905  34.822  68.745  1.00 57.56  ? 18  ASP G O   1 
ATOM   6723 C CB  . ASP H 3 19  ? -5.958  33.037  66.621  1.00 58.10  ? 18  ASP G CB  1 
ATOM   6724 C CG  . ASP H 3 19  ? -6.397  32.045  65.547  1.00 67.58  ? 18  ASP G CG  1 
ATOM   6725 O OD1 . ASP H 3 19  ? -7.562  31.584  65.579  1.00 58.40  ? 18  ASP G OD1 1 
ATOM   6726 O OD2 . ASP H 3 19  ? -5.575  31.734  64.661  1.00 65.18  ? 18  ASP G OD2 1 
ATOM   6727 N N   . ILE H 3 20  ? -6.667  36.564  67.533  1.00 57.16  ? 19  ILE G N   1 
ATOM   6728 C CA  . ILE H 3 20  ? -6.483  37.572  68.567  1.00 55.86  ? 19  ILE G CA  1 
ATOM   6729 C C   . ILE H 3 20  ? -7.563  37.450  69.639  1.00 51.79  ? 19  ILE G C   1 
ATOM   6730 O O   . ILE H 3 20  ? -8.743  37.629  69.351  1.00 47.14  ? 19  ILE G O   1 
ATOM   6731 C CB  . ILE H 3 20  ? -6.571  38.977  67.958  1.00 54.47  ? 19  ILE G CB  1 
ATOM   6732 C CG1 . ILE H 3 20  ? -5.542  39.114  66.834  1.00 59.47  ? 19  ILE G CG1 1 
ATOM   6733 C CG2 . ILE H 3 20  ? -6.357  40.020  69.029  1.00 59.04  ? 19  ILE G CG2 1 
ATOM   6734 C CD1 . ILE H 3 20  ? -5.580  40.458  66.122  1.00 62.26  ? 19  ILE G CD1 1 
ATOM   6735 N N   . GLY H 3 21  ? -7.164  37.156  70.874  1.00 49.17  ? 20  GLY G N   1 
ATOM   6736 C CA  . GLY H 3 21  ? -8.147  37.028  71.936  1.00 44.83  ? 20  GLY G CA  1 
ATOM   6737 C C   . GLY H 3 21  ? -7.894  37.895  73.159  1.00 46.40  ? 20  GLY G C   1 
ATOM   6738 O O   . GLY H 3 21  ? -6.796  38.414  73.343  1.00 47.49  ? 20  GLY G O   1 
ATOM   6739 N N   . GLN H 3 22  ? -8.924  38.062  73.985  1.00 41.70  ? 21  GLN G N   1 
ATOM   6740 C CA  . GLN H 3 22  ? -8.832  38.835  75.218  1.00 40.52  ? 21  GLN G CA  1 
ATOM   6741 C C   . GLN H 3 22  ? -9.839  38.263  76.212  1.00 41.65  ? 21  GLN G C   1 
ATOM   6742 O O   . GLN H 3 22  ? -10.983 38.005  75.857  1.00 43.02  ? 21  GLN G O   1 
ATOM   6743 C CB  . GLN H 3 22  ? -9.145  40.320  74.985  1.00 39.84  ? 21  GLN G CB  1 
ATOM   6744 C CG  . GLN H 3 22  ? -9.063  41.146  76.271  1.00 39.80  ? 21  GLN G CG  1 
ATOM   6745 C CD  . GLN H 3 22  ? -9.620  42.558  76.152  1.00 44.57  ? 21  GLN G CD  1 
ATOM   6746 O OE1 . GLN H 3 22  ? -8.946  43.478  75.682  1.00 44.69  ? 21  GLN G OE1 1 
ATOM   6747 N NE2 . GLN H 3 22  ? -10.860 42.733  76.589  1.00 40.53  ? 21  GLN G NE2 1 
ATOM   6748 N N   . TYR H 3 23  ? -9.410  38.067  77.456  1.00 42.66  ? 22  TYR G N   1 
ATOM   6749 C CA  . TYR H 3 23  ? -10.280 37.523  78.499  1.00 38.20  ? 22  TYR G CA  1 
ATOM   6750 C C   . TYR H 3 23  ? -10.187 38.445  79.714  1.00 38.60  ? 22  TYR G C   1 
ATOM   6751 O O   . TYR H 3 23  ? -9.107  38.616  80.286  1.00 32.13  ? 22  TYR G O   1 
ATOM   6752 C CB  . TYR H 3 23  ? -9.821  36.110  78.883  1.00 35.41  ? 22  TYR G CB  1 
ATOM   6753 C CG  . TYR H 3 23  ? -10.794 35.367  79.771  1.00 42.29  ? 22  TYR G CG  1 
ATOM   6754 C CD1 . TYR H 3 23  ? -11.862 34.656  79.225  1.00 40.03  ? 22  TYR G CD1 1 
ATOM   6755 C CD2 . TYR H 3 23  ? -10.657 35.385  81.157  1.00 42.30  ? 22  TYR G CD2 1 
ATOM   6756 C CE1 . TYR H 3 23  ? -12.767 33.984  80.035  1.00 47.03  ? 22  TYR G CE1 1 
ATOM   6757 C CE2 . TYR H 3 23  ? -11.555 34.716  81.974  1.00 47.63  ? 22  TYR G CE2 1 
ATOM   6758 C CZ  . TYR H 3 23  ? -12.608 34.017  81.408  1.00 47.85  ? 22  TYR G CZ  1 
ATOM   6759 O OH  . TYR H 3 23  ? -13.503 33.353  82.218  1.00 47.78  ? 22  TYR G OH  1 
ATOM   6760 N N   . THR H 3 24  ? -11.310 39.029  80.120  1.00 33.61  ? 23  THR G N   1 
ATOM   6761 C CA  . THR H 3 24  ? -11.288 39.952  81.251  1.00 35.39  ? 23  THR G CA  1 
ATOM   6762 C C   . THR H 3 24  ? -12.429 39.823  82.265  1.00 35.91  ? 23  THR G C   1 
ATOM   6763 O O   . THR H 3 24  ? -13.469 39.228  81.992  1.00 40.35  ? 23  THR G O   1 
ATOM   6764 C CB  . THR H 3 24  ? -11.273 41.414  80.759  1.00 34.07  ? 23  THR G CB  1 
ATOM   6765 O OG1 . THR H 3 24  ? -12.424 41.653  79.941  1.00 38.70  ? 23  THR G OG1 1 
ATOM   6766 C CG2 . THR H 3 24  ? -10.031 41.689  79.950  1.00 33.45  ? 23  THR G CG2 1 
ATOM   6767 N N   . PHE H 3 25  ? -12.200 40.404  83.440  1.00 37.67  ? 24  PHE G N   1 
ATOM   6768 C CA  . PHE H 3 25  ? -13.158 40.433  84.543  1.00 34.22  ? 24  PHE G CA  1 
ATOM   6769 C C   . PHE H 3 25  ? -13.329 41.909  84.881  1.00 39.46  ? 24  PHE G C   1 
ATOM   6770 O O   . PHE H 3 25  ? -12.336 42.610  85.098  1.00 37.25  ? 24  PHE G O   1 
ATOM   6771 C CB  . PHE H 3 25  ? -12.584 39.730  85.774  1.00 34.68  ? 24  PHE G CB  1 
ATOM   6772 C CG  . PHE H 3 25  ? -13.078 38.330  85.981  1.00 40.32  ? 24  PHE G CG  1 
ATOM   6773 C CD1 . PHE H 3 25  ? -13.136 37.426  84.925  1.00 44.28  ? 24  PHE G CD1 1 
ATOM   6774 C CD2 . PHE H 3 25  ? -13.416 37.891  87.259  1.00 43.67  ? 24  PHE G CD2 1 
ATOM   6775 C CE1 . PHE H 3 25  ? -13.519 36.096  85.140  1.00 46.83  ? 24  PHE G CE1 1 
ATOM   6776 C CE2 . PHE H 3 25  ? -13.799 36.566  87.485  1.00 47.95  ? 24  PHE G CE2 1 
ATOM   6777 C CZ  . PHE H 3 25  ? -13.850 35.667  86.426  1.00 38.49  ? 24  PHE G CZ  1 
ATOM   6778 N N   . GLU H 3 26  ? -14.575 42.375  84.928  1.00 38.96  ? 25  GLU G N   1 
ATOM   6779 C CA  . GLU H 3 26  ? -14.872 43.771  85.258  1.00 40.83  ? 25  GLU G CA  1 
ATOM   6780 C C   . GLU H 3 26  ? -15.843 43.835  86.432  1.00 40.62  ? 25  GLU G C   1 
ATOM   6781 O O   . GLU H 3 26  ? -16.690 42.957  86.596  1.00 42.45  ? 25  GLU G O   1 
ATOM   6782 C CB  . GLU H 3 26  ? -15.532 44.498  84.072  1.00 41.37  ? 25  GLU G CB  1 
ATOM   6783 C CG  . GLU H 3 26  ? -14.638 44.797  82.880  1.00 43.43  ? 25  GLU G CG  1 
ATOM   6784 C CD  . GLU H 3 26  ? -15.380 45.546  81.781  1.00 45.27  ? 25  GLU G CD  1 
ATOM   6785 O OE1 . GLU H 3 26  ? -16.343 46.265  82.114  1.00 46.99  ? 25  GLU G OE1 1 
ATOM   6786 O OE2 . GLU H 3 26  ? -15.001 45.432  80.591  1.00 46.45  ? 25  GLU G OE2 1 
ATOM   6787 N N   . PHE H 3 27  ? -15.713 44.874  87.246  1.00 35.88  ? 26  PHE G N   1 
ATOM   6788 C CA  . PHE H 3 27  ? -16.621 45.087  88.364  1.00 37.77  ? 26  PHE G CA  1 
ATOM   6789 C C   . PHE H 3 27  ? -16.896 46.587  88.363  1.00 39.68  ? 26  PHE G C   1 
ATOM   6790 O O   . PHE H 3 27  ? -15.976 47.390  88.492  1.00 41.07  ? 26  PHE G O   1 
ATOM   6791 C CB  . PHE H 3 27  ? -15.993 44.672  89.700  1.00 41.46  ? 26  PHE G CB  1 
ATOM   6792 C CG  . PHE H 3 27  ? -16.976 44.651  90.837  1.00 38.67  ? 26  PHE G CG  1 
ATOM   6793 C CD1 . PHE H 3 27  ? -17.910 43.621  90.945  1.00 39.13  ? 26  PHE G CD1 1 
ATOM   6794 C CD2 . PHE H 3 27  ? -17.016 45.696  91.760  1.00 40.62  ? 26  PHE G CD2 1 
ATOM   6795 C CE1 . PHE H 3 27  ? -18.874 43.632  91.950  1.00 44.83  ? 26  PHE G CE1 1 
ATOM   6796 C CE2 . PHE H 3 27  ? -17.979 45.720  92.776  1.00 41.62  ? 26  PHE G CE2 1 
ATOM   6797 C CZ  . PHE H 3 27  ? -18.910 44.686  92.872  1.00 40.75  ? 26  PHE G CZ  1 
ATOM   6798 N N   . ASP H 3 28  ? -18.158 46.962  88.194  1.00 41.24  ? 27  ASP G N   1 
ATOM   6799 C CA  . ASP H 3 28  ? -18.539 48.371  88.143  1.00 42.96  ? 27  ASP G CA  1 
ATOM   6800 C C   . ASP H 3 28  ? -17.762 49.176  87.099  1.00 40.85  ? 27  ASP G C   1 
ATOM   6801 O O   . ASP H 3 28  ? -17.425 50.339  87.320  1.00 46.80  ? 27  ASP G O   1 
ATOM   6802 C CB  . ASP H 3 28  ? -18.387 49.030  89.517  1.00 38.93  ? 27  ASP G CB  1 
ATOM   6803 C CG  . ASP H 3 28  ? -19.415 48.532  90.522  1.00 51.71  ? 27  ASP G CG  1 
ATOM   6804 O OD1 . ASP H 3 28  ? -20.436 47.951  90.089  1.00 53.38  ? 27  ASP G OD1 1 
ATOM   6805 O OD2 . ASP H 3 28  ? -19.208 48.732  91.742  1.00 53.65  ? 27  ASP G OD2 1 
ATOM   6806 N N   . GLY H 3 29  ? -17.471 48.557  85.961  1.00 38.39  ? 28  GLY G N   1 
ATOM   6807 C CA  . GLY H 3 29  ? -16.769 49.265  84.905  1.00 39.84  ? 28  GLY G CA  1 
ATOM   6808 C C   . GLY H 3 29  ? -15.255 49.315  84.980  1.00 40.49  ? 28  GLY G C   1 
ATOM   6809 O O   . GLY H 3 29  ? -14.611 49.787  84.043  1.00 46.26  ? 28  GLY G O   1 
ATOM   6810 N N   . ASP H 3 30  ? -14.683 48.853  86.087  1.00 35.07  ? 29  ASP G N   1 
ATOM   6811 C CA  . ASP H 3 30  ? -13.238 48.837  86.232  1.00 33.81  ? 29  ASP G CA  1 
ATOM   6812 C C   . ASP H 3 30  ? -12.691 47.438  85.991  1.00 32.10  ? 29  ASP G C   1 
ATOM   6813 O O   . ASP H 3 30  ? -13.372 46.445  86.224  1.00 41.06  ? 29  ASP G O   1 
ATOM   6814 C CB  . ASP H 3 30  ? -12.836 49.335  87.613  1.00 37.50  ? 29  ASP G CB  1 
ATOM   6815 C CG  . ASP H 3 30  ? -12.842 50.835  87.699  1.00 38.84  ? 29  ASP G CG  1 
ATOM   6816 O OD1 . ASP H 3 30  ? -12.130 51.454  86.890  1.00 45.88  ? 29  ASP G OD1 1 
ATOM   6817 O OD2 . ASP H 3 30  ? -13.551 51.395  88.561  1.00 42.17  ? 29  ASP G OD2 1 
ATOM   6818 N N   . GLU H 3 31  ? -11.460 47.366  85.507  1.00 30.70  ? 30  GLU G N   1 
ATOM   6819 C CA  . GLU H 3 31  ? -10.831 46.088  85.213  1.00 37.77  ? 30  GLU G CA  1 
ATOM   6820 C C   . GLU H 3 31  ? -10.213 45.416  86.434  1.00 40.71  ? 30  GLU G C   1 
ATOM   6821 O O   . GLU H 3 31  ? -9.296  45.963  87.053  1.00 43.91  ? 30  GLU G O   1 
ATOM   6822 C CB  . GLU H 3 31  ? -9.744  46.284  84.154  1.00 36.92  ? 30  GLU G CB  1 
ATOM   6823 C CG  . GLU H 3 31  ? -9.023  45.009  83.733  1.00 38.24  ? 30  GLU G CG  1 
ATOM   6824 C CD  . GLU H 3 31  ? -7.834  45.303  82.808  1.00 51.97  ? 30  GLU G CD  1 
ATOM   6825 O OE1 . GLU H 3 31  ? -7.932  46.249  81.992  1.00 55.34  ? 30  GLU G OE1 1 
ATOM   6826 O OE2 . GLU H 3 31  ? -6.806  44.593  82.886  1.00 46.00  ? 30  GLU G OE2 1 
ATOM   6827 N N   . LEU H 3 32  ? -10.713 44.237  86.784  1.00 33.28  ? 31  LEU G N   1 
ATOM   6828 C CA  . LEU H 3 32  ? -10.146 43.492  87.898  1.00 32.93  ? 31  LEU G CA  1 
ATOM   6829 C C   . LEU H 3 32  ? -8.853  42.867  87.393  1.00 33.56  ? 31  LEU G C   1 
ATOM   6830 O O   . LEU H 3 32  ? -7.812  42.942  88.041  1.00 37.84  ? 31  LEU G O   1 
ATOM   6831 C CB  . LEU H 3 32  ? -11.092 42.384  88.327  1.00 36.28  ? 31  LEU G CB  1 
ATOM   6832 C CG  . LEU H 3 32  ? -12.341 42.875  89.047  1.00 42.72  ? 31  LEU G CG  1 
ATOM   6833 C CD1 . LEU H 3 32  ? -13.469 41.853  88.845  1.00 29.05  ? 31  LEU G CD1 1 
ATOM   6834 C CD2 . LEU H 3 32  ? -12.010 43.129  90.529  1.00 23.93  ? 31  LEU G CD2 1 
ATOM   6835 N N   . PHE H 3 33  ? -8.932  42.256  86.218  1.00 32.28  ? 32  PHE G N   1 
ATOM   6836 C CA  . PHE H 3 33  ? -7.778  41.610  85.618  1.00 39.77  ? 32  PHE G CA  1 
ATOM   6837 C C   . PHE H 3 33  ? -8.079  41.099  84.209  1.00 39.18  ? 32  PHE G C   1 
ATOM   6838 O O   . PHE H 3 33  ? -9.221  41.100  83.756  1.00 40.33  ? 32  PHE G O   1 
ATOM   6839 C CB  . PHE H 3 33  ? -7.331  40.429  86.496  1.00 39.54  ? 32  PHE G CB  1 
ATOM   6840 C CG  . PHE H 3 33  ? -8.335  39.291  86.564  1.00 37.99  ? 32  PHE G CG  1 
ATOM   6841 C CD1 . PHE H 3 33  ? -8.574  38.479  85.457  1.00 42.39  ? 32  PHE G CD1 1 
ATOM   6842 C CD2 . PHE H 3 33  ? -9.038  39.037  87.738  1.00 35.81  ? 32  PHE G CD2 1 
ATOM   6843 C CE1 . PHE H 3 33  ? -9.500  37.428  85.518  1.00 45.05  ? 32  PHE G CE1 1 
ATOM   6844 C CE2 . PHE H 3 33  ? -9.968  37.988  87.812  1.00 40.69  ? 32  PHE G CE2 1 
ATOM   6845 C CZ  . PHE H 3 33  ? -10.199 37.182  86.696  1.00 41.06  ? 32  PHE G CZ  1 
ATOM   6846 N N   . TYR H 3 34  ? -7.032  40.673  83.519  1.00 35.71  ? 33  TYR G N   1 
ATOM   6847 C CA  . TYR H 3 34  ? -7.176  40.088  82.196  1.00 44.37  ? 33  TYR G CA  1 
ATOM   6848 C C   . TYR H 3 34  ? -6.265  38.881  82.279  1.00 40.61  ? 33  TYR G C   1 
ATOM   6849 O O   . TYR H 3 34  ? -5.321  38.880  83.066  1.00 40.81  ? 33  TYR G O   1 
ATOM   6850 C CB  . TYR H 3 34  ? -6.710  41.045  81.091  1.00 36.36  ? 33  TYR G CB  1 
ATOM   6851 C CG  . TYR H 3 34  ? -5.228  41.340  81.082  1.00 40.53  ? 33  TYR G CG  1 
ATOM   6852 C CD1 . TYR H 3 34  ? -4.316  40.430  80.551  1.00 39.85  ? 33  TYR G CD1 1 
ATOM   6853 C CD2 . TYR H 3 34  ? -4.738  42.552  81.580  1.00 39.26  ? 33  TYR G CD2 1 
ATOM   6854 C CE1 . TYR H 3 34  ? -2.949  40.721  80.508  1.00 33.46  ? 33  TYR G CE1 1 
ATOM   6855 C CE2 . TYR H 3 34  ? -3.381  42.853  81.545  1.00 40.88  ? 33  TYR G CE2 1 
ATOM   6856 C CZ  . TYR H 3 34  ? -2.492  41.937  81.004  1.00 43.78  ? 33  TYR G CZ  1 
ATOM   6857 O OH  . TYR H 3 34  ? -1.159  42.258  80.928  1.00 35.15  ? 33  TYR G OH  1 
ATOM   6858 N N   . VAL H 3 35  ? -6.556  37.839  81.513  1.00 39.33  ? 34  VAL G N   1 
ATOM   6859 C CA  . VAL H 3 35  ? -5.705  36.668  81.541  1.00 36.27  ? 34  VAL G CA  1 
ATOM   6860 C C   . VAL H 3 35  ? -4.735  36.736  80.368  1.00 44.58  ? 34  VAL G C   1 
ATOM   6861 O O   . VAL H 3 35  ? -5.158  36.857  79.209  1.00 38.31  ? 34  VAL G O   1 
ATOM   6862 C CB  . VAL H 3 35  ? -6.534  35.366  81.475  1.00 41.13  ? 34  VAL G CB  1 
ATOM   6863 C CG1 . VAL H 3 35  ? -5.607  34.145  81.294  1.00 31.46  ? 34  VAL G CG1 1 
ATOM   6864 C CG2 . VAL H 3 35  ? -7.354  35.221  82.759  1.00 38.02  ? 34  VAL G CG2 1 
ATOM   6865 N N   . ASP H 3 36  ? -3.437  36.686  80.684  1.00 44.86  ? 35  ASP G N   1 
ATOM   6866 C CA  . ASP H 3 36  ? -2.382  36.721  79.674  1.00 45.71  ? 35  ASP G CA  1 
ATOM   6867 C C   . ASP H 3 36  ? -2.335  35.326  79.080  1.00 45.49  ? 35  ASP G C   1 
ATOM   6868 O O   . ASP H 3 36  ? -1.759  34.421  79.671  1.00 49.56  ? 35  ASP G O   1 
ATOM   6869 C CB  . ASP H 3 36  ? -1.031  37.059  80.315  1.00 45.41  ? 35  ASP G CB  1 
ATOM   6870 C CG  . ASP H 3 36  ? 0.081   37.238  79.285  1.00 50.28  ? 35  ASP G CG  1 
ATOM   6871 O OD1 . ASP H 3 36  ? 0.271   36.340  78.442  1.00 51.27  ? 35  ASP G OD1 1 
ATOM   6872 O OD2 . ASP H 3 36  ? 0.774   38.275  79.323  1.00 55.76  ? 35  ASP G OD2 1 
ATOM   6873 N N   . LEU H 3 37  ? -2.948  35.165  77.911  1.00 51.41  ? 36  LEU G N   1 
ATOM   6874 C CA  . LEU H 3 37  ? -3.035  33.879  77.214  1.00 53.02  ? 36  LEU G CA  1 
ATOM   6875 C C   . LEU H 3 37  ? -1.705  33.266  76.775  1.00 55.53  ? 36  LEU G C   1 
ATOM   6876 O O   . LEU H 3 37  ? -1.591  32.047  76.618  1.00 52.53  ? 36  LEU G O   1 
ATOM   6877 C CB  . LEU H 3 37  ? -3.944  34.044  76.006  1.00 50.26  ? 36  LEU G CB  1 
ATOM   6878 C CG  . LEU H 3 37  ? -5.225  34.791  76.388  1.00 51.74  ? 36  LEU G CG  1 
ATOM   6879 C CD1 . LEU H 3 37  ? -5.999  35.152  75.135  1.00 46.60  ? 36  LEU G CD1 1 
ATOM   6880 C CD2 . LEU H 3 37  ? -6.053  33.932  77.344  1.00 39.32  ? 36  LEU G CD2 1 
ATOM   6881 N N   . ASP H 3 38  ? -0.703  34.110  76.562  1.00 58.63  ? 37  ASP G N   1 
ATOM   6882 C CA  . ASP H 3 38  ? 0.599   33.620  76.155  1.00 60.93  ? 37  ASP G CA  1 
ATOM   6883 C C   . ASP H 3 38  ? 1.301   33.061  77.388  1.00 61.10  ? 37  ASP G C   1 
ATOM   6884 O O   . ASP H 3 38  ? 1.723   31.904  77.410  1.00 58.16  ? 37  ASP G O   1 
ATOM   6885 C CB  . ASP H 3 38  ? 1.418   34.752  75.523  1.00 66.56  ? 37  ASP G CB  1 
ATOM   6886 C CG  . ASP H 3 38  ? 0.722   35.377  74.307  1.00 80.07  ? 37  ASP G CG  1 
ATOM   6887 O OD1 . ASP H 3 38  ? 0.331   34.632  73.377  1.00 78.63  ? 37  ASP G OD1 1 
ATOM   6888 O OD2 . ASP H 3 38  ? 0.568   36.617  74.275  1.00 84.86  ? 37  ASP G OD2 1 
ATOM   6889 N N   . LYS H 3 39  ? 1.399   33.884  78.426  1.00 58.85  ? 38  LYS G N   1 
ATOM   6890 C CA  . LYS H 3 39  ? 2.049   33.476  79.665  1.00 57.75  ? 38  LYS G CA  1 
ATOM   6891 C C   . LYS H 3 39  ? 1.127   32.594  80.522  1.00 54.29  ? 38  LYS G C   1 
ATOM   6892 O O   . LYS H 3 39  ? 1.558   32.011  81.514  1.00 45.60  ? 38  LYS G O   1 
ATOM   6893 C CB  . LYS H 3 39  ? 2.458   34.719  80.459  1.00 58.39  ? 38  LYS G CB  1 
ATOM   6894 C CG  . LYS H 3 39  ? 3.176   35.777  79.633  1.00 69.03  ? 38  LYS G CG  1 
ATOM   6895 C CD  . LYS H 3 39  ? 3.287   37.114  80.378  1.00 72.31  ? 38  LYS G CD  1 
ATOM   6896 C CE  . LYS H 3 39  ? 4.253   37.045  81.552  1.00 79.52  ? 38  LYS G CE  1 
ATOM   6897 N NZ  . LYS H 3 39  ? 5.654   36.790  81.096  1.00 86.53  ? 38  LYS G NZ  1 
ATOM   6898 N N   . LYS H 3 40  ? -0.138  32.492  80.130  1.00 53.46  ? 39  LYS G N   1 
ATOM   6899 C CA  . LYS H 3 40  ? -1.110  31.700  80.882  1.00 54.81  ? 39  LYS G CA  1 
ATOM   6900 C C   . LYS H 3 40  ? -1.084  32.141  82.349  1.00 51.52  ? 39  LYS G C   1 
ATOM   6901 O O   . LYS H 3 40  ? -0.771  31.353  83.238  1.00 56.16  ? 39  LYS G O   1 
ATOM   6902 C CB  . LYS H 3 40  ? -0.780  30.199  80.788  1.00 56.20  ? 39  LYS G CB  1 
ATOM   6903 C CG  . LYS H 3 40  ? -0.773  29.600  79.377  1.00 52.53  ? 39  LYS G CG  1 
ATOM   6904 C CD  . LYS H 3 40  ? -0.815  28.069  79.444  1.00 53.07  ? 39  LYS G CD  1 
ATOM   6905 C CE  . LYS H 3 40  ? -0.898  27.415  78.068  1.00 55.86  ? 39  LYS G CE  1 
ATOM   6906 N NZ  . LYS H 3 40  ? 0.427   26.990  77.538  1.00 55.21  ? 39  LYS G NZ  1 
ATOM   6907 N N   . GLU H 3 41  ? -1.428  33.398  82.600  1.00 50.63  ? 40  GLU G N   1 
ATOM   6908 C CA  . GLU H 3 41  ? -1.404  33.940  83.957  1.00 50.07  ? 40  GLU G CA  1 
ATOM   6909 C C   . GLU H 3 41  ? -2.445  35.048  84.159  1.00 47.78  ? 40  GLU G C   1 
ATOM   6910 O O   . GLU H 3 41  ? -2.703  35.842  83.245  1.00 39.70  ? 40  GLU G O   1 
ATOM   6911 C CB  . GLU H 3 41  ? 0.023   34.456  84.237  1.00 58.53  ? 40  GLU G CB  1 
ATOM   6912 C CG  . GLU H 3 41  ? 0.207   35.464  85.377  1.00 72.29  ? 40  GLU G CG  1 
ATOM   6913 C CD  . GLU H 3 41  ? 1.662   35.973  85.503  1.00 78.20  ? 40  GLU G CD  1 
ATOM   6914 O OE1 . GLU H 3 41  ? 2.273   36.351  84.474  1.00 72.10  ? 40  GLU G OE1 1 
ATOM   6915 O OE2 . GLU H 3 41  ? 2.190   36.008  86.639  1.00 78.48  ? 40  GLU G OE2 1 
ATOM   6916 N N   . THR H 3 42  ? -3.062  35.075  85.345  1.00 43.95  ? 41  THR G N   1 
ATOM   6917 C CA  . THR H 3 42  ? -4.051  36.111  85.687  1.00 44.37  ? 41  THR G CA  1 
ATOM   6918 C C   . THR H 3 42  ? -3.286  37.387  86.068  1.00 45.41  ? 41  THR G C   1 
ATOM   6919 O O   . THR H 3 42  ? -2.467  37.369  86.981  1.00 46.66  ? 41  THR G O   1 
ATOM   6920 C CB  . THR H 3 42  ? -4.911  35.710  86.903  1.00 41.23  ? 41  THR G CB  1 
ATOM   6921 O OG1 . THR H 3 42  ? -5.424  34.389  86.714  1.00 47.11  ? 41  THR G OG1 1 
ATOM   6922 C CG2 . THR H 3 42  ? -6.072  36.683  87.083  1.00 32.77  ? 41  THR G CG2 1 
ATOM   6923 N N   . ILE H 3 43  ? -3.560  38.487  85.376  1.00 46.31  ? 42  ILE G N   1 
ATOM   6924 C CA  . ILE H 3 43  ? -2.877  39.755  85.636  1.00 42.17  ? 42  ILE G CA  1 
ATOM   6925 C C   . ILE H 3 43  ? -3.800  40.800  86.267  1.00 41.11  ? 42  ILE G C   1 
ATOM   6926 O O   . ILE H 3 43  ? -4.567  41.465  85.572  1.00 44.86  ? 42  ILE G O   1 
ATOM   6927 C CB  . ILE H 3 43  ? -2.293  40.315  84.314  1.00 50.48  ? 42  ILE G CB  1 
ATOM   6928 C CG1 . ILE H 3 43  ? -1.417  39.248  83.662  1.00 43.57  ? 42  ILE G CG1 1 
ATOM   6929 C CG2 . ILE H 3 43  ? -1.465  41.575  84.577  1.00 40.04  ? 42  ILE G CG2 1 
ATOM   6930 C CD1 . ILE H 3 43  ? -0.253  38.830  84.533  1.00 42.50  ? 42  ILE G CD1 1 
ATOM   6931 N N   . TRP H 3 44  ? -3.702  40.952  87.585  1.00 38.56  ? 43  TRP G N   1 
ATOM   6932 C CA  . TRP H 3 44  ? -4.537  41.894  88.338  1.00 34.21  ? 43  TRP G CA  1 
ATOM   6933 C C   . TRP H 3 44  ? -4.104  43.352  88.215  1.00 31.82  ? 43  TRP G C   1 
ATOM   6934 O O   . TRP H 3 44  ? -2.916  43.641  88.184  1.00 37.51  ? 43  TRP G O   1 
ATOM   6935 C CB  . TRP H 3 44  ? -4.546  41.499  89.815  1.00 23.90  ? 43  TRP G CB  1 
ATOM   6936 C CG  . TRP H 3 44  ? -5.108  40.152  90.043  1.00 38.31  ? 43  TRP G CG  1 
ATOM   6937 C CD1 . TRP H 3 44  ? -4.475  38.951  89.855  1.00 41.52  ? 43  TRP G CD1 1 
ATOM   6938 C CD2 . TRP H 3 44  ? -6.455  39.842  90.413  1.00 35.79  ? 43  TRP G CD2 1 
ATOM   6939 N NE1 . TRP H 3 44  ? -5.348  37.916  90.083  1.00 42.13  ? 43  TRP G NE1 1 
ATOM   6940 C CE2 . TRP H 3 44  ? -6.570  38.435  90.433  1.00 44.05  ? 43  TRP G CE2 1 
ATOM   6941 C CE3 . TRP H 3 44  ? -7.577  40.618  90.740  1.00 38.60  ? 43  TRP G CE3 1 
ATOM   6942 C CZ2 . TRP H 3 44  ? -7.771  37.784  90.752  1.00 43.21  ? 43  TRP G CZ2 1 
ATOM   6943 C CZ3 . TRP H 3 44  ? -8.771  39.969  91.059  1.00 38.39  ? 43  TRP G CZ3 1 
ATOM   6944 C CH2 . TRP H 3 44  ? -8.855  38.567  91.067  1.00 32.69  ? 43  TRP G CH2 1 
ATOM   6945 N N   . MET H 3 45  ? -5.063  44.271  88.148  1.00 29.40  ? 44  MET G N   1 
ATOM   6946 C CA  . MET H 3 45  ? -4.726  45.687  88.052  1.00 33.37  ? 44  MET G CA  1 
ATOM   6947 C C   . MET H 3 45  ? -4.283  46.233  89.418  1.00 39.80  ? 44  MET G C   1 
ATOM   6948 O O   . MET H 3 45  ? -3.286  46.953  89.523  1.00 38.62  ? 44  MET G O   1 
ATOM   6949 C CB  . MET H 3 45  ? -5.909  46.503  87.529  1.00 33.24  ? 44  MET G CB  1 
ATOM   6950 C CG  . MET H 3 45  ? -5.527  47.969  87.335  1.00 46.78  ? 44  MET G CG  1 
ATOM   6951 S SD  . MET H 3 45  ? -6.536  48.853  86.163  1.00 51.89  ? 44  MET G SD  1 
ATOM   6952 C CE  . MET H 3 45  ? -5.927  48.178  84.680  1.00 51.44  ? 44  MET G CE  1 
ATOM   6953 N N   . LEU H 3 46  ? -5.041  45.907  90.459  1.00 40.03  ? 45  LEU G N   1 
ATOM   6954 C CA  . LEU H 3 46  ? -4.693  46.321  91.810  1.00 35.49  ? 45  LEU G CA  1 
ATOM   6955 C C   . LEU H 3 46  ? -4.042  45.097  92.466  1.00 42.60  ? 45  LEU G C   1 
ATOM   6956 O O   . LEU H 3 46  ? -4.718  44.122  92.785  1.00 45.84  ? 45  LEU G O   1 
ATOM   6957 C CB  . LEU H 3 46  ? -5.947  46.731  92.577  1.00 29.48  ? 45  LEU G CB  1 
ATOM   6958 C CG  . LEU H 3 46  ? -6.664  47.988  92.078  1.00 29.18  ? 45  LEU G CG  1 
ATOM   6959 C CD1 . LEU H 3 46  ? -7.910  48.230  92.909  1.00 28.17  ? 45  LEU G CD1 1 
ATOM   6960 C CD2 . LEU H 3 46  ? -5.727  49.183  92.169  1.00 24.81  ? 45  LEU G CD2 1 
ATOM   6961 N N   . PRO H 3 47  ? -2.715  45.133  92.676  1.00 42.76  ? 46  PRO G N   1 
ATOM   6962 C CA  . PRO H 3 47  ? -2.011  44.002  93.293  1.00 42.97  ? 46  PRO G CA  1 
ATOM   6963 C C   . PRO H 3 47  ? -2.594  43.605  94.653  1.00 44.18  ? 46  PRO G C   1 
ATOM   6964 O O   . PRO H 3 47  ? -2.718  42.421  94.952  1.00 48.28  ? 46  PRO G O   1 
ATOM   6965 C CB  . PRO H 3 47  ? -0.573  44.503  93.416  1.00 39.43  ? 46  PRO G CB  1 
ATOM   6966 C CG  . PRO H 3 47  ? -0.499  45.629  92.412  1.00 41.06  ? 46  PRO G CG  1 
ATOM   6967 C CD  . PRO H 3 47  ? -1.819  46.292  92.549  1.00 37.55  ? 46  PRO G CD  1 
ATOM   6968 N N   . GLU H 3 48  ? -2.945  44.591  95.473  1.00 36.74  ? 47  GLU G N   1 
ATOM   6969 C CA  . GLU H 3 48  ? -3.507  44.293  96.777  1.00 36.92  ? 47  GLU G CA  1 
ATOM   6970 C C   . GLU H 3 48  ? -4.692  43.357  96.623  1.00 39.93  ? 47  GLU G C   1 
ATOM   6971 O O   . GLU H 3 48  ? -4.957  42.555  97.512  1.00 46.56  ? 47  GLU G O   1 
ATOM   6972 C CB  . GLU H 3 48  ? -3.933  45.573  97.498  1.00 34.65  ? 47  GLU G CB  1 
ATOM   6973 C CG  . GLU H 3 48  ? -4.829  46.476  96.681  1.00 58.82  ? 47  GLU G CG  1 
ATOM   6974 C CD  . GLU H 3 48  ? -4.066  47.551  95.898  1.00 64.83  ? 47  GLU G CD  1 
ATOM   6975 O OE1 . GLU H 3 48  ? -3.033  47.228  95.256  1.00 56.71  ? 47  GLU G OE1 1 
ATOM   6976 O OE2 . GLU H 3 48  ? -4.522  48.720  95.920  1.00 57.06  ? 47  GLU G OE2 1 
ATOM   6977 N N   . PHE H 3 49  ? -5.399  43.444  95.497  1.00 42.50  ? 48  PHE G N   1 
ATOM   6978 C CA  . PHE H 3 49  ? -6.544  42.563  95.260  1.00 39.16  ? 48  PHE G CA  1 
ATOM   6979 C C   . PHE H 3 49  ? -6.081  41.128  95.077  1.00 43.44  ? 48  PHE G C   1 
ATOM   6980 O O   . PHE H 3 49  ? -6.723  40.194  95.564  1.00 43.58  ? 48  PHE G O   1 
ATOM   6981 C CB  . PHE H 3 49  ? -7.329  42.986  94.016  1.00 31.37  ? 48  PHE G CB  1 
ATOM   6982 C CG  . PHE H 3 49  ? -8.369  44.044  94.276  1.00 30.86  ? 48  PHE G CG  1 
ATOM   6983 C CD1 . PHE H 3 49  ? -8.214  44.965  95.305  1.00 31.50  ? 48  PHE G CD1 1 
ATOM   6984 C CD2 . PHE H 3 49  ? -9.458  44.175  93.430  1.00 27.47  ? 48  PHE G CD2 1 
ATOM   6985 C CE1 . PHE H 3 49  ? -9.127  46.009  95.484  1.00 22.62  ? 48  PHE G CE1 1 
ATOM   6986 C CE2 . PHE H 3 49  ? -10.374 45.213  93.597  1.00 33.77  ? 48  PHE G CE2 1 
ATOM   6987 C CZ  . PHE H 3 49  ? -10.204 46.133  94.626  1.00 33.07  ? 48  PHE G CZ  1 
ATOM   6988 N N   . ALA H 3 50  ? -4.969  40.955  94.370  1.00 43.13  ? 49  ALA G N   1 
ATOM   6989 C CA  . ALA H 3 50  ? -4.425  39.624  94.134  1.00 48.51  ? 49  ALA G CA  1 
ATOM   6990 C C   . ALA H 3 50  ? -4.066  38.929  95.457  1.00 49.29  ? 49  ALA G C   1 
ATOM   6991 O O   . ALA H 3 50  ? -3.969  37.701  95.519  1.00 45.50  ? 49  ALA G O   1 
ATOM   6992 C CB  . ALA H 3 50  ? -3.200  39.714  93.238  1.00 44.02  ? 49  ALA G CB  1 
ATOM   6993 N N   . GLN H 3 51  ? -3.864  39.717  96.511  1.00 45.04  ? 50  GLN G N   1 
ATOM   6994 C CA  . GLN H 3 51  ? -3.526  39.156  97.820  1.00 48.28  ? 50  GLN G CA  1 
ATOM   6995 C C   . GLN H 3 51  ? -4.767  38.603  98.523  1.00 50.46  ? 50  GLN G C   1 
ATOM   6996 O O   . GLN H 3 51  ? -4.644  37.803  99.441  1.00 55.91  ? 50  GLN G O   1 
ATOM   6997 C CB  . GLN H 3 51  ? -2.899  40.222  98.734  1.00 47.57  ? 50  GLN G CB  1 
ATOM   6998 C CG  . GLN H 3 51  ? -1.530  40.748  98.330  1.00 48.72  ? 50  GLN G CG  1 
ATOM   6999 C CD  . GLN H 3 51  ? -0.455  39.685  98.376  1.00 58.54  ? 50  GLN G CD  1 
ATOM   7000 O OE1 . GLN H 3 51  ? -0.371  38.835  97.492  1.00 64.20  ? 50  GLN G OE1 1 
ATOM   7001 N NE2 . GLN H 3 51  ? 0.371   39.721  99.416  1.00 58.37  ? 50  GLN G NE2 1 
ATOM   7002 N N   . LEU H 3 52  ? -5.955  39.026  98.094  1.00 43.79  ? 51  LEU G N   1 
ATOM   7003 C CA  . LEU H 3 52  ? -7.193  38.596  98.729  1.00 40.28  ? 51  LEU G CA  1 
ATOM   7004 C C   . LEU H 3 52  ? -8.127  37.701  97.915  1.00 43.49  ? 51  LEU G C   1 
ATOM   7005 O O   . LEU H 3 52  ? -9.038  37.099  98.477  1.00 45.86  ? 51  LEU G O   1 
ATOM   7006 C CB  . LEU H 3 52  ? -7.975  39.829  99.189  1.00 43.87  ? 51  LEU G CB  1 
ATOM   7007 C CG  . LEU H 3 52  ? -7.568  40.567  100.469 1.00 44.34  ? 51  LEU G CG  1 
ATOM   7008 C CD1 . LEU H 3 52  ? -6.125  40.276  100.821 1.00 55.77  ? 51  LEU G CD1 1 
ATOM   7009 C CD2 . LEU H 3 52  ? -7.789  42.058  100.277 1.00 37.19  ? 51  LEU G CD2 1 
ATOM   7010 N N   . ARG H 3 53  ? -7.921  37.621  96.604  1.00 44.23  ? 52  ARG G N   1 
ATOM   7011 C CA  . ARG H 3 53  ? -8.778  36.803  95.743  1.00 38.26  ? 52  ARG G CA  1 
ATOM   7012 C C   . ARG H 3 53  ? -7.972  36.275  94.580  1.00 39.04  ? 52  ARG G C   1 
ATOM   7013 O O   . ARG H 3 53  ? -6.844  36.712  94.362  1.00 43.01  ? 52  ARG G O   1 
ATOM   7014 C CB  . ARG H 3 53  ? -9.959  37.630  95.219  1.00 35.56  ? 52  ARG G CB  1 
ATOM   7015 C CG  . ARG H 3 53  ? -9.541  38.846  94.410  1.00 37.10  ? 52  ARG G CG  1 
ATOM   7016 C CD  . ARG H 3 53  ? -10.709 39.775  94.132  1.00 37.30  ? 52  ARG G CD  1 
ATOM   7017 N NE  . ARG H 3 53  ? -11.652 39.217  93.170  1.00 35.11  ? 52  ARG G NE  1 
ATOM   7018 C CZ  . ARG H 3 53  ? -12.664 39.899  92.642  1.00 39.66  ? 52  ARG G CZ  1 
ATOM   7019 N NH1 . ARG H 3 53  ? -12.867 41.160  92.986  1.00 33.45  ? 52  ARG G NH1 1 
ATOM   7020 N NH2 . ARG H 3 53  ? -13.462 39.329  91.755  1.00 31.18  ? 52  ARG G NH2 1 
ATOM   7021 N N   . SER H 3 54  ? -8.545  35.346  93.820  1.00 40.11  ? 53  SER G N   1 
ATOM   7022 C CA  . SER H 3 54  ? -7.817  34.773  92.691  1.00 40.48  ? 53  SER G CA  1 
ATOM   7023 C C   . SER H 3 54  ? -8.714  34.211  91.600  1.00 35.13  ? 53  SER G C   1 
ATOM   7024 O O   . SER H 3 54  ? -9.930  34.156  91.746  1.00 40.91  ? 53  SER G O   1 
ATOM   7025 C CB  . SER H 3 54  ? -6.892  33.659  93.189  1.00 40.01  ? 53  SER G CB  1 
ATOM   7026 O OG  . SER H 3 54  ? -7.642  32.587  93.745  1.00 44.54  ? 53  SER G OG  1 
ATOM   7027 N N   . PHE H 3 55  ? -8.089  33.792  90.507  1.00 33.33  ? 54  PHE G N   1 
ATOM   7028 C CA  . PHE H 3 55  ? -8.789  33.201  89.375  1.00 35.73  ? 54  PHE G CA  1 
ATOM   7029 C C   . PHE H 3 55  ? -7.816  32.352  88.573  1.00 40.14  ? 54  PHE G C   1 
ATOM   7030 O O   . PHE H 3 55  ? -6.743  32.816  88.182  1.00 38.81  ? 54  PHE G O   1 
ATOM   7031 C CB  . PHE H 3 55  ? -9.384  34.269  88.454  1.00 39.78  ? 54  PHE G CB  1 
ATOM   7032 C CG  . PHE H 3 55  ? -10.148 33.691  87.293  1.00 41.11  ? 54  PHE G CG  1 
ATOM   7033 C CD1 . PHE H 3 55  ? -11.312 32.965  87.509  1.00 32.29  ? 54  PHE G CD1 1 
ATOM   7034 C CD2 . PHE H 3 55  ? -9.658  33.793  85.997  1.00 44.90  ? 54  PHE G CD2 1 
ATOM   7035 C CE1 . PHE H 3 55  ? -11.977 32.336  86.448  1.00 35.09  ? 54  PHE G CE1 1 
ATOM   7036 C CE2 . PHE H 3 55  ? -10.314 33.167  84.928  1.00 41.85  ? 54  PHE G CE2 1 
ATOM   7037 C CZ  . PHE H 3 55  ? -11.474 32.436  85.159  1.00 36.93  ? 54  PHE G CZ  1 
ATOM   7038 N N   . ASP H 3 56  ? -8.196  31.102  88.337  1.00 44.81  ? 55  ASP G N   1 
ATOM   7039 C CA  . ASP H 3 56  ? -7.372  30.164  87.581  1.00 44.76  ? 55  ASP G CA  1 
ATOM   7040 C C   . ASP H 3 56  ? -7.368  30.591  86.108  1.00 45.29  ? 55  ASP G C   1 
ATOM   7041 O O   . ASP H 3 56  ? -8.413  30.643  85.473  1.00 50.25  ? 55  ASP G O   1 
ATOM   7042 C CB  . ASP H 3 56  ? -7.967  28.766  87.723  1.00 52.15  ? 55  ASP G CB  1 
ATOM   7043 C CG  . ASP H 3 56  ? -7.063  27.690  87.192  1.00 47.16  ? 55  ASP G CG  1 
ATOM   7044 O OD1 . ASP H 3 56  ? -6.313  27.948  86.228  1.00 54.31  ? 55  ASP G OD1 1 
ATOM   7045 O OD2 . ASP H 3 56  ? -7.120  26.574  87.738  1.00 56.56  ? 55  ASP G OD2 1 
ATOM   7046 N N   . PRO H 3 57  ? -6.190  30.892  85.547  1.00 43.10  ? 56  PRO G N   1 
ATOM   7047 C CA  . PRO H 3 57  ? -6.073  31.318  84.149  1.00 45.98  ? 56  PRO G CA  1 
ATOM   7048 C C   . PRO H 3 57  ? -6.606  30.285  83.153  1.00 49.86  ? 56  PRO G C   1 
ATOM   7049 O O   . PRO H 3 57  ? -7.013  30.621  82.032  1.00 46.43  ? 56  PRO G O   1 
ATOM   7050 C CB  . PRO H 3 57  ? -4.568  31.544  83.970  1.00 40.38  ? 56  PRO G CB  1 
ATOM   7051 C CG  . PRO H 3 57  ? -4.067  31.760  85.354  1.00 51.51  ? 56  PRO G CG  1 
ATOM   7052 C CD  . PRO H 3 57  ? -4.862  30.772  86.160  1.00 47.42  ? 56  PRO G CD  1 
ATOM   7053 N N   . GLN H 3 58  ? -6.578  29.020  83.547  1.00 46.20  ? 57  GLN G N   1 
ATOM   7054 C CA  . GLN H 3 58  ? -7.057  27.983  82.659  1.00 47.62  ? 57  GLN G CA  1 
ATOM   7055 C C   . GLN H 3 58  ? -8.514  28.324  82.345  1.00 48.17  ? 57  GLN G C   1 
ATOM   7056 O O   . GLN H 3 58  ? -8.998  28.074  81.244  1.00 53.49  ? 57  GLN G O   1 
ATOM   7057 C CB  . GLN H 3 58  ? -6.927  26.617  83.338  1.00 52.56  ? 57  GLN G CB  1 
ATOM   7058 C CG  . GLN H 3 58  ? -6.645  25.489  82.374  1.00 56.20  ? 57  GLN G CG  1 
ATOM   7059 C CD  . GLN H 3 58  ? -5.433  25.767  81.503  1.00 60.50  ? 57  GLN G CD  1 
ATOM   7060 O OE1 . GLN H 3 58  ? -4.331  25.963  82.007  1.00 58.10  ? 57  GLN G OE1 1 
ATOM   7061 N NE2 . GLN H 3 58  ? -5.633  25.786  80.185  1.00 60.98  ? 57  GLN G NE2 1 
ATOM   7062 N N   . GLY H 3 59  ? -9.196  28.930  83.313  1.00 43.73  ? 58  GLY G N   1 
ATOM   7063 C CA  . GLY H 3 59  ? -10.577 29.317  83.114  1.00 39.54  ? 58  GLY G CA  1 
ATOM   7064 C C   . GLY H 3 59  ? -10.688 30.201  81.892  1.00 47.78  ? 58  GLY G C   1 
ATOM   7065 O O   . GLY H 3 59  ? -11.584 30.035  81.054  1.00 49.37  ? 58  GLY G O   1 
ATOM   7066 N N   . GLY H 3 60  ? -9.758  31.143  81.785  1.00 44.86  ? 59  GLY G N   1 
ATOM   7067 C CA  . GLY H 3 60  ? -9.756  32.052  80.657  1.00 43.15  ? 59  GLY G CA  1 
ATOM   7068 C C   . GLY H 3 60  ? -9.412  31.347  79.362  1.00 43.38  ? 59  GLY G C   1 
ATOM   7069 O O   . GLY H 3 60  ? -10.042 31.601  78.337  1.00 41.42  ? 59  GLY G O   1 
ATOM   7070 N N   . LEU H 3 61  ? -8.409  30.469  79.405  1.00 44.70  ? 60  LEU G N   1 
ATOM   7071 C CA  . LEU H 3 61  ? -7.985  29.713  78.225  1.00 46.02  ? 60  LEU G CA  1 
ATOM   7072 C C   . LEU H 3 61  ? -9.095  28.796  77.682  1.00 51.64  ? 60  LEU G C   1 
ATOM   7073 O O   . LEU H 3 61  ? -9.254  28.666  76.468  1.00 49.81  ? 60  LEU G O   1 
ATOM   7074 C CB  . LEU H 3 61  ? -6.741  28.877  78.535  1.00 41.65  ? 60  LEU G CB  1 
ATOM   7075 C CG  . LEU H 3 61  ? -5.427  29.620  78.817  1.00 47.25  ? 60  LEU G CG  1 
ATOM   7076 C CD1 . LEU H 3 61  ? -4.309  28.602  79.033  1.00 43.85  ? 60  LEU G CD1 1 
ATOM   7077 C CD2 . LEU H 3 61  ? -5.074  30.540  77.661  1.00 45.12  ? 60  LEU G CD2 1 
ATOM   7078 N N   . GLN H 3 62  ? -9.853  28.158  78.571  1.00 49.97  ? 61  GLN G N   1 
ATOM   7079 C CA  . GLN H 3 62  ? -10.938 27.292  78.135  1.00 49.92  ? 61  GLN G CA  1 
ATOM   7080 C C   . GLN H 3 62  ? -11.955 28.095  77.318  1.00 54.34  ? 61  GLN G C   1 
ATOM   7081 O O   . GLN H 3 62  ? -12.253 27.760  76.168  1.00 59.23  ? 61  GLN G O   1 
ATOM   7082 C CB  . GLN H 3 62  ? -11.644 26.662  79.339  1.00 46.73  ? 61  GLN G CB  1 
ATOM   7083 C CG  . GLN H 3 62  ? -12.934 25.913  78.980  1.00 47.95  ? 61  GLN G CG  1 
ATOM   7084 C CD  . GLN H 3 62  ? -12.688 24.630  78.194  1.00 50.92  ? 61  GLN G CD  1 
ATOM   7085 O OE1 . GLN H 3 62  ? -12.264 23.615  78.752  1.00 49.97  ? 61  GLN G OE1 1 
ATOM   7086 N NE2 . GLN H 3 62  ? -12.947 24.675  76.893  1.00 47.19  ? 61  GLN G NE2 1 
ATOM   7087 N N   . ASN H 3 63  ? -12.480 29.160  77.916  1.00 53.02  ? 62  ASN G N   1 
ATOM   7088 C CA  . ASN H 3 63  ? -13.474 29.997  77.255  1.00 48.30  ? 62  ASN G CA  1 
ATOM   7089 C C   . ASN H 3 63  ? -12.943 30.735  76.028  1.00 44.97  ? 62  ASN G C   1 
ATOM   7090 O O   . ASN H 3 63  ? -13.708 31.131  75.158  1.00 47.11  ? 62  ASN G O   1 
ATOM   7091 C CB  . ASN H 3 63  ? -14.069 30.961  78.278  1.00 43.52  ? 62  ASN G CB  1 
ATOM   7092 C CG  . ASN H 3 63  ? -14.830 30.229  79.371  1.00 50.46  ? 62  ASN G CG  1 
ATOM   7093 O OD1 . ASN H 3 63  ? -15.889 29.659  79.121  1.00 51.42  ? 62  ASN G OD1 1 
ATOM   7094 N ND2 . ASN H 3 63  ? -14.282 30.221  80.580  1.00 37.78  ? 62  ASN G ND2 1 
ATOM   7095 N N   . ILE H 3 64  ? -11.632 30.919  75.954  1.00 48.55  ? 63  ILE G N   1 
ATOM   7096 C CA  . ILE H 3 64  ? -11.036 31.569  74.796  1.00 45.73  ? 63  ILE G CA  1 
ATOM   7097 C C   . ILE H 3 64  ? -11.149 30.581  73.637  1.00 51.23  ? 63  ILE G C   1 
ATOM   7098 O O   . ILE H 3 64  ? -11.465 30.958  72.507  1.00 50.56  ? 63  ILE G O   1 
ATOM   7099 C CB  . ILE H 3 64  ? -9.544  31.910  75.047  1.00 45.21  ? 63  ILE G CB  1 
ATOM   7100 C CG1 . ILE H 3 64  ? -9.447  33.193  75.866  1.00 52.72  ? 63  ILE G CG1 1 
ATOM   7101 C CG2 . ILE H 3 64  ? -8.789  32.067  73.724  1.00 27.91  ? 63  ILE G CG2 1 
ATOM   7102 C CD1 . ILE H 3 64  ? -10.055 34.412  75.175  1.00 57.88  ? 63  ILE G CD1 1 
ATOM   7103 N N   . ALA H 3 65  ? -10.895 29.309  73.933  1.00 52.13  ? 64  ALA G N   1 
ATOM   7104 C CA  . ALA H 3 65  ? -10.969 28.255  72.929  1.00 55.17  ? 64  ALA G CA  1 
ATOM   7105 C C   . ALA H 3 65  ? -12.397 28.128  72.391  1.00 56.97  ? 64  ALA G C   1 
ATOM   7106 O O   . ALA H 3 65  ? -12.605 27.730  71.238  1.00 58.79  ? 64  ALA G O   1 
ATOM   7107 C CB  . ALA H 3 65  ? -10.511 26.932  73.532  1.00 54.89  ? 64  ALA G CB  1 
ATOM   7108 N N   . THR H 3 66  ? -13.376 28.454  73.234  1.00 50.04  ? 65  THR G N   1 
ATOM   7109 C CA  . THR H 3 66  ? -14.773 28.395  72.831  1.00 47.87  ? 65  THR G CA  1 
ATOM   7110 C C   . THR H 3 66  ? -15.071 29.576  71.912  1.00 53.75  ? 65  THR G C   1 
ATOM   7111 O O   . THR H 3 66  ? -15.903 29.483  71.007  1.00 53.29  ? 65  THR G O   1 
ATOM   7112 C CB  . THR H 3 66  ? -15.711 28.449  74.048  1.00 43.61  ? 65  THR G CB  1 
ATOM   7113 O OG1 . THR H 3 66  ? -15.604 27.224  74.776  1.00 44.05  ? 65  THR G OG1 1 
ATOM   7114 C CG2 . THR H 3 66  ? -17.162 28.655  73.608  1.00 36.14  ? 65  THR G CG2 1 
ATOM   7115 N N   . GLY H 3 67  ? -14.388 30.689  72.158  1.00 52.92  ? 66  GLY G N   1 
ATOM   7116 C CA  . GLY H 3 67  ? -14.576 31.863  71.332  1.00 53.39  ? 66  GLY G CA  1 
ATOM   7117 C C   . GLY H 3 67  ? -14.036 31.553  69.952  1.00 54.38  ? 66  GLY G C   1 
ATOM   7118 O O   . GLY H 3 67  ? -14.617 31.944  68.940  1.00 54.10  ? 66  GLY G O   1 
ATOM   7119 N N   . LYS H 3 68  ? -12.913 30.843  69.920  1.00 54.12  ? 67  LYS G N   1 
ATOM   7120 C CA  . LYS H 3 68  ? -12.292 30.449  68.667  1.00 54.69  ? 67  LYS G CA  1 
ATOM   7121 C C   . LYS H 3 68  ? -13.263 29.532  67.939  1.00 56.83  ? 67  LYS G C   1 
ATOM   7122 O O   . LYS H 3 68  ? -13.357 29.559  66.716  1.00 57.32  ? 67  LYS G O   1 
ATOM   7123 C CB  . LYS H 3 68  ? -10.984 29.708  68.934  1.00 54.90  ? 67  LYS G CB  1 
ATOM   7124 C CG  . LYS H 3 68  ? -10.177 29.390  67.685  1.00 51.27  ? 67  LYS G CG  1 
ATOM   7125 C CD  . LYS H 3 68  ? -8.929  28.585  68.024  1.00 45.20  ? 67  LYS G CD  1 
ATOM   7126 C CE  . LYS H 3 68  ? -8.168  28.200  66.771  1.00 47.32  ? 67  LYS G CE  1 
ATOM   7127 N NZ  . LYS H 3 68  ? -6.977  27.361  67.073  1.00 50.70  ? 67  LYS G NZ  1 
ATOM   7128 N N   . HIS H 3 69  ? -13.992 28.731  68.710  1.00 57.91  ? 68  HIS G N   1 
ATOM   7129 C CA  . HIS H 3 69  ? -14.973 27.799  68.166  1.00 58.36  ? 68  HIS G CA  1 
ATOM   7130 C C   . HIS H 3 69  ? -16.232 28.485  67.643  1.00 59.49  ? 68  HIS G C   1 
ATOM   7131 O O   . HIS H 3 69  ? -16.669 28.208  66.528  1.00 63.01  ? 68  HIS G O   1 
ATOM   7132 C CB  . HIS H 3 69  ? -15.378 26.786  69.232  1.00 60.39  ? 68  HIS G CB  1 
ATOM   7133 C CG  . HIS H 3 69  ? -16.540 25.929  68.837  1.00 64.37  ? 68  HIS G CG  1 
ATOM   7134 N ND1 . HIS H 3 69  ? -16.401 24.796  68.064  1.00 65.35  ? 68  HIS G ND1 1 
ATOM   7135 C CD2 . HIS H 3 69  ? -17.864 26.050  69.094  1.00 62.23  ? 68  HIS G CD2 1 
ATOM   7136 C CE1 . HIS H 3 69  ? -17.589 24.254  67.866  1.00 61.84  ? 68  HIS G CE1 1 
ATOM   7137 N NE2 . HIS H 3 69  ? -18.494 24.995  68.480  1.00 58.36  ? 68  HIS G NE2 1 
ATOM   7138 N N   . ASN H 3 70  ? -16.834 29.354  68.454  1.00 60.11  ? 69  ASN G N   1 
ATOM   7139 C CA  . ASN H 3 70  ? -18.042 30.053  68.027  1.00 56.08  ? 69  ASN G CA  1 
ATOM   7140 C C   . ASN H 3 70  ? -17.727 30.985  66.872  1.00 56.63  ? 69  ASN G C   1 
ATOM   7141 O O   . ASN H 3 70  ? -18.513 31.095  65.940  1.00 62.98  ? 69  ASN G O   1 
ATOM   7142 C CB  . ASN H 3 70  ? -18.684 30.813  69.186  1.00 52.26  ? 69  ASN G CB  1 
ATOM   7143 C CG  . ASN H 3 70  ? -19.399 29.884  70.158  1.00 63.60  ? 69  ASN G CG  1 
ATOM   7144 O OD1 . ASN H 3 70  ? -19.851 28.802  69.772  1.00 66.46  ? 69  ASN G OD1 1 
ATOM   7145 N ND2 . ASN H 3 70  ? -19.521 30.305  71.418  1.00 54.93  ? 69  ASN G ND2 1 
ATOM   7146 N N   . LEU H 3 71  ? -16.593 31.675  66.927  1.00 58.82  ? 70  LEU G N   1 
ATOM   7147 C CA  . LEU H 3 71  ? -16.213 32.507  65.794  1.00 59.25  ? 70  LEU G CA  1 
ATOM   7148 C C   . LEU H 3 71  ? -15.934 31.377  64.819  1.00 66.56  ? 70  LEU G C   1 
ATOM   7149 O O   . LEU H 3 71  ? -15.369 30.360  65.214  1.00 75.85  ? 70  LEU G O   1 
ATOM   7150 C CB  . LEU H 3 71  ? -14.919 33.279  66.063  1.00 53.00  ? 70  LEU G CB  1 
ATOM   7151 C CG  . LEU H 3 71  ? -14.440 34.132  64.881  1.00 54.73  ? 70  LEU G CG  1 
ATOM   7152 C CD1 . LEU H 3 71  ? -15.430 35.252  64.649  1.00 55.14  ? 70  LEU G CD1 1 
ATOM   7153 C CD2 . LEU H 3 71  ? -13.064 34.709  65.151  1.00 52.31  ? 70  LEU G CD2 1 
ATOM   7154 N N   . GLY H 3 72  ? -16.320 31.518  63.563  1.00 66.68  ? 71  GLY G N   1 
ATOM   7155 C CA  . GLY H 3 72  ? -16.094 30.416  62.643  1.00 67.51  ? 71  GLY G CA  1 
ATOM   7156 C C   . GLY H 3 72  ? -17.445 29.769  62.418  1.00 63.75  ? 71  GLY G C   1 
ATOM   7157 O O   . GLY H 3 72  ? -17.886 29.619  61.282  1.00 63.83  ? 71  GLY G O   1 
ATOM   7158 N N   . VAL H 3 73  ? -18.107 29.378  63.501  1.00 55.41  ? 72  VAL G N   1 
ATOM   7159 C CA  . VAL H 3 73  ? -19.441 28.819  63.380  1.00 58.88  ? 72  VAL G CA  1 
ATOM   7160 C C   . VAL H 3 73  ? -20.340 29.987  62.977  1.00 65.37  ? 72  VAL G C   1 
ATOM   7161 O O   . VAL H 3 73  ? -21.148 29.876  62.053  1.00 71.42  ? 72  VAL G O   1 
ATOM   7162 C CB  . VAL H 3 73  ? -19.945 28.234  64.716  1.00 58.72  ? 72  VAL G CB  1 
ATOM   7163 C CG1 . VAL H 3 73  ? -21.462 28.056  64.684  1.00 45.70  ? 72  VAL G CG1 1 
ATOM   7164 C CG2 . VAL H 3 73  ? -19.269 26.907  64.973  1.00 56.56  ? 72  VAL G CG2 1 
ATOM   7165 N N   . LEU H 3 74  ? -20.181 31.113  63.671  1.00 65.08  ? 73  LEU G N   1 
ATOM   7166 C CA  . LEU H 3 74  ? -20.972 32.312  63.391  1.00 63.30  ? 73  LEU G CA  1 
ATOM   7167 C C   . LEU H 3 74  ? -20.489 33.012  62.127  1.00 60.25  ? 73  LEU G C   1 
ATOM   7168 O O   . LEU H 3 74  ? -21.272 33.643  61.426  1.00 59.20  ? 73  LEU G O   1 
ATOM   7169 C CB  . LEU H 3 74  ? -20.916 33.287  64.578  1.00 59.04  ? 73  LEU G CB  1 
ATOM   7170 C CG  . LEU H 3 74  ? -21.829 33.027  65.782  1.00 56.39  ? 73  LEU G CG  1 
ATOM   7171 C CD1 . LEU H 3 74  ? -23.252 33.370  65.409  1.00 60.02  ? 73  LEU G CD1 1 
ATOM   7172 C CD2 . LEU H 3 74  ? -21.727 31.574  66.238  1.00 52.62  ? 73  LEU G CD2 1 
ATOM   7173 N N   . THR H 3 75  ? -19.198 32.903  61.834  1.00 67.77  ? 74  THR G N   1 
ATOM   7174 C CA  . THR H 3 75  ? -18.653 33.535  60.636  1.00 73.96  ? 74  THR G CA  1 
ATOM   7175 C C   . THR H 3 75  ? -19.274 32.890  59.393  1.00 76.50  ? 74  THR G C   1 
ATOM   7176 O O   . THR H 3 75  ? -19.575 33.574  58.413  1.00 77.92  ? 74  THR G O   1 
ATOM   7177 C CB  . THR H 3 75  ? -17.112 33.397  60.572  1.00 73.42  ? 74  THR G CB  1 
ATOM   7178 O OG1 . THR H 3 75  ? -16.529 33.979  61.745  1.00 76.66  ? 74  THR G OG1 1 
ATOM   7179 C CG2 . THR H 3 75  ? -16.559 34.111  59.340  1.00 71.15  ? 74  THR G CG2 1 
ATOM   7180 N N   . LYS H 3 76  ? -19.468 31.575  59.440  1.00 74.20  ? 75  LYS G N   1 
ATOM   7181 C CA  . LYS H 3 76  ? -20.064 30.859  58.320  1.00 74.79  ? 75  LYS G CA  1 
ATOM   7182 C C   . LYS H 3 76  ? -21.565 31.110  58.306  1.00 71.96  ? 75  LYS G C   1 
ATOM   7183 O O   . LYS H 3 76  ? -22.126 31.497  57.287  1.00 72.18  ? 75  LYS G O   1 
ATOM   7184 C CB  . LYS H 3 76  ? -19.800 29.358  58.441  1.00 80.29  ? 75  LYS G CB  1 
ATOM   7185 C CG  . LYS H 3 76  ? -20.321 28.538  57.267  1.00 89.38  ? 75  LYS G CG  1 
ATOM   7186 C CD  . LYS H 3 76  ? -20.159 27.040  57.516  1.00 93.88  ? 75  LYS G CD  1 
ATOM   7187 C CE  . LYS H 3 76  ? -20.475 26.220  56.270  1.00 93.88  ? 75  LYS G CE  1 
ATOM   7188 N NZ  . LYS H 3 76  ? -19.496 26.468  55.172  1.00 89.14  ? 75  LYS G NZ  1 
ATOM   7189 N N   . ARG H 3 77  ? -22.210 30.893  59.447  1.00 67.19  ? 76  ARG G N   1 
ATOM   7190 C CA  . ARG H 3 77  ? -23.646 31.097  59.564  1.00 64.59  ? 76  ARG G CA  1 
ATOM   7191 C C   . ARG H 3 77  ? -24.067 32.496  59.124  1.00 67.75  ? 76  ARG G C   1 
ATOM   7192 O O   . ARG H 3 77  ? -25.180 32.690  58.651  1.00 71.73  ? 76  ARG G O   1 
ATOM   7193 C CB  . ARG H 3 77  ? -24.098 30.878  61.007  1.00 66.43  ? 76  ARG G CB  1 
ATOM   7194 C CG  . ARG H 3 77  ? -25.603 30.966  61.192  1.00 60.54  ? 76  ARG G CG  1 
ATOM   7195 C CD  . ARG H 3 77  ? -25.975 31.094  62.654  1.00 61.70  ? 76  ARG G CD  1 
ATOM   7196 N NE  . ARG H 3 77  ? -25.476 29.980  63.448  1.00 59.73  ? 76  ARG G NE  1 
ATOM   7197 C CZ  . ARG H 3 77  ? -25.693 29.845  64.752  1.00 61.48  ? 76  ARG G CZ  1 
ATOM   7198 N NH1 . ARG H 3 77  ? -26.396 30.759  65.403  1.00 63.17  ? 76  ARG G NH1 1 
ATOM   7199 N NH2 . ARG H 3 77  ? -25.215 28.793  65.404  1.00 65.50  ? 76  ARG G NH2 1 
ATOM   7200 N N   . SER H 3 78  ? -23.186 33.473  59.291  1.00 69.11  ? 77  SER G N   1 
ATOM   7201 C CA  . SER H 3 78  ? -23.501 34.846  58.898  1.00 71.57  ? 77  SER G CA  1 
