data_1U4E
# 
_entry.id   1U4E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1U4E         
RCSB  RCSB023230   
WWPDB D_1000023230 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1P7B 'The cytoplasmic domain of KirBac1.1 channel is homologous to the one of GIRK channel' unspecified 
PDB 1N9P 'The same protein with some different local conformations'                             unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1U4E 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pegan, S.'       1 
'Arrabit, C.'     2 
'Zhou, W.'        3 
'Kwiatkowski, W.' 4 
'Slesinger, P.A.' 5 
'Choe, S.'        6 
# 
_citation.id                        primary 
_citation.title                     
'Cytoplasmic domain structures of Kir2.1 and Kir3.1 show sites for modulating gating and rectification' 
_citation.journal_abbrev            Nat.Neurosci. 
_citation.journal_volume            8 
_citation.page_first                279 
_citation.page_last                 287 
_citation.year                      2005 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1097-6256 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15723059 
_citation.pdbx_database_id_DOI      10.1038/nn1411 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pegan, S.'       1 
primary 'Arrabit, C.'     2 
primary 'Zhou, W.'        3 
primary 'Kwiatkowski, W.' 4 
primary 'Collins, A.'     5 
primary 'Slesinger, P.A.' 6 
primary 'Choe, S.'        7 
# 
_cell.entry_id           1U4E 
_cell.length_a           76.357 
_cell.length_b           76.357 
_cell.length_c           92.164 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1U4E 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'G protein-activated inward rectifier potassium channel 1' 24152.568 1   ? ? 'Cytoplasmic domain' ? 
2 water   nat water                                                      18.015    129 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'GIRK1; Potassium channel, inwardly rectifying, subfamily J, member 3; Inward rectifier K+ channel Kir3.1; KGA; KGB1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PRGSHGKKRQRFVDKNGRCNVQHGNLGSEKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTP
EGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTED
EVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PRGSHGKKRQRFVDKNGRCNVQHGNLGSEKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTP
EGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTED
EVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   GLY n 
1 7   LYS n 
1 8   LYS n 
1 9   ARG n 
1 10  GLN n 
1 11  ARG n 
1 12  PHE n 
1 13  VAL n 
1 14  ASP n 
1 15  LYS n 
1 16  ASN n 
1 17  GLY n 
1 18  ARG n 
1 19  CYS n 
1 20  ASN n 
1 21  VAL n 
1 22  GLN n 
1 23  HIS n 
1 24  GLY n 
1 25  ASN n 
1 26  LEU n 
1 27  GLY n 
1 28  SER n 
1 29  GLU n 
1 30  LYS n 
1 31  ARG n 
1 32  ALA n 
1 33  GLU n 
1 34  THR n 
1 35  LEU n 
1 36  MET n 
1 37  PHE n 
1 38  SER n 
1 39  GLU n 
1 40  HIS n 
1 41  ALA n 
1 42  VAL n 
1 43  ILE n 
1 44  SER n 
1 45  MET n 
1 46  ARG n 
1 47  ASP n 
1 48  GLY n 
1 49  LYS n 
1 50  LEU n 
1 51  THR n 
1 52  LEU n 
1 53  MET n 
1 54  PHE n 
1 55  ARG n 
1 56  VAL n 
1 57  GLY n 
1 58  ASN n 
1 59  LEU n 
1 60  ARG n 
1 61  ASN n 
1 62  SER n 
1 63  HIS n 
1 64  MET n 
1 65  VAL n 
1 66  SER n 
1 67  ALA n 
1 68  GLN n 
1 69  ILE n 
1 70  ARG n 
1 71  CYS n 
1 72  LYS n 
1 73  LEU n 
1 74  LEU n 
1 75  LYS n 
1 76  SER n 
1 77  ARG n 
1 78  GLN n 
1 79  THR n 
1 80  PRO n 
1 81  GLU n 
1 82  GLY n 
1 83  GLU n 
1 84  PHE n 
1 85  LEU n 
1 86  PRO n 
1 87  LEU n 
1 88  ASP n 
1 89  GLN n 
1 90  LEU n 
1 91  GLU n 
1 92  LEU n 
1 93  ASP n 
1 94  VAL n 
1 95  GLY n 
1 96  PHE n 
1 97  SER n 
1 98  THR n 
1 99  GLY n 
1 100 ALA n 
1 101 ASP n 
1 102 GLN n 
1 103 LEU n 
1 104 PHE n 
1 105 LEU n 
1 106 VAL n 
1 107 SER n 
1 108 PRO n 
1 109 LEU n 
1 110 THR n 
1 111 ILE n 
1 112 CYS n 
1 113 HIS n 
1 114 VAL n 
1 115 ILE n 
1 116 ASP n 
1 117 ALA n 
1 118 LYS n 
1 119 SER n 
1 120 PRO n 
1 121 PHE n 
1 122 TYR n 
1 123 ASP n 
1 124 LEU n 
1 125 SER n 
1 126 GLN n 
1 127 ARG n 
1 128 SER n 
1 129 MET n 
1 130 GLN n 
1 131 THR n 
1 132 GLU n 
1 133 GLN n 
1 134 PHE n 
1 135 GLU n 
1 136 VAL n 
1 137 VAL n 
1 138 VAL n 
1 139 ILE n 
1 140 LEU n 
1 141 GLU n 
1 142 GLY n 
1 143 ILE n 
1 144 VAL n 
1 145 GLU n 
1 146 THR n 
1 147 THR n 
1 148 GLY n 
1 149 MET n 
1 150 THR n 
1 151 CYS n 
1 152 GLN n 
1 153 ALA n 
1 154 ARG n 
1 155 THR n 
1 156 SER n 
1 157 TYR n 
1 158 THR n 
1 159 GLU n 
1 160 ASP n 
1 161 GLU n 
1 162 VAL n 
1 163 LEU n 
1 164 TRP n 
1 165 GLY n 
1 166 HIS n 
1 167 ARG n 
1 168 PHE n 
1 169 PHE n 
1 170 PRO n 
1 171 VAL n 
1 172 ILE n 
1 173 SER n 
1 174 LEU n 
1 175 GLU n 
1 176 GLU n 
1 177 GLY n 
1 178 PHE n 
1 179 PHE n 
1 180 LYS n 
1 181 VAL n 
1 182 ASP n 
1 183 TYR n 
1 184 SER n 
1 185 GLN n 
1 186 PHE n 
1 187 HIS n 
1 188 ALA n 
1 189 THR n 
1 190 PHE n 
1 191 GLU n 
1 192 VAL n 
1 193 PRO n 
1 194 THR n 
1 195 PRO n 
1 196 PRO n 
1 197 TYR n 
1 198 SER n 
1 199 VAL n 
1 200 LYS n 
1 201 GLU n 
1 202 GLN n 
1 203 GLU n 
1 204 GLU n 
1 205 MET n 
1 206 LEU n 
1 207 LEU n 
1 208 MET n 
1 209 SER n 
1 210 SER n 
1 211 PRO n 
1 212 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 7  29  'house mouse' Mus 'Kcnj3, GIRK1, Kga' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? pHIS8 ? ? 
1 2 sample ? 30 212 'house mouse' Mus 'Kcnj3, GIRK1, Kga' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? pHIS8 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IRK3_MOUSE P63250 1 KKRQRFVDKNGRCNVQHGNLGSE 41  ? 
2 UNP IRK3_MOUSE P35562 1 
;KRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPL
TICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHAT
FEVPTPPYSVKEQEEMLLMSSPL
;
189 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1U4E A 7  ? 29  ? P63250 41  ? 63  ? 41  63  
2 2 1U4E A 30 ? 212 ? P35562 189 ? 371 ? 189 371 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1U4E PRO A 1 ? UNP P63250 ? ? 'CLONING ARTIFACT' 35 1 
1 1U4E ARG A 2 ? UNP P63250 ? ? 'CLONING ARTIFACT' 36 2 
1 1U4E GLY A 3 ? UNP P63250 ? ? 'CLONING ARTIFACT' 37 3 
1 1U4E SER A 4 ? UNP P63250 ? ? 'CLONING ARTIFACT' 38 4 
1 1U4E HIS A 5 ? UNP P63250 ? ? 'CLONING ARTIFACT' 39 5 
1 1U4E GLY A 6 ? UNP P63250 ? ? 'CLONING ARTIFACT' 40 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1U4E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   44.6 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'ethanol, hepes, magnesium chloride, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2003-03-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.08 
# 
_reflns.entry_id                     1U4E 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.08 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   17035 
_reflns.number_obs                   16100 
_reflns.percent_possible_obs         94.51 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.07 
_reflns.pdbx_netI_over_sigmaI        23.02 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.08 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_all   73.32 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1U4E 
_refine.ls_number_reflns_obs                     15270 
_refine.ls_number_reflns_all                     15270 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             91.29 
_refine.ls_d_res_high                            2.09 
_refine.ls_percent_reflns_obs                    96.00 
_refine.ls_R_factor_obs                          0.19641 
_refine.ls_R_factor_all                          0.19641 
_refine.ls_R_factor_R_work                       0.19431 
_refine.ls_R_factor_R_free                       0.23505 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  813 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.936 
_refine.B_iso_mean                               33.928 
_refine.aniso_B[1][1]                            -1.12 
_refine.aniso_B[2][2]                            -1.12 
_refine.aniso_B[3][3]                            2.23 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1N9P' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.191 
_refine.pdbx_overall_ESU_R_Free                  0.171 
_refine.overall_SU_ML                            0.121 
_refine.overall_SU_B                             4.589 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1599 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             129 
_refine_hist.number_atoms_total               1728 
_refine_hist.d_res_high                       2.09 
_refine_hist.d_res_low                        91.29 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.034 0.021 ? 1632 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 1461 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.378 1.951 ? 2204 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.161 3.000 ? 3398 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   9.008 5.000 ? 198  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.177 0.200 ? 246  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.012 0.020 ? 1803 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.005 0.020 ? 340  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.234 0.200 ? 305  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.272 0.200 ? 1720 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.098 0.200 ? 992  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.222 0.200 ? 112  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.237 0.200 ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.377 0.200 ? 79   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.200 0.200 ? 21   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.858 1.500 ? 996  'X-RAY DIFFRACTION' ? 
r_mcbond_other           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it             3.268 2.000 ? 1618 'X-RAY DIFFRACTION' ? 
r_scbond_it              4.212 3.000 ? 636  'X-RAY DIFFRACTION' ? 
r_scangle_it             6.655 4.500 ? 586  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.09 
_refine_ls_shell.d_res_low                        2.145 
_refine_ls_shell.number_reflns_R_work             999 
_refine_ls_shell.R_factor_R_work                  0.276 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.322 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             47 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1U4E 
_struct.title                     'Crystal Structure of Cytoplasmic Domains of GIRK1 channel' 
_struct.pdbx_descriptor           'G protein-activated inward rectifier potassium channel 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1U4E 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 125 ? GLN A 130 ? SER A 284 GLN A 289 1 ? 6 
HELX_P HELX_P2 2 SER A 184 ? PHE A 186 ? SER A 343 PHE A 345 5 ? 3 
HELX_P HELX_P3 3 SER A 198 ? MET A 205 ? SER A 357 MET A 364 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 4 ? 