ATOM   7202 C C   . SER H 3 78  ? -23.240 35.005  57.411  1.00 70.82  ? 77  SER G C   1 
ATOM   7203 O O   . SER H 3 78  ? -23.293 36.112  56.876  1.00 66.64  ? 77  SER G O   1 
ATOM   7204 C CB  . SER H 3 78  ? -22.609 35.838  59.638  1.00 70.57  ? 77  SER G CB  1 
ATOM   7205 O OG  . SER H 3 78  ? -21.324 35.884  59.032  1.00 67.07  ? 77  SER G OG  1 
ATOM   7206 N N   . ASN H 3 79  ? -22.957 33.891  56.749  1.00 71.92  ? 78  ASN G N   1 
ATOM   7207 C CA  . ASN H 3 79  ? -22.641 33.912  55.331  1.00 73.79  ? 78  ASN G CA  1 
ATOM   7208 C C   . ASN H 3 79  ? -21.423 34.819  55.160  1.00 69.92  ? 78  ASN G C   1 
ATOM   7209 O O   . ASN H 3 79  ? -21.276 35.532  54.168  1.00 69.02  ? 78  ASN G O   1 
ATOM   7210 C CB  . ASN H 3 79  ? -23.843 34.402  54.500  1.00 75.02  ? 78  ASN G CB  1 
ATOM   7211 C CG  . ASN H 3 79  ? -24.953 33.348  54.394  1.00 80.52  ? 78  ASN G CG  1 
ATOM   7212 O OD1 . ASN H 3 79  ? -24.680 32.179  54.109  1.00 77.66  ? 78  ASN G OD1 1 
ATOM   7213 N ND2 . ASN H 3 79  ? -26.206 33.763  54.613  1.00 78.46  ? 78  ASN G ND2 1 
ATOM   7214 N N   . SER H 3 80  ? -20.563 34.788  56.174  1.00 66.97  ? 79  SER G N   1 
ATOM   7215 C CA  . SER H 3 80  ? -19.311 35.537  56.194  1.00 64.76  ? 79  SER G CA  1 
ATOM   7216 C C   . SER H 3 80  ? -19.390 37.065  56.190  1.00 62.45  ? 79  SER G C   1 
ATOM   7217 O O   . SER H 3 80  ? -18.652 37.722  55.454  1.00 58.78  ? 79  SER G O   1 
ATOM   7218 C CB  . SER H 3 80  ? -18.429 35.067  55.032  1.00 63.68  ? 79  SER G CB  1 
ATOM   7219 O OG  . SER H 3 80  ? -17.144 35.658  55.077  1.00 69.88  ? 79  SER G OG  1 
ATOM   7220 N N   . THR H 3 81  ? -20.266 37.637  57.012  1.00 59.57  ? 80  THR G N   1 
ATOM   7221 C CA  . THR H 3 81  ? -20.369 39.091  57.084  1.00 60.23  ? 80  THR G CA  1 
ATOM   7222 C C   . THR H 3 81  ? -19.193 39.620  57.912  1.00 61.61  ? 80  THR G C   1 
ATOM   7223 O O   . THR H 3 81  ? -19.000 39.216  59.059  1.00 63.37  ? 80  THR G O   1 
ATOM   7224 C CB  . THR H 3 81  ? -21.665 39.546  57.770  1.00 62.51  ? 80  THR G CB  1 
ATOM   7225 O OG1 . THR H 3 81  ? -22.791 38.915  57.150  1.00 62.26  ? 80  THR G OG1 1 
ATOM   7226 C CG2 . THR H 3 81  ? -21.807 41.062  57.659  1.00 54.15  ? 80  THR G CG2 1 
ATOM   7227 N N   . PRO H 3 82  ? -18.394 40.533  57.340  1.00 61.72  ? 81  PRO G N   1 
ATOM   7228 C CA  . PRO H 3 82  ? -17.240 41.106  58.037  1.00 58.97  ? 81  PRO G CA  1 
ATOM   7229 C C   . PRO H 3 82  ? -17.658 42.230  58.986  1.00 59.96  ? 81  PRO G C   1 
ATOM   7230 O O   . PRO H 3 82  ? -18.796 42.701  58.945  1.00 63.59  ? 81  PRO G O   1 
ATOM   7231 C CB  . PRO H 3 82  ? -16.380 41.611  56.890  1.00 59.49  ? 81  PRO G CB  1 
ATOM   7232 C CG  . PRO H 3 82  ? -17.424 42.163  55.960  1.00 61.75  ? 81  PRO G CG  1 
ATOM   7233 C CD  . PRO H 3 82  ? -18.524 41.105  55.986  1.00 60.84  ? 81  PRO G CD  1 
ATOM   7234 N N   . ALA H 3 83  ? -16.737 42.665  59.835  1.00 57.59  ? 82  ALA G N   1 
ATOM   7235 C CA  . ALA H 3 83  ? -17.044 43.734  60.778  1.00 55.04  ? 82  ALA G CA  1 
ATOM   7236 C C   . ALA H 3 83  ? -16.983 45.120  60.134  1.00 48.96  ? 82  ALA G C   1 
ATOM   7237 O O   . ALA H 3 83  ? -16.148 45.384  59.267  1.00 42.65  ? 82  ALA G O   1 
ATOM   7238 C CB  . ALA H 3 83  ? -16.094 43.669  61.962  1.00 52.77  ? 82  ALA G CB  1 
ATOM   7239 N N   . THR H 3 84  ? -17.872 46.001  60.576  1.00 47.99  ? 83  THR G N   1 
ATOM   7240 C CA  . THR H 3 84  ? -17.922 47.364  60.062  1.00 56.06  ? 83  THR G CA  1 
ATOM   7241 C C   . THR H 3 84  ? -17.069 48.325  60.902  1.00 56.43  ? 83  THR G C   1 
ATOM   7242 O O   . THR H 3 84  ? -17.431 48.666  62.031  1.00 62.18  ? 83  THR G O   1 
ATOM   7243 C CB  . THR H 3 84  ? -19.376 47.889  60.035  1.00 60.65  ? 83  THR G CB  1 
ATOM   7244 O OG1 . THR H 3 84  ? -20.184 47.022  59.226  1.00 64.76  ? 83  THR G OG1 1 
ATOM   7245 C CG2 . THR H 3 84  ? -19.424 49.310  59.467  1.00 46.86  ? 83  THR G CG2 1 
ATOM   7246 N N   . ASN H 3 85  ? -15.941 48.758  60.347  1.00 52.44  ? 84  ASN G N   1 
ATOM   7247 C CA  . ASN H 3 85  ? -15.049 49.688  61.033  1.00 53.98  ? 84  ASN G CA  1 
ATOM   7248 C C   . ASN H 3 85  ? -15.749 50.958  61.520  1.00 53.37  ? 84  ASN G C   1 
ATOM   7249 O O   . ASN H 3 85  ? -16.646 51.481  60.854  1.00 53.88  ? 84  ASN G O   1 
ATOM   7250 C CB  . ASN H 3 85  ? -13.903 50.132  60.115  1.00 47.39  ? 84  ASN G CB  1 
ATOM   7251 C CG  . ASN H 3 85  ? -12.906 49.038  59.843  1.00 54.54  ? 84  ASN G CG  1 
ATOM   7252 O OD1 . ASN H 3 85  ? -12.652 48.187  60.693  1.00 64.51  ? 84  ASN G OD1 1 
ATOM   7253 N ND2 . ASN H 3 85  ? -12.306 49.068  58.655  1.00 61.40  ? 84  ASN G ND2 1 
ATOM   7254 N N   . GLU H 3 86  ? -15.322 51.449  62.680  1.00 49.59  ? 85  GLU G N   1 
ATOM   7255 C CA  . GLU H 3 86  ? -15.843 52.695  63.243  1.00 49.45  ? 85  GLU G CA  1 
ATOM   7256 C C   . GLU H 3 86  ? -14.621 53.597  63.395  1.00 45.91  ? 85  GLU G C   1 
ATOM   7257 O O   . GLU H 3 86  ? -13.491 53.151  63.179  1.00 45.44  ? 85  GLU G O   1 
ATOM   7258 C CB  . GLU H 3 86  ? -16.456 52.464  64.618  1.00 49.79  ? 85  GLU G CB  1 
ATOM   7259 C CG  . GLU H 3 86  ? -17.575 51.458  64.648  1.00 62.30  ? 85  GLU G CG  1 
ATOM   7260 C CD  . GLU H 3 86  ? -18.860 51.996  64.067  1.00 68.42  ? 85  GLU G CD  1 
ATOM   7261 O OE1 . GLU H 3 86  ? -19.308 53.081  64.508  1.00 67.01  ? 85  GLU G OE1 1 
ATOM   7262 O OE2 . GLU H 3 86  ? -19.422 51.321  63.179  1.00 72.98  ? 85  GLU G OE2 1 
ATOM   7263 N N   . ALA H 3 87  ? -14.836 54.861  63.743  1.00 43.01  ? 86  ALA G N   1 
ATOM   7264 C CA  . ALA H 3 87  ? -13.720 55.780  63.937  1.00 43.98  ? 86  ALA G CA  1 
ATOM   7265 C C   . ALA H 3 87  ? -13.687 56.057  65.427  1.00 48.15  ? 86  ALA G C   1 
ATOM   7266 O O   . ALA H 3 87  ? -14.684 56.488  66.007  1.00 48.49  ? 86  ALA G O   1 
ATOM   7267 C CB  . ALA H 3 87  ? -13.933 57.073  63.159  1.00 36.02  ? 86  ALA G CB  1 
ATOM   7268 N N   . PRO H 3 88  ? -12.544 55.790  66.071  1.00 46.27  ? 87  PRO G N   1 
ATOM   7269 C CA  . PRO H 3 88  ? -12.370 56.003  67.505  1.00 49.46  ? 87  PRO G CA  1 
ATOM   7270 C C   . PRO H 3 88  ? -12.274 57.490  67.765  1.00 47.91  ? 87  PRO G C   1 
ATOM   7271 O O   . PRO H 3 88  ? -11.961 58.263  66.859  1.00 45.64  ? 87  PRO G O   1 
ATOM   7272 C CB  . PRO H 3 88  ? -11.042 55.313  67.812  1.00 48.76  ? 87  PRO G CB  1 
ATOM   7273 C CG  . PRO H 3 88  ? -10.724 54.521  66.574  1.00 53.62  ? 87  PRO G CG  1 
ATOM   7274 C CD  . PRO H 3 88  ? -11.283 55.346  65.473  1.00 49.74  ? 87  PRO G CD  1 
ATOM   7275 N N   . GLN H 3 89  ? -12.546 57.880  69.002  1.00 45.74  ? 88  GLN G N   1 
ATOM   7276 C CA  . GLN H 3 89  ? -12.462 59.273  69.387  1.00 48.50  ? 88  GLN G CA  1 
ATOM   7277 C C   . GLN H 3 89  ? -11.607 59.345  70.650  1.00 44.80  ? 88  GLN G C   1 
ATOM   7278 O O   . GLN H 3 89  ? -11.856 58.640  71.628  1.00 37.27  ? 88  GLN G O   1 
ATOM   7279 C CB  . GLN H 3 89  ? -13.857 59.835  69.651  1.00 55.40  ? 88  GLN G CB  1 
ATOM   7280 C CG  . GLN H 3 89  ? -13.932 61.351  69.508  1.00 67.77  ? 88  GLN G CG  1 
ATOM   7281 C CD  . GLN H 3 89  ? -15.304 61.908  69.853  1.00 77.09  ? 88  GLN G CD  1 
ATOM   7282 O OE1 . GLN H 3 89  ? -16.329 61.457  69.325  1.00 73.17  ? 88  GLN G OE1 1 
ATOM   7283 N NE2 . GLN H 3 89  ? -15.331 62.897  70.743  1.00 77.14  ? 88  GLN G NE2 1 
ATOM   7284 N N   . ALA H 3 90  ? -10.587 60.188  70.621  1.00 40.86  ? 89  ALA G N   1 
ATOM   7285 C CA  . ALA H 3 90  ? -9.716  60.315  71.765  1.00 40.62  ? 89  ALA G CA  1 
ATOM   7286 C C   . ALA H 3 90  ? -9.939  61.592  72.559  1.00 44.92  ? 89  ALA G C   1 
ATOM   7287 O O   . ALA H 3 90  ? -10.337 62.620  72.016  1.00 41.62  ? 89  ALA G O   1 
ATOM   7288 C CB  . ALA H 3 90  ? -8.280  60.230  71.318  1.00 40.13  ? 89  ALA G CB  1 
ATOM   7289 N N   . THR H 3 91  ? -9.690  61.493  73.861  1.00 39.70  ? 90  THR G N   1 
ATOM   7290 C CA  . THR H 3 91  ? -9.804  62.608  74.784  1.00 33.89  ? 90  THR G CA  1 
ATOM   7291 C C   . THR H 3 91  ? -8.615  62.496  75.721  1.00 38.05  ? 90  THR G C   1 
ATOM   7292 O O   . THR H 3 91  ? -8.391  61.440  76.321  1.00 37.47  ? 90  THR G O   1 
ATOM   7293 C CB  . THR H 3 91  ? -11.068 62.522  75.629  1.00 42.25  ? 90  THR G CB  1 
ATOM   7294 O OG1 . THR H 3 91  ? -12.217 62.627  74.786  1.00 52.09  ? 90  THR G OG1 1 
ATOM   7295 C CG2 . THR H 3 91  ? -11.086 63.640  76.650  1.00 41.39  ? 90  THR G CG2 1 
ATOM   7296 N N   . VAL H 3 92  ? -7.851  63.574  75.845  1.00 34.89  ? 91  VAL G N   1 
ATOM   7297 C CA  . VAL H 3 92  ? -6.685  63.572  76.709  1.00 36.88  ? 91  VAL G CA  1 
ATOM   7298 C C   . VAL H 3 92  ? -6.851  64.454  77.952  1.00 40.84  ? 91  VAL G C   1 
ATOM   7299 O O   . VAL H 3 92  ? -7.248  65.621  77.855  1.00 38.79  ? 91  VAL G O   1 
ATOM   7300 C CB  . VAL H 3 92  ? -5.438  64.013  75.932  1.00 31.50  ? 91  VAL G CB  1 
ATOM   7301 C CG1 . VAL H 3 92  ? -4.280  64.228  76.886  1.00 49.98  ? 91  VAL G CG1 1 
ATOM   7302 C CG2 . VAL H 3 92  ? -5.060  62.952  74.941  1.00 36.12  ? 91  VAL G CG2 1 
ATOM   7303 N N   . PHE H 3 93  ? -6.544  63.884  79.117  1.00 33.68  ? 92  PHE G N   1 
ATOM   7304 C CA  . PHE H 3 93  ? -6.650  64.613  80.387  1.00 35.06  ? 92  PHE G CA  1 
ATOM   7305 C C   . PHE H 3 93  ? -5.674  64.103  81.462  1.00 30.04  ? 92  PHE G C   1 
ATOM   7306 O O   . PHE H 3 93  ? -5.279  62.937  81.473  1.00 25.45  ? 92  PHE G O   1 
ATOM   7307 C CB  . PHE H 3 93  ? -8.079  64.539  80.929  1.00 34.44  ? 92  PHE G CB  1 
ATOM   7308 C CG  . PHE H 3 93  ? -8.586  63.136  81.113  1.00 38.40  ? 92  PHE G CG  1 
ATOM   7309 C CD1 . PHE H 3 93  ? -9.182  62.449  80.057  1.00 34.48  ? 92  PHE G CD1 1 
ATOM   7310 C CD2 . PHE H 3 93  ? -8.444  62.487  82.333  1.00 30.62  ? 92  PHE G CD2 1 
ATOM   7311 C CE1 . PHE H 3 93  ? -9.626  61.137  80.215  1.00 28.82  ? 92  PHE G CE1 1 
ATOM   7312 C CE2 . PHE H 3 93  ? -8.889  61.170  82.497  1.00 36.55  ? 92  PHE G CE2 1 
ATOM   7313 C CZ  . PHE H 3 93  ? -9.481  60.496  81.432  1.00 31.97  ? 92  PHE G CZ  1 
ATOM   7314 N N   . PRO H 3 94  ? -5.269  64.987  82.382  1.00 33.94  ? 93  PRO G N   1 
ATOM   7315 C CA  . PRO H 3 94  ? -4.339  64.614  83.452  1.00 31.92  ? 93  PRO G CA  1 
ATOM   7316 C C   . PRO H 3 94  ? -5.093  63.942  84.599  1.00 29.35  ? 93  PRO G C   1 
ATOM   7317 O O   . PRO H 3 94  ? -6.218  64.328  84.919  1.00 29.31  ? 93  PRO G O   1 
ATOM   7318 C CB  . PRO H 3 94  ? -3.760  65.952  83.857  1.00 29.42  ? 93  PRO G CB  1 
ATOM   7319 C CG  . PRO H 3 94  ? -4.977  66.834  83.777  1.00 25.58  ? 93  PRO G CG  1 
ATOM   7320 C CD  . PRO H 3 94  ? -5.631  66.416  82.477  1.00 31.53  ? 93  PRO G CD  1 
ATOM   7321 N N   . LYS H 3 95  ? -4.481  62.930  85.198  1.00 21.62  ? 94  LYS G N   1 
ATOM   7322 C CA  . LYS H 3 95  ? -5.096  62.218  86.314  1.00 32.59  ? 94  LYS G CA  1 
ATOM   7323 C C   . LYS H 3 95  ? -5.285  63.132  87.530  1.00 32.46  ? 94  LYS G C   1 
ATOM   7324 O O   . LYS H 3 95  ? -6.294  63.049  88.223  1.00 33.87  ? 94  LYS G O   1 
ATOM   7325 C CB  . LYS H 3 95  ? -4.225  61.020  86.716  1.00 34.12  ? 94  LYS G CB  1 
ATOM   7326 C CG  . LYS H 3 95  ? -4.723  60.230  87.913  1.00 31.96  ? 94  LYS G CG  1 
ATOM   7327 C CD  . LYS H 3 95  ? -3.815  59.022  88.165  1.00 37.71  ? 94  LYS G CD  1 
ATOM   7328 C CE  . LYS H 3 95  ? -3.961  58.468  89.588  1.00 32.28  ? 94  LYS G CE  1 
ATOM   7329 N NZ  . LYS H 3 95  ? -5.376  58.146  89.962  1.00 31.30  ? 94  LYS G NZ  1 
ATOM   7330 N N   . SER H 3 96  ? -4.319  64.013  87.765  1.00 26.11  ? 95  SER G N   1 
ATOM   7331 C CA  . SER H 3 96  ? -4.361  64.909  88.906  1.00 36.84  ? 95  SER G CA  1 
ATOM   7332 C C   . SER H 3 96  ? -4.164  66.340  88.464  1.00 42.90  ? 95  SER G C   1 
ATOM   7333 O O   . SER H 3 96  ? -3.735  66.598  87.340  1.00 42.16  ? 95  SER G O   1 
ATOM   7334 C CB  . SER H 3 96  ? -3.245  64.547  89.898  1.00 39.10  ? 95  SER G CB  1 
ATOM   7335 O OG  . SER H 3 96  ? -3.310  63.176  90.277  1.00 49.36  ? 95  SER G OG  1 
ATOM   7336 N N   . PRO H 3 97  ? -4.463  67.302  89.353  1.00 45.12  ? 96  PRO G N   1 
ATOM   7337 C CA  . PRO H 3 97  ? -4.282  68.706  88.975  1.00 38.98  ? 96  PRO G CA  1 
ATOM   7338 C C   . PRO H 3 97  ? -2.824  68.865  88.579  1.00 39.48  ? 96  PRO G C   1 
ATOM   7339 O O   . PRO H 3 97  ? -1.944  68.263  89.196  1.00 45.72  ? 96  PRO G O   1 
ATOM   7340 C CB  . PRO H 3 97  ? -4.633  69.452  90.255  1.00 44.20  ? 96  PRO G CB  1 
ATOM   7341 C CG  . PRO H 3 97  ? -5.645  68.528  90.916  1.00 41.46  ? 96  PRO G CG  1 
ATOM   7342 C CD  . PRO H 3 97  ? -5.003  67.181  90.719  1.00 41.77  ? 96  PRO G CD  1 
ATOM   7343 N N   . VAL H 3 98  ? -2.562  69.652  87.545  1.00 36.38  ? 97  VAL G N   1 
ATOM   7344 C CA  . VAL H 3 98  ? -1.192  69.824  87.098  1.00 40.25  ? 97  VAL G CA  1 
ATOM   7345 C C   . VAL H 3 98  ? -0.458  70.876  87.914  1.00 45.07  ? 97  VAL G C   1 
ATOM   7346 O O   . VAL H 3 98  ? -0.940  71.995  88.092  1.00 49.52  ? 97  VAL G O   1 
ATOM   7347 C CB  . VAL H 3 98  ? -1.141  70.175  85.596  1.00 37.92  ? 97  VAL G CB  1 
ATOM   7348 C CG1 . VAL H 3 98  ? 0.290   70.383  85.157  1.00 40.51  ? 97  VAL G CG1 1 
ATOM   7349 C CG2 . VAL H 3 98  ? -1.748  69.039  84.786  1.00 42.43  ? 97  VAL G CG2 1 
ATOM   7350 N N   . LEU H 3 99  ? 0.712   70.498  88.416  1.00 42.11  ? 98  LEU G N   1 
ATOM   7351 C CA  . LEU H 3 99  ? 1.522   71.390  89.235  1.00 45.04  ? 98  LEU G CA  1 
ATOM   7352 C C   . LEU H 3 99  ? 2.959   71.144  88.882  1.00 34.96  ? 98  LEU G C   1 
ATOM   7353 O O   . LEU H 3 99  ? 3.415   70.009  88.939  1.00 39.93  ? 98  LEU G O   1 
ATOM   7354 C CB  . LEU H 3 99  ? 1.316   71.085  90.723  1.00 52.33  ? 98  LEU G CB  1 
ATOM   7355 C CG  . LEU H 3 99  ? -0.120  71.219  91.230  1.00 57.91  ? 98  LEU G CG  1 
ATOM   7356 C CD1 . LEU H 3 99  ? -0.289  70.519  92.575  1.00 66.04  ? 98  LEU G CD1 1 
ATOM   7357 C CD2 . LEU H 3 99  ? -0.465  72.692  91.331  1.00 63.98  ? 98  LEU G CD2 1 
ATOM   7358 N N   . LEU H 3 100 ? 3.680   72.198  88.520  1.00 31.99  ? 99  LEU G N   1 
ATOM   7359 C CA  . LEU H 3 100 ? 5.079   72.037  88.169  1.00 37.80  ? 99  LEU G CA  1 
ATOM   7360 C C   . LEU H 3 100 ? 5.821   71.407  89.344  1.00 41.49  ? 99  LEU G C   1 
ATOM   7361 O O   . LEU H 3 100 ? 5.550   71.722  90.503  1.00 40.37  ? 99  LEU G O   1 
ATOM   7362 C CB  . LEU H 3 100 ? 5.694   73.388  87.814  1.00 40.94  ? 99  LEU G CB  1 
ATOM   7363 C CG  . LEU H 3 100 ? 4.907   74.109  86.714  1.00 48.65  ? 99  LEU G CG  1 
ATOM   7364 C CD1 . LEU H 3 100 ? 3.605   74.643  87.301  1.00 50.39  ? 99  LEU G CD1 1 
ATOM   7365 C CD2 . LEU H 3 100 ? 5.731   75.252  86.134  1.00 45.44  ? 99  LEU G CD2 1 
ATOM   7366 N N   . GLY H 3 101 ? 6.736   70.496  89.035  1.00 39.63  ? 100 GLY G N   1 
ATOM   7367 C CA  . GLY H 3 101 ? 7.500   69.836  90.074  1.00 36.20  ? 100 GLY G CA  1 
ATOM   7368 C C   . GLY H 3 101 ? 6.847   68.587  90.635  1.00 36.16  ? 100 GLY G C   1 
ATOM   7369 O O   . GLY H 3 101 ? 7.477   67.841  91.374  1.00 37.49  ? 100 GLY G O   1 
ATOM   7370 N N   . GLN H 3 102 ? 5.592   68.336  90.281  1.00 36.63  ? 101 GLN G N   1 
ATOM   7371 C CA  . GLN H 3 102 ? 4.910   67.167  90.809  1.00 35.70  ? 101 GLN G CA  1 
ATOM   7372 C C   . GLN H 3 102 ? 4.535   66.130  89.760  1.00 35.54  ? 101 GLN G C   1 
ATOM   7373 O O   . GLN H 3 102 ? 3.711   66.387  88.885  1.00 27.34  ? 101 GLN G O   1 
ATOM   7374 C CB  . GLN H 3 102 ? 3.652   67.593  91.577  1.00 43.76  ? 101 GLN G CB  1 
ATOM   7375 C CG  . GLN H 3 102 ? 3.882   68.677  92.635  1.00 51.24  ? 101 GLN G CG  1 
ATOM   7376 C CD  . GLN H 3 102 ? 2.727   68.801  93.627  1.00 60.91  ? 101 GLN G CD  1 
ATOM   7377 O OE1 . GLN H 3 102 ? 2.601   69.806  94.320  1.00 67.67  ? 101 GLN G OE1 1 
ATOM   7378 N NE2 . GLN H 3 102 ? 1.888   67.770  93.706  1.00 67.29  ? 101 GLN G NE2 1 
ATOM   7379 N N   . PRO H 3 103 ? 5.143   64.934  89.847  1.00 35.07  ? 102 PRO G N   1 
ATOM   7380 C CA  . PRO H 3 103 ? 4.888   63.827  88.921  1.00 33.84  ? 102 PRO G CA  1 
ATOM   7381 C C   . PRO H 3 103 ? 3.384   63.630  88.788  1.00 37.78  ? 102 PRO G C   1 
ATOM   7382 O O   . PRO H 3 103 ? 2.640   63.837  89.748  1.00 44.31  ? 102 PRO G O   1 
ATOM   7383 C CB  . PRO H 3 103 ? 5.582   62.649  89.601  1.00 41.01  ? 102 PRO G CB  1 
ATOM   7384 C CG  . PRO H 3 103 ? 6.767   63.308  90.257  1.00 32.39  ? 102 PRO G CG  1 
ATOM   7385 C CD  . PRO H 3 103 ? 6.141   64.548  90.866  1.00 31.42  ? 102 PRO G CD  1 
ATOM   7386 N N   . ASN H 3 104 ? 2.944   63.223  87.602  1.00 34.47  ? 103 ASN G N   1 
ATOM   7387 C CA  . ASN H 3 104 ? 1.521   63.058  87.323  1.00 27.51  ? 103 ASN G CA  1 
ATOM   7388 C C   . ASN H 3 104 ? 1.377   62.005  86.225  1.00 33.71  ? 103 ASN G C   1 
ATOM   7389 O O   . ASN H 3 104 ? 2.344   61.350  85.847  1.00 35.44  ? 103 ASN G O   1 
ATOM   7390 C CB  . ASN H 3 104 ? 0.954   64.411  86.842  1.00 20.80  ? 103 ASN G CB  1 
ATOM   7391 C CG  . ASN H 3 104 ? -0.550  64.530  87.022  1.00 26.81  ? 103 ASN G CG  1 
ATOM   7392 O OD1 . ASN H 3 104 ? -1.291  63.546  86.944  1.00 29.84  ? 103 ASN G OD1 1 
ATOM   7393 N ND2 . ASN H 3 104 ? -1.014  65.753  87.247  1.00 31.49  ? 103 ASN G ND2 1 
ATOM   7394 N N   . THR H 3 105 ? 0.170   61.846  85.709  1.00 32.35  ? 104 THR G N   1 
ATOM   7395 C CA  . THR H 3 105 ? -0.060  60.878  84.657  1.00 32.16  ? 104 THR G CA  1 
ATOM   7396 C C   . THR H 3 105 ? -1.024  61.461  83.637  1.00 38.49  ? 104 THR G C   1 
ATOM   7397 O O   . THR H 3 105 ? -2.077  62.000  83.998  1.00 35.54  ? 104 THR G O   1 
ATOM   7398 C CB  . THR H 3 105 ? -0.639  59.575  85.229  1.00 31.95  ? 104 THR G CB  1 
ATOM   7399 O OG1 . THR H 3 105 ? 0.306   59.008  86.135  1.00 32.99  ? 104 THR G OG1 1 
ATOM   7400 C CG2 . THR H 3 105 ? -0.913  58.556  84.117  1.00 26.34  ? 104 THR G CG2 1 
ATOM   7401 N N   . LEU H 3 106 ? -0.641  61.406  82.364  1.00 36.00  ? 105 LEU G N   1 
ATOM   7402 C CA  . LEU H 3 106 ? -1.526  61.896  81.315  1.00 31.59  ? 105 LEU G CA  1 
ATOM   7403 C C   . LEU H 3 106 ? -2.284  60.666  80.868  1.00 28.38  ? 105 LEU G C   1 
ATOM   7404 O O   . LEU H 3 106 ? -1.706  59.591  80.696  1.00 28.00  ? 105 LEU G O   1 
ATOM   7405 C CB  . LEU H 3 106 ? -0.758  62.482  80.134  1.00 33.42  ? 105 LEU G CB  1 
ATOM   7406 C CG  . LEU H 3 106 ? -0.938  63.974  79.869  1.00 41.73  ? 105 LEU G CG  1 
ATOM   7407 C CD1 . LEU H 3 106 ? -0.237  64.307  78.572  1.00 47.45  ? 105 LEU G CD1 1 
ATOM   7408 C CD2 . LEU H 3 106 ? -2.402  64.347  79.775  1.00 43.98  ? 105 LEU G CD2 1 
ATOM   7409 N N   . ILE H 3 107 ? -3.581  60.843  80.677  1.00 31.60  ? 106 ILE G N   1 
ATOM   7410 C CA  . ILE H 3 107 ? -4.465  59.764  80.297  1.00 33.46  ? 106 ILE G CA  1 
ATOM   7411 C C   . ILE H 3 107 ? -5.057  60.008  78.920  1.00 34.43  ? 106 ILE G C   1 
ATOM   7412 O O   . ILE H 3 107 ? -5.483  61.128  78.607  1.00 33.78  ? 106 ILE G O   1 
ATOM   7413 C CB  . ILE H 3 107 ? -5.632  59.651  81.322  1.00 30.44  ? 106 ILE G CB  1 
ATOM   7414 C CG1 . ILE H 3 107 ? -5.064  59.458  82.733  1.00 42.83  ? 106 ILE G CG1 1 
ATOM   7415 C CG2 . ILE H 3 107 ? -6.551  58.510  80.948  1.00 25.41  ? 106 ILE G CG2 1 
ATOM   7416 C CD1 . ILE H 3 107 ? -6.115  59.291  83.810  1.00 29.39  ? 106 ILE G CD1 1 
ATOM   7417 N N   . CYS H 3 108 ? -5.075  58.960  78.099  1.00 34.42  ? 107 CYS G N   1 
ATOM   7418 C CA  . CYS H 3 108 ? -5.669  59.052  76.777  1.00 34.09  ? 107 CYS G CA  1 
ATOM   7419 C C   . CYS H 3 108 ? -6.808  58.057  76.741  1.00 34.68  ? 107 CYS G C   1 
ATOM   7420 O O   . CYS H 3 108 ? -6.593  56.841  76.764  1.00 30.15  ? 107 CYS G O   1 
ATOM   7421 C CB  . CYS H 3 108 ? -4.683  58.713  75.661  1.00 39.79  ? 107 CYS G CB  1 
ATOM   7422 S SG  . CYS H 3 108 ? -5.412  59.071  74.019  1.00 43.26  ? 107 CYS G SG  1 
ATOM   7423 N N   . PHE H 3 109 ? -8.018  58.600  76.701  1.00 32.97  ? 108 PHE G N   1 
ATOM   7424 C CA  . PHE H 3 109 ? -9.245  57.829  76.664  1.00 34.02  ? 108 PHE G CA  1 
ATOM   7425 C C   . PHE H 3 109 ? -9.747  57.728  75.216  1.00 35.59  ? 108 PHE G C   1 
ATOM   7426 O O   . PHE H 3 109 ? -10.065 58.738  74.592  1.00 36.69  ? 108 PHE G O   1 
ATOM   7427 C CB  . PHE H 3 109 ? -10.286 58.534  77.527  1.00 30.49  ? 108 PHE G CB  1 
ATOM   7428 C CG  . PHE H 3 109 ? -11.659 57.969  77.396  1.00 32.52  ? 108 PHE G CG  1 
ATOM   7429 C CD1 . PHE H 3 109 ? -11.959 56.722  77.914  1.00 26.54  ? 108 PHE G CD1 1 
ATOM   7430 C CD2 . PHE H 3 109 ? -12.661 58.693  76.755  1.00 39.24  ? 108 PHE G CD2 1 
ATOM   7431 C CE1 . PHE H 3 109 ? -13.242 56.196  77.804  1.00 27.72  ? 108 PHE G CE1 1 
ATOM   7432 C CE2 . PHE H 3 109 ? -13.943 58.182  76.637  1.00 31.69  ? 108 PHE G CE2 1 
ATOM   7433 C CZ  . PHE H 3 109 ? -14.234 56.925  77.167  1.00 33.16  ? 108 PHE G CZ  1 
ATOM   7434 N N   . VAL H 3 110 ? -9.815  56.508  74.695  1.00 32.84  ? 109 VAL G N   1 
ATOM   7435 C CA  . VAL H 3 110 ? -10.269 56.275  73.330  1.00 32.42  ? 109 VAL G CA  1 
ATOM   7436 C C   . VAL H 3 110 ? -11.554 55.459  73.324  1.00 38.87  ? 109 VAL G C   1 
ATOM   7437 O O   . VAL H 3 110 ? -11.557 54.278  73.693  1.00 31.17  ? 109 VAL G O   1 
ATOM   7438 C CB  . VAL H 3 110 ? -9.218  55.516  72.538  1.00 34.75  ? 109 VAL G CB  1 
ATOM   7439 C CG1 . VAL H 3 110 ? -9.633  55.449  71.076  1.00 31.70  ? 109 VAL G CG1 1 
ATOM   7440 C CG2 . VAL H 3 110 ? -7.863  56.181  72.720  1.00 25.71  ? 109 VAL G CG2 1 
ATOM   7441 N N   . ASP H 3 111 ? -12.640 56.091  72.892  1.00 36.69  ? 110 ASP G N   1 
ATOM   7442 C CA  . ASP H 3 111 ? -13.940 55.446  72.858  1.00 36.09  ? 110 ASP G CA  1 
ATOM   7443 C C   . ASP H 3 111 ? -14.328 55.068  71.426  1.00 44.37  ? 110 ASP G C   1 
ATOM   7444 O O   . ASP H 3 111 ? -13.626 55.412  70.463  1.00 43.97  ? 110 ASP G O   1 
ATOM   7445 C CB  . ASP H 3 111 ? -14.993 56.393  73.443  1.00 32.61  ? 110 ASP G CB  1 
ATOM   7446 C CG  . ASP H 3 111 ? -16.164 55.655  74.063  1.00 48.76  ? 110 ASP G CG  1 
ATOM   7447 O OD1 . ASP H 3 111 ? -16.354 54.455  73.761  1.00 52.61  ? 110 ASP G OD1 1 
ATOM   7448 O OD2 . ASP H 3 111 ? -16.905 56.279  74.853  1.00 52.50  ? 110 ASP G OD2 1 
ATOM   7449 N N   . ASN H 3 112 ? -15.459 54.372  71.305  1.00 41.64  ? 111 ASN G N   1 
ATOM   7450 C CA  . ASN H 3 112 ? -15.998 53.928  70.024  1.00 40.57  ? 111 ASN G CA  1 
ATOM   7451 C C   . ASN H 3 112 ? -14.962 53.183  69.191  1.00 37.06  ? 111 ASN G C   1 
ATOM   7452 O O   . ASN H 3 112 ? -14.791 53.445  68.003  1.00 39.07  ? 111 ASN G O   1 
ATOM   7453 C CB  . ASN H 3 112 ? -16.555 55.122  69.235  1.00 42.00  ? 111 ASN G CB  1 
ATOM   7454 C CG  . ASN H 3 112 ? -17.439 54.689  68.071  1.00 48.59  ? 111 ASN G CG  1 
ATOM   7455 O OD1 . ASN H 3 112 ? -18.363 53.887  68.248  1.00 38.84  ? 111 ASN G OD1 1 
ATOM   7456 N ND2 . ASN H 3 112 ? -17.163 55.219  66.877  1.00 37.84  ? 111 ASN G ND2 1 
ATOM   7457 N N   . ILE H 3 113 ? -14.262 52.253  69.830  1.00 42.57  ? 112 ILE G N   1 
ATOM   7458 C CA  . ILE H 3 113 ? -13.253 51.472  69.145  1.00 40.52  ? 112 ILE G CA  1 
ATOM   7459 C C   . ILE H 3 113 ? -13.915 50.221  68.602  1.00 46.50  ? 112 ILE G C   1 
ATOM   7460 O O   . ILE H 3 113 ? -14.504 49.461  69.364  1.00 39.24  ? 112 ILE G O   1 
ATOM   7461 C CB  . ILE H 3 113 ? -12.127 51.037  70.091  1.00 44.29  ? 112 ILE G CB  1 
ATOM   7462 C CG1 . ILE H 3 113 ? -11.544 52.253  70.820  1.00 45.75  ? 112 ILE G CG1 1 
ATOM   7463 C CG2 . ILE H 3 113 ? -11.034 50.310  69.293  1.00 32.37  ? 112 ILE G CG2 1 
ATOM   7464 C CD1 . ILE H 3 113 ? -10.416 51.904  71.799  1.00 41.50  ? 112 ILE G CD1 1 
ATOM   7465 N N   . PHE H 3 114 ? -13.834 50.018  67.285  1.00 51.51  ? 113 PHE G N   1 
ATOM   7466 C CA  . PHE H 3 114 ? -14.423 48.833  66.663  1.00 51.10  ? 113 PHE G CA  1 
ATOM   7467 C C   . PHE H 3 114 ? -13.997 48.635  65.217  1.00 50.37  ? 113 PHE G C   1 
ATOM   7468 O O   . PHE H 3 114 ? -14.213 49.500  64.371  1.00 55.50  ? 113 PHE G O   1 
ATOM   7469 C CB  . PHE H 3 114 ? -15.949 48.874  66.712  1.00 44.18  ? 113 PHE G CB  1 
ATOM   7470 C CG  . PHE H 3 114 ? -16.584 47.580  66.313  1.00 52.21  ? 113 PHE G CG  1 
ATOM   7471 C CD1 . PHE H 3 114 ? -16.654 46.519  67.218  1.00 58.66  ? 113 PHE G CD1 1 
ATOM   7472 C CD2 . PHE H 3 114 ? -17.052 47.388  65.014  1.00 47.75  ? 113 PHE G CD2 1 
ATOM   7473 C CE1 . PHE H 3 114 ? -17.180 45.277  66.834  1.00 56.33  ? 113 PHE G CE1 1 
ATOM   7474 C CE2 . PHE H 3 114 ? -17.577 46.155  64.618  1.00 55.94  ? 113 PHE G CE2 1 
ATOM   7475 C CZ  . PHE H 3 114 ? -17.640 45.097  65.531  1.00 56.19  ? 113 PHE G CZ  1 
ATOM   7476 N N   . PRO H 3 115 ? -13.399 47.476  64.914  1.00 46.48  ? 114 PRO G N   1 
ATOM   7477 C CA  . PRO H 3 115 ? -13.137 46.401  65.878  1.00 46.97  ? 114 PRO G CA  1 
ATOM   7478 C C   . PRO H 3 115 ? -11.984 46.710  66.859  1.00 46.54  ? 114 PRO G C   1 
ATOM   7479 O O   . PRO H 3 115 ? -11.318 47.739  66.734  1.00 46.72  ? 114 PRO G O   1 
ATOM   7480 C CB  . PRO H 3 115 ? -12.819 45.209  64.975  1.00 52.40  ? 114 PRO G CB  1 
ATOM   7481 C CG  . PRO H 3 115 ? -12.143 45.858  63.798  1.00 47.32  ? 114 PRO G CG  1 
ATOM   7482 C CD  . PRO H 3 115 ? -13.009 47.073  63.551  1.00 45.75  ? 114 PRO G CD  1 
ATOM   7483 N N   . PRO H 3 116 ? -11.749 45.815  67.848  1.00 45.95  ? 115 PRO G N   1 
ATOM   7484 C CA  . PRO H 3 116 ? -10.746 45.795  68.924  1.00 38.79  ? 115 PRO G CA  1 
ATOM   7485 C C   . PRO H 3 116 ? -9.306  45.712  68.581  1.00 37.66  ? 115 PRO G C   1 
ATOM   7486 O O   . PRO H 3 116 ? -8.604  44.914  69.192  1.00 39.12  ? 115 PRO G O   1 
ATOM   7487 C CB  . PRO H 3 116 ? -11.068 44.539  69.689  1.00 44.24  ? 115 PRO G CB  1 
ATOM   7488 C CG  . PRO H 3 116 ? -12.499 44.455  69.619  1.00 51.94  ? 115 PRO G CG  1 
ATOM   7489 C CD  . PRO H 3 116 ? -12.979 45.197  68.371  1.00 53.42  ? 115 PRO G CD  1 
ATOM   7490 N N   . VAL H 3 117 ? -8.842  46.495  67.635  1.00 37.26  ? 116 VAL G N   1 
ATOM   7491 C CA  . VAL H 3 117 ? -7.445  46.406  67.254  1.00 37.44  ? 116 VAL G CA  1 
ATOM   7492 C C   . VAL H 3 117 ? -7.033  47.850  67.184  1.00 34.76  ? 116 VAL G C   1 
ATOM   7493 O O   . VAL H 3 117 ? -7.733  48.653  66.567  1.00 31.32  ? 116 VAL G O   1 
ATOM   7494 C CB  . VAL H 3 117 ? -7.318  45.705  65.867  1.00 38.94  ? 116 VAL G CB  1 
ATOM   7495 C CG1 . VAL H 3 117 ? -5.867  45.614  65.454  1.00 27.66  ? 116 VAL G CG1 1 
ATOM   7496 C CG2 . VAL H 3 117 ? -7.946  44.301  65.924  1.00 28.93  ? 116 VAL G CG2 1 
ATOM   7497 N N   . ILE H 3 118 ? -5.918  48.212  67.802  1.00 34.81  ? 117 ILE G N   1 
ATOM   7498 C CA  . ILE H 3 118 ? -5.564  49.624  67.788  1.00 40.63  ? 117 ILE G CA  1 
ATOM   7499 C C   . ILE H 3 118 ? -4.159  49.886  68.317  1.00 40.62  ? 117 ILE G C   1 
ATOM   7500 O O   . ILE H 3 118 ? -3.627  49.099  69.093  1.00 42.72  ? 117 ILE G O   1 
ATOM   7501 C CB  . ILE H 3 118 ? -6.609  50.421  68.644  1.00 38.47  ? 117 ILE G CB  1 
ATOM   7502 C CG1 . ILE H 3 118 ? -6.583  51.906  68.305  1.00 34.18  ? 117 ILE G CG1 1 
ATOM   7503 C CG2 . ILE H 3 118 ? -6.341  50.208  70.123  1.00 35.96  ? 117 ILE G CG2 1 
ATOM   7504 C CD1 . ILE H 3 118 ? -7.733  52.673  68.926  1.00 25.00  ? 117 ILE G CD1 1 
ATOM   7505 N N   . ASN H 3 119 ? -3.569  50.990  67.869  1.00 43.61  ? 118 ASN G N   1 
ATOM   7506 C CA  . ASN H 3 119 ? -2.244  51.413  68.298  1.00 45.19  ? 118 ASN G CA  1 
ATOM   7507 C C   . ASN H 3 119 ? -2.414  52.791  68.911  1.00 48.54  ? 118 ASN G C   1 
ATOM   7508 O O   . ASN H 3 119 ? -2.835  53.732  68.229  1.00 47.25  ? 118 ASN G O   1 
ATOM   7509 C CB  . ASN H 3 119 ? -1.277  51.535  67.113  1.00 51.46  ? 118 ASN G CB  1 
ATOM   7510 C CG  . ASN H 3 119 ? -0.800  50.196  66.593  1.00 62.13  ? 118 ASN G CG  1 
ATOM   7511 O OD1 . ASN H 3 119 ? -0.080  50.130  65.590  1.00 67.91  ? 118 ASN G OD1 1 
ATOM   7512 N ND2 . ASN H 3 119 ? -1.190  49.118  67.270  1.00 64.20  ? 118 ASN G ND2 1 
ATOM   7513 N N   . ILE H 3 120 ? -2.114  52.909  70.198  1.00 47.00  ? 119 ILE G N   1 
ATOM   7514 C CA  . ILE H 3 120 ? -2.203  54.196  70.874  1.00 39.26  ? 119 ILE G CA  1 
ATOM   7515 C C   . ILE H 3 120 ? -0.801  54.500  71.329  1.00 38.82  ? 119 ILE G C   1 
ATOM   7516 O O   . ILE H 3 120 ? -0.178  53.683  72.003  1.00 35.03  ? 119 ILE G O   1 
ATOM   7517 C CB  . ILE H 3 120 ? -3.113  54.146  72.097  1.00 37.12  ? 119 ILE G CB  1 
ATOM   7518 C CG1 . ILE H 3 120 ? -4.544  53.852  71.657  1.00 25.10  ? 119 ILE G CG1 1 
ATOM   7519 C CG2 . ILE H 3 120 ? -3.052  55.480  72.831  1.00 37.22  ? 119 ILE G CG2 1 
ATOM   7520 C CD1 . ILE H 3 120 ? -5.420  53.338  72.749  1.00 28.88  ? 119 ILE G CD1 1 
ATOM   7521 N N   . THR H 3 121 ? -0.296  55.665  70.944  1.00 34.83  ? 120 THR G N   1 
ATOM   7522 C CA  . THR H 3 121 ? 1.055   56.042  71.320  1.00 38.84  ? 120 THR G CA  1 
ATOM   7523 C C   . THR H 3 121 ? 1.142   57.479  71.792  1.00 30.00  ? 120 THR G C   1 
ATOM   7524 O O   . THR H 3 121 ? 0.214   58.251  71.615  1.00 32.64  ? 120 THR G O   1 
ATOM   7525 C CB  . THR H 3 121 ? 2.022   55.834  70.152  1.00 37.89  ? 120 THR G CB  1 
ATOM   7526 O OG1 . THR H 3 121 ? 1.552   56.561  69.008  1.00 46.68  ? 120 THR G OG1 1 
ATOM   7527 C CG2 . THR H 3 121 ? 2.107   54.367  69.816  1.00 35.23  ? 120 THR G CG2 1 
ATOM   7528 N N   . TRP H 3 122 ? 2.278   57.837  72.372  1.00 32.81  ? 121 TRP G N   1 
ATOM   7529 C CA  . TRP H 3 122 ? 2.454   59.182  72.888  1.00 37.06  ? 121 TRP G CA  1 
ATOM   7530 C C   . TRP H 3 122 ? 3.562   59.988  72.224  1.00 37.47  ? 121 TRP G C   1 
ATOM   7531 O O   . TRP H 3 122 ? 4.570   59.444  71.780  1.00 38.48  ? 121 TRP G O   1 
ATOM   7532 C CB  . TRP H 3 122 ? 2.738   59.127  74.399  1.00 33.22  ? 121 TRP G CB  1 
ATOM   7533 C CG  . TRP H 3 122 ? 1.585   58.686  75.230  1.00 32.55  ? 121 TRP G CG  1 
ATOM   7534 C CD1 . TRP H 3 122 ? 1.301   57.417  75.640  1.00 35.36  ? 121 TRP G CD1 1 
ATOM   7535 C CD2 . TRP H 3 122 ? 0.525   59.514  75.718  1.00 25.93  ? 121 TRP G CD2 1 
ATOM   7536 N NE1 . TRP H 3 122 ? 0.131   57.404  76.368  1.00 34.90  ? 121 TRP G NE1 1 
ATOM   7537 C CE2 . TRP H 3 122 ? -0.353  58.686  76.445  1.00 29.61  ? 121 TRP G CE2 1 
ATOM   7538 C CE3 . TRP H 3 122 ? 0.259   60.888  75.650  1.00 24.29  ? 121 TRP G CE3 1 
ATOM   7539 C CZ2 . TRP H 3 122 ? -1.512  59.177  77.050  1.00 17.74  ? 121 TRP G CZ2 1 
ATOM   7540 C CZ3 . TRP H 3 122 ? -0.886  61.374  76.248  1.00 20.52  ? 121 TRP G CZ3 1 
ATOM   7541 C CH2 . TRP H 3 122 ? -1.750  60.522  76.961  1.00 22.20  ? 121 TRP G CH2 1 
ATOM   7542 N N   . LEU H 3 123 ? 3.369   61.299  72.183  1.00 40.31  ? 122 LEU G N   1 
ATOM   7543 C CA  . LEU H 3 123 ? 4.369   62.202  71.648  1.00 40.99  ? 122 LEU G CA  1 
ATOM   7544 C C   . LEU H 3 123 ? 4.614   63.283  72.699  1.00 39.86  ? 122 LEU G C   1 
ATOM   7545 O O   . LEU H 3 123 ? 3.669   63.813  73.282  1.00 41.69  ? 122 LEU G O   1 
ATOM   7546 C CB  . LEU H 3 123 ? 3.884   62.868  70.357  1.00 41.26  ? 122 LEU G CB  1 
ATOM   7547 C CG  . LEU H 3 123 ? 3.486   61.996  69.160  1.00 46.15  ? 122 LEU G CG  1 
ATOM   7548 C CD1 . LEU H 3 123 ? 2.986   62.910  68.042  1.00 30.50  ? 122 LEU G CD1 1 
ATOM   7549 C CD2 . LEU H 3 123 ? 4.676   61.156  68.681  1.00 38.52  ? 122 LEU G CD2 1 
ATOM   7550 N N   . ARG H 3 124 ? 5.886   63.587  72.944  1.00 43.38  ? 123 ARG G N   1 
ATOM   7551 C CA  . ARG H 3 124 ? 6.289   64.627  73.885  1.00 40.80  ? 123 ARG G CA  1 
ATOM   7552 C C   . ARG H 3 124 ? 7.075   65.621  73.034  1.00 42.67  ? 123 ARG G C   1 
ATOM   7553 O O   . ARG H 3 124 ? 8.148   65.292  72.522  1.00 45.38  ? 123 ARG G O   1 
ATOM   7554 C CB  . ARG H 3 124 ? 7.214   64.064  74.973  1.00 40.70  ? 123 ARG G CB  1 
ATOM   7555 C CG  . ARG H 3 124 ? 7.222   64.885  76.255  1.00 42.77  ? 123 ARG G CG  1 
ATOM   7556 C CD  . ARG H 3 124 ? 8.615   65.186  76.800  1.00 36.99  ? 123 ARG G CD  1 
ATOM   7557 N NE  . ARG H 3 124 ? 9.538   64.052  76.795  1.00 42.74  ? 123 ARG G NE  1 
ATOM   7558 C CZ  . ARG H 3 124 ? 9.296   62.856  77.327  1.00 53.31  ? 123 ARG G CZ  1 
ATOM   7559 N NH1 . ARG H 3 124 ? 8.136   62.597  77.924  1.00 51.55  ? 123 ARG G NH1 1 
ATOM   7560 N NH2 . ARG H 3 124 ? 10.233  61.913  77.270  1.00 57.62  ? 123 ARG G NH2 1 
ATOM   7561 N N   . ASN H 3 125 ? 6.550   66.830  72.884  1.00 38.93  ? 124 ASN G N   1 
ATOM   7562 C CA  . ASN H 3 125 ? 7.211   67.840  72.071  1.00 44.92  ? 124 ASN G CA  1 
ATOM   7563 C C   . ASN H 3 125 ? 7.443   67.296  70.658  1.00 49.73  ? 124 ASN G C   1 
ATOM   7564 O O   . ASN H 3 125 ? 8.539   67.411  70.093  1.00 51.34  ? 124 ASN G O   1 
ATOM   7565 C CB  . ASN H 3 125 ? 8.546   68.259  72.695  1.00 43.66  ? 124 ASN G CB  1 
ATOM   7566 C CG  . ASN H 3 125 ? 8.380   68.915  74.059  1.00 42.65  ? 124 ASN G CG  1 
ATOM   7567 O OD1 . ASN H 3 125 ? 7.415   69.642  74.300  1.00 37.53  ? 124 ASN G OD1 1 
ATOM   7568 N ND2 . ASN H 3 125 ? 9.340   68.673  74.954  1.00 34.86  ? 124 ASN G ND2 1 
ATOM   7569 N N   . SER H 3 126 ? 6.396   66.686  70.110  1.00 47.84  ? 125 SER G N   1 
ATOM   7570 C CA  . SER H 3 126 ? 6.411   66.133  68.769  1.00 47.03  ? 125 SER G CA  1 
ATOM   7571 C C   . SER H 3 126 ? 7.211   64.867  68.569  1.00 51.26  ? 125 SER G C   1 
ATOM   7572 O O   . SER H 3 126 ? 7.191   64.307  67.478  1.00 58.88  ? 125 SER G O   1 
ATOM   7573 C CB  . SER H 3 126 ? 6.893   67.185  67.772  1.00 49.24  ? 125 SER G CB  1 
ATOM   7574 O OG  . SER H 3 126 ? 5.994   68.276  67.724  1.00 55.20  ? 125 SER G OG  1 
ATOM   7575 N N   . LYS H 3 127 ? 7.915   64.398  69.592  1.00 47.91  ? 126 LYS G N   1 
ATOM   7576 C CA  . LYS H 3 127 ? 8.689   63.172  69.424  1.00 43.70  ? 126 LYS G CA  1 
ATOM   7577 C C   . LYS H 3 127 ? 8.044   61.999  70.141  1.00 49.22  ? 126 LYS G C   1 
ATOM   7578 O O   . LYS H 3 127 ? 7.387   62.164  71.166  1.00 50.39  ? 126 LYS G O   1 
ATOM   7579 C CB  . LYS H 3 127 ? 10.115  63.358  69.934  1.00 45.53  ? 126 LYS G CB  1 
ATOM   7580 C CG  . LYS H 3 127 ? 10.852  64.538  69.320  1.00 47.37  ? 126 LYS G CG  1 
ATOM   7581 C CD  . LYS H 3 127 ? 12.168  64.741  70.025  1.00 55.34  ? 126 LYS G CD  1 
ATOM   7582 C CE  . LYS H 3 127 ? 12.408  66.203  70.294  1.00 64.40  ? 126 LYS G CE  1 
ATOM   7583 N NZ  . LYS H 3 127 ? 13.366  66.375  71.417  1.00 70.58  ? 126 LYS G NZ  1 
ATOM   7584 N N   . SER H 3 128 ? 8.245   60.808  69.595  1.00 50.53  ? 127 SER G N   1 
ATOM   7585 C CA  . SER H 3 128 ? 7.685   59.595  70.158  1.00 47.11  ? 127 SER G CA  1 
ATOM   7586 C C   . SER H 3 128 ? 8.270   59.294  71.539  1.00 46.33  ? 127 SER G C   1 
ATOM   7587 O O   . SER H 3 128 ? 9.457   59.444  71.750  1.00 44.54  ? 127 SER G O   1 
ATOM   7588 C CB  . SER H 3 128 ? 7.962   58.434  69.212  1.00 46.03  ? 127 SER G CB  1 
ATOM   7589 O OG  . SER H 3 128 ? 7.397   57.243  69.719  1.00 67.55  ? 127 SER G OG  1 
ATOM   7590 N N   . VAL H 3 129 ? 7.424   58.868  72.472  1.00 50.06  ? 128 VAL G N   1 
ATOM   7591 C CA  . VAL H 3 129 ? 7.852   58.550  73.835  1.00 46.55  ? 128 VAL G CA  1 
ATOM   7592 C C   . VAL H 3 129 ? 7.834   57.046  74.061  1.00 48.00  ? 128 VAL G C   1 
ATOM   7593 O O   . VAL H 3 129 ? 6.845   56.380  73.744  1.00 49.10  ? 128 VAL G O   1 
ATOM   7594 C CB  . VAL H 3 129 ? 6.910   59.180  74.880  1.00 45.60  ? 128 VAL G CB  1 
ATOM   7595 C CG1 . VAL H 3 129 ? 7.298   58.719  76.266  1.00 34.39  ? 128 VAL G CG1 1 
ATOM   7596 C CG2 . VAL H 3 129 ? 6.955   60.690  74.783  1.00 42.00  ? 128 VAL G CG2 1 
ATOM   7597 N N   . ALA H 3 130 ? 8.914   56.521  74.635  1.00 46.43  ? 129 ALA G N   1 
ATOM   7598 C CA  . ALA H 3 130 ? 9.020   55.085  74.895  1.00 50.86  ? 129 ALA G CA  1 
ATOM   7599 C C   . ALA H 3 130 ? 8.731   54.644  76.337  1.00 46.72  ? 129 ALA G C   1 
ATOM   7600 O O   . ALA H 3 130 ? 7.980   53.696  76.561  1.00 44.10  ? 129 ALA G O   1 
ATOM   7601 C CB  . ALA H 3 130 ? 10.403  54.596  74.483  1.00 53.80  ? 129 ALA G CB  1 
ATOM   7602 N N   . ASP H 3 131 ? 9.320   55.337  77.308  1.00 48.71  ? 130 ASP G N   1 
ATOM   7603 C CA  . ASP H 3 131 ? 9.148   54.982  78.720  1.00 51.63  ? 130 ASP G CA  1 
ATOM   7604 C C   . ASP H 3 131 ? 7.990   55.663  79.452  1.00 44.22  ? 130 ASP G C   1 
ATOM   7605 O O   . ASP H 3 131 ? 7.624   56.789  79.143  1.00 48.78  ? 130 ASP G O   1 
ATOM   7606 C CB  . ASP H 3 131 ? 10.443  55.273  79.481  1.00 52.10  ? 130 ASP G CB  1 
ATOM   7607 C CG  . ASP H 3 131 ? 11.666  54.747  78.766  1.00 51.87  ? 130 ASP G CG  1 
ATOM   7608 O OD1 . ASP H 3 131 ? 11.640  53.577  78.337  1.00 63.42  ? 130 ASP G OD1 1 
ATOM   7609 O OD2 . ASP H 3 131 ? 12.656  55.497  78.638  1.00 53.52  ? 130 ASP G OD2 1 
ATOM   7610 N N   . GLY H 3 132 ? 7.429   54.967  80.435  1.00 46.66  ? 131 GLY G N   1 
ATOM   7611 C CA  . GLY H 3 132 ? 6.341   55.529  81.220  1.00 44.03  ? 131 GLY G CA  1 
ATOM   7612 C C   . GLY H 3 132 ? 4.975   55.399  80.589  1.00 41.38  ? 131 GLY G C   1 
ATOM   7613 O O   . GLY H 3 132 ? 4.097   56.254  80.784  1.00 40.61  ? 131 GLY G O   1 
ATOM   7614 N N   . VAL H 3 133 ? 4.793   54.324  79.833  1.00 35.18  ? 132 VAL G N   1 
ATOM   7615 C CA  . VAL H 3 133 ? 3.529   54.095  79.164  1.00 38.06  ? 132 VAL G CA  1 
ATOM   7616 C C   . VAL H 3 133 ? 2.914   52.758  79.519  1.00 37.98  ? 132 VAL G C   1 
ATOM   7617 O O   . VAL H 3 133 ? 3.549   51.719  79.414  1.00 33.40  ? 132 VAL G O   1 
ATOM   7618 C CB  . VAL H 3 133 ? 3.693   54.174  77.652  1.00 37.86  ? 132 VAL G CB  1 
ATOM   7619 C CG1 . VAL H 3 133 ? 2.417   53.725  76.971  1.00 31.48  ? 132 VAL G CG1 1 
ATOM   7620 C CG2 . VAL H 3 133 ? 4.051   55.594  77.263  1.00 32.14  ? 132 VAL G CG2 1 
ATOM   7621 N N   . TYR H 3 134 ? 1.656   52.821  79.932  1.00 38.57  ? 133 TYR G N   1 
ATOM   7622 C CA  . TYR H 3 134 ? 0.862   51.673  80.337  1.00 37.25  ? 133 TYR G CA  1 
ATOM   7623 C C   . TYR H 3 134 ? -0.448  51.765  79.552  1.00 30.72  ? 133 TYR G C   1 
ATOM   7624 O O   . TYR H 3 134 ? -0.858  52.850  79.140  1.00 35.68  ? 133 TYR G O   1 
ATOM   7625 C CB  . TYR H 3 134 ? 0.584   51.752  81.849  1.00 40.97  ? 133 TYR G CB  1 
ATOM   7626 C CG  . TYR H 3 134 ? -0.373  50.698  82.347  1.00 46.47  ? 133 TYR G CG  1 
ATOM   7627 C CD1 . TYR H 3 134 ? 0.001   49.345  82.395  1.00 54.29  ? 133 TYR G CD1 1 
ATOM   7628 C CD2 . TYR H 3 134 ? -1.668  51.038  82.724  1.00 44.22  ? 133 TYR G CD2 1 
ATOM   7629 C CE1 . TYR H 3 134 ? -0.904  48.353  82.808  1.00 51.80  ? 133 TYR G CE1 1 
ATOM   7630 C CE2 . TYR H 3 134 ? -2.582  50.058  83.135  1.00 49.21  ? 133 TYR G CE2 1 
ATOM   7631 C CZ  . TYR H 3 134 ? -2.196  48.720  83.174  1.00 54.27  ? 133 TYR G CZ  1 
ATOM   7632 O OH  . TYR H 3 134 ? -3.109  47.763  83.556  1.00 54.63  ? 133 TYR G OH  1 
ATOM   7633 N N   . GLU H 3 135 ? -1.114  50.637  79.366  1.00 31.66  ? 134 GLU G N   1 
ATOM   7634 C CA  . GLU H 3 135 ? -2.362  50.607  78.603  1.00 39.35  ? 134 GLU G CA  1 
ATOM   7635 C C   . GLU H 3 135 ? -3.340  49.617  79.267  1.00 33.29  ? 134 GLU G C   1 
ATOM   7636 O O   . GLU H 3 135 ? -2.919  48.609  79.826  1.00 35.00  ? 134 GLU G O   1 
ATOM   7637 C CB  . GLU H 3 135 ? -2.029  50.165  77.165  1.00 37.98  ? 134 GLU G CB  1 
ATOM   7638 C CG  . GLU H 3 135 ? -3.091  50.395  76.114  1.00 49.38  ? 134 GLU G CG  1 
ATOM   7639 C CD  . GLU H 3 135 ? -2.640  49.929  74.728  1.00 59.99  ? 134 GLU G CD  1 
ATOM   7640 O OE1 . GLU H 3 135 ? -2.731  48.714  74.442  1.00 63.54  ? 134 GLU G OE1 1 
ATOM   7641 O OE2 . GLU H 3 135 ? -2.181  50.774  73.925  1.00 54.45  ? 134 GLU G OE2 1 
ATOM   7642 N N   . THR H 3 136 ? -4.636  49.906  79.208  1.00 32.99  ? 135 THR G N   1 
ATOM   7643 C CA  . THR H 3 136 ? -5.642  49.015  79.796  1.00 32.29  ? 135 THR G CA  1 
ATOM   7644 C C   . THR H 3 136 ? -6.088  48.012  78.742  1.00 32.67  ? 135 THR G C   1 
ATOM   7645 O O   . THR H 3 136 ? -5.622  48.047  77.607  1.00 37.70  ? 135 THR G O   1 
ATOM   7646 C CB  . THR H 3 136 ? -6.914  49.785  80.233  1.00 29.26  ? 135 THR G CB  1 
ATOM   7647 O OG1 . THR H 3 136 ? -7.741  50.041  79.093  1.00 36.31  ? 135 THR G OG1 1 
ATOM   7648 C CG2 . THR H 3 136 ? -6.548  51.109  80.846  1.00 38.24  ? 135 THR G CG2 1 
ATOM   7649 N N   . SER H 3 137 ? -6.981  47.110  79.119  1.00 30.64  ? 136 SER G N   1 
ATOM   7650 C CA  . SER H 3 137 ? -7.523  46.168  78.160  1.00 29.79  ? 136 SER G CA  1 
ATOM   7651 C C   . SER H 3 137 ? -8.644  46.923  77.411  1.00 37.13  ? 136 SER G C   1 
ATOM   7652 O O   . SER H 3 137 ? -8.813  48.137  77.586  1.00 35.81  ? 136 SER G O   1 
ATOM   7653 C CB  . SER H 3 137 ? -8.103  44.954  78.881  1.00 28.41  ? 136 SER G CB  1 
ATOM   7654 O OG  . SER H 3 137 ? -7.106  44.308  79.647  1.00 42.50  ? 136 SER G OG  1 
ATOM   7655 N N   . PHE H 3 138 ? -9.395  46.215  76.572  1.00 41.03  ? 137 PHE G N   1 
ATOM   7656 C CA  . PHE H 3 138 ? -10.505 46.815  75.833  1.00 37.77  ? 137 PHE G CA  1 
ATOM   7657 C C   . PHE H 3 138 ? -11.752 46.634  76.692  1.00 38.54  ? 137 PHE G C   1 
ATOM   7658 O O   . PHE H 3 138 ? -12.206 45.506  76.874  1.00 40.21  ? 137 PHE G O   1 
ATOM   7659 C CB  . PHE H 3 138 ? -10.725 46.088  74.491  1.00 36.37  ? 137 PHE G CB  1 
ATOM   7660 C CG  . PHE H 3 138 ? -9.726  46.443  73.419  1.00 31.42  ? 137 PHE G CG  1 
ATOM   7661 C CD1 . PHE H 3 138 ? -9.799  47.664  72.750  1.00 25.13  ? 137 PHE G CD1 1 
ATOM   7662 C CD2 . PHE H 3 138 ? -8.711  45.554  73.073  1.00 34.56  ? 137 PHE G CD2 1 
ATOM   7663 C CE1 . PHE H 3 138 ? -8.878  47.992  71.753  1.00 21.50  ? 137 PHE G CE1 1 
ATOM   7664 C CE2 . PHE H 3 138 ? -7.779  45.877  72.077  1.00 32.95  ? 137 PHE G CE2 1 
ATOM   7665 C CZ  . PHE H 3 138 ? -7.867  47.103  71.415  1.00 28.35  ? 137 PHE G CZ  1 
ATOM   7666 N N   . PHE H 3 139 ? -12.303 47.721  77.229  1.00 37.03  ? 138 PHE G N   1 
ATOM   7667 C CA  . PHE H 3 139 ? -13.514 47.613  78.042  1.00 34.53  ? 138 PHE G CA  1 
ATOM   7668 C C   . PHE H 3 139 ? -14.727 47.541  77.131  1.00 39.27  ? 138 PHE G C   1 
ATOM   7669 O O   . PHE H 3 139 ? -14.717 48.091  76.029  1.00 39.06  ? 138 PHE G O   1 
ATOM   7670 C CB  . PHE H 3 139 ? -13.688 48.818  78.971  1.00 38.10  ? 138 PHE G CB  1 
ATOM   7671 C CG  . PHE H 3 139 ? -12.651 48.922  80.046  1.00 39.14  ? 138 PHE G CG  1 
ATOM   7672 C CD1 . PHE H 3 139 ? -11.411 49.501  79.784  1.00 42.10  ? 138 PHE G CD1 1 
ATOM   7673 C CD2 . PHE H 3 139 ? -12.919 48.459  81.335  1.00 45.93  ? 138 PHE G CD2 1 
ATOM   7674 C CE1 . PHE H 3 139 ? -10.451 49.624  80.794  1.00 45.55  ? 138 PHE G CE1 1 
ATOM   7675 C CE2 . PHE H 3 139 ? -11.966 48.574  82.356  1.00 39.78  ? 138 PHE G CE2 1 
ATOM   7676 C CZ  . PHE H 3 139 ? -10.731 49.159  82.084  1.00 41.27  ? 138 PHE G CZ  1 
ATOM   7677 N N   . VAL H 3 140 ? -15.779 46.877  77.591  1.00 37.58  ? 139 VAL G N   1 
ATOM   7678 C CA  . VAL H 3 140 ? -16.983 46.776  76.785  1.00 42.27  ? 139 VAL G CA  1 
ATOM   7679 C C   . VAL H 3 140 ? -17.912 47.983  76.941  1.00 44.02  ? 139 VAL G C   1 
ATOM   7680 O O   . VAL H 3 140 ? -18.056 48.535  78.030  1.00 50.25  ? 139 VAL G O   1 
ATOM   7681 C CB  . VAL H 3 140 ? -17.792 45.495  77.127  1.00 38.91  ? 139 VAL G CB  1 