D ? 4 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 21  ? GLY A 24  ? VAL A 55  GLY A 58  
A 2 PHE A 178 ? ASP A 182 ? PHE A 337 ASP A 341 
A 3 ILE A 172 ? GLU A 175 ? ILE A 331 GLU A 334 
B 1 LEU A 35  ? PHE A 37  ? LEU A 194 PHE A 196 
B 2 LYS A 49  ? ASN A 58  ? LYS A 208 ASN A 217 
B 3 LEU A 109 ? VAL A 114 ? LEU A 268 VAL A 273 
C 1 LEU A 35  ? PHE A 37  ? LEU A 194 PHE A 196 
C 2 LYS A 49  ? ASN A 58  ? LYS A 208 ASN A 217 
C 3 ALA A 41  ? ARG A 46  ? ALA A 200 ARG A 205 
C 4 VAL A 162 ? TRP A 164 ? VAL A 321 TRP A 323 
D 1 PHE A 84  ? GLU A 91  ? PHE A 243 GLU A 250 
D 2 MET A 64  ? GLN A 78  ? MET A 223 GLN A 237 
D 3 GLU A 135 ? VAL A 144 ? GLU A 294 VAL A 303 
D 4 THR A 150 ? THR A 158 ? THR A 309 THR A 317 
E 1 HIS A 166 ? PHE A 168 ? HIS A 325 PHE A 327 
E 2 THR A 189 ? GLU A 191 ? THR A 348 GLU A 350 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 22  ? N GLN A 56  O PHE A 179 ? O PHE A 338 
A 2 3 O LYS A 180 ? O LYS A 339 N SER A 173 ? N SER A 332 
B 1 2 N MET A 36  ? N MET A 195 O GLY A 57  ? O GLY A 216 
B 2 3 N LEU A 52  ? N LEU A 211 O HIS A 113 ? O HIS A 272 
C 1 2 N MET A 36  ? N MET A 195 O GLY A 57  ? O GLY A 216 
C 2 3 O MET A 53  ? O MET A 212 N VAL A 42  ? N VAL A 201 
C 3 4 N ALA A 41  ? N ALA A 200 O LEU A 163 ? O LEU A 322 
D 1 2 O LEU A 85  ? O LEU A 244 N ARG A 77  ? N ARG A 236 
D 2 3 N LYS A 72  ? N LYS A 231 O VAL A 137 ? O VAL A 296 
D 3 4 N LEU A 140 ? N LEU A 299 O ALA A 153 ? O ALA A 312 
E 1 2 N ARG A 167 ? N ARG A 326 O PHE A 190 ? O PHE A 349 
# 
_database_PDB_matrix.entry_id          1U4E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1U4E 
_atom_sites.fract_transf_matrix[1][1]   0.013096 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013096 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010850 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 8   ? 23.035 8.772  30.633  1.00 67.52 ? 42  LYS A N   1 
ATOM   2    C CA  . LYS A 1 8   ? 24.267 8.748  31.475  1.00 67.94 ? 42  LYS A CA  1 
ATOM   3    C C   . LYS A 1 8   ? 24.778 10.206 31.576  1.00 66.05 ? 42  LYS A C   1 
ATOM   4    O O   . LYS A 1 8   ? 24.937 10.725 32.695  1.00 65.65 ? 42  LYS A O   1 
ATOM   5    C CB  . LYS A 1 8   ? 25.356 7.742  30.953  1.00 69.00 ? 42  LYS A CB  1 
ATOM   6    C CG  . LYS A 1 8   ? 24.840 6.252  30.632  1.00 72.83 ? 42  LYS A CG  1 
ATOM   7    C CD  . LYS A 1 8   ? 23.585 5.740  31.505  1.00 76.20 ? 42  LYS A CD  1 
ATOM   8    C CE  . LYS A 1 8   ? 22.175 5.970  30.850  1.00 78.16 ? 42  LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 8   ? 21.468 7.237  31.333  1.00 78.97 ? 42  LYS A NZ  1 
ATOM   10   N N   . ARG A 1 9   ? 24.977 10.866 30.423  1.00 63.85 ? 43  ARG A N   1 
ATOM   11   C CA  . ARG A 1 9   ? 25.469 12.255 30.372  1.00 61.93 ? 43  ARG A CA  1 
ATOM   12   C C   . ARG A 1 9   ? 24.637 13.148 31.315  1.00 58.70 ? 43  ARG A C   1 
ATOM   13   O O   . ARG A 1 9   ? 23.433 13.016 31.422  1.00 57.68 ? 43  ARG A O   1 
ATOM   14   C CB  . ARG A 1 9   ? 25.477 12.814 28.928  1.00 62.79 ? 43  ARG A CB  1 
ATOM   15   C CG  . ARG A 1 9   ? 24.125 13.428 28.484  1.00 65.05 ? 43  ARG A CG  1 
ATOM   16   C CD  . ARG A 1 9   ? 23.928 13.722 26.958  1.00 67.67 ? 43  ARG A CD  1 
ATOM   17   N NE  . ARG A 1 9   ? 22.555 14.162 26.725  1.00 65.69 ? 43  ARG A NE  1 
ATOM   18   C CZ  . ARG A 1 9   ? 22.096 15.346 27.133  1.00 66.39 ? 43  ARG A CZ  1 
ATOM   19   N NH1 . ARG A 1 9   ? 22.887 16.209 27.758  1.00 67.74 ? 43  ARG A NH1 1 
ATOM   20   N NH2 . ARG A 1 9   ? 20.839 15.662 26.946  1.00 65.55 ? 43  ARG A NH2 1 
ATOM   21   N N   . GLN A 1 10  ? 25.315 14.028 32.020  1.00 55.56 ? 44  GLN A N   1 
ATOM   22   C CA  . GLN A 1 10  ? 24.649 14.918 32.952  1.00 53.73 ? 44  GLN A CA  1 
ATOM   23   C C   . GLN A 1 10  ? 23.556 15.850 32.263  1.00 49.66 ? 44  GLN A C   1 
ATOM   24   O O   . GLN A 1 10  ? 23.831 16.551 31.257  1.00 49.77 ? 44  GLN A O   1 
ATOM   25   C CB  . GLN A 1 10  ? 25.731 15.740 33.721  1.00 54.96 ? 44  GLN A CB  1 
ATOM   26   C CG  . GLN A 1 10  ? 25.235 16.481 34.984  1.00 55.56 ? 44  GLN A CG  1 
ATOM   27   C CD  . GLN A 1 10  ? 24.361 15.599 35.837  1.00 57.27 ? 44  GLN A CD  1 
ATOM   28   O OE1 . GLN A 1 10  ? 23.114 15.732 35.798  1.00 54.49 ? 44  GLN A OE1 1 
ATOM   29   N NE2 . GLN A 1 10  ? 24.993 14.660 36.590  1.00 58.91 ? 44  GLN A NE2 1 
ATOM   30   N N   . ARG A 1 11  ? 22.351 15.831 32.851  1.00 44.53 ? 45  ARG A N   1 
ATOM   31   C CA  . ARG A 1 11  ? 21.207 16.729 32.536  1.00 39.63 ? 45  ARG A CA  1 
ATOM   32   C C   . ARG A 1 11  ? 21.189 18.077 33.333  1.00 36.52 ? 45  ARG A C   1 
ATOM   33   O O   . ARG A 1 11  ? 21.590 18.151 34.509  1.00 32.98 ? 45  ARG A O   1 
ATOM   34   C CB  . ARG A 1 11  ? 19.899 15.971 32.788  1.00 38.49 ? 45  ARG A CB  1 
ATOM   35   C CG  . ARG A 1 11  ? 19.585 15.673 34.213  1.00 38.42 ? 45  ARG A CG  1 
ATOM   36   C CD  . ARG A 1 11  ? 18.416 14.583 34.525  1.00 39.36 ? 45  ARG A CD  1 
ATOM   37   N NE  . ARG A 1 11  ? 17.192 14.867 33.763  1.00 30.98 ? 45  ARG A NE  1 
ATOM   38   C CZ  . ARG A 1 11  ? 16.529 13.969 33.009  1.00 35.88 ? 45  ARG A CZ  1 
ATOM   39   N NH1 . ARG A 1 11  ? 16.855 12.642 32.961  1.00 28.99 ? 45  ARG A NH1 1 
ATOM   40   N NH2 . ARG A 1 11  ? 15.510 14.390 32.291  1.00 35.19 ? 45  ARG A NH2 1 
ATOM   41   N N   . PHE A 1 12  ? 20.628 19.138 32.747  1.00 33.30 ? 46  PHE A N   1 
ATOM   42   C CA  . PHE A 1 12  ? 20.547 20.407 33.512  1.00 32.20 ? 46  PHE A CA  1 
ATOM   43   C C   . PHE A 1 12  ? 19.509 20.394 34.665  1.00 30.18 ? 46  PHE A C   1 
ATOM   44   O O   . PHE A 1 12  ? 19.651 20.983 35.770  1.00 27.02 ? 46  PHE A O   1 
ATOM   45   C CB  . PHE A 1 12  ? 20.240 21.539 32.548  1.00 32.71 ? 46  PHE A CB  1 
ATOM   46   C CG  . PHE A 1 12  ? 20.474 22.900 33.137  1.00 37.50 ? 46  PHE A CG  1 
ATOM   47   C CD1 . PHE A 1 12  ? 21.774 23.308 33.485  1.00 40.77 ? 46  PHE A CD1 1 
ATOM   48   C CD2 . PHE A 1 12  ? 19.420 23.768 33.383  1.00 41.11 ? 46  PHE A CD2 1 
ATOM   49   C CE1 . PHE A 1 12  ? 21.992 24.561 33.989  1.00 40.90 ? 46  PHE A CE1 1 
ATOM   50   C CE2 . PHE A 1 12  ? 19.661 25.050 33.905  1.00 42.85 ? 46  PHE A CE2 1 
ATOM   51   C CZ  . PHE A 1 12  ? 20.916 25.436 34.178  1.00 38.98 ? 46  PHE A CZ  1 
ATOM   52   N N   . VAL A 1 13  ? 18.407 19.748 34.368  1.00 27.96 ? 47  VAL A N   1 
ATOM   53   C CA  . VAL A 1 13  ? 17.240 19.725 35.273  1.00 26.60 ? 47  VAL A CA  1 
ATOM   54   C C   . VAL A 1 13  ? 16.906 18.209 35.414  1.00 25.49 ? 47  VAL A C   1 
ATOM   55   O O   . VAL A 1 13  ? 16.751 17.463 34.378  1.00 23.80 ? 47  VAL A O   1 
ATOM   56   C CB  . VAL A 1 13  ? 15.993 20.501 34.646  1.00 25.80 ? 47  VAL A CB  1 
ATOM   57   C CG1 . VAL A 1 13  ? 14.765 20.443 35.482  1.00 26.78 ? 47  VAL A CG1 1 
ATOM   58   C CG2 . VAL A 1 13  ? 16.328 21.953 34.355  1.00 27.21 ? 47  VAL A CG2 1 
ATOM   59   N N   . ASP A 1 14  ? 16.673 17.835 36.632  1.00 25.16 ? 48  ASP A N   1 
ATOM   60   C CA  . ASP A 1 14  ? 16.397 16.455 37.009  1.00 28.24 ? 48  ASP A CA  1 
ATOM   61   C C   . ASP A 1 14  ? 14.885 16.266 36.733  1.00 29.22 ? 48  ASP A C   1 
ATOM   62   O O   . ASP A 1 14  ? 14.119 17.285 36.674  1.00 26.00 ? 48  ASP A O   1 
ATOM   63   C CB  . ASP A 1 14  ? 16.636 16.355 38.541  1.00 30.55 ? 48  ASP A CB  1 
ATOM   64   C CG  . ASP A 1 14  ? 18.021 15.799 38.897  1.00 31.74 ? 48  ASP A CG  1 
ATOM   65   O OD1 . ASP A 1 14  ? 18.934 15.721 38.056  1.00 35.89 ? 48  ASP A OD1 1 
ATOM   66   O OD2 . ASP A 1 14  ? 18.211 15.343 40.036  1.00 42.47 ? 48  ASP A OD2 1 
ATOM   67   N N   . LYS A 1 15  ? 14.429 15.016 36.720  1.00 29.54 ? 49  LYS A N   1 
ATOM   68   C CA  . LYS A 1 15  ? 13.003 14.731 36.459  1.00 30.83 ? 49  LYS A CA  1 
ATOM   69   C C   . LYS A 1 15  ? 12.103 15.407 37.435  1.00 31.36 ? 49  LYS A C   1 
ATOM   70   O O   . LYS A 1 15  ? 10.933 15.769 37.130  1.00 29.35 ? 49  LYS A O   1 
ATOM   71   C CB  . LYS A 1 15  ? 12.741 13.206 36.492  1.00 33.01 ? 49  LYS A CB  1 
ATOM   72   C CG  . LYS A 1 15  ? 13.556 12.388 35.491  1.00 34.27 ? 49  LYS A CG  1 
ATOM   73   C CD  . LYS A 1 15  ? 13.183 12.730 34.012  1.00 38.63 ? 49  LYS A CD  1 
ATOM   74   C CE  . LYS A 1 15  ? 11.927 12.033 33.529  1.00 31.44 ? 49  LYS A CE  1 
ATOM   75   N NZ  . LYS A 1 15  ? 11.711 12.550 32.127  1.00 26.82 ? 49  LYS A NZ  1 
ATOM   76   N N   . ASN A 1 16  ? 12.604 15.570 38.667  1.00 30.59 ? 50  ASN A N   1 
ATOM   77   C CA  . ASN A 1 16  ? 11.782 16.246 39.645  1.00 30.81 ? 50  ASN A CA  1 
ATOM   78   C C   . ASN A 1 16  ? 11.832 17.733 39.639  1.00 28.03 ? 50  ASN A C   1 
ATOM   79   O O   . ASN A 1 16  ? 11.231 18.329 40.459  1.00 26.48 ? 50  ASN A O   1 
ATOM   80   C CB  . ASN A 1 16  ? 12.024 15.744 41.103  1.00 32.37 ? 50  ASN A CB  1 
ATOM   81   C CG  . ASN A 1 16  ? 13.429 16.095 41.661  1.00 36.35 ? 50  ASN A CG  1 
ATOM   82   O OD1 . ASN A 1 16  ? 14.201 16.833 41.065  1.00 36.36 ? 50  ASN A OD1 1 
ATOM   83   N ND2 . ASN A 1 16  ? 13.720 15.571 42.854  1.00 38.90 ? 50  ASN A ND2 1 
ATOM   84   N N   . GLY A 1 17  ? 12.610 18.374 38.800  1.00 30.21 ? 51  GLY A N   1 
ATOM   85   C CA  . GLY A 1 17  ? 12.628 19.812 38.814  1.00 30.00 ? 51  GLY A CA  1 
ATOM   86   C C   . GLY A 1 17  ? 13.905 20.443 39.370  1.00 31.45 ? 51  GLY A C   1 
ATOM   87   O O   . GLY A 1 17  ? 14.145 21.629 39.162  1.00 28.81 ? 51  GLY A O   1 
ATOM   88   N N   . ARG A 1 18  ? 14.765 19.663 39.972  1.00 31.43 ? 52  ARG A N   1 
ATOM   89   C CA  . ARG A 1 18  ? 15.940 20.251 40.670  1.00 33.61 ? 52  ARG A CA  1 
ATOM   90   C C   . ARG A 1 18  ? 16.959 20.595 39.617  1.00 33.46 ? 52  ARG A C   1 
ATOM   91   O O   . ARG A 1 18  ? 17.197 19.758 38.680  1.00 30.39 ? 52  ARG A O   1 
ATOM   92   C CB  . ARG A 1 18  ? 16.577 19.240 41.696  1.00 36.08 ? 52  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 18  ? 17.836 19.772 42.456  1.00 40.69 ? 52  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 18  ? 18.336 18.909 43.727  1.00 52.73 ? 52  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 18  ? 18.002 19.772 44.896  1.00 61.29 ? 52  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 18  ? 16.835 19.728 45.565  1.00 64.74 ? 52  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 18  ? 15.906 18.778 45.304  1.00 66.95 ? 52  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 18  ? 16.618 20.614 46.531  1.00 66.07 ? 52  ARG A NH2 1 
ATOM   99   N N   . CYS A 1 19  ? 17.485 21.838 39.664  1.00 34.16 ? 53  CYS A N   1 
ATOM   100  C CA  . CYS A 1 19  ? 18.530 22.244 38.695  1.00 36.28 ? 53  CYS A CA  1 
ATOM   101  C C   . CYS A 1 19  ? 19.925 21.883 39.211  1.00 36.28 ? 53  CYS A C   1 
ATOM   102  O O   . CYS A 1 19  ? 20.205 22.111 40.382  1.00 37.26 ? 53  CYS A O   1 
ATOM   103  C CB  . CYS A 1 19  ? 18.438 23.731 38.321  1.00 37.08 ? 53  CYS A CB  1 
ATOM   104  S SG  . CYS A 1 19  ? 16.751 24.194 37.770  1.00 39.47 ? 53  CYS A SG  1 
ATOM   105  N N   . ASN A 1 20  ? 20.747 21.293 38.339  1.00 36.50 ? 54  ASN A N   1 
ATOM   106  C CA  . ASN A 1 20  ? 22.145 20.848 38.638  1.00 37.96 ? 54  ASN A CA  1 
ATOM   107  C C   . ASN A 1 20  ? 23.151 21.934 38.233  1.00 38.43 ? 54  ASN A C   1 
ATOM   108  O O   . ASN A 1 20  ? 24.078 21.696 37.469  1.00 38.60 ? 54  ASN A O   1 
ATOM   109  C CB  . ASN A 1 20  ? 22.481 19.545 37.901  1.00 35.69 ? 54  ASN A CB  1 
ATOM   110  C CG  . ASN A 1 20  ? 21.441 18.447 38.148  1.00 39.13 ? 54  ASN A CG  1 
ATOM   111  O OD1 . ASN A 1 20  ? 21.064 18.209 39.307  1.00 36.08 ? 54  ASN A OD1 1 
ATOM   112  N ND2 . ASN A 1 20  ? 20.911 17.848 37.060  1.00 29.59 ? 54  ASN A ND2 1 
ATOM   113  N N   . VAL A 1 21  ? 22.851 23.159 38.607  1.00 38.25 ? 55  VAL A N   1 
ATOM   114  C CA  . VAL A 1 21  ? 23.775 24.256 38.353  1.00 39.32 ? 55  VAL A CA  1 
ATOM   115  C C   . VAL A 1 21  ? 24.581 24.595 39.593  1.00 39.17 ? 55  VAL A C   1 
ATOM   116  O O   . VAL A 1 21  ? 24.010 24.717 40.633  1.00 39.32 ? 55  VAL A O   1 
ATOM   117  C CB  . VAL A 1 21  ? 23.059 25.531 37.956  1.00 38.61 ? 55  VAL A CB  1 
ATOM   118  C CG1 . VAL A 1 21  ? 23.975 26.730 37.982  1.00 42.75 ? 55  VAL A CG1 1 
ATOM   119  C CG2 . VAL A 1 21  ? 22.750 25.398 36.599  1.00 43.47 ? 55  VAL A CG2 1 
ATOM   120  N N   . GLN A 1 22  ? 25.880 24.828 39.465  1.00 39.84 ? 56  GLN A N   1 
ATOM   121  C CA  . GLN A 1 22  ? 26.603 25.462 40.579  1.00 41.75 ? 56  GLN A CA  1 