ATOM   7682 C CG1 . VAL H 3 140 ? -16.962 44.265  76.831  1.00 38.30  ? 139 VAL G CG1 1 
ATOM   7683 C CG2 . VAL H 3 140 ? -18.233 45.520  78.583  1.00 39.09  ? 139 VAL G CG2 1 
ATOM   7684 N N   . ASN H 3 141 ? -18.541 48.383  75.839  1.00 49.01  ? 140 ASN G N   1 
ATOM   7685 C CA  . ASN H 3 141 ? -19.497 49.493  75.837  1.00 47.38  ? 140 ASN G CA  1 
ATOM   7686 C C   . ASN H 3 141 ? -20.898 48.916  75.662  1.00 48.06  ? 140 ASN G C   1 
ATOM   7687 O O   . ASN H 3 141 ? -21.053 47.749  75.310  1.00 45.76  ? 140 ASN G O   1 
ATOM   7688 C CB  . ASN H 3 141 ? -19.207 50.456  74.687  1.00 48.56  ? 140 ASN G CB  1 
ATOM   7689 C CG  . ASN H 3 141 ? -17.943 51.239  74.897  1.00 46.22  ? 140 ASN G CG  1 
ATOM   7690 O OD1 . ASN H 3 141 ? -17.590 51.558  76.025  1.00 48.37  ? 140 ASN G OD1 1 
ATOM   7691 N ND2 . ASN H 3 141 ? -17.260 51.574  73.808  1.00 42.12  ? 140 ASN G ND2 1 
ATOM   7692 N N   . ARG H 3 142 ? -21.924 49.725  75.884  1.00 48.39  ? 141 ARG G N   1 
ATOM   7693 C CA  . ARG H 3 142 ? -23.280 49.218  75.745  1.00 53.09  ? 141 ARG G CA  1 
ATOM   7694 C C   . ARG H 3 142 ? -23.650 48.867  74.302  1.00 49.99  ? 141 ARG G C   1 
ATOM   7695 O O   . ARG H 3 142 ? -24.426 47.936  74.065  1.00 41.69  ? 141 ARG G O   1 
ATOM   7696 C CB  . ARG H 3 142 ? -24.289 50.221  76.309  1.00 57.86  ? 141 ARG G CB  1 
ATOM   7697 C CG  . ARG H 3 142 ? -25.691 49.644  76.442  1.00 73.02  ? 141 ARG G CG  1 
ATOM   7698 C CD  . ARG H 3 142 ? -26.608 50.556  77.247  1.00 84.30  ? 141 ARG G CD  1 
ATOM   7699 N NE  . ARG H 3 142 ? -27.888 49.912  77.546  1.00 92.48  ? 141 ARG G NE  1 
ATOM   7700 C CZ  . ARG H 3 142 ? -28.828 50.440  78.326  1.00 96.89  ? 141 ARG G CZ  1 
ATOM   7701 N NH1 . ARG H 3 142 ? -28.631 51.627  78.890  1.00 99.50  ? 141 ARG G NH1 1 
ATOM   7702 N NH2 . ARG H 3 142 ? -29.963 49.782  78.546  1.00 94.32  ? 141 ARG G NH2 1 
ATOM   7703 N N   . ASP H 3 143 ? -23.090 49.595  73.341  1.00 48.82  ? 142 ASP G N   1 
ATOM   7704 C CA  . ASP H 3 143 ? -23.394 49.337  71.938  1.00 48.51  ? 142 ASP G CA  1 
ATOM   7705 C C   . ASP H 3 143 ? -22.483 48.262  71.352  1.00 47.79  ? 142 ASP G C   1 
ATOM   7706 O O   . ASP H 3 143 ? -22.487 48.016  70.142  1.00 49.78  ? 142 ASP G O   1 
ATOM   7707 C CB  . ASP H 3 143 ? -23.299 50.633  71.123  1.00 48.24  ? 142 ASP G CB  1 
ATOM   7708 C CG  . ASP H 3 143 ? -21.886 51.172  71.036  1.00 63.14  ? 142 ASP G CG  1 
ATOM   7709 O OD1 . ASP H 3 143 ? -20.983 50.602  71.682  1.00 63.66  ? 142 ASP G OD1 1 
ATOM   7710 O OD2 . ASP H 3 143 ? -21.682 52.175  70.319  1.00 60.93  ? 142 ASP G OD2 1 
ATOM   7711 N N   . TYR H 3 144 ? -21.710 47.629  72.233  1.00 42.47  ? 143 TYR G N   1 
ATOM   7712 C CA  . TYR H 3 144 ? -20.786 46.548  71.886  1.00 33.73  ? 143 TYR G CA  1 
ATOM   7713 C C   . TYR H 3 144 ? -19.525 46.963  71.162  1.00 32.46  ? 143 TYR G C   1 
ATOM   7714 O O   . TYR H 3 144 ? -18.856 46.146  70.532  1.00 36.81  ? 143 TYR G O   1 
ATOM   7715 C CB  . TYR H 3 144 ? -21.531 45.443  71.136  1.00 38.03  ? 143 TYR G CB  1 
ATOM   7716 C CG  . TYR H 3 144 ? -22.737 45.014  71.928  1.00 44.01  ? 143 TYR G CG  1 
ATOM   7717 C CD1 . TYR H 3 144 ? -22.619 44.707  73.290  1.00 37.67  ? 143 TYR G CD1 1 
ATOM   7718 C CD2 . TYR H 3 144 ? -24.002 44.962  71.344  1.00 37.77  ? 143 TYR G CD2 1 
ATOM   7719 C CE1 . TYR H 3 144 ? -23.737 44.361  74.056  1.00 44.36  ? 143 TYR G CE1 1 
ATOM   7720 C CE2 . TYR H 3 144 ? -25.126 44.616  72.097  1.00 44.52  ? 143 TYR G CE2 1 
ATOM   7721 C CZ  . TYR H 3 144 ? -24.992 44.317  73.454  1.00 47.51  ? 143 TYR G CZ  1 
ATOM   7722 O OH  . TYR H 3 144 ? -26.109 43.982  74.199  1.00 51.24  ? 143 TYR G OH  1 
ATOM   7723 N N   . SER H 3 145 ? -19.207 48.249  71.255  1.00 39.84  ? 144 SER G N   1 
ATOM   7724 C CA  . SER H 3 145 ? -17.956 48.770  70.717  1.00 41.29  ? 144 SER G CA  1 
ATOM   7725 C C   . SER H 3 145 ? -17.108 48.832  71.991  1.00 42.68  ? 144 SER G C   1 
ATOM   7726 O O   . SER H 3 145 ? -17.573 48.441  73.072  1.00 40.99  ? 144 SER G O   1 
ATOM   7727 C CB  . SER H 3 145 ? -18.120 50.172  70.117  1.00 38.81  ? 144 SER G CB  1 
ATOM   7728 O OG  . SER H 3 145 ? -18.557 51.106  71.079  1.00 41.51  ? 144 SER G OG  1 
ATOM   7729 N N   . PHE H 3 146 ? -15.878 49.306  71.901  1.00 43.16  ? 145 PHE G N   1 
ATOM   7730 C CA  . PHE H 3 146 ? -15.063 49.336  73.106  1.00 43.64  ? 145 PHE G CA  1 
ATOM   7731 C C   . PHE H 3 146 ? -14.286 50.636  73.313  1.00 48.77  ? 145 PHE G C   1 
ATOM   7732 O O   . PHE H 3 146 ? -14.129 51.452  72.397  1.00 48.39  ? 145 PHE G O   1 
ATOM   7733 C CB  . PHE H 3 146 ? -14.006 48.222  73.091  1.00 40.47  ? 145 PHE G CB  1 
ATOM   7734 C CG  . PHE H 3 146 ? -14.487 46.875  72.619  1.00 44.96  ? 145 PHE G CG  1 
ATOM   7735 C CD1 . PHE H 3 146 ? -14.882 46.662  71.297  1.00 36.15  ? 145 PHE G CD1 1 
ATOM   7736 C CD2 . PHE H 3 146 ? -14.468 45.788  73.493  1.00 46.51  ? 145 PHE G CD2 1 
ATOM   7737 C CE1 . PHE H 3 146 ? -15.234 45.386  70.856  1.00 38.66  ? 145 PHE G CE1 1 
ATOM   7738 C CE2 . PHE H 3 146 ? -14.820 44.508  73.060  1.00 49.35  ? 145 PHE G CE2 1 
ATOM   7739 C CZ  . PHE H 3 146 ? -15.206 44.307  71.739  1.00 43.14  ? 145 PHE G CZ  1 
ATOM   7740 N N   . HIS H 3 147 ? -13.788 50.816  74.532  1.00 41.99  ? 146 HIS G N   1 
ATOM   7741 C CA  . HIS H 3 147 ? -12.939 51.957  74.828  1.00 40.59  ? 146 HIS G CA  1 
ATOM   7742 C C   . HIS H 3 147 ? -11.723 51.377  75.545  1.00 40.11  ? 146 HIS G C   1 
ATOM   7743 O O   . HIS H 3 147 ? -11.787 50.298  76.128  1.00 38.01  ? 146 HIS G O   1 
ATOM   7744 C CB  . HIS H 3 147 ? -13.646 53.027  75.681  1.00 36.87  ? 146 HIS G CB  1 
ATOM   7745 C CG  . HIS H 3 147 ? -14.114 52.547  77.019  1.00 39.96  ? 146 HIS G CG  1 
ATOM   7746 N ND1 . HIS H 3 147 ? -15.296 51.859  77.193  1.00 36.28  ? 146 HIS G ND1 1 
ATOM   7747 C CD2 . HIS H 3 147 ? -13.586 52.705  78.255  1.00 32.29  ? 146 HIS G CD2 1 
ATOM   7748 C CE1 . HIS H 3 147 ? -15.480 51.622  78.478  1.00 34.69  ? 146 HIS G CE1 1 
ATOM   7749 N NE2 . HIS H 3 147 ? -14.458 52.125  79.145  1.00 32.50  ? 146 HIS G NE2 1 
ATOM   7750 N N   . LYS H 3 148 ? -10.607 52.081  75.467  1.00 33.72  ? 147 LYS G N   1 
ATOM   7751 C CA  . LYS H 3 148 ? -9.387  51.630  76.089  1.00 31.93  ? 147 LYS G CA  1 
ATOM   7752 C C   . LYS H 3 148 ? -8.675  52.879  76.582  1.00 31.42  ? 147 LYS G C   1 
ATOM   7753 O O   . LYS H 3 148 ? -8.920  53.966  76.068  1.00 34.28  ? 147 LYS G O   1 
ATOM   7754 C CB  . LYS H 3 148 ? -8.551  50.888  75.047  1.00 30.29  ? 147 LYS G CB  1 
ATOM   7755 C CG  . LYS H 3 148 ? -7.148  50.603  75.482  1.00 41.92  ? 147 LYS G CG  1 
ATOM   7756 C CD  . LYS H 3 148 ? -6.361  49.861  74.415  1.00 47.05  ? 147 LYS G CD  1 
ATOM   7757 C CE  . LYS H 3 148 ? -6.715  48.386  74.381  1.00 41.83  ? 147 LYS G CE  1 
ATOM   7758 N NZ  . LYS H 3 148 ? -5.469  47.563  74.304  1.00 42.71  ? 147 LYS G NZ  1 
ATOM   7759 N N   . LEU H 3 149 ? -7.828  52.755  77.599  1.00 35.83  ? 148 LEU G N   1 
ATOM   7760 C CA  . LEU H 3 149 ? -7.106  53.936  78.073  1.00 27.46  ? 148 LEU G CA  1 
ATOM   7761 C C   . LEU H 3 149 ? -5.614  53.681  78.089  1.00 26.62  ? 148 LEU G C   1 
ATOM   7762 O O   . LEU H 3 149 ? -5.150  52.574  78.381  1.00 22.93  ? 148 LEU G O   1 
ATOM   7763 C CB  . LEU H 3 149 ? -7.567  54.365  79.474  1.00 28.14  ? 148 LEU G CB  1 
ATOM   7764 C CG  . LEU H 3 149 ? -9.053  54.686  79.669  1.00 32.44  ? 148 LEU G CG  1 
ATOM   7765 C CD1 . LEU H 3 149 ? -9.785  53.418  80.066  1.00 30.98  ? 148 LEU G CD1 1 
ATOM   7766 C CD2 . LEU H 3 149 ? -9.241  55.752  80.736  1.00 36.15  ? 148 LEU G CD2 1 
ATOM   7767 N N   . SER H 3 150 ? -4.860  54.713  77.743  1.00 24.03  ? 149 SER G N   1 
ATOM   7768 C CA  . SER H 3 150 ? -3.419  54.605  77.740  1.00 30.49  ? 149 SER G CA  1 
ATOM   7769 C C   . SER H 3 150 ? -2.912  55.674  78.692  1.00 28.73  ? 149 SER G C   1 
ATOM   7770 O O   . SER H 3 150 ? -3.524  56.733  78.812  1.00 31.13  ? 149 SER G O   1 
ATOM   7771 C CB  . SER H 3 150 ? -2.873  54.838  76.332  1.00 27.08  ? 149 SER G CB  1 
ATOM   7772 O OG  . SER H 3 150 ? -1.462  54.882  76.355  1.00 28.08  ? 149 SER G OG  1 
ATOM   7773 N N   . TYR H 3 151 ? -1.795  55.404  79.360  1.00 32.57  ? 150 TYR G N   1 
ATOM   7774 C CA  . TYR H 3 151 ? -1.241  56.361  80.318  1.00 28.44  ? 150 TYR G CA  1 
ATOM   7775 C C   . TYR H 3 151 ? 0.222   56.722  80.107  1.00 29.05  ? 150 TYR G C   1 
ATOM   7776 O O   . TYR H 3 151 ? 1.055   55.867  79.795  1.00 33.43  ? 150 TYR G O   1 
ATOM   7777 C CB  . TYR H 3 151 ? -1.379  55.814  81.735  1.00 28.65  ? 150 TYR G CB  1 
ATOM   7778 C CG  . TYR H 3 151 ? -2.755  55.321  82.092  1.00 23.03  ? 150 TYR G CG  1 
ATOM   7779 C CD1 . TYR H 3 151 ? -3.148  54.018  81.806  1.00 26.01  ? 150 TYR G CD1 1 
ATOM   7780 C CD2 . TYR H 3 151 ? -3.660  56.159  82.734  1.00 24.16  ? 150 TYR G CD2 1 
ATOM   7781 C CE1 . TYR H 3 151 ? -4.416  53.561  82.161  1.00 32.82  ? 150 TYR G CE1 1 
ATOM   7782 C CE2 . TYR H 3 151 ? -4.918  55.717  83.091  1.00 23.71  ? 150 TYR G CE2 1 
ATOM   7783 C CZ  . TYR H 3 151 ? -5.298  54.423  82.809  1.00 27.72  ? 150 TYR G CZ  1 
ATOM   7784 O OH  . TYR H 3 151 ? -6.560  54.002  83.187  1.00 28.02  ? 150 TYR G OH  1 
ATOM   7785 N N   . LEU H 3 152 ? 0.534   57.998  80.294  1.00 25.75  ? 151 LEU G N   1 
ATOM   7786 C CA  . LEU H 3 152 ? 1.905   58.459  80.173  1.00 28.30  ? 151 LEU G CA  1 
ATOM   7787 C C   . LEU H 3 152 ? 2.314   59.216  81.438  1.00 28.97  ? 151 LEU G C   1 
ATOM   7788 O O   . LEU H 3 152 ? 1.816   60.308  81.713  1.00 34.11  ? 151 LEU G O   1 
ATOM   7789 C CB  . LEU H 3 152 ? 2.061   59.385  78.967  1.00 29.73  ? 151 LEU G CB  1 
ATOM   7790 C CG  . LEU H 3 152 ? 3.446   60.044  78.889  1.00 26.14  ? 151 LEU G CG  1 
ATOM   7791 C CD1 . LEU H 3 152 ? 4.493   58.971  78.590  1.00 22.00  ? 151 LEU G CD1 1 
ATOM   7792 C CD2 . LEU H 3 152 ? 3.463   61.112  77.826  1.00 34.53  ? 151 LEU G CD2 1 
ATOM   7793 N N   . THR H 3 153 ? 3.211   58.646  82.219  1.00 26.86  ? 152 THR G N   1 
ATOM   7794 C CA  . THR H 3 153 ? 3.649   59.352  83.413  1.00 33.78  ? 152 THR G CA  1 
ATOM   7795 C C   . THR H 3 153 ? 4.490   60.538  82.944  1.00 34.82  ? 152 THR G C   1 
ATOM   7796 O O   . THR H 3 153 ? 5.195   60.446  81.935  1.00 37.75  ? 152 THR G O   1 
ATOM   7797 C CB  . THR H 3 153 ? 4.493   58.443  84.337  1.00 32.22  ? 152 THR G CB  1 
ATOM   7798 O OG1 . THR H 3 153 ? 5.760   58.180  83.738  1.00 56.90  ? 152 THR G OG1 1 
ATOM   7799 C CG2 . THR H 3 153 ? 3.798   57.121  84.543  1.00 35.79  ? 152 THR G CG2 1 
ATOM   7800 N N   . PHE H 3 154 ? 4.405   61.659  83.652  1.00 35.01  ? 153 PHE G N   1 
ATOM   7801 C CA  . PHE H 3 154 ? 5.189   62.823  83.265  1.00 36.34  ? 153 PHE G CA  1 
ATOM   7802 C C   . PHE H 3 154 ? 5.377   63.848  84.374  1.00 41.98  ? 153 PHE G C   1 
ATOM   7803 O O   . PHE H 3 154 ? 4.662   63.851  85.376  1.00 40.75  ? 153 PHE G O   1 
ATOM   7804 C CB  . PHE H 3 154 ? 4.554   63.524  82.060  1.00 34.46  ? 153 PHE G CB  1 
ATOM   7805 C CG  . PHE H 3 154 ? 3.378   64.401  82.413  1.00 27.06  ? 153 PHE G CG  1 
ATOM   7806 C CD1 . PHE H 3 154 ? 2.166   63.838  82.831  1.00 32.97  ? 153 PHE G CD1 1 
ATOM   7807 C CD2 . PHE H 3 154 ? 3.480   65.787  82.321  1.00 22.87  ? 153 PHE G CD2 1 
ATOM   7808 C CE1 . PHE H 3 154 ? 1.067   64.647  83.150  1.00 31.70  ? 153 PHE G CE1 1 
ATOM   7809 C CE2 . PHE H 3 154 ? 2.401   66.610  82.634  1.00 24.46  ? 153 PHE G CE2 1 
ATOM   7810 C CZ  . PHE H 3 154 ? 1.185   66.043  83.050  1.00 29.84  ? 153 PHE G CZ  1 
ATOM   7811 N N   . ILE H 3 155 ? 6.348   64.729  84.171  1.00 43.56  ? 154 ILE G N   1 
ATOM   7812 C CA  . ILE H 3 155 ? 6.637   65.788  85.121  1.00 41.15  ? 154 ILE G CA  1 
ATOM   7813 C C   . ILE H 3 155 ? 6.241   67.071  84.417  1.00 40.94  ? 154 ILE G C   1 
ATOM   7814 O O   . ILE H 3 155 ? 6.859   67.446  83.419  1.00 47.06  ? 154 ILE G O   1 
ATOM   7815 C CB  . ILE H 3 155 ? 8.138   65.909  85.433  1.00 44.33  ? 154 ILE G CB  1 
ATOM   7816 C CG1 . ILE H 3 155 ? 8.743   64.546  85.811  1.00 37.62  ? 154 ILE G CG1 1 
ATOM   7817 C CG2 . ILE H 3 155 ? 8.324   66.946  86.532  1.00 45.61  ? 154 ILE G CG2 1 
ATOM   7818 C CD1 . ILE H 3 155 ? 8.214   63.978  87.104  1.00 51.11  ? 154 ILE G CD1 1 
ATOM   7819 N N   . PRO H 3 156 ? 5.215   67.766  84.924  1.00 38.83  ? 155 PRO G N   1 
ATOM   7820 C CA  . PRO H 3 156 ? 4.740   69.019  84.334  1.00 43.53  ? 155 PRO G CA  1 
ATOM   7821 C C   . PRO H 3 156 ? 5.819   70.079  84.162  1.00 44.80  ? 155 PRO G C   1 
ATOM   7822 O O   . PRO H 3 156 ? 6.518   70.405  85.119  1.00 56.28  ? 155 PRO G O   1 
ATOM   7823 C CB  . PRO H 3 156 ? 3.655   69.459  85.308  1.00 41.76  ? 155 PRO G CB  1 
ATOM   7824 C CG  . PRO H 3 156 ? 3.105   68.170  85.781  1.00 30.43  ? 155 PRO G CG  1 
ATOM   7825 C CD  . PRO H 3 156 ? 4.356   67.375  86.052  1.00 33.01  ? 155 PRO G CD  1 
ATOM   7826 N N   . SER H 3 157 ? 5.933   70.615  82.944  1.00 54.75  ? 156 SER G N   1 
ATOM   7827 C CA  . SER H 3 157 ? 6.916   71.652  82.602  1.00 59.50  ? 156 SER G CA  1 
ATOM   7828 C C   . SER H 3 157 ? 6.270   72.730  81.739  1.00 59.99  ? 156 SER G C   1 
ATOM   7829 O O   . SER H 3 157 ? 5.277   72.477  81.067  1.00 58.77  ? 156 SER G O   1 
ATOM   7830 C CB  . SER H 3 157 ? 8.082   71.057  81.808  1.00 58.56  ? 156 SER G CB  1 
ATOM   7831 O OG  . SER H 3 157 ? 8.540   69.848  82.378  1.00 69.01  ? 156 SER G OG  1 
ATOM   7832 N N   . ASP H 3 158 ? 6.842   73.929  81.751  1.00 65.23  ? 157 ASP G N   1 
ATOM   7833 C CA  . ASP H 3 158 ? 6.323   75.021  80.935  1.00 72.29  ? 157 ASP G CA  1 
ATOM   7834 C C   . ASP H 3 158 ? 6.613   74.722  79.469  1.00 74.52  ? 157 ASP G C   1 
ATOM   7835 O O   . ASP H 3 158 ? 5.793   74.974  78.584  1.00 74.74  ? 157 ASP G O   1 
ATOM   7836 C CB  . ASP H 3 158 ? 7.011   76.342  81.286  1.00 77.97  ? 157 ASP G CB  1 
ATOM   7837 C CG  . ASP H 3 158 ? 6.607   76.876  82.636  1.00 84.37  ? 157 ASP G CG  1 
ATOM   7838 O OD1 . ASP H 3 158 ? 5.387   76.909  82.917  1.00 77.84  ? 157 ASP G OD1 1 
ATOM   7839 O OD2 . ASP H 3 158 ? 7.511   77.277  83.406  1.00 89.42  ? 157 ASP G OD2 1 
ATOM   7840 N N   . ASP H 3 159 ? 7.800   74.178  79.239  1.00 75.04  ? 158 ASP G N   1 
ATOM   7841 C CA  . ASP H 3 159 ? 8.293   73.854  77.907  1.00 82.15  ? 158 ASP G CA  1 
ATOM   7842 C C   . ASP H 3 159 ? 7.862   72.492  77.351  1.00 80.67  ? 158 ASP G C   1 
ATOM   7843 O O   . ASP H 3 159 ? 8.555   71.923  76.500  1.00 83.52  ? 158 ASP G O   1 
ATOM   7844 C CB  . ASP H 3 159 ? 9.818   73.916  77.937  1.00 92.10  ? 158 ASP G CB  1 
ATOM   7845 C CG  . ASP H 3 159 ? 10.414  72.870  78.865  1.00 96.52  ? 158 ASP G CG  1 
ATOM   7846 O OD1 . ASP H 3 159 ? 9.827   72.641  79.947  1.00 94.55  ? 158 ASP G OD1 1 
ATOM   7847 O OD2 . ASP H 3 159 ? 11.462  72.283  78.516  1.00 102.50 ? 158 ASP G OD2 1 
ATOM   7848 N N   . ASP H 3 160 ? 6.730   71.965  77.806  1.00 71.73  ? 159 ASP G N   1 
ATOM   7849 C CA  . ASP H 3 160 ? 6.292   70.671  77.314  1.00 60.68  ? 159 ASP G CA  1 
ATOM   7850 C C   . ASP H 3 160 ? 4.869   70.612  76.794  1.00 59.34  ? 159 ASP G C   1 
ATOM   7851 O O   . ASP H 3 160 ? 3.947   71.155  77.399  1.00 62.32  ? 159 ASP G O   1 
ATOM   7852 C CB  . ASP H 3 160 ? 6.501   69.616  78.394  1.00 58.23  ? 159 ASP G CB  1 
ATOM   7853 C CG  . ASP H 3 160 ? 7.956   69.225  78.537  1.00 62.20  ? 159 ASP G CG  1 
ATOM   7854 O OD1 . ASP H 3 160 ? 8.799   69.861  77.875  1.00 64.14  ? 159 ASP G OD1 1 
ATOM   7855 O OD2 . ASP H 3 160 ? 8.263   68.289  79.305  1.00 69.48  ? 159 ASP G OD2 1 
ATOM   7856 N N   . ILE H 3 161 ? 4.719   69.938  75.656  1.00 49.97  ? 160 ILE G N   1 
ATOM   7857 C CA  . ILE H 3 161 ? 3.441   69.744  74.980  1.00 42.72  ? 160 ILE G CA  1 
ATOM   7858 C C   . ILE H 3 161 ? 3.303   68.256  74.677  1.00 40.15  ? 160 ILE G C   1 
ATOM   7859 O O   . ILE H 3 161 ? 4.282   67.604  74.334  1.00 45.55  ? 160 ILE G O   1 
ATOM   7860 C CB  . ILE H 3 161 ? 3.395   70.547  73.651  1.00 46.77  ? 160 ILE G CB  1 
ATOM   7861 C CG1 . ILE H 3 161 ? 2.649   71.861  73.873  1.00 52.99  ? 160 ILE G CG1 1 
ATOM   7862 C CG2 . ILE H 3 161 ? 2.745   69.729  72.545  1.00 43.35  ? 160 ILE G CG2 1 
ATOM   7863 C CD1 . ILE H 3 161 ? 3.273   72.744  74.934  1.00 57.52  ? 160 ILE G CD1 1 
ATOM   7864 N N   . TYR H 3 162 ? 2.093   67.718  74.784  1.00 35.74  ? 161 TYR G N   1 
ATOM   7865 C CA  . TYR H 3 162 ? 1.904   66.300  74.530  1.00 35.08  ? 161 TYR G CA  1 
ATOM   7866 C C   . TYR H 3 162 ? 0.854   66.001  73.500  1.00 32.53  ? 161 TYR G C   1 
ATOM   7867 O O   . TYR H 3 162 ? -0.018  66.829  73.230  1.00 37.89  ? 161 TYR G O   1 
ATOM   7868 C CB  . TYR H 3 162 ? 1.525   65.576  75.812  1.00 32.03  ? 161 TYR G CB  1 
ATOM   7869 C CG  . TYR H 3 162 ? 2.593   65.615  76.852  1.00 34.53  ? 161 TYR G CG  1 
ATOM   7870 C CD1 . TYR H 3 162 ? 2.766   66.736  77.670  1.00 31.94  ? 161 TYR G CD1 1 
ATOM   7871 C CD2 . TYR H 3 162 ? 3.469   64.550  76.994  1.00 30.71  ? 161 TYR G CD2 1 
ATOM   7872 C CE1 . TYR H 3 162 ? 3.797   66.782  78.602  1.00 38.24  ? 161 TYR G CE1 1 
ATOM   7873 C CE2 . TYR H 3 162 ? 4.495   64.591  77.909  1.00 37.07  ? 161 TYR G CE2 1 
ATOM   7874 C CZ  . TYR H 3 162 ? 4.658   65.704  78.709  1.00 35.26  ? 161 TYR G CZ  1 
ATOM   7875 O OH  . TYR H 3 162 ? 5.706   65.723  79.598  1.00 52.04  ? 161 TYR G OH  1 
ATOM   7876 N N   . ASP H 3 163 ? 0.931   64.797  72.946  1.00 29.32  ? 162 ASP G N   1 
ATOM   7877 C CA  . ASP H 3 163 ? -0.027  64.355  71.940  1.00 37.18  ? 162 ASP G CA  1 
ATOM   7878 C C   . ASP H 3 163 ? -0.247  62.865  72.072  1.00 33.99  ? 162 ASP G C   1 
ATOM   7879 O O   . ASP H 3 163 ? 0.702   62.104  72.254  1.00 34.50  ? 162 ASP G O   1 
ATOM   7880 C CB  . ASP H 3 163 ? 0.477   64.655  70.514  1.00 37.50  ? 162 ASP G CB  1 
ATOM   7881 C CG  . ASP H 3 163 ? 0.566   66.151  70.215  1.00 40.39  ? 162 ASP G CG  1 
ATOM   7882 O OD1 . ASP H 3 163 ? -0.481  66.773  69.925  1.00 42.37  ? 162 ASP G OD1 1 
ATOM   7883 O OD2 . ASP H 3 163 ? 1.686   66.708  70.278  1.00 42.79  ? 162 ASP G OD2 1 
ATOM   7884 N N   . CYS H 3 164 ? -1.512  62.469  72.000  1.00 35.19  ? 163 CYS G N   1 
ATOM   7885 C CA  . CYS H 3 164 ? -1.907  61.071  72.056  1.00 38.84  ? 163 CYS G CA  1 
ATOM   7886 C C   . CYS H 3 164 ? -2.197  60.718  70.600  1.00 42.34  ? 163 CYS G C   1 
ATOM   7887 O O   . CYS H 3 164 ? -3.108  61.295  69.987  1.00 36.74  ? 163 CYS G O   1 
ATOM   7888 C CB  . CYS H 3 164 ? -3.196  60.886  72.871  1.00 43.41  ? 163 CYS G CB  1 
ATOM   7889 S SG  . CYS H 3 164 ? -3.812  59.167  72.772  1.00 46.57  ? 163 CYS G SG  1 
ATOM   7890 N N   . LYS H 3 165 ? -1.432  59.783  70.047  1.00 41.52  ? 164 LYS G N   1 
ATOM   7891 C CA  . LYS H 3 165 ? -1.618  59.378  68.652  1.00 40.74  ? 164 LYS G CA  1 
ATOM   7892 C C   . LYS H 3 165 ? -2.415  58.086  68.523  1.00 32.77  ? 164 LYS G C   1 
ATOM   7893 O O   . LYS H 3 165 ? -2.072  57.074  69.128  1.00 38.87  ? 164 LYS G O   1 
ATOM   7894 C CB  . LYS H 3 165 ? -0.253  59.230  67.980  1.00 42.11  ? 164 LYS G CB  1 
ATOM   7895 C CG  . LYS H 3 165 ? -0.295  58.716  66.554  1.00 49.23  ? 164 LYS G CG  1 
ATOM   7896 C CD  . LYS H 3 165 ? 1.103   58.711  65.954  1.00 51.51  ? 164 LYS G CD  1 
ATOM   7897 C CE  . LYS H 3 165 ? 1.095   58.126  64.559  1.00 59.63  ? 164 LYS G CE  1 
ATOM   7898 N NZ  . LYS H 3 165 ? 2.389   58.327  63.861  1.00 59.01  ? 164 LYS G NZ  1 
ATOM   7899 N N   . VAL H 3 166 ? -3.486  58.119  67.738  1.00 36.73  ? 165 VAL G N   1 
ATOM   7900 C CA  . VAL H 3 166 ? -4.319  56.931  67.558  1.00 38.01  ? 165 VAL G CA  1 
ATOM   7901 C C   . VAL H 3 166 ? -4.351  56.439  66.098  1.00 43.64  ? 165 VAL G C   1 
ATOM   7902 O O   . VAL H 3 166 ? -4.558  57.222  65.169  1.00 51.96  ? 165 VAL G O   1 
ATOM   7903 C CB  . VAL H 3 166 ? -5.767  57.204  68.044  1.00 33.08  ? 165 VAL G CB  1 
ATOM   7904 C CG1 . VAL H 3 166 ? -6.584  55.941  67.988  1.00 29.64  ? 165 VAL G CG1 1 
ATOM   7905 C CG2 . VAL H 3 166 ? -5.747  57.730  69.466  1.00 35.76  ? 165 VAL G CG2 1 
ATOM   7906 N N   . GLU H 3 167 ? -4.121  55.140  65.917  1.00 45.21  ? 166 GLU G N   1 
ATOM   7907 C CA  . GLU H 3 167 ? -4.125  54.478  64.606  1.00 44.20  ? 166 GLU G CA  1 
ATOM   7908 C C   . GLU H 3 167 ? -5.152  53.360  64.635  1.00 43.41  ? 166 GLU G C   1 
ATOM   7909 O O   . GLU H 3 167 ? -5.026  52.423  65.420  1.00 43.26  ? 166 GLU G O   1 
ATOM   7910 C CB  . GLU H 3 167 ? -2.777  53.826  64.294  1.00 38.91  ? 166 GLU G CB  1 
ATOM   7911 C CG  . GLU H 3 167 ? -1.603  54.762  64.263  1.00 58.57  ? 166 GLU G CG  1 
ATOM   7912 C CD  . GLU H 3 167 ? -0.322  54.052  63.859  1.00 70.03  ? 166 GLU G CD  1 
ATOM   7913 O OE1 . GLU H 3 167 ? 0.011   53.019  64.482  1.00 75.08  ? 166 GLU G OE1 1 
ATOM   7914 O OE2 . GLU H 3 167 ? 0.354   54.531  62.920  1.00 81.14  ? 166 GLU G OE2 1 
ATOM   7915 N N   . HIS H 3 168 ? -6.159  53.455  63.776  1.00 45.17  ? 167 HIS G N   1 
ATOM   7916 C CA  . HIS H 3 168 ? -7.203  52.445  63.696  1.00 47.91  ? 167 HIS G CA  1 
ATOM   7917 C C   . HIS H 3 168 ? -7.631  52.313  62.232  1.00 49.49  ? 167 HIS G C   1 
ATOM   7918 O O   . HIS H 3 168 ? -7.494  53.265  61.456  1.00 46.57  ? 167 HIS G O   1 
ATOM   7919 C CB  . HIS H 3 168 ? -8.398  52.860  64.559  1.00 44.59  ? 167 HIS G CB  1 
ATOM   7920 C CG  . HIS H 3 168 ? -9.464  51.816  64.652  1.00 42.29  ? 167 HIS G CG  1 
ATOM   7921 N ND1 . HIS H 3 168 ? -9.320  50.671  65.405  1.00 45.84  ? 167 HIS G ND1 1 
ATOM   7922 C CD2 . HIS H 3 168 ? -10.680 51.731  64.064  1.00 41.39  ? 167 HIS G CD2 1 
ATOM   7923 C CE1 . HIS H 3 168 ? -10.403 49.925  65.275  1.00 44.81  ? 167 HIS G CE1 1 
ATOM   7924 N NE2 . HIS H 3 168 ? -11.242 50.545  64.467  1.00 39.66  ? 167 HIS G NE2 1 
ATOM   7925 N N   . TRP H 3 169 ? -8.144  51.142  61.854  1.00 48.14  ? 168 TRP G N   1 
ATOM   7926 C CA  . TRP H 3 169 ? -8.572  50.927  60.471  1.00 47.66  ? 168 TRP G CA  1 
ATOM   7927 C C   . TRP H 3 169 ? -9.683  51.899  60.084  1.00 49.18  ? 168 TRP G C   1 
ATOM   7928 O O   . TRP H 3 169 ? -9.698  52.426  58.970  1.00 53.00  ? 168 TRP G O   1 
ATOM   7929 C CB  . TRP H 3 169 ? -9.040  49.482  60.262  1.00 36.58  ? 168 TRP G CB  1 
ATOM   7930 C CG  . TRP H 3 169 ? -7.961  48.440  60.519  1.00 36.92  ? 168 TRP G CG  1 
ATOM   7931 C CD1 . TRP H 3 169 ? -6.628  48.557  60.247  1.00 34.74  ? 168 TRP G CD1 1 
ATOM   7932 C CD2 . TRP H 3 169 ? -8.137  47.134  61.095  1.00 37.02  ? 168 TRP G CD2 1 
ATOM   7933 N NE1 . TRP H 3 169 ? -5.965  47.413  60.619  1.00 35.74  ? 168 TRP G NE1 1 
ATOM   7934 C CE2 . TRP H 3 169 ? -6.865  46.521  61.138  1.00 35.38  ? 168 TRP G CE2 1 
ATOM   7935 C CE3 . TRP H 3 169 ? -9.248  46.422  61.573  1.00 39.11  ? 168 TRP G CE3 1 
ATOM   7936 C CZ2 . TRP H 3 169 ? -6.666  45.228  61.652  1.00 41.69  ? 168 TRP G CZ2 1 
ATOM   7937 C CZ3 . TRP H 3 169 ? -9.050  45.131  62.087  1.00 42.43  ? 168 TRP G CZ3 1 
ATOM   7938 C CH2 . TRP H 3 169 ? -7.766  44.551  62.116  1.00 39.96  ? 168 TRP G CH2 1 
ATOM   7939 N N   . GLY H 3 170 ? -10.601 52.148  61.012  1.00 49.86  ? 169 GLY G N   1 
ATOM   7940 C CA  . GLY H 3 170 ? -11.697 53.063  60.748  1.00 47.86  ? 169 GLY G CA  1 
ATOM   7941 C C   . GLY H 3 170 ? -11.265 54.510  60.571  1.00 51.81  ? 169 GLY G C   1 
ATOM   7942 O O   . GLY H 3 170 ? -12.104 55.407  60.437  1.00 51.37  ? 169 GLY G O   1 
ATOM   7943 N N   . LEU H 3 171 ? -9.956  54.745  60.575  1.00 50.85  ? 170 LEU G N   1 
ATOM   7944 C CA  . LEU H 3 171 ? -9.427  56.092  60.406  1.00 57.85  ? 170 LEU G CA  1 
ATOM   7945 C C   . LEU H 3 171 ? -8.494  56.147  59.219  1.00 65.00  ? 170 LEU G C   1 
ATOM   7946 O O   . LEU H 3 171 ? -7.511  55.407  59.162  1.00 66.14  ? 170 LEU G O   1 
ATOM   7947 C CB  . LEU H 3 171 ? -8.670  56.540  61.654  1.00 60.30  ? 170 LEU G CB  1 
ATOM   7948 C CG  . LEU H 3 171 ? -9.534  57.003  62.825  1.00 59.41  ? 170 LEU G CG  1 
ATOM   7949 C CD1 . LEU H 3 171 ? -8.656  57.337  64.023  1.00 60.27  ? 170 LEU G CD1 1 
ATOM   7950 C CD2 . LEU H 3 171 ? -10.350 58.211  62.391  1.00 57.29  ? 170 LEU G CD2 1 
ATOM   7951 N N   . GLU H 3 172 ? -8.800  57.034  58.276  1.00 71.15  ? 171 GLU G N   1 
ATOM   7952 C CA  . GLU H 3 172 ? -7.988  57.182  57.076  1.00 74.31  ? 171 GLU G CA  1 
ATOM   7953 C C   . GLU H 3 172 ? -6.576  57.662  57.391  1.00 70.43  ? 171 GLU G C   1 
ATOM   7954 O O   . GLU H 3 172 ? -5.616  57.292  56.717  1.00 65.47  ? 171 GLU G O   1 
ATOM   7955 C CB  . GLU H 3 172 ? -8.656  58.156  56.101  1.00 84.02  ? 171 GLU G CB  1 
ATOM   7956 C CG  . GLU H 3 172 ? -8.091  58.062  54.694  1.00 94.70  ? 171 GLU G CG  1 
ATOM   7957 C CD  . GLU H 3 172 ? -8.076  56.627  54.188  1.00 101.52 ? 171 GLU G CD  1 
ATOM   7958 O OE1 . GLU H 3 172 ? -9.169  56.031  54.057  1.00 104.32 ? 171 GLU G OE1 1 
ATOM   7959 O OE2 . GLU H 3 172 ? -6.973  56.093  53.934  1.00 101.24 ? 171 GLU G OE2 1 
ATOM   7960 N N   . GLU H 3 173 ? -6.453  58.482  58.428  1.00 71.36  ? 172 GLU G N   1 
ATOM   7961 C CA  . GLU H 3 173 ? -5.159  59.017  58.824  1.00 67.39  ? 172 GLU G CA  1 
ATOM   7962 C C   . GLU H 3 173 ? -5.062  59.021  60.345  1.00 59.08  ? 172 GLU G C   1 
ATOM   7963 O O   . GLU H 3 173 ? -6.052  59.272  61.034  1.00 57.42  ? 172 GLU G O   1 
ATOM   7964 C CB  . GLU H 3 173 ? -5.010  60.446  58.286  1.00 72.60  ? 172 GLU G CB  1 
ATOM   7965 C CG  . GLU H 3 173 ? -3.575  60.899  58.085  1.00 85.74  ? 172 GLU G CG  1 
ATOM   7966 C CD  . GLU H 3 173 ? -2.766  59.909  57.256  1.00 94.15  ? 172 GLU G CD  1 
ATOM   7967 O OE1 . GLU H 3 173 ? -3.286  59.432  56.226  1.00 96.54  ? 172 GLU G OE1 1 
ATOM   7968 O OE2 . GLU H 3 173 ? -1.608  59.611  57.629  1.00 101.48 ? 172 GLU G OE2 1 
ATOM   7969 N N   . PRO H 3 174 ? -3.875  58.719  60.889  1.00 53.03  ? 173 PRO G N   1 
ATOM   7970 C CA  . PRO H 3 174 ? -3.694  58.707  62.343  1.00 54.18  ? 173 PRO G CA  1 
ATOM   7971 C C   . PRO H 3 174 ? -4.089  60.047  62.960  1.00 54.65  ? 173 PRO G C   1 
ATOM   7972 O O   . PRO H 3 174 ? -3.659  61.103  62.494  1.00 55.50  ? 173 PRO G O   1 
ATOM   7973 C CB  . PRO H 3 174 ? -2.205  58.420  62.498  1.00 54.44  ? 173 PRO G CB  1 
ATOM   7974 C CG  . PRO H 3 174 ? -1.935  57.509  61.359  1.00 56.19  ? 173 PRO G CG  1 
ATOM   7975 C CD  . PRO H 3 174 ? -2.689  58.167  60.212  1.00 56.78  ? 173 PRO G CD  1 
ATOM   7976 N N   . VAL H 3 175 ? -4.918  60.003  63.998  1.00 54.07  ? 174 VAL G N   1 
ATOM   7977 C CA  . VAL H 3 175 ? -5.351  61.221  64.674  1.00 47.71  ? 174 VAL G CA  1 
ATOM   7978 C C   . VAL H 3 175 ? -4.451  61.545  65.864  1.00 46.17  ? 174 VAL G C   1 
ATOM   7979 O O   . VAL H 3 175 ? -3.933  60.653  66.542  1.00 39.28  ? 174 VAL G O   1 
ATOM   7980 C CB  . VAL H 3 175 ? -6.784  61.086  65.184  1.00 55.02  ? 174 VAL G CB  1 
ATOM   7981 C CG1 . VAL H 3 175 ? -7.156  62.296  66.021  1.00 60.33  ? 174 VAL G CG1 1 
ATOM   7982 C CG2 . VAL H 3 175 ? -7.731  60.939  64.008  1.00 66.08  ? 174 VAL G CG2 1 
ATOM   7983 N N   . LEU H 3 176 ? -4.255  62.830  66.110  1.00 44.91  ? 175 LEU G N   1 
ATOM   7984 C CA  . LEU H 3 176 ? -3.432  63.248  67.228  1.00 45.63  ? 175 LEU G CA  1 
ATOM   7985 C C   . LEU H 3 176 ? -4.279  64.079  68.161  1.00 46.43  ? 175 LEU G C   1 
ATOM   7986 O O   . LEU H 3 176 ? -4.786  65.123  67.765  1.00 45.59  ? 175 LEU G O   1 
ATOM   7987 C CB  . LEU H 3 176 ? -2.254  64.099  66.764  1.00 40.46  ? 175 LEU G CB  1 
ATOM   7988 C CG  . LEU H 3 176 ? -1.233  63.533  65.787  1.00 39.52  ? 175 LEU G CG  1 
ATOM   7989 C CD1 . LEU H 3 176 ? -0.109  64.545  65.672  1.00 44.55  ? 175 LEU G CD1 1 
ATOM   7990 C CD2 . LEU H 3 176 ? -0.696  62.186  66.252  1.00 38.13  ? 175 LEU G CD2 1 
ATOM   7991 N N   . LYS H 3 177 ? -4.456  63.615  69.393  1.00 50.87  ? 176 LYS G N   1 
ATOM   7992 C CA  . LYS H 3 177 ? -5.229  64.400  70.336  1.00 48.04  ? 176 LYS G CA  1 
ATOM   7993 C C   . LYS H 3 177 ? -4.213  65.214  71.132  1.00 49.24  ? 176 LYS G C   1 
ATOM   7994 O O   . LYS H 3 177 ? -3.286  64.675  71.739  1.00 53.59  ? 176 LYS G O   1 
ATOM   7995 C CB  . LYS H 3 177 ? -6.071  63.508  71.234  1.00 46.14  ? 176 LYS G CB  1 
ATOM   7996 C CG  . LYS H 3 177 ? -7.241  64.246  71.849  1.00 51.33  ? 176 LYS G CG  1 
ATOM   7997 C CD  . LYS H 3 177 ? -8.023  65.009  70.783  1.00 51.45  ? 176 LYS G CD  1 
ATOM   7998 C CE  . LYS H 3 177 ? -9.150  65.814  71.395  1.00 50.28  ? 176 LYS G CE  1 
ATOM   7999 N NZ  . LYS H 3 177 ? -9.622  66.875  70.460  1.00 65.25  ? 176 LYS G NZ  1 
ATOM   8000 N N   . HIS H 3 178 ? -4.396  66.526  71.093  1.00 43.01  ? 177 HIS G N   1 
ATOM   8001 C CA  . HIS H 3 178 ? -3.502  67.477  71.725  1.00 47.28  ? 177 HIS G CA  1 
ATOM   8002 C C   . HIS H 3 178 ? -3.800  67.810  73.188  1.00 49.26  ? 177 HIS G C   1 
ATOM   8003 O O   . HIS H 3 178 ? -4.951  67.819  73.624  1.00 49.55  ? 177 HIS G O   1 
ATOM   8004 C CB  . HIS H 3 178 ? -3.534  68.762  70.892  1.00 50.65  ? 177 HIS G CB  1 
ATOM   8005 C CG  . HIS H 3 178 ? -2.434  69.721  71.202  1.00 52.68  ? 177 HIS G CG  1 
ATOM   8006 N ND1 . HIS H 3 178 ? -1.102  69.387  71.083  1.00 54.89  ? 177 HIS G ND1 1 
ATOM   8007 C CD2 . HIS H 3 178 ? -2.464  71.018  71.589  1.00 60.57  ? 177 HIS G CD2 1 
ATOM   8008 C CE1 . HIS H 3 178 ? -0.359  70.438  71.382  1.00 60.74  ? 177 HIS G CE1 1 
ATOM   8009 N NE2 . HIS H 3 178 ? -1.160  71.441  71.692  1.00 65.24  ? 177 HIS G NE2 1 
ATOM   8010 N N   . TRP H 3 179 ? -2.739  68.085  73.937  1.00 51.00  ? 178 TRP G N   1 
ATOM   8011 C CA  . TRP H 3 179 ? -2.858  68.481  75.330  1.00 51.37  ? 178 TRP G CA  1 
ATOM   8012 C C   . TRP H 3 179 ? -1.620  69.235  75.787  1.00 57.21  ? 178 TRP G C   1 
ATOM   8013 O O   . TRP H 3 179 ? -0.486  68.813  75.536  1.00 59.80  ? 178 TRP G O   1 
ATOM   8014 C CB  . TRP H 3 179 ? -3.034  67.280  76.257  1.00 44.49  ? 178 TRP G CB  1 
ATOM   8015 C CG  . TRP H 3 179 ? -3.376  67.718  77.662  1.00 47.43  ? 178 TRP G CG  1 
ATOM   8016 C CD1 . TRP H 3 179 ? -4.622  68.012  78.148  1.00 52.86  ? 178 TRP G CD1 1 
ATOM   8017 C CD2 . TRP H 3 179 ? -2.456  68.000  78.733  1.00 44.54  ? 178 TRP G CD2 1 
ATOM   8018 N NE1 . TRP H 3 179 ? -4.535  68.459  79.448  1.00 45.15  ? 178 TRP G NE1 1 
ATOM   8019 C CE2 . TRP H 3 179 ? -3.220  68.462  79.830  1.00 39.78  ? 178 TRP G CE2 1 
ATOM   8020 C CE3 . TRP H 3 179 ? -1.066  67.907  78.869  1.00 45.49  ? 178 TRP G CE3 1 
ATOM   8021 C CZ2 . TRP H 3 179 ? -2.641  68.831  81.046  1.00 37.32  ? 178 TRP G CZ2 1 
ATOM   8022 C CZ3 . TRP H 3 179 ? -0.486  68.275  80.084  1.00 46.50  ? 178 TRP G CZ3 1 
ATOM   8023 C CH2 . TRP H 3 179 ? -1.277  68.730  81.155  1.00 49.74  ? 178 TRP G CH2 1 
ATOM   8024 N N   . GLU H 3 180 ? -1.837  70.353  76.464  1.00 59.96  ? 179 GLU G N   1 
ATOM   8025 C CA  . GLU H 3 180 ? -0.729  71.126  77.000  1.00 70.13  ? 179 GLU G CA  1 
ATOM   8026 C C   . GLU H 3 180 ? -1.109  71.714  78.355  1.00 69.05  ? 179 GLU G C   1 
ATOM   8027 O O   . GLU H 3 180 ? -2.265  72.069  78.586  1.00 72.54  ? 179 GLU G O   1 
ATOM   8028 C CB  . GLU H 3 180 ? -0.305  72.235  76.024  1.00 70.79  ? 179 GLU G CB  1 
ATOM   8029 C CG  . GLU H 3 180 ? -1.406  73.172  75.557  1.00 77.15  ? 179 GLU G CG  1 
ATOM   8030 C CD  . GLU H 3 180 ? -0.892  74.213  74.568  1.00 81.79  ? 179 GLU G CD  1 
ATOM   8031 O OE1 . GLU H 3 180 ? -0.328  73.816  73.523  1.00 79.58  ? 179 GLU G OE1 1 
ATOM   8032 O OE2 . GLU H 3 180 ? -1.051  75.424  74.837  1.00 79.20  ? 179 GLU G OE2 1 
ATOM   8033 N N   . PRO H 3 181 ? -0.145  71.790  79.286  1.00 68.35  ? 180 PRO G N   1 
ATOM   8034 C CA  . PRO H 3 181 ? -0.464  72.351  80.598  1.00 70.17  ? 180 PRO G CA  1 
ATOM   8035 C C   . PRO H 3 181 ? -0.879  73.817  80.474  1.00 73.69  ? 180 PRO G C   1 
ATOM   8036 O O   . PRO H 3 181 ? -0.114  74.655  79.993  1.00 68.15  ? 180 PRO G O   1 
ATOM   8037 C CB  . PRO H 3 181 ? 0.838   72.166  81.376  1.00 71.31  ? 180 PRO G CB  1 
ATOM   8038 C CG  . PRO H 3 181 ? 1.884   72.239  80.306  1.00 71.52  ? 180 PRO G CG  1 
ATOM   8039 C CD  . PRO H 3 181 ? 1.274   71.403  79.210  1.00 66.98  ? 180 PRO G CD  1 
ATOM   8040 N N   . GLU H 3 182 ? -2.106  74.110  80.893  1.00 80.55  ? 181 GLU G N   1 
ATOM   8041 C CA  . GLU H 3 182 ? -2.641  75.466  80.836  1.00 90.84  ? 181 GLU G CA  1 
ATOM   8042 C C   . GLU H 3 182 ? -2.785  76.034  82.250  1.00 90.33  ? 181 GLU G C   1 
ATOM   8043 O O   . GLU H 3 182 ? -3.940  76.233  82.691  1.00 89.40  ? 181 GLU G O   1 
ATOM   8044 C CB  . GLU H 3 182 ? -4.000  75.467  80.121  1.00 97.45  ? 181 GLU G CB  1 
ATOM   8045 C CG  . GLU H 3 182 ? -4.619  76.852  79.918  1.00 106.38 ? 181 GLU G CG  1 
ATOM   8046 C CD  . GLU H 3 182 ? -5.905  76.807  79.104  1.00 112.54 ? 181 GLU G CD  1 
ATOM   8047 O OE1 . GLU H 3 182 ? -6.841  76.080  79.505  1.00 115.58 ? 181 GLU G OE1 1 
ATOM   8048 O OE2 . GLU H 3 182 ? -5.982  77.499  78.064  1.00 114.32 ? 181 GLU G OE2 1 
ATOM   8049 O OXT . GLU H 3 182 ? -1.736  76.262  82.898  1.00 84.14  ? 181 GLU G OXT 1 
ATOM   8050 N N   . GLY I 4 1   ? -12.389 35.992  54.382  1.00 123.37 ? 1   GLY H N   1 
ATOM   8051 C CA  . GLY I 4 1   ? -11.205 36.837  54.499  1.00 124.73 ? 1   GLY H CA  1 
ATOM   8052 C C   . GLY I 4 1   ? -10.485 37.011  53.184  1.00 127.13 ? 1   GLY H C   1 
ATOM   8053 O O   . GLY I 4 1   ? -9.403  36.452  52.979  1.00 127.55 ? 1   GLY H O   1 
ATOM   8054 N N   . ASP I 4 2   ? -11.096 37.771  52.282  1.00 128.91 ? 2   ASP H N   1 
ATOM   8055 C CA  . ASP I 4 2   ? -10.462 38.043  51.011  1.00 128.86 ? 2   ASP H CA  1 
ATOM   8056 C C   . ASP I 4 2   ? -9.397  39.153  51.197  1.00 128.65 ? 2   ASP H C   1 
ATOM   8057 O O   . ASP I 4 2   ? -8.242  38.960  50.827  1.00 128.02 ? 2   ASP H O   1 
ATOM   8058 C CB  . ASP I 4 2   ? -11.495 38.466  49.934  1.00 127.49 ? 2   ASP H CB  1 
ATOM   8059 C CG  . ASP I 4 2   ? -12.475 37.340  49.547  1.00 127.75 ? 2   ASP H CG  1 
ATOM   8060 O OD1 . ASP I 4 2   ? -12.042 36.288  49.015  1.00 126.60 ? 2   ASP H OD1 1 
ATOM   8061 O OD2 . ASP I 4 2   ? -13.693 37.525  49.767  1.00 127.48 ? 2   ASP H OD2 1 
ATOM   8062 N N   . SER I 4 3   ? -9.714  40.292  51.799  1.00 127.82 ? 3   SER H N   1 
ATOM   8063 C CA  . SER I 4 3   ? -8.650  41.295  51.831  1.00 126.70 ? 3   SER H CA  1 
ATOM   8064 C C   . SER I 4 3   ? -8.469  42.071  53.110  1.00 121.73 ? 3   SER H C   1 
ATOM   8065 O O   . SER I 4 3   ? -7.342  42.351  53.524  1.00 121.25 ? 3   SER H O   1 
ATOM   8066 C CB  . SER I 4 3   ? -8.843  42.253  50.655  1.00 130.95 ? 3   SER H CB  1 
ATOM   8067 O OG  . SER I 4 3   ? -10.162 42.769  50.638  1.00 136.94 ? 3   SER H OG  1 
ATOM   8068 N N   . GLU I 4 4   ? -9.590  42.448  53.709  1.00 117.36 ? 4   GLU H N   1 
ATOM   8069 C CA  . GLU I 4 4   ? -9.588  43.149  54.987  1.00 114.23 ? 4   GLU H CA  1 
ATOM   8070 C C   . GLU I 4 4   ? -10.753 42.584  55.759  1.00 110.36 ? 4   GLU H C   1 
ATOM   8071 O O   . GLU I 4 4   ? -11.042 43.028  56.860  1.00 112.53 ? 4   GLU H O   1 
ATOM   8072 C CB  . GLU I 4 4   ? -9.803  44.670  54.850  1.00 115.78 ? 4   GLU H CB  1 
ATOM   8073 C CG  . GLU I 4 4   ? -8.982  45.589  55.838  1.00 121.13 ? 4   GLU H CG  1 
ATOM   8074 C CD  . GLU I 4 4   ? -9.163  45.331  57.355  1.00 121.60 ? 4   GLU H CD  1 
ATOM   8075 O OE1 . GLU I 4 4   ? -10.307 45.397  57.862  1.00 120.53 ? 4   GLU H OE1 1 
ATOM   8076 O OE2 . GLU I 4 4   ? -8.140  45.090  58.045  1.00 117.93 ? 4   GLU H OE2 1 
ATOM   8077 N N   . ARG I 4 5   ? -11.437 41.598  55.215  1.00 103.64 ? 5   ARG H N   1 
ATOM   8078 C CA  . ARG I 4 5   ? -12.565 41.113  55.971  1.00 100.16 ? 5   ARG H CA  1 
ATOM   8079 C C   . ARG I 4 5   ? -12.092 40.661  57.360  1.00 93.67  ? 5   ARG H C   1 
ATOM   8080 O O   . ARG I 4 5   ? -11.319 39.714  57.492  1.00 94.56  ? 5   ARG H O   1 
ATOM   8081 C CB  . ARG I 4 5   ? -13.253 40.012  55.172  1.00 105.58 ? 5   ARG H CB  1 
ATOM   8082 C CG  . ARG I 4 5   ? -13.165 40.287  53.664  1.00 112.39 ? 5   ARG H CG  1 
ATOM   8083 C CD  . ARG I 4 5   ? -13.564 39.082  52.839  1.00 122.35 ? 5   ARG H CD  1 
ATOM   8084 N NE  . ARG I 4 5   ? -14.957 38.717  53.061  1.00 126.32 ? 5   ARG H NE  1 
ATOM   8085 C CZ  . ARG I 4 5   ? -15.987 39.505  52.770  1.00 128.25 ? 5   ARG H CZ  1 
ATOM   8086 N NH1 . ARG I 4 5   ? -15.779 40.706  52.244  1.00 128.95 ? 5   ARG H NH1 1 
ATOM   8087 N NH2 . ARG I 4 5   ? -17.227 39.092  53.001  1.00 127.06 ? 5   ARG H NH2 1 
ATOM   8088 N N   . HIS I 4 6   ? -12.535 41.386  58.387  1.00 82.66  ? 6   HIS H N   1 
ATOM   8089 C CA  . HIS I 4 6   ? -12.176 41.091  59.770  1.00 73.13  ? 6   HIS H CA  1 
ATOM   8090 C C   . HIS I 4 6   ? -13.415 40.556  60.485  1.00 68.74  ? 6   HIS H C   1 
ATOM   8091 O O   . HIS I 4 6   ? -14.514 41.085  60.315  1.00 69.75  ? 6   HIS H O   1 
ATOM   8092 C CB  . HIS I 4 6   ? -11.681 42.362  60.464  1.00 74.14  ? 6   HIS H CB  1 
ATOM   8093 C CG  . HIS I 4 6   ? -11.051 42.118  61.801  1.00 82.64  ? 6   HIS H CG  1 
ATOM   8094 N ND1 . HIS I 4 6   ? -9.750  41.682  61.943  1.00 79.86  ? 6   HIS H ND1 1 
ATOM   8095 C CD2 . HIS I 4 6   ? -11.548 42.235  63.057  1.00 80.96  ? 6   HIS H CD2 1 
ATOM   8096 C CE1 . HIS I 4 6   ? -9.474  41.541  63.227  1.00 81.26  ? 6   HIS H CE1 1 
ATOM   8097 N NE2 . HIS I 4 6   ? -10.548 41.869  63.924  1.00 78.25  ? 6   HIS H NE2 1 
ATOM   8098 N N   . PHE I 4 7   ? -13.239 39.510  61.285  1.00 63.19  ? 7   PHE H N   1 
ATOM   8099 C CA  . PHE I 4 7   ? -14.361 38.903  62.001  1.00 63.88  ? 7   PHE H CA  1 
ATOM   8100 C C   . PHE I 4 7   ? -14.055 38.790  63.492  1.00 60.85  ? 7   PHE H C   1 
ATOM   8101 O O   . PHE I 4 7   ? -12.891 38.714  63.889  1.00 60.83  ? 7   PHE H O   1 
ATOM   8102 C CB  . PHE I 4 7   ? -14.647 37.505  61.430  1.00 68.85  ? 7   PHE H CB  1 
ATOM   8103 C CG  . PHE I 4 7   ? -14.761 37.476  59.933  1.00 68.60  ? 7   PHE H CG  1 
ATOM   8104 C CD1 . PHE I 4 7   ? -15.922 37.910  59.309  1.00 71.82  ? 7   PHE H CD1 1 
ATOM   8105 C CD2 . PHE I 4 7   ? -13.694 37.054  59.145  1.00 71.30  ? 7   PHE H CD2 1 
ATOM   8106 C CE1 . PHE I 4 7   ? -16.023 37.934  57.918  1.00 73.44  ? 7   PHE H CE1 1 
ATOM   8107 C CE2 . PHE I 4 7   ? -13.782 37.074  57.751  1.00 73.34  ? 7   PHE H CE2 1 
ATOM   8108 C CZ  . PHE I 4 7   ? -14.953 37.515  57.138  1.00 73.06  ? 7   PHE H CZ  1 
ATOM   8109 N N   . VAL I 4 8   ? -15.098 38.769  64.316  1.00 55.92  ? 8   VAL H N   1 
ATOM   8110 C CA  . VAL I 4 8   ? -14.910 38.656  65.761  1.00 57.53  ? 8   VAL H CA  1 
ATOM   8111 C C   . VAL I 4 8   ? -16.196 38.194  66.444  1.00 50.57  ? 8   VAL H C   1 
ATOM   8112 O O   . VAL I 4 8   ? -17.266 38.246  65.858  1.00 51.68  ? 8   VAL H O   1 
ATOM   8113 C CB  . VAL I 4 8   ? -14.454 40.028  66.369  1.00 61.12  ? 8   VAL H CB  1 
ATOM   8114 C CG1 . VAL I 4 8   ? -15.563 41.057  66.248  1.00 52.65  ? 8   VAL H CG1 1 
ATOM   8115 C CG2 . VAL I 4 8   ? -14.041 39.858  67.818  1.00 71.18  ? 8   VAL H CG2 1 
ATOM   8116 N N   . VAL I 4 9   ? -16.080 37.708  67.673  1.00 52.25  ? 9   VAL H N   1 
ATOM   8117 C CA  . VAL I 4 9   ? -17.249 37.288  68.448  1.00 52.26  ? 9   VAL H CA  1 
ATOM   8118 C C   . VAL I 4 9   ? -17.062 37.869  69.846  1.00 51.55  ? 9   VAL H C   1 
ATOM   8119 O O   . VAL I 4 9   ? -15.941 38.215  70.230  1.00 43.46  ? 9   VAL H O   1 
ATOM   8120 C CB  . VAL I 4 9   ? -17.380 35.744  68.561  1.00 52.94  ? 9   VAL H CB  1 
ATOM   8121 C CG1 . VAL I 4 9   ? -17.733 35.145  67.207  1.00 58.85  ? 9   VAL H CG1 1 
ATOM   8122 C CG2 . VAL I 4 9   ? -16.090 35.143  69.092  1.00 49.52  ? 9   VAL H CG2 1 
ATOM   8123 N N   . GLN I 4 10  ? -18.149 37.984  70.603  1.00 52.63  ? 10  GLN H N   1 
ATOM   8124 C CA  . GLN I 4 10  ? -18.071 38.535  71.954  1.00 47.48  ? 10  GLN H CA  1 
ATOM   8125 C C   . GLN I 4 10  ? -18.990 37.851  72.955  1.00 51.38  ? 10  GLN H C   1 
ATOM   8126 O O   . GLN I 4 10  ? -20.188 37.732  72.714  1.00 51.26  ? 10  GLN H O   1 
ATOM   8127 C CB  . GLN I 4 10  ? -18.449 40.018  71.969  1.00 40.06  ? 10  GLN H CB  1 
ATOM   8128 C CG  . GLN I 4 10  ? -17.540 40.971  71.233  1.00 41.37  ? 10  GLN H CG  1 
ATOM   8129 C CD  . GLN I 4 10  ? -18.024 42.402  71.376  1.00 46.72  ? 10  GLN H CD  1 
ATOM   8130 O OE1 . GLN I 4 10  ? -18.171 42.906  72.491  1.00 47.94  ? 10  GLN H OE1 1 
ATOM   8131 N NE2 . GLN I 4 10  ? -18.280 43.063  70.251  1.00 38.94  ? 10  GLN H NE2 1 
ATOM   8132 N N   . PHE I 4 11  ? -18.432 37.415  74.082  1.00 47.57  ? 11  PHE H N   1 
ATOM   8133 C CA  . PHE I 4 11  ? -19.246 36.830  75.138  1.00 49.56  ? 11  PHE H CA  1 
ATOM   8134 C C   . PHE I 4 11  ? -19.187 37.845  76.285  1.00 49.53  ? 11  PHE H C   1 
ATOM   8135 O O   . PHE I 4 11  ? -18.106 38.170  76.776  1.00 47.76  ? 11  PHE H O   1 
ATOM   8136 C CB  . PHE I 4 11  ? -18.691 35.489  75.613  1.00 48.97  ? 11  PHE H CB  1 
ATOM   8137 C CG  . PHE I 4 11  ? -19.462 34.900  76.771  1.00 48.24  ? 11  PHE H CG  1 
ATOM   8138 C CD1 . PHE I 4 11  ? -20.780 34.480  76.605  1.00 42.17  ? 11  PHE H CD1 1 
ATOM   8139 C CD2 . PHE I 4 11  ? -18.877 34.788  78.027  1.00 37.26  ? 11  PHE H CD2 1 
ATOM   8140 C CE1 . PHE I 4 11  ? -21.505 33.955  77.674  1.00 46.35  ? 11  PHE H CE1 1 
ATOM   8141 C CE2 . PHE I 4 11  ? -19.593 34.266  79.103  1.00 44.19  ? 11  PHE H CE2 1 
ATOM   8142 C CZ  . PHE I 4 11  ? -20.912 33.847  78.926  1.00 44.36  ? 11  PHE H CZ  1 
ATOM   8143 N N   . GLN I 4 12  ? -20.346 38.344  76.702  1.00 46.64  ? 12  GLN H N   1 
ATOM   8144 C CA  . GLN I 4 12  ? -20.409 39.343  77.762  1.00 43.84  ? 12  GLN H CA  1 
ATOM   8145 C C   . GLN I 4 12  ? -21.339 38.972  78.902  1.00 39.27  ? 12  GLN H C   1 
ATOM   8146 O O   . GLN I 4 12  ? -22.536 39.188  78.817  1.00 43.44  ? 12  GLN H O   1 
ATOM   8147 C CB  . GLN I 4 12  ? -20.862 40.678  77.183  1.00 44.53  ? 12  GLN H CB  1 
ATOM   8148 C CG  . GLN I 4 12  ? -19.871 41.317  76.234  1.00 40.14  ? 12  GLN H CG  1 
ATOM   8149 C CD  . GLN I 4 12  ? -20.193 42.783  75.988  1.00 45.99  ? 12  GLN H CD  1 
ATOM   8150 O OE1 . GLN I 4 12  ? -20.887 43.417  76.791  1.00 37.53  ? 12  GLN H OE1 1 
ATOM   8151 N NE2 . GLN I 4 12  ? -19.677 43.334  74.888  1.00 34.16  ? 12  GLN H NE2 1 
ATOM   8152 N N   . PRO I 4 13  ? -20.796 38.418  79.995  1.00 40.20  ? 13  PRO H N   1 
ATOM   8153 C CA  . PRO I 4 13  ? -21.644 38.041  81.124  1.00 39.72  ? 13  PRO H CA  1 
ATOM   8154 C C   . PRO I 4 13  ? -21.814 39.215  82.063  1.00 40.92  ? 13  PRO H C   1 
ATOM   8155 O O   . PRO I 4 13  ? -20.876 39.973  82.286  1.00 49.74  ? 13  PRO H O   1 
ATOM   8156 C CB  . PRO I 4 13  ? -20.864 36.907  81.758  1.00 45.24  ? 13  PRO H CB  1 
ATOM   8157 C CG  . PRO I 4 13  ? -19.447 37.406  81.620  1.00 46.72  ? 13  PRO H CG  1 
ATOM   8158 C CD  . PRO I 4 13  ? -19.410 37.955  80.203  1.00 41.89  ? 13  PRO H CD  1 
ATOM   8159 N N   . PHE I 4 14  ? -23.013 39.359  82.610  1.00 43.07  ? 14  PHE H N   1 
ATOM   8160 C CA  . PHE I 4 14  ? -23.320 40.447  83.529  1.00 41.29  ? 14  PHE H CA  1 
ATOM   8161 C C   . PHE I 4 14  ? -24.014 39.921  84.783  1.00 43.21  ? 14  PHE H C   1 
ATOM   8162 O O   . PHE I 4 14  ? -24.884 39.061  84.705  1.00 46.60  ? 14  PHE H O   1 
ATOM   8163 C CB  . PHE I 4 14  ? -24.241 41.468  82.842  1.00 40.49  ? 14  PHE H CB  1 
ATOM   8164 C CG  . PHE I 4 14  ? -23.585 42.217  81.721  1.00 42.75  ? 14  PHE H CG  1 
ATOM   8165 C CD1 . PHE I 4 14  ? -22.869 43.386  81.973  1.00 37.76  ? 14  PHE H CD1 1 
ATOM   8166 C CD2 . PHE I 4 14  ? -23.635 41.728  80.419  1.00 32.52  ? 14  PHE H CD2 1 
ATOM   8167 C CE1 . PHE I 4 14  ? -22.207 44.056  80.944  1.00 41.89  ? 14  PHE H CE1 1 
ATOM   8168 C CE2 . PHE I 4 14  ? -22.976 42.388  79.382  1.00 44.13  ? 14  PHE H CE2 1 
ATOM   8169 C CZ  . PHE I 4 14  ? -22.257 43.556  79.643  1.00 42.60  ? 14  PHE H CZ  1 
ATOM   8170 N N   . CYS I 4 15  ? -23.615 40.438  85.935  1.00 47.34  ? 15  CYS H N   1 
ATOM   8171 C CA  . CYS I 4 15  ? -24.225 40.066  87.203  1.00 50.66  ? 15  CYS H CA  1 
ATOM   8172 C C   . CYS I 4 15  ? -24.699 41.390  87.787  1.00 50.28  ? 15  CYS H C   1 
ATOM   8173 O O   . CYS I 4 15  ? -23.897 42.165  88.305  1.00 54.62  ? 15  CYS H O   1 
ATOM   8174 C CB  . CYS I 4 15  ? -23.212 39.438  88.170  1.00 49.02  ? 15  CYS H CB  1 
ATOM   8175 S SG  . CYS I 4 15  ? -22.597 37.745  87.860  1.00 59.75  ? 15  CYS H SG  1 
ATOM   8176 N N   . TYR I 4 16  ? -25.996 41.651  87.693  1.00 48.87  ? 16  TYR H N   1 
ATOM   8177 C CA  . TYR I 4 16  ? -26.567 42.886  88.206  1.00 50.15  ? 16  TYR H CA  1 
ATOM   8178 C C   . TYR I 4 16  ? -26.998 42.741  89.657  1.00 55.23  ? 16  TYR H C   1 
ATOM   8179 O O   . TYR I 4 16  ? -27.969 42.055  89.957  1.00 61.56  ? 16  TYR H O   1 
ATOM   8180 C CB  . TYR I 4 16  ? -27.757 43.284  87.346  1.00 47.51  ? 16  TYR H CB  1 
ATOM   8181 C CG  . TYR I 4 16  ? -27.370 43.623  85.934  1.00 40.86  ? 16  TYR H CG  1 
ATOM   8182 C CD1 . TYR I 4 16  ? -26.790 44.852  85.630  1.00 45.34  ? 16  TYR H CD1 1 
ATOM   8183 C CD2 . TYR I 4 16  ? -27.569 42.712  84.899  1.00 46.37  ? 16  TYR H CD2 1 
ATOM   8184 C CE1 . TYR I 4 16  ? -26.418 45.168  84.321  1.00 49.88  ? 16  TYR H CE1 1 
ATOM   8185 C CE2 . TYR I 4 16  ? -27.200 43.015  83.586  1.00 48.36  ? 16  TYR H CE2 1 
ATOM   8186 C CZ  . TYR I 4 16  ? -26.627 44.244  83.304  1.00 43.97  ? 16  TYR H CZ  1 
ATOM   8187 O OH  . TYR I 4 16  ? -26.276 44.559  82.007  1.00 54.90  ? 16  TYR H OH  1 
ATOM   8188 N N   . PHE I 4 17  ? -26.276 43.400  90.555  1.00 57.21  ? 17  PHE H N   1 
ATOM   8189 C CA  . PHE I 4 17  ? -26.569 43.337  91.983  1.00 57.50  ? 17  PHE H CA  1 
ATOM   8190 C C   . PHE I 4 17  ? -27.370 44.541  92.496  1.00 55.57  ? 17  PHE H C   1 
ATOM   8191 O O   . PHE I 4 17  ? -27.089 45.685  92.149  1.00 56.70  ? 17  PHE H O   1 
ATOM   8192 C CB  . PHE I 4 17  ? -25.256 43.241  92.770  1.00 58.59  ? 17  PHE H CB  1 
ATOM   8193 C CG  . PHE I 4 17  ? -24.422 42.043  92.421  1.00 61.30  ? 17  PHE H CG  1 
ATOM   8194 C CD1 . PHE I 4 17  ? -24.778 40.774  92.872  1.00 61.57  ? 17  PHE H CD1 1 
ATOM   8195 C CD2 . PHE I 4 17  ? -23.281 42.179  91.636  1.00 62.39  ? 17  PHE H CD2 1 
ATOM   8196 C CE1 . PHE I 4 17  ? -24.012 39.661  92.548  1.00 55.40  ? 17  PHE H CE1 1 
ATOM   8197 C CE2 . PHE I 4 17  ? -22.506 41.069  91.304  1.00 61.42  ? 17  PHE H CE2 1 
ATOM   8198 C CZ  . PHE I 4 17  ? -22.873 39.807  91.762  1.00 61.95  ? 17  PHE H CZ  1 
ATOM   8199 N N   . THR I 4 18  ? -28.373 44.274  93.323  1.00 58.37  ? 18  THR H N   1 
ATOM   8200 C CA  . THR I 4 18  ? -29.184 45.337  93.905  1.00 61.77  ? 18  THR H CA  1 
ATOM   8201 C C   . THR I 4 18  ? -29.347 45.019  95.386  1.00 63.45  ? 18  THR H C   1 
ATOM   8202 O O   . THR I 4 18  ? -29.695 43.895  95.751  1.00 64.14  ? 18  THR H O   1 
ATOM   8203 C CB  . THR I 4 18  ? -30.585 45.430  93.260  1.00 61.55  ? 18  THR H CB  1 
ATOM   8204 O OG1 . THR I 4 18  ? -30.465 45.777  91.878  1.00 65.22  ? 18  THR H OG1 1 
ATOM   8205 C CG2 . THR I 4 18  ? -31.402 46.498  93.944  1.00 65.62  ? 18  THR H CG2 1 
ATOM   8206 N N   . ASN I 4 19  ? -29.083 46.012  96.231  1.00 67.79  ? 19  ASN H N   1 
ATOM   8207 C CA  . ASN I 4 19  ? -29.189 45.849  97.675  1.00 69.99  ? 19  ASN H CA  1 
ATOM   8208 C C   . ASN I 4 19  ? -28.493 44.554  98.093  1.00 68.41  ? 19  ASN H C   1 
ATOM   8209 O O   . ASN I 4 19  ? -29.139 43.571  98.451  1.00 64.85  ? 19  ASN H O   1 
ATOM   8210 C CB  . ASN I 4 19  ? -30.662 45.821  98.090  1.00 79.25  ? 19  ASN H CB  1 
ATOM   8211 C CG  . ASN I 4 19  ? -30.847 45.899  99.598  1.00 91.28  ? 19  ASN H CG  1 
ATOM   8212 O OD1 . ASN I 4 19  ? -30.303 45.087  100.350 1.00 94.98  ? 19  ASN H OD1 1 
ATOM   8213 N ND2 . ASN I 4 19  ? -31.627 46.878  100.045 1.00 97.68  ? 19  ASN H ND2 1 
ATOM   8214 N N   . GLY I 4 20  ? -27.164 44.564  98.035  1.00 73.45  ? 20  GLY H N   1 
ATOM   8215 C CA  . GLY I 4 20  ? -26.389 43.390  98.396  1.00 72.70  ? 20  GLY H CA  1 
ATOM   8216 C C   . GLY I 4 20  ? -26.630 42.260  97.415  1.00 73.38  ? 20  GLY H C   1 
ATOM   8217 O O   . GLY I 4 20  ? -26.511 42.437  96.200  1.00 69.64  ? 20  GLY H O   1 
ATOM   8218 N N   . THR I 4 21  ? -26.969 41.089  97.939  1.00 76.09  ? 21  THR H N   1 
ATOM   8219 C CA  . THR I 4 21  ? -27.239 39.941  97.089  1.00 75.01  ? 21  THR H CA  1 
ATOM   8220 C C   . THR I 4 21  ? -28.727 39.626  97.054  1.00 75.07  ? 21  THR H C   1 
ATOM   8221 O O   . THR I 4 21  ? -29.127 38.578  96.555  1.00 75.39  ? 21  THR H O   1 
ATOM   8222 C CB  . THR I 4 21  ? -26.464 38.689  97.562  1.00 72.85  ? 21  THR H CB  1 
ATOM   8223 O OG1 . THR I 4 21  ? -26.460 38.633  98.994  1.00 77.25  ? 21  THR H OG1 1 
ATOM   8224 C CG2 . THR I 4 21  ? -25.038 38.724  97.051  1.00 68.10  ? 21  THR H CG2 1 
ATOM   8225 N N   . GLN I 4 22  ? -29.545 40.534  97.586  1.00 78.23  ? 22  GLN H N   1 
ATOM   8226 C CA  . GLN I 4 22  ? -30.991 40.331  97.592  1.00 81.21  ? 22  GLN H CA  1 
ATOM   8227 C C   . GLN I 4 22  ? -31.468 40.147  96.163  1.00 79.80  ? 22  GLN H C   1 
ATOM   8228 O O   . GLN I 4 22  ? -31.749 39.027  95.744  1.00 83.46  ? 22  GLN H O   1 
ATOM   8229 C CB  . GLN I 4 22  ? -31.717 41.513  98.242  1.00 84.07  ? 22  GLN H CB  1 
ATOM   8230 C CG  . GLN I 4 22  ? -31.523 41.591  99.747  1.00 94.78  ? 22  GLN H CG  1 
ATOM   8231 C CD  . GLN I 4 22  ? -32.631 42.360  100.446 1.00 102.42 ? 22  GLN H CD  1 
ATOM   8232 O OE1 . GLN I 4 22  ? -32.837 43.549  100.196 1.00 103.79 ? 22  GLN H OE1 1 
ATOM   8233 N NE2 . GLN I 4 22  ? -33.352 41.678  101.331 1.00 105.00 ? 22  GLN H NE2 1 
ATOM   8234 N N   . ARG I 4 23  ? -31.562 41.236  95.410  1.00 77.91  ? 23  ARG H N   1 
ATOM   8235 C CA  . ARG I 4 23  ? -31.984 41.121  94.020  1.00 79.62  ? 23  ARG H CA  1 
ATOM   8236 C C   . ARG I 4 23  ? -30.738 40.833  93.179  1.00 71.46  ? 23  ARG H C   1 
ATOM   8237 O O   . ARG I 4 23  ? -29.700 41.464  93.362  1.00 72.77  ? 23  ARG H O   1 
ATOM   8238 C CB  . ARG I 4 23  ? -32.660 42.416  93.532  1.00 87.53  ? 23  ARG H CB  1 
ATOM   8239 C CG  . ARG I 4 23  ? -33.182 42.336  92.085  1.00 95.70  ? 23  ARG H CG  1 
ATOM   8240 C CD  . ARG I 4 23  ? -33.618 43.696  91.523  1.00 104.27 ? 23  ARG H CD  1 
ATOM   8241 N NE  . ARG I 4 23  ? -33.878 43.631  90.081  1.00 110.76 ? 23  ARG H NE  1 
ATOM   8242 C CZ  . ARG I 4 23  ? -34.082 44.691  89.298  1.00 114.51 ? 23  ARG H CZ  1 
ATOM   8243 N NH1 . ARG I 4 23  ? -34.062 45.916  89.809  1.00 114.44 ? 23  ARG H NH1 1 
ATOM   8244 N NH2 . ARG I 4 23  ? -34.295 44.526  87.996  1.00 112.44 ? 23  ARG H NH2 1 
ATOM   8245 N N   . ILE I 4 24  ? -30.844 39.866  92.275  1.00 63.96  ? 24  ILE H N   1 
ATOM   8246 C CA  . ILE I 4 24  ? -29.737 39.503  91.402  1.00 56.67  ? 24  ILE H CA  1 
ATOM   8247 C C   . ILE I 4 24  ? -30.230 39.116  90.008  1.00 55.43  ? 24  ILE H C   1 
ATOM   8248 O O   . ILE I 4 24  ? -30.927 38.119  89.841  1.00 57.21  ? 24  ILE H O   1 
ATOM   8249 C CB  . ILE I 4 24  ? -28.929 38.313  91.972  1.00 55.80  ? 24  ILE H CB  1 
ATOM   8250 C CG1 . ILE I 4 24  ? -28.184 38.737  93.238  1.00 53.05  ? 24  ILE H CG1 1 
ATOM   8251 C CG2 . ILE I 4 24  ? -27.946 37.801  90.928  1.00 52.59  ? 24  ILE H CG2 1 
ATOM   8252 C CD1 . ILE I 4 24  ? -27.288 37.649  93.810  1.00 53.05  ? 24  ILE H CD1 1 
ATOM   8253 N N   . ARG I 4 25  ? -29.877 39.908  89.006  1.00 53.31  ? 25  ARG H N   1 
ATOM   8254 C CA  . ARG I 4 25  ? -30.280 39.592  87.646  1.00 52.85  ? 25  ARG H CA  1 
ATOM   8255 C C   . ARG I 4 25  ? -29.029 39.174  86.892  1.00 54.08  ? 25  ARG H C   1 
ATOM   8256 O O   . ARG I 4 25  ? -28.024 39.886  86.881  1.00 55.92  ? 25  ARG H O   1 
ATOM   8257 C CB  . ARG I 4 25  ? -30.928 40.799  86.980  1.00 52.32  ? 25  ARG H CB  1 
ATOM   8258 C CG  . ARG I 4 25  ? -31.484 40.493  85.610  1.00 59.62  ? 25  ARG H CG  1 
ATOM   8259 C CD  . ARG I 4 25  ? -32.304 41.659  85.103  1.00 72.51  ? 25  ARG H CD  1 
ATOM   8260 N NE  . ARG I 4 25  ? -32.793 41.429  83.750  1.00 73.61  ? 25  ARG H NE  1 
ATOM   8261 C CZ  . ARG I 4 25  ? -33.538 42.296  83.077  1.00 76.44  ? 25  ARG H CZ  1 
ATOM   8262 N NH1 . ARG I 4 25  ? -33.878 43.451  83.637  1.00 76.45  ? 25  ARG H NH1 1 
ATOM   8263 N NH2 . ARG I 4 25  ? -33.940 42.007  81.846  1.00 75.63  ? 25  ARG H NH2 1 
ATOM   8264 N N   . TYR I 4 26  ? -29.095 38.014  86.260  1.00 47.39  ? 26  TYR H N   1 
ATOM   8265 C CA  . TYR I 4 26  ? -27.949 37.487  85.551  1.00 47.64  ? 26  TYR H CA  1 
ATOM   8266 C C   . TYR I 4 26  ? -28.190 37.431  84.054  1.00 44.85  ? 26  TYR H C   1 
ATOM   8267 O O   . TYR I 4 26  ? -29.087 36.738  83.593  1.00 53.96  ? 26  TYR H O   1 
ATOM   8268 C CB  . TYR I 4 26  ? -27.634 36.098  86.117  1.00 48.15  ? 26  TYR H CB  1 
ATOM   8269 C CG  . TYR I 4 26  ? -26.524 35.356  85.425  1.00 45.75  ? 26  TYR H CG  1 
ATOM   8270 C CD1 . TYR I 4 26  ? -25.278 35.946  85.224  1.00 41.69  ? 26  TYR H CD1 1 
ATOM   8271 C CD2 . TYR I 4 26  ? -26.712 34.048  84.997  1.00 44.85  ? 26  TYR H CD2 1 
ATOM   8272 C CE1 . TYR I 4 26  ? -24.251 35.250  84.615  1.00 43.79  ? 26  TYR H CE1 1 
ATOM   8273 C CE2 . TYR I 4 26  ? -25.692 33.340  84.388  1.00 51.39  ? 26  TYR H CE2 1 
ATOM   8274 C CZ  . TYR I 4 26  ? -24.462 33.942  84.199  1.00 50.23  ? 26  TYR H CZ  1 
ATOM   8275 O OH  . TYR I 4 26  ? -23.445 33.226  83.604  1.00 51.89  ? 26  TYR H OH  1 
ATOM   8276 N N   . VAL I 4 27  ? -27.390 38.167  83.292  1.00 40.48  ? 27  VAL H N   1 
ATOM   8277 C CA  . VAL I 4 27  ? -27.558 38.178  81.847  1.00 44.99  ? 27  VAL H CA  1 
ATOM   8278 C C   . VAL I 4 27  ? -26.300 37.719  81.119  1.00 49.65  ? 27  VAL H C   1 
ATOM   8279 O O   . VAL I 4 27  ? -25.176 38.054  81.497  1.00 53.21  ? 27  VAL H O   1 
ATOM   8280 C CB  . VAL I 4 27  ? -27.952 39.579  81.332  1.00 42.61  ? 27  VAL H CB  1 
ATOM   8281 C CG1 . VAL I 4 27  ? -28.134 39.538  79.827  1.00 44.22  ? 27  VAL H CG1 1 
ATOM   8282 C CG2 . VAL I 4 27  ? -29.237 40.044  82.009  1.00 41.26  ? 27  VAL H CG2 1 
ATOM   8283 N N   . THR I 4 28  ? -26.513 36.939  80.071  1.00 45.77  ? 28  THR H N   1 
ATOM   8284 C CA  . THR I 4 28  ? -25.441 36.399  79.259  1.00 52.57  ? 28  THR H CA  1 
ATOM   8285 C C   . THR I 4 28  ? -25.722 36.820  77.813  1.00 52.89  ? 28  THR H C   1 
ATOM   8286 O O   . THR I 4 28  ? -26.775 36.500  77.269  1.00 56.16  ? 28  THR H O   1 
ATOM   8287 C CB  . THR I 4 28  ? -25.421 34.861  79.402  1.00 56.90  ? 28  THR H CB  1 
ATOM   8288 O OG1 . THR I 4 28  ? -24.468 34.480  80.403  1.00 59.79  ? 28  THR H OG1 1 
ATOM   8289 C CG2 . THR I 4 28  ? -25.096 34.208  78.103  1.00 53.45  ? 28  THR H CG2 1 
ATOM   8290 N N   . ARG I 4 29  ? -24.790 37.539  77.196  1.00 48.86  ? 29  ARG H N   1 
ATOM   8291 C CA  . ARG I 4 29  ? -24.987 38.018  75.830  1.00 47.05  ? 29  ARG H CA  1 
ATOM   8292 C C   . ARG I 4 29  ? -24.014 37.427  74.825  1.00 48.99  ? 29  ARG H C   1 
ATOM   8293 O O   . ARG I 4 29  ? -22.801 37.467  75.024  1.00 47.85  ? 29  ARG H O   1 
ATOM   8294 C CB  . ARG I 4 29  ? -24.859 39.546  75.781  1.00 50.73  ? 29  ARG H CB  1 
ATOM   8295 C CG  . ARG I 4 29  ? -25.792 40.309  76.727  1.00 58.30  ? 29  ARG H CG  1 
ATOM   8296 C CD  . ARG I 4 29  ? -25.501 41.810  76.676  1.00 63.40  ? 29  ARG H CD  1 
ATOM   8297 N NE  . ARG I 4 29  ? -26.241 42.578  77.676  1.00 59.16  ? 29  ARG H NE  1 
ATOM   8298 C CZ  . ARG I 4 29  ? -27.532 42.872  77.592  1.00 60.01  ? 29  ARG H CZ  1 
ATOM   8299 N NH1 . ARG I 4 29  ? -28.243 42.466  76.547  1.00 59.72  ? 29  ARG H NH1 1 
ATOM   8300 N NH2 . ARG I 4 29  ? -28.114 43.570  78.557  1.00 62.31  ? 29  ARG H NH2 1 
ATOM   8301 N N   . TYR I 4 30  ? -24.553 36.883  73.738  1.00 51.31  ? 30  TYR H N   1 
ATOM   8302 C CA  . TYR I 4 30  ? -23.728 36.310  72.681  1.00 48.87  ? 30  TYR H CA  1 
ATOM   8303 C C   . TYR I 4 30  ? -23.771 37.283  71.511  1.00 53.68  ? 30  TYR H C   1 
ATOM   8304 O O   . TYR I 4 30  ? -24.827 37.516  70.926  1.00 62.95  ? 30  TYR H O   1 
ATOM   8305 C CB  . TYR I 4 30  ? -24.250 34.924  72.278  1.00 44.12  ? 30  TYR H CB  1 
ATOM   8306 C CG  . TYR I 4 30  ? -24.006 33.868  73.342  1.00 43.04  ? 30  TYR H CG  1 
ATOM   8307 C CD1 . TYR I 4 30  ? -24.622 33.955  74.592  1.00 42.05  ? 30  TYR H CD1 1 
ATOM   8308 C CD2 . TYR I 4 30  ? -23.108 32.816  73.128  1.00 44.21  ? 30  TYR H CD2 1 
ATOM   8309 C CE1 . TYR I 4 30  ? -24.350 33.032  75.598  1.00 33.96  ? 30  TYR H CE1 1 
ATOM   8310 C CE2 . TYR I 4 30  ? -22.828 31.884  74.142  1.00 35.28  ? 30  TYR H CE2 1 
ATOM   8311 C CZ  . TYR I 4 30  ? -23.459 32.008  75.376  1.00 41.44  ? 30  TYR H CZ  1 
ATOM   8312 O OH  . TYR I 4 30  ? -23.197 31.127  76.403  1.00 41.89  ? 30  TYR H OH  1 
ATOM   8313 N N   . ILE I 4 31  ? -22.618 37.868  71.199  1.00 51.29  ? 31  ILE H N   1 
ATOM   8314 C CA  . ILE I 4 31  ? -22.493 38.850  70.127  1.00 51.61  ? 31  ILE H CA  1 
ATOM   8315 C C   . ILE I 4 31  ? -21.673 38.286  68.968  1.00 52.55  ? 31  ILE H C   1 
ATOM   8316 O O   . ILE I 4 31  ? -20.679 37.595  69.203  1.00 50.43  ? 31  ILE H O   1 
ATOM   8317 C CB  . ILE I 4 31  ? -21.783 40.144  70.644  1.00 51.35  ? 31  ILE H CB  1 
ATOM   8318 C CG1 . ILE I 4 31  ? -22.690 40.900  71.615  1.00 50.58  ? 31  ILE H CG1 1 
ATOM   8319 C CG2 . ILE I 4 31  ? -21.401 41.055  69.475  1.00 52.07  ? 31  ILE H CG2 1 
ATOM   8320 C CD1 . ILE I 4 31  ? -22.794 40.274  72.979  1.00 58.61  ? 31  ILE H CD1 1 
ATOM   8321 N N   . TYR I 4 32  ? -22.081 38.571  67.727  1.00 49.60  ? 32  TYR H N   1 
ATOM   8322 C CA  . TYR I 4 32  ? -21.320 38.088  66.581  1.00 56.69  ? 32  TYR H CA  1 
ATOM   8323 C C   . TYR I 4 32  ? -20.242 39.100  66.266  1.00 58.54  ? 32  TYR H C   1 
ATOM   8324 O O   . TYR I 4 32  ? -19.098 38.906  66.656  1.00 68.01  ? 32  TYR H O   1 
ATOM   8325 C CB  . TYR I 4 32  ? -22.176 37.859  65.333  1.00 55.32  ? 32  TYR H CB  1 
ATOM   8326 C CG  . TYR I 4 32  ? -21.311 37.552  64.122  1.00 52.50  ? 32  TYR H CG  1 
ATOM   8327 C CD1 . TYR I 4 32  ? -20.222 36.683  64.223  1.00 46.27  ? 32  TYR H CD1 1 
ATOM   8328 C CD2 . TYR I 4 32  ? -21.541 38.173  62.894  1.00 52.99  ? 32  TYR H CD2 1 
ATOM   8329 C CE1 . TYR I 4 32  ? -19.380 36.446  63.138  1.00 48.75  ? 32  TYR H CE1 1 
ATOM   8330 C CE2 . TYR I 4 32  ? -20.709 37.945  61.802  1.00 45.39  ? 32  TYR H CE2 1 
ATOM   8331 C CZ  . TYR I 4 32  ? -19.629 37.083  61.929  1.00 54.09  ? 32  TYR H CZ  1 
ATOM   8332 O OH  . TYR I 4 32  ? -18.792 36.872  60.851  1.00 55.18  ? 32  TYR H OH  1 
ATOM   8333 N N   . ASN I 4 33  ? -20.573 40.168  65.553  1.00 53.12  ? 33  ASN H N   1 
ATOM   8334 C CA  . ASN I 4 33  ? -19.548 41.173  65.283  1.00 58.52  ? 33  ASN H CA  1 
ATOM   8335 C C   . ASN I 4 33  ? -19.803 42.332  66.219  1.00 60.81  ? 33  ASN H C   1 
ATOM   8336 O O   . ASN I 4 33  ? -19.022 42.613  67.127  1.00 62.03  ? 33  ASN H O   1 
ATOM   8337 C CB  . ASN I 4 33  ? -19.606 41.676  63.843  1.00 59.15  ? 33  ASN H CB  1 
ATOM   8338 C CG  . ASN I 4 33  ? -18.689 40.908  62.926  1.00 60.56  ? 33  ASN H CG  1 
ATOM   8339 O OD1 . ASN I 4 33  ? -17.563 40.574  63.295  1.00 52.75  ? 33  ASN H OD1 1 
ATOM   8340 N ND2 . ASN I 4 33  ? -19.156 40.636  61.714  1.00 60.53  ? 33  ASN H ND2 1 
ATOM   8341 N N   . ARG I 4 34  ? -20.927 42.990  65.983  1.00 58.74  ? 34  ARG H N   1 
ATOM   8342 C CA  . ARG I 4 34  ? -21.353 44.132  66.764  1.00 55.37  ? 34  ARG H CA  1 
ATOM   8343 C C   . ARG I 4 34  ? -22.808 43.827  67.073  1.00 52.90  ? 34  ARG H C   1 
ATOM   8344 O O   . ARG I 4 34  ? -23.525 44.649  67.636  1.00 51.46  ? 34  ARG H O   1 
ATOM   8345 C CB  . ARG I 4 34  ? -21.252 45.391  65.901  1.00 59.98  ? 34  ARG H CB  1 
ATOM   8346 C CG  . ARG I 4 34  ? -21.696 46.662  66.567  1.00 54.80  ? 34  ARG H CG  1 
ATOM   8347 C CD  . ARG I 4 34  ? -20.512 47.360  67.155  1.00 56.08  ? 34  ARG H CD  1 
ATOM   8348 N NE  . ARG I 4 34  ? -20.286 48.656  66.526  1.00 55.11  ? 34  ARG H NE  1 
ATOM   8349 C CZ  . ARG I 4 34  ? -20.852 49.791  66.919  1.00 57.26  ? 34  ARG H CZ  1 
ATOM   8350 N NH1 . ARG I 4 34  ? -21.692 49.812  67.952  1.00 55.49  ? 34  ARG H NH1 1 
ATOM   8351 N NH2 . ARG I 4 34  ? -20.568 50.914  66.278  1.00 65.37  ? 34  ARG H NH2 1 
ATOM   8352 N N   . GLU I 4 35  ? -23.224 42.619  66.706  1.00 54.63  ? 35  GLU H N   1 
ATOM   8353 C CA  . GLU I 4 35  ? -24.606 42.189  66.883  1.00 56.32  ? 35  GLU H CA  1 
ATOM   8354 C C   . GLU I 4 35  ? -24.837 41.119  67.948  1.00 55.13  ? 35  GLU H C   1 
ATOM   8355 O O   . GLU I 4 35  ? -24.206 40.059  67.926  1.00 50.96  ? 35  GLU H O   1 
ATOM   8356 C CB  . GLU I 4 35  ? -25.139 41.669  65.545  1.00 57.24  ? 35  GLU H CB  1 
ATOM   8357 C CG  . GLU I 4 35  ? -26.645 41.406  65.496  1.00 63.75  ? 35  GLU H CG  1 
ATOM   8358 C CD  . GLU I 4 35  ? -27.035 40.451  64.367  1.00 68.14  ? 35  GLU H CD  1 
ATOM   8359 O OE1 . GLU I 4 35  ? -26.493 40.577  63.244  1.00 63.29  ? 35  GLU H OE1 1 
ATOM   8360 O OE2 . GLU I 4 35  ? -27.892 39.575  64.606  1.00 69.34  ? 35  GLU H OE2 1 
ATOM   8361 N N   . GLU I 4 36  ? -25.748 41.402  68.875  1.00 44.85  ? 36  GLU H N   1 
ATOM   8362 C CA  . GLU I 4 36  ? -26.102 40.441  69.909  1.00 50.72  ? 36  GLU H CA  1 
ATOM   8363 C C   . GLU I 4 36  ? -27.105 39.501  69.234  1.00 55.29  ? 36  GLU H C   1 
ATOM   8364 O O   . GLU I 4 36  ? -28.187 39.931  68.838  1.00 59.41  ? 36  GLU H O   1 
ATOM   8365 C CB  . GLU I 4 36  ? -26.758 41.154  71.103  1.00 45.72  ? 36  GLU H CB  1 
ATOM   8366 C CG  . GLU I 4 36  ? -27.426 40.219  72.099  1.00 49.38  ? 36  GLU H CG  1 
ATOM   8367 C CD  . GLU I 4 36  ? -28.120 40.958  73.231  1.00 57.93  ? 36  GLU H CD  1 
ATOM   8368 O OE1 . GLU I 4 36  ? -28.781 41.982  72.956  1.00 57.99  ? 36  GLU H OE1 1 
ATOM   8369 O OE2 . GLU I 4 36  ? -28.018 40.508  74.393  1.00 57.07  ? 36  GLU H OE2 1 
ATOM   8370 N N   . TYR I 4 37  ? -26.750 38.226  69.094  1.00 59.05  ? 37  TYR H N   1 
ATOM   8371 C CA  . TYR I 4 37  ? -27.637 37.274  68.430  1.00 57.62  ? 37  TYR H CA  1 
ATOM   8372 C C   . TYR I 4 37  ? -28.341 36.286  69.351  1.00 55.40  ? 37  TYR H C   1 
ATOM   8373 O O   . TYR I 4 37  ? -29.422 35.801  69.029  1.00 59.79  ? 37  TYR H O   1 
ATOM   8374 C CB  . TYR I 4 37  ? -26.864 36.514  67.353  1.00 61.47  ? 37  TYR H CB  1 
ATOM   8375 C CG  . TYR I 4 37  ? -25.751 35.647  67.889  1.00 72.14  ? 37  TYR H CG  1 
ATOM   8376 C CD1 . TYR I 4 37  ? -26.031 34.446  68.541  1.00 74.69  ? 37  TYR H CD1 1 
ATOM   8377 C CD2 . TYR I 4 37  ? -24.414 36.025  67.747  1.00 68.78  ? 37  TYR H CD2 1 
ATOM   8378 C CE1 . TYR I 4 37  ? -25.011 33.641  69.040  1.00 77.52  ? 37  TYR H CE1 1 
ATOM   8379 C CE2 . TYR I 4 37  ? -23.383 35.223  68.244  1.00 71.16  ? 37  TYR H CE2 1 
ATOM   8380 C CZ  . TYR I 4 37  ? -23.691 34.032  68.889  1.00 72.42  ? 37  TYR H CZ  1 
ATOM   8381 O OH  . TYR I 4 37  ? -22.691 33.226  69.384  1.00 75.19  ? 37  TYR H OH  1 
ATOM   8382 N N   . LEU I 4 38  ? -27.735 35.981  70.490  1.00 54.29  ? 38  LEU H N   1 
ATOM   8383 C CA  . LEU I 4 38  ? -28.334 35.047  71.441  1.00 54.29  ? 38  LEU H CA  1 
ATOM   8384 C C   . LEU I 4 38  ? -28.262 35.669  72.827  1.00 51.80  ? 38  LEU H C   1 
ATOM   8385 O O   . LEU I 4 38  ? -27.463 36.578  73.052  1.00 60.21  ? 38  LEU H O   1 
ATOM   8386 C CB  . LEU I 4 38  ? -27.581 33.710  71.420  1.00 49.20  ? 38  LEU H CB  1 
ATOM   8387 C CG  . LEU I 4 38  ? -28.172 32.558  72.237  1.00 49.93  ? 38  LEU H CG  1 
ATOM   8388 C CD1 . LEU I 4 38  ? -29.519 32.170  71.663  1.00 57.34  ? 38  LEU H CD1 1 
ATOM   8389 C CD2 . LEU I 4 38  ? -27.234 31.375  72.212  1.00 48.80  ? 38  LEU H CD2 1 
ATOM   8390 N N   . ARG I 4 39  ? -29.083 35.192  73.759  1.00 49.34  ? 39  ARG H N   1 
ATOM   8391 C CA  . ARG I 4 39  ? -29.067 35.759  75.106  1.00 48.00  ? 39  ARG H CA  1 
ATOM   8392 C C   . ARG I 4 39  ? -29.837 35.027  76.196  1.00 52.52  ? 39  ARG H C   1 
ATOM   8393 O O   . ARG I 4 39  ? -30.974 34.593  75.997  1.00 56.87  ? 39  ARG H O   1 
ATOM   8394 C CB  . ARG I 4 39  ? -29.593 37.189  75.080  1.00 40.60  ? 39  ARG H CB  1 
ATOM   8395 C CG  . ARG I 4 39  ? -29.614 37.836  76.446  1.00 49.98  ? 39  ARG H CG  1 
ATOM   8396 C CD  . ARG I 4 39  ? -30.597 38.978  76.496  1.00 57.03  ? 39  ARG H CD  1 
ATOM   8397 N NE  . ARG I 4 39  ? -30.402 39.917  75.397  1.00 59.08  ? 39  ARG H NE  1 
ATOM   8398 C CZ  . ARG I 4 39  ? -31.251 40.893  75.104  1.00 56.12  ? 39  ARG H CZ  1 
ATOM   8399 N NH1 . ARG I 4 39  ? -32.350 41.046  75.832  1.00 51.63  ? 39  ARG H NH1 1 
ATOM   8400 N NH2 . ARG I 4 39  ? -31.001 41.714  74.093  1.00 51.99  ? 39  ARG H NH2 1 
ATOM   8401 N N   . PHE I 4 40  ? -29.212 34.906  77.363  1.00 53.47  ? 40  PHE H N   1 
ATOM   8402 C CA  . PHE I 4 40  ? -29.879 34.297  78.501  1.00 51.88  ? 40  PHE H CA  1 
ATOM   8403 C C   . PHE I 4 40  ? -30.155 35.419  79.495  1.00 49.58  ? 40  PHE H C   1 
ATOM   8404 O O   . PHE I 4 40  ? -29.299 36.273  79.724  1.00 59.53  ? 40  PHE H O   1 
ATOM   8405 C CB  . PHE I 4 40  ? -29.018 33.244  79.188  1.00 45.34  ? 40  PHE H CB  1 
ATOM   8406 C CG  . PHE I 4 40  ? -29.609 32.766  80.476  1.00 48.45  ? 40  PHE H CG  1 
ATOM   8407 C CD1 . PHE I 4 40  ? -30.587 31.776  80.479  1.00 49.44  ? 40  PHE H CD1 1 
ATOM   8408 C CD2 . PHE I 4 40  ? -29.292 33.400  81.677  1.00 41.88  ? 40  PHE H CD2 1 
ATOM   8409 C CE1 . PHE I 4 40  ? -31.249 31.425  81.662  1.00 50.19  ? 40  PHE H CE1 1 
ATOM   8410 C CE2 . PHE I 4 40  ? -29.945 33.059  82.857  1.00 52.68  ? 40  PHE H CE2 1 
ATOM   8411 C CZ  . PHE I 4 40  ? -30.930 32.068  82.848  1.00 45.11  ? 40  PHE H CZ  1 
ATOM   8412 N N   . ASP I 4 41  ? -31.338 35.415  80.095  1.00 51.55  ? 41  ASP H N   1 
ATOM   8413 C CA  . ASP I 4 41  ? -31.710 36.446  81.060  1.00 50.04  ? 41  ASP H CA  1 
ATOM   8414 C C   . ASP I 4 41  ? -32.421 35.774  82.223  1.00 51.20  ? 41  ASP H C   1 
ATOM   8415 O O   . ASP I 4 41  ? -33.487 35.192  82.046  1.00 50.16  ? 41  ASP H O   1 
ATOM   8416 C CB  . ASP I 4 41  ? -32.648 37.467  80.396  1.00 54.16  ? 41  ASP H CB  1 
ATOM   8417 C CG  . ASP I 4 41  ? -32.925 38.686  81.274  1.00 56.91  ? 41  ASP H CG  1 
ATOM   8418 O OD1 . ASP I 4 41  ? -33.189 38.521  82.485  1.00 59.31  ? 41  ASP H OD1 1 
ATOM   8419 O OD2 . ASP I 4 41  ? -32.897 39.818  80.743  1.00 59.29  ? 41  ASP H OD2 1 
ATOM   8420 N N   . SER I 4 42  ? -31.837 35.847  83.414  1.00 57.66  ? 42  SER H N   1 
ATOM   8421 C CA  . SER I 4 42  ? -32.457 35.229  84.579  1.00 58.14  ? 42  SER H CA  1 
ATOM   8422 C C   . SER I 4 42  ? -33.908 35.683  84.725  1.00 62.99  ? 42  SER H C   1 
ATOM   8423 O O   . SER I 4 42  ? -34.763 34.907  85.142  1.00 70.54  ? 42  SER H O   1 
ATOM   8424 C CB  . SER I 4 42  ? -31.677 35.564  85.853  1.00 51.05  ? 42  SER H CB  1 
ATOM   8425 O OG  . SER I 4 42  ? -31.766 36.938  86.176  1.00 58.99  ? 42  SER H OG  1 
ATOM   8426 N N   . ASP I 4 43  ? -34.188 36.935  84.370  1.00 67.37  ? 43  ASP H N   1 
ATOM   8427 C CA  . ASP I 4 43  ? -35.544 37.468  84.472  1.00 66.63  ? 43  ASP H CA  1 
ATOM   8428 C C   . ASP I 4 43  ? -36.518 36.774  83.527  1.00 66.56  ? 43  ASP H C   1 
ATOM   8429 O O   . ASP I 4 43  ? -37.703 36.644  83.830  1.00 70.19  ? 43  ASP H O   1 
ATOM   8430 C CB  . ASP I 4 43  ? -35.537 38.976  84.224  1.00 68.77  ? 43  ASP H CB  1 
ATOM   8431 C CG  . ASP I 4 43  ? -35.449 39.767  85.513  1.00 76.64  ? 43  ASP H CG  1 
ATOM   8432 O OD1 . ASP I 4 43  ? -34.866 39.236  86.486  1.00 77.50  ? 43  ASP H OD1 1 
ATOM   8433 O OD2 . ASP I 4 43  ? -35.953 40.912  85.555  1.00 77.04  ? 43  ASP H OD2 1 
ATOM   8434 N N   . VAL I 4 44  ? -36.019 36.333  82.382  1.00 62.24  ? 44  VAL H N   1 
ATOM   8435 C CA  . VAL I 4 44  ? -36.854 35.624  81.427  1.00 58.39  ? 44  VAL H CA  1 
ATOM   8436 C C   . VAL I 4 44  ? -36.798 34.155  81.822  1.00 64.68  ? 44  VAL H C   1 
ATOM   8437 O O   . VAL I 4 44  ? -37.815 33.464  81.820  1.00 66.57  ? 44  VAL H O   1 
ATOM   8438 C CB  . VAL I 4 44  ? -36.329 35.807  79.991  1.00 60.09  ? 44  VAL H CB  1 
ATOM   8439 C CG1 . VAL I 4 44  ? -36.945 34.754  79.058  1.00 46.48  ? 44  VAL H CG1 1 
ATOM   8440 C CG2 . VAL I 4 44  ? -36.659 37.219  79.508  1.00 51.25  ? 44  VAL H CG2 1 
ATOM   8441 N N   . GLY I 4 45  ? -35.600 33.693  82.171  1.00 66.06  ? 45  GLY H N   1 
ATOM   8442 C CA  . GLY I 4 45  ? -35.418 32.316  82.591  1.00 63.03  ? 45  GLY H CA  1 
ATOM   8443 C C   . GLY I 4 45  ? -34.997 31.350  81.501  1.00 64.70  ? 45  GLY H C   1 
ATOM   8444 O O   . GLY I 4 45  ? -35.104 30.138  81.678  1.00 62.78  ? 45  GLY H O   1 
ATOM   8445 N N   . GLU I 4 46  ? -34.504 31.860  80.378  1.00 66.31  ? 46  GLU H N   1 
ATOM   8446 C CA  . GLU I 4 46  ? -34.094 30.969  79.301  1.00 65.96  ? 46  GLU H CA  1 
ATOM   8447 C C   . GLU I 4 46  ? -33.412 31.678  78.134  1.00 62.83  ? 46  GLU H C   1 
ATOM   8448 O O   . GLU I 4 46  ? -33.565 32.887  77.942  1.00 65.17  ? 46  GLU H O   1 
ATOM   8449 C CB  . GLU I 4 46  ? -35.323 30.196  78.808  1.00 68.57  ? 46  GLU H CB  1 
ATOM   8450 C CG  . GLU I 4 46  ? -35.597 30.289  77.316  1.00 79.95  ? 46  GLU H CG  1 
ATOM   8451 C CD  . GLU I 4 46  ? -37.009 29.853  76.952  1.00 83.34  ? 46  GLU H CD  1 
ATOM   8452 O OE1 . GLU I 4 46  ? -37.357 29.908  75.749  1.00 84.54  ? 46  GLU H OE1 1 
ATOM   8453 O OE2 . GLU I 4 46  ? -37.770 29.460  77.867  1.00 78.39  ? 46  GLU H OE2 1 
ATOM   8454 N N   . TYR I 4 47  ? -32.652 30.909  77.363  1.00 61.08  ? 47  TYR H N   1 
ATOM   8455 C CA  . TYR I 4 47  ? -31.960 31.429  76.189  1.00 63.66  ? 47  TYR H CA  1 
ATOM   8456 C C   . TYR I 4 47  ? -32.960 31.759  75.086  1.00 65.56  ? 47  TYR H C   1 
ATOM   8457 O O   . TYR I 4 47  ? -33.712 30.895  74.637  1.00 69.58  ? 47  TYR H O   1 
ATOM   8458 C CB  . TYR I 4 47  ? -30.977 30.398  75.640  1.00 63.49  ? 47  TYR H CB  1 
ATOM   8459 C CG  . TYR I 4 47  ? -29.705 30.244  76.423  1.00 64.23  ? 47  TYR H CG  1 
ATOM   8460 C CD1 . TYR I 4 47  ? -28.735 31.239  76.406  1.00 72.70  ? 47  TYR H CD1 1 
ATOM   8461 C CD2 . TYR I 4 47  ? -29.445 29.083  77.146  1.00 67.17  ? 47  TYR H CD2 1 
ATOM   8462 C CE1 . TYR I 4 47  ? -27.531 31.082  77.085  1.00 76.88  ? 47  TYR H CE1 1 
ATOM   8463 C CE2 . TYR I 4 47  ? -28.244 28.914  77.829  1.00 71.79  ? 47  TYR H CE2 1 
ATOM   8464 C CZ  . TYR I 4 47  ? -27.290 29.919  77.792  1.00 71.87  ? 47  TYR H CZ  1 
ATOM   8465 O OH  . TYR I 4 47  ? -26.091 29.763  78.442  1.00 70.97  ? 47  TYR H OH  1 
ATOM   8466 N N   . ARG I 4 48  ? -32.958 33.010  74.648  1.00 66.75  ? 48  ARG H N   1 
ATOM   8467 C CA  . ARG I 4 48  ? -33.852 33.455  73.590  1.00 64.08  ? 48  ARG H CA  1 
ATOM   8468 C C   . ARG I 4 48  ? -32.994 33.964  72.444  1.00 68.03  ? 48  ARG H C   1 
ATOM   8469 O O   . ARG I 4 48  ? -31.910 34.502  72.666  1.00 72.85  ? 48  ARG H O   1 
ATOM   8470 C CB  . ARG I 4 48  ? -34.742 34.593  74.090  1.00 60.73  ? 48  ARG H CB  1 
ATOM   8471 C CG  . ARG I 4 48  ? -35.771 34.214  75.145  1.00 66.71  ? 48  ARG H CG  1 
ATOM   8472 C CD  . ARG I 4 48  ? -37.136 34.054  74.509  1.00 71.01  ? 48  ARG H CD  1 
ATOM   8473 N NE  . ARG I 4 48  ? -38.216 34.487  75.395  1.00 75.00  ? 48  ARG H NE  1 
ATOM   8474 C CZ  . ARG I 4 48  ? -38.801 33.711  76.302  1.00 75.38  ? 48  ARG H CZ  1 
ATOM   8475 N NH1 . ARG I 4 48  ? -38.410 32.452  76.445  1.00 77.44  ? 48  ARG H NH1 1 
ATOM   8476 N NH2 . ARG I 4 48  ? -39.777 34.193  77.063  1.00 65.63  ? 48  ARG H NH2 1 
ATOM   8477 N N   . ALA I 4 49  ? -33.462 33.783  71.217  1.00 67.93  ? 49  ALA H N   1 
ATOM   8478 C CA  . ALA I 4 49  ? -32.709 34.274  70.075  1.00 67.86  ? 49  ALA H CA  1 
ATOM   8479 C C   . ALA I 4 49  ? -33.061 35.749  69.961  1.00 68.52  ? 49  ALA H C   1 
ATOM   8480 O O   . ALA I 4 49  ? -34.236 36.116  69.879  1.00 68.03  ? 49  ALA H O   1 
ATOM   8481 C CB  . ALA I 4 49  ? -33.102 33.526  68.803  1.00 64.03  ? 49  ALA H CB  1 
ATOM   8482 N N   . VAL I 4 50  ? -32.038 36.593  69.988  1.00 67.25  ? 50  VAL H N   1 
ATOM   8483 C CA  . VAL I 4 50  ? -32.235 38.028  69.899  1.00 63.73  ? 50  VAL H CA  1 
ATOM   8484 C C   . VAL I 4 50  ? -32.512 38.428  68.453  1.00 67.02  ? 50  VAL H C   1 
ATOM   8485 O O   . VAL I 4 50  ? -33.329 39.308  68.193  1.00 66.90  ? 50  VAL H O   1 
ATOM   8486 C CB  . VAL I 4 50  ? -30.993 38.777  70.435  1.00 63.64  ? 50  VAL H CB  1 
ATOM   8487 C CG1 . VAL I 4 50  ? -31.154 40.275  70.251  1.00 61.01  ? 50  VAL H CG1 1 
ATOM   8488 C CG2 . VAL I 4 50  ? -30.792 38.447  71.902  1.00 59.99  ? 50  VAL H CG2 1 
ATOM   8489 N N   . THR I 4 51  ? -31.826 37.781  67.516  1.00 66.77  ? 51  THR H N   1 
ATOM   8490 C CA  . THR I 4 51  ? -32.018 38.064  66.096  1.00 72.16  ? 51  THR H CA  1 
ATOM   8491 C C   . THR I 4 51  ? -32.011 36.766  65.302  1.00 74.65  ? 51  THR H C   1 
ATOM   8492 O O   . THR I 4 51  ? -31.535 35.738  65.778  1.00 74.21  ? 51  THR H O   1 
ATOM   8493 C CB  . THR I 4 51  ? -30.906 38.962  65.520  1.00 69.86  ? 51  THR H CB  1 
ATOM   8494 O OG1 . THR I 4 51  ? -29.682 38.223  65.454  1.00 72.57  ? 51  THR H OG1 1 
ATOM   8495 C CG2 . THR I 4 51  ? -30.711 40.188  66.384  1.00 62.51  ? 51  THR H CG2 1 
ATOM   8496 N N   . GLU I 4 52  ? -32.536 36.827  64.085  1.00 77.97  ? 52  GLU H N   1 
ATOM   8497 C CA  . GLU I 4 52  ? -32.599 35.664  63.209  1.00 82.55  ? 52  GLU H CA  1 
ATOM   8498 C C   . GLU I 4 52  ? -31.311 34.841  63.255  1.00 79.05  ? 52  GLU H C   1 
ATOM   8499 O O   . GLU I 4 52  ? -31.345 33.612  63.160  1.00 79.10  ? 52  GLU H O   1 
ATOM   8500 C CB  . GLU I 4 52  ? -32.891 36.127  61.772  1.00 90.65  ? 52  GLU H CB  1 
ATOM   8501 C CG  . GLU I 4 52  ? -32.879 35.036  60.701  1.00 101.58 ? 52  GLU H CG  1 
ATOM   8502 C CD  . GLU I 4 52  ? -31.472 34.617  60.299  1.00 107.83 ? 52  GLU H CD  1 
ATOM   8503 O OE1 . GLU I 4 52  ? -30.673 35.499  59.912  1.00 107.98 ? 52  GLU H OE1 1 
ATOM   8504 O OE2 . GLU I 4 52  ? -31.167 33.406  60.367  1.00 112.51 ? 52  GLU H OE2 1 
ATOM   8505 N N   . LEU I 4 53  ? -30.183 35.524  63.422  1.00 78.18  ? 53  LEU H N   1 
ATOM   8506 C CA  . LEU I 4 53  ? -28.879 34.865  63.461  1.00 76.88  ? 53  LEU H CA  1 
ATOM   8507 C C   . LEU I 4 53  ? -28.724 33.922  64.650  1.00 75.07  ? 53  LEU H C   1 
ATOM   8508 O O   . LEU I 4 53  ? -27.886 33.023  64.632  1.00 76.36  ? 53  LEU H O   1 
ATOM   8509 C CB  . LEU I 4 53  ? -27.765 35.917  63.489  1.00 77.88  ? 53  LEU H CB  1 
ATOM   8510 C CG  . LEU I 4 53  ? -26.455 35.600  62.762  1.00 74.03  ? 53  LEU H CG  1 
ATOM   8511 C CD1 . LEU I 4 53  ? -25.536 36.803  62.852  1.00 78.03  ? 53  LEU H CD1 1 
ATOM   8512 C CD2 . LEU I 4 53  ? -25.790 34.380  63.361  1.00 78.92  ? 53  LEU H CD2 1 
ATOM   8513 N N   . GLY I 4 54  ? -29.531 34.124  65.683  1.00 73.25  ? 54  GLY H N   1 
ATOM   8514 C CA  . GLY I 4 54  ? -29.440 33.268  66.850  1.00 77.47  ? 54  GLY H CA  1 
ATOM   8515 C C   . GLY I 4 54  ? -30.528 32.213  66.902  1.00 81.22  ? 54  GLY H C   1 
ATOM   8516 O O   . GLY I 4 54  ? -30.644 31.481  67.884  1.00 83.21  ? 54  GLY H O   1 
ATOM   8517 N N   . ARG I 4 55  ? -31.325 32.132  65.842  1.00 81.90  ? 55  ARG H N   1 
ATOM   8518 C CA  . ARG I 4 55  ? -32.417 31.169  65.768  1.00 79.85  ? 55  ARG H CA  1 
ATOM   8519 C C   . ARG I 4 55  ? -31.945 29.724  65.999  1.00 74.51  ? 55  ARG H C   1 
ATOM   8520 O O   . ARG I 4 55  ? -32.500 29.000  66.828  1.00 66.02  ? 55  ARG H O   1 
ATOM   8521 C CB  . ARG I 4 55  ? -33.109 31.278  64.401  1.00 89.26  ? 55  ARG H CB  1 
ATOM   8522 C CG  . ARG I 4 55  ? -34.631 31.282  64.466  1.00 99.44  ? 55  ARG H CG  1 
ATOM   8523 C CD  . ARG I 4 55  ? -35.198 32.694  64.630  1.00 104.36 ? 55  ARG H CD  1 
ATOM   8524 N NE  . ARG I 4 55  ? -35.364 33.374  63.344  1.00 108.54 ? 55  ARG H NE  1 
ATOM   8525 C CZ  . ARG I 4 55  ? -35.859 34.602  63.200  1.00 108.75 ? 55  ARG H CZ  1 
ATOM   8526 N NH1 . ARG I 4 55  ? -36.237 35.299  64.266  1.00 108.23 ? 55  ARG H NH1 1 
ATOM   8527 N NH2 . ARG I 4 55  ? -35.985 35.130  61.987  1.00 101.57 ? 55  ARG H NH2 1 
ATOM   8528 N N   . PRO I 4 56  ? -30.907 29.292  65.266  1.00 71.34  ? 56  PRO H N   1 
ATOM   8529 C CA  . PRO I 4 56  ? -30.332 27.941  65.354  1.00 71.57  ? 56  PRO H CA  1 
ATOM   8530 C C   . PRO I 4 56  ? -29.787 27.486  66.705  1.00 70.44  ? 56  PRO H C   1 
ATOM   8531 O O   . PRO I 4 56  ? -29.597 26.292  66.923  1.00 68.70  ? 56  PRO H O   1 
ATOM   8532 C CB  . PRO I 4 56  ? -29.227 27.966  64.298  1.00 73.71  ? 56  PRO H CB  1 
ATOM   8533 C CG  . PRO I 4 56  ? -29.743 28.950  63.288  1.00 76.49  ? 56  PRO H CG  1 
ATOM   8534 C CD  . PRO I 4 56  ? -30.280 30.050  64.168  1.00 69.06  ? 56  PRO H CD  1 
ATOM   8535 N N   . ASP I 4 57  ? -29.524 28.424  67.607  1.00 73.76  ? 57  ASP H N   1 
ATOM   8536 C CA  . ASP I 4 57  ? -28.965 28.072  68.912  1.00 70.19  ? 57  ASP H CA  1 
ATOM   8537 C C   . ASP I 4 57  ? -29.969 27.975  70.058  1.00 62.73  ? 57  ASP H C   1 
ATOM   8538 O O   . ASP I 4 57  ? -29.778 27.192  70.986  1.00 57.74  ? 57  ASP H O   1 
ATOM   8539 C CB  . ASP I 4 57  ? -27.863 29.073  69.302  1.00 76.86  ? 57  ASP H CB  1 
ATOM   8540 C CG  . ASP I 4 57  ? -26.625 28.969  68.418  1.00 80.18  ? 57  ASP H CG  1 
ATOM   8541 O OD1 . ASP I 4 57  ? -26.122 27.841  68.217  1.00 78.79  ? 57  ASP H OD1 1 
ATOM   8542 O OD2 . ASP I 4 57  ? -26.145 30.018  67.937  1.00 83.65  ? 57  ASP H OD2 1 
ATOM   8543 N N   . ALA I 4 58  ? -31.029 28.772  70.000  1.00 58.23  ? 58  ALA H N   1 
ATOM   8544 C CA  . ALA I 4 58  ? -32.033 28.785  71.055  1.00 61.24  ? 58  ALA H CA  1 
ATOM   8545 C C   . ALA I 4 58  ? -32.327 27.402  71.631  1.00 65.15  ? 58  ALA H C   1 
ATOM   8546 O O   . ALA I 4 58  ? -31.951 27.106  72.765  1.00 67.16  ? 58  ALA H O   1 
ATOM   8547 C CB  . ALA I 4 58  ? -33.307 29.424  70.541  1.00 65.76  ? 58  ALA H CB  1 
ATOM   8548 N N   . GLU I 4 59  ? -32.994 26.562  70.843  1.00 69.97  ? 59  GLU H N   1 
ATOM   8549 C CA  . GLU I 4 59  ? -33.353 25.201  71.252  1.00 70.14  ? 59  GLU H CA  1 
ATOM   8550 C C   . GLU I 4 59  ? -32.169 24.462  71.878  1.00 67.07  ? 59  GLU H C   1 
ATOM   8551 O O   . GLU I 4 59  ? -32.186 24.147  73.070  1.00 65.97  ? 59  GLU H O   1 
ATOM   8552 C CB  . GLU I 4 59  ? -33.872 24.421  70.032  1.00 81.70  ? 59  GLU H CB  1 
ATOM   8553 C CG  . GLU I 4 59  ? -34.448 23.023  70.320  1.00 92.86  ? 59  GLU H CG  1 
ATOM   8554 C CD  . GLU I 4 59  ? -34.790 22.243  69.039  1.00 97.57  ? 59  GLU H CD  1 
ATOM   8555 O OE1 . GLU I 4 59  ? -35.550 22.774  68.197  1.00 96.90  ? 59  GLU H OE1 1 
ATOM   8556 O OE2 . GLU I 4 59  ? -34.302 21.100  68.874  1.00 93.75  ? 59  GLU H OE2 1 
ATOM   8557 N N   . TYR I 4 60  ? -31.142 24.200  71.071  1.00 67.45  ? 60  TYR H N   1 
ATOM   8558 C CA  . TYR I 4 60  ? -29.944 23.488  71.521  1.00 68.04  ? 60  TYR H CA  1 
ATOM   8559 C C   . TYR I 4 60  ? -29.386 23.991  72.853  1.00 69.05  ? 60  TYR H C   1 
ATOM   8560 O O   . TYR I 4 60  ? -29.050 23.188  73.724  1.00 66.91  ? 60  TYR H O   1 
ATOM   8561 C CB  . TYR I 4 60  ? -28.839 23.561  70.457  1.00 67.52  ? 60  TYR H CB  1 
ATOM   8562 C CG  . TYR I 4 60  ? -27.647 22.682  70.775  1.00 73.27  ? 60  TYR H CG  1 
ATOM   8563 C CD1 . TYR I 4 60  ? -27.752 21.294  70.729  1.00 74.37  ? 60  TYR H CD1 1 
ATOM   8564 C CD2 . TYR I 4 60  ? -26.430 23.235  71.178  1.00 79.73  ? 60  TYR H CD2 1 
ATOM   8565 C CE1 . TYR I 4 60  ? -26.681 20.473  71.081  1.00 76.59  ? 60  TYR H CE1 1 
ATOM   8566 C CE2 . TYR I 4 60  ? -25.348 22.422  71.535  1.00 78.20  ? 60  TYR H CE2 1 
ATOM   8567 C CZ  . TYR I 4 60  ? -25.484 21.041  71.486  1.00 81.13  ? 60  TYR H CZ  1 
ATOM   8568 O OH  . TYR I 4 60  ? -24.438 20.225  71.862  1.00 79.19  ? 60  TYR H OH  1 
ATOM   8569 N N   . TYR I 4 61  ? -29.279 25.313  73.007  1.00 69.80  ? 61  TYR H N   1 
ATOM   8570 C CA  . TYR I 4 61  ? -28.758 25.906  74.242  1.00 68.85  ? 61  TYR H CA  1 
ATOM   8571 C C   . TYR I 4 61  ? -29.677 25.652  75.423  1.00 66.24  ? 61  TYR H C   1 
ATOM   8572 O O   . TYR I 4 61  ? -29.220 25.473  76.553  1.00 64.44  ? 61  TYR H O   1 
ATOM   8573 C CB  . TYR I 4 61  ? -28.549 27.418  74.089  1.00 61.28  ? 61  TYR H CB  1 
ATOM   8574 C CG  . TYR I 4 61  ? -27.216 27.796  73.488  1.00 60.54  ? 61  TYR H CG  1 
ATOM   8575 C CD1 . TYR I 4 61  ? -26.884 27.418  72.192  1.00 61.39  ? 61  TYR H CD1 1 
ATOM   8576 C CD2 . TYR I 4 61  ? -26.288 28.544  74.213  1.00 62.26  ? 61  TYR H CD2 1 
ATOM   8577 C CE1 . TYR I 4 61  ? -25.664 27.775  71.627  1.00 61.08  ? 61  TYR H CE1 1 
ATOM   8578 C CE2 . TYR I 4 61  ? -25.062 28.908  73.656  1.00 58.52  ? 61  TYR H CE2 1 
ATOM   8579 C CZ  . TYR I 4 61  ? -24.759 28.521  72.361  1.00 62.15  ? 61  TYR H CZ  1 
ATOM   8580 O OH  . TYR I 4 61  ? -23.565 28.892  71.781  1.00 58.79  ? 61  TYR H OH  1 
ATOM   8581 N N   . ASN I 4 62  ? -30.976 25.638  75.161  1.00 66.27  ? 62  ASN H N   1 
ATOM   8582 C CA  . ASN I 4 62  ? -31.938 25.395  76.222  1.00 67.65  ? 62  ASN H CA  1 
ATOM   8583 C C   . ASN I 4 62  ? -31.927 23.930  76.649  1.00 64.86  ? 62  ASN H C   1 
ATOM   8584 O O   . ASN I 4 62  ? -32.324 23.605  77.770  1.00 62.18  ? 62  ASN H O   1 
ATOM   8585 C CB  . ASN I 4 62  ? -33.331 25.823  75.768  1.00 63.41  ? 62  ASN H CB  1 
ATOM   8586 C CG  . ASN I 4 62  ? -33.462 27.331  75.652  1.00 68.66  ? 62  ASN H CG  1 
ATOM   8587 O OD1 . ASN I 4 62  ? -33.353 28.055  76.649  1.00 64.91  ? 62  ASN H OD1 1 
ATOM   8588 N ND2 . ASN I 4 62  ? -33.691 27.817  74.433  1.00 66.11  ? 62  ASN H ND2 1 
ATOM   8589 N N   . LYS I 4 63  ? -31.461 23.056  75.758  1.00 63.83  ? 63  LYS H N   1 
ATOM   8590 C CA  . LYS I 4 63  ? -31.383 21.628  76.052  1.00 66.93  ? 63  LYS H CA  1 
ATOM   8591 C C   . LYS I 4 63  ? -30.135 21.354  76.876  1.00 68.95  ? 63  LYS H C   1 
ATOM   8592 O O   . LYS I 4 63  ? -30.213 20.935  78.030  1.00 70.33  ? 63  LYS H O   1 
ATOM   8593 C CB  . LYS I 4 63  ? -31.267 20.791  74.774  1.00 68.65  ? 63  LYS H CB  1 
ATOM   8594 C CG  . LYS I 4 63  ? -32.408 20.876  73.778  1.00 79.61  ? 63  LYS H CG  1 
ATOM   8595 C CD  . LYS I 4 63  ? -32.030 20.117  72.489  1.00 82.32  ? 63  LYS H CD  1 
ATOM   8596 C CE  . LYS I 4 63  ? -33.146 20.110  71.432  1.00 80.61  ? 63  LYS H CE  1 
ATOM   8597 N NZ  . LYS I 4 63  ? -34.325 19.265  71.800  1.00 78.95  ? 63  LYS H NZ  1 
ATOM   8598 N N   . GLN I 4 64  ? -28.985 21.611  76.256  1.00 70.69  ? 64  GLN H N   1 
ATOM   8599 C CA  . GLN I 4 64  ? -27.667 21.366  76.843  1.00 70.35  ? 64  GLN H CA  1 
ATOM   8600 C C   . GLN I 4 64  ? -27.195 22.266  77.980  1.00 66.62  ? 64  GLN H C   1 
ATOM   8601 O O   . GLN I 4 64  ? -26.416 21.829  78.831  1.00 66.89  ? 64  GLN H O   1 
ATOM   8602 C CB  . GLN I 4 64  ? -26.595 21.423  75.746  1.00 69.51  ? 64  GLN H CB  1 
ATOM   8603 C CG  . GLN I 4 64  ? -27.017 20.836  74.418  1.00 79.10  ? 64  GLN H CG  1 
ATOM   8604 C CD  . GLN I 4 64  ? -27.323 19.355  74.501  1.00 85.47  ? 64  GLN H CD  1 
ATOM   8605 O OE1 . GLN I 4 64  ? -27.896 18.778  73.575  1.00 89.10  ? 64  GLN H OE1 1 
ATOM   8606 N NE2 . GLN I 4 64  ? -26.939 18.728  75.609  1.00 85.35  ? 64  GLN H NE2 1 
ATOM   8607 N N   . TYR I 4 65  ? -27.660 23.508  78.018  1.00 64.34  ? 67  TYR H N   1 
ATOM   8608 C CA  . TYR I 4 65  ? -27.153 24.419  79.031  1.00 62.96  ? 67  TYR H CA  1 
ATOM   8609 C C   . TYR I 4 65  ? -28.103 25.041  80.047  1.00 66.35  ? 67  TYR H C   1 
ATOM   8610 O O   . TYR I 4 65  ? -27.671 25.426  81.134  1.00 66.98  ? 67  TYR H O   1 
ATOM   8611 C CB  . TYR I 4 65  ? -26.383 25.531  78.320  1.00 53.40  ? 67  TYR H CB  1 
ATOM   8612 C CG  . TYR I 4 65  ? -25.452 25.033  77.219  1.00 52.76  ? 67  TYR H CG  1 
ATOM   8613 C CD1 . TYR I 4 65  ? -24.444 24.098  77.487  1.00 47.52  ? 67  TYR H CD1 1 
ATOM   8614 C CD2 . TYR I 4 65  ? -25.555 25.528  75.913  1.00 48.95  ? 67  TYR H CD2 1 
ATOM   8615 C CE1 . TYR I 4 65  ? -23.557 23.674  76.473  1.00 47.41  ? 67  TYR H CE1 1 
ATOM   8616 C CE2 . TYR I 4 65  ? -24.672 25.112  74.900  1.00 40.10  ? 67  TYR H CE2 1 
ATOM   8617 C CZ  . TYR I 4 65  ? -23.682 24.194  75.186  1.00 40.14  ? 67  TYR H CZ  1 
ATOM   8618 O OH  . TYR I 4 65  ? -22.800 23.821  74.196  1.00 53.29  ? 67  TYR H OH  1 
ATOM   8619 N N   . LEU I 4 66  ? -29.384 25.139  79.712  1.00 67.65  ? 68  LEU H N   1 
ATOM   8620 C CA  . LEU I 4 66  ? -30.347 25.767  80.610  1.00 67.33  ? 68  LEU H CA  1 
ATOM   8621 C C   . LEU I 4 66  ? -30.132 25.563  82.104  1.00 63.97  ? 68  LEU H C   1 
ATOM   8622 O O   . LEU I 4 66  ? -30.069 26.535  82.855  1.00 55.40  ? 68  LEU H O   1 
ATOM   8623 C CB  . LEU I 4 66  ? -31.775 25.351  80.252  1.00 71.94  ? 68  LEU H CB  1 
ATOM   8624 C CG  . LEU I 4 66  ? -32.681 26.522  79.855  1.00 72.90  ? 68  LEU H CG  1 
ATOM   8625 C CD1 . LEU I 4 66  ? -34.097 26.017  79.663  1.00 73.40  ? 68  LEU H CD1 1 
ATOM   8626 C CD2 . LEU I 4 66  ? -32.643 27.604  80.923  1.00 72.30  ? 68  LEU H CD2 1 
ATOM   8627 N N   . GLU I 4 67  ? -30.007 24.313  82.540  1.00 66.73  ? 69  GLU H N   1 
ATOM   8628 C CA  . GLU I 4 67  ? -29.835 24.048  83.965  1.00 67.88  ? 69  GLU H CA  1 
ATOM   8629 C C   . GLU I 4 67  ? -28.540 24.615  84.546  1.00 61.00  ? 69  GLU H C   1 
ATOM   8630 O O   . GLU I 4 67  ? -28.508 25.066  85.692  1.00 49.62  ? 69  GLU H O   1 
ATOM   8631 C CB  . GLU I 4 67  ? -29.912 22.545  84.251  1.00 73.25  ? 69  GLU H CB  1 
ATOM   8632 C CG  . GLU I 4 67  ? -30.396 22.250  85.671  1.00 83.50  ? 69  GLU H CG  1 
ATOM   8633 C CD  . GLU I 4 67  ? -30.383 20.775  86.026  1.00 85.99  ? 69  GLU H CD  1 
ATOM   8634 O OE1 . GLU I 4 67  ? -30.976 19.970  85.275  1.00 90.00  ? 69  GLU H OE1 1 
ATOM   8635 O OE2 . GLU I 4 67  ? -29.786 20.424  87.066  1.00 84.21  ? 69  GLU H OE2 1 
ATOM   8636 N N   . ARG I 4 68  ? -27.477 24.595  83.752  1.00 59.82  ? 70  ARG H N   1 
ATOM   8637 C CA  . ARG I 4 68  ? -26.189 25.106  84.206  1.00 62.93  ? 70  ARG H CA  1 
ATOM   8638 C C   . ARG I 4 68  ? -26.149 26.633  84.313  1.00 63.18  ? 70  ARG H C   1 
ATOM   8639 O O   . ARG I 4 68  ? -25.779 27.183  85.354  1.00 60.21  ? 70  ARG H O   1 
ATOM   8640 C CB  . ARG I 4 68  ? -25.078 24.626  83.272  1.00 61.34  ? 70  ARG H CB  1 