ATOM   122  C C   . GLN A 1 22  ? 27.130 26.855 40.189  1.00 40.49 ? 56  GLN A C   1 
ATOM   123  O O   . GLN A 1 22  ? 27.601 27.125 39.080  1.00 36.56 ? 56  GLN A O   1 
ATOM   124  C CB  . GLN A 1 22  ? 27.743 24.567 41.051  1.00 43.10 ? 56  GLN A CB  1 
ATOM   125  C CG  . GLN A 1 22  ? 27.267 23.186 41.486  1.00 50.75 ? 56  GLN A CG  1 
ATOM   126  C CD  . GLN A 1 22  ? 28.314 22.474 42.460  1.00 59.64 ? 56  GLN A CD  1 
ATOM   127  O OE1 . GLN A 1 22  ? 28.044 21.356 42.976  1.00 60.79 ? 56  GLN A OE1 1 
ATOM   128  N NE2 . GLN A 1 22  ? 29.496 23.150 42.697  1.00 61.46 ? 56  GLN A NE2 1 
ATOM   129  N N   . HIS A 1 23  ? 27.035 27.726 41.150  1.00 41.78 ? 57  HIS A N   1 
ATOM   130  C CA  . HIS A 1 23  ? 27.396 29.111 40.953  1.00 43.48 ? 57  HIS A CA  1 
ATOM   131  C C   . HIS A 1 23  ? 28.817 29.362 41.482  1.00 44.67 ? 57  HIS A C   1 
ATOM   132  O O   . HIS A 1 23  ? 29.006 29.356 42.663  1.00 45.09 ? 57  HIS A O   1 
ATOM   133  C CB  . HIS A 1 23  ? 26.364 29.928 41.706  1.00 43.49 ? 57  HIS A CB  1 
ATOM   134  C CG  . HIS A 1 23  ? 24.956 29.716 41.208  1.00 46.55 ? 57  HIS A CG  1 
ATOM   135  N ND1 . HIS A 1 23  ? 24.365 30.540 40.265  1.00 43.11 ? 57  HIS A ND1 1 
ATOM   136  C CD2 . HIS A 1 23  ? 24.034 28.761 41.510  1.00 48.63 ? 57  HIS A CD2 1 
ATOM   137  C CE1 . HIS A 1 23  ? 23.126 30.124 40.051  1.00 48.57 ? 57  HIS A CE1 1 
ATOM   138  N NE2 . HIS A 1 23  ? 22.911 29.028 40.765  1.00 48.00 ? 57  HIS A NE2 1 
ATOM   139  N N   . GLY A 1 24  ? 29.811 29.594 40.640  1.00 46.30 ? 58  GLY A N   1 
ATOM   140  C CA  . GLY A 1 24  ? 31.212 29.781 41.154  1.00 48.66 ? 58  GLY A CA  1 
ATOM   141  C C   . GLY A 1 24  ? 31.985 31.098 40.873  1.00 50.28 ? 58  GLY A C   1 
ATOM   142  O O   . GLY A 1 24  ? 31.652 31.875 39.925  1.00 45.51 ? 58  GLY A O   1 
ATOM   143  N N   . ASN A 1 25  ? 33.039 31.379 41.685  1.00 52.15 ? 59  ASN A N   1 
ATOM   144  C CA  . ASN A 1 25  ? 33.909 32.555 41.374  1.00 54.86 ? 59  ASN A CA  1 
ATOM   145  C C   . ASN A 1 25  ? 33.176 33.873 41.548  1.00 55.68 ? 59  ASN A C   1 
ATOM   146  O O   . ASN A 1 25  ? 33.385 34.833 40.766  1.00 55.89 ? 59  ASN A O   1 
ATOM   147  C CB  . ASN A 1 25  ? 34.512 32.488 39.916  1.00 55.63 ? 59  ASN A CB  1 
ATOM   148  C CG  . ASN A 1 25  ? 35.825 31.678 39.866  1.00 58.42 ? 59  ASN A CG  1 
ATOM   149  O OD1 . ASN A 1 25  ? 36.302 31.283 38.777  1.00 61.03 ? 59  ASN A OD1 1 
ATOM   150  N ND2 . ASN A 1 25  ? 36.401 31.408 41.060  1.00 54.92 ? 59  ASN A ND2 1 
ATOM   151  N N   . LEU A 1 26  ? 32.364 33.902 42.614  1.00 57.18 ? 60  LEU A N   1 
ATOM   152  C CA  . LEU A 1 26  ? 31.399 34.951 42.865  1.00 58.99 ? 60  LEU A CA  1 
ATOM   153  C C   . LEU A 1 26  ? 32.068 36.223 43.348  1.00 60.23 ? 60  LEU A C   1 
ATOM   154  O O   . LEU A 1 26  ? 31.510 37.302 43.128  1.00 62.30 ? 60  LEU A O   1 
ATOM   155  C CB  . LEU A 1 26  ? 30.378 34.492 43.913  1.00 59.50 ? 60  LEU A CB  1 
ATOM   156  C CG  . LEU A 1 26  ? 29.224 33.577 43.478  1.00 60.98 ? 60  LEU A CG  1 
ATOM   157  C CD1 . LEU A 1 26  ? 29.801 32.352 42.811  1.00 62.60 ? 60  LEU A CD1 1 
ATOM   158  C CD2 . LEU A 1 26  ? 28.262 33.148 44.646  1.00 61.32 ? 60  LEU A CD2 1 
ATOM   159  N N   . ARG A 1 31  ? 26.822 42.515 39.820  1.00 77.03 ? 190 ARG A N   1 
ATOM   160  C CA  . ARG A 1 31  ? 25.887 43.212 40.743  1.00 77.88 ? 190 ARG A CA  1 
ATOM   161  C C   . ARG A 1 31  ? 25.675 42.540 42.166  1.00 78.37 ? 190 ARG A C   1 
ATOM   162  O O   . ARG A 1 31  ? 24.570 42.614 42.736  1.00 78.69 ? 190 ARG A O   1 
ATOM   163  C CB  . ARG A 1 31  ? 24.471 43.390 40.086  1.00 78.31 ? 190 ARG A CB  1 
ATOM   164  C CG  . ARG A 1 31  ? 24.311 44.000 38.630  1.00 75.74 ? 190 ARG A CG  1 
ATOM   165  C CD  . ARG A 1 31  ? 24.221 45.557 38.612  1.00 77.59 ? 190 ARG A CD  1 
ATOM   166  N NE  . ARG A 1 31  ? 22.981 46.221 38.165  1.00 73.46 ? 190 ARG A NE  1 
ATOM   167  C CZ  . ARG A 1 31  ? 21.792 46.199 38.812  1.00 72.14 ? 190 ARG A CZ  1 
ATOM   168  N NH1 . ARG A 1 31  ? 21.603 45.466 39.943  1.00 74.78 ? 190 ARG A NH1 1 
ATOM   169  N NH2 . ARG A 1 31  ? 20.770 46.884 38.315  1.00 60.41 ? 190 ARG A NH2 1 
ATOM   170  N N   . ALA A 1 32  ? 26.761 42.014 42.762  1.00 78.71 ? 191 ALA A N   1 
ATOM   171  C CA  . ALA A 1 32  ? 26.804 40.802 43.665  1.00 78.19 ? 191 ALA A CA  1 
ATOM   172  C C   . ALA A 1 32  ? 25.750 40.473 44.792  1.00 77.83 ? 191 ALA A C   1 
ATOM   173  O O   . ALA A 1 32  ? 25.738 41.143 45.857  1.00 77.90 ? 191 ALA A O   1 
ATOM   174  C CB  . ALA A 1 32  ? 28.231 40.699 44.294  1.00 78.14 ? 191 ALA A CB  1 
ATOM   175  N N   . GLU A 1 33  ? 24.924 39.431 44.523  1.00 76.32 ? 192 GLU A N   1 
ATOM   176  C CA  . GLU A 1 33  ? 24.133 38.589 45.491  1.00 75.09 ? 192 GLU A CA  1 
ATOM   177  C C   . GLU A 1 33  ? 22.522 38.619 45.432  1.00 73.02 ? 192 GLU A C   1 
ATOM   178  O O   . GLU A 1 33  ? 21.830 38.015 46.283  1.00 73.57 ? 192 GLU A O   1 
ATOM   179  C CB  . GLU A 1 33  ? 24.711 38.681 46.934  1.00 76.24 ? 192 GLU A CB  1 
ATOM   180  C CG  . GLU A 1 33  ? 25.189 37.345 47.575  1.00 78.43 ? 192 GLU A CG  1 
ATOM   181  C CD  . GLU A 1 33  ? 26.211 36.504 46.752  1.00 81.30 ? 192 GLU A CD  1 
ATOM   182  O OE1 . GLU A 1 33  ? 27.438 36.831 46.771  1.00 80.03 ? 192 GLU A OE1 1 
ATOM   183  O OE2 . GLU A 1 33  ? 25.786 35.473 46.121  1.00 83.88 ? 192 GLU A OE2 1 
ATOM   184  N N   . THR A 1 34  ? 22.003 39.227 44.342  1.00 69.36 ? 193 THR A N   1 
ATOM   185  C CA  . THR A 1 34  ? 20.608 39.545 44.002  1.00 65.40 ? 193 THR A CA  1 
ATOM   186  C C   . THR A 1 34  ? 20.268 39.076 42.501  1.00 61.63 ? 193 THR A C   1 
ATOM   187  O O   . THR A 1 34  ? 20.658 37.978 42.060  1.00 62.10 ? 193 THR A O   1 
ATOM   188  C CB  . THR A 1 34  ? 20.448 41.109 44.037  1.00 66.48 ? 193 THR A CB  1 
ATOM   189  O OG1 . THR A 1 34  ? 21.717 41.737 43.739  1.00 65.34 ? 193 THR A OG1 1 
ATOM   190  C CG2 . THR A 1 34  ? 19.991 41.660 45.434  1.00 68.47 ? 193 THR A CG2 1 
ATOM   191  N N   . LEU A 1 35  ? 19.528 39.896 41.737  1.00 55.32 ? 194 LEU A N   1 
ATOM   192  C CA  . LEU A 1 35  ? 19.591 39.865 40.263  1.00 51.12 ? 194 LEU A CA  1 
ATOM   193  C C   . LEU A 1 35  ? 20.648 40.865 39.774  1.00 46.66 ? 194 LEU A C   1 