ATOM   8641 C CG  . ARG I 4 68  ? -24.954 23.115  83.202  1.00 66.03  ? 70  ARG H CG  1 
ATOM   8642 C CD  . ARG I 4 68  ? -23.547 22.658  83.558  1.00 74.52  ? 70  ARG H CD  1 
ATOM   8643 N NE  . ARG I 4 68  ? -23.465 21.207  83.715  1.00 77.25  ? 70  ARG H NE  1 
ATOM   8644 C CZ  . ARG I 4 68  ? -23.668 20.332  82.735  1.00 76.34  ? 70  ARG H CZ  1 
ATOM   8645 N NH1 . ARG I 4 68  ? -23.968 20.747  81.508  1.00 73.67  ? 70  ARG H NH1 1 
ATOM   8646 N NH2 . ARG I 4 68  ? -23.575 19.034  82.986  1.00 78.35  ? 70  ARG H NH2 1 
ATOM   8647 N N   . THR I 4 69  ? -26.534 27.316  83.240  1.00 62.45  ? 71  THR H N   1 
ATOM   8648 C CA  . THR I 4 69  ? -26.519 28.773  83.228  1.00 61.14  ? 71  THR H CA  1 
ATOM   8649 C C   . THR I 4 69  ? -27.345 29.363  84.355  1.00 60.88  ? 71  THR H C   1 
ATOM   8650 O O   . THR I 4 69  ? -26.911 30.302  85.019  1.00 61.71  ? 71  THR H O   1 
ATOM   8651 C CB  . THR I 4 69  ? -27.038 29.329  81.897  1.00 60.56  ? 71  THR H CB  1 
ATOM   8652 O OG1 . THR I 4 69  ? -26.230 28.827  80.826  1.00 62.19  ? 71  THR H OG1 1 
ATOM   8653 C CG2 . THR I 4 69  ? -26.974 30.848  81.900  1.00 62.07  ? 71  THR H CG2 1 
ATOM   8654 N N   . ARG I 4 70  ? -28.538 28.822  84.571  1.00 58.12  ? 72  ARG H N   1 
ATOM   8655 C CA  . ARG I 4 70  ? -29.387 29.327  85.637  1.00 59.58  ? 72  ARG H CA  1 
ATOM   8656 C C   . ARG I 4 70  ? -28.624 29.285  86.960  1.00 59.28  ? 72  ARG H C   1 
ATOM   8657 O O   . ARG I 4 70  ? -28.650 30.238  87.739  1.00 56.63  ? 72  ARG H O   1 
ATOM   8658 C CB  . ARG I 4 70  ? -30.646 28.471  85.778  1.00 65.84  ? 72  ARG H CB  1 
ATOM   8659 C CG  . ARG I 4 70  ? -31.635 28.512  84.622  1.00 77.71  ? 72  ARG H CG  1 
ATOM   8660 C CD  . ARG I 4 70  ? -32.557 27.299  84.727  1.00 84.35  ? 72  ARG H CD  1 
ATOM   8661 N NE  . ARG I 4 70  ? -33.614 27.254  83.720  1.00 89.86  ? 72  ARG H NE  1 
ATOM   8662 C CZ  . ARG I 4 70  ? -34.767 27.908  83.813  1.00 94.97  ? 72  ARG H CZ  1 
ATOM   8663 N NH1 . ARG I 4 70  ? -35.020 28.669  84.873  1.00 95.76  ? 72  ARG H NH1 1 
ATOM   8664 N NH2 . ARG I 4 70  ? -35.677 27.783  82.854  1.00 90.31  ? 72  ARG H NH2 1 
ATOM   8665 N N   . ALA I 4 71  ? -27.941 28.169  87.201  1.00 52.79  ? 73  ALA H N   1 
ATOM   8666 C CA  . ALA I 4 71  ? -27.200 27.966  88.444  1.00 57.46  ? 73  ALA H CA  1 
ATOM   8667 C C   . ALA I 4 71  ? -26.098 28.991  88.724  1.00 55.10  ? 73  ALA H C   1 
ATOM   8668 O O   . ALA I 4 71  ? -25.900 29.409  89.869  1.00 53.22  ? 73  ALA H O   1 
ATOM   8669 C CB  . ALA I 4 71  ? -26.619 26.549  88.468  1.00 58.19  ? 73  ALA H CB  1 
ATOM   8670 N N   . GLU I 4 72  ? -25.379 29.381  87.680  1.00 53.72  ? 74  GLU H N   1 
ATOM   8671 C CA  . GLU I 4 72  ? -24.297 30.341  87.813  1.00 53.43  ? 74  GLU H CA  1 
ATOM   8672 C C   . GLU I 4 72  ? -24.749 31.597  88.541  1.00 56.21  ? 74  GLU H C   1 
ATOM   8673 O O   . GLU I 4 72  ? -23.937 32.258  89.186  1.00 57.07  ? 74  GLU H O   1 
ATOM   8674 C CB  . GLU I 4 72  ? -23.737 30.716  86.434  1.00 55.09  ? 74  GLU H CB  1 
ATOM   8675 C CG  . GLU I 4 72  ? -23.044 29.576  85.700  1.00 54.98  ? 74  GLU H CG  1 
ATOM   8676 C CD  . GLU I 4 72  ? -22.517 29.986  84.334  1.00 61.56  ? 74  GLU H CD  1 
ATOM   8677 O OE1 . GLU I 4 72  ? -23.309 30.532  83.531  1.00 61.20  ? 74  GLU H OE1 1 
ATOM   8678 O OE2 . GLU I 4 72  ? -21.315 29.751  84.062  1.00 60.31  ? 74  GLU H OE2 1 
ATOM   8679 N N   . LEU I 4 73  ? -26.035 31.934  88.439  1.00 55.59  ? 75  LEU H N   1 
ATOM   8680 C CA  . LEU I 4 73  ? -26.537 33.120  89.125  1.00 55.51  ? 75  LEU H CA  1 
ATOM   8681 C C   . LEU I 4 73  ? -26.126 33.008  90.589  1.00 58.92  ? 75  LEU H C   1 
ATOM   8682 O O   . LEU I 4 73  ? -25.923 34.010  91.272  1.00 61.48  ? 75  LEU H O   1 
ATOM   8683 C CB  . LEU I 4 73  ? -28.065 33.223  89.004  1.00 52.34  ? 75  LEU H CB  1 
ATOM   8684 C CG  . LEU I 4 73  ? -28.709 34.482  89.620  1.00 58.36  ? 75  LEU H CG  1 
ATOM   8685 C CD1 . LEU I 4 73  ? -29.978 34.840  88.862  1.00 47.18  ? 75  LEU H CD1 1 
ATOM   8686 C CD2 . LEU I 4 73  ? -28.997 34.269  91.107  1.00 46.19  ? 75  LEU H CD2 1 
ATOM   8687 N N   . ASP I 4 74  ? -25.990 31.772  91.060  1.00 56.71  ? 76  ASP H N   1 
ATOM   8688 C CA  . ASP I 4 74  ? -25.596 31.522  92.434  1.00 59.50  ? 76  ASP H CA  1 
ATOM   8689 C C   . ASP I 4 74  ? -24.132 31.108  92.559  1.00 56.34  ? 76  ASP H C   1 
ATOM   8690 O O   . ASP I 4 74  ? -23.399 31.686  93.356  1.00 49.66  ? 76  ASP H O   1 
ATOM   8691 C CB  . ASP I 4 74  ? -26.497 30.449  93.058  1.00 66.98  ? 76  ASP H CB  1 
ATOM   8692 C CG  . ASP I 4 74  ? -27.866 30.992  93.463  1.00 78.79  ? 76  ASP H CG  1 
ATOM   8693 O OD1 . ASP I 4 74  ? -27.914 31.876  94.350  1.00 77.33  ? 76  ASP H OD1 1 
ATOM   8694 O OD2 . ASP I 4 74  ? -28.891 30.535  92.900  1.00 81.16  ? 76  ASP H OD2 1 
ATOM   8695 N N   . THR I 4 75  ? -23.700 30.121  91.773  1.00 56.54  ? 77  THR H N   1 
ATOM   8696 C CA  . THR I 4 75  ? -22.314 29.653  91.851  1.00 55.15  ? 77  THR H CA  1 
ATOM   8697 C C   . THR I 4 75  ? -21.284 30.649  91.302  1.00 52.97  ? 77  THR H C   1 
ATOM   8698 O O   . THR I 4 75  ? -20.084 30.502  91.532  1.00 53.18  ? 77  THR H O   1 
ATOM   8699 C CB  . THR I 4 75  ? -22.122 28.294  91.128  1.00 53.90  ? 77  THR H CB  1 
ATOM   8700 O OG1 . THR I 4 75  ? -22.110 28.495  89.710  1.00 53.20  ? 77  THR H OG1 1 
ATOM   8701 C CG2 . THR I 4 75  ? -23.244 27.339  91.488  1.00 51.89  ? 77  THR H CG2 1 
ATOM   8702 N N   . VAL I 4 76  ? -21.745 31.658  90.572  1.00 49.38  ? 78  VAL H N   1 
ATOM   8703 C CA  . VAL I 4 76  ? -20.833 32.658  90.040  1.00 46.63  ? 78  VAL H CA  1 
ATOM   8704 C C   . VAL I 4 76  ? -21.134 34.035  90.612  1.00 48.35  ? 78  VAL H C   1 
ATOM   8705 O O   . VAL I 4 76  ? -20.334 34.580  91.362  1.00 49.26  ? 78  VAL H O   1 
ATOM   8706 C CB  . VAL I 4 76  ? -20.887 32.729  88.501  1.00 46.05  ? 78  VAL H CB  1 
ATOM   8707 C CG1 . VAL I 4 76  ? -19.993 33.858  88.002  1.00 42.53  ? 78  VAL H CG1 1 
ATOM   8708 C CG2 . VAL I 4 76  ? -20.419 31.413  87.907  1.00 38.22  ? 78  VAL H CG2 1 
ATOM   8709 N N   . CYS I 4 77  ? -22.294 34.585  90.269  1.00 50.14  ? 79  CYS H N   1 
ATOM   8710 C CA  . CYS I 4 77  ? -22.687 35.910  90.738  1.00 49.86  ? 79  CYS H CA  1 
ATOM   8711 C C   . CYS I 4 77  ? -22.730 36.059  92.258  1.00 50.67  ? 79  CYS H C   1 
ATOM   8712 O O   . CYS I 4 77  ? -21.927 36.788  92.843  1.00 51.88  ? 79  CYS H O   1 
ATOM   8713 C CB  . CYS I 4 77  ? -24.050 36.297  90.167  1.00 41.80  ? 79  CYS H CB  1 
ATOM   8714 S SG  . CYS I 4 77  ? -24.152 36.522  88.358  1.00 63.25  ? 79  CYS H SG  1 
ATOM   8715 N N   . ARG I 4 78  ? -23.679 35.393  92.902  1.00 51.56  ? 80  ARG H N   1 
ATOM   8716 C CA  . ARG I 4 78  ? -23.781 35.493  94.349  1.00 52.17  ? 80  ARG H CA  1 
ATOM   8717 C C   . ARG I 4 78  ? -22.468 35.100  95.014  1.00 53.74  ? 80  ARG H C   1 
ATOM   8718 O O   . ARG I 4 78  ? -22.029 35.749  95.971  1.00 51.60  ? 80  ARG H O   1 
ATOM   8719 C CB  . ARG I 4 78  ? -24.919 34.612  94.876  1.00 55.71  ? 80  ARG H CB  1 
ATOM   8720 C CG  . ARG I 4 78  ? -24.914 34.477  96.392  1.00 58.16  ? 80  ARG H CG  1 
ATOM   8721 C CD  . ARG I 4 78  ? -26.210 33.894  96.927  1.00 61.26  ? 80  ARG H CD  1 
ATOM   8722 N NE  . ARG I 4 78  ? -27.246 34.911  97.082  1.00 68.01  ? 80  ARG H NE  1 
ATOM   8723 C CZ  . ARG I 4 78  ? -28.318 35.018  96.305  1.00 66.75  ? 80  ARG H CZ  1 
ATOM   8724 N NH1 . ARG I 4 78  ? -28.506 34.167  95.305  1.00 60.38  ? 80  ARG H NH1 1 
ATOM   8725 N NH2 . ARG I 4 78  ? -29.207 35.975  96.536  1.00 68.94  ? 80  ARG H NH2 1 
ATOM   8726 N N   . TYR I 4 79  ? -21.838 34.049  94.491  1.00 42.45  ? 81  TYR H N   1 
ATOM   8727 C CA  . TYR I 4 79  ? -20.578 33.559  95.035  1.00 47.17  ? 81  TYR H CA  1 
ATOM   8728 C C   . TYR I 4 79  ? -19.429 34.564  94.935  1.00 51.24  ? 81  TYR H C   1 
ATOM   8729 O O   . TYR I 4 79  ? -18.776 34.875  95.936  1.00 57.94  ? 81  TYR H O   1 
ATOM   8730 C CB  . TYR I 4 79  ? -20.152 32.269  94.335  1.00 49.71  ? 81  TYR H CB  1 
ATOM   8731 C CG  . TYR I 4 79  ? -18.838 31.743  94.855  1.00 51.03  ? 81  TYR H CG  1 
ATOM   8732 C CD1 . TYR I 4 79  ? -18.781 31.003  96.029  1.00 57.12  ? 81  TYR H CD1 1 
ATOM   8733 C CD2 . TYR I 4 79  ? -17.646 32.015  94.192  1.00 52.90  ? 81  TYR H CD2 1 
ATOM   8734 C CE1 . TYR I 4 79  ? -17.571 30.541  96.530  1.00 62.92  ? 81  TYR H CE1 1 
ATOM   8735 C CE2 . TYR I 4 79  ? -16.429 31.562  94.685  1.00 60.78  ? 81  TYR H CE2 1 
ATOM   8736 C CZ  . TYR I 4 79  ? -16.398 30.823  95.854  1.00 65.27  ? 81  TYR H CZ  1 
ATOM   8737 O OH  . TYR I 4 79  ? -15.199 30.355  96.341  1.00 70.08  ? 81  TYR H OH  1 
ATOM   8738 N N   . ASN I 4 80  ? -19.169 35.045  93.721  1.00 44.76  ? 82  ASN H N   1 
ATOM   8739 C CA  . ASN I 4 80  ? -18.098 36.006  93.488  1.00 39.53  ? 82  ASN H CA  1 
ATOM   8740 C C   . ASN I 4 80  ? -18.301 37.245  94.338  1.00 34.67  ? 82  ASN H C   1 
ATOM   8741 O O   . ASN I 4 80  ? -17.350 37.814  94.864  1.00 46.11  ? 82  ASN H O   1 
ATOM   8742 C CB  . ASN I 4 80  ? -18.040 36.403  92.005  1.00 38.93  ? 82  ASN H CB  1 
ATOM   8743 C CG  . ASN I 4 80  ? -17.279 35.398  91.152  1.00 45.06  ? 82  ASN H CG  1 
ATOM   8744 O OD1 . ASN I 4 80  ? -16.767 34.390  91.648  1.00 49.63  ? 82  ASN H OD1 1 
ATOM   8745 N ND2 . ASN I 4 80  ? -17.192 35.677  89.861  1.00 44.51  ? 82  ASN H ND2 1 
ATOM   8746 N N   . TYR I 4 81  ? -19.551 37.650  94.495  1.00 39.19  ? 83  TYR H N   1 
ATOM   8747 C CA  . TYR I 4 81  ? -19.856 38.839  95.271  1.00 39.71  ? 83  TYR H CA  1 
ATOM   8748 C C   . TYR I 4 81  ? -19.562 38.714  96.760  1.00 46.33  ? 83  TYR H C   1 
ATOM   8749 O O   . TYR I 4 81  ? -18.855 39.546  97.333  1.00 48.66  ? 83  TYR H O   1 
ATOM   8750 C CB  . TYR I 4 81  ? -21.318 39.227  95.060  1.00 35.70  ? 83  TYR H CB  1 
ATOM   8751 C CG  . TYR I 4 81  ? -21.705 40.563  95.645  1.00 38.84  ? 83  TYR H CG  1 
ATOM   8752 C CD1 . TYR I 4 81  ? -21.796 40.746  97.024  1.00 39.25  ? 83  TYR H CD1 1 
ATOM   8753 C CD2 . TYR I 4 81  ? -22.027 41.637  94.818  1.00 37.79  ? 83  TYR H CD2 1 
ATOM   8754 C CE1 . TYR I 4 81  ? -22.207 41.965  97.566  1.00 34.48  ? 83  TYR H CE1 1 
ATOM   8755 C CE2 . TYR I 4 81  ? -22.435 42.859  95.348  1.00 31.34  ? 83  TYR H CE2 1 
ATOM   8756 C CZ  . TYR I 4 81  ? -22.527 43.019  96.722  1.00 40.54  ? 83  TYR H CZ  1 
ATOM   8757 O OH  . TYR I 4 81  ? -22.946 44.225  97.260  1.00 43.79  ? 83  TYR H OH  1 
ATOM   8758 N N   . GLU I 4 82  ? -20.099 37.682  97.394  1.00 52.21  ? 84  GLU H N   1 
ATOM   8759 C CA  . GLU I 4 82  ? -19.889 37.514  98.826  1.00 52.23  ? 84  GLU H CA  1 
ATOM   8760 C C   . GLU I 4 82  ? -18.494 37.009  99.123  1.00 47.56  ? 84  GLU H C   1 
ATOM   8761 O O   . GLU I 4 82  ? -17.922 37.320  100.161 1.00 51.89  ? 84  GLU H O   1 
ATOM   8762 C CB  . GLU I 4 82  ? -20.926 36.545  99.406  1.00 58.90  ? 84  GLU H CB  1 
ATOM   8763 C CG  . GLU I 4 82  ? -22.365 36.874  99.016  1.00 61.04  ? 84  GLU H CG  1 
ATOM   8764 C CD  . GLU I 4 82  ? -23.393 35.956  99.666  1.00 73.21  ? 84  GLU H CD  1 
ATOM   8765 O OE1 . GLU I 4 82  ? -23.157 34.723  99.727  1.00 69.80  ? 84  GLU H OE1 1 
ATOM   8766 O OE2 . GLU I 4 82  ? -24.449 36.473  100.101 1.00 76.72  ? 84  GLU H OE2 1 
ATOM   8767 N N   . GLU I 4 83  A -17.934 36.253  98.191  1.00 53.31  ? 84  GLU H N   1 
ATOM   8768 C CA  . GLU I 4 83  A -16.607 35.672  98.379  1.00 56.89  ? 84  GLU H CA  1 
ATOM   8769 C C   . GLU I 4 83  A -15.395 36.497  97.942  1.00 56.77  ? 84  GLU H C   1 
ATOM   8770 O O   . GLU I 4 83  A -14.376 36.514  98.632  1.00 52.52  ? 84  GLU H O   1 
ATOM   8771 C CB  . GLU I 4 83  A -16.552 34.305  97.691  1.00 58.24  ? 84  GLU H CB  1 
ATOM   8772 C CG  . GLU I 4 83  A -16.391 33.147  98.653  1.00 64.79  ? 84  GLU H CG  1 
ATOM   8773 C CD  . GLU I 4 83  A -17.347 33.236  99.824  1.00 63.79  ? 84  GLU H CD  1 
ATOM   8774 O OE1 . GLU I 4 83  A -18.575 33.185  99.601  1.00 64.84  ? 84  GLU H OE1 1 
ATOM   8775 O OE2 . GLU I 4 83  A -16.865 33.362  100.969 1.00 66.22  ? 84  GLU H OE2 1 
ATOM   8776 N N   . THR I 4 84  ? -15.492 37.190  96.813  1.00 52.26  ? 85  THR H N   1 
ATOM   8777 C CA  . THR I 4 84  ? -14.340 37.940  96.335  1.00 49.60  ? 85  THR H CA  1 
ATOM   8778 C C   . THR I 4 84  ? -14.465 39.458  96.301  1.00 48.09  ? 85  THR H C   1 
ATOM   8779 O O   . THR I 4 84  ? -13.472 40.155  96.482  1.00 43.96  ? 85  THR H O   1 
ATOM   8780 C CB  . THR I 4 84  ? -13.930 37.436  94.947  1.00 47.04  ? 85  THR H CB  1 
ATOM   8781 O OG1 . THR I 4 84  ? -14.960 37.738  94.000  1.00 50.87  ? 85  THR H OG1 1 
ATOM   8782 C CG2 . THR I 4 84  ? -13.731 35.925  94.985  1.00 44.57  ? 85  THR H CG2 1 
ATOM   8783 N N   . GLU I 4 85  ? -15.674 39.967  96.090  1.00 45.57  ? 86  GLU H N   1 
ATOM   8784 C CA  . GLU I 4 85  ? -15.901 41.407  96.026  1.00 43.09  ? 86  GLU H CA  1 
ATOM   8785 C C   . GLU I 4 85  ? -15.962 42.098  97.387  1.00 47.77  ? 86  GLU H C   1 
ATOM   8786 O O   . GLU I 4 85  ? -15.364 43.158  97.578  1.00 51.89  ? 86  GLU H O   1 
ATOM   8787 C CB  . GLU I 4 85  ? -17.189 41.686  95.254  1.00 42.12  ? 86  GLU H CB  1 
ATOM   8788 C CG  . GLU I 4 85  ? -17.215 41.090  93.847  1.00 44.69  ? 86  GLU H CG  1 
ATOM   8789 C CD  . GLU I 4 85  ? -16.085 41.608  92.961  1.00 52.95  ? 86  GLU H CD  1 
ATOM   8790 O OE1 . GLU I 4 85  ? -15.437 42.613  93.341  1.00 45.17  ? 86  GLU H OE1 1 
ATOM   8791 O OE2 . GLU I 4 85  ? -15.853 41.015  91.882  1.00 44.29  ? 86  GLU H OE2 1 
ATOM   8792 N N   . VAL I 4 86  ? -16.694 41.502  98.324  1.00 49.92  ? 87  VAL H N   1 
ATOM   8793 C CA  . VAL I 4 86  ? -16.849 42.047  99.673  1.00 43.23  ? 87  VAL H CA  1 
ATOM   8794 C C   . VAL I 4 86  ? -15.525 42.484  100.310 1.00 42.02  ? 87  VAL H C   1 
ATOM   8795 O O   . VAL I 4 86  ? -15.433 43.573  100.873 1.00 49.29  ? 87  VAL H O   1 
ATOM   8796 C CB  . VAL I 4 86  ? -17.577 41.006  100.606 1.00 49.96  ? 87  VAL H CB  1 
ATOM   8797 C CG1 . VAL I 4 86  ? -17.357 41.346  102.090 1.00 28.98  ? 87  VAL H CG1 1 
ATOM   8798 C CG2 . VAL I 4 86  ? -19.078 40.989  100.288 1.00 36.38  ? 87  VAL H CG2 1 
ATOM   8799 N N   . PRO I 4 87  ? -14.484 41.640  100.240 1.00 44.06  ? 88  PRO H N   1 
ATOM   8800 C CA  . PRO I 4 87  ? -13.202 42.026  100.837 1.00 46.12  ? 88  PRO H CA  1 
ATOM   8801 C C   . PRO I 4 87  ? -12.280 42.866  99.945  1.00 46.59  ? 88  PRO H C   1 
ATOM   8802 O O   . PRO I 4 87  ? -11.204 43.274  100.388 1.00 45.36  ? 88  PRO H O   1 
ATOM   8803 C CB  . PRO I 4 87  ? -12.583 40.681  101.202 1.00 42.87  ? 88  PRO H CB  1 
ATOM   8804 C CG  . PRO I 4 87  ? -13.025 39.821  100.078 1.00 42.59  ? 88  PRO H CG  1 
ATOM   8805 C CD  . PRO I 4 87  ? -14.482 40.207  99.887  1.00 39.33  ? 88  PRO H CD  1 
ATOM   8806 N N   . THR I 4 88  ? -12.675 43.121  98.695  1.00 44.84  ? 89  THR H N   1 
ATOM   8807 C CA  . THR I 4 88  ? -11.828 43.937  97.807  1.00 44.83  ? 89  THR H CA  1 
ATOM   8808 C C   . THR I 4 88  ? -12.467 45.225  97.285  1.00 43.75  ? 89  THR H C   1 
ATOM   8809 O O   . THR I 4 88  ? -12.265 46.302  97.850  1.00 47.28  ? 89  THR H O   1 
ATOM   8810 C CB  . THR I 4 88  ? -11.289 43.134  96.581  1.00 44.25  ? 89  THR H CB  1 
ATOM   8811 O OG1 . THR I 4 88  ? -12.377 42.598  95.816  1.00 37.69  ? 89  THR H OG1 1 
ATOM   8812 C CG2 . THR I 4 88  ? -10.362 42.021  97.043  1.00 36.02  ? 89  THR H CG2 1 
ATOM   8813 N N   . SER I 4 89  ? -13.233 45.116  96.208  1.00 36.14  ? 90  SER H N   1 
ATOM   8814 C CA  . SER I 4 89  ? -13.871 46.285  95.621  1.00 40.20  ? 90  SER H CA  1 
ATOM   8815 C C   . SER I 4 89  ? -14.899 46.981  96.505  1.00 42.73  ? 90  SER H C   1 
ATOM   8816 O O   . SER I 4 89  ? -14.948 48.213  96.563  1.00 43.43  ? 90  SER H O   1 
ATOM   8817 C CB  . SER I 4 89  ? -14.527 45.903  94.300  1.00 38.22  ? 90  SER H CB  1 
ATOM   8818 O OG  . SER I 4 89  ? -15.478 44.889  94.500  1.00 39.61  ? 90  SER H OG  1 
ATOM   8819 N N   . LEU I 4 90  ? -15.726 46.207  97.195  1.00 45.75  ? 91  LEU H N   1 
ATOM   8820 C CA  . LEU I 4 90  ? -16.749 46.809  98.036  1.00 47.56  ? 91  LEU H CA  1 
ATOM   8821 C C   . LEU I 4 90  ? -16.160 47.468  99.274  1.00 46.75  ? 91  LEU H C   1 
ATOM   8822 O O   . LEU I 4 90  ? -16.862 48.163  100.001 1.00 44.06  ? 91  LEU H O   1 
ATOM   8823 C CB  . LEU I 4 90  ? -17.791 45.757  98.422  1.00 42.95  ? 91  LEU H CB  1 
ATOM   8824 C CG  . LEU I 4 90  ? -18.457 45.116  97.194  1.00 50.72  ? 91  LEU H CG  1 
ATOM   8825 C CD1 . LEU I 4 90  ? -19.229 43.875  97.603  1.00 44.81  ? 91  LEU H CD1 1 
ATOM   8826 C CD2 . LEU I 4 90  ? -19.365 46.129  96.496  1.00 42.99  ? 91  LEU H CD2 1 
ATOM   8827 N N   . ARG I 4 91  ? -14.863 47.270  99.491  1.00 49.28  ? 92  ARG H N   1 
ATOM   8828 C CA  . ARG I 4 91  ? -14.181 47.845  100.647 1.00 49.59  ? 92  ARG H CA  1 
ATOM   8829 C C   . ARG I 4 91  ? -13.191 48.943  100.257 1.00 47.08  ? 92  ARG H C   1 
ATOM   8830 O O   . ARG I 4 91  ? -12.543 49.535  101.116 1.00 48.33  ? 92  ARG H O   1 
ATOM   8831 C CB  . ARG I 4 91  ? -13.449 46.736  101.417 1.00 54.86  ? 92  ARG H CB  1 
ATOM   8832 C CG  . ARG I 4 91  ? -12.804 47.192  102.715 1.00 64.21  ? 92  ARG H CG  1 
ATOM   8833 C CD  . ARG I 4 91  ? -12.553 46.035  103.675 1.00 68.93  ? 92  ARG H CD  1 
ATOM   8834 N NE  . ARG I 4 91  ? -11.488 45.139  103.230 1.00 84.76  ? 92  ARG H NE  1 
ATOM   8835 C CZ  . ARG I 4 91  ? -11.112 44.041  103.886 1.00 88.84  ? 92  ARG H CZ  1 
ATOM   8836 N NH1 . ARG I 4 91  ? -11.717 43.705  105.020 1.00 93.15  ? 92  ARG H NH1 1 
ATOM   8837 N NH2 . ARG I 4 91  ? -10.136 43.275  103.408 1.00 80.63  ? 92  ARG H NH2 1 
ATOM   8838 N N   . ARG I 4 92  ? -13.077 49.217  98.960  1.00 44.98  ? 93  ARG H N   1 
ATOM   8839 C CA  . ARG I 4 92  ? -12.149 50.235  98.482  1.00 35.96  ? 93  ARG H CA  1 
ATOM   8840 C C   . ARG I 4 92  ? -12.646 51.645  98.778  1.00 34.86  ? 93  ARG H C   1 
ATOM   8841 O O   . ARG I 4 92  ? -13.770 52.022  98.429  1.00 29.27  ? 93  ARG H O   1 
ATOM   8842 C CB  . ARG I 4 92  ? -11.909 50.060  96.976  1.00 36.04  ? 93  ARG H CB  1 
ATOM   8843 C CG  . ARG I 4 92  ? -10.837 50.978  96.385  1.00 40.47  ? 93  ARG H CG  1 
ATOM   8844 C CD  . ARG I 4 92  ? -10.557 50.651  94.909  1.00 38.82  ? 93  ARG H CD  1 
ATOM   8845 N NE  . ARG I 4 92  ? -9.675  51.631  94.268  1.00 37.66  ? 93  ARG H NE  1 
ATOM   8846 C CZ  . ARG I 4 92  ? -8.388  51.794  94.557  1.00 39.24  ? 93  ARG H CZ  1 
ATOM   8847 N NH1 . ARG I 4 92  ? -7.805  51.043  95.481  1.00 41.09  ? 93  ARG H NH1 1 
ATOM   8848 N NH2 . ARG I 4 92  ? -7.682  52.715  93.922  1.00 35.52  ? 93  ARG H NH2 1 
ATOM   8849 N N   . LEU I 4 93  ? -11.798 52.416  99.445  1.00 29.26  ? 94  LEU H N   1 
ATOM   8850 C CA  . LEU I 4 93  ? -12.120 53.790  99.794  1.00 30.94  ? 94  LEU H CA  1 
ATOM   8851 C C   . LEU I 4 93  ? -10.911 54.662  99.554  1.00 32.34  ? 94  LEU H C   1 
ATOM   8852 O O   . LEU I 4 93  ? -9.855  54.435  100.134 1.00 43.31  ? 94  LEU H O   1 
ATOM   8853 C CB  . LEU I 4 93  ? -12.505 53.908  101.266 1.00 43.42  ? 94  LEU H CB  1 
ATOM   8854 C CG  . LEU I 4 93  ? -13.943 53.651  101.685 1.00 40.89  ? 94  LEU H CG  1 
ATOM   8855 C CD1 . LEU I 4 93  ? -14.029 53.899  103.167 1.00 43.46  ? 94  LEU H CD1 1 
ATOM   8856 C CD2 . LEU I 4 93  ? -14.901 54.577  100.934 1.00 43.28  ? 94  LEU H CD2 1 
ATOM   8857 N N   . GLU I 4 94  ? -11.068 55.659  98.699  1.00 34.01  ? 95  GLU H N   1 
ATOM   8858 C CA  . GLU I 4 94  ? -9.980  56.569  98.392  1.00 32.31  ? 95  GLU H CA  1 
ATOM   8859 C C   . GLU I 4 94  ? -10.542 57.965  98.550  1.00 30.27  ? 95  GLU H C   1 
ATOM   8860 O O   . GLU I 4 94  ? -11.598 58.279  98.016  1.00 32.81  ? 95  GLU H O   1 
ATOM   8861 C CB  . GLU I 4 94  ? -9.488  56.342  96.963  1.00 32.60  ? 95  GLU H CB  1 
ATOM   8862 C CG  . GLU I 4 94  ? -8.903  54.964  96.721  1.00 35.04  ? 95  GLU H CG  1 
ATOM   8863 C CD  . GLU I 4 94  ? -7.568  54.775  97.413  1.00 41.90  ? 95  GLU H CD  1 
ATOM   8864 O OE1 . GLU I 4 94  ? -6.710  55.672  97.274  1.00 48.40  ? 95  GLU H OE1 1 
ATOM   8865 O OE2 . GLU I 4 94  ? -7.366  53.739  98.084  1.00 44.81  ? 95  GLU H OE2 1 
ATOM   8866 N N   . GLN I 4 95  ? -9.826  58.793  99.292  1.00 27.23  ? 96  GLN H N   1 
ATOM   8867 C CA  . GLN I 4 95  ? -10.250 60.146  99.556  1.00 31.32  ? 96  GLN H CA  1 
ATOM   8868 C C   . GLN I 4 95  ? -9.937  61.133  98.468  1.00 33.71  ? 96  GLN H C   1 
ATOM   8869 O O   . GLN I 4 95  ? -8.876  61.108  97.852  1.00 34.12  ? 96  GLN H O   1 
ATOM   8870 C CB  . GLN I 4 95  ? -9.622  60.645  100.848 1.00 36.22  ? 96  GLN H CB  1 
ATOM   8871 C CG  . GLN I 4 95  ? -9.959  59.803  102.068 1.00 39.30  ? 96  GLN H CG  1 
ATOM   8872 C CD  . GLN I 4 95  ? -8.860  59.857  103.112 1.00 49.94  ? 96  GLN H CD  1 
ATOM   8873 O OE1 . GLN I 4 95  ? -8.544  60.921  103.645 1.00 37.09  ? 96  GLN H OE1 1 
ATOM   8874 N NE2 . GLN I 4 95  ? -8.256  58.700  103.400 1.00 67.08  ? 96  GLN H NE2 1 
ATOM   8875 N N   . PRO I 4 96  ? -10.888 62.014  98.211  1.00 32.49  ? 97  PRO H N   1 
ATOM   8876 C CA  . PRO I 4 96  ? -10.804 63.064  97.214  1.00 33.59  ? 97  PRO H CA  1 
ATOM   8877 C C   . PRO I 4 96  ? -9.616  64.010  97.409  1.00 41.20  ? 97  PRO H C   1 
ATOM   8878 O O   . PRO I 4 96  ? -9.296  64.399  98.523  1.00 39.18  ? 97  PRO H O   1 
ATOM   8879 C CB  . PRO I 4 96  ? -12.161 63.746  97.365  1.00 27.51  ? 97  PRO H CB  1 
ATOM   8880 C CG  . PRO I 4 96  ? -13.071 62.559  97.581  1.00 26.72  ? 97  PRO H CG  1 
ATOM   8881 C CD  . PRO I 4 96  ? -12.256 61.479  98.262  1.00 31.73  ? 97  PRO H CD  1 
ATOM   8882 N N   . ASN I 4 97  ? -8.929  64.325  96.316  1.00 45.43  ? 98  ASN H N   1 
ATOM   8883 C CA  . ASN I 4 97  ? -7.834  65.285  96.358  1.00 41.01  ? 98  ASN H CA  1 
ATOM   8884 C C   . ASN I 4 97  ? -8.526  66.560  95.890  1.00 43.10  ? 98  ASN H C   1 
ATOM   8885 O O   . ASN I 4 97  ? -9.168  66.565  94.844  1.00 44.40  ? 98  ASN H O   1 
ATOM   8886 C CB  . ASN I 4 97  ? -6.726  64.892  95.384  1.00 53.71  ? 98  ASN H CB  1 
ATOM   8887 C CG  . ASN I 4 97  ? -5.352  65.177  95.938  1.00 53.63  ? 98  ASN H CG  1 
ATOM   8888 O OD1 . ASN I 4 97  ? -4.865  66.308  95.881  1.00 56.33  ? 98  ASN H OD1 1 
ATOM   8889 N ND2 . ASN I 4 97  ? -4.725  64.150  96.509  1.00 61.94  ? 98  ASN H ND2 1 
ATOM   8890 N N   . VAL I 4 98  ? -8.417  67.642  96.647  1.00 39.46  ? 99  VAL H N   1 
ATOM   8891 C CA  . VAL I 4 98  ? -9.111  68.855  96.245  1.00 33.52  ? 99  VAL H CA  1 
ATOM   8892 C C   . VAL I 4 98  ? -8.215  70.059  96.069  1.00 34.80  ? 99  VAL H C   1 
ATOM   8893 O O   . VAL I 4 98  ? -7.620  70.530  97.030  1.00 41.80  ? 99  VAL H O   1 
ATOM   8894 C CB  . VAL I 4 98  ? -10.203 69.228  97.280  1.00 37.07  ? 99  VAL H CB  1 
ATOM   8895 C CG1 . VAL I 4 98  ? -11.093 70.333  96.737  1.00 34.77  ? 99  VAL H CG1 1 
ATOM   8896 C CG2 . VAL I 4 98  ? -11.022 68.001  97.645  1.00 17.96  ? 99  VAL H CG2 1 
ATOM   8897 N N   . VAL I 4 99  ? -8.104  70.559  94.843  1.00 37.14  ? 100 VAL H N   1 
ATOM   8898 C CA  . VAL I 4 99  ? -7.300  71.751  94.619  1.00 34.84  ? 100 VAL H CA  1 
ATOM   8899 C C   . VAL I 4 99  ? -8.050  72.739  93.733  1.00 40.33  ? 100 VAL H C   1 
ATOM   8900 O O   . VAL I 4 99  ? -8.807  72.357  92.835  1.00 35.62  ? 100 VAL H O   1 
ATOM   8901 C CB  . VAL I 4 99  ? -5.914  71.439  93.982  1.00 37.04  ? 100 VAL H CB  1 
ATOM   8902 C CG1 . VAL I 4 99  ? -5.467  70.026  94.348  1.00 38.47  ? 100 VAL H CG1 1 
ATOM   8903 C CG2 . VAL I 4 99  ? -5.950  71.650  92.492  1.00 39.70  ? 100 VAL H CG2 1 
ATOM   8904 N N   . ILE I 4 100 ? -7.847  74.017  94.008  1.00 37.39  ? 101 ILE H N   1 
ATOM   8905 C CA  . ILE I 4 100 ? -8.487  75.067  93.240  1.00 39.54  ? 101 ILE H CA  1 
ATOM   8906 C C   . ILE I 4 100 ? -7.453  75.772  92.378  1.00 42.04  ? 101 ILE H C   1 
ATOM   8907 O O   . ILE I 4 100 ? -6.360  76.099  92.845  1.00 37.87  ? 101 ILE H O   1 
ATOM   8908 C CB  . ILE I 4 100 ? -9.127  76.116  94.157  1.00 35.80  ? 101 ILE H CB  1 
ATOM   8909 C CG1 . ILE I 4 100 ? -10.236 75.470  94.994  1.00 37.10  ? 101 ILE H CG1 1 
ATOM   8910 C CG2 . ILE I 4 100 ? -9.643  77.276  93.324  1.00 31.56  ? 101 ILE H CG2 1 
ATOM   8911 C CD1 . ILE I 4 100 ? -10.798 76.375  96.069  1.00 23.89  ? 101 ILE H CD1 1 
ATOM   8912 N N   . SER I 4 101 ? -7.811  76.013  91.122  1.00 43.32  ? 102 SER H N   1 
ATOM   8913 C CA  . SER I 4 101 ? -6.928  76.700  90.192  1.00 40.85  ? 102 SER H CA  1 
ATOM   8914 C C   . SER I 4 101 ? -7.735  77.736  89.427  1.00 43.93  ? 102 SER H C   1 
ATOM   8915 O O   . SER I 4 101 ? -8.952  77.612  89.291  1.00 48.99  ? 102 SER H O   1 
ATOM   8916 C CB  . SER I 4 101 ? -6.307  75.702  89.217  1.00 33.10  ? 102 SER H CB  1 
ATOM   8917 O OG  . SER I 4 101 ? -7.296  75.131  88.386  1.00 46.93  ? 102 SER H OG  1 
ATOM   8918 N N   . LEU I 4 102 ? -7.043  78.754  88.930  1.00 53.57  ? 103 LEU H N   1 
ATOM   8919 C CA  . LEU I 4 102 ? -7.645  79.850  88.176  1.00 53.99  ? 103 LEU H CA  1 
ATOM   8920 C C   . LEU I 4 102 ? -7.303  79.673  86.690  1.00 63.40  ? 103 LEU H C   1 
ATOM   8921 O O   . LEU I 4 102 ? -6.210  79.216  86.364  1.00 64.48  ? 103 LEU H O   1 
ATOM   8922 C CB  . LEU I 4 102 ? -7.074  81.158  88.710  1.00 45.46  ? 103 LEU H CB  1 
ATOM   8923 C CG  . LEU I 4 102 ? -7.590  82.463  88.140  1.00 49.78  ? 103 LEU H CG  1 
ATOM   8924 C CD1 . LEU I 4 102 ? -9.103  82.548  88.288  1.00 50.60  ? 103 LEU H CD1 1 
ATOM   8925 C CD2 . LEU I 4 102 ? -6.909  83.591  88.880  1.00 58.61  ? 103 LEU H CD2 1 
ATOM   8926 N N   . SER I 4 103 ? -8.213  80.040  85.788  1.00 71.74  ? 104 SER H N   1 
ATOM   8927 C CA  . SER I 4 103 ? -7.953  79.859  84.357  1.00 83.28  ? 104 SER H CA  1 
ATOM   8928 C C   . SER I 4 103 ? -7.739  81.103  83.492  1.00 97.61  ? 104 SER H C   1 
ATOM   8929 O O   . SER I 4 103 ? -8.036  81.079  82.293  1.00 99.40  ? 104 SER H O   1 
ATOM   8930 C CB  . SER I 4 103 ? -9.061  79.013  83.729  1.00 73.93  ? 104 SER H CB  1 
ATOM   8931 O OG  . SER I 4 103 ? -8.999  77.675  84.184  1.00 70.17  ? 104 SER H OG  1 
ATOM   8932 N N   . ARG I 4 104 ? -7.221  82.180  84.079  1.00 112.77 ? 105 ARG H N   1 
ATOM   8933 C CA  . ARG I 4 104 ? -6.960  83.414  83.326  1.00 125.71 ? 105 ARG H CA  1 
ATOM   8934 C C   . ARG I 4 104 ? -5.839  84.239  83.978  1.00 132.31 ? 105 ARG H C   1 
ATOM   8935 O O   . ARG I 4 104 ? -4.880  83.674  84.510  1.00 133.12 ? 105 ARG H O   1 
ATOM   8936 C CB  . ARG I 4 104 ? -8.239  84.257  83.215  1.00 126.76 ? 105 ARG H CB  1 
ATOM   8937 C CG  . ARG I 4 104 ? -9.423  83.542  82.555  1.00 128.39 ? 105 ARG H CG  1 
ATOM   8938 C CD  . ARG I 4 104 ? -9.825  84.167  81.221  1.00 128.68 ? 105 ARG H CD  1 
ATOM   8939 N NE  . ARG I 4 104 ? -8.774  84.074  80.207  1.00 127.22 ? 105 ARG H NE  1 
ATOM   8940 C CZ  . ARG I 4 104 ? -8.914  84.482  78.947  1.00 124.41 ? 105 ARG H CZ  1 
ATOM   8941 N NH1 . ARG I 4 104 ? -10.062 85.011  78.541  1.00 120.60 ? 105 ARG H NH1 1 
ATOM   8942 N NH2 . ARG I 4 104 ? -7.906  84.364  78.092  1.00 120.22 ? 105 ARG H NH2 1 
ATOM   8943 N N   . THR I 4 105 ? -5.960  85.568  83.932  1.00 138.95 ? 106 THR H N   1 
ATOM   8944 C CA  . THR I 4 105 ? -4.958  86.469  84.519  1.00 144.24 ? 106 THR H CA  1 
ATOM   8945 C C   . THR I 4 105 ? -5.333  86.925  85.938  1.00 148.31 ? 106 THR H C   1 
ATOM   8946 O O   . THR I 4 105 ? -6.510  87.135  86.243  1.00 148.41 ? 106 THR H O   1 
ATOM   8947 C CB  . THR I 4 105 ? -4.741  87.723  83.629  1.00 143.62 ? 106 THR H CB  1 
ATOM   8948 O OG1 . THR I 4 105 ? -4.228  87.320  82.352  1.00 141.75 ? 106 THR H OG1 1 
ATOM   8949 C CG2 . THR I 4 105 ? -3.753  88.687  84.284  1.00 141.80 ? 106 THR H CG2 1 
ATOM   8950 N N   . GLU I 4 106 ? -4.319  87.085  86.790  1.00 151.74 ? 107 GLU H N   1 
ATOM   8951 C CA  . GLU I 4 106 ? -4.502  87.492  88.188  1.00 154.17 ? 107 GLU H CA  1 
ATOM   8952 C C   . GLU I 4 106 ? -4.517  89.011  88.410  1.00 155.95 ? 107 GLU H C   1 
ATOM   8953 O O   . GLU I 4 106 ? -3.467  89.637  88.573  1.00 157.53 ? 107 GLU H O   1 
ATOM   8954 C CB  . GLU I 4 106 ? -3.400  86.856  89.053  1.00 152.40 ? 107 GLU H CB  1 
ATOM   8955 C CG  . GLU I 4 106 ? -3.431  87.222  90.538  1.00 150.11 ? 107 GLU H CG  1 
ATOM   8956 C CD  . GLU I 4 106 ? -4.582  86.578  91.287  1.00 148.88 ? 107 GLU H CD  1 
ATOM   8957 O OE1 . GLU I 4 106 ? -4.670  85.331  91.284  1.00 146.27 ? 107 GLU H OE1 1 
ATOM   8958 O OE2 . GLU I 4 106 ? -5.394  87.318  91.884  1.00 148.12 ? 107 GLU H OE2 1 
ATOM   8959 N N   . ALA I 4 107 ? -5.714  89.593  88.423  1.00 156.16 ? 108 ALA H N   1 
ATOM   8960 C CA  . ALA I 4 107 ? -5.878  91.028  88.645  1.00 155.17 ? 108 ALA H CA  1 
ATOM   8961 C C   . ALA I 4 107 ? -6.885  91.239  89.776  1.00 155.52 ? 108 ALA H C   1 
ATOM   8962 O O   . ALA I 4 107 ? -7.221  90.297  90.497  1.00 155.06 ? 108 ALA H O   1 
ATOM   8963 C CB  . ALA I 4 107 ? -6.365  91.706  87.369  1.00 152.28 ? 108 ALA H CB  1 
ATOM   8964 N N   . LEU I 4 108 ? -7.363  92.470  89.935  1.00 155.64 ? 109 LEU H N   1 
ATOM   8965 C CA  . LEU I 4 108 ? -8.334  92.767  90.984  1.00 156.24 ? 109 LEU H CA  1 
ATOM   8966 C C   . LEU I 4 108 ? -9.777  92.778  90.470  1.00 157.61 ? 109 LEU H C   1 
ATOM   8967 O O   . LEU I 4 108 ? -10.706 93.039  91.238  1.00 159.50 ? 109 LEU H O   1 
ATOM   8968 C CB  . LEU I 4 108 ? -8.017  94.115  91.651  1.00 153.95 ? 109 LEU H CB  1 
ATOM   8969 C CG  . LEU I 4 108 ? -6.792  94.214  92.570  1.00 151.11 ? 109 LEU H CG  1 
ATOM   8970 C CD1 . LEU I 4 108 ? -6.654  95.643  93.085  1.00 147.49 ? 109 LEU H CD1 1 
ATOM   8971 C CD2 . LEU I 4 108 ? -6.934  93.240  93.733  1.00 146.29 ? 109 LEU H CD2 1 
ATOM   8972 N N   . ASN I 4 109 ? -9.964  92.489  89.181  1.00 156.93 ? 110 ASN H N   1 
ATOM   8973 C CA  . ASN I 4 109 ? -11.303 92.471  88.581  1.00 154.25 ? 110 ASN H CA  1 
ATOM   8974 C C   . ASN I 4 109 ? -11.267 92.010  87.113  1.00 152.41 ? 110 ASN H C   1 
ATOM   8975 O O   . ASN I 4 109 ? -10.766 92.727  86.245  1.00 153.44 ? 110 ASN H O   1 
ATOM   8976 C CB  . ASN I 4 109 ? -11.928 93.871  88.673  1.00 153.03 ? 110 ASN H CB  1 
ATOM   8977 C CG  . ASN I 4 109 ? -13.444 93.848  88.596  1.00 152.30 ? 110 ASN H CG  1 
ATOM   8978 O OD1 . ASN I 4 109 ? -14.104 93.185  89.392  1.00 152.36 ? 110 ASN H OD1 1 
ATOM   8979 N ND2 . ASN I 4 109 ? -14.002 94.584  87.642  1.00 152.15 ? 110 ASN H ND2 1 
ATOM   8980 N N   . HIS I 4 110 ? -11.799 90.815  86.849  1.00 149.30 ? 111 HIS H N   1 
ATOM   8981 C CA  . HIS I 4 110 ? -11.847 90.238  85.496  1.00 143.98 ? 111 HIS H CA  1 
ATOM   8982 C C   . HIS I 4 110 ? -12.852 89.078  85.395  1.00 138.15 ? 111 HIS H C   1 
ATOM   8983 O O   . HIS I 4 110 ? -13.345 88.581  86.410  1.00 137.58 ? 111 HIS H O   1 
ATOM   8984 C CB  . HIS I 4 110 ? -10.457 89.731  85.073  1.00 145.03 ? 111 HIS H CB  1 
ATOM   8985 C CG  . HIS I 4 110 ? -9.603  90.766  84.404  1.00 146.08 ? 111 HIS H CG  1 
ATOM   8986 N ND1 . HIS I 4 110 ? -10.014 91.466  83.289  1.00 146.93 ? 111 HIS H ND1 1 
ATOM   8987 C CD2 . HIS I 4 110 ? -8.348  91.199  84.676  1.00 147.04 ? 111 HIS H CD2 1 
ATOM   8988 C CE1 . HIS I 4 110 ? -9.051  92.284  82.904  1.00 147.28 ? 111 HIS H CE1 1 
ATOM   8989 N NE2 . HIS I 4 110 ? -8.029  92.141  83.728  1.00 147.39 ? 111 HIS H NE2 1 
ATOM   8990 N N   . HIS I 4 111 ? -13.149 88.656  84.164  1.00 130.61 ? 112 HIS H N   1 
ATOM   8991 C CA  . HIS I 4 111 ? -14.079 87.549  83.913  1.00 120.31 ? 112 HIS H CA  1 
ATOM   8992 C C   . HIS I 4 111 ? -13.278 86.266  83.652  1.00 111.52 ? 112 HIS H C   1 
ATOM   8993 O O   . HIS I 4 111 ? -12.935 85.944  82.508  1.00 109.25 ? 112 HIS H O   1 
ATOM   8994 C CB  . HIS I 4 111 ? -14.972 87.871  82.709  1.00 120.45 ? 112 HIS H CB  1 
ATOM   8995 C CG  . HIS I 4 111 ? -16.428 87.623  82.955  1.00 121.32 ? 112 HIS H CG  1 
ATOM   8996 N ND1 . HIS I 4 111 ? -16.933 86.373  83.239  1.00 119.89 ? 112 HIS H ND1 1 
ATOM   8997 C CD2 . HIS I 4 111 ? -17.487 88.468  82.970  1.00 122.49 ? 112 HIS H CD2 1 
ATOM   8998 C CE1 . HIS I 4 111 ? -18.240 86.458  83.417  1.00 120.67 ? 112 HIS H CE1 1 
ATOM   8999 N NE2 . HIS I 4 111 ? -18.601 87.719  83.260  1.00 120.76 ? 112 HIS H NE2 1 
ATOM   9000 N N   . ASN I 4 112 ? -12.992 85.540  84.731  1.00 100.69 ? 113 ASN H N   1 
ATOM   9001 C CA  . ASN I 4 112 ? -12.206 84.313  84.669  1.00 83.88  ? 113 ASN H CA  1 
ATOM   9002 C C   . ASN I 4 112 ? -12.967 83.083  85.171  1.00 69.73  ? 113 ASN H C   1 
ATOM   9003 O O   . ASN I 4 112 ? -14.192 83.107  85.319  1.00 63.52  ? 113 ASN H O   1 
ATOM   9004 C CB  . ASN I 4 112 ? -10.932 84.508  85.489  1.00 89.74  ? 113 ASN H CB  1 
ATOM   9005 C CG  . ASN I 4 112 ? -10.390 85.925  85.383  1.00 93.26  ? 113 ASN H CG  1 
ATOM   9006 O OD1 . ASN I 4 112 ? -10.007 86.377  84.304  1.00 98.57  ? 113 ASN H OD1 1 
ATOM   9007 N ND2 . ASN I 4 112 ? -10.368 86.637  86.506  1.00 93.51  ? 113 ASN H ND2 1 
ATOM   9008 N N   . THR I 4 113 ? -12.234 82.007  85.439  1.00 52.45  ? 114 THR H N   1 
ATOM   9009 C CA  . THR I 4 113 ? -12.853 80.776  85.902  1.00 43.95  ? 114 THR H CA  1 
ATOM   9010 C C   . THR I 4 113 ? -12.061 80.041  86.967  1.00 41.26  ? 114 THR H C   1 
ATOM   9011 O O   . THR I 4 113 ? -10.903 79.702  86.764  1.00 43.68  ? 114 THR H O   1 
ATOM   9012 C CB  . THR I 4 113 ? -13.054 79.781  84.746  1.00 37.20  ? 114 THR H CB  1 
ATOM   9013 O OG1 . THR I 4 113 ? -13.896 80.361  83.747  1.00 44.08  ? 114 THR H OG1 1 
ATOM   9014 C CG2 . THR I 4 113 ? -13.698 78.500  85.253  1.00 39.70  ? 114 THR H CG2 1 
ATOM   9015 N N   . LEU I 4 114 ? -12.679 79.804  88.113  1.00 39.54  ? 115 LEU H N   1 
ATOM   9016 C CA  . LEU I 4 114 ? -12.001 79.029  89.135  1.00 41.18  ? 115 LEU H CA  1 
ATOM   9017 C C   . LEU I 4 114 ? -12.388 77.589  88.822  1.00 43.07  ? 115 LEU H C   1 
ATOM   9018 O O   . LEU I 4 114 ? -13.500 77.320  88.376  1.00 44.87  ? 115 LEU H O   1 
ATOM   9019 C CB  . LEU I 4 114 ? -12.494 79.393  90.531  1.00 42.58  ? 115 LEU H CB  1 
ATOM   9020 C CG  . LEU I 4 114 ? -12.168 80.797  91.019  1.00 46.02  ? 115 LEU H CG  1 
ATOM   9021 C CD1 . LEU I 4 114 ? -12.665 80.934  92.441  1.00 41.04  ? 115 LEU H CD1 1 
ATOM   9022 C CD2 . LEU I 4 114 ? -10.662 81.046  90.940  1.00 45.26  ? 115 LEU H CD2 1 
ATOM   9023 N N   . VAL I 4 115 ? -11.470 76.659  89.019  1.00 40.26  ? 116 VAL H N   1 
ATOM   9024 C CA  . VAL I 4 115 ? -11.788 75.271  88.758  1.00 33.67  ? 116 VAL H CA  1 
ATOM   9025 C C   . VAL I 4 115 ? -11.478 74.472  89.989  1.00 30.18  ? 116 VAL H C   1 
ATOM   9026 O O   . VAL I 4 115 ? -10.361 74.529  90.497  1.00 38.18  ? 116 VAL H O   1 
ATOM   9027 C CB  . VAL I 4 115 ? -10.941 74.668  87.614  1.00 36.88  ? 116 VAL H CB  1 
ATOM   9028 C CG1 . VAL I 4 115 ? -11.225 73.162  87.503  1.00 21.36  ? 116 VAL H CG1 1 
ATOM   9029 C CG2 . VAL I 4 115 ? -11.260 75.354  86.311  1.00 29.76  ? 116 VAL H CG2 1 
ATOM   9030 N N   . CYS I 4 116 ? -12.457 73.723  90.474  1.00 32.17  ? 117 CYS H N   1 
ATOM   9031 C CA  . CYS I 4 116 ? -12.206 72.882  91.622  1.00 27.85  ? 117 CYS H CA  1 
ATOM   9032 C C   . CYS I 4 116 ? -12.027 71.451  91.139  1.00 28.45  ? 117 CYS H C   1 
ATOM   9033 O O   . CYS I 4 116 ? -13.003 70.796  90.753  1.00 29.04  ? 117 CYS H O   1 
ATOM   9034 C CB  . CYS I 4 116 ? -13.355 72.934  92.625  1.00 29.18  ? 117 CYS H CB  1 
ATOM   9035 S SG  . CYS I 4 116 ? -12.914 71.995  94.135  1.00 44.82  ? 117 CYS H SG  1 
ATOM   9036 N N   . SER I 4 117 ? -10.783 70.972  91.146  1.00 27.25  ? 118 SER H N   1 
ATOM   9037 C CA  . SER I 4 117 ? -10.483 69.599  90.724  1.00 29.47  ? 118 SER H CA  1 
ATOM   9038 C C   . SER I 4 117 ? -10.557 68.653  91.916  1.00 31.57  ? 118 SER H C   1 
ATOM   9039 O O   . SER I 4 117 ? -9.794  68.788  92.876  1.00 35.19  ? 118 SER H O   1 
ATOM   9040 C CB  . SER I 4 117 ? -9.085  69.508  90.124  1.00 30.75  ? 118 SER H CB  1 
ATOM   9041 O OG  . SER I 4 117 ? -8.913  70.479  89.121  1.00 35.00  ? 118 SER H OG  1 
ATOM   9042 N N   . VAL I 4 118 ? -11.471 67.695  91.834  1.00 28.49  ? 119 VAL H N   1 
ATOM   9043 C CA  . VAL I 4 118 ? -11.690 66.708  92.879  1.00 26.51  ? 119 VAL H CA  1 
ATOM   9044 C C   . VAL I 4 118 ? -11.317 65.354  92.284  1.00 28.88  ? 119 VAL H C   1 
ATOM   9045 O O   . VAL I 4 118 ? -12.123 64.679  91.644  1.00 34.87  ? 119 VAL H O   1 
ATOM   9046 C CB  . VAL I 4 118 ? -13.164 66.758  93.333  1.00 31.27  ? 119 VAL H CB  1 
ATOM   9047 C CG1 . VAL I 4 118 ? -13.424 65.770  94.457  1.00 29.76  ? 119 VAL H CG1 1 
ATOM   9048 C CG2 . VAL I 4 118 ? -13.488 68.173  93.787  1.00 24.59  ? 119 VAL H CG2 1 
ATOM   9049 N N   . THR I 4 119 ? -10.078 64.964  92.546  1.00 29.26  ? 120 THR H N   1 
ATOM   9050 C CA  . THR I 4 119 ? -9.484  63.764  91.989  1.00 25.40  ? 120 THR H CA  1 
ATOM   9051 C C   . THR I 4 119 ? -9.132  62.589  92.912  1.00 27.44  ? 120 THR H C   1 
ATOM   9052 O O   . THR I 4 119 ? -9.069  62.718  94.132  1.00 35.18  ? 120 THR H O   1 
ATOM   9053 C CB  . THR I 4 119 ? -8.188  64.175  91.270  1.00 33.40  ? 120 THR H CB  1 
ATOM   9054 O OG1 . THR I 4 119 ? -7.198  64.520  92.250  1.00 29.78  ? 120 THR H OG1 1 
ATOM   9055 C CG2 . THR I 4 119 ? -8.425  65.416  90.397  1.00 17.57  ? 120 THR H CG2 1 
ATOM   9056 N N   . ASP I 4 120 ? -8.891  61.446  92.276  1.00 25.68  ? 121 ASP H N   1 
ATOM   9057 C CA  . ASP I 4 120 ? -8.458  60.204  92.917  1.00 32.35  ? 121 ASP H CA  1 
ATOM   9058 C C   . ASP I 4 120 ? -9.368  59.559  93.941  1.00 35.81  ? 121 ASP H C   1 
ATOM   9059 O O   . ASP I 4 120 ? -8.898  58.865  94.840  1.00 36.27  ? 121 ASP H O   1 
ATOM   9060 C CB  . ASP I 4 120 ? -7.086  60.417  93.560  1.00 33.19  ? 121 ASP H CB  1 
ATOM   9061 C CG  . ASP I 4 120 ? -6.062  60.973  92.583  1.00 43.93  ? 121 ASP H CG  1 
ATOM   9062 O OD1 . ASP I 4 120 ? -5.997  60.481  91.433  1.00 43.25  ? 121 ASP H OD1 1 
ATOM   9063 O OD2 . ASP I 4 120 ? -5.315  61.897  92.970  1.00 54.82  ? 121 ASP H OD2 1 
ATOM   9064 N N   . PHE I 4 121 ? -10.668 59.755  93.813  1.00 37.29  ? 122 PHE H N   1 
ATOM   9065 C CA  . PHE I 4 121 ? -11.549 59.166  94.789  1.00 35.30  ? 122 PHE H CA  1 
ATOM   9066 C C   . PHE I 4 121 ? -12.236 57.902  94.352  1.00 39.29  ? 122 PHE H C   1 
ATOM   9067 O O   . PHE I 4 121 ? -12.267 57.577  93.173  1.00 34.90  ? 122 PHE H O   1 
ATOM   9068 C CB  . PHE I 4 121 ? -12.593 60.180  95.236  1.00 33.00  ? 122 PHE H CB  1 
ATOM   9069 C CG  . PHE I 4 121 ? -13.440 60.730  94.126  1.00 23.29  ? 122 PHE H CG  1 
ATOM   9070 C CD1 . PHE I 4 121 ? -13.042 61.862  93.429  1.00 24.75  ? 122 PHE H CD1 1 
ATOM   9071 C CD2 . PHE I 4 121 ? -14.696 60.182  93.860  1.00 25.15  ? 122 PHE H CD2 1 
ATOM   9072 C CE1 . PHE I 4 121 ? -13.882 62.454  92.491  1.00 22.51  ? 122 PHE H CE1 1 
ATOM   9073 C CE2 . PHE I 4 121 ? -15.544 60.763  92.929  1.00 19.95  ? 122 PHE H CE2 1 
ATOM   9074 C CZ  . PHE I 4 121 ? -15.134 61.910  92.240  1.00 26.70  ? 122 PHE H CZ  1 
ATOM   9075 N N   . TYR I 4 122 ? -12.785 57.192  95.332  1.00 40.66  ? 123 TYR H N   1 
ATOM   9076 C CA  . TYR I 4 122 ? -13.519 55.958  95.094  1.00 36.66  ? 123 TYR H CA  1 
ATOM   9077 C C   . TYR I 4 122 ? -14.273 55.637  96.373  1.00 38.14  ? 123 TYR H C   1 
ATOM   9078 O O   . TYR I 4 122 ? -13.728 55.771  97.465  1.00 43.82  ? 123 TYR H O   1 
ATOM   9079 C CB  . TYR I 4 122 ? -12.560 54.825  94.741  1.00 32.66  ? 123 TYR H CB  1 
ATOM   9080 C CG  . TYR I 4 122 ? -13.243 53.596  94.185  1.00 30.00  ? 123 TYR H CG  1 
ATOM   9081 C CD1 . TYR I 4 122 ? -13.763 52.605  95.029  1.00 28.53  ? 123 TYR H CD1 1 
ATOM   9082 C CD2 . TYR I 4 122 ? -13.373 53.425  92.810  1.00 29.84  ? 123 TYR H CD2 1 
ATOM   9083 C CE1 . TYR I 4 122 ? -14.395 51.468  94.502  1.00 26.82  ? 123 TYR H CE1 1 
ATOM   9084 C CE2 . TYR I 4 122 ? -14.001 52.302  92.269  1.00 27.39  ? 123 TYR H CE2 1 
ATOM   9085 C CZ  . TYR I 4 122 ? -14.507 51.329  93.110  1.00 36.71  ? 123 TYR H CZ  1 
ATOM   9086 O OH  . TYR I 4 122 ? -15.116 50.233  92.543  1.00 34.74  ? 123 TYR H OH  1 
ATOM   9087 N N   . PRO I 4 123 ? -15.528 55.185  96.260  1.00 40.30  ? 124 PRO H N   1 
ATOM   9088 C CA  . PRO I 4 123 ? -16.257 54.962  95.010  1.00 38.41  ? 124 PRO H CA  1 
ATOM   9089 C C   . PRO I 4 123 ? -16.831 56.234  94.366  1.00 36.29  ? 124 PRO H C   1 
ATOM   9090 O O   . PRO I 4 123 ? -16.450 57.357  94.726  1.00 34.10  ? 124 PRO H O   1 
ATOM   9091 C CB  . PRO I 4 123 ? -17.326 53.953  95.429  1.00 34.95  ? 124 PRO H CB  1 
ATOM   9092 C CG  . PRO I 4 123 ? -17.683 54.437  96.795  1.00 26.95  ? 124 PRO H CG  1 
ATOM   9093 C CD  . PRO I 4 123 ? -16.350 54.800  97.423  1.00 32.79  ? 124 PRO H CD  1 
ATOM   9094 N N   . ALA I 4 124 ? -17.752 56.041  93.422  1.00 34.19  ? 125 ALA H N   1 
ATOM   9095 C CA  . ALA I 4 124 ? -18.362 57.137  92.663  1.00 39.19  ? 125 ALA H CA  1 
ATOM   9096 C C   . ALA I 4 124 ? -19.068 58.255  93.425  1.00 35.71  ? 125 ALA H C   1 
ATOM   9097 O O   . ALA I 4 124 ? -18.793 59.421  93.186  1.00 43.92  ? 125 ALA H O   1 
ATOM   9098 C CB  . ALA I 4 124 ? -19.313 56.560  91.615  1.00 43.20  ? 125 ALA H CB  1 
ATOM   9099 N N   . LYS I 4 125 ? -19.983 57.899  94.319  1.00 37.25  ? 126 LYS H N   1 
ATOM   9100 C CA  . LYS I 4 125 ? -20.752 58.865  95.109  1.00 37.97  ? 126 LYS H CA  1 
ATOM   9101 C C   . LYS I 4 125 ? -19.916 60.056  95.591  1.00 36.84  ? 126 LYS H C   1 
ATOM   9102 O O   . LYS I 4 125 ? -18.917 59.877  96.279  1.00 39.05  ? 126 LYS H O   1 
ATOM   9103 C CB  . LYS I 4 125 ? -21.375 58.146  96.311  1.00 45.29  ? 126 LYS H CB  1 
ATOM   9104 C CG  . LYS I 4 125 ? -22.526 58.867  97.003  1.00 47.44  ? 126 LYS H CG  1 
ATOM   9105 C CD  . LYS I 4 125 ? -22.984 58.076  98.248  1.00 59.03  ? 126 LYS H CD  1 
ATOM   9106 C CE  . LYS I 4 125 ? -24.375 58.484  98.744  1.00 59.63  ? 126 LYS H CE  1 
ATOM   9107 N NZ  . LYS I 4 125 ? -24.497 59.945  98.997  1.00 55.52  ? 126 LYS H NZ  1 
ATOM   9108 N N   . ILE I 4 126 ? -20.320 61.263  95.204  1.00 28.45  ? 127 ILE H N   1 
ATOM   9109 C CA  . ILE I 4 126 ? -19.629 62.483  95.605  1.00 30.88  ? 127 ILE H CA  1 
ATOM   9110 C C   . ILE I 4 126 ? -20.481 63.728  95.349  1.00 30.35  ? 127 ILE H C   1 
ATOM   9111 O O   . ILE I 4 126 ? -21.349 63.723  94.478  1.00 36.67  ? 127 ILE H O   1 
ATOM   9112 C CB  . ILE I 4 126 ? -18.273 62.671  94.865  1.00 32.83  ? 127 ILE H CB  1 
ATOM   9113 C CG1 . ILE I 4 126 ? -17.519 63.854  95.485  1.00 25.45  ? 127 ILE H CG1 1 
ATOM   9114 C CG2 . ILE I 4 126 ? -18.512 62.981  93.379  1.00 31.71  ? 127 ILE H CG2 1 
ATOM   9115 C CD1 . ILE I 4 126 ? -16.038 63.856  95.242  1.00 21.62  ? 127 ILE H CD1 1 
ATOM   9116 N N   . LYS I 4 127 ? -20.224 64.785  96.118  1.00 23.84  ? 128 LYS H N   1 
ATOM   9117 C CA  . LYS I 4 127 ? -20.937 66.051  95.980  1.00 31.04  ? 128 LYS H CA  1 
ATOM   9118 C C   . LYS I 4 127 ? -19.933 67.186  96.074  1.00 24.98  ? 128 LYS H C   1 
ATOM   9119 O O   . LYS I 4 127 ? -19.111 67.217  96.981  1.00 31.33  ? 128 LYS H O   1 
ATOM   9120 C CB  . LYS I 4 127 ? -22.004 66.212  97.071  1.00 38.03  ? 128 LYS H CB  1 