ATOM   194  O O   . LEU A 1 35  ? 20.861 41.882 40.373  1.00 46.55 ? 194 LEU A O   1 
ATOM   195  C CB  . LEU A 1 35  ? 18.233 40.156 39.632  1.00 50.84 ? 194 LEU A CB  1 
ATOM   196  C CG  . LEU A 1 35  ? 17.112 39.265 40.216  1.00 51.77 ? 194 LEU A CG  1 
ATOM   197  C CD1 . LEU A 1 35  ? 15.751 39.982 40.256  1.00 54.86 ? 194 LEU A CD1 1 
ATOM   198  C CD2 . LEU A 1 35  ? 17.001 37.967 39.471  1.00 53.30 ? 194 LEU A CD2 1 
ATOM   199  N N   . MET A 1 36  ? 21.307 40.526 38.678  1.00 40.77 ? 195 MET A N   1 
ATOM   200  C CA  . MET A 1 36  ? 22.441 41.248 38.173  1.00 34.71 ? 195 MET A CA  1 
ATOM   201  C C   . MET A 1 36  ? 22.414 41.276 36.623  1.00 27.49 ? 195 MET A C   1 
ATOM   202  O O   . MET A 1 36  ? 21.812 40.433 35.974  1.00 23.67 ? 195 MET A O   1 
ATOM   203  C CB  . MET A 1 36  ? 23.728 40.592 38.712  1.00 37.20 ? 195 MET A CB  1 
ATOM   204  C CG  . MET A 1 36  ? 23.745 39.105 38.589  1.00 41.51 ? 195 MET A CG  1 
ATOM   205  S SD  . MET A 1 36  ? 25.302 38.307 38.822  1.00 62.32 ? 195 MET A SD  1 
ATOM   206  C CE  . MET A 1 36  ? 26.568 39.762 39.057  1.00 58.94 ? 195 MET A CE  1 
ATOM   207  N N   . PHE A 1 37  ? 23.073 42.258 36.101  1.00 20.39 ? 196 PHE A N   1 
ATOM   208  C CA  . PHE A 1 37  ? 23.128 42.610 34.716  1.00 21.75 ? 196 PHE A CA  1 
ATOM   209  C C   . PHE A 1 37  ? 24.545 42.853 34.289  1.00 22.19 ? 196 PHE A C   1 
ATOM   210  O O   . PHE A 1 37  ? 25.296 43.421 35.052  1.00 21.06 ? 196 PHE A O   1 
ATOM   211  C CB  . PHE A 1 37  ? 22.377 43.926 34.499  1.00 20.54 ? 196 PHE A CB  1 
ATOM   212  C CG  . PHE A 1 37  ? 20.918 43.879 34.892  1.00 23.29 ? 196 PHE A CG  1 
ATOM   213  C CD1 . PHE A 1 37  ? 20.510 44.298 36.162  1.00 24.39 ? 196 PHE A CD1 1 
ATOM   214  C CD2 . PHE A 1 37  ? 19.952 43.368 34.018  1.00 26.00 ? 196 PHE A CD2 1 
ATOM   215  C CE1 . PHE A 1 37  ? 19.137 44.337 36.512  1.00 25.89 ? 196 PHE A CE1 1 
ATOM   216  C CE2 . PHE A 1 37  ? 18.539 43.368 34.427  1.00 26.18 ? 196 PHE A CE2 1 
ATOM   217  C CZ  . PHE A 1 37  ? 18.193 43.848 35.635  1.00 26.45 ? 196 PHE A CZ  1 
ATOM   218  N N   . SER A 1 38  ? 24.944 42.422 33.084  1.00 21.59 ? 197 SER A N   1 
ATOM   219  C CA  . SER A 1 38  ? 26.251 42.786 32.629  1.00 20.34 ? 197 SER A CA  1 
ATOM   220  C C   . SER A 1 38  ? 26.402 44.351 32.665  1.00 20.89 ? 197 SER A C   1 
ATOM   221  O O   . SER A 1 38  ? 25.454 45.150 32.457  1.00 19.72 ? 197 SER A O   1 
ATOM   222  C CB  . SER A 1 38  ? 26.527 42.268 31.229  1.00 19.16 ? 197 SER A CB  1 
ATOM   223  O OG  . SER A 1 38  ? 25.543 42.659 30.235  1.00 17.08 ? 197 SER A OG  1 
ATOM   224  N N   . GLU A 1 39  ? 27.645 44.781 32.827  1.00 20.76 ? 198 GLU A N   1 
ATOM   225  C CA  . GLU A 1 39  ? 28.045 46.170 32.791  1.00 21.17 ? 198 GLU A CA  1 
ATOM   226  C C   . GLU A 1 39  ? 27.817 46.832 31.449  1.00 20.97 ? 198 GLU A C   1 
ATOM   227  O O   . GLU A 1 39  ? 27.360 48.009 31.396  1.00 21.80 ? 198 GLU A O   1 
ATOM   228  C CB  . GLU A 1 39  ? 29.534 46.172 33.186  1.00 22.64 ? 198 GLU A CB  1 
ATOM   229  C CG  . GLU A 1 39  ? 30.068 47.562 33.088  1.00 33.86 ? 198 GLU A CG  1 
ATOM   230  C CD  . GLU A 1 39  ? 31.353 47.787 33.889  1.00 48.06 ? 198 GLU A CD  1 
ATOM   231  O OE1 . GLU A 1 39  ? 32.089 46.746 34.166  1.00 53.81 ? 198 GLU A OE1 1 
ATOM   232  O OE2 . GLU A 1 39  ? 31.591 49.023 34.180  1.00 53.74 ? 198 GLU A OE2 1 
ATOM   233  N N   . HIS A 1 40  ? 28.021 46.057 30.388  1.00 21.47 ? 199 HIS A N   1 
ATOM   234  C CA  . HIS A 1 40  ? 27.834 46.476 29.031  1.00 22.56 ? 199 HIS A CA  1 
ATOM   235  C C   . HIS A 1 40  ? 26.869 45.555 28.300  1.00 21.52 ? 199 HIS A C   1 
ATOM   236  O O   . HIS A 1 40  ? 26.555 44.414 28.695  1.00 18.58 ? 199 HIS A O   1 
ATOM   237  C CB  . HIS A 1 40  ? 29.144 46.543 28.230  1.00 23.95 ? 199 HIS A CB  1 
ATOM   238  C CG  . HIS A 1 40  ? 30.249 47.245 28.932  1.00 28.15 ? 199 HIS A CG  1 
ATOM   239  N ND1 . HIS A 1 40  ? 31.432 46.603 29.252  1.00 32.78 ? 199 HIS A ND1 1 
ATOM   240  C CD2 . HIS A 1 40  ? 30.389 48.550 29.343  1.00 31.90 ? 199 HIS A CD2 1 
ATOM   241  C CE1 . HIS A 1 40  ? 32.261 47.491 29.827  1.00 30.55 ? 199 HIS A CE1 1 
ATOM   242  N NE2 . HIS A 1 40  ? 31.642 48.673 29.921  1.00 32.37 ? 199 HIS A NE2 1 
ATOM   243  N N   . ALA A 1 41  ? 26.381 46.133 27.196  1.00 21.29 ? 200 ALA A N   1 
ATOM   244  C CA  . ALA A 1 41  ? 25.708 45.444 26.130  1.00 20.95 ? 200 ALA A CA  1 
ATOM   245  C C   . ALA A 1 41  ? 26.591 45.477 24.925  1.00 20.89 ? 200 ALA A C   1 
ATOM   246  O O   . ALA A 1 41  ? 27.525 46.292 24.852  1.00 21.24 ? 200 ALA A O   1 
ATOM   247  C CB  . ALA A 1 41  ? 24.331 46.126 25.763  1.00 20.18 ? 200 ALA A CB  1 
ATOM   248  N N   . VAL A 1 42  ? 26.298 44.596 24.016  1.00 18.72 ? 201 VAL A N   1 
ATOM   249  C CA  . VAL A 1 42  ? 27.071 44.505 22.757  1.00 20.58 ? 201 VAL A CA  1 
ATOM   250  C C   . VAL A 1 42  ? 26.114 44.378 21.605  1.00 21.70 ? 201 VAL A C   1 
ATOM   251  O O   . VAL A 1 42  ? 24.897 44.002 21.780  1.00 18.14 ? 201 VAL A O   1 
ATOM   252  C CB  . VAL A 1 42  ? 28.003 43.291 22.797  1.00 20.06 ? 201 VAL A CB  1 
ATOM   253  C CG1 . VAL A 1 42  ? 28.847 43.274 24.211  1.00 24.77 ? 201 VAL A CG1 1 
ATOM   254  C CG2 . VAL A 1 42  ? 27.262 41.971 22.644  1.00 21.14 ? 201 VAL A CG2 1 
ATOM   255  N N   . ILE A 1 43  ? 26.646 44.726 20.427  1.00 23.59 ? 202 ILE A N   1 
ATOM   256  C CA  . ILE A 1 43  ? 25.999 44.428 19.169  1.00 25.01 ? 202 ILE A CA  1 
ATOM   257  C C   . ILE A 1 43  ? 26.869 43.668 18.186  1.00 25.74 ? 202 ILE A C   1 
ATOM   258  O O   . ILE A 1 43  ? 27.987 44.100 17.819  1.00 27.20 ? 202 ILE A O   1 
ATOM   259  C CB  . ILE A 1 43  ? 25.625 45.759 18.500  1.00 24.02 ? 202 ILE A CB  1 
ATOM   260  C CG1 . ILE A 1 43  ? 24.681 46.682 19.258  1.00 26.26 ? 202 ILE A CG1 1 
ATOM   261  C CG2 . ILE A 1 43  ? 25.099 45.502 17.148  1.00 30.72 ? 202 ILE A CG2 1 
ATOM   262  N N   . SER A 1 44  ? 26.397 42.541 17.715  1.00 25.44 ? 203 SER A N   1 
ATOM   263  C CA  . SER A 1 44  ? 27.234 41.684 16.882  1.00 25.26 ? 203 SER A CA  1 
ATOM   264  C C   . SER A 1 44  ? 26.351 40.646 16.241  1.00 25.63 ? 203 SER A C   1 
ATOM   265  O O   . SER A 1 44  ? 25.160 40.587 16.516  1.00 26.41 ? 203 SER A O   1 
ATOM   266  C CB  . SER A 1 44  ? 28.451 41.134 17.697  1.00 27.60 ? 203 SER A CB  1 
ATOM   267  O OG  . SER A 1 44  ? 28.136 40.234 18.769  1.00 23.89 ? 203 SER A OG  1 
ATOM   268  N N   . MET A 1 45  ? 26.928 39.801 15.383  1.00 26.29 ? 204 MET A N   1 
ATOM   269  C CA  . MET A 1 45  ? 26.209 38.895 14.552  1.00 26.31 ? 204 MET A CA  1 
ATOM   270  C C   . MET A 1 45  ? 25.907 37.602 15.331  1.00 27.97 ? 204 MET A C   1 
ATOM   271  O O   . MET A 1 45  ? 26.792 37.026 15.980  1.00 27.04 ? 204 MET A O   1 
ATOM   272  C CB  . MET A 1 45  ? 27.084 38.553 13.313  1.00 29.25 ? 204 MET A CB  1 
ATOM   273  C CG  . MET A 1 45  ? 27.183 39.675 12.355  1.00 29.58 ? 204 MET A CG  1 
ATOM   274  S SD  . MET A 1 45  ? 25.537 40.148 11.758  1.00 39.53 ? 204 MET A SD  1 
ATOM   275  C CE  . MET A 1 45  ? 25.739 41.453 11.816  1.00 35.70 ? 204 MET A CE  1 
ATOM   276  N N   . ARG A 1 46  ? 24.640 37.184 15.326  1.00 26.78 ? 205 ARG A N   1 
ATOM   277  C CA  . ARG A 1 46  ? 24.285 35.911 15.863  1.00 28.12 ? 205 ARG A CA  1 
ATOM   278  C C   . ARG A 1 46  ? 23.173 35.248 14.985  1.00 29.66 ? 205 ARG A C   1 
ATOM   279  O O   . ARG A 1 46  ? 22.115 35.838 14.753  1.00 29.22 ? 205 ARG A O   1 
ATOM   280  C CB  . ARG A 1 46  ? 23.801 36.025 17.290  1.00 25.48 ? 205 ARG A CB  1 
ATOM   281  C CG  . ARG A 1 46  ? 23.501 34.702 17.844  1.00 29.12 ? 205 ARG A CG  1 
ATOM   282  C CD  . ARG A 1 46  ? 22.833 34.709 19.220  1.00 32.62 ? 205 ARG A CD  1 
ATOM   283  N NE  . ARG A 1 46  ? 23.807 34.886 20.258  1.00 31.75 ? 205 ARG A NE  1 
ATOM   284  C CZ  . ARG A 1 46  ? 23.777 34.358 21.490  1.00 26.98 ? 205 ARG A CZ  1 
ATOM   285  N NH1 . ARG A 1 46  ? 22.815 33.633 21.890  1.00 23.99 ? 205 ARG A NH1 1 
ATOM   286  N NH2 . ARG A 1 46  ? 24.725 34.641 22.328  1.00 20.88 ? 205 ARG A NH2 1 
ATOM   287  N N   . ASP A 1 47  ? 23.407 33.996 14.590  1.00 30.72 ? 206 ASP A N   1 
ATOM   288  C CA  . ASP A 1 47  ? 22.441 33.239 13.766  1.00 33.63 ? 206 ASP A CA  1 
ATOM   289  C C   . ASP A 1 47  ? 22.045 33.972 12.528  1.00 34.92 ? 206 ASP A C   1 
ATOM   290  O O   . ASP A 1 47  ? 20.898 33.854 12.082  1.00 36.53 ? 206 ASP A O   1 
ATOM   291  C CB  . ASP A 1 47  ? 21.173 32.850 14.561  1.00 33.23 ? 206 ASP A CB  1 
ATOM   292  C CG  . ASP A 1 47  ? 21.504 31.906 15.686  1.00 34.60 ? 206 ASP A CG  1 
ATOM   293  O OD1 . ASP A 1 47  ? 22.243 30.899 15.488  1.00 43.11 ? 206 ASP A OD1 1 
ATOM   294  O OD2 . ASP A 1 47  ? 21.116 32.089 16.818  1.00 37.92 ? 206 ASP A OD2 1 
ATOM   295  N N   . GLY A 1 48  ? 22.956 34.797 12.044  1.00 36.40 ? 207 GLY A N   1 
ATOM   296  C CA  . GLY A 1 48  ? 22.761 35.498 10.807  1.00 36.99 ? 207 GLY A CA  1 
ATOM   297  C C   . GLY A 1 48  ? 22.203 36.859 10.997  1.00 38.21 ? 207 GLY A C   1 
ATOM   298  O O   . GLY A 1 48  ? 21.989 37.523 9.996   1.00 41.93 ? 207 GLY A O   1 
ATOM   299  N N   . LYS A 1 49  ? 21.992 37.355 12.206  1.00 36.18 ? 208 LYS A N   1 
ATOM   300  C CA  . LYS A 1 49  ? 21.402 38.708 12.350  1.00 34.95 ? 208 LYS A CA  1 
ATOM   301  C C   . LYS A 1 49  ? 22.163 39.597 13.302  1.00 31.22 ? 208 LYS A C   1 
ATOM   302  O O   . LYS A 1 49  ? 22.737 39.094 14.322  1.00 28.23 ? 208 LYS A O   1 
ATOM   303  C CB  . LYS A 1 49  ? 19.997 38.579 12.903  1.00 36.62 ? 208 LYS A CB  1 
ATOM   304  C CG  . LYS A 1 49  ? 19.118 37.420 12.366  1.00 43.73 ? 208 LYS A CG  1 
ATOM   305  C CD  . LYS A 1 49  ? 18.002 37.963 11.462  1.00 51.42 ? 208 LYS A CD  1 
ATOM   306  C CE  . LYS A 1 49  ? 17.076 36.820 10.962  1.00 56.34 ? 208 LYS A CE  1 
ATOM   307  N NZ  . LYS A 1 49  ? 15.615 37.203 10.988  1.00 59.13 ? 208 LYS A NZ  1 
ATOM   308  N N   . LEU A 1 50  ? 22.214 40.867 12.967  1.00 28.45 ? 209 LEU A N   1 
ATOM   309  C CA  . LEU A 1 50  ? 22.747 41.864 13.895  1.00 29.45 ? 209 LEU A CA  1 
ATOM   310  C C   . LEU A 1 50  ? 21.864 41.960 15.135  1.00 29.79 ? 209 LEU A C   1 
ATOM   311  O O   . LEU A 1 50  ? 20.617 42.176 15.030  1.00 29.51 ? 209 LEU A O   1 
ATOM   312  C CB  . LEU A 1 50  ? 22.944 43.216 13.254  1.00 28.93 ? 209 LEU A CB  1 
ATOM   313  C CG  . LEU A 1 50  ? 23.980 44.198 13.896  1.00 27.74 ? 209 LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 50  ? 25.442 43.705 13.816  1.00 29.11 ? 209 LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 50  ? 23.871 45.614 13.453  1.00 25.06 ? 209 LEU A CD2 1 
ATOM   316  N N   . THR A 1 51  ? 22.475 41.700 16.312  1.00 29.07 ? 210 THR A N   1 
ATOM   317  C CA  . THR A 1 51  ? 21.729 41.530 17.579  1.00 24.88 ? 210 THR A CA  1 
ATOM   318  C C   . THR A 1 51  ? 22.337 42.371 18.669  1.00 24.97 ? 210 THR A C   1 
ATOM   319  O O   . THR A 1 51  ? 23.623 42.408 18.927  1.00 22.69 ? 210 THR A O   1 
ATOM   320  C CB  . THR A 1 51  ? 21.757 40.084 17.891  1.00 26.60 ? 210 THR A CB  1 
ATOM   321  O OG1 . THR A 1 51  ? 21.389 39.265 16.779  1.00 24.12 ? 210 THR A OG1 1 
ATOM   322  C CG2 . THR A 1 51  ? 20.799 39.633 19.019  1.00 27.56 ? 210 THR A CG2 1 
ATOM   323  N N   . LEU A 1 52  ? 21.462 43.096 19.366  1.00 23.76 ? 211 LEU A N   1 
ATOM   324  C CA  . LEU A 1 52  ? 21.824 43.766 20.600  1.00 21.72 ? 211 LEU A CA  1 
ATOM   325  C C   . LEU A 1 52  ? 21.664 42.736 21.748  1.00 22.64 ? 211 LEU A C   1 
ATOM   326  O O   . LEU A 1 52  ? 20.621 42.069 21.884  1.00 20.46 ? 211 LEU A O   1 
ATOM   327  C CB  . LEU A 1 52  ? 20.960 44.978 20.769  1.00 21.75 ? 211 LEU A CB  1 
ATOM   328  C CG  . LEU A 1 52  ? 20.945 45.599 22.108  1.00 21.28 ? 211 LEU A CG  1 
ATOM   329  C CD1 . LEU A 1 52  ? 22.219 46.272 22.419  1.00 27.11 ? 211 LEU A CD1 1 
ATOM   330  C CD2 . LEU A 1 52  ? 19.774 46.616 22.309  1.00 27.29 ? 211 LEU A CD2 1 
ATOM   331  N N   . MET A 1 53  ? 22.713 42.571 22.547  1.00 21.38 ? 212 MET A N   1 
ATOM   332  C CA  . MET A 1 53  ? 22.756 41.533 23.580  1.00 19.16 ? 212 MET A CA  1 
ATOM   333  C C   . MET A 1 53  ? 23.219 42.087 24.910  1.00 18.91 ? 212 MET A C   1 
ATOM   334  O O   . MET A 1 53  ? 24.055 42.964 24.957  1.00 20.42 ? 212 MET A O   1 
ATOM   335  C CB  . MET A 1 53  ? 23.659 40.406 23.160  1.00 18.61 ? 212 MET A CB  1 
ATOM   336  C CG  . MET A 1 53  ? 23.159 39.590 22.101  1.00 22.01 ? 212 MET A CG  1 