ATOM   9121 C CG  . LYS I 4 127 ? -22.660 67.598  97.075  1.00 46.03  ? 128 LYS H CG  1 
ATOM   9122 C CD  . LYS I 4 127 ? -23.881 67.671  97.981  1.00 49.99  ? 128 LYS H CD  1 
ATOM   9123 C CE  . LYS I 4 127 ? -23.527 67.465  99.438  1.00 49.36  ? 128 LYS H CE  1 
ATOM   9124 N NZ  . LYS I 4 127 ? -24.754 67.400  100.271 1.00 54.42  ? 128 LYS H NZ  1 
ATOM   9125 N N   . VAL I 4 128 ? -20.000 68.124  95.140  1.00 28.43  ? 129 VAL H N   1 
ATOM   9126 C CA  . VAL I 4 128 ? -19.054 69.233  95.121  1.00 21.10  ? 129 VAL H CA  1 
ATOM   9127 C C   . VAL I 4 128 ? -19.824 70.510  94.980  1.00 25.40  ? 129 VAL H C   1 
ATOM   9128 O O   . VAL I 4 128 ? -20.688 70.596  94.129  1.00 34.48  ? 129 VAL H O   1 
ATOM   9129 C CB  . VAL I 4 128 ? -18.098 69.092  93.933  1.00 26.83  ? 129 VAL H CB  1 
ATOM   9130 C CG1 . VAL I 4 128 ? -17.057 70.183  93.956  1.00 23.85  ? 129 VAL H CG1 1 
ATOM   9131 C CG2 . VAL I 4 128 ? -17.453 67.719  93.967  1.00 24.80  ? 129 VAL H CG2 1 
ATOM   9132 N N   . ARG I 4 129 ? -19.525 71.504  95.811  1.00 29.88  ? 130 ARG H N   1 
ATOM   9133 C CA  . ARG I 4 129 ? -20.253 72.761  95.732  1.00 30.39  ? 130 ARG H CA  1 
ATOM   9134 C C   . ARG I 4 129 ? -19.348 73.972  95.891  1.00 32.98  ? 130 ARG H C   1 
ATOM   9135 O O   . ARG I 4 129 ? -18.273 73.878  96.474  1.00 32.31  ? 130 ARG H O   1 
ATOM   9136 C CB  . ARG I 4 129 ? -21.357 72.786  96.785  1.00 29.03  ? 130 ARG H CB  1 
ATOM   9137 C CG  . ARG I 4 129 ? -22.418 71.713  96.596  1.00 33.56  ? 130 ARG H CG  1 
ATOM   9138 C CD  . ARG I 4 129 ? -23.466 71.787  97.713  1.00 47.37  ? 130 ARG H CD  1 
ATOM   9139 N NE  . ARG I 4 129 ? -22.880 71.444  99.002  1.00 49.59  ? 130 ARG H NE  1 
ATOM   9140 C CZ  . ARG I 4 129 ? -23.460 71.647  100.179 1.00 58.27  ? 130 ARG H CZ  1 
ATOM   9141 N NH1 . ARG I 4 129 ? -24.665 72.208  100.252 1.00 54.92  ? 130 ARG H NH1 1 
ATOM   9142 N NH2 . ARG I 4 129 ? -22.836 71.271  101.290 1.00 57.96  ? 130 ARG H NH2 1 
ATOM   9143 N N   . TRP I 4 130 ? -19.794 75.111  95.365  1.00 32.03  ? 131 TRP H N   1 
ATOM   9144 C CA  . TRP I 4 130 ? -19.028 76.355  95.433  1.00 34.18  ? 131 TRP H CA  1 
ATOM   9145 C C   . TRP I 4 130 ? -19.664 77.410  96.352  1.00 33.98  ? 131 TRP H C   1 
ATOM   9146 O O   . TRP I 4 130 ? -20.883 77.592  96.353  1.00 32.80  ? 131 TRP H O   1 
ATOM   9147 C CB  . TRP I 4 130 ? -18.902 76.972  94.035  1.00 28.73  ? 131 TRP H CB  1 
ATOM   9148 C CG  . TRP I 4 130 ? -17.751 76.494  93.220  1.00 36.93  ? 131 TRP H CG  1 
ATOM   9149 C CD1 . TRP I 4 130 ? -17.802 75.712  92.101  1.00 38.17  ? 131 TRP H CD1 1 
ATOM   9150 C CD2 . TRP I 4 130 ? -16.372 76.824  93.412  1.00 37.00  ? 131 TRP H CD2 1 
ATOM   9151 N NE1 . TRP I 4 130 ? -16.541 75.541  91.580  1.00 29.11  ? 131 TRP H NE1 1 
ATOM   9152 C CE2 . TRP I 4 130 ? -15.645 76.215  92.363  1.00 30.61  ? 131 TRP H CE2 1 
ATOM   9153 C CE3 . TRP I 4 130 ? -15.681 77.591  94.357  1.00 27.73  ? 131 TRP H CE3 1 
ATOM   9154 C CZ2 . TRP I 4 130 ? -14.262 76.333  92.246  1.00 28.47  ? 131 TRP H CZ2 1 
ATOM   9155 C CZ3 . TRP I 4 130 ? -14.307 77.712  94.236  1.00 29.83  ? 131 TRP H CZ3 1 
ATOM   9156 C CH2 . TRP I 4 130 ? -13.612 77.087  93.182  1.00 31.10  ? 131 TRP H CH2 1 
ATOM   9157 N N   . PHE I 4 131 ? -18.844 78.104  97.134  1.00 28.05  ? 132 PHE H N   1 
ATOM   9158 C CA  . PHE I 4 131 ? -19.371 79.167  97.977  1.00 27.46  ? 132 PHE H CA  1 
ATOM   9159 C C   . PHE I 4 131 ? -18.559 80.425  97.766  1.00 31.88  ? 132 PHE H C   1 
ATOM   9160 O O   . PHE I 4 131 ? -17.375 80.359  97.459  1.00 33.64  ? 132 PHE H O   1 
ATOM   9161 C CB  . PHE I 4 131 ? -19.345 78.800  99.455  1.00 22.72  ? 132 PHE H CB  1 
ATOM   9162 C CG  . PHE I 4 131 ? -20.255 77.676  99.812  1.00 24.37  ? 132 PHE H CG  1 
ATOM   9163 C CD1 . PHE I 4 131 ? -19.869 76.358  99.595  1.00 23.84  ? 132 PHE H CD1 1 
ATOM   9164 C CD2 . PHE I 4 131 ? -21.520 77.934  100.345 1.00 31.42  ? 132 PHE H CD2 1 
ATOM   9165 C CE1 . PHE I 4 131 ? -20.733 75.308  99.903  1.00 30.62  ? 132 PHE H CE1 1 
ATOM   9166 C CE2 . PHE I 4 131 ? -22.394 76.892  100.658 1.00 26.29  ? 132 PHE H CE2 1 
ATOM   9167 C CZ  . PHE I 4 131 ? -22.001 75.575  100.438 1.00 22.46  ? 132 PHE H CZ  1 
ATOM   9168 N N   . ARG I 4 132 ? -19.228 81.565  97.903  1.00 39.92  ? 133 ARG H N   1 
ATOM   9169 C CA  . ARG I 4 132 ? -18.632 82.888  97.754  1.00 43.51  ? 133 ARG H CA  1 
ATOM   9170 C C   . ARG I 4 132 ? -19.024 83.600  99.050  1.00 47.18  ? 133 ARG H C   1 
ATOM   9171 O O   . ARG I 4 132 ? -20.210 83.811  99.324  1.00 39.11  ? 133 ARG H O   1 
ATOM   9172 C CB  . ARG I 4 132 ? -19.221 83.592  96.526  1.00 41.59  ? 133 ARG H CB  1 
ATOM   9173 C CG  . ARG I 4 132 ? -18.790 85.034  96.340  1.00 50.97  ? 133 ARG H CG  1 
ATOM   9174 C CD  . ARG I 4 132 ? -19.338 85.588  95.030  1.00 60.65  ? 133 ARG H CD  1 
ATOM   9175 N NE  . ARG I 4 132 ? -19.440 87.047  95.049  1.00 80.20  ? 133 ARG H NE  1 
ATOM   9176 C CZ  . ARG I 4 132 ? -20.430 87.727  95.626  1.00 87.55  ? 133 ARG H CZ  1 
ATOM   9177 N NH1 . ARG I 4 132 ? -21.417 87.080  96.234  1.00 90.28  ? 133 ARG H NH1 1 
ATOM   9178 N NH2 . ARG I 4 132 ? -20.433 89.057  95.603  1.00 87.68  ? 133 ARG H NH2 1 
ATOM   9179 N N   . ASN I 4 133 ? -18.022 83.927  99.859  1.00 42.95  ? 134 ASN H N   1 
ATOM   9180 C CA  . ASN I 4 133 ? -18.246 84.562  101.147 1.00 43.15  ? 134 ASN H CA  1 
ATOM   9181 C C   . ASN I 4 133 ? -19.291 83.788  101.941 1.00 47.63  ? 134 ASN H C   1 
ATOM   9182 O O   . ASN I 4 133 ? -20.235 84.370  102.483 1.00 53.48  ? 134 ASN H O   1 
ATOM   9183 C CB  . ASN I 4 133 ? -18.690 86.013  100.966 1.00 48.15  ? 134 ASN H CB  1 
ATOM   9184 C CG  . ASN I 4 133 ? -17.710 86.819  100.127 1.00 53.20  ? 134 ASN H CG  1 
ATOM   9185 O OD1 . ASN I 4 133 ? -16.493 86.725  100.305 1.00 52.32  ? 134 ASN H OD1 1 
ATOM   9186 N ND2 . ASN I 4 133 ? -18.239 87.619  99.208  1.00 58.34  ? 134 ASN H ND2 1 
ATOM   9187 N N   . GLY I 4 134 ? -19.132 82.468  101.987 1.00 42.73  ? 135 GLY H N   1 
ATOM   9188 C CA  . GLY I 4 134 ? -20.055 81.636  102.739 1.00 39.76  ? 135 GLY H CA  1 
ATOM   9189 C C   . GLY I 4 134 ? -21.435 81.400  102.151 1.00 46.45  ? 135 GLY H C   1 
ATOM   9190 O O   . GLY I 4 134 ? -22.263 80.716  102.766 1.00 43.04  ? 135 GLY H O   1 
ATOM   9191 N N   . GLN I 4 135 ? -21.701 81.963  100.976 1.00 37.07  ? 136 GLN H N   1 
ATOM   9192 C CA  . GLN I 4 135 ? -22.999 81.763  100.325 1.00 40.36  ? 136 GLN H CA  1 
ATOM   9193 C C   . GLN I 4 135 ? -22.839 80.836  99.117  1.00 36.73  ? 136 GLN H C   1 
ATOM   9194 O O   . GLN I 4 135 ? -21.864 80.950  98.372  1.00 32.71  ? 136 GLN H O   1 
ATOM   9195 C CB  . GLN I 4 135 ? -23.569 83.113  99.893  1.00 51.32  ? 136 GLN H CB  1 
ATOM   9196 C CG  . GLN I 4 135 ? -23.923 84.021  101.070 1.00 57.12  ? 136 GLN H CG  1 
ATOM   9197 C CD  . GLN I 4 135 ? -24.981 83.394  101.961 1.00 66.28  ? 136 GLN H CD  1 
ATOM   9198 O OE1 . GLN I 4 135 ? -26.104 83.129  101.517 1.00 68.09  ? 136 GLN H OE1 1 
ATOM   9199 N NE2 . GLN I 4 135 ? -24.628 83.142  103.220 1.00 66.12  ? 136 GLN H NE2 1 
ATOM   9200 N N   . GLU I 4 136 ? -23.777 79.919  98.907  1.00 28.15  ? 137 GLU H N   1 
ATOM   9201 C CA  . GLU I 4 136 ? -23.622 79.022  97.773  1.00 29.19  ? 137 GLU H CA  1 
ATOM   9202 C C   . GLU I 4 136 ? -23.830 79.659  96.401  1.00 30.37  ? 137 GLU H C   1 
ATOM   9203 O O   . GLU I 4 136 ? -24.792 80.383  96.180  1.00 31.92  ? 137 GLU H O   1 
ATOM   9204 C CB  . GLU I 4 136 ? -24.532 77.801  97.887  1.00 29.41  ? 137 GLU H CB  1 
ATOM   9205 C CG  . GLU I 4 136 ? -23.826 76.556  97.364  1.00 29.29  ? 137 GLU H CG  1 
ATOM   9206 C CD  . GLU I 4 136 ? -24.750 75.401  97.051  1.00 41.24  ? 137 GLU H CD  1 
ATOM   9207 O OE1 . GLU I 4 136 ? -25.751 75.209  97.770  1.00 45.99  ? 137 GLU H OE1 1 
ATOM   9208 O OE2 . GLU I 4 136 ? -24.457 74.668  96.083  1.00 49.08  ? 137 GLU H OE2 1 
ATOM   9209 N N   . GLU I 4 137 ? -22.901 79.381  95.493  1.00 27.74  ? 138 GLU H N   1 
ATOM   9210 C CA  . GLU I 4 137 ? -22.959 79.870  94.125  1.00 32.34  ? 138 GLU H CA  1 
ATOM   9211 C C   . GLU I 4 137 ? -23.421 78.744  93.207  1.00 31.81  ? 138 GLU H C   1 
ATOM   9212 O O   . GLU I 4 137 ? -22.794 77.697  93.143  1.00 31.39  ? 138 GLU H O   1 
ATOM   9213 C CB  . GLU I 4 137 ? -21.585 80.350  93.674  1.00 37.32  ? 138 GLU H CB  1 
ATOM   9214 C CG  . GLU I 4 137 ? -21.229 81.748  94.158  1.00 57.37  ? 138 GLU H CG  1 
ATOM   9215 C CD  . GLU I 4 137 ? -21.725 82.849  93.225  1.00 62.51  ? 138 GLU H CD  1 
ATOM   9216 O OE1 . GLU I 4 137 ? -22.808 82.685  92.600  1.00 54.41  ? 138 GLU H OE1 1 
ATOM   9217 O OE2 . GLU I 4 137 ? -21.021 83.884  93.134  1.00 69.53  ? 138 GLU H OE2 1 
ATOM   9218 N N   . THR I 4 138 ? -24.527 78.940  92.508  1.00 28.29  ? 139 THR H N   1 
ATOM   9219 C CA  . THR I 4 138 ? -24.977 77.897  91.609  1.00 34.16  ? 139 THR H CA  1 
ATOM   9220 C C   . THR I 4 138 ? -25.049 78.368  90.173  1.00 33.48  ? 139 THR H C   1 
ATOM   9221 O O   . THR I 4 138 ? -25.042 77.550  89.264  1.00 34.71  ? 139 THR H O   1 
ATOM   9222 C CB  . THR I 4 138 ? -26.374 77.360  91.985  1.00 33.86  ? 139 THR H CB  1 
ATOM   9223 O OG1 . THR I 4 138 ? -27.287 78.457  92.117  1.00 35.36  ? 139 THR H OG1 1 
ATOM   9224 C CG2 . THR I 4 138 ? -26.313 76.563  93.274  1.00 37.75  ? 139 THR H CG2 1 
ATOM   9225 N N   . VAL I 4 139 ? -25.098 79.684  89.980  1.00 38.84  ? 140 VAL H N   1 
ATOM   9226 C CA  . VAL I 4 139 ? -25.238 80.266  88.656  1.00 34.48  ? 140 VAL H CA  1 
ATOM   9227 C C   . VAL I 4 139 ? -24.122 80.112  87.625  1.00 39.99  ? 140 VAL H C   1 
ATOM   9228 O O   . VAL I 4 139 ? -24.350 79.508  86.578  1.00 51.58  ? 140 VAL H O   1 
ATOM   9229 C CB  . VAL I 4 139 ? -25.681 81.728  88.783  1.00 33.59  ? 140 VAL H CB  1 
ATOM   9230 C CG1 . VAL I 4 139 ? -25.562 82.461  87.446  1.00 31.91  ? 140 VAL H CG1 1 
ATOM   9231 C CG2 . VAL I 4 139 ? -27.147 81.738  89.232  1.00 22.40  ? 140 VAL H CG2 1 
ATOM   9232 N N   . GLY I 4 140 ? -22.929 80.623  87.845  1.00 26.14  ? 141 GLY H N   1 
ATOM   9233 C CA  . GLY I 4 140 ? -21.947 80.388  86.783  1.00 37.08  ? 141 GLY H CA  1 
ATOM   9234 C C   . GLY I 4 140 ? -21.143 79.132  87.073  1.00 32.33  ? 141 GLY H C   1 
ATOM   9235 O O   . GLY I 4 140 ? -19.916 79.122  86.974  1.00 35.75  ? 141 GLY H O   1 
ATOM   9236 N N   . VAL I 4 141 ? -21.859 78.060  87.394  1.00 34.84  ? 142 VAL H N   1 
ATOM   9237 C CA  . VAL I 4 141 ? -21.256 76.810  87.823  1.00 26.56  ? 142 VAL H CA  1 
ATOM   9238 C C   . VAL I 4 141 ? -21.545 75.592  86.984  1.00 28.21  ? 142 VAL H C   1 
ATOM   9239 O O   . VAL I 4 141 ? -22.697 75.276  86.737  1.00 31.22  ? 142 VAL H O   1 
ATOM   9240 C CB  . VAL I 4 141 ? -21.731 76.495  89.264  1.00 27.78  ? 142 VAL H CB  1 
ATOM   9241 C CG1 . VAL I 4 141 ? -21.250 75.134  89.711  1.00 22.69  ? 142 VAL H CG1 1 
ATOM   9242 C CG2 . VAL I 4 141 ? -21.251 77.582  90.205  1.00 35.40  ? 142 VAL H CG2 1 
ATOM   9243 N N   . SER I 4 142 ? -20.496 74.878  86.589  1.00 21.78  ? 143 SER H N   1 
ATOM   9244 C CA  . SER I 4 142 ? -20.699 73.674  85.815  1.00 29.66  ? 143 SER H CA  1 
ATOM   9245 C C   . SER I 4 142 ? -19.638 72.649  86.141  1.00 26.19  ? 143 SER H C   1 
ATOM   9246 O O   . SER I 4 142 ? -18.463 72.967  86.298  1.00 30.15  ? 143 SER H O   1 
ATOM   9247 C CB  . SER I 4 142 ? -20.722 73.979  84.300  1.00 34.44  ? 143 SER H CB  1 
ATOM   9248 O OG  . SER I 4 142 ? -19.456 74.337  83.791  1.00 44.95  ? 143 SER H OG  1 
ATOM   9249 N N   . SER I 4 143 ? -20.066 71.408  86.267  1.00 22.32  ? 144 SER H N   1 
ATOM   9250 C CA  . SER I 4 143 ? -19.130 70.348  86.557  1.00 32.53  ? 144 SER H CA  1 
ATOM   9251 C C   . SER I 4 143 ? -19.176 69.306  85.463  1.00 32.21  ? 144 SER H C   1 
ATOM   9252 O O   . SER I 4 143 ? -20.174 69.133  84.777  1.00 31.95  ? 144 SER H O   1 
ATOM   9253 C CB  . SER I 4 143 ? -19.474 69.672  87.879  1.00 40.50  ? 144 SER H CB  1 
ATOM   9254 O OG  . SER I 4 143 ? -20.698 68.978  87.765  1.00 33.90  ? 144 SER H OG  1 
ATOM   9255 N N   . THR I 4 144 ? -18.069 68.619  85.295  1.00 30.30  ? 145 THR H N   1 
ATOM   9256 C CA  . THR I 4 144 ? -18.006 67.562  84.317  1.00 32.17  ? 145 THR H CA  1 
ATOM   9257 C C   . THR I 4 144 ? -18.854 66.419  84.873  1.00 35.69  ? 145 THR H C   1 
ATOM   9258 O O   . THR I 4 144 ? -19.340 66.488  85.998  1.00 31.79  ? 145 THR H O   1 
ATOM   9259 C CB  . THR I 4 144 ? -16.590 67.043  84.192  1.00 30.52  ? 145 THR H CB  1 
ATOM   9260 O OG1 . THR I 4 144 ? -16.239 66.352  85.400  1.00 30.60  ? 145 THR H OG1 1 
ATOM   9261 C CG2 . THR I 4 144 ? -15.627 68.194  83.963  1.00 18.52  ? 145 THR H CG2 1 
ATOM   9262 N N   . GLN I 4 145 ? -19.075 65.390  84.066  1.00 39.27  ? 146 GLN H N   1 
ATOM   9263 C CA  . GLN I 4 145 ? -19.780 64.228  84.576  1.00 32.96  ? 146 GLN H CA  1 
ATOM   9264 C C   . GLN I 4 145 ? -18.651 63.458  85.246  1.00 35.07  ? 146 GLN H C   1 
ATOM   9265 O O   . GLN I 4 145 ? -17.497 63.887  85.200  1.00 35.91  ? 146 GLN H O   1 
ATOM   9266 C CB  . GLN I 4 145 ? -20.414 63.382  83.463  1.00 37.62  ? 146 GLN H CB  1 
ATOM   9267 C CG  . GLN I 4 145 ? -21.765 63.920  82.980  1.00 50.63  ? 146 GLN H CG  1 
ATOM   9268 C CD  . GLN I 4 145 ? -22.407 63.102  81.827  1.00 58.03  ? 146 GLN H CD  1 
ATOM   9269 O OE1 . GLN I 4 145 ? -22.150 63.374  80.670  1.00 62.99  ? 146 GLN H OE1 1 
ATOM   9270 N NE2 . GLN I 4 145 ? -23.234 62.113  82.154  1.00 57.12  ? 146 GLN H NE2 1 
ATOM   9271 N N   . LEU I 4 146 ? -18.971 62.345  85.885  1.00 33.22  ? 147 LEU H N   1 
ATOM   9272 C CA  . LEU I 4 146 ? -17.951 61.567  86.557  1.00 28.53  ? 147 LEU H CA  1 
ATOM   9273 C C   . LEU I 4 146 ? -16.942 61.102  85.514  1.00 36.35  ? 147 LEU H C   1 
ATOM   9274 O O   . LEU I 4 146 ? -17.317 60.576  84.470  1.00 38.65  ? 147 LEU H O   1 
ATOM   9275 C CB  . LEU I 4 146 ? -18.584 60.362  87.265  1.00 30.86  ? 147 LEU H CB  1 
ATOM   9276 C CG  . LEU I 4 146 ? -17.763 59.644  88.349  1.00 36.69  ? 147 LEU H CG  1 
ATOM   9277 C CD1 . LEU I 4 146 ? -17.486 60.571  89.528  1.00 21.43  ? 147 LEU H CD1 1 
ATOM   9278 C CD2 . LEU I 4 146 ? -18.521 58.416  88.826  1.00 43.96  ? 147 LEU H CD2 1 
ATOM   9279 N N   . ILE I 4 147 ? -15.664 61.315  85.798  1.00 33.66  ? 148 ILE H N   1 
ATOM   9280 C CA  . ILE I 4 147 ? -14.604 60.913  84.894  1.00 27.06  ? 148 ILE H CA  1 
ATOM   9281 C C   . ILE I 4 147 ? -13.944 59.660  85.465  1.00 35.05  ? 148 ILE H C   1 
ATOM   9282 O O   . ILE I 4 147 ? -13.428 59.675  86.581  1.00 33.95  ? 148 ILE H O   1 
ATOM   9283 C CB  . ILE I 4 147 ? -13.556 62.035  84.758  1.00 27.17  ? 148 ILE H CB  1 
ATOM   9284 C CG1 . ILE I 4 147 ? -14.221 63.301  84.225  1.00 26.16  ? 148 ILE H CG1 1 
ATOM   9285 C CG2 . ILE I 4 147 ? -12.448 61.602  83.842  1.00 22.88  ? 148 ILE H CG2 1 
ATOM   9286 C CD1 . ILE I 4 147 ? -13.287 64.474  84.118  1.00 25.27  ? 148 ILE H CD1 1 
ATOM   9287 N N   . ARG I 4 148 ? -13.982 58.571  84.701  1.00 37.05  ? 149 ARG H N   1 
ATOM   9288 C CA  . ARG I 4 148 ? -13.394 57.305  85.129  1.00 35.03  ? 149 ARG H CA  1 
ATOM   9289 C C   . ARG I 4 148 ? -11.943 57.291  84.666  1.00 34.70  ? 149 ARG H C   1 
ATOM   9290 O O   . ARG I 4 148 ? -11.671 57.376  83.474  1.00 43.18  ? 149 ARG H O   1 
ATOM   9291 C CB  . ARG I 4 148 ? -14.178 56.141  84.515  1.00 31.00  ? 149 ARG H CB  1 
ATOM   9292 C CG  . ARG I 4 148 ? -13.753 54.752  84.980  1.00 37.92  ? 149 ARG H CG  1 
ATOM   9293 C CD  . ARG I 4 148 ? -14.637 53.694  84.350  1.00 38.10  ? 149 ARG H CD  1 
ATOM   9294 N NE  . ARG I 4 148 ? -16.013 53.829  84.804  1.00 53.61  ? 149 ARG H NE  1 
ATOM   9295 C CZ  . ARG I 4 148 ? -16.502 53.240  85.893  1.00 63.87  ? 149 ARG H CZ  1 
ATOM   9296 N NH1 . ARG I 4 148 ? -15.718 52.464  86.633  1.00 64.70  ? 149 ARG H NH1 1 
ATOM   9297 N NH2 . ARG I 4 148 ? -17.769 53.439  86.252  1.00 55.43  ? 149 ARG H NH2 1 
ATOM   9298 N N   . ASN I 4 149 ? -11.011 57.185  85.604  1.00 25.58  ? 150 ASN H N   1 
ATOM   9299 C CA  . ASN I 4 149 ? -9.602  57.206  85.250  1.00 27.13  ? 150 ASN H CA  1 
ATOM   9300 C C   . ASN I 4 149 ? -9.126  55.855  84.730  1.00 30.09  ? 150 ASN H C   1 
ATOM   9301 O O   . ASN I 4 149 ? -8.076  55.752  84.099  1.00 27.17  ? 150 ASN H O   1 
ATOM   9302 C CB  . ASN I 4 149 ? -8.769  57.649  86.454  1.00 29.61  ? 150 ASN H CB  1 
ATOM   9303 C CG  . ASN I 4 149 ? -8.991  59.117  86.826  1.00 36.92  ? 150 ASN H CG  1 
ATOM   9304 O OD1 . ASN I 4 149 ? -8.906  59.484  87.998  1.00 45.12  ? 150 ASN H OD1 1 
ATOM   9305 N ND2 . ASN I 4 149 ? -9.259  59.960  85.832  1.00 37.89  ? 150 ASN H ND2 1 
ATOM   9306 N N   . GLY I 4 150 ? -9.918  54.821  84.983  1.00 38.89  ? 151 GLY H N   1 
ATOM   9307 C CA  . GLY I 4 150 ? -9.576  53.487  84.517  1.00 36.99  ? 151 GLY H CA  1 
ATOM   9308 C C   . GLY I 4 150 ? -8.586  52.774  85.405  1.00 33.28  ? 151 GLY H C   1 
ATOM   9309 O O   . GLY I 4 150 ? -8.233  51.630  85.148  1.00 38.82  ? 151 GLY H O   1 
ATOM   9310 N N   . ASP I 4 151 ? -8.147  53.453  86.456  1.00 34.22  ? 152 ASP H N   1 
ATOM   9311 C CA  . ASP I 4 151 ? -7.177  52.905  87.401  1.00 35.04  ? 152 ASP H CA  1 
ATOM   9312 C C   . ASP I 4 151 ? -7.828  52.705  88.784  1.00 35.27  ? 152 ASP H C   1 
ATOM   9313 O O   . ASP I 4 151 ? -7.139  52.588  89.801  1.00 33.25  ? 152 ASP H O   1 
ATOM   9314 C CB  . ASP I 4 151 ? -6.019  53.882  87.525  1.00 27.43  ? 152 ASP H CB  1 
ATOM   9315 C CG  . ASP I 4 151 ? -6.433  55.161  88.238  1.00 38.33  ? 152 ASP H CG  1 
ATOM   9316 O OD1 . ASP I 4 151 ? -7.662  55.400  88.336  1.00 36.71  ? 152 ASP H OD1 1 
ATOM   9317 O OD2 . ASP I 4 151 ? -5.545  55.916  88.699  1.00 35.05  ? 152 ASP H OD2 1 
ATOM   9318 N N   . TRP I 4 152 ? -9.157  52.677  88.796  1.00 30.79  ? 153 TRP H N   1 
ATOM   9319 C CA  . TRP I 4 152 ? -9.964  52.500  89.999  1.00 36.85  ? 153 TRP H CA  1 
ATOM   9320 C C   . TRP I 4 152 ? -10.076 53.753  90.858  1.00 36.06  ? 153 TRP H C   1 
ATOM   9321 O O   . TRP I 4 152 ? -10.098 53.681  92.095  1.00 35.38  ? 153 TRP H O   1 
ATOM   9322 C CB  . TRP I 4 152 ? -9.479  51.316  90.861  1.00 32.79  ? 153 TRP H CB  1 
ATOM   9323 C CG  . TRP I 4 152 ? -9.717  49.970  90.250  1.00 32.41  ? 153 TRP H CG  1 
ATOM   9324 C CD1 . TRP I 4 152 ? -8.988  49.386  89.256  1.00 40.17  ? 153 TRP H CD1 1 
ATOM   9325 C CD2 . TRP I 4 152 ? -10.761 49.039  90.574  1.00 36.05  ? 153 TRP H CD2 1 
ATOM   9326 N NE1 . TRP I 4 152 ? -9.505  48.151  88.938  1.00 36.96  ? 153 TRP H NE1 1 
ATOM   9327 C CE2 . TRP I 4 152 ? -10.594 47.911  89.731  1.00 40.14  ? 153 TRP H CE2 1 
ATOM   9328 C CE3 . TRP I 4 152 ? -11.820 49.045  91.487  1.00 33.93  ? 153 TRP H CE3 1 
ATOM   9329 C CZ2 . TRP I 4 152 ? -11.447 46.802  89.778  1.00 31.58  ? 153 TRP H CZ2 1 
ATOM   9330 C CZ3 . TRP I 4 152 ? -12.669 47.943  91.533  1.00 35.36  ? 153 TRP H CZ3 1 
ATOM   9331 C CH2 . TRP I 4 152 ? -12.474 46.836  90.682  1.00 29.72  ? 153 TRP H CH2 1 
ATOM   9332 N N   . THR I 4 153 ? -10.125 54.897  90.187  1.00 27.69  ? 154 THR H N   1 
ATOM   9333 C CA  . THR I 4 153 ? -10.328 56.180  90.842  1.00 26.05  ? 154 THR H CA  1 
ATOM   9334 C C   . THR I 4 153 ? -11.135 57.035  89.874  1.00 33.46  ? 154 THR H C   1 
ATOM   9335 O O   . THR I 4 153 ? -11.237 56.725  88.688  1.00 35.05  ? 154 THR H O   1 
ATOM   9336 C CB  . THR I 4 153 ? -9.009  56.927  91.188  1.00 30.17  ? 154 THR H CB  1 
ATOM   9337 O OG1 . THR I 4 153 ? -8.344  57.333  89.987  1.00 35.76  ? 154 THR H OG1 1 
ATOM   9338 C CG2 . THR I 4 153 ? -8.083  56.039  92.023  1.00 25.74  ? 154 THR H CG2 1 
ATOM   9339 N N   . PHE I 4 154 ? -11.714 58.108  90.392  1.00 31.70  ? 155 PHE H N   1 
ATOM   9340 C CA  . PHE I 4 154 ? -12.515 59.021  89.607  1.00 24.54  ? 155 PHE H CA  1 
ATOM   9341 C C   . PHE I 4 154 ? -12.049 60.442  89.883  1.00 31.91  ? 155 PHE H C   1 
ATOM   9342 O O   . PHE I 4 154 ? -11.270 60.696  90.798  1.00 29.17  ? 155 PHE H O   1 
ATOM   9343 C CB  . PHE I 4 154 ? -13.976 58.953  90.033  1.00 30.84  ? 155 PHE H CB  1 
ATOM   9344 C CG  . PHE I 4 154 ? -14.621 57.634  89.797  1.00 41.17  ? 155 PHE H CG  1 
ATOM   9345 C CD1 . PHE I 4 154 ? -15.088 57.293  88.533  1.00 40.61  ? 155 PHE H CD1 1 
ATOM   9346 C CD2 . PHE I 4 154 ? -14.782 56.735  90.842  1.00 36.65  ? 155 PHE H CD2 1 
ATOM   9347 C CE1 . PHE I 4 154 ? -15.709 56.074  88.317  1.00 41.02  ? 155 PHE H CE1 1 
ATOM   9348 C CE2 . PHE I 4 154 ? -15.400 55.517  90.633  1.00 38.24  ? 155 PHE H CE2 1 
ATOM   9349 C CZ  . PHE I 4 154 ? -15.866 55.184  89.370  1.00 40.44  ? 155 PHE H CZ  1 
ATOM   9350 N N   . GLN I 4 155 ? -12.537 61.365  89.075  1.00 28.32  ? 156 GLN H N   1 
ATOM   9351 C CA  . GLN I 4 155 ? -12.251 62.759  89.276  1.00 30.56  ? 156 GLN H CA  1 
ATOM   9352 C C   . GLN I 4 155 ? -13.451 63.459  88.681  1.00 30.70  ? 156 GLN H C   1 
ATOM   9353 O O   . GLN I 4 155 ? -14.181 62.882  87.872  1.00 32.26  ? 156 GLN H O   1 
ATOM   9354 C CB  . GLN I 4 155 ? -10.953 63.183  88.589  1.00 32.93  ? 156 GLN H CB  1 
ATOM   9355 C CG  . GLN I 4 155 ? -10.921 63.055  87.096  1.00 32.61  ? 156 GLN H CG  1 
ATOM   9356 C CD  . GLN I 4 155 ? -9.650  63.641  86.518  1.00 32.28  ? 156 GLN H CD  1 
ATOM   9357 O OE1 . GLN I 4 155 ? -9.468  64.849  86.521  1.00 31.69  ? 156 GLN H OE1 1 
ATOM   9358 N NE2 . GLN I 4 155 ? -8.755  62.779  86.032  1.00 28.64  ? 156 GLN H NE2 1 
ATOM   9359 N N   . VAL I 4 156 ? -13.687 64.678  89.128  1.00 33.28  ? 157 VAL H N   1 
ATOM   9360 C CA  . VAL I 4 156 ? -14.797 65.467  88.629  1.00 37.21  ? 157 VAL H CA  1 
ATOM   9361 C C   . VAL I 4 156 ? -14.286 66.887  88.716  1.00 35.17  ? 157 VAL H C   1 
ATOM   9362 O O   . VAL I 4 156 ? -13.660 67.246  89.706  1.00 41.06  ? 157 VAL H O   1 
ATOM   9363 C CB  . VAL I 4 156 ? -16.055 65.318  89.516  1.00 40.71  ? 157 VAL H CB  1 
ATOM   9364 C CG1 . VAL I 4 156 ? -15.777 65.835  90.927  1.00 45.54  ? 157 VAL H CG1 1 
ATOM   9365 C CG2 . VAL I 4 156 ? -17.200 66.086  88.911  1.00 42.79  ? 157 VAL H CG2 1 
ATOM   9366 N N   . LEU I 4 157 ? -14.521 67.686  87.686  1.00 29.87  ? 158 LEU H N   1 
ATOM   9367 C CA  . LEU I 4 157 ? -14.051 69.063  87.711  1.00 27.92  ? 158 LEU H CA  1 
ATOM   9368 C C   . LEU I 4 157 ? -15.251 69.981  87.788  1.00 27.00  ? 158 LEU H C   1 
ATOM   9369 O O   . LEU I 4 157 ? -16.242 69.759  87.099  1.00 26.03  ? 158 LEU H O   1 
ATOM   9370 C CB  . LEU I 4 157 ? -13.245 69.381  86.455  1.00 29.53  ? 158 LEU H CB  1 
ATOM   9371 C CG  . LEU I 4 157 ? -12.113 68.425  86.053  1.00 39.25  ? 158 LEU H CG  1 
ATOM   9372 C CD1 . LEU I 4 157 ? -11.449 68.995  84.811  1.00 42.57  ? 158 LEU H CD1 1 
ATOM   9373 C CD2 . LEU I 4 157 ? -11.087 68.251  87.172  1.00 38.72  ? 158 LEU H CD2 1 
ATOM   9374 N N   . VAL I 4 158 ? -15.176 71.005  88.632  1.00 22.50  ? 159 VAL H N   1 
ATOM   9375 C CA  . VAL I 4 158 ? -16.292 71.924  88.749  1.00 24.06  ? 159 VAL H CA  1 
ATOM   9376 C C   . VAL I 4 158 ? -15.811 73.347  88.567  1.00 23.66  ? 159 VAL H C   1 
ATOM   9377 O O   . VAL I 4 158 ? -14.929 73.822  89.275  1.00 31.47  ? 159 VAL H O   1 
ATOM   9378 C CB  . VAL I 4 158 ? -17.006 71.740  90.086  1.00 24.09  ? 159 VAL H CB  1 
ATOM   9379 C CG1 . VAL I 4 158 ? -18.319 72.482  90.057  1.00 25.25  ? 159 VAL H CG1 1 
ATOM   9380 C CG2 . VAL I 4 158 ? -17.241 70.243  90.338  1.00 15.96  ? 159 VAL H CG2 1 
ATOM   9381 N N   . MET I 4 159 ? -16.379 74.014  87.574  1.00 27.57  ? 160 MET H N   1 
ATOM   9382 C CA  . MET I 4 159 ? -15.979 75.375  87.229  1.00 30.30  ? 160 MET H CA  1 
ATOM   9383 C C   . MET I 4 159 ? -16.953 76.428  87.738  1.00 27.84  ? 160 MET H C   1 
ATOM   9384 O O   . MET I 4 159 ? -18.155 76.190  87.854  1.00 31.47  ? 160 MET H O   1 
ATOM   9385 C CB  . MET I 4 159 ? -15.838 75.513  85.701  1.00 37.54  ? 160 MET H CB  1 
ATOM   9386 C CG  . MET I 4 159 ? -14.746 74.656  85.034  1.00 57.80  ? 160 MET H CG  1 
ATOM   9387 S SD  . MET I 4 159 ? -14.979 72.834  85.035  1.00 73.30  ? 160 MET H SD  1 
ATOM   9388 C CE  . MET I 4 159 ? -16.036 72.590  83.543  1.00 67.45  ? 160 MET H CE  1 
ATOM   9389 N N   . LEU I 4 160 ? -16.422 77.603  88.023  1.00 25.93  ? 161 LEU H N   1 
ATOM   9390 C CA  . LEU I 4 160 ? -17.217 78.708  88.517  1.00 30.27  ? 161 LEU H CA  1 
ATOM   9391 C C   . LEU I 4 160 ? -16.788 79.972  87.803  1.00 38.25  ? 161 LEU H C   1 
ATOM   9392 O O   . LEU I 4 160 ? -15.665 80.428  88.011  1.00 41.75  ? 161 LEU H O   1 
ATOM   9393 C CB  . LEU I 4 160 ? -16.973 78.893  90.011  1.00 28.62  ? 161 LEU H CB  1 
ATOM   9394 C CG  . LEU I 4 160 ? -17.385 80.251  90.580  1.00 32.90  ? 161 LEU H CG  1 
ATOM   9395 C CD1 . LEU I 4 160 ? -18.878 80.422  90.397  1.00 28.79  ? 161 LEU H CD1 1 
ATOM   9396 C CD2 . LEU I 4 160 ? -17.020 80.337  92.055  1.00 31.58  ? 161 LEU H CD2 1 
ATOM   9397 N N   . GLU I 4 161 ? -17.658 80.533  86.962  1.00 41.85  ? 162 GLU H N   1 
ATOM   9398 C CA  . GLU I 4 161 ? -17.332 81.779  86.254  1.00 42.74  ? 162 GLU H CA  1 
ATOM   9399 C C   . GLU I 4 161 ? -17.377 82.883  87.295  1.00 43.22  ? 162 GLU H C   1 
ATOM   9400 O O   . GLU I 4 161 ? -18.416 83.115  87.905  1.00 51.03  ? 162 GLU H O   1 
ATOM   9401 C CB  . GLU I 4 161 ? -18.368 82.094  85.178  1.00 40.76  ? 162 GLU H CB  1 
ATOM   9402 C CG  . GLU I 4 161 ? -18.726 80.933  84.290  1.00 42.40  ? 162 GLU H CG  1 
ATOM   9403 C CD  . GLU I 4 161 ? -17.509 80.232  83.741  1.00 61.51  ? 162 GLU H CD  1 
ATOM   9404 O OE1 . GLU I 4 161 ? -16.600 80.928  83.237  1.00 66.50  ? 162 GLU H OE1 1 
ATOM   9405 O OE2 . GLU I 4 161 ? -17.464 78.982  83.809  1.00 74.14  ? 162 GLU H OE2 1 
ATOM   9406 N N   . MET I 4 162 ? -16.267 83.568  87.517  1.00 46.88  ? 163 MET H N   1 
ATOM   9407 C CA  . MET I 4 162 ? -16.286 84.614  88.522  1.00 55.16  ? 163 MET H CA  1 
ATOM   9408 C C   . MET I 4 162 ? -15.448 85.838  88.199  1.00 61.05  ? 163 MET H C   1 
ATOM   9409 O O   . MET I 4 162 ? -14.756 85.894  87.184  1.00 62.50  ? 163 MET H O   1 
ATOM   9410 C CB  . MET I 4 162 ? -15.852 84.035  89.871  1.00 54.20  ? 163 MET H CB  1 
ATOM   9411 C CG  . MET I 4 162 ? -14.526 83.283  89.839  1.00 57.76  ? 163 MET H CG  1 
ATOM   9412 S SD  . MET I 4 162 ? -13.064 84.298  89.503  1.00 64.33  ? 163 MET H SD  1 
ATOM   9413 C CE  . MET I 4 162 ? -12.568 84.803  91.189  1.00 56.08  ? 163 MET H CE  1 
ATOM   9414 N N   . THR I 4 163 ? -15.527 86.820  89.089  1.00 67.95  ? 164 THR H N   1 
ATOM   9415 C CA  . THR I 4 163 ? -14.793 88.066  88.958  1.00 72.23  ? 164 THR H CA  1 
ATOM   9416 C C   . THR I 4 163 ? -14.156 88.348  90.316  1.00 78.64  ? 164 THR H C   1 
ATOM   9417 O O   . THR I 4 163 ? -14.801 88.889  91.217  1.00 79.44  ? 164 THR H O   1 
ATOM   9418 C CB  . THR I 4 163 ? -15.737 89.226  88.591  1.00 69.24  ? 164 THR H CB  1 
ATOM   9419 O OG1 . THR I 4 163 ? -16.571 88.836  87.493  1.00 70.99  ? 164 THR H OG1 1 
ATOM   9420 C CG2 . THR I 4 163 ? -14.936 90.452  88.193  1.00 69.02  ? 164 THR H CG2 1 
ATOM   9421 N N   . PRO I 4 164 ? -12.876 87.978  90.482  1.00 83.66  ? 165 PRO H N   1 
ATOM   9422 C CA  . PRO I 4 164 ? -12.180 88.203  91.750  1.00 88.56  ? 165 PRO H CA  1 
ATOM   9423 C C   . PRO I 4 164 ? -12.276 89.652  92.214  1.00 94.25  ? 165 PRO H C   1 
ATOM   9424 O O   . PRO I 4 164 ? -12.210 90.580  91.406  1.00 96.50  ? 165 PRO H O   1 
ATOM   9425 C CB  . PRO I 4 164 ? -10.744 87.779  91.434  1.00 89.06  ? 165 PRO H CB  1 
ATOM   9426 C CG  . PRO I 4 164 ? -10.613 88.095  89.977  1.00 84.48  ? 165 PRO H CG  1 
ATOM   9427 C CD  . PRO I 4 164 ? -11.923 87.586  89.428  1.00 84.38  ? 165 PRO H CD  1 
ATOM   9428 N N   . ARG I 4 165 ? -12.444 89.837  93.518  1.00 97.70  ? 166 ARG H N   1 
ATOM   9429 C CA  . ARG I 4 165 ? -12.546 91.171  94.088  1.00 101.82 ? 166 ARG H CA  1 
ATOM   9430 C C   . ARG I 4 165 ? -11.793 91.229  95.415  1.00 103.09 ? 166 ARG H C   1 
ATOM   9431 O O   . ARG I 4 165 ? -11.088 90.285  95.776  1.00 102.08 ? 166 ARG H O   1 
ATOM   9432 C CB  . ARG I 4 165 ? -14.021 91.549  94.267  1.00 104.65 ? 166 ARG H CB  1 
ATOM   9433 C CG  . ARG I 4 165 ? -14.795 91.590  92.945  1.00 108.96 ? 166 ARG H CG  1 
ATOM   9434 C CD  . ARG I 4 165 ? -16.256 91.984  93.137  1.00 115.64 ? 166 ARG H CD  1 
ATOM   9435 N NE  . ARG I 4 165 ? -17.023 91.967  91.887  1.00 120.79 ? 166 ARG H NE  1 
ATOM   9436 C CZ  . ARG I 4 165 ? -16.854 92.814  90.872  1.00 120.05 ? 166 ARG H CZ  1 
ATOM   9437 N NH1 . ARG I 4 165 ? -15.937 93.769  90.934  1.00 119.26 ? 166 ARG H NH1 1 
ATOM   9438 N NH2 . ARG I 4 165 ? -17.610 92.709  89.787  1.00 117.48 ? 166 ARG H NH2 1 
ATOM   9439 N N   . ARG I 4 166 ? -11.938 92.335  96.137  1.00 103.97 ? 167 ARG H N   1 
ATOM   9440 C CA  . ARG I 4 166 ? -11.243 92.500  97.409  1.00 104.73 ? 167 ARG H CA  1 
ATOM   9441 C C   . ARG I 4 166 ? -11.807 91.650  98.553  1.00 101.74 ? 167 ARG H C   1 
ATOM   9442 O O   . ARG I 4 166 ? -13.021 91.559  98.742  1.00 98.18  ? 167 ARG H O   1 
ATOM   9443 C CB  . ARG I 4 166 ? -11.238 93.983  97.819  1.00 111.68 ? 167 ARG H CB  1 
ATOM   9444 C CG  . ARG I 4 166 ? -12.601 94.556  98.209  1.00 115.01 ? 167 ARG H CG  1 
ATOM   9445 C CD  . ARG I 4 166 ? -12.505 96.025  98.625  1.00 114.30 ? 167 ARG H CD  1 
ATOM   9446 N NE  . ARG I 4 166 ? -12.952 96.945  97.577  1.00 117.20 ? 167 ARG H NE  1 
ATOM   9447 C CZ  . ARG I 4 166 ? -12.362 97.098  96.394  1.00 117.65 ? 167 ARG H CZ  1 
ATOM   9448 N NH1 . ARG I 4 166 ? -11.283 96.392  96.084  1.00 117.09 ? 167 ARG H NH1 1 
ATOM   9449 N NH2 . ARG I 4 166 ? -12.856 97.961  95.514  1.00 116.24 ? 167 ARG H NH2 1 
ATOM   9450 N N   . GLY I 4 167 ? -10.902 91.029  99.308  1.00 98.11  ? 168 GLY H N   1 
ATOM   9451 C CA  . GLY I 4 167 ? -11.287 90.205  100.442 1.00 89.23  ? 168 GLY H CA  1 
ATOM   9452 C C   . GLY I 4 167 ? -12.421 89.226  100.203 1.00 82.89  ? 168 GLY H C   1 
ATOM   9453 O O   . GLY I 4 167 ? -13.048 88.752  101.151 1.00 83.18  ? 168 GLY H O   1 
ATOM   9454 N N   . GLU I 4 168 ? -12.692 88.923  98.939  1.00 76.26  ? 169 GLU H N   1 
ATOM   9455 C CA  . GLU I 4 168 ? -13.750 87.987  98.586  1.00 67.28  ? 169 GLU H CA  1 
ATOM   9456 C C   . GLU I 4 168 ? -13.177 86.574  98.707  1.00 60.02  ? 169 GLU H C   1 
ATOM   9457 O O   . GLU I 4 168 ? -12.122 86.272  98.152  1.00 54.66  ? 169 GLU H O   1 
ATOM   9458 C CB  . GLU I 4 168 ? -14.205 88.265  97.157  1.00 71.87  ? 169 GLU H CB  1 
ATOM   9459 C CG  . GLU I 4 168 ? -15.631 87.879  96.851  1.00 75.59  ? 169 GLU H CG  1 
ATOM   9460 C CD  . GLU I 4 168 ? -16.145 88.590  95.613  1.00 80.30  ? 169 GLU H CD  1 
ATOM   9461 O OE1 . GLU I 4 168 ? -15.452 88.532  94.573  1.00 79.46  ? 169 GLU H OE1 1 
ATOM   9462 O OE2 . GLU I 4 168 ? -17.235 89.205  95.679  1.00 77.15  ? 169 GLU H OE2 1 
ATOM   9463 N N   . VAL I 4 169 ? -13.860 85.710  99.448  1.00 52.74  ? 170 VAL H N   1 
ATOM   9464 C CA  . VAL I 4 169 ? -13.373 84.348  99.627  1.00 49.96  ? 170 VAL H CA  1 
ATOM   9465 C C   . VAL I 4 169 ? -14.226 83.289  98.940  1.00 44.01  ? 170 VAL H C   1 
ATOM   9466 O O   . VAL I 4 169 ? -15.424 83.195  99.187  1.00 43.64  ? 170 VAL H O   1 
ATOM   9467 C CB  . VAL I 4 169 ? -13.270 84.009  101.119 1.00 46.68  ? 170 VAL H CB  1 
ATOM   9468 C CG1 . VAL I 4 169 ? -12.790 82.581  101.310 1.00 43.01  ? 170 VAL H CG1 1 
ATOM   9469 C CG2 . VAL I 4 169 ? -12.320 84.975  101.779 1.00 57.68  ? 170 VAL H CG2 1 
ATOM   9470 N N   . TYR I 4 170 ? -13.598 82.500  98.072  1.00 38.88  ? 171 TYR H N   1 
ATOM   9471 C CA  . TYR I 4 170 ? -14.291 81.431  97.364  1.00 36.62  ? 171 TYR H CA  1 
ATOM   9472 C C   . TYR I 4 170 ? -13.921 80.110  97.996  1.00 36.60  ? 171 TYR H C   1 
ATOM   9473 O O   . TYR I 4 170 ? -12.761 79.894  98.347  1.00 45.15  ? 171 TYR H O   1 
ATOM   9474 C CB  . TYR I 4 170 ? -13.906 81.420  95.888  1.00 37.61  ? 171 TYR H CB  1 
ATOM   9475 C CG  . TYR I 4 170 ? -14.377 82.643  95.155  1.00 39.77  ? 171 TYR H CG  1 
ATOM   9476 C CD1 . TYR I 4 170 ? -13.663 83.845  95.220  1.00 37.75  ? 171 TYR H CD1 1 
ATOM   9477 C CD2 . TYR I 4 170 ? -15.549 82.610  94.409  1.00 36.64  ? 171 TYR H CD2 1 
ATOM   9478 C CE1 . TYR I 4 170 ? -14.112 84.983  94.551  1.00 41.17  ? 171 TYR H CE1 1 
ATOM   9479 C CE2 . TYR I 4 170 ? -16.009 83.743  93.740  1.00 41.58  ? 171 TYR H CE2 1 
ATOM   9480 C CZ  . TYR I 4 170 ? -15.289 84.920  93.811  1.00 41.00  ? 171 TYR H CZ  1 
ATOM   9481 O OH  . TYR I 4 170 ? -15.742 86.023  93.125  1.00 45.11  ? 171 TYR H OH  1 
ATOM   9482 N N   . THR I 4 171 ? -14.892 79.212  98.115  1.00 32.62  ? 172 THR H N   1 
ATOM   9483 C CA  . THR I 4 171 ? -14.641 77.933  98.759  1.00 38.92  ? 172 THR H CA  1 
ATOM   9484 C C   . THR I 4 171 ? -15.227 76.747  98.032  1.00 32.81  ? 172 THR H C   1 
ATOM   9485 O O   . THR I 4 171 ? -16.355 76.796  97.561  1.00 41.19  ? 172 THR H O   1 
ATOM   9486 C CB  . THR I 4 171 ? -15.223 77.929  100.187 1.00 39.82  ? 172 THR H CB  1 
ATOM   9487 O OG1 . THR I 4 171 ? -14.696 79.038  100.914 1.00 47.04  ? 172 THR H OG1 1 
ATOM   9488 C CG2 . THR I 4 171 ? -14.872 76.651  100.908 1.00 45.45  ? 172 THR H CG2 1 
ATOM   9489 N N   . CYS I 4 172 ? -14.457 75.670  97.972  1.00 32.96  ? 173 CYS H N   1 
ATOM   9490 C CA  . CYS I 4 172 ? -14.904 74.443  97.338  1.00 33.96  ? 173 CYS H CA  1 
ATOM   9491 C C   . CYS I 4 172 ? -15.235 73.448  98.476  1.00 33.68  ? 173 CYS H C   1 
ATOM   9492 O O   . CYS I 4 172 ? -14.374 73.098  99.281  1.00 30.07  ? 173 CYS H O   1 
ATOM   9493 C CB  . CYS I 4 172 ? -13.804 73.891  96.412  1.00 30.16  ? 173 CYS H CB  1 
ATOM   9494 S SG  . CYS I 4 172 ? -14.366 72.428  95.492  1.00 49.34  ? 173 CYS H SG  1 
ATOM   9495 N N   . HIS I 4 173 ? -16.488 73.009  98.535  1.00 26.11  ? 174 HIS H N   1 
ATOM   9496 C CA  . HIS I 4 173 ? -16.973 72.100  99.572  1.00 28.27  ? 174 HIS H CA  1 
ATOM   9497 C C   . HIS I 4 173 ? -17.155 70.715  98.960  1.00 30.98  ? 174 HIS H C   1 
ATOM   9498 O O   . HIS I 4 173 ? -17.877 70.570  97.972  1.00 35.80  ? 174 HIS H O   1 
ATOM   9499 C CB  . HIS I 4 173 ? -18.312 72.638  100.101 1.00 37.70  ? 174 HIS H CB  1 
ATOM   9500 C CG  . HIS I 4 173 ? -18.799 71.987  101.362 1.00 49.29  ? 174 HIS H CG  1 
ATOM   9501 N ND1 . HIS I 4 173 ? -18.542 72.504  102.615 1.00 49.22  ? 174 HIS H ND1 1 
ATOM   9502 C CD2 . HIS I 4 173 ? -19.564 70.885  101.559 1.00 46.86  ? 174 HIS H CD2 1 
ATOM   9503 C CE1 . HIS I 4 173 ? -19.130 71.749  103.529 1.00 49.85  ? 174 HIS H CE1 1 
ATOM   9504 N NE2 . HIS I 4 173 ? -19.756 70.760  102.914 1.00 48.93  ? 174 HIS H NE2 1 
ATOM   9505 N N   . VAL I 4 174 ? -16.499 69.706  99.541  1.00 27.88  ? 175 VAL H N   1 
ATOM   9506 C CA  . VAL I 4 174 ? -16.571 68.332  99.036  1.00 30.45  ? 175 VAL H CA  1 
ATOM   9507 C C   . VAL I 4 174 ? -16.952 67.282  100.075 1.00 31.94  ? 175 VAL H C   1 
ATOM   9508 O O   . VAL I 4 174 ? -16.321 67.184  101.122 1.00 33.99  ? 175 VAL H O   1 
ATOM   9509 C CB  . VAL I 4 174 ? -15.217 67.892  98.402  1.00 33.70  ? 175 VAL H CB  1 
ATOM   9510 C CG1 . VAL I 4 174 ? -15.294 66.430  97.927  1.00 19.77  ? 175 VAL H CG1 1 
ATOM   9511 C CG2 . VAL I 4 174 ? -14.866 68.808  97.245  1.00 24.86  ? 175 VAL H CG2 1 
ATOM   9512 N N   . GLU I 4 175 ? -17.977 66.495  99.755  1.00 30.72  ? 176 GLU H N   1 
ATOM   9513 C CA  . GLU I 4 175 ? -18.477 65.419  100.610 1.00 33.39  ? 176 GLU H CA  1 
ATOM   9514 C C   . GLU I 4 175 ? -18.364 64.089  99.884  1.00 36.82  ? 176 GLU H C   1 
ATOM   9515 O O   . GLU I 4 175 ? -18.777 63.963  98.729  1.00 35.74  ? 176 GLU H O   1 
ATOM   9516 C CB  . GLU I 4 175 ? -19.928 65.680  100.988 1.00 33.47  ? 176 GLU H CB  1 
ATOM   9517 C CG  . GLU I 4 175 ? -20.064 66.673  102.129 1.00 43.24  ? 176 GLU H CG  1 
ATOM   9518 C CD  . GLU I 4 175 ? -21.470 67.233  102.283 1.00 45.65  ? 176 GLU H CD  1 
ATOM   9519 O OE1 . GLU I 4 175 ? -22.446 66.497  102.015 1.00 46.77  ? 176 GLU H OE1 1 
ATOM   9520 O OE2 . GLU I 4 175 ? -21.592 68.412  102.691 1.00 56.90  ? 176 GLU H OE2 1 
ATOM   9521 N N   . HIS I 4 176 ? -17.828 63.088  100.576 1.00 30.22  ? 177 HIS H N   1 
ATOM   9522 C CA  . HIS I 4 176 ? -17.601 61.787  99.971  1.00 25.96  ? 177 HIS H CA  1 
ATOM   9523 C C   . HIS I 4 176 ? -17.582 60.710  101.060 1.00 30.41  ? 177 HIS H C   1 
ATOM   9524 O O   . HIS I 4 176 ? -17.075 60.942  102.152 1.00 35.14  ? 177 HIS H O   1 
ATOM   9525 C CB  . HIS I 4 176 ? -16.247 61.853  99.240  1.00 27.57  ? 177 HIS H CB  1 
ATOM   9526 C CG  . HIS I 4 176 ? -15.818 60.562  98.619  1.00 24.73  ? 177 HIS H CG  1 
ATOM   9527 N ND1 . HIS I 4 176 ? -16.322 60.106  97.420  1.00 36.65  ? 177 HIS H ND1 1 
ATOM   9528 C CD2 . HIS I 4 176 ? -14.936 59.625  99.035  1.00 28.71  ? 177 HIS H CD2 1 
ATOM   9529 C CE1 . HIS I 4 176 ? -15.768 58.943  97.125  1.00 25.10  ? 177 HIS H CE1 1 
ATOM   9530 N NE2 . HIS I 4 176 ? -14.924 58.628  98.090  1.00 26.29  ? 177 HIS H NE2 1 
ATOM   9531 N N   . PRO I 4 177 ? -18.105 59.508  100.766 1.00 33.36  ? 178 PRO H N   1 
ATOM   9532 C CA  . PRO I 4 177 ? -18.153 58.395  101.719 1.00 37.25  ? 178 PRO H CA  1 
ATOM   9533 C C   . PRO I 4 177 ? -16.849 58.089  102.442 1.00 41.48  ? 178 PRO H C   1 
ATOM   9534 O O   . PRO I 4 177 ? -16.859 57.446  103.484 1.00 46.86  ? 178 PRO H O   1 
ATOM   9535 C CB  . PRO I 4 177 ? -18.581 57.212  100.855 1.00 33.72  ? 178 PRO H CB  1 
ATOM   9536 C CG  . PRO I 4 177 ? -19.391 57.846  99.799  1.00 34.11  ? 178 PRO H CG  1 
ATOM   9537 C CD  . PRO I 4 177 ? -18.593 59.070  99.450  1.00 34.13  ? 178 PRO H CD  1 
ATOM   9538 N N   . SER I 4 178 ? -15.725 58.527  101.895 1.00 39.19  ? 179 SER H N   1 
ATOM   9539 C CA  . SER I 4 178 ? -14.447 58.233  102.536 1.00 34.68  ? 179 SER H CA  1 
ATOM   9540 C C   . SER I 4 178 ? -14.051 59.318  103.518 1.00 32.34  ? 179 SER H C   1 
ATOM   9541 O O   . SER I 4 178 ? -13.013 59.224  104.155 1.00 27.35  ? 179 SER H O   1 
ATOM   9542 C CB  . SER I 4 178 ? -13.337 58.078  101.487 1.00 35.30  ? 179 SER H CB  1 
ATOM   9543 O OG  . SER I 4 178 ? -12.988 59.334  100.914 1.00 33.38  ? 179 SER H OG  1 
ATOM   9544 N N   . LEU I 4 179 ? -14.878 60.348  103.627 1.00 32.57  ? 180 LEU H N   1 
ATOM   9545 C CA  . LEU I 4 179 ? -14.597 61.464  104.520 1.00 43.31  ? 180 LEU H CA  1 
ATOM   9546 C C   . LEU I 4 179 ? -15.574 61.484  105.685 1.00 47.70  ? 180 LEU H C   1 
ATOM   9547 O O   . LEU I 4 179 ? -16.762 61.236  105.509 1.00 55.06  ? 180 LEU H O   1 
ATOM   9548 C CB  . LEU I 4 179 ? -14.706 62.787  103.752 1.00 40.38  ? 180 LEU H CB  1 
ATOM   9549 C CG  . LEU I 4 179 ? -13.760 62.976  102.561 1.00 42.79  ? 180 LEU H CG  1 
ATOM   9550 C CD1 . LEU I 4 179 ? -14.081 64.284  101.870 1.00 36.94  ? 180 LEU H CD1 1 
ATOM   9551 C CD2 . LEU I 4 179 ? -12.310 62.963  103.025 1.00 30.14  ? 180 LEU H CD2 1 
ATOM   9552 N N   . LYS I 4 180 ? -15.080 61.775  106.879 1.00 52.52  ? 181 LYS H N   1 
ATOM   9553 C CA  . LYS I 4 180 ? -15.962 61.832  108.032 1.00 54.95  ? 181 LYS H CA  1 
ATOM   9554 C C   . LYS I 4 180 ? -16.535 63.228  108.076 1.00 48.64  ? 181 LYS H C   1 
ATOM   9555 O O   . LYS I 4 180 ? -17.679 63.435  108.475 1.00 50.08  ? 181 LYS H O   1 
ATOM   9556 C CB  . LYS I 4 180 ? -15.196 61.515  109.313 1.00 55.22  ? 181 LYS H CB  1 
ATOM   9557 C CG  . LYS I 4 180 ? -14.799 60.056  109.409 1.00 61.51  ? 181 LYS H CG  1 
ATOM   9558 C CD  . LYS I 4 180 ? -14.443 59.667  110.831 1.00 67.46  ? 181 LYS H CD  1 
ATOM   9559 C CE  . LYS I 4 180 ? -14.170 58.175  110.961 1.00 67.47  ? 181 LYS H CE  1 
ATOM   9560 N NZ  . LYS I 4 180 ? -13.884 57.808  112.380 1.00 71.73  ? 181 LYS H NZ  1 
ATOM   9561 N N   . SER I 4 181 ? -15.721 64.181  107.647 1.00 46.96  ? 182 SER H N   1 
ATOM   9562 C CA  . SER I 4 181 ? -16.116 65.583  107.588 1.00 47.74  ? 182 SER H CA  1 
ATOM   9563 C C   . SER I 4 181 ? -15.886 66.060  106.169 1.00 44.94  ? 182 SER H C   1 
ATOM   9564 O O   . SER I 4 181 ? -15.096 65.474  105.428 1.00 42.05  ? 182 SER H O   1 
ATOM   9565 C CB  . SER I 4 181 ? -15.263 66.433  108.527 1.00 47.92  ? 182 SER H CB  1 
ATOM   9566 O OG  . SER I 4 181 ? -15.506 66.106  109.878 1.00 70.55  ? 182 SER H OG  1 
ATOM   9567 N N   . PRO I 4 182 ? -16.556 67.144  105.776 1.00 45.76  ? 183 PRO H N   1 
ATOM   9568 C CA  . PRO I 4 182 ? -16.389 67.671  104.421 1.00 42.74  ? 183 PRO H CA  1 
ATOM   9569 C C   . PRO I 4 182 ? -15.032 68.337  104.239 1.00 44.48  ? 183 PRO H C   1 
ATOM   9570 O O   . PRO I 4 182 ? -14.501 68.929  105.178 1.00 46.11  ? 183 PRO H O   1 
ATOM   9571 C CB  . PRO I 4 182 ? -17.519 68.697  104.304 1.00 42.46  ? 183 PRO H CB  1 
ATOM   9572 C CG  . PRO I 4 182 ? -18.532 68.248  105.342 1.00 35.21  ? 183 PRO H CG  1 
ATOM   9573 C CD  . PRO I 4 182 ? -17.635 67.854  106.483 1.00 40.24  ? 183 PRO H CD  1 
ATOM   9574 N N   . ILE I 4 183 ? -14.459 68.223  103.043 1.00 38.64  ? 184 ILE H N   1 
ATOM   9575 C CA  . ILE I 4 183 ? -13.204 68.907  102.763 1.00 30.50  ? 184 ILE H CA  1 
ATOM   9576 C C   . ILE I 4 183 ? -13.606 70.296  102.259 1.00 36.03  ? 184 ILE H C   1 
ATOM   9577 O O   . ILE I 4 183 ? -14.605 70.457  101.550 1.00 34.61  ? 184 ILE H O   1 
ATOM   9578 C CB  . ILE I 4 183 ? -12.382 68.214  101.646 1.00 36.08  ? 184 ILE H CB  1 
ATOM   9579 C CG1 . ILE I 4 183 ? -11.715 66.953  102.191 1.00 30.37  ? 184 ILE H CG1 1 
ATOM   9580 C CG2 . ILE I 4 183 ? -11.324 69.184  101.088 1.00 22.36  ? 184 ILE H CG2 1 
ATOM   9581 C CD1 . ILE I 4 183 ? -10.917 66.191  101.153 1.00 37.17  ? 184 ILE H CD1 1 
ATOM   9582 N N   . THR I 4 184 ? -12.849 71.307  102.646 1.00 33.23  ? 185 THR H N   1 
ATOM   9583 C CA  . THR I 4 184 ? -13.136 72.641  102.177 1.00 28.85  ? 185 THR H CA  1 
ATOM   9584 C C   . THR I 4 184 ? -11.828 73.333  101.866 1.00 35.12  ? 185 THR H C   1 
ATOM   9585 O O   . THR I 4 184 ? -10.913 73.377  102.691 1.00 41.16  ? 185 THR H O   1 
ATOM   9586 C CB  . THR I 4 184 ? -13.911 73.455  103.210 1.00 31.70  ? 185 THR H CB  1 
ATOM   9587 O OG1 . THR I 4 184 ? -13.100 73.651  104.367 1.00 50.03  ? 185 THR H OG1 1 
ATOM   9588 C CG2 . THR I 4 184 ? -15.171 72.729  103.609 1.00 29.39  ? 185 THR H CG2 1 
ATOM   9589 N N   . VAL I 4 185 ? -11.727 73.848  100.652 1.00 34.53  ? 186 VAL H N   1 
ATOM   9590 C CA  . VAL I 4 185 ? -10.528 74.552  100.249 1.00 31.57  ? 186 VAL H CA  1 
ATOM   9591 C C   . VAL I 4 185 ? -10.951 75.981  99.917  1.00 29.24  ? 186 VAL H C   1 
ATOM   9592 O O   . VAL I 4 185 ? -12.027 76.211  99.352  1.00 31.50  ? 186 VAL H O   1 
ATOM   9593 C CB  . VAL I 4 185 ? -9.877  73.871  99.029  1.00 33.15  ? 186 VAL H CB  1 
ATOM   9594 C CG1 . VAL I 4 185 ? -8.577  74.577  98.671  1.00 34.02  ? 186 VAL H CG1 1 
ATOM   9595 C CG2 . VAL I 4 185 ? -9.611  72.417  99.333  1.00 19.61  ? 186 VAL H CG2 1 
ATOM   9596 N N   . GLU I 4 186 ? -10.122 76.945  100.290 1.00 33.28  ? 187 GLU H N   1 
ATOM   9597 C CA  . GLU I 4 186 ? -10.454 78.339  100.035 1.00 40.07  ? 187 GLU H CA  1 
ATOM   9598 C C   . GLU I 4 186 ? -9.500  78.925  99.029  1.00 40.37  ? 187 GLU H C   1 
ATOM   9599 O O   . GLU I 4 186 ? -8.361  78.494  98.914  1.00 47.33  ? 187 GLU H O   1 