ATOM   337  S SD  . MET A 1 53  ? 24.278 38.394 21.243  1.00 23.95 ? 212 MET A SD  1 
ATOM   338  C CE  . MET A 1 53  ? 25.137 39.346 20.099  1.00 23.65 ? 212 MET A CE  1 
ATOM   339  N N   . PHE A 1 54  ? 22.678 41.591 26.018  1.00 19.75 ? 213 PHE A N   1 
ATOM   340  C CA  . PHE A 1 54  ? 23.218 41.858 27.328  1.00 17.16 ? 213 PHE A CA  1 
ATOM   341  C C   . PHE A 1 54  ? 23.003 40.626 28.138  1.00 19.10 ? 213 PHE A C   1 
ATOM   342  O O   . PHE A 1 54  ? 22.270 39.740 27.703  1.00 20.04 ? 213 PHE A O   1 
ATOM   343  C CB  . PHE A 1 54  ? 22.603 43.066 27.995  1.00 18.19 ? 213 PHE A CB  1 
ATOM   344  C CG  . PHE A 1 54  ? 21.096 43.041 28.112  1.00 18.29 ? 213 PHE A CG  1 
ATOM   345  C CD1 . PHE A 1 54  ? 20.524 42.621 29.263  1.00 20.89 ? 213 PHE A CD1 1 
ATOM   346  C CD2 . PHE A 1 54  ? 20.299 43.560 27.101  1.00 22.41 ? 213 PHE A CD2 1 
ATOM   347  C CE1 . PHE A 1 54  ? 19.119 42.574 29.361  1.00 21.70 ? 213 PHE A CE1 1 
ATOM   348  C CE2 . PHE A 1 54  ? 18.858 43.568 27.182  1.00 20.92 ? 213 PHE A CE2 1 
ATOM   349  C CZ  . PHE A 1 54  ? 18.282 43.121 28.306  1.00 17.80 ? 213 PHE A CZ  1 
ATOM   350  N N   . ARG A 1 55  ? 23.607 40.579 29.344  1.00 17.38 ? 214 ARG A N   1 
ATOM   351  C CA  . ARG A 1 55  ? 23.551 39.368 30.188  1.00 17.82 ? 214 ARG A CA  1 
ATOM   352  C C   . ARG A 1 55  ? 22.814 39.675 31.462  1.00 16.06 ? 214 ARG A C   1 
ATOM   353  O O   . ARG A 1 55  ? 22.896 40.742 31.942  1.00 13.31 ? 214 ARG A O   1 
ATOM   354  C CB  . ARG A 1 55  ? 24.984 38.760 30.537  1.00 16.65 ? 214 ARG A CB  1 
ATOM   355  C CG  . ARG A 1 55  ? 24.914 37.472 31.209  1.00 19.55 ? 214 ARG A CG  1 
ATOM   356  C CD  . ARG A 1 55  ? 25.915 36.391 30.930  1.00 28.45 ? 214 ARG A CD  1 
ATOM   357  N NE  . ARG A 1 55  ? 27.257 36.783 30.646  1.00 32.11 ? 214 ARG A NE  1 
ATOM   358  C CZ  . ARG A 1 55  ? 28.065 36.103 29.886  1.00 21.29 ? 214 ARG A CZ  1 
ATOM   359  N NH1 . ARG A 1 55  ? 27.686 35.087 29.155  1.00 23.83 ? 214 ARG A NH1 1 
ATOM   360  N NH2 . ARG A 1 55  ? 29.238 36.594 29.761  1.00 25.51 ? 214 ARG A NH2 1 
ATOM   361  N N   . VAL A 1 56  ? 21.978 38.731 31.906  1.00 17.30 ? 215 VAL A N   1 
ATOM   362  C CA  . VAL A 1 56  ? 21.259 38.861 33.187  1.00 19.39 ? 215 VAL A CA  1 
ATOM   363  C C   . VAL A 1 56  ? 21.523 37.596 33.986  1.00 19.83 ? 215 VAL A C   1 
ATOM   364  O O   . VAL A 1 56  ? 21.599 36.502 33.399  1.00 20.95 ? 215 VAL A O   1 
ATOM   365  C CB  . VAL A 1 56  ? 19.707 38.989 33.010  1.00 18.92 ? 215 VAL A CB  1 
ATOM   366  C CG1 . VAL A 1 56  ? 19.303 40.176 32.153  1.00 21.87 ? 215 VAL A CG1 1 
ATOM   367  C CG2 . VAL A 1 56  ? 19.123 37.811 32.300  1.00 23.93 ? 215 VAL A CG2 1 
ATOM   368  N N   . GLY A 1 57  ? 21.604 37.731 35.292  1.00 23.25 ? 216 GLY A N   1 
ATOM   369  C CA  . GLY A 1 57  ? 21.935 36.601 36.188  1.00 26.82 ? 216 GLY A CA  1 
ATOM   370  C C   . GLY A 1 57  ? 20.972 36.571 37.370  1.00 28.89 ? 216 GLY A C   1 
ATOM   371  O O   . GLY A 1 57  ? 20.305 37.530 37.613  1.00 29.70 ? 216 GLY A O   1 
ATOM   372  N N   . ASN A 1 58  ? 20.939 35.478 38.111  1.00 31.58 ? 217 ASN A N   1 
ATOM   373  C CA  . ASN A 1 58  ? 20.153 35.363 39.321  1.00 34.29 ? 217 ASN A CA  1 
ATOM   374  C C   . ASN A 1 58  ? 20.976 34.641 40.302  1.00 38.13 ? 217 ASN A C   1 
ATOM   375  O O   . ASN A 1 58  ? 21.230 33.420 40.175  1.00 36.73 ? 217 ASN A O   1 
ATOM   376  C CB  . ASN A 1 58  ? 19.009 34.504 39.041  1.00 35.33 ? 217 ASN A CB  1 
ATOM   377  C CG  . ASN A 1 58  ? 18.054 34.329 40.179  1.00 36.37 ? 217 ASN A CG  1 
ATOM   378  O OD1 . ASN A 1 58  ? 17.176 33.490 40.030  1.00 42.32 ? 217 ASN A OD1 1 
ATOM   379  N ND2 . ASN A 1 58  ? 18.162 35.094 41.280  1.00 31.14 ? 217 ASN A ND2 1 
ATOM   380  N N   . LEU A 1 59  ? 21.371 35.420 41.284  1.00 43.66 ? 218 LEU A N   1 
ATOM   381  C CA  . LEU A 1 59  ? 22.024 34.945 42.518  1.00 49.42 ? 218 LEU A CA  1 
ATOM   382  C C   . LEU A 1 59  ? 21.194 34.948 43.824  1.00 53.61 ? 218 LEU A C   1 
ATOM   383  O O   . LEU A 1 59  ? 21.781 34.780 44.906  1.00 54.33 ? 218 LEU A O   1 
ATOM   384  C CB  . LEU A 1 59  ? 23.297 35.785 42.749  1.00 49.22 ? 218 LEU A CB  1 
ATOM   385  C CG  . LEU A 1 59  ? 24.537 35.483 41.900  1.00 49.04 ? 218 LEU A CG  1 
ATOM   386  C CD1 . LEU A 1 59  ? 25.720 36.308 42.447  1.00 52.71 ? 218 LEU A CD1 1 
ATOM   387  C CD2 . LEU A 1 59  ? 24.872 33.963 41.816  1.00 50.56 ? 218 LEU A CD2 1 
ATOM   388  N N   . ARG A 1 60  ? 19.869 35.140 43.790  1.00 59.21 ? 219 ARG A N   1 
ATOM   389  C CA  . ARG A 1 60  ? 19.074 34.694 44.982  1.00 63.44 ? 219 ARG A CA  1 
ATOM   390  C C   . ARG A 1 60  ? 19.332 33.169 45.175  1.00 65.39 ? 219 ARG A C   1 
ATOM   391  O O   . ARG A 1 60  ? 19.927 32.525 44.302  1.00 67.56 ? 219 ARG A O   1 
ATOM   392  C CB  . ARG A 1 60  ? 17.529 35.009 44.936  1.00 64.69 ? 219 ARG A CB  1 
ATOM   393  C CG  . ARG A 1 60  ? 16.940 36.014 43.863  1.00 67.93 ? 219 ARG A CG  1 
ATOM   394  C CD  . ARG A 1 60  ? 15.816 37.012 44.358  1.00 73.52 ? 219 ARG A CD  1 
ATOM   395  N NE  . ARG A 1 60  ? 16.196 38.409 44.055  1.00 78.97 ? 219 ARG A NE  1 
ATOM   396  C CZ  . ARG A 1 60  ? 15.547 39.527 44.424  1.00 81.99 ? 219 ARG A CZ  1 
ATOM   397  N NH1 . ARG A 1 60  ? 14.430 39.476 45.137  1.00 81.97 ? 219 ARG A NH1 1 
ATOM   398  N NH2 . ARG A 1 60  ? 16.043 40.724 44.057  1.00 83.54 ? 219 ARG A NH2 1 
ATOM   399  N N   . ASN A 1 61  ? 18.930 32.541 46.266  1.00 67.76 ? 220 ASN A N   1 
ATOM   400  C CA  . ASN A 1 61  ? 18.657 31.106 46.046  1.00 69.55 ? 220 ASN A CA  1 
ATOM   401  C C   . ASN A 1 61  ? 17.175 30.689 46.146  1.00 68.66 ? 220 ASN A C   1 
ATOM   402  O O   . ASN A 1 61  ? 16.843 29.495 46.118  1.00 69.25 ? 220 ASN A O   1 
ATOM   403  C CB  . ASN A 1 61  ? 19.697 30.095 46.620  1.00 71.01 ? 220 ASN A CB  1 
ATOM   404  C CG  . ASN A 1 61  ? 20.099 28.981 45.549  1.00 74.74 ? 220 ASN A CG  1 
ATOM   405  O OD1 . ASN A 1 61  ? 19.259 28.119 45.160  1.00 76.67 ? 220 ASN A OD1 1 
ATOM   406  N ND2 . ASN A 1 61  ? 21.357 29.044 45.049  1.00 77.65 ? 220 ASN A ND2 1 
ATOM   407  N N   . SER A 1 62  ? 16.296 31.691 46.129  1.00 67.44 ? 221 SER A N   1 