ATOM   9600 C CB  . GLU I 4 186 ? -10.369 79.184  101.317 1.00 40.87  ? 187 GLU H CB  1 
ATOM   9601 C CG  . GLU I 4 186 ? -11.086 78.614  102.551 1.00 57.39  ? 187 GLU H CG  1 
ATOM   9602 C CD  . GLU I 4 186 ? -11.050 79.574  103.752 1.00 65.05  ? 187 GLU H CD  1 
ATOM   9603 O OE1 . GLU I 4 186 ? -9.986  80.196  103.991 1.00 64.78  ? 187 GLU H OE1 1 
ATOM   9604 O OE2 . GLU I 4 186 ? -12.079 79.700  104.460 1.00 59.65  ? 187 GLU H OE2 1 
ATOM   9605 N N   . TRP I 4 187 ? -9.979  79.917  98.297  1.00 39.89  ? 188 TRP H N   1 
ATOM   9606 C CA  . TRP I 4 187 ? -9.156  80.597  97.321  1.00 43.77  ? 188 TRP H CA  1 
ATOM   9607 C C   . TRP I 4 187 ? -9.392  82.095  97.500  1.00 50.24  ? 188 TRP H C   1 
ATOM   9608 O O   . TRP I 4 187 ? -10.538 82.545  97.537  1.00 46.24  ? 188 TRP H O   1 
ATOM   9609 C CB  . TRP I 4 187 ? -9.545  80.175  95.911  1.00 41.72  ? 188 TRP H CB  1 
ATOM   9610 C CG  . TRP I 4 187 ? -8.665  80.755  94.866  1.00 44.43  ? 188 TRP H CG  1 
ATOM   9611 C CD1 . TRP I 4 187 ? -7.553  80.182  94.320  1.00 50.19  ? 188 TRP H CD1 1 
ATOM   9612 C CD2 . TRP I 4 187 ? -8.797  82.041  94.255  1.00 45.97  ? 188 TRP H CD2 1 
ATOM   9613 N NE1 . TRP I 4 187 ? -6.986  81.028  93.401  1.00 50.68  ? 188 TRP H NE1 1 
ATOM   9614 C CE2 . TRP I 4 187 ? -7.732  82.176  93.336  1.00 50.12  ? 188 TRP H CE2 1 
ATOM   9615 C CE3 . TRP I 4 187 ? -9.720  83.087  94.384  1.00 50.18  ? 188 TRP H CE3 1 
ATOM   9616 C CZ2 . TRP I 4 187 ? -7.553  83.323  92.561  1.00 47.71  ? 188 TRP H CZ2 1 
ATOM   9617 C CZ3 . TRP I 4 187 ? -9.546  84.229  93.614  1.00 58.75  ? 188 TRP H CZ3 1 
ATOM   9618 C CH2 . TRP I 4 187 ? -8.471  84.334  92.706  1.00 64.53  ? 188 TRP H CH2 1 
ATOM   9619 N N   . ARG I 4 188 ? -8.311  82.859  97.636  1.00 56.35  ? 189 ARG H N   1 
ATOM   9620 C CA  . ARG I 4 188 ? -8.426  84.305  97.799  1.00 63.67  ? 189 ARG H CA  1 
ATOM   9621 C C   . ARG I 4 188 ? -7.730  85.007  96.653  1.00 65.87  ? 189 ARG H C   1 
ATOM   9622 O O   . ARG I 4 188 ? -6.605  84.650  96.289  1.00 65.64  ? 189 ARG H O   1 
ATOM   9623 C CB  . ARG I 4 188 ? -7.813  84.756  99.127  1.00 67.82  ? 189 ARG H CB  1 
ATOM   9624 C CG  . ARG I 4 188 ? -8.643  84.377  100.336 1.00 75.59  ? 189 ARG H CG  1 
ATOM   9625 C CD  . ARG I 4 188 ? -7.778  83.843  101.464 1.00 83.22  ? 189 ARG H CD  1 
ATOM   9626 N NE  . ARG I 4 188 ? -8.587  83.204  102.497 1.00 89.06  ? 189 ARG H NE  1 
ATOM   9627 C CZ  . ARG I 4 188 ? -9.482  83.841  103.247 1.00 92.41  ? 189 ARG H CZ  1 
ATOM   9628 N NH1 . ARG I 4 188 ? -9.680  85.144  103.082 1.00 89.99  ? 189 ARG H NH1 1 
ATOM   9629 N NH2 . ARG I 4 188 ? -10.185 83.175  104.155 1.00 93.59  ? 189 ARG H NH2 1 
ATOM   9630 N N   . ALA I 4 189 ? -8.414  85.993  96.080  1.00 68.17  ? 190 ALA H N   1 
ATOM   9631 C CA  . ALA I 4 189 ? -7.872  86.769  94.971  1.00 71.83  ? 190 ALA H CA  1 
ATOM   9632 C C   . ALA I 4 189 ? -6.615  87.508  95.428  1.00 74.60  ? 190 ALA H C   1 
ATOM   9633 O O   . ALA I 4 189 ? -5.545  87.334  94.792  1.00 74.70  ? 190 ALA H O   1 
ATOM   9634 C CB  . ALA I 4 189 ? -8.918  87.762  94.472  1.00 71.40  ? 190 ALA H CB  1 
ATOM   9635 O OXT . ALA I 4 189 ? -6.725  88.252  96.428  1.00 70.29  ? 190 ALA H OXT 1 
ATOM   9636 N N   . SER J 5 1   ? -12.037 33.727  98.091  1.00 62.83  ? -3  SER I N   1 
ATOM   9637 C CA  . SER J 5 1   ? -10.657 33.583  97.555  1.00 59.86  ? -3  SER I CA  1 
ATOM   9638 C C   . SER J 5 1   ? -10.640 33.104  96.095  1.00 58.66  ? -3  SER I C   1 
ATOM   9639 O O   . SER J 5 1   ? -10.120 33.806  95.229  1.00 66.09  ? -3  SER I O   1 
ATOM   9640 C CB  . SER J 5 1   ? -9.857  32.620  98.438  1.00 67.40  ? -3  SER I CB  1 
ATOM   9641 O OG  . SER J 5 1   ? -8.489  32.588  98.059  1.00 73.52  ? -3  SER I OG  1 
ATOM   9642 N N   . ARG J 5 2   ? -11.201 31.924  95.817  1.00 52.65  ? -2  ARG I N   1 
ATOM   9643 C CA  . ARG J 5 2   ? -11.235 31.383  94.445  1.00 56.31  ? -2  ARG I CA  1 
ATOM   9644 C C   . ARG J 5 2   ? -12.511 31.759  93.689  1.00 53.28  ? -2  ARG I C   1 
ATOM   9645 O O   . ARG J 5 2   ? -13.578 31.224  93.962  1.00 52.01  ? -2  ARG I O   1 
ATOM   9646 C CB  . ARG J 5 2   ? -11.078 29.855  94.468  1.00 59.35  ? -2  ARG I CB  1 
ATOM   9647 C CG  . ARG J 5 2   ? -9.627  29.395  94.605  1.00 65.86  ? -2  ARG I CG  1 
ATOM   9648 C CD  . ARG J 5 2   ? -9.506  27.929  94.999  1.00 71.92  ? -2  ARG I CD  1 
ATOM   9649 N NE  . ARG J 5 2   ? -10.120 27.673  96.300  1.00 81.75  ? -2  ARG I NE  1 
ATOM   9650 C CZ  . ARG J 5 2   ? -9.775  26.678  97.114  1.00 82.63  ? -2  ARG I CZ  1 
ATOM   9651 N NH1 . ARG J 5 2   ? -8.810  25.838  96.761  1.00 77.35  ? -2  ARG I NH1 1 
ATOM   9652 N NH2 . ARG J 5 2   ? -10.398 26.523  98.280  1.00 80.65  ? -2  ARG I NH2 1 
ATOM   9653 N N   . GLY J 5 3   ? -12.384 32.670  92.724  1.00 51.31  ? -1  GLY I N   1 
ATOM   9654 C CA  . GLY J 5 3   ? -13.536 33.135  91.970  1.00 48.28  ? -1  GLY I CA  1 
ATOM   9655 C C   . GLY J 5 3   ? -13.988 32.334  90.760  1.00 49.22  ? -1  GLY I C   1 
ATOM   9656 O O   . GLY J 5 3   ? -13.193 31.681  90.087  1.00 46.49  ? -1  GLY I O   1 
ATOM   9657 N N   . GLY J 5 4   ? -15.288 32.406  90.482  1.00 46.80  ? 0   GLY I N   1 
ATOM   9658 C CA  . GLY J 5 4   ? -15.848 31.683  89.358  1.00 44.65  ? 0   GLY I CA  1 
ATOM   9659 C C   . GLY J 5 4   ? -16.054 32.560  88.140  1.00 49.95  ? 0   GLY I C   1 
ATOM   9660 O O   . GLY J 5 4   ? -15.978 33.790  88.219  1.00 46.99  ? 0   GLY I O   1 
ATOM   9661 N N   . ALA J 5 5   ? -16.324 31.918  87.009  1.00 47.15  ? 1   ALA I N   1 
ATOM   9662 C CA  . ALA J 5 5   ? -16.543 32.627  85.760  1.00 42.28  ? 1   ALA I CA  1 
ATOM   9663 C C   . ALA J 5 5   ? -17.767 32.103  85.019  1.00 46.95  ? 1   ALA I C   1 
ATOM   9664 O O   . ALA J 5 5   ? -18.035 30.904  85.009  1.00 45.48  ? 1   ALA I O   1 
ATOM   9665 C CB  . ALA J 5 5   ? -15.322 32.493  84.878  1.00 40.81  ? 1   ALA I CB  1 
ATOM   9666 N N   . SER J 5 6   ? -18.522 33.010  84.412  1.00 48.25  ? 2   SER I N   1 
ATOM   9667 C CA  . SER J 5 6   ? -19.671 32.599  83.630  1.00 47.28  ? 2   SER I CA  1 
ATOM   9668 C C   . SER J 5 6   ? -19.047 31.881  82.438  1.00 49.12  ? 2   SER I C   1 
ATOM   9669 O O   . SER J 5 6   ? -18.077 32.371  81.850  1.00 44.35  ? 2   SER I O   1 
ATOM   9670 C CB  . SER J 5 6   ? -20.463 33.815  83.162  1.00 42.86  ? 2   SER I CB  1 
ATOM   9671 O OG  . SER J 5 6   ? -20.898 34.580  84.273  1.00 49.30  ? 2   SER I OG  1 
ATOM   9672 N N   . GLN J 5 7   ? -19.588 30.719  82.092  1.00 48.78  ? 3   GLN I N   1 
ATOM   9673 C CA  . GLN J 5 7   ? -19.045 29.944  80.989  1.00 53.01  ? 3   GLN I CA  1 
ATOM   9674 C C   . GLN J 5 7   ? -19.615 30.284  79.612  1.00 48.33  ? 3   GLN I C   1 
ATOM   9675 O O   . GLN J 5 7   ? -20.823 30.391  79.427  1.00 57.32  ? 3   GLN I O   1 
ATOM   9676 C CB  . GLN J 5 7   ? -19.232 28.452  81.282  1.00 54.88  ? 3   GLN I CB  1 
ATOM   9677 C CG  . GLN J 5 7   ? -18.606 27.999  82.598  1.00 55.92  ? 3   GLN I CG  1 
ATOM   9678 C CD  . GLN J 5 7   ? -17.103 28.209  82.630  1.00 57.43  ? 3   GLN I CD  1 
ATOM   9679 O OE1 . GLN J 5 7   ? -16.594 29.001  83.424  1.00 55.82  ? 3   GLN I OE1 1 
ATOM   9680 N NE2 . GLN J 5 7   ? -16.385 27.501  81.762  1.00 48.54  ? 3   GLN I NE2 1 
ATOM   9681 N N   . TYR J 5 8   ? -18.720 30.456  78.652  1.00 48.16  ? 4   TYR I N   1 
ATOM   9682 C CA  . TYR J 5 8   ? -19.083 30.756  77.275  1.00 50.98  ? 4   TYR I CA  1 
ATOM   9683 C C   . TYR J 5 8   ? -19.423 29.408  76.607  1.00 51.79  ? 4   TYR I C   1 
ATOM   9684 O O   . TYR J 5 8   ? -18.571 28.517  76.521  1.00 48.20  ? 4   TYR I O   1 
ATOM   9685 C CB  . TYR J 5 8   ? -17.885 31.434  76.603  1.00 45.58  ? 4   TYR I CB  1 
ATOM   9686 C CG  . TYR J 5 8   ? -18.111 31.997  75.218  1.00 36.93  ? 4   TYR I CG  1 
ATOM   9687 C CD1 . TYR J 5 8   ? -19.385 32.310  74.759  1.00 38.32  ? 4   TYR I CD1 1 
ATOM   9688 C CD2 . TYR J 5 8   ? -17.025 32.306  74.401  1.00 43.62  ? 4   TYR I CD2 1 
ATOM   9689 C CE1 . TYR J 5 8   ? -19.572 32.927  73.529  1.00 39.99  ? 4   TYR I CE1 1 
ATOM   9690 C CE2 . TYR J 5 8   ? -17.199 32.922  73.169  1.00 43.52  ? 4   TYR I CE2 1 
ATOM   9691 C CZ  . TYR J 5 8   ? -18.473 33.238  72.737  1.00 43.80  ? 4   TYR I CZ  1 
ATOM   9692 O OH  . TYR J 5 8   ? -18.634 33.912  71.537  1.00 48.94  ? 4   TYR I OH  1 
ATOM   9693 N N   . ARG J 5 9   ? -20.667 29.276  76.139  1.00 58.64  ? 5   ARG I N   1 
ATOM   9694 C CA  . ARG J 5 9   ? -21.178 28.044  75.508  1.00 58.84  ? 5   ARG I CA  1 
ATOM   9695 C C   . ARG J 5 9   ? -20.929 27.876  74.001  1.00 57.55  ? 5   ARG I C   1 
ATOM   9696 O O   . ARG J 5 9   ? -21.068 28.822  73.231  1.00 61.80  ? 5   ARG I O   1 
ATOM   9697 C CB  . ARG J 5 9   ? -22.688 27.938  75.744  1.00 53.37  ? 5   ARG I CB  1 
ATOM   9698 C CG  . ARG J 5 9   ? -23.140 28.211  77.166  1.00 46.97  ? 5   ARG I CG  1 
ATOM   9699 C CD  . ARG J 5 9   ? -22.591 27.205  78.145  1.00 44.35  ? 5   ARG I CD  1 
ATOM   9700 N NE  . ARG J 5 9   ? -22.973 27.551  79.514  1.00 47.51  ? 5   ARG I NE  1 
ATOM   9701 C CZ  . ARG J 5 9   ? -22.726 26.795  80.580  1.00 45.77  ? 5   ARG I CZ  1 
ATOM   9702 N NH1 . ARG J 5 9   ? -22.093 25.633  80.453  1.00 47.82  ? 5   ARG I NH1 1 
ATOM   9703 N NH2 . ARG J 5 9   ? -23.111 27.200  81.780  1.00 48.04  ? 5   ARG I NH2 1 
ATOM   9704 N N   . PRO J 5 10  ? -20.567 26.655  73.560  1.00 62.91  ? 6   PRO I N   1 
ATOM   9705 C CA  . PRO J 5 10  ? -20.311 26.380  72.136  1.00 63.64  ? 6   PRO I CA  1 
ATOM   9706 C C   . PRO J 5 10  ? -21.631 26.217  71.366  1.00 68.64  ? 6   PRO I C   1 
ATOM   9707 O O   . PRO J 5 10  ? -22.708 26.332  71.950  1.00 66.26  ? 6   PRO I O   1 
ATOM   9708 C CB  . PRO J 5 10  ? -19.510 25.079  72.166  1.00 61.22  ? 6   PRO I CB  1 
ATOM   9709 C CG  . PRO J 5 10  ? -18.959 25.017  73.568  1.00 64.38  ? 6   PRO I CG  1 
ATOM   9710 C CD  . PRO J 5 10  ? -20.093 25.538  74.392  1.00 58.81  ? 6   PRO I CD  1 
ATOM   9711 N N   . SER J 5 11  ? -21.550 25.930  70.069  1.00 75.10  ? 7   SER I N   1 
ATOM   9712 C CA  . SER J 5 11  ? -22.756 25.771  69.253  1.00 82.86  ? 7   SER I CA  1 
ATOM   9713 C C   . SER J 5 11  ? -22.531 24.960  67.975  1.00 88.68  ? 7   SER I C   1 
ATOM   9714 O O   . SER J 5 11  ? -21.560 25.192  67.255  1.00 96.38  ? 7   SER I O   1 
ATOM   9715 C CB  . SER J 5 11  ? -23.311 27.151  68.890  1.00 78.99  ? 7   SER I CB  1 
ATOM   9716 O OG  . SER J 5 11  ? -22.323 27.939  68.252  1.00 77.91  ? 7   SER I OG  1 
ATOM   9717 N N   . GLN J 5 12  ? -23.447 24.031  67.694  1.00 90.54  ? 8   GLN I N   1 
ATOM   9718 C CA  . GLN J 5 12  ? -23.383 23.152  66.516  1.00 91.65  ? 8   GLN I CA  1 
ATOM   9719 C C   . GLN J 5 12  ? -21.975 22.662  66.187  1.00 91.75  ? 8   GLN I C   1 
ATOM   9720 O O   . GLN J 5 12  ? -21.406 21.928  67.023  1.00 92.67  ? 8   GLN I O   1 
ATOM   9721 C CB  . GLN J 5 12  ? -23.963 23.841  65.272  1.00 97.10  ? 8   GLN I CB  1 
ATOM   9722 C CG  . GLN J 5 12  ? -24.306 22.851  64.145  1.00 101.24 ? 8   GLN I CG  1 
ATOM   9723 C CD  . GLN J 5 12  ? -23.601 23.143  62.825  1.00 103.46 ? 8   GLN I CD  1 
ATOM   9724 O OE1 . GLN J 5 12  ? -22.373 23.249  62.766  1.00 101.62 ? 8   GLN I OE1 1 
ATOM   9725 N NE2 . GLN J 5 12  ? -24.382 23.259  61.754  1.00 101.03 ? 8   GLN I NE2 1 
ATOM   9726 O OXT . GLN J 5 12  ? -21.459 23.011  65.098  1.00 85.16  ? 8   GLN I OXT 1 
HETATM 9727 O O   . HOH K 6 .   ? 16.054  39.394  45.124  1.00 46.99  ? 117 HOH A O   1 
HETATM 9728 O O   . HOH K 6 .   ? 30.775  18.402  25.167  1.00 55.37  ? 118 HOH A O   1 
HETATM 9729 O O   . HOH K 6 .   ? 23.810  25.785  18.659  1.00 47.50  ? 119 HOH A O   1 
HETATM 9730 O O   . HOH K 6 .   ? 9.204   15.173  20.162  1.00 57.58  ? 120 HOH A O   1 
HETATM 9731 O O   . HOH L 6 .   ? 25.962  36.301  49.222  1.00 59.48  ? 118 HOH B O   1 
HETATM 9732 O O   . HOH L 6 .   ? 0.942   27.974  48.446  1.00 43.34  ? 119 HOH B O   1 
HETATM 9733 O O   . HOH L 6 .   ? 20.523  41.079  40.673  1.00 41.54  ? 120 HOH B O   1 
HETATM 9734 O O   . HOH L 6 .   ? 0.009   30.628  47.632  1.00 6.19   ? 121 HOH B O   1 
HETATM 9735 O O   . HOH M 6 .   ? 14.775  61.579  69.694  1.00 40.92  ? 182 HOH C O   1 
HETATM 9736 O O   . HOH M 6 .   ? 13.407  66.993  40.047  1.00 26.75  ? 183 HOH C O   1 
HETATM 9737 O O   . HOH M 6 .   ? 18.633  62.998  68.702  1.00 36.24  ? 184 HOH C O   1 
HETATM 9738 O O   . HOH M 6 .   ? 5.468   51.601  42.587  1.00 31.43  ? 185 HOH C O   1 
HETATM 9739 O O   . HOH M 6 .   ? 0.758   75.696  51.355  1.00 39.18  ? 186 HOH C O   1 
HETATM 9740 O O   . HOH M 6 .   ? 6.772   42.377  45.649  1.00 44.22  ? 187 HOH C O   1 
HETATM 9741 O O   . HOH M 6 .   ? 11.585  64.032  63.516  1.00 40.28  ? 188 HOH C O   1 
HETATM 9742 O O   . HOH M 6 .   ? 13.597  68.581  67.098  1.00 38.13  ? 189 HOH C O   1 
HETATM 9743 O O   . HOH M 6 .   ? 7.333   61.030  43.172  1.00 37.26  ? 190 HOH C O   1 
HETATM 9744 O O   . HOH M 6 .   ? 20.054  67.922  36.999  1.00 45.52  ? 191 HOH C O   1 
HETATM 9745 O O   . HOH M 6 .   ? 9.668   54.000  38.203  1.00 41.11  ? 192 HOH C O   1 
HETATM 9746 O O   . HOH M 6 .   ? 12.104  70.791  42.180  1.00 30.77  ? 193 HOH C O   1 
HETATM 9747 O O   . HOH M 6 .   ? 2.707   55.829  47.252  1.00 41.69  ? 194 HOH C O   1 
HETATM 9748 O O   . HOH M 6 .   ? 20.850  62.214  43.093  1.00 34.35  ? 195 HOH C O   1 
HETATM 9749 O O   . HOH M 6 .   ? 25.195  66.979  60.747  1.00 49.58  ? 196 HOH C O   1 
HETATM 9750 O O   . HOH M 6 .   ? 7.122   69.314  65.020  1.00 41.68  ? 197 HOH C O   1 
HETATM 9751 O O   . HOH M 6 .   ? 30.590  70.652  61.655  1.00 38.92  ? 198 HOH C O   1 
HETATM 9752 O O   . HOH M 6 .   ? 6.900   72.230  73.407  1.00 38.43  ? 199 HOH C O   1 
HETATM 9753 O O   . HOH M 6 .   ? 35.557  58.684  60.036  1.00 55.26  ? 200 HOH C O   1 
HETATM 9754 O O   . HOH M 6 .   ? 12.065  68.745  73.082  1.00 52.28  ? 201 HOH C O   1 
HETATM 9755 O O   . HOH M 6 .   ? 9.187   79.110  68.254  1.00 43.23  ? 202 HOH C O   1 
HETATM 9756 O O   . HOH M 6 .   ? 11.599  70.202  44.995  1.00 33.93  ? 203 HOH C O   1 
HETATM 9757 O O   . HOH M 6 .   ? 18.271  56.207  50.593  1.00 39.61  ? 204 HOH C O   1 
HETATM 9758 O O   . HOH M 6 .   ? 13.603  54.003  53.181  1.00 36.99  ? 205 HOH C O   1 
HETATM 9759 O O   . HOH M 6 .   ? 19.314  55.075  57.357  1.00 39.62  ? 206 HOH C O   1 
HETATM 9760 O O   . HOH M 6 .   ? 11.629  58.766  54.709  1.00 49.49  ? 207 HOH C O   1 
HETATM 9761 O O   . HOH M 6 .   ? 0.916   81.683  62.505  1.00 47.90  ? 208 HOH C O   1 
HETATM 9762 O O   . HOH M 6 .   ? 17.602  82.287  63.978  1.00 44.40  ? 209 HOH C O   1 
HETATM 9763 O O   . HOH M 6 .   ? 18.800  67.058  46.049  1.00 36.49  ? 210 HOH C O   1 
HETATM 9764 O O   . HOH M 6 .   ? 10.123  66.982  61.085  1.00 40.66  ? 211 HOH C O   1 
HETATM 9765 O O   . HOH M 6 .   ? 8.317   59.859  49.026  1.00 33.64  ? 212 HOH C O   1 
HETATM 9766 O O   . HOH M 6 .   ? 11.894  52.377  56.118  1.00 39.95  ? 213 HOH C O   1 
HETATM 9767 O O   . HOH M 6 .   ? 5.851   59.721  53.372  1.00 44.19  ? 214 HOH C O   1 
HETATM 9768 O O   . HOH M 6 .   ? 17.628  60.066  49.053  1.00 32.67  ? 215 HOH C O   1 
HETATM 9769 O O   . HOH M 6 .   ? 19.085  63.225  41.048  1.00 41.25  ? 216 HOH C O   1 
HETATM 9770 O O   . HOH M 6 .   ? 7.648   47.762  39.175  1.00 43.63  ? 217 HOH C O   1 
HETATM 9771 O O   . HOH M 6 .   ? 6.052   60.757  50.770  1.00 39.56  ? 218 HOH C O   1 
HETATM 9772 O O   . HOH M 6 .   ? 6.982   62.880  57.550  1.00 42.08  ? 219 HOH C O   1 
HETATM 9773 O O   . HOH M 6 .   ? 10.252  47.585  39.923  1.00 40.54  ? 220 HOH C O   1 
HETATM 9774 O O   . HOH M 6 .   ? 32.363  66.866  38.429  1.00 58.03  ? 221 HOH C O   1 
HETATM 9775 O O   . HOH M 6 .   ? 20.445  78.134  68.091  1.00 45.21  ? 222 HOH C O   1 
HETATM 9776 O O   . HOH M 6 .   ? 14.976  67.257  28.866  1.00 46.27  ? 223 HOH C O   1 
HETATM 9777 O O   . HOH M 6 .   ? 1.163   83.628  49.030  1.00 41.12  ? 224 HOH C O   1 
HETATM 9778 O O   . HOH M 6 .   ? 16.311  70.111  38.870  1.00 48.75  ? 225 HOH C O   1 
HETATM 9779 O O   . HOH M 6 .   ? 6.957   42.724  48.665  1.00 41.52  ? 226 HOH C O   1 
HETATM 9780 O O   . HOH M 6 .   ? 22.695  62.852  65.556  1.00 44.63  ? 227 HOH C O   1 
HETATM 9781 O O   . HOH M 6 .   ? 12.751  83.709  55.193  1.00 49.32  ? 228 HOH C O   1 
HETATM 9782 O O   . HOH M 6 .   ? 20.164  64.902  46.440  1.00 5.90   ? 229 HOH C O   1 
HETATM 9783 O O   . HOH M 6 .   ? 28.992  63.854  33.121  1.00 5.74   ? 230 HOH C O   1 
HETATM 9784 O O   . HOH N 6 .   ? 16.989  89.825  36.057  1.00 33.25  ? 191 HOH D O   1 
HETATM 9785 O O   . HOH N 6 .   ? -0.246  81.373  34.768  1.00 34.29  ? 192 HOH D O   1 
HETATM 9786 O O   . HOH N 6 .   ? 14.499  70.914  37.030  1.00 41.31  ? 193 HOH D O   1 
HETATM 9787 O O   . HOH N 6 .   ? 27.793  48.817  41.316  1.00 37.65  ? 194 HOH D O   1 
HETATM 9788 O O   . HOH N 6 .   ? 4.771   84.111  44.140  1.00 33.95  ? 195 HOH D O   1 
HETATM 9789 O O   . HOH N 6 .   ? 16.360  92.396  34.764  1.00 29.52  ? 196 HOH D O   1 
HETATM 9790 O O   . HOH N 6 .   ? 17.252  83.087  32.817  1.00 27.02  ? 197 HOH D O   1 
HETATM 9791 O O   . HOH N 6 .   ? 11.984  66.208  46.811  1.00 35.87  ? 198 HOH D O   1 
HETATM 9792 O O   . HOH N 6 .   ? -0.681  82.024  26.237  1.00 34.46  ? 199 HOH D O   1 
HETATM 9793 O O   . HOH N 6 .   ? 4.084   64.659  35.187  1.00 30.06  ? 200 HOH D O   1 
HETATM 9794 O O   . HOH N 6 .   ? 13.442  67.875  35.746  1.00 44.13  ? 201 HOH D O   1 
HETATM 9795 O O   . HOH N 6 .   ? 17.407  80.236  35.069  1.00 44.64  ? 202 HOH D O   1 
HETATM 9796 O O   . HOH N 6 .   ? 18.391  90.688  32.847  1.00 39.61  ? 203 HOH D O   1 
HETATM 9797 O O   . HOH N 6 .   ? -0.297  93.375  36.797  1.00 45.67  ? 204 HOH D O   1 
HETATM 9798 O O   . HOH N 6 .   ? 7.202   81.523  29.086  1.00 46.82  ? 205 HOH D O   1 
HETATM 9799 O O   . HOH N 6 .   ? 2.813   80.515  45.309  1.00 36.87  ? 206 HOH D O   1 
HETATM 9800 O O   . HOH N 6 .   ? 1.024   85.681  29.380  1.00 46.53  ? 207 HOH D O   1 
HETATM 9801 O O   . HOH N 6 .   ? 0.541   74.755  36.866  1.00 35.45  ? 208 HOH D O   1 
HETATM 9802 O O   . HOH N 6 .   ? 2.843   74.353  41.809  1.00 38.88  ? 209 HOH D O   1 
HETATM 9803 O O   . HOH N 6 .   ? 20.586  78.552  41.490  1.00 44.51  ? 210 HOH D O   1 
HETATM 9804 O O   . HOH N 6 .   ? 1.603   77.443  47.397  1.00 52.42  ? 211 HOH D O   1 
HETATM 9805 O O   . HOH N 6 .   ? 16.355  93.963  27.805  1.00 61.54  ? 212 HOH D O   1 
HETATM 9806 O O   . HOH N 6 .   ? 19.447  94.437  44.347  1.00 37.49  ? 213 HOH D O   1 
HETATM 9807 O O   . HOH N 6 .   ? 15.069  72.842  33.706  1.00 46.36  ? 214 HOH D O   1 
HETATM 9808 O O   . HOH N 6 .   ? 29.585  40.307  35.831  1.00 56.44  ? 215 HOH D O   1 
HETATM 9809 O O   . HOH N 6 .   ? 20.315  66.762  19.235  1.00 59.66  ? 216 HOH D O   1 
HETATM 9810 O O   . HOH N 6 .   ? 7.328   77.980  46.187  1.00 36.01  ? 217 HOH D O   1 
HETATM 9811 O O   . HOH N 6 .   ? 4.228   71.182  49.528  1.00 45.99  ? 218 HOH D O   1 
HETATM 9812 O O   . HOH N 6 .   ? 34.817  59.173  55.766  1.00 56.00  ? 219 HOH D O   1 
HETATM 9813 O O   . HOH N 6 .   ? 27.773  38.628  33.653  1.00 48.07  ? 220 HOH D O   1 
HETATM 9814 O O   . HOH N 6 .   ? 14.106  103.199 39.976  1.00 49.99  ? 221 HOH D O   1 
HETATM 9815 O O   . HOH N 6 .   ? 26.193  62.683  46.027  1.00 45.71  ? 222 HOH D O   1 
HETATM 9816 O O   . HOH N 6 .   ? 7.683   98.742  32.881  1.00 44.18  ? 223 HOH D O   1 
HETATM 9817 O O   . HOH N 6 .   ? -0.408  104.287 46.175  1.00 58.42  ? 224 HOH D O   1 
HETATM 9818 O O   . HOH N 6 .   ? 11.776  87.407  31.473  1.00 36.78  ? 225 HOH D O   1 
HETATM 9819 O O   . HOH N 6 .   ? 18.651  99.989  40.400  1.00 52.19  ? 226 HOH D O   1 
HETATM 9820 O O   . HOH N 6 .   ? 1.702   74.140  32.183  1.00 41.23  ? 227 HOH D O   1 
HETATM 9821 O O   . HOH N 6 .   ? 8.609   87.430  48.861  1.00 45.70  ? 228 HOH D O   1 
HETATM 9822 O O   . HOH N 6 .   ? 2.089   68.960  36.020  1.00 43.84  ? 229 HOH D O   1 
HETATM 9823 O O   . HOH N 6 .   ? 6.002   53.317  28.987  1.00 51.14  ? 230 HOH D O   1 
HETATM 9824 O O   . HOH N 6 .   ? 12.985  80.336  30.704  1.00 38.27  ? 231 HOH D O   1 
HETATM 9825 O O   . HOH N 6 .   ? 31.048  60.643  29.387  1.00 49.10  ? 232 HOH D O   1 
HETATM 9826 O O   . HOH O 6 .   ? 19.939  49.818  44.893  1.00 50.27  ? 40  HOH P O   1 
HETATM 9827 O O   . HOH O 6 .   ? 29.422  51.068  50.651  1.00 49.42  ? 154 HOH P O   1 
HETATM 9828 O O   . HOH O 6 .   ? 25.842  47.931  40.251  1.00 5.97   ? 182 HOH P O   1 
HETATM 9829 O O   . HOH P 6 .   ? -16.387 -1.200  103.342 1.00 52.84  ? 117 HOH E O   1 
HETATM 9830 O O   . HOH P 6 .   ? -22.273 -7.703  90.797  1.00 65.11  ? 118 HOH E O   1 
HETATM 9831 O O   . HOH P 6 .   ? -17.562 1.067   83.094  1.00 57.36  ? 119 HOH E O   1 
HETATM 9832 O O   . HOH P 6 .   ? -27.451 13.281  86.026  1.00 54.36  ? 120 HOH E O   1 
HETATM 9833 O O   . HOH Q 6 .   ? -14.652 25.290  72.745  1.00 49.66  ? 118 HOH F O   1 
HETATM 9834 O O   . HOH Q 6 .   ? -18.004 20.774  71.764  1.00 53.69  ? 119 HOH F O   1 
HETATM 9835 O O   . HOH Q 6 .   ? 4.151   11.539  85.234  1.00 5.91   ? 120 HOH F O   1 
HETATM 9836 O O   . HOH R 6 .   ? -11.676 40.328  77.527  1.00 42.58  ? 182 HOH G O   1 
HETATM 9837 O O   . HOH R 6 .   ? -7.770  61.514  89.624  1.00 39.31  ? 183 HOH G O   1 
HETATM 9838 O O   . HOH R 6 .   ? -15.179 49.906  89.729  1.00 34.64  ? 184 HOH G O   1 
HETATM 9839 O O   . HOH R 6 .   ? 1.051   49.014  63.551  1.00 52.48  ? 185 HOH G O   1 
HETATM 9840 O O   . HOH R 6 .   ? -4.692  44.045  84.824  1.00 35.59  ? 186 HOH G O   1 
HETATM 9841 O O   . HOH R 6 .   ? -7.522  44.757  90.171  1.00 31.08  ? 187 HOH G O   1 
HETATM 9842 O O   . HOH R 6 .   ? -15.960 27.146  77.201  1.00 45.86  ? 188 HOH G O   1 
HETATM 9843 O O   . HOH R 6 .   ? -13.204 52.170  82.281  1.00 38.04  ? 189 HOH G O   1 
HETATM 9844 O O   . HOH R 6 .   ? 4.295   69.549  80.820  1.00 44.50  ? 190 HOH G O   1 
HETATM 9845 O O   . HOH R 6 .   ? -17.302 48.258  80.592  1.00 48.91  ? 191 HOH G O   1 
HETATM 9846 O O   . HOH R 6 .   ? -0.799  52.892  75.061  1.00 37.14  ? 192 HOH G O   1 
HETATM 9847 O O   . HOH R 6 .   ? -6.694  41.558  71.925  1.00 36.31  ? 193 HOH G O   1 
HETATM 9848 O O   . HOH R 6 .   ? -4.826  46.208  81.950  1.00 35.92  ? 194 HOH G O   1 
HETATM 9849 O O   . HOH R 6 .   ? 0.091   60.217  88.917  1.00 39.51  ? 195 HOH G O   1 
HETATM 9850 O O   . HOH R 6 .   ? -20.115 54.101  70.861  1.00 47.03  ? 196 HOH G O   1 
HETATM 9851 O O   . HOH R 6 .   ? 1.251   67.556  88.896  1.00 38.92  ? 197 HOH G O   1 
HETATM 9852 O O   . HOH R 6 .   ? -5.445  39.115  75.579  1.00 37.01  ? 198 HOH G O   1 
HETATM 9853 O O   . HOH R 6 .   ? -10.813 62.218  68.727  1.00 42.15  ? 199 HOH G O   1 
HETATM 9854 O O   . HOH R 6 .   ? -18.532 45.815  85.175  1.00 37.71  ? 200 HOH G O   1 
HETATM 9855 O O   . HOH R 6 .   ? -8.468  30.770  91.822  1.00 48.92  ? 201 HOH G O   1 
HETATM 9856 O O   . HOH R 6 .   ? -13.041 52.358  66.251  1.00 49.39  ? 202 HOH G O   1 
HETATM 9857 O O   . HOH R 6 .   ? -11.487 36.776  91.885  1.00 36.79  ? 203 HOH G O   1 
HETATM 9858 O O   . HOH R 6 .   ? -20.581 37.581  85.054  1.00 51.25  ? 204 HOH G O   1 
HETATM 9859 O O   . HOH R 6 .   ? -6.638  42.921  74.390  1.00 43.75  ? 205 HOH G O   1 
HETATM 9860 O O   . HOH R 6 .   ? -18.500 54.531  76.466  1.00 49.46  ? 206 HOH G O   1 
HETATM 9861 O O   . HOH R 6 .   ? -21.983 45.911  76.960  1.00 43.21  ? 207 HOH G O   1 
HETATM 9862 O O   . HOH R 6 .   ? -12.875 60.131  73.429  1.00 39.34  ? 208 HOH G O   1 
HETATM 9863 O O   . HOH R 6 .   ? -12.856 44.374  79.612  1.00 35.19  ? 209 HOH G O   1 
HETATM 9864 O O   . HOH R 6 .   ? -4.658  51.584  94.971  1.00 48.12  ? 210 HOH G O   1 
HETATM 9865 O O   . HOH R 6 .   ? -6.696  38.883  78.007  1.00 33.81  ? 211 HOH G O   1 
HETATM 9866 O O   . HOH R 6 .   ? -11.290 53.897  87.283  1.00 41.77  ? 212 HOH G O   1 
HETATM 9867 O O   . HOH R 6 .   ? 6.003   67.756  80.865  1.00 47.55  ? 213 HOH G O   1 
HETATM 9868 O O   . HOH R 6 .   ? -0.118  64.005  90.404  1.00 40.88  ? 214 HOH G O   1 
HETATM 9869 O O   . HOH R 6 .   ? -2.080  33.334  87.479  1.00 45.13  ? 215 HOH G O   1 
HETATM 9870 O O   . HOH R 6 .   ? -13.107 54.083  89.144  1.00 41.64  ? 216 HOH G O   1 
HETATM 9871 O O   . HOH R 6 .   ? -4.556  46.194  68.735  1.00 45.34  ? 217 HOH G O   1 
HETATM 9872 O O   . HOH R 6 .   ? -9.244  66.073  74.836  1.00 47.33  ? 218 HOH G O   1 
HETATM 9873 O O   . HOH R 6 .   ? 5.910   73.941  76.016  1.00 60.85  ? 219 HOH G O   1 
HETATM 9874 O O   . HOH R 6 .   ? -0.179  55.220  67.393  1.00 45.17  ? 220 HOH G O   1 
HETATM 9875 O O   . HOH R 6 .   ? -10.621 59.105  58.614  1.00 55.00  ? 221 HOH G O   1 
HETATM 9876 O O   . HOH R 6 .   ? -10.246 49.785  85.389  1.00 38.91  ? 222 HOH G O   1 
HETATM 9877 O O   . HOH R 6 .   ? -1.280  61.581  90.068  1.00 6.53   ? 223 HOH G O   1 
HETATM 9878 O O   . HOH S 6 .   ? -14.386 58.802  80.953  1.00 33.93  ? 191 HOH H O   1 
HETATM 9879 O O   . HOH S 6 .   ? -22.557 75.039  94.304  1.00 29.78  ? 192 HOH H O   1 
HETATM 9880 O O   . HOH S 6 .   ? -17.725 87.067  86.056  1.00 47.19  ? 193 HOH H O   1 
HETATM 9881 O O   . HOH S 6 .   ? -26.688 72.903  98.229  1.00 43.06  ? 194 HOH H O   1 
HETATM 9882 O O   . HOH S 6 .   ? -17.952 65.500  81.258  1.00 41.88  ? 195 HOH H O   1 
HETATM 9883 O O   . HOH S 6 .   ? -23.470 72.931  88.738  1.00 35.16  ? 196 HOH H O   1 
HETATM 9884 O O   . HOH S 6 .   ? -10.020 47.416  99.032  1.00 36.91  ? 197 HOH H O   1 
HETATM 9885 O O   . HOH S 6 .   ? -7.976  72.771  90.137  1.00 42.92  ? 198 HOH H O   1 
HETATM 9886 O O   . HOH S 6 .   ? -24.371 31.529  78.679  1.00 51.40  ? 199 HOH H O   1 
HETATM 9887 O O   . HOH S 6 .   ? -5.516  72.224  97.420  1.00 38.79  ? 200 HOH H O   1 
HETATM 9888 O O   . HOH S 6 .   ? -18.556 63.599  103.489 1.00 44.53  ? 201 HOH H O   1 
HETATM 9889 O O   . HOH S 6 .   ? -16.620 81.280  100.689 1.00 44.81  ? 202 HOH H O   1 
HETATM 9890 O O   . HOH S 6 .   ? -14.576 79.028  104.196 1.00 43.38  ? 203 HOH H O   1 
HETATM 9891 O O   . HOH S 6 .   ? -21.881 68.344  82.923  1.00 32.82  ? 204 HOH H O   1 
HETATM 9892 O O   . HOH S 6 .   ? -14.232 36.709  91.580  1.00 38.10  ? 205 HOH H O   1 
HETATM 9893 O O   . HOH S 6 .   ? -7.317  66.296  86.925  1.00 44.65  ? 206 HOH H O   1 
HETATM 9894 O O   . HOH S 6 .   ? -32.727 37.650  92.935  1.00 49.71  ? 207 HOH H O   1 
HETATM 9895 O O   . HOH S 6 .   ? -5.693  81.437  97.764  1.00 45.19  ? 208 HOH H O   1 
HETATM 9896 O O   . HOH S 6 .   ? -18.601 57.891  83.755  1.00 56.54  ? 209 HOH H O   1 
HETATM 9897 O O   . HOH S 6 .   ? -30.163 43.803  90.343  1.00 44.82  ? 210 HOH H O   1 
HETATM 9898 O O   . HOH S 6 .   ? -20.590 54.929  95.040  1.00 49.18  ? 211 HOH H O   1 
HETATM 9899 O O   . HOH S 6 .   ? -20.647 53.219  67.110  1.00 45.11  ? 212 HOH H O   1 
HETATM 9900 O O   . HOH S 6 .   ? -19.401 53.611  88.769  1.00 48.61  ? 213 HOH H O   1 
HETATM 9901 O O   . HOH S 6 .   ? -6.218  74.513  95.981  1.00 38.48  ? 214 HOH H O   1 
HETATM 9902 O O   . HOH S 6 .   ? -8.121  76.201  102.434 1.00 46.49  ? 215 HOH H O   1 
HETATM 9903 O O   . HOH S 6 .   ? -26.984 76.001  99.757  1.00 39.89  ? 216 HOH H O   1 
HETATM 9904 O O   . HOH S 6 .   ? -18.199 53.447  92.334  1.00 49.29  ? 217 HOH H O   1 
HETATM 9905 O O   . HOH S 6 .   ? -28.617 44.345  71.535  1.00 52.69  ? 218 HOH H O   1 
HETATM 9906 O O   . HOH S 6 .   ? -5.399  51.612  84.732  1.00 39.10  ? 219 HOH H O   1 
HETATM 9907 O O   . HOH S 6 .   ? -20.570 69.662  98.859  1.00 38.45  ? 220 HOH H O   1 
HETATM 9908 O O   . HOH T 6 .   ? -17.222 25.908  80.120  1.00 42.32  ? 39  HOH I O   1 
HETATM 9909 O O   . HOH T 6 .   ? -20.620 23.718  82.395  1.00 38.30  ? 60  HOH I O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   2   2   GLN GLN A . n 
A 1 2   VAL 2   3   3   VAL VAL A . n 
A 1 3   ARG 3   4   4   ARG ARG A . n 
A 1 4   GLN 4   5   5   GLN GLN A . n 
A 1 5   SER 5   6   6   SER SER A . n 
A 1 6   PRO 6   7   7   PRO PRO A . n 
A 1 7   GLN 7   8   8   GLN GLN A . n 
A 1 8   SER 8   9   9   SER SER A . n 
A 1 9   LEU 9   10  10  LEU LEU A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  TRP 12  13  13  TRP TRP A . n 
A 1 13  GLU 13  14  14  GLU GLU A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  GLU 15  16  16  GLU GLU A . n 
A 1 16  THR 16  17  17  THR THR A . n 
A 1 17  ALA 17  18  18  ALA ALA A . n 
A 1 18  ILE 18  19  19  ILE ILE A . n 
A 1 19  LEU 19  20  20  LEU LEU A . n 
A 1 20  ASN 20  21  21  ASN ASN A . n 
A 1 21  CYS 21  22  22  CYS CYS A . n 
A 1 22  SER 22  23  23  SER SER A . n 
A 1 23  TYR 23  24  24  TYR TYR A . n 
A 1 24  GLU 24  25  25  GLU GLU A . n 
A 1 25  ASN 25  26  26  ASN ASN A . n 
A 1 26  SER 26  27  27  SER SER A . n 
A 1 27  ALA 27  28  28  ALA ALA A . n 
A 1 28  PHE 28  29  29  PHE PHE A . n 
A 1 29  ASP 29  30  30  ASP ASP A . n 
A 1 30  TYR 30  31  31  TYR TYR A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  PRO 32  33  33  PRO PRO A . n 
A 1 33  TRP 33  34  34  TRP TRP A . n 
A 1 34  TYR 34  35  35  TYR TYR A . n 
A 1 35  GLN 35  36  36  GLN GLN A . n 
A 1 36  GLN 36  37  37  GLN GLN A . n 
A 1 37  PHE 37  38  38  PHE PHE A . n 
A 1 38  PRO 38  39  39  PRO PRO A . n 
A 1 39  GLY 39  40  40  GLY GLY A . n 
A 1 40  GLU 40  41  41  GLU GLU A . n 
A 1 41  GLY 41  42  42  GLY GLY A . n 
A 1 42  PRO 42  43  43  PRO PRO A . n 
A 1 43  ALA 43  44  44  ALA ALA A . n 
A 1 44  LEU 44  45  45  LEU LEU A . n 
A 1 45  LEU 45  46  46  LEU LEU A . n 
A 1 46  ILE 46  47  47  ILE ILE A . n 
A 1 47  SER 47  48  48  SER SER A . n 
A 1 48  ILE 48  49  49  ILE ILE A . n 
A 1 49  LEU 49  50  50  LEU LEU A . n 
A 1 50  SER 50  51  51  SER SER A . n 
A 1 51  VAL 51  52  52  VAL VAL A . n 
A 1 52  SER 52  53  53  SER SER A . n 
A 1 53  ASP 53  54  54  ASP ASP A . n 
A 1 54  LYS 54  55  55  LYS LYS A . n 
A 1 55  LYS 55  56  56  LYS LYS A . n 
A 1 56  GLU 56  57  57  GLU GLU A . n 
A 1 57  ASP 57  58  58  ASP ASP A . n 
A 1 58  GLY 58  59  59  GLY GLY A . n 
A 1 59  ARG 59  61  61  ARG ARG A . n 
A 1 60  PHE 60  62  62  PHE PHE A . n 
A 1 61  THR 61  63  63  THR THR A . n 
A 1 62  ILE 62  64  64  ILE ILE A . n 
A 1 63  PHE 63  65  65  PHE PHE A . n 
A 1 64  PHE 64  66  66  PHE PHE A . n 
A 1 65  ASN 65  67  67  ASN ASN A . n 
A 1 66  LYS 66  68  68  LYS LYS A . n 
A 1 67  ARG 67  69  69  ARG ARG A . n 
A 1 68  GLU 68  70  70  GLU GLU A . n 
A 1 69  LYS 69  71  71  LYS LYS A . n 
A 1 70  LYS 70  72  72  LYS LYS A . n 
A 1 71  LEU 71  73  73  LEU LEU A . n 
A 1 72  SER 72  74  74  SER SER A . n 
A 1 73  LEU 73  75  75  LEU LEU A . n 
A 1 74  HIS 74  76  76  HIS HIS A . n 
A 1 75  ILE 75  77  77  ILE ILE A . n 
A 1 76  ALA 76  78  78  ALA ALA A . n 
A 1 77  ASP 77  79  79  ASP ASP A . n 
A 1 78  SER 78  80  80  SER SER A . n 
A 1 79  GLN 79  81  81  GLN GLN A . n 
A 1 80  PRO 80  82  82  PRO PRO A . n 
A 1 81  GLY 81  83  83  GLY GLY A . n 
A 1 82  ASP 82  84  84  ASP ASP A . n 
A 1 83  SER 83  85  85  SER SER A . n 
A 1 84  ALA 84  86  86  ALA ALA A . n 
A 1 85  THR 85  87  87  THR THR A . n 
A 1 86  TYR 86  88  88  TYR TYR A . n 
A 1 87  PHE 87  89  89  PHE PHE A . n 
A 1 88  CYS 88  90  90  CYS CYS A . n 
A 1 89  ALA 89  91  91  ALA ALA A . n 
A 1 90  ALA 90  92  92  ALA ALA A . n 
A 1 91  SER 91  93  93  SER SER A . n 
A 1 92  ALA 92  98  98  ALA ALA A . n 
A 1 93  ASN 93  99  99  ASN ASN A . n 
A 1 94  SER 94  100 100 SER SER A . n 
A 1 95  GLY 95  101 101 GLY GLY A . n 
A 1 96  THR 96  102 102 THR THR A . n 
A 1 97  TYR 97  103 103 TYR TYR A . n 
A 1 98  GLN 98  104 104 GLN GLN A . n 
A 1 99  ARG 99  105 105 ARG ARG A . n 
A 1 100 PHE 100 106 106 PHE PHE A . n 
A 1 101 GLY 101 107 107 GLY GLY A . n 
A 1 102 THR 102 108 108 THR THR A . n 
A 1 103 GLY 103 109 109 GLY GLY A . n 
A 1 104 THR 104 110 110 THR THR A . n 
A 1 105 LYS 105 111 111 LYS LYS A . n 
A 1 106 LEU 106 112 112 LEU LEU A . n 
A 1 107 GLN 107 113 113 GLN GLN A . n 
A 1 108 VAL 108 114 114 VAL VAL A . n 
A 1 109 VAL 109 115 115 VAL VAL A . n 
A 1 110 PRO 110 116 116 PRO PRO A . n 
B 2 1   ALA 1   3   3   ALA ALA B . n 
B 2 2   VAL 2   4   4   VAL VAL B . n 
B 2 3   THR 3   5   5   THR THR B . n 
B 2 4   GLN 4   6   6   GLN GLN B . n 
B 2 5   SER 5   7   7   SER SER B . n 
B 2 6   PRO 6   8   8   PRO PRO B . n 
B 2 7   ARG 7   9   9   ARG ARG B . n 
B 2 8   ASN 8   10  10  ASN ASN B . n 
B 2 9   LYS 9   11  11  LYS LYS B . n 
B 2 10  VAL 10  12  12  VAL VAL B . n 
B 2 11  ALA 11  13  13  ALA ALA B . n 
B 2 12  VAL 12  14  14  VAL VAL B . n 
B 2 13  THR 13  15  15  THR THR B . n 
B 2 14  GLY 14  16  16  GLY GLY B . n 
B 2 15  GLU 15  17  17  GLU GLU B . n 
B 2 16  LYS 16  18  18  LYS LYS B . n 
B 2 17  VAL 17  19  19  VAL VAL B . n 
B 2 18  THR 18  20  20  THR THR B . n 
B 2 19  LEU 19  21  21  LEU LEU B . n 
B 2 20  SER 20  22  22  SER SER B . n 
B 2 21  CYS 21  23  23  CYS CYS B . n 
B 2 22  ASN 22  24  24  ASN ASN B . n 
B 2 23  GLN 23  25  25  GLN GLN B . n 
B 2 24  THR 24  26  26  THR THR B . n 
B 2 25  ASN 25  27  27  ASN ASN B . n 
B 2 26  ASN 26  28  28  ASN ASN B . n 
B 2 27  HIS 27  29  29  HIS HIS B . n 
B 2 28  ASN 28  30  30  ASN ASN B . n 
B 2 29  ASN 29  31  31  ASN ASN B . n 
B 2 30  MET 30  32  32  MET MET B . n 
B 2 31  TYR 31  33  33  TYR TYR B . n 
B 2 32  TRP 32  34  34  TRP TRP B . n 
B 2 33  TYR 33  35  35  TYR TYR B . n 
B 2 34  ARG 34  36  36  ARG ARG B . n 
B 2 35  GLN 35  37  37  GLN GLN B . n 
B 2 36  ASP 36  38  38  ASP ASP B . n 
B 2 37  THR 37  39  39  THR THR B . n 
B 2 38  GLY 38  40  40  GLY GLY B . n 
B 2 39  HIS 39  41  41  HIS HIS B . n 
B 2 40  GLY 40  42  42  GLY GLY B . n 
B 2 41  LEU 41  43  43  LEU LEU B . n 
B 2 42  ARG 42  44  44  ARG ARG B . n 
B 2 43  LEU 43  45  45  LEU LEU B . n 
B 2 44  ILE 44  46  46  ILE ILE B . n 
B 2 45  TYR 45  47  47  TYR TYR B . n 
B 2 46  TYR 46  48  48  TYR TYR B . n 
B 2 47  SER 47  49  49  SER SER B . n 
B 2 48  TYR 48  50  50  TYR TYR B . n 
B 2 49  GLY 49  51  51  GLY GLY B . n 
B 2 50  ALA 50  52  52  ALA ALA B . n 
B 2 51  GLY 51  53  53  GLY GLY B . n 
B 2 52  SER 52  54  54  SER SER B . n 
B 2 53  THR 53  55  55  THR THR B . n 
B 2 54  GLU 54  56  56  GLU GLU B . n 
B 2 55  LYS 55  57  57  LYS LYS B . n 
B 2 56  GLY 56  58  58  GLY GLY B . n 
B 2 57  ASP 57  59  59  ASP ASP B . n 
B 2 58  ILE 58  60  60  ILE ILE B . n 
B 2 59  PRO 59  61  61  PRO PRO B . n 
B 2 60  ASP 60  62  62  ASP ASP B . n 
B 2 61  GLY 61  63  63  GLY GLY B . n 
B 2 62  TYR 62  65  65  TYR TYR B . n 
B 2 63  LYS 63  66  66  LYS LYS B . n 
B 2 64  ALA 64  67  67  ALA ALA B . n 
B 2 65  SER 65  68  68  SER SER B . n 
B 2 66  ARG 66  69  69  ARG ARG B . n 
B 2 67  PRO 67  70  70  PRO PRO B . n 
B 2 68  SER 68  71  71  SER SER B . n 
B 2 69  GLN 69  72  72  GLN GLN B . n 
B 2 70  GLU 70  73  73  GLU GLU B . n 
B 2 71  ASN 71  74  74  ASN ASN B . n 
B 2 72  PHE 72  75  75  PHE PHE B . n 
B 2 73  SER 73  76  76  SER SER B . n 
B 2 74  LEU 74  77  77  LEU LEU B . n 
B 2 75  THR 75  78  78  THR THR B . n 
B 2 76  LEU 76  79  79  LEU LEU B . n 
B 2 77  GLU 77  80  80  GLU GLU B . n 
B 2 78  SER 78  81  81  SER SER B . n 
B 2 79  ALA 79  82  82  ALA ALA B . n 
B 2 80  THR 80  83  83  THR THR B . n 
B 2 81  PRO 81  84  84  PRO PRO B . n 
B 2 82  SER 82  85  85  SER SER B . n 
B 2 83  GLN 83  86  86  GLN GLN B . n 
B 2 84  THR 84  87  87  THR THR B . n 
B 2 85  SER 85  88  88  SER SER B . n 
B 2 86  VAL 86  89  89  VAL VAL B . n 
B 2 87  TYR 87  90  90  TYR TYR B . n 
B 2 88  PHE 88  91  91  PHE PHE B . n 
B 2 89  CYS 89  92  92  CYS CYS B . n 
B 2 90  ALA 90  93  93  ALA ALA B . n 
B 2 91  SER 91  94  94  SER SER B . n 
B 2 92  GLY 92  95  95  GLY GLY B . n 
B 2 93  ASP 93  96  96  ASP ASP B . n 
B 2 94  ALA 94  97  97  ALA ALA B . n 
B 2 95  GLY 95  98  98  GLY GLY B . n 
B 2 96  GLY 96  99  99  GLY GLY B . n 
B 2 97  GLY 97  100 100 GLY GLY B . n 
B 2 98  TYR 98  104 104 TYR TYR B . n 
B 2 99  GLU 99  105 105 GLU GLU B . n 
B 2 100 GLN 100 106 106 GLN GLN B . n 
B 2 101 TYR 101 107 107 TYR TYR B . n 
B 2 102 PHE 102 108 108 PHE PHE B . n 
B 2 103 GLY 103 109 109 GLY GLY B . n 
B 2 104 PRO 104 110 110 PRO PRO B . n 
B 2 105 GLY 105 111 111 GLY GLY B . n 
B 2 106 THR 106 112 112 THR THR B . n 
B 2 107 ARG 107 113 113 ARG ARG B . n 
B 2 108 LEU 108 114 114 LEU LEU B . n 
B 2 109 THR 109 115 115 THR THR B . n 
B 2 110 VAL 110 116 116 VAL VAL B . n 
B 2 111 LEU 111 117 117 LEU LEU B . n 
C 3 1   ILE 1   1   1   ILE ILE C . n 
C 3 2   GLU 2   2   2   GLU GLU C . n 
C 3 3   ALA 3   3   3   ALA ALA C . n 
C 3 4   ASP 4   4   4   ASP ASP C . n 
C 3 5   HIS 5   5   5   HIS HIS C . n 
C 3 6   VAL 6   6   6   VAL VAL C . n 
C 3 7   GLY 7   7   7   GLY GLY C . n 
C 3 8   SER 8   8   8   SER SER C . n 
C 3 9   TYR 9   9   9   TYR TYR C . n 
C 3 10  GLY 10  9   9   GLY GLY C A n 
C 3 11  ILE 11  10  10  ILE ILE C . n 
C 3 12  VAL 12  11  11  VAL VAL C . n 
C 3 13  VAL 13  12  12  VAL VAL C . n 
C 3 14  TYR 14  13  13  TYR TYR C . n 
C 3 15  GLN 15  14  14  GLN GLN C . n 
C 3 16  SER 16  15  15  SER SER C . n 
C 3 17  PRO 17  16  16  PRO PRO C . n 
C 3 18  GLY 18  17  17  GLY GLY C . n 
C 3 19  ASP 19  18  18  ASP ASP C . n 
C 3 20  ILE 20  19  19  ILE ILE C . n 
C 3 21  GLY 21  20  20  GLY GLY C . n 
C 3 22  GLN 22  21  21  GLN GLN C . n 
C 3 23  TYR 23  22  22  TYR TYR C . n 
C 3 24  THR 24  23  23  THR THR C . n 
C 3 25  PHE 25  24  24  PHE PHE C . n 
C 3 26  GLU 26  25  25  GLU GLU C . n 
C 3 27  PHE 27  26  26  PHE PHE C . n 
C 3 28  ASP 28  27  27  ASP ASP C . n 
C 3 29  GLY 29  28  28  GLY GLY C . n 
C 3 30  ASP 30  29  29  ASP ASP C . n 
C 3 31  GLU 31  30  30  GLU GLU C . n 
C 3 32  LEU 32  31  31  LEU LEU C . n 
C 3 33  PHE 33  32  32  PHE PHE C . n 
C 3 34  TYR 34  33  33  TYR TYR C . n 
C 3 35  VAL 35  34  34  VAL VAL C . n 
C 3 36  ASP 36  35  35  ASP ASP C . n 
C 3 37  LEU 37  36  36  LEU LEU C . n 
C 3 38  ASP 38  37  37  ASP ASP C . n 
C 3 39  LYS 39  38  38  LYS LYS C . n 
C 3 40  LYS 40  39  39  LYS LYS C . n 
C 3 41  GLU 41  40  40  GLU GLU C . n 
C 3 42  THR 42  41  41  THR THR C . n 
C 3 43  ILE 43  42  42  ILE ILE C . n 
C 3 44  TRP 44  43  43  TRP TRP C . n 
C 3 45  MET 45  44  44  MET MET C . n 
C 3 46  LEU 46  45  45  LEU LEU C . n 
C 3 47  PRO 47  46  46  PRO PRO C . n 
C 3 48  GLU 48  47  47  GLU GLU C . n 
C 3 49  PHE 49  48  48  PHE PHE C . n 
C 3 50  ALA 50  49  49  ALA ALA C . n 
C 3 51  GLN 51  50  50  GLN GLN C . n 
C 3 52  LEU 52  51  51  LEU LEU C . n 
C 3 53  ARG 53  52  52  ARG ARG C . n 
C 3 54  SER 54  53  53  SER SER C . n 
C 3 55  PHE 55  54  54  PHE PHE C . n 
C 3 56  ASP 56  55  55  ASP ASP C . n 
C 3 57  PRO 57  56  56  PRO PRO C . n 
C 3 58  GLN 58  57  57  GLN GLN C . n 
C 3 59  GLY 59  58  58  GLY GLY C . n 
C 3 60  GLY 60  59  59  GLY GLY C . n 
C 3 61  LEU 61  60  60  LEU LEU C . n 
C 3 62  GLN 62  61  61  GLN GLN C . n 
C 3 63  ASN 63  62  62  ASN ASN C . n 
C 3 64  ILE 64  63  63  ILE ILE C . n 
C 3 65  ALA 65  64  64  ALA ALA C . n 
C 3 66  THR 66  65  65  THR THR C . n 
C 3 67  GLY 67  66  66  GLY GLY C . n 
C 3 68  LYS 68  67  67  LYS LYS C . n 
C 3 69  HIS 69  68  68  HIS HIS C . n 
C 3 70  ASN 70  69  69  ASN ASN C . n 
C 3 71  LEU 71  70  70  LEU LEU C . n 
C 3 72  GLY 72  71  71  GLY GLY C . n 
C 3 73  VAL 73  72  72  VAL VAL C . n 
C 3 74  LEU 74  73  73  LEU LEU C . n 
C 3 75  THR 75  74  74  THR THR C . n 
C 3 76  LYS 76  75  75  LYS LYS C . n 
C 3 77  ARG 77  76  76  ARG ARG C . n 
C 3 78  SER 78  77  77  SER SER C . n 
C 3 79  ASN 79  78  78  ASN ASN C . n 
C 3 80  SER 80  79  79  SER SER C . n 
C 3 81  THR 81  80  80  THR THR C . n 
C 3 82  PRO 82  81  81  PRO PRO C . n 
C 3 83  ALA 83  82  82  ALA ALA C . n 
C 3 84  THR 84  83  83  THR THR C . n 
C 3 85  ASN 85  84  84  ASN ASN C . n 
C 3 86  GLU 86  85  85  GLU GLU C . n 
C 3 87  ALA 87  86  86  ALA ALA C . n 
C 3 88  PRO 88  87  87  PRO PRO C . n 
C 3 89  GLN 89  88  88  GLN GLN C . n 
C 3 90  ALA 90  89  89  ALA ALA C . n 
C 3 91  THR 91  90  90  THR THR C . n 
C 3 92  VAL 92  91  91  VAL VAL C . n 
C 3 93  PHE 93  92  92  PHE PHE C . n 
C 3 94  PRO 94  93  93  PRO PRO C . n 
C 3 95  LYS 95  94  94  LYS LYS C . n 
C 3 96  SER 96  95  95  SER SER C . n 
C 3 97  PRO 97  96  96  PRO PRO C . n 
C 3 98  VAL 98  97  97  VAL VAL C . n 
C 3 99  LEU 99  98  98  LEU LEU C . n 
C 3 100 LEU 100 99  99  LEU LEU C . n 
C 3 101 GLY 101 100 100 GLY GLY C . n 
C 3 102 GLN 102 101 101 GLN GLN C . n 
C 3 103 PRO 103 102 102 PRO PRO C . n 
C 3 104 ASN 104 103 103 ASN ASN C . n 
C 3 105 THR 105 104 104 THR THR C . n 
C 3 106 LEU 106 105 105 LEU LEU C . n 
C 3 107 ILE 107 106 106 ILE ILE C . n 
C 3 108 CYS 108 107 107 CYS CYS C . n 
C 3 109 PHE 109 108 108 PHE PHE C . n 
C 3 110 VAL 110 109 109 VAL VAL C . n 
C 3 111 ASP 111 110 110 ASP ASP C . n 
C 3 112 ASN 112 111 111 ASN ASN C . n 
C 3 113 ILE 113 112 112 ILE ILE C . n 
C 3 114 PHE 114 113 113 PHE PHE C . n 
C 3 115 PRO 115 114 114 PRO PRO C . n 
C 3 116 PRO 116 115 115 PRO PRO C . n 
C 3 117 VAL 117 116 116 VAL VAL C . n 
C 3 118 ILE 118 117 117 ILE ILE C . n 
C 3 119 ASN 119 118 118 ASN ASN C . n 
C 3 120 ILE 120 119 119 ILE ILE C . n 
C 3 121 THR 121 120 120 THR THR C . n 
C 3 122 TRP 122 121 121 TRP TRP C . n 
C 3 123 LEU 123 122 122 LEU LEU C . n 
C 3 124 ARG 124 123 123 ARG ARG C . n 
C 3 125 ASN 125 124 124 ASN ASN C . n 
C 3 126 SER 126 125 125 SER SER C . n 
C 3 127 LYS 127 126 126 LYS LYS C . n 
C 3 128 SER 128 127 127 SER SER C . n 
C 3 129 VAL 129 128 128 VAL VAL C . n 
C 3 130 ALA 130 129 129 ALA ALA C . n 
C 3 131 ASP 131 130 130 ASP ASP C . n 
C 3 132 GLY 132 131 131 GLY GLY C . n 
C 3 133 VAL 133 132 132 VAL VAL C . n 
C 3 134 TYR 134 133 133 TYR TYR C . n 
C 3 135 GLU 135 134 134 GLU GLU C . n 
C 3 136 THR 136 135 135 THR THR C . n 
C 3 137 SER 137 136 136 SER SER C . n 
C 3 138 PHE 138 137 137 PHE PHE C . n 
C 3 139 PHE 139 138 138 PHE PHE C . n 
C 3 140 VAL 140 139 139 VAL VAL C . n 
C 3 141 ASN 141 140 140 ASN ASN C . n 
C 3 142 ARG 142 141 141 ARG ARG C . n 
C 3 143 ASP 143 142 142 ASP ASP C . n 
C 3 144 TYR 144 143 143 TYR TYR C . n 
C 3 145 SER 145 144 144 SER SER C . n 
C 3 146 PHE 146 145 145 PHE PHE C . n 
C 3 147 HIS 147 146 146 HIS HIS C . n 
C 3 148 LYS 148 147 147 LYS LYS C . n 
C 3 149 LEU 149 148 148 LEU LEU C . n 
C 3 150 SER 150 149 149 SER SER C . n 
C 3 151 TYR 151 150 150 TYR TYR C . n 
C 3 152 LEU 152 151 151 LEU LEU C . n 
C 3 153 THR 153 152 152 THR THR C . n 
C 3 154 PHE 154 153 153 PHE PHE C . n 
C 3 155 ILE 155 154 154 ILE ILE C . n 
C 3 156 PRO 156 155 155 PRO PRO C . n 
C 3 157 SER 157 156 156 SER SER C . n 
C 3 158 ASP 158 157 157 ASP ASP C . n 
C 3 159 ASP 159 158 158 ASP ASP C . n 
C 3 160 ASP 160 159 159 ASP ASP C . n 
C 3 161 ILE 161 160 160 ILE ILE C . n 
C 3 162 TYR 162 161 161 TYR TYR C . n 
C 3 163 ASP 163 162 162 ASP ASP C . n 
C 3 164 CYS 164 163 163 CYS CYS C . n 
C 3 165 LYS 165 164 164 LYS LYS C . n 
C 3 166 VAL 166 165 165 VAL VAL C . n 
C 3 167 GLU 167 166 166 GLU GLU C . n 
C 3 168 HIS 168 167 167 HIS HIS C . n 
C 3 169 TRP 169 168 168 TRP TRP C . n 
C 3 170 GLY 170 169 169 GLY GLY C . n 
C 3 171 LEU 171 170 170 LEU LEU C . n 
C 3 172 GLU 172 171 171 GLU GLU C . n 
C 3 173 GLU 173 172 172 GLU GLU C . n 
C 3 174 PRO 174 173 173 PRO PRO C . n 
C 3 175 VAL 175 174 174 VAL VAL C . n 
C 3 176 LEU 176 175 175 LEU LEU C . n 
C 3 177 LYS 177 176 176 LYS LYS C . n 
C 3 178 HIS 178 177 177 HIS HIS C . n 
C 3 179 TRP 179 178 178 TRP TRP C . n 
C 3 180 GLU 180 179 179 GLU GLU C . n 
C 3 181 PRO 181 180 180 PRO PRO C . n 
C 3 182 GLU 182 181 181 GLU GLU C . n 
D 4 1   GLY 1   1   1   GLY GLY D . n 
D 4 2   ASP 2   2   2   ASP ASP D . n 
D 4 3   SER 3   3   3   SER SER D . n 
D 4 4   GLU 4   4   4   GLU GLU D . n 
D 4 5   ARG 5   5   5   ARG ARG D . n 
D 4 6   HIS 6   6   6   HIS HIS D . n 
D 4 7   PHE 7   7   7   PHE PHE D . n 
D 4 8   VAL 8   8   8   VAL VAL D . n 
D 4 9   VAL 9   9   9   VAL VAL D . n 
D 4 10  GLN 10  10  10  GLN GLN D . n 
D 4 11  PHE 11  11  11  PHE PHE D . n 
D 4 12  GLN 12  12  12  GLN GLN D . n 
D 4 13  PRO 13  13  13  PRO PRO D . n 
D 4 14  PHE 14  14  14  PHE PHE D . n 
D 4 15  CYS 15  15  15  CYS CYS D . n 
D 4 16  TYR 16  16  16  TYR TYR D . n 
D 4 17  PHE 17  17  17  PHE PHE D . n 
D 4 18  THR 18  18  18  THR THR D . n 
D 4 19  ASN 19  19  19  ASN ASN D . n 
D 4 20  GLY 20  20  20  GLY GLY D . n 
D 4 21  THR 21  21  21  THR THR D . n 
D 4 22  GLN 22  22  22  GLN GLN D . n 
D 4 23  ARG 23  23  23  ARG ARG D . n 
D 4 24  ILE 24  24  24  ILE ILE D . n 
D 4 25  ARG 25  25  25  ARG ARG D . n 
D 4 26  TYR 26  26  26  TYR TYR D . n 
D 4 27  VAL 27  27  27  VAL VAL D . n 
D 4 28  THR 28  28  28  THR THR D . n 
D 4 29  ARG 29  29  29  ARG ARG D . n 
D 4 30  TYR 30  30  30  TYR TYR D . n 
D 4 31  ILE 31  31  31  ILE ILE D . n 
D 4 32  TYR 32  32  32  TYR TYR D . n 
D 4 33  ASN 33  33  33  ASN ASN D . n 
D 4 34  ARG 34  34  34  ARG ARG D . n 
D 4 35  GLU 35  35  35  GLU GLU D . n 
D 4 36  GLU 36  36  36  GLU GLU D . n 
D 4 37  TYR 37  37  37  TYR TYR D . n 
D 4 38  LEU 38  38  38  LEU LEU D . n 
D 4 39  ARG 39  39  39  ARG ARG D . n 
D 4 40  PHE 40  40  40  PHE PHE D . n 
D 4 41  ASP 41  41  41  ASP ASP D . n 
D 4 42  SER 42  42  42  SER SER D . n 
D 4 43  ASP 43  43  43  ASP ASP D . n 
D 4 44  VAL 44  44  44  VAL VAL D . n 
D 4 45  GLY 45  45  45  GLY GLY D . n 
D 4 46  GLU 46  46  46  GLU GLU D . n 
D 4 47  TYR 47  47  47  TYR TYR D . n 
D 4 48  ARG 48  48  48  ARG ARG D . n 
D 4 49  ALA 49  49  49  ALA ALA D . n 
D 4 50  VAL 50  50  50  VAL VAL D . n 
D 4 51  THR 51  51  51  THR THR D . n 
D 4 52  GLU 52  52  52  GLU GLU D . n 
D 4 53  LEU 53  53  53  LEU LEU D . n 
D 4 54  GLY 54  54  54  GLY GLY D . n 
D 4 55  ARG 55  55  55  ARG ARG D . n 
D 4 56  PRO 56  56  56  PRO PRO D . n 
D 4 57  ASP 57  57  57  ASP ASP D . n 
D 4 58  ALA 58  58  58  ALA ALA D . n 
D 4 59  GLU 59  59  59  GLU GLU D . n 
D 4 60  TYR 60  60  60  TYR TYR D . n 
D 4 61  TYR 61  61  61  TYR TYR D . n 
D 4 62  ASN 62  62  62  ASN ASN D . n 
D 4 63  LYS 63  63  63  LYS LYS D . n 
D 4 64  GLN 64  64  64  GLN GLN D . n 
D 4 65  TYR 65  67  67  TYR TYR D . n 
D 4 66  LEU 66  68  68  LEU LEU D . n 
D 4 67  GLU 67  69  69  GLU GLU D . n 
D 4 68  ARG 68  70  70  ARG ARG D . n 
D 4 69  THR 69  71  71  THR THR D . n 
D 4 70  ARG 70  72  72  ARG ARG D . n 
D 4 71  ALA 71  73  73  ALA ALA D . n 
D 4 72  GLU 72  74  74  GLU GLU D . n 
D 4 73  LEU 73  75  75  LEU LEU D . n 
D 4 74  ASP 74  76  76  ASP ASP D . n 
D 4 75  THR 75  77  77  THR THR D . n 
D 4 76  VAL 76  78  78  VAL VAL D . n 
D 4 77  CYS 77  79  79  CYS CYS D . n 
D 4 78  ARG 78  80  80  ARG ARG D . n 
D 4 79  TYR 79  81  81  TYR TYR D . n 
D 4 80  ASN 80  82  82  ASN ASN D . n 
D 4 81  TYR 81  83  83  TYR TYR D . n 
D 4 82  GLU 82  84  84  GLU GLU D . n 
D 4 83  GLU 83  84  84  GLU GLU D A n 
D 4 84  THR 84  85  85  THR THR D . n 
D 4 85  GLU 85  86  86  GLU GLU D . n 
D 4 86  VAL 86  87  87  VAL VAL D . n 
D 4 87  PRO 87  88  88  PRO PRO D . n 
D 4 88  THR 88  89  89  THR THR D . n 
D 4 89  SER 89  90  90  SER SER D . n 
D 4 90  LEU 90  91  91  LEU LEU D . n 
D 4 91  ARG 91  92  92  ARG ARG D . n 
D 4 92  ARG 92  93  93  ARG ARG D . n 
D 4 93  LEU 93  94  94  LEU LEU D . n 
D 4 94  GLU 94  95  95  GLU GLU D . n 
D 4 95  GLN 95  96  96  GLN GLN D . n 
D 4 96  PRO 96  97  97  PRO PRO D . n 
D 4 97  ASN 97  98  98  ASN ASN D . n 
D 4 98  VAL 98  99  99  VAL VAL D . n 
D 4 99  VAL 99  100 100 VAL VAL D . n 
D 4 100 ILE 100 101 101 ILE ILE D . n 
D 4 101 SER 101 102 102 SER SER D . n 
D 4 102 LEU 102 103 103 LEU LEU D . n 
D 4 103 SER 103 104 104 SER SER D . n 
D 4 104 ARG 104 105 105 ARG ARG D . n 
D 4 105 THR 105 106 106 THR THR D . n 
D 4 106 GLU 106 107 107 GLU GLU D . n 
D 4 107 ALA 107 108 108 ALA ALA D . n 
D 4 108 LEU 108 109 109 LEU LEU D . n 
D 4 109 ASN 109 110 110 ASN ASN D . n 
D 4 110 HIS 110 111 111 HIS HIS D . n 
D 4 111 HIS 111 112 112 HIS HIS D . n 
D 4 112 ASN 112 113 113 ASN ASN D . n 
D 4 113 THR 113 114 114 THR THR D . n 
D 4 114 LEU 114 115 115 LEU LEU D . n 
D 4 115 VAL 115 116 116 VAL VAL D . n 
D 4 116 CYS 116 117 117 CYS CYS D . n 
D 4 117 SER 117 118 118 SER SER D . n 
D 4 118 VAL 118 119 119 VAL VAL D . n 
D 4 119 THR 119 120 120 THR THR D . n 
D 4 120 ASP 120 121 121 ASP ASP D . n 
D 4 121 PHE 121 122 122 PHE PHE D . n 
D 4 122 TYR 122 123 123 TYR TYR D . n 
D 4 123 PRO 123 124 124 PRO PRO D . n 
D 4 124 ALA 124 125 125 ALA ALA D . n 
D 4 125 LYS 125 126 126 LYS LYS D . n 
D 4 126 ILE 126 127 127 ILE ILE D . n 
D 4 127 LYS 127 128 128 LYS LYS D . n 
D 4 128 VAL 128 129 129 VAL VAL D . n 
D 4 129 ARG 129 130 130 ARG ARG D . n 
D 4 130 TRP 130 131 131 TRP TRP D . n 
D 4 131 PHE 131 132 132 PHE PHE D . n 
D 4 132 ARG 132 133 133 ARG ARG D . n 
D 4 133 ASN 133 134 134 ASN ASN D . n 
D 4 134 GLY 134 135 135 GLY GLY D . n 
D 4 135 GLN 135 136 136 GLN GLN D . n 
D 4 136 GLU 136 137 137 GLU GLU D . n 
D 4 137 GLU 137 138 138 GLU GLU D . n 
D 4 138 THR 138 139 139 THR THR D . n 
D 4 139 VAL 139 140 140 VAL VAL D . n 
D 4 140 GLY 140 141 141 GLY GLY D . n 
D 4 141 VAL 141 142 142 VAL VAL D . n 
D 4 142 SER 142 143 143 SER SER D . n 
D 4 143 SER 143 144 144 SER SER D . n 
D 4 144 THR 144 145 145 THR THR D . n 
D 4 145 GLN 145 146 146 GLN GLN D . n 
D 4 146 LEU 146 147 147 LEU LEU D . n 
D 4 147 ILE 147 148 148 ILE ILE D . n 
D 4 148 ARG 148 149 149 ARG ARG D . n 
D 4 149 ASN 149 150 150 ASN ASN D . n 
D 4 150 GLY 150 151 151 GLY GLY D . n 
D 4 151 ASP 151 152 152 ASP ASP D . n 
D 4 152 TRP 152 153 153 TRP TRP D . n 
D 4 153 THR 153 154 154 THR THR D . n 
D 4 154 PHE 154 155 155 PHE PHE D . n 
D 4 155 GLN 155 156 156 GLN GLN D . n 
D 4 156 VAL 156 157 157 VAL VAL D . n 
D 4 157 LEU 157 158 158 LEU LEU D . n 
D 4 158 VAL 158 159 159 VAL VAL D . n 
D 4 159 MET 159 160 160 MET MET D . n 
D 4 160 LEU 160 161 161 LEU LEU D . n 
D 4 161 GLU 161 162 162 GLU GLU D . n 
D 4 162 MET 162 163 163 MET MET D . n 
D 4 163 THR 163 164 164 THR THR D . n 
D 4 164 PRO 164 165 165 PRO PRO D . n 
D 4 165 ARG 165 166 166 ARG ARG D . n 
D 4 166 ARG 166 167 167 ARG ARG D . n 
D 4 167 GLY 167 168 168 GLY GLY D . n 
D 4 168 GLU 168 169 169 GLU GLU D . n 
D 4 169 VAL 169 170 170 VAL VAL D . n 
D 4 170 TYR 170 171 171 TYR TYR D . n 
D 4 171 THR 171 172 172 THR THR D . n 
D 4 172 CYS 172 173 173 CYS CYS D . n 
D 4 173 HIS 173 174 174 HIS HIS D . n 
D 4 174 VAL 174 175 175 VAL VAL D . n 
D 4 175 GLU 175 176 176 GLU GLU D . n 
D 4 176 HIS 176 177 177 HIS HIS D . n 
D 4 177 PRO 177 178 178 PRO PRO D . n 
D 4 178 SER 178 179 179 SER SER D . n 
D 4 179 LEU 179 180 180 LEU LEU D . n 
D 4 180 LYS 180 181 181 LYS LYS D . n 
D 4 181 SER 181 182 182 SER SER D . n 
D 4 182 PRO 182 183 183 PRO PRO D . n 
D 4 183 ILE 183 184 184 ILE ILE D . n 
D 4 184 THR 184 185 185 THR THR D . n 
D 4 185 VAL 185 186 186 VAL VAL D . n 
D 4 186 GLU 186 187 187 GLU GLU D . n 
D 4 187 TRP 187 188 188 TRP TRP D . n 
D 4 188 ARG 188 189 189 ARG ARG D . n 
D 4 189 ALA 189 190 190 ALA ALA D . n 
E 5 1   SER 1   -3  -3  SER SER P . n 
E 5 2   ARG 2   -2  -2  ARG ARG P . n 
E 5 3   GLY 3   -1  -1  GLY GLY P . n 
E 5 4   GLY 4   0   0   GLY GLY P . n 
E 5 5   ALA 5   1   1   ALA ALA P . n 
E 5 6   SER 6   2   2   SER SER P . n 
E 5 7   GLN 7   3   3   GLN GLN P . n 
E 5 8   TYR 8   4   4   TYR TYR P . n 
E 5 9   ARG 9   5   5   ARG ARG P . n 
E 5 10  PRO 10  6   6   PRO PRO P . n 
E 5 11  SER 11  7   7   SER SER P . n 
E 5 12  GLN 12  8   8   GLN GLN P . n 
F 1 1   GLN 1   2   2   GLN GLN E . n 
F 1 2   VAL 2   3   3   VAL VAL E . n 
F 1 3   ARG 3   4   4   ARG ARG E . n 
F 1 4   GLN 4   5   5   GLN GLN E . n 
F 1 5   SER 5   6   6   SER SER E . n 
F 1 6   PRO 6   7   7   PRO PRO E . n 
F 1 7   GLN 7   8   8   GLN GLN E . n 
F 1 8   SER 8   9   9   SER SER E . n 
F 1 9   LEU 9   10  10  LEU LEU E . n 
F 1 10  THR 10  11  11  THR THR E . n 
F 1 11  VAL 11  12  12  VAL VAL E . n 
F 1 12  TRP 12  13  13  TRP TRP E . n 
F 1 13  GLU 13  14  14  GLU GLU E . n 
F 1 14  GLY 14  15  15  GLY GLY E . n 
F 1 15  GLU 15  16  16  GLU GLU E . n 
F 1 16  THR 16  17  17  THR THR E . n 
F 1 17  ALA 17  18  18  ALA ALA E . n 
F 1 18  ILE 18  19  19  ILE ILE E . n 
F 1 19  LEU 19  20  20  LEU LEU E . n 
F 1 20  ASN 20  21  21  ASN ASN E . n 
F 1 21  CYS 21  22  22  CYS CYS E . n 
F 1 22  SER 22  23  23  SER SER E . n 
F 1 23  TYR 23  24  24  TYR TYR E . n 
F 1 24  GLU 24  25  25  GLU GLU E . n 
F 1 25  ASN 25  26  26  ASN ASN E . n 
F 1 26  SER 26  27  27  SER SER E . n 
F 1 27  ALA 27  28  28  ALA ALA E . n 
F 1 28  PHE 28  29  29  PHE PHE E . n 
F 1 29  ASP 29  30  30  ASP ASP E . n 
F 1 30  TYR 30  31  31  TYR TYR E . n 
F 1 31  PHE 31  32  32  PHE PHE E . n 
F 1 32  PRO 32  33  33  PRO PRO E . n 
F 1 33  TRP 33  34  34  TRP TRP E . n 
F 1 34  TYR 34  35  35  TYR TYR E . n 
F 1 35  GLN 35  36  36  GLN GLN E . n 
F 1 36  GLN 36  37  37  GLN GLN E . n 
F 1 37  PHE 37  38  38  PHE PHE E . n 
F 1 38  PRO 38  39  39  PRO PRO E . n 
F 1 39  GLY 39  40  40  GLY GLY E . n 
F 1 40  GLU 40  41  41  GLU GLU E . n 
F 1 41  GLY 41  42  42  GLY GLY E . n 
F 1 42  PRO 42  43  43  PRO PRO E . n 
F 1 43  ALA 43  44  44  ALA ALA E . n 
F 1 44  LEU 44  45  45  LEU LEU E . n 
F 1 45  LEU 45  46  46  LEU LEU E . n 
F 1 46  ILE 46  47  47  ILE ILE E . n 
F 1 47  SER 47  48  48  SER SER E . n 
F 1 48  ILE 48  49  49  ILE ILE E . n 
F 1 49  LEU 49  50  50  LEU LEU E . n 
F 1 50  SER 50  51  51  SER SER E . n 
F 1 51  VAL 51  52  52  VAL VAL E . n 
F 1 52  SER 52  53  53  SER SER E . n 
F 1 53  ASP 53  54  54  ASP ASP E . n 
F 1 54  LYS 54  55  55  LYS LYS E . n 
F 1 55  LYS 55  56  56  LYS LYS E . n 
F 1 56  GLU 56  57  57  GLU GLU E . n 
F 1 57  ASP 57  58  58  ASP ASP E . n 
F 1 58  GLY 58  59  59  GLY GLY E . n 
F 1 59  ARG 59  61  61  ARG ARG E . n 
F 1 60  PHE 60  62  62  PHE PHE E . n 
F 1 61  THR 61  63  63  THR THR E . n 
F 1 62  ILE 62  64  64  ILE ILE E . n 
F 1 63  PHE 63  65  65  PHE PHE E . n 
F 1 64  PHE 64  66  66  PHE PHE E . n 
F 1 65  ASN 65  67  67  ASN ASN E . n 
F 1 66  LYS 66  68  68  LYS LYS E . n 
F 1 67  ARG 67  69  69  ARG ARG E . n 
F 1 68  GLU 68  70  70  GLU GLU E . n 
F 1 69  LYS 69  71  71  LYS LYS E . n 
F 1 70  LYS 70  72  72  LYS LYS E . n 
F 1 71  LEU 71  73  73  LEU LEU E . n 
F 1 72  SER 72  74  74  SER SER E . n 
F 1 73  LEU 73  75  75  LEU LEU E . n 
F 1 74  HIS 74  76  76  HIS HIS E . n 
F 1 75  ILE 75  77  77  ILE ILE E . n 
F 1 76  ALA 76  78  78  ALA ALA E . n 
F 1 77  ASP 77  79  79  ASP ASP E . n 
F 1 78  SER 78  80  80  SER SER E . n 
F 1 79  GLN 79  81  81  GLN GLN E . n 
F 1 80  PRO 80  82  82  PRO PRO E . n 
F 1 81  GLY 81  83  83  GLY GLY E . n 
F 1 82  ASP 82  84  84  ASP ASP E . n 
F 1 83  SER 83  85  85  SER SER E . n 
F 1 84  ALA 84  86  86  ALA ALA E . n 
F 1 85  THR 85  87  87  THR THR E . n 
F 1 86  TYR 86  88  88  TYR TYR E . n 
F 1 87  PHE 87  89  89  PHE PHE E . n 
F 1 88  CYS 88  90  90  CYS CYS E . n 
F 1 89  ALA 89  91  91  ALA ALA E . n 
F 1 90  ALA 90  92  92  ALA ALA E . n 
F 1 91  SER 91  93  93  SER SER E . n 
F 1 92  ALA 92  98  98  ALA ALA E . n 
F 1 93  ASN 93  99  99  ASN ASN E . n 
F 1 94  SER 94  100 100 SER SER E . n 
F 1 95  GLY 95  101 101 GLY GLY E . n 
F 1 96  THR 96  102 102 THR THR E . n 
F 1 97  TYR 97  103 103 TYR TYR E . n 
F 1 98  GLN 98  104 104 GLN GLN E . n 
F 1 99  ARG 99  105 105 ARG ARG E . n 
F 1 100 PHE 100 106 106 PHE PHE E . n 
F 1 101 GLY 101 107 107 GLY GLY E . n 
F 1 102 THR 102 108 108 THR THR E . n 
F 1 103 GLY 103 109 109 GLY GLY E . n 
F 1 104 THR 104 110 110 THR THR E . n 
F 1 105 LYS 105 111 111 LYS LYS E . n 
F 1 106 LEU 106 112 112 LEU LEU E . n 
F 1 107 GLN 107 113 113 GLN GLN E . n 
F 1 108 VAL 108 114 114 VAL VAL E . n 
F 1 109 VAL 109 115 115 VAL VAL E . n 
F 1 110 PRO 110 116 116 PRO PRO E . n 
G 2 1   ALA 1   3   3   ALA ALA F . n 
G 2 2   VAL 2   4   4   VAL VAL F . n 
G 2 3   THR 3   5   5   THR THR F . n 
G 2 4   GLN 4   6   6   GLN GLN F . n 
G 2 5   SER 5   7   7   SER SER F . n 
G 2 6   PRO 6   8   8   PRO PRO F . n 
G 2 7   ARG 7   9   9   ARG ARG F . n 
G 2 8   ASN 8   10  10  ASN ASN F . n 
G 2 9   LYS 9   11  11  LYS LYS F . n 
G 2 10  VAL 10  12  12  VAL VAL F . n 
G 2 11  ALA 11  13  13  ALA ALA F . n 
G 2 12  VAL 12  14  14  VAL VAL F . n 
G 2 13  THR 13  15  15  THR THR F . n 
G 2 14  GLY 14  16  16  GLY GLY F . n 
G 2 15  GLU 15  17  17  GLU GLU F . n 
G 2 16  LYS 16  18  18  LYS LYS F . n 
G 2 17  VAL 17  19  19  VAL VAL F . n 
G 2 18  THR 18  20  20  THR THR F . n 
G 2 19  LEU 19  21  21  LEU LEU F . n 
G 2 20  SER 20  22  22  SER SER F . n 
G 2 21  CYS 21  23  23  CYS CYS F . n 
G 2 22  ASN 22  24  24  ASN ASN F . n 
G 2 23  GLN 23  25  25  GLN GLN F . n 
G 2 24  THR 24  26  26  THR THR F . n 
G 2 25  ASN 25  27  27  ASN ASN F . n 
G 2 26  ASN 26  28  28  ASN ASN F . n 
G 2 27  HIS 27  29  29  HIS HIS F . n 
G 2 28  ASN 28  30  30  ASN ASN F . n 
G 2 29  ASN 29  31  31  ASN ASN F . n 
G 2 30  MET 30  32  32  MET MET F . n 
G 2 31  TYR 31  33  33  TYR TYR F . n 
G 2 32  TRP 32  34  34  TRP TRP F . n 
G 2 33  TYR 33  35  35  TYR TYR F . n 
G 2 34  ARG 34  36  36  ARG ARG F . n 
G 2 35  GLN 35  37  37  GLN GLN F . n 
G 2 36  ASP 36  38  38  ASP ASP F . n 
G 2 37  THR 37  39  39  THR THR F . n 
G 2 38  GLY 38  40  40  GLY GLY F . n 
G 2 39  HIS 39  41  41  HIS HIS F . n 
G 2 40  GLY 40  42  42  GLY GLY F . n 
G 2 41  LEU 41  43  43  LEU LEU F . n 
G 2 42  ARG 42  44  44  ARG ARG F . n 
G 2 43  LEU 43  45  45  LEU LEU F . n 
G 2 44  ILE 44  46  46  ILE ILE F . n 
G 2 45  TYR 45  47  47  TYR TYR F . n 
G 2 46  TYR 46  48  48  TYR TYR F . n 
G 2 47  SER 47  49  49  SER SER F . n 
G 2 48  TYR 48  50  50  TYR TYR F . n 
G 2 49  GLY 49  51  51  GLY GLY F . n 
G 2 50  ALA 50  52  52  ALA ALA F . n 
G 2 51  GLY 51  53  53  GLY GLY F . n 
G 2 52  SER 52  54  54  SER SER F . n 
G 2 53  THR 53  55  55  THR THR F . n 
G 2 54  GLU 54  56  56  GLU GLU F . n 
G 2 55  LYS 55  57  57  LYS LYS F . n 
G 2 56  GLY 56  58  58  GLY GLY F . n 
G 2 57  ASP 57  59  59  ASP ASP F . n 
G 2 58  ILE 58  60  60  ILE ILE F . n 
G 2 59  PRO 59  61  61  PRO PRO F . n 
G 2 60  ASP 60  62  62  ASP ASP F . n 
G 2 61  GLY 61  63  63  GLY GLY F . n 
G 2 62  TYR 62  65  65  TYR TYR F . n 
G 2 63  LYS 63  66  66  LYS LYS F . n 
G 2 64  ALA 64  67  67  ALA ALA F . n 
G 2 65  SER 65  68  68  SER SER F . n 
G 2 66  ARG 66  69  69  ARG ARG F . n 
G 2 67  PRO 67  70  70  PRO PRO F . n 
G 2 68  SER 68  71  71  SER SER F . n 
G 2 69  GLN 69  72  72  GLN GLN F . n 
G 2 70  GLU 70  73  73  GLU GLU F . n 
G 2 71  ASN 71  74  74  ASN ASN F . n 
G 2 72  PHE 72  75  75  PHE PHE F . n 
G 2 73  SER 73  76  76  SER SER F . n 
G 2 74  LEU 74  77  77  LEU LEU F . n 
G 2 75  THR 75  78  78  THR THR F . n 
G 2 76  LEU 76  79  79  LEU LEU F . n 
G 2 77  GLU 77  80  80  GLU GLU F . n 
G 2 78  SER 78  81  81  SER SER F . n 
G 2 79  ALA 79  82  82  ALA ALA F . n 
G 2 80  THR 80  83  83  THR THR F . n 
G 2 81  PRO 81  84  84  PRO PRO F . n 
G 2 82  SER 82  85  85  SER SER F . n 
G 2 83  GLN 83  86  86  GLN GLN F . n 
G 2 84  THR 84  87  87  THR THR F . n 
G 2 85  SER 85  88  88  SER SER F . n 
G 2 86  VAL 86  89  89  VAL VAL F . n 
G 2 87  TYR 87  90  90  TYR TYR F . n 
G 2 88  PHE 88  91  91  PHE PHE F . n 
G 2 89  CYS 89  92  92  CYS CYS F . n 
G 2 90  ALA 90  93  93  ALA ALA F . n 
G 2 91  SER 91  94  94  SER SER F . n 
G 2 92  GLY 92  95  95  GLY GLY F . n 
G 2 93  ASP 93  96  96  ASP ASP F . n 
G 2 94  ALA 94  97  97  ALA ALA F . n 
G 2 95  GLY 95  98  98  GLY GLY F . n 
G 2 96  GLY 96  99  99  GLY GLY F . n 
G 2 97  GLY 97  100 100 GLY GLY F . n 
G 2 98  TYR 98  104 104 TYR TYR F . n 
G 2 99  GLU 99  105 105 GLU GLU F . n 
G 2 100 GLN 100 106 106 GLN GLN F . n 
G 2 101 TYR 101 107 107 TYR TYR F . n 
G 2 102 PHE 102 108 108 PHE PHE F . n 
G 2 103 GLY 103 109 109 GLY GLY F . n 
G 2 104 PRO 104 110 110 PRO PRO F . n 
G 2 105 GLY 105 111 111 GLY GLY F . n 
G 2 106 THR 106 112 112 THR THR F . n 
G 2 107 ARG 107 113 113 ARG ARG F . n 
G 2 108 LEU 108 114 114 LEU LEU F . n 
G 2 109 THR 109 115 115 THR THR F . n 
G 2 110 VAL 110 116 116 VAL VAL F . n 
G 2 111 LEU 111 117 117 LEU LEU F . n 
H 3 1   ILE 1   1   1   ILE ILE G . n 
H 3 2   GLU 2   2   2   GLU GLU G . n 
H 3 3   ALA 3   3   3   ALA ALA G . n 
H 3 4   ASP 4   4   4   ASP ASP G . n 
H 3 5   HIS 5   5   5   HIS HIS G . n 
H 3 6   VAL 6   6   6   VAL VAL G . n 
H 3 7   GLY 7   7   7   GLY GLY G . n 
H 3 8   SER 8   8   8   SER SER G . n 
H 3 9   TYR 9   9   9   TYR TYR G . n 
H 3 10  GLY 10  9   9   GLY GLY G A n 
H 3 11  ILE 11  10  10  ILE ILE G . n 
H 3 12  VAL 12  11  11  VAL VAL G . n 
H 3 13  VAL 13  12  12  VAL VAL G . n 
H 3 14  TYR 14  13  13  TYR TYR G . n 
H 3 15  GLN 15  14  14  GLN GLN G . n 
H 3 16  SER 16  15  15  SER SER G . n 
H 3 17  PRO 17  16  16  PRO PRO G . n 
H 3 18  GLY 18  17  17  GLY GLY G . n 
H 3 19  ASP 19  18  18  ASP ASP G . n 
H 3 20  ILE 20  19  19  ILE ILE G . n 
H 3 21  GLY 21  20  20  GLY GLY G . n 
H 3 22  GLN 22  21  21  GLN GLN G . n 
H 3 23  TYR 23  22  22  TYR TYR G . n 
H 3 24  THR 24  23  23  THR THR G . n 
H 3 25  PHE 25  24  24  PHE PHE G . n 
H 3 26  GLU 26  25  25  GLU GLU G . n 
H 3 27  PHE 27  26  26  PHE PHE G . n 
H 3 28  ASP 28  27  27  ASP ASP G . n 
H 3 29  GLY 29  28  28  GLY GLY G . n 
H 3 30  ASP 30  29  29  ASP ASP G . n 
H 3 31  GLU 31  30  30  GLU GLU G . n 
H 3 32  LEU 32  31  31  LEU LEU G . n 
H 3 33  PHE 33  32  32  PHE PHE G . n 
H 3 34  TYR 34  33  33  TYR TYR G . n 
H 3 35  VAL 35  34  34  VAL VAL G . n 
H 3 36  ASP 36  35  35  ASP ASP G . n 
H 3 37  LEU 37  36  36  LEU LEU G . n 
H 3 38  ASP 38  37  37  ASP ASP G . n 
H 3 39  LYS 39  38  38  LYS LYS G . n 
H 3 40  LYS 40  39  39  LYS LYS G . n 
H 3 41  GLU 41  40  40  GLU GLU G . n 
H 3 42  THR 42  41  41  THR THR G . n 
H 3 43  ILE 43  42  42  ILE ILE G . n 
H 3 44  TRP 44  43  43  TRP TRP G . n 
H 3 45  MET 45  44  44  MET MET G . n 
H 3 46  LEU 46  45  45  LEU LEU G . n 
H 3 47  PRO 47  46  46  PRO PRO G . n 
H 3 48  GLU 48  47  47  GLU GLU G . n 
H 3 49  PHE 49  48  48  PHE PHE G . n 
H 3 50  ALA 50  49  49  ALA ALA G . n 
H 3 51  GLN 51  50  50  GLN GLN G . n 
H 3 52  LEU 52  51  51  LEU LEU G . n 
H 3 53  ARG 53  52  52  ARG ARG G . n 
H 3 54  SER 54  53  53  SER SER G . n 
H 3 55  PHE 55  54  54  PHE PHE G . n 
H 3 56  ASP 56  55  55  ASP ASP G . n 
H 3 57  PRO 57  56  56  PRO PRO G . n 
H 3 58  GLN 58  57  57  GLN GLN G . n 
H 3 59  GLY 59  58  58  GLY GLY G . n 
H 3 60  GLY 60  59  59  GLY GLY G . n 
H 3 61  LEU 61  60  60  LEU LEU G . n 
H 3 62  GLN 62  61  61  GLN GLN G . n 
H 3 63  ASN 63  62  62  ASN ASN G . n 
H 3 64  ILE 64  63  63  ILE ILE G . n 
H 3 65  ALA 65  64  64  ALA ALA G . n 
H 3 66  THR 66  65  65  THR THR G . n 
H 3 67  GLY 67  66  66  GLY GLY G . n 
H 3 68  LYS 68  67  67  LYS LYS G . n 
H 3 69  HIS 69  68  68  HIS HIS G . n 
H 3 70  ASN 70  69  69  ASN ASN G . n 
H 3 71  LEU 71  70  70  LEU LEU G . n 
H 3 72  GLY 72  71  71  GLY GLY G . n 
H 3 73  VAL 73  72  72  VAL VAL G . n 
H 3 74  LEU 74  73  73  LEU LEU G . n 
H 3 75  THR 75  74  74  THR THR G . n 
H 3 76  LYS 76  75  75  LYS LYS G . n 
H 3 77  ARG 77  76  76  ARG ARG G . n 
H 3 78  SER 78  77  77  SER SER G . n 
H 3 79  ASN 79  78  78  ASN ASN G . n 
H 3 80  SER 80  79  79  SER SER G . n 
H 3 81  THR 81  80  80  THR THR G . n 
H 3 82  PRO 82  81  81  PRO PRO G . n 
H 3 83  ALA 83  82  82  ALA ALA G . n 
H 3 84  THR 84  83  83  THR THR G . n 
H 3 85  ASN 85  84  84  ASN ASN G . n 
H 3 86  GLU 86  85  85  GLU GLU G . n 
H 3 87  ALA 87  86  86  ALA ALA G . n 
H 3 88  PRO 88  87  87  PRO PRO G . n 
H 3 89  GLN 89  88  88  GLN GLN G . n 
H 3 90  ALA 90  89  89  ALA ALA G . n 
H 3 91  THR 91  90  90  THR THR G . n 
H 3 92  VAL 92  91  91  VAL VAL G . n 
H 3 93  PHE 93  92  92  PHE PHE G . n 
H 3 94  PRO 94  93  93  PRO PRO G . n 
H 3 95  LYS 95  94  94  LYS LYS G . n 
H 3 96  SER 96  95  95  SER SER G . n 
H 3 97  PRO 97  96  96  PRO PRO G . n 
H 3 98  VAL 98  97  97  VAL VAL G . n 
H 3 99  LEU 99  98  98  LEU LEU G . n 
H 3 100 LEU 100 99  99  LEU LEU G . n 
H 3 101 GLY 101 100 100 GLY GLY G . n 
H 3 102 GLN 102 101 101 GLN GLN G . n 
H 3 103 PRO 103 102 102 PRO PRO G . n 
H 3 104 ASN 104 103 103 ASN ASN G . n 
H 3 105 THR 105 104 104 THR THR G . n 
H 3 106 LEU 106 105 105 LEU LEU G . n 
H 3 107 ILE 107 106 106 ILE ILE G . n 
H 3 108 CYS 108 107 107 CYS CYS G . n 
H 3 109 PHE 109 108 108 PHE PHE G . n 
H 3 110 VAL 110 109 109 VAL VAL G . n 
H 3 111 ASP 111 110 110 ASP ASP G . n 
H 3 112 ASN 112 111 111 ASN ASN G . n 
H 3 113 ILE 113 112 112 ILE ILE G . n 
H 3 114 PHE 114 113 113 PHE PHE G . n 
H 3 115 PRO 115 114 114 PRO PRO G . n 
H 3 116 PRO 116 115 115 PRO PRO G . n 
H 3 117 VAL 117 116 116 VAL VAL G . n 
H 3 118 ILE 118 117 117 ILE ILE G . n 
H 3 119 ASN 119 118 118 ASN ASN G . n 
H 3 120 ILE 120 119 119 ILE ILE G . n 
H 3 121 THR 121 120 120 THR THR G . n 
H 3 122 TRP 122 121 121 TRP TRP G . n 
H 3 123 LEU 123 122 122 LEU LEU G . n 
H 3 124 ARG 124 123 123 ARG ARG G . n 
H 3 125 ASN 125 124 124 ASN ASN G . n 
H 3 126 SER 126 125 125 SER SER G . n 
H 3 127 LYS 127 126 126 LYS LYS G . n 
H 3 128 SER 128 127 127 SER SER G . n 
H 3 129 VAL 129 128 128 VAL VAL G . n 
H 3 130 ALA 130 129 129 ALA ALA G . n 
H 3 131 ASP 131 130 130 ASP ASP G . n 
H 3 132 GLY 132 131 131 GLY GLY G . n 
H 3 133 VAL 133 132 132 VAL VAL G . n 
H 3 134 TYR 134 133 133 TYR TYR G . n 
H 3 135 GLU 135 134 134 GLU GLU G . n 
H 3 136 THR 136 135 135 THR THR G . n 
H 3 137 SER 137 136 136 SER SER G . n 
H 3 138 PHE 138 137 137 PHE PHE G . n 
H 3 139 PHE 139 138 138 PHE PHE G . n 
H 3 140 VAL 140 139 139 VAL VAL G . n 
H 3 141 ASN 141 140 140 ASN ASN G . n 
H 3 142 ARG 142 141 141 ARG ARG G . n 
H 3 143 ASP 143 142 142 ASP ASP G . n 
H 3 144 TYR 144 143 143 TYR TYR G . n 
H 3 145 SER 145 144 144 SER SER G . n 
H 3 146 PHE 146 145 145 PHE PHE G . n 
H 3 147 HIS 147 146 146 HIS HIS G . n 
H 3 148 LYS 148 147 147 LYS LYS G . n 
H 3 149 LEU 149 148 148 LEU LEU G . n 
H 3 150 SER 150 149 149 SER SER G . n 
H 3 151 TYR 151 150 150 TYR TYR G . n 
H 3 152 LEU 152 151 151 LEU LEU G . n 
H 3 153 THR 153 152 152 THR THR G . n 
H 3 154 PHE 154 153 153 PHE PHE G . n 
H 3 155 ILE 155 154 154 ILE ILE G . n 
H 3 156 PRO 156 155 155 PRO PRO G . n 
H 3 157 SER 157 156 156 SER SER G . n 
H 3 158 ASP 158 157 157 ASP ASP G . n 
H 3 159 ASP 159 158 158 ASP ASP G . n 
H 3 160 ASP 160 159 159 ASP ASP G . n 
H 3 161 ILE 161 160 160 ILE ILE G . n 
H 3 162 TYR 162 161 161 TYR TYR G . n 
H 3 163 ASP 163 162 162 ASP ASP G . n 
H 3 164 CYS 164 163 163 CYS CYS G . n 
H 3 165 LYS 165 164 164 LYS LYS G . n 
H 3 166 VAL 166 165 165 VAL VAL G . n 
H 3 167 GLU 167 166 166 GLU GLU G . n 
H 3 168 HIS 168 167 167 HIS HIS G . n 
H 3 169 TRP 169 168 168 TRP TRP G . n 
H 3 170 GLY 170 169 169 GLY GLY G . n 
H 3 171 LEU 171 170 170 LEU LEU G . n 
H 3 172 GLU 172 171 171 GLU GLU G . n 
H 3 173 GLU 173 172 172 GLU GLU G . n 
H 3 174 PRO 174 173 173 PRO PRO G . n 
H 3 175 VAL 175 174 174 VAL VAL G . n 
H 3 176 LEU 176 175 175 LEU LEU G . n 
H 3 177 LYS 177 176 176 LYS LYS G . n 
H 3 178 HIS 178 177 177 HIS HIS G . n 
H 3 179 TRP 179 178 178 TRP TRP G . n 
H 3 180 GLU 180 179 179 GLU GLU G . n 
H 3 181 PRO 181 180 180 PRO PRO G . n 
H 3 182 GLU 182 181 181 GLU GLU G . n 
I 4 1   GLY 1   1   1   GLY GLY H . n 
I 4 2   ASP 2   2   2   ASP ASP H . n 
I 4 3   SER 3   3   3   SER SER H . n 
I 4 4   GLU 4   4   4   GLU GLU H . n 
I 4 5   ARG 5   5   5   ARG ARG H . n 
I 4 6   HIS 6   6   6   HIS HIS H . n 
I 4 7   PHE 7   7   7   PHE PHE H . n 
I 4 8   VAL 8   8   8   VAL VAL H . n 
I 4 9   VAL 9   9   9   VAL VAL H . n 
I 4 10  GLN 10  10  10  GLN GLN H . n 
I 4 11  PHE 11  11  11  PHE PHE H . n 
I 4 12  GLN 12  12  12  GLN GLN H . n 
I 4 13  PRO 13  13  13  PRO PRO H . n 
I 4 14  PHE 14  14  14  PHE PHE H . n 
I 4 15  CYS 15  15  15  CYS CYS H . n 
I 4 16  TYR 16  16  16  TYR TYR H . n 
I 4 17  PHE 17  17  17  PHE PHE H . n 
I 4 18  THR 18  18  18  THR THR H . n 
I 4 19  ASN 19  19  19  ASN ASN H . n 
I 4 20  GLY 20  20  20  GLY GLY H . n 
I 4 21  THR 21  21  21  THR THR H . n 
I 4 22  GLN 22  22  22  GLN GLN H . n 
I 4 23  ARG 23  23  23  ARG ARG H . n 
I 4 24  ILE 24  24  24  ILE ILE H . n 
I 4 25  ARG 25  25  25  ARG ARG H . n 
I 4 26  TYR 26  26  26  TYR TYR H . n 
I 4 27  VAL 27  27  27  VAL VAL H . n 
I 4 28  THR 28  28  28  THR THR H . n 
I 4 29  ARG 29  29  29  ARG ARG H . n 
I 4 30  TYR 30  30  30  TYR TYR H . n 
I 4 31  ILE 31  31  31  ILE ILE H . n 
I 4 32  TYR 32  32  32  TYR TYR H . n 
I 4 33  ASN 33  33  33  ASN ASN H . n 
I 4 34  ARG 34  34  34  ARG ARG H . n 
I 4 35  GLU 35  35  35  GLU GLU H . n 
I 4 36  GLU 36  36  36  GLU GLU H . n 
I 4 37  TYR 37  37  37  TYR TYR H . n 
I 4 38  LEU 38  38  38  LEU LEU H . n 
I 4 39  ARG 39  39  39  ARG ARG H . n 
I 4 40  PHE 40  40  40  PHE PHE H . n 
I 4 41  ASP 41  41  41  ASP ASP H . n 
I 4 42  SER 42  42  42  SER SER H . n 
I 4 43  ASP 43  43  43  ASP ASP H . n 
I 4 44  VAL 44  44  44  VAL VAL H . n 
I 4 45  GLY 45  45  45  GLY GLY H . n 
I 4 46  GLU 46  46  46  GLU GLU H . n 
I 4 47  TYR 47  47  47  TYR TYR H . n 
I 4 48  ARG 48  48  48  ARG ARG H . n 
I 4 49  ALA 49  49  49  ALA ALA H . n 
I 4 50  VAL 50  50  50  VAL VAL H . n 
I 4 51  THR 51  51  51  THR THR H . n 
I 4 52  GLU 52  52  52  GLU GLU H . n 
I 4 53  LEU 53  53  53  LEU LEU H . n 
I 4 54  GLY 54  54  54  GLY GLY H . n 
I 4 55  ARG 55  55  55  ARG ARG H . n 
I 4 56  PRO 56  56  56  PRO PRO H . n 
I 4 57  ASP 57  57  57  ASP ASP H . n 
I 4 58  ALA 58  58  58  ALA ALA H . n 
I 4 59  GLU 59  59  59  GLU GLU H . n 
I 4 60  TYR 60  60  60  TYR TYR H . n 
I 4 61  TYR 61  61  61  TYR TYR H . n 
I 4 62  ASN 62  62  62  ASN ASN H . n 
I 4 63  LYS 63  63  63  LYS LYS H . n 
I 4 64  GLN 64  64  64  GLN GLN H . n 
I 4 65  TYR 65  67  67  TYR TYR H . n 
I 4 66  LEU 66  68  68  LEU LEU H . n 
I 4 67  GLU 67  69  69  GLU GLU H . n 
I 4 68  ARG 68  70  70  ARG ARG H . n 
I 4 69  THR 69  71  71  THR THR H . n 
I 4 70  ARG 70  72  72  ARG ARG H . n 
I 4 71  ALA 71  73  73  ALA ALA H . n 
I 4 72  GLU 72  74  74  GLU GLU H . n 
I 4 73  LEU 73  75  75  LEU LEU H . n 
I 4 74  ASP 74  76  76  ASP ASP H . n 
I 4 75  THR 75  77  77  THR THR H . n 
I 4 76  VAL 76  78  78  VAL VAL H . n 
I 4 77  CYS 77  79  79  CYS CYS H . n 
I 4 78  ARG 78  80  80  ARG ARG H . n 
I 4 79  TYR 79  81  81  TYR TYR H . n 
I 4 80  ASN 80  82  82  ASN ASN H . n 
I 4 81  TYR 81  83  83  TYR TYR H . n 
I 4 82  GLU 82  84  84  GLU GLU H . n 
I 4 83  GLU 83  84  84  GLU GLU H A n 
I 4 84  THR 84  85  85  THR THR H . n 
I 4 85  GLU 85  86  86  GLU GLU H . n 
I 4 86  VAL 86  87  87  VAL VAL H . n 
I 4 87  PRO 87  88  88  PRO PRO H . n 
I 4 88  THR 88  89  89  THR THR H . n 
I 4 89  SER 89  90  90  SER SER H . n 
I 4 90  LEU 90  91  91  LEU LEU H . n 
I 4 91  ARG 91  92  92  ARG ARG H . n 
I 4 92  ARG 92  93  93  ARG ARG H . n 
I 4 93  LEU 93  94  94  LEU LEU H . n 
I 4 94  GLU 94  95  95  GLU GLU H . n 
I 4 95  GLN 95  96  96  GLN GLN H . n 
I 4 96  PRO 96  97  97  PRO PRO H . n 
I 4 97  ASN 97  98  98  ASN ASN H . n 
I 4 98  VAL 98  99  99  VAL VAL H . n 
I 4 99  VAL 99  100 100 VAL VAL H . n 
I 4 100 ILE 100 101 101 ILE ILE H . n 
I 4 101 SER 101 102 102 SER SER H . n 
I 4 102 LEU 102 103 103 LEU LEU H . n 
I 4 103 SER 103 104 104 SER SER H . n 
I 4 104 ARG 104 105 105 ARG ARG H . n 
I 4 105 THR 105 106 106 THR THR H . n 
I 4 106 GLU 106 107 107 GLU GLU H . n 
I 4 107 ALA 107 108 108 ALA ALA H . n 
I 4 108 LEU 108 109 109 LEU LEU H . n 
I 4 109 ASN 109 110 110 ASN ASN H . n 
I 4 110 HIS 110 111 111 HIS HIS H . n 
I 4 111 HIS 111 112 112 HIS HIS H . n 
I 4 112 ASN 112 113 113 ASN ASN H . n 
I 4 113 THR 113 114 114 THR THR H . n 
I 4 114 LEU 114 115 115 LEU LEU H . n 
I 4 115 VAL 115 116 116 VAL VAL H . n 
I 4 116 CYS 116 117 117 CYS CYS H . n 
I 4 117 SER 117 118 118 SER SER H . n 
I 4 118 VAL 118 119 119 VAL VAL H . n 
I 4 119 THR 119 120 120 THR THR H . n 
I 4 120 ASP 120 121 121 ASP ASP H . n 
I 4 121 PHE 121 122 122 PHE PHE H . n 
I 4 122 TYR 122 123 123 TYR TYR H . n 
I 4 123 PRO 123 124 124 PRO PRO H . n 
I 4 124 ALA 124 125 125 ALA ALA H . n 
I 4 125 LYS 125 126 126 LYS LYS H . n 
I 4 126 ILE 126 127 127 ILE ILE H . n 
I 4 127 LYS 127 128 128 LYS LYS H . n 
I 4 128 VAL 128 129 129 VAL VAL H . n 
I 4 129 ARG 129 130 130 ARG ARG H . n 
I 4 130 TRP 130 131 131 TRP TRP H . n 
I 4 131 PHE 131 132 132 PHE PHE H . n 
I 4 132 ARG 132 133 133 ARG ARG H . n 
I 4 133 ASN 133 134 134 ASN ASN H . n 
I 4 134 GLY 134 135 135 GLY GLY H . n 
I 4 135 GLN 135 136 136 GLN GLN H . n 
I 4 136 GLU 136 137 137 GLU GLU H . n 
I 4 137 GLU 137 138 138 GLU GLU H . n 
I 4 138 THR 138 139 139 THR THR H . n 
I 4 139 VAL 139 140 140 VAL VAL H . n 
I 4 140 GLY 140 141 141 GLY GLY H . n 
I 4 141 VAL 141 142 142 VAL VAL H . n 
I 4 142 SER 142 143 143 SER SER H . n 
I 4 143 SER 143 144 144 SER SER H . n 
I 4 144 THR 144 145 145 THR THR H . n 
I 4 145 GLN 145 146 146 GLN GLN H . n 
I 4 146 LEU 146 147 147 LEU LEU H . n 
I 4 147 ILE 147 148 148 ILE ILE H . n 
I 4 148 ARG 148 149 149 ARG ARG H . n 
I 4 149 ASN 149 150 150 ASN ASN H . n 
I 4 150 GLY 150 151 151 GLY GLY H . n 
I 4 151 ASP 151 152 152 ASP ASP H . n 
I 4 152 TRP 152 153 153 TRP TRP H . n 
I 4 153 THR 153 154 154 THR THR H . n 
I 4 154 PHE 154 155 155 PHE PHE H . n 
I 4 155 GLN 155 156 156 GLN GLN H . n 
I 4 156 VAL 156 157 157 VAL VAL H . n 
I 4 157 LEU 157 158 158 LEU LEU H . n 
I 4 158 VAL 158 159 159 VAL VAL H . n 
I 4 159 MET 159 160 160 MET MET H . n 
I 4 160 LEU 160 161 161 LEU LEU H . n 
I 4 161 GLU 161 162 162 GLU GLU H . n 
I 4 162 MET 162 163 163 MET MET H . n 
I 4 163 THR 163 164 164 THR THR H . n 
I 4 164 PRO 164 165 165 PRO PRO H . n 
I 4 165 ARG 165 166 166 ARG ARG H . n 
I 4 166 ARG 166 167 167 ARG ARG H . n 
I 4 167 GLY 167 168 168 GLY GLY H . n 
I 4 168 GLU 168 169 169 GLU GLU H . n 
I 4 169 VAL 169 170 170 VAL VAL H . n 
I 4 170 TYR 170 171 171 TYR TYR H . n 
I 4 171 THR 171 172 172 THR THR H . n 
I 4 172 CYS 172 173 173 CYS CYS H . n 
I 4 173 HIS 173 174 174 HIS HIS H . n 
I 4 174 VAL 174 175 175 VAL VAL H . n 
I 4 175 GLU 175 176 176 GLU GLU H . n 
I 4 176 HIS 176 177 177 HIS HIS H . n 
I 4 177 PRO 177 178 178 PRO PRO H . n 
I 4 178 SER 178 179 179 SER SER H . n 
I 4 179 LEU 179 180 180 LEU LEU H . n 
I 4 180 LYS 180 181 181 LYS LYS H . n 
I 4 181 SER 181 182 182 SER SER H . n 
I 4 182 PRO 182 183 183 PRO PRO H . n 
I 4 183 ILE 183 184 184 ILE ILE H . n 
I 4 184 THR 184 185 185 THR THR H . n 
I 4 185 VAL 185 186 186 VAL VAL H . n 
I 4 186 GLU 186 187 187 GLU GLU H . n 
I 4 187 TRP 187 188 188 TRP TRP H . n 
I 4 188 ARG 188 189 189 ARG ARG H . n 
I 4 189 ALA 189 190 190 ALA ALA H . n 
J 5 1   SER 1   -3  -3  SER SER I . n 
J 5 2   ARG 2   -2  -2  ARG ARG I . n 
J 5 3   GLY 3   -1  -1  GLY GLY I . n 
J 5 4   GLY 4   0   0   GLY GLY I . n 
J 5 5   ALA 5   1   1   ALA ALA I . n 
J 5 6   SER 6   2   2   SER SER I . n 
J 5 7   GLN 7   3   3   GLN GLN I . n 
J 5 8   TYR 8   4   4   TYR TYR I . n 
J 5 9   ARG 9   5   5   ARG ARG I . n 
J 5 10  PRO 10  6   6   PRO PRO I . n 
J 5 11  SER 11  7   7   SER SER I . n 
J 5 12  GLN 12  8   8   GLN GLN I . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
K 6 HOH 1  117 48  HOH HOH A . 
K 6 HOH 2  118 136 HOH HOH A . 
K 6 HOH 3  119 158 HOH HOH A . 
K 6 HOH 4  120 177 HOH HOH A . 
L 6 HOH 1  118 26  HOH HOH B . 
L 6 HOH 2  119 62  HOH HOH B . 
L 6 HOH 3  120 137 HOH HOH B . 
L 6 HOH 4  121 181 HOH HOH B . 
M 6 HOH 1  182 2   HOH HOH C . 
M 6 HOH 2  183 3   HOH HOH C . 
M 6 HOH 3  184 5   HOH HOH C . 
M 6 HOH 4  185 8   HOH HOH C . 
M 6 HOH 5  186 14  HOH HOH C . 
M 6 HOH 6  187 20  HOH HOH C . 
M 6 HOH 7  188 24  HOH HOH C . 
M 6 HOH 8  189 28  HOH HOH C . 
M 6 HOH 9  190 29  HOH HOH C . 
M 6 HOH 10 191 31  HOH HOH C . 
M 6 HOH 11 192 32  HOH HOH C . 
M 6 HOH 12 193 34  HOH HOH C . 
M 6 HOH 13 194 36  HOH HOH C . 
M 6 HOH 14 195 38  HOH HOH C . 
M 6 HOH 15 196 42  HOH HOH C . 
M 6 HOH 16 197 54  HOH HOH C . 
M 6 HOH 17 198 57  HOH HOH C . 
M 6 HOH 18 199 65  HOH HOH C . 
M 6 HOH 19 200 68  HOH HOH C . 
M 6 HOH 20 201 73  HOH HOH C . 
M 6 HOH 21 202 74  HOH HOH C . 
M 6 HOH 22 203 75  HOH HOH C . 
M 6 HOH 23 204 79  HOH HOH C . 
M 6 HOH 24 205 82  HOH HOH C . 
M 6 HOH 25 206 88  HOH HOH C . 
M 6 HOH 26 207 89  HOH HOH C . 
M 6 HOH 27 208 91  HOH HOH C . 
M 6 HOH 28 209 99  HOH HOH C . 
M 6 HOH 29 210 112 HOH HOH C . 
M 6 HOH 30 211 119 HOH HOH C . 
M 6 HOH 31 212 121 HOH HOH C . 
M 6 HOH 32 213 124 HOH HOH C . 
M 6 HOH 33 214 126 HOH HOH C . 
M 6 HOH 34 215 128 HOH HOH C . 
M 6 HOH 35 216 130 HOH HOH C . 
M 6 HOH 36 217 138 HOH HOH C . 
M 6 HOH 37 218 144 HOH HOH C . 
M 6 HOH 38 219 149 HOH HOH C . 
M 6 HOH 39 220 151 HOH HOH C . 
M 6 HOH 40 221 155 HOH HOH C . 
M 6 HOH 41 222 160 HOH HOH C . 
M 6 HOH 42 223 161 HOH HOH C . 
M 6 HOH 43 224 164 HOH HOH C . 
M 6 HOH 44 225 165 HOH HOH C . 
M 6 HOH 45 226 168 HOH HOH C . 
M 6 HOH 46 227 169 HOH HOH C . 
M 6 HOH 47 228 170 HOH HOH C . 
M 6 HOH 48 229 184 HOH HOH C . 
M 6 HOH 49 230 185 HOH HOH C . 
N 6 HOH 1  191 4   HOH HOH D . 
N 6 HOH 2  192 9   HOH HOH D . 
N 6 HOH 3  193 17  HOH HOH D . 
N 6 HOH 4  194 25  HOH HOH D . 
N 6 HOH 5  195 27  HOH HOH D . 
N 6 HOH 6  196 30  HOH HOH D . 
N 6 HOH 7  197 35  HOH HOH D . 
N 6 HOH 8  198 50  HOH HOH D . 
N 6 HOH 9  199 56  HOH HOH D . 
N 6 HOH 10 200 58  HOH HOH D . 
N 6 HOH 11 201 63  HOH HOH D . 
N 6 HOH 12 202 66  HOH HOH D . 
N 6 HOH 13 203 78  HOH HOH D . 
N 6 HOH 14 204 84  HOH HOH D . 
N 6 HOH 15 205 86  HOH HOH D . 
N 6 HOH 16 206 90  HOH HOH D . 
N 6 HOH 17 207 93  HOH HOH D . 
N 6 HOH 18 208 102 HOH HOH D . 
N 6 HOH 19 209 103 HOH HOH D . 
N 6 HOH 20 210 109 HOH HOH D . 
N 6 HOH 21 211 111 HOH HOH D . 
N 6 HOH 22 212 114 HOH HOH D . 
N 6 HOH 23 213 115 HOH HOH D . 
N 6 HOH 24 214 116 HOH HOH D . 
N 6 HOH 25 215 117 HOH HOH D . 
N 6 HOH 26 216 120 HOH HOH D . 
N 6 HOH 27 217 125 HOH HOH D . 
N 6 HOH 28 218 127 HOH HOH D . 
N 6 HOH 29 219 129 HOH HOH D . 
N 6 HOH 30 220 132 HOH HOH D . 
N 6 HOH 31 221 134 HOH HOH D . 
N 6 HOH 32 222 142 HOH HOH D . 
N 6 HOH 33 223 145 HOH HOH D . 
N 6 HOH 34 224 146 HOH HOH D . 
N 6 HOH 35 225 148 HOH HOH D . 
N 6 HOH 36 226 153 HOH HOH D . 
N 6 HOH 37 227 157 HOH HOH D . 
N 6 HOH 38 228 159 HOH HOH D . 
N 6 HOH 39 229 163 HOH HOH D . 
N 6 HOH 40 230 172 HOH HOH D . 
N 6 HOH 41 231 173 HOH HOH D . 
N 6 HOH 42 232 178 HOH HOH D . 
O 6 HOH 1  40  40  HOH HOH P . 
O 6 HOH 2  154 154 HOH HOH P . 
O 6 HOH 3  182 182 HOH HOH P . 
P 6 HOH 1  117 6   HOH HOH E . 
P 6 HOH 2  118 69  HOH HOH E . 
P 6 HOH 3  119 80  HOH HOH E . 
P 6 HOH 4  120 139 HOH HOH E . 
Q 6 HOH 1  118 83  HOH HOH F . 
Q 6 HOH 2  119 107 HOH HOH F . 
Q 6 HOH 3  120 183 HOH HOH F . 
R 6 HOH 1  182 11  HOH HOH G . 
R 6 HOH 2  183 12  HOH HOH G . 
R 6 HOH 3  184 13  HOH HOH G . 
R 6 HOH 4  185 16  HOH HOH G . 
R 6 HOH 5  186 19  HOH HOH G . 
R 6 HOH 6  187 33  HOH HOH G . 
R 6 HOH 7  188 37  HOH HOH G . 
R 6 HOH 8  189 41  HOH HOH G . 
R 6 HOH 9  190 43  HOH HOH G . 
R 6 HOH 10 191 44  HOH HOH G . 
R 6 HOH 11 192 49  HOH HOH G . 
R 6 HOH 12 193 51  HOH HOH G . 
R 6 HOH 13 194 52  HOH HOH G . 
R 6 HOH 14 195 53  HOH HOH G . 
R 6 HOH 15 196 55  HOH HOH G . 
R 6 HOH 16 197 64  HOH HOH G . 
R 6 HOH 17 198 70  HOH HOH G . 
R 6 HOH 18 199 71  HOH HOH G . 
R 6 HOH 19 200 76  HOH HOH G . 
R 6 HOH 20 201 81  HOH HOH G . 
R 6 HOH 21 202 85  HOH HOH G . 
R 6 HOH 22 203 87  HOH HOH G . 
R 6 HOH 23 204 92  HOH HOH G . 
R 6 HOH 24 205 95  HOH HOH G . 
R 6 HOH 25 206 96  HOH HOH G . 
R 6 HOH 26 207 97  HOH HOH G . 
R 6 HOH 27 208 98  HOH HOH G . 
R 6 HOH 28 209 100 HOH HOH G . 
R 6 HOH 29 210 104 HOH HOH G . 
R 6 HOH 30 211 105 HOH HOH G . 
R 6 HOH 31 212 110 HOH HOH G . 
R 6 HOH 32 213 113 HOH HOH G . 
R 6 HOH 33 214 123 HOH HOH G . 
R 6 HOH 34 215 140 HOH HOH G . 
R 6 HOH 35 216 147 HOH HOH G . 
R 6 HOH 36 217 166 HOH HOH G . 
R 6 HOH 37 218 167 HOH HOH G . 
R 6 HOH 38 219 171 HOH HOH G . 
R 6 HOH 39 220 174 HOH HOH G . 
R 6 HOH 40 221 176 HOH HOH G . 
R 6 HOH 41 222 179 HOH HOH G . 
R 6 HOH 42 223 180 HOH HOH G . 
S 6 HOH 1  191 7   HOH HOH H . 
S 6 HOH 2  192 10  HOH HOH H . 
S 6 HOH 3  193 15  HOH HOH H . 
S 6 HOH 4  194 18  HOH HOH H . 
S 6 HOH 5  195 21  HOH HOH H . 
S 6 HOH 6  196 22  HOH HOH H . 
S 6 HOH 7  197 23  HOH HOH H . 
S 6 HOH 8  198 45  HOH HOH H . 
S 6 HOH 9  199 46  HOH HOH H . 
S 6 HOH 10 200 47  HOH HOH H . 
S 6 HOH 11 201 59  HOH HOH H . 
S 6 HOH 12 202 61  HOH HOH H . 
S 6 HOH 13 203 67  HOH HOH H . 
S 6 HOH 14 204 72  HOH HOH H . 
S 6 HOH 15 205 77  HOH HOH H . 
S 6 HOH 16 206 94  HOH HOH H . 
S 6 HOH 17 207 101 HOH HOH H . 
S 6 HOH 18 208 106 HOH HOH H . 
S 6 HOH 19 209 108 HOH HOH H . 
S 6 HOH 20 210 118 HOH HOH H . 
S 6 HOH 21 211 122 HOH HOH H . 
S 6 HOH 22 212 131 HOH HOH H . 
S 6 HOH 23 213 133 HOH HOH H . 
S 6 HOH 24 214 135 HOH HOH H . 
S 6 HOH 25 215 143 HOH HOH H . 
S 6 HOH 26 216 150 HOH HOH H . 
S 6 HOH 27 217 152 HOH HOH H . 
S 6 HOH 28 218 156 HOH HOH H . 
S 6 HOH 29 219 162 HOH HOH H . 
S 6 HOH 30 220 175 HOH HOH H . 
T 6 HOH 1  39  39  HOH HOH I . 
T 6 HOH 2  60  60  HOH HOH I . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? pentameric 5 
2 author_defined_assembly ? pentameric 5 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,K,L,M,N,O 
2 1 F,G,H,I,J,P,Q,R,S,T 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-05-17 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2013-03-06 
5 'Structure model' 1 4 2020-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Other                       
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' pdbx_entity_src_syn      
2 5 'Structure model' pdbx_struct_assembly     
3 5 'Structure model' pdbx_struct_assembly_gen 
4 5 'Structure model' struct_ref_seq_dif       
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement       1.1 ? 1 
HKL-2000 'data reduction' .   ? 2 
HKL-2000 'data scaling'   .   ? 3 
MOLREP   phasing          .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CG2 C ILE 1  ? ? O C HOH 230 ? ? 1.78 
2 1 O   H VAL 8  ? ? O H TYR 32  ? ? 2.10 
3 1 O   D VAL 8  ? ? O D TYR 32  ? ? 2.16 
4 1 CG2 F ILE 60 ? ? O F HOH 120 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C  B SER 7   ? ? N  B PRO 8   ? ? CD B PRO 8   ? ? 115.52 128.40 -12.88 2.10 Y 
2  1 CA B ALA 52  ? ? C  B ALA 52  ? ? N  B GLY 53  ? ? 103.68 116.20 -12.52 2.00 Y 
3  1 C  B ALA 52  ? ? N  B GLY 53  ? ? CA B GLY 53  ? ? 135.18 122.30 12.88  2.10 Y 
4  1 C  D GLN 96  ? ? N  D PRO 97  ? ? CD D PRO 97  ? ? 113.27 128.40 -15.13 2.10 Y 
5  1 CA E SER 100 ? ? C  E SER 100 ? ? N  E GLY 101 ? ? 128.61 116.20 12.41  2.00 Y 
6  1 C  E SER 100 ? ? N  E GLY 101 ? ? CA E GLY 101 ? ? 107.17 122.30 -15.13 2.10 Y 
7  1 N  F GLY 53  ? ? CA F GLY 53  ? ? C  F GLY 53  ? ? 96.79  113.10 -16.31 2.50 N 
8  1 C  G PRO 114 ? ? N  G PRO 115 ? ? CA G PRO 115 ? ? 131.40 119.30 12.10  1.50 Y 
9  1 C  G PRO 114 ? ? N  G PRO 115 ? ? CD G PRO 115 ? ? 113.06 128.40 -15.34 2.10 Y 
10 1 C  H GLN 96  ? ? N  H PRO 97  ? ? CD H PRO 97  ? ? 114.86 128.40 -13.54 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 7   ? ? -62.45  94.55   
2  1 GLU A 14  ? ? -28.72  124.48  
3  1 GLU A 16  ? ? -76.68  -161.78 
4  1 GLU A 25  ? ? -142.84 50.68   
5  1 SER A 27  ? ? -51.57  -9.54   
6  1 LEU A 46  ? ? -98.27  -67.25  
7  1 ASP A 58  ? ? -172.65 87.09   
8  1 LYS A 68  ? ? -29.30  -67.88  
9  1 GLU A 70  ? ? 73.73   -6.51   
10 1 LEU A 73  ? ? -172.57 144.46  
11 1 ASP A 79  ? ? 52.23   70.82   
12 1 SER A 80  ? ? -47.29  176.20  
13 1 GLN A 81  ? ? 179.59  126.69  
14 1 SER A 85  ? ? -78.80  34.90   
15 1 ALA A 86  ? ? -101.16 -147.47 
16 1 SER B 7   ? ? -54.97  -77.01  
17 1 ASN B 27  ? ? -55.17  -9.37   
18 1 ALA B 52  ? ? -132.71 -69.04  
19 1 GLN B 72  ? ? -39.76  -38.68  
20 1 SER B 81  ? ? -173.59 71.23   
21 1 ALA B 82  ? ? -33.65  148.55  
22 1 THR B 112 ? ? -165.83 118.09  
23 1 ALA C 3   ? ? -177.81 -173.04 
24 1 TYR C 9   ? ? -101.43 79.50   
25 1 SER C 125 ? ? 89.65   17.84   
26 1 SER C 136 ? ? -75.15  -169.51 
27 1 ASP D 2   ? ? -53.65  -77.23  
28 1 SER D 3   ? ? -130.14 -61.96  
29 1 ASN D 19  ? ? 54.48   74.88   
30 1 TYR D 32  ? ? -90.52  -80.67  
31 1 LYS D 63  ? ? -70.78  -73.09  
32 1 LEU D 68  ? ? -29.75  -50.89  
33 1 THR D 89  ? ? -116.98 -81.38  
34 1 ARG D 105 ? ? -109.62 -142.93 
35 1 ALA D 108 ? ? -145.85 -155.55 
36 1 ASN D 110 ? ? -179.05 92.05   
37 1 SER P 7   ? ? -102.76 -167.07 
38 1 SER E 6   ? ? -64.66  -82.11  
39 1 PRO E 7   ? ? -56.07  103.70  
40 1 GLU E 14  ? ? -36.22  142.66  
41 1 SER E 27  ? ? -48.07  -15.80  
42 1 PRO E 39  ? ? -34.83  130.49  
43 1 SER E 51  ? ? -53.02  -3.01   
44 1 LYS E 68  ? ? -39.37  -77.28  
45 1 GLU E 70  ? ? 68.95   -10.75  
46 1 ASP E 79  ? ? 49.89   74.27   
47 1 SER E 80  ? ? -57.00  -165.97 
48 1 GLN E 81  ? ? 174.80  134.87  
49 1 PRO E 82  ? ? -67.24  60.25   
50 1 ALA E 86  ? ? -164.99 -159.67 
51 1 SER F 7   ? ? -57.15  -94.09  
52 1 PRO F 8   ? ? -48.31  109.35  
53 1 THR F 15  ? ? -62.06  83.30   
54 1 THR F 20  ? ? -150.25 89.87   
55 1 TRP F 34  ? ? -163.36 101.87  
56 1 ILE F 60  ? ? -118.95 55.54   
57 1 SER F 81  ? ? -153.56 76.78   
58 1 ALA F 82  ? ? -37.58  139.31  
59 1 ALA F 97  ? ? -50.63  83.99   
60 1 THR F 112 ? ? -162.75 112.81  
61 1 PRO G 115 ? ? -63.60  46.16   
62 1 SER G 125 ? ? 72.67   -4.57   
63 1 SER H 3   ? ? -138.62 -40.88  
64 1 ASN H 19  ? ? 46.96   72.01   
65 1 GLN H 22  ? ? -57.79  -76.64  
66 1 TYR H 32  ? ? -87.32  -81.53  
67 1 ASN H 33  ? ? -102.79 -66.78  
68 1 ALA H 58  ? ? -38.06  -71.11  
69 1 THR H 89  ? ? -119.78 -84.15  
70 1 ARG H 105 ? ? -154.20 -144.14 
71 1 ALA H 108 ? ? -127.55 -166.73 
72 1 ASN H 110 ? ? -175.77 110.38  
73 1 ASN H 113 ? ? -119.78 -164.76 
74 1 PRO H 124 ? ? -78.96  -164.68 
75 1 LYS H 126 ? ? -39.97  121.03  
76 1 TRP H 153 ? ? 77.22   35.38   
# 
_pdbx_entity_nonpoly.entity_id   6 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#