ATOM   408  C CA  . SER A 1 62  ? 14.915 31.472 45.683  1.00 66.20 ? 221 SER A CA  1 
ATOM   409  C C   . SER A 1 62  ? 14.924 31.309 44.129  1.00 63.53 ? 221 SER A C   1 
ATOM   410  O O   . SER A 1 62  ? 15.717 31.967 43.421  1.00 62.77 ? 221 SER A O   1 
ATOM   411  C CB  . SER A 1 62  ? 14.002 32.624 46.134  1.00 66.14 ? 221 SER A CB  1 
ATOM   412  O OG  . SER A 1 62  ? 14.599 33.891 45.830  1.00 69.30 ? 221 SER A OG  1 
ATOM   413  N N   . HIS A 1 63  ? 14.099 30.379 43.632  1.00 60.76 ? 222 HIS A N   1 
ATOM   414  C CA  . HIS A 1 63  ? 13.609 30.457 42.248  1.00 58.13 ? 222 HIS A CA  1 
ATOM   415  C C   . HIS A 1 63  ? 12.775 31.758 42.061  1.00 56.04 ? 222 HIS A C   1 
ATOM   416  O O   . HIS A 1 63  ? 11.998 32.202 42.954  1.00 55.43 ? 222 HIS A O   1 
ATOM   417  C CB  . HIS A 1 63  ? 12.802 29.216 41.825  1.00 57.87 ? 222 HIS A CB  1 
ATOM   418  C CG  . HIS A 1 63  ? 13.671 28.097 41.332  1.00 58.10 ? 222 HIS A CG  1 
ATOM   419  N ND1 . HIS A 1 63  ? 14.465 28.219 40.216  1.00 57.48 ? 222 HIS A ND1 1 
ATOM   420  C CD2 . HIS A 1 63  ? 13.954 26.875 41.863  1.00 58.67 ? 222 HIS A CD2 1 
ATOM   421  C CE1 . HIS A 1 63  ? 15.171 27.109 40.055  1.00 58.10 ? 222 HIS A CE1 1 
ATOM   422  N NE2 . HIS A 1 63  ? 14.890 26.282 41.047  1.00 57.39 ? 222 HIS A NE2 1 
ATOM   423  N N   . MET A 1 64  ? 13.036 32.387 40.925  1.00 53.66 ? 223 MET A N   1 
ATOM   424  C CA  . MET A 1 64  ? 12.193 33.440 40.389  1.00 52.71 ? 223 MET A CA  1 
ATOM   425  C C   . MET A 1 64  ? 11.094 32.915 39.485  1.00 48.61 ? 223 MET A C   1 
ATOM   426  O O   . MET A 1 64  ? 11.296 32.518 38.368  1.00 48.75 ? 223 MET A O   1 
ATOM   427  C CB  . MET A 1 64  ? 13.042 34.476 39.655  1.00 54.24 ? 223 MET A CB  1 
ATOM   428  C CG  . MET A 1 64  ? 13.525 35.613 40.580  1.00 59.76 ? 223 MET A CG  1 
ATOM   429  S SD  . MET A 1 64  ? 13.596 37.128 39.578  1.00 72.85 ? 223 MET A SD  1 
ATOM   430  C CE  . MET A 1 64  ? 12.515 38.207 40.513  1.00 69.98 ? 223 MET A CE  1 
ATOM   431  N N   . VAL A 1 65  ? 9.907  32.981 40.006  1.00 44.11 ? 224 VAL A N   1 
ATOM   432  C CA  . VAL A 1 65  ? 8.724  32.471 39.376  1.00 43.15 ? 224 VAL A CA  1 
ATOM   433  C C   . VAL A 1 65  ? 8.131  33.591 38.522  1.00 41.87 ? 224 VAL A C   1 
ATOM   434  O O   . VAL A 1 65  ? 8.157  34.782 38.940  1.00 42.40 ? 224 VAL A O   1 
ATOM   435  C CB  . VAL A 1 65  ? 7.730  31.976 40.483  1.00 42.38 ? 224 VAL A CB  1 
ATOM   436  C CG1 . VAL A 1 65  ? 6.395  31.557 39.917  1.00 45.42 ? 224 VAL A CG1 1 
ATOM   437  C CG2 . VAL A 1 65  ? 8.356  30.835 41.216  1.00 42.12 ? 224 VAL A CG2 1 
ATOM   438  N N   . SER A 1 66  ? 7.615  33.208 37.351  1.00 36.97 ? 225 SER A N   1 
ATOM   439  C CA  . SER A 1 66  ? 7.102  34.156 36.364  1.00 36.33 ? 225 SER A CA  1 
ATOM   440  C C   . SER A 1 66  ? 8.097  35.284 36.089  1.00 33.04 ? 225 SER A C   1 
ATOM   441  O O   . SER A 1 66  ? 7.668  36.421 36.085  1.00 34.91 ? 225 SER A O   1 
ATOM   442  C CB  . SER A 1 66  ? 5.739  34.733 36.745  1.00 36.42 ? 225 SER A CB  1 
ATOM   443  O OG  . SER A 1 66  ? 5.196  34.160 37.945  1.00 45.54 ? 225 SER A OG  1 
ATOM   444  N N   . ALA A 1 67  ? 9.415  35.002 36.042  1.00 30.73 ? 226 ALA A N   1 
ATOM   445  C CA  . ALA A 1 67  ? 10.503 35.970 35.592  1.00 28.88 ? 226 ALA A CA  1 
ATOM   446  C C   . ALA A 1 67  ? 10.225 36.518 34.196  1.00 27.77 ? 226 ALA A C   1 
ATOM   447  O O   . ALA A 1 67  ? 9.948  35.734 33.238  1.00 27.00 ? 226 ALA A O   1 
ATOM   448  C CB  . ALA A 1 67  ? 11.756 35.213 35.559  1.00 29.73 ? 226 ALA A CB  1 
ATOM   449  N N   . GLN A 1 68  ? 10.183 37.826 34.055  1.00 25.50 ? 227 GLN A N   1 
ATOM   450  C CA  . GLN A 1 68  ? 9.948  38.423 32.745  1.00 25.61 ? 227 GLN A CA  1 
ATOM   451  C C   . GLN A 1 68  ? 10.737 39.671 32.570  1.00 24.18 ? 227 GLN A C   1 
ATOM   452  O O   . GLN A 1 68  ? 11.013 40.457 33.518  1.00 23.97 ? 227 GLN A O   1 
ATOM   453  C CB  . GLN A 1 68  ? 8.472  38.654 32.584  1.00 27.91 ? 227 GLN A CB  1 
ATOM   454  C CG  . GLN A 1 68  ? 8.114  40.000 32.322  1.00 33.52 ? 227 GLN A CG  1 
ATOM   455  C CD  . GLN A 1 68  ? 6.954  39.929 31.436  1.00 47.69 ? 227 GLN A CD  1 
ATOM   456  O OE1 . GLN A 1 68  ? 5.829  39.708 31.944  1.00 55.44 ? 227 GLN A OE1 1 
ATOM   457  N NE2 . GLN A 1 68  ? 7.208  39.887 30.116  1.00 46.46 ? 227 GLN A NE2 1 
ATOM   458  N N   . ILE A 1 69  ? 11.241 39.836 31.383  1.00 22.00 ? 228 ILE A N   1 
ATOM   459  C CA  . ILE A 1 69  ? 12.178 40.969 31.120  1.00 21.72 ? 228 ILE A CA  1 
ATOM   460  C C   . ILE A 1 69  ? 11.462 41.819 30.034  1.00 21.26 ? 228 ILE A C   1 
ATOM   461  O O   . ILE A 1 69  ? 10.811 41.289 29.067  1.00 17.71 ? 228 ILE A O   1 
ATOM   462  C CB  . ILE A 1 69  ? 13.507 40.355 30.687  1.00 21.01 ? 228 ILE A CB  1 
ATOM   463  C CG1 . ILE A 1 69  ? 14.838 41.275 30.779  1.00 23.64 ? 228 ILE A CG1 1 
ATOM   464  C CG2 . ILE A 1 69  ? 13.326 39.538 29.382  1.00 21.93 ? 228 ILE A CG2 1 
ATOM   465  N N   . ARG A 1 70  ? 11.640 43.121 30.155  1.00 20.40 ? 229 ARG A N   1 
ATOM   466  C CA  . ARG A 1 70  ? 11.296 44.089 29.060  1.00 20.45 ? 229 ARG A CA  1 
ATOM   467  C C   . ARG A 1 70  ? 12.401 45.135 28.954  1.00 19.72 ? 229 ARG A C   1 
ATOM   468  O O   . ARG A 1 70  ? 13.139 45.310 29.897  1.00 18.64 ? 229 ARG A O   1 
ATOM   469  C CB  . ARG A 1 70  ? 10.009 44.870 29.417  1.00 20.98 ? 229 ARG A CB  1 
ATOM   470  C CG  . ARG A 1 70  ? 8.956  43.976 29.938  1.00 29.19 ? 229 ARG A CG  1 
ATOM   471  C CD  . ARG A 1 70  ? 7.654  44.706 30.297  1.00 38.66 ? 229 ARG A CD  1 
ATOM   472  N NE  . ARG A 1 70  ? 7.811  45.650 31.353  1.00 40.51 ? 229 ARG A NE  1 
ATOM   473  C CZ  . ARG A 1 70  ? 7.556  45.313 32.579  1.00 45.63 ? 229 ARG A CZ  1 
ATOM   474  N NH1 . ARG A 1 70  ? 7.108  44.080 32.771  1.00 47.74 ? 229 ARG A NH1 1 
ATOM   475  N NH2 . ARG A 1 70  ? 7.648  46.208 33.600  1.00 45.31 ? 229 ARG A NH2 1 
ATOM   476  N N   . CYS A 1 71  ? 12.440 45.849 27.862  1.00 18.82 ? 230 CYS A N   1 
ATOM   477  C CA  . CYS A 1 71  ? 13.478 46.764 27.518  1.00 20.28 ? 230 CYS A CA  1 
ATOM   478  C C   . CYS A 1 71  ? 12.796 47.988 26.827  1.00 23.04 ? 230 CYS A C   1 
ATOM   479  O O   . CYS A 1 71  ? 11.887 47.840 26.011  1.00 23.72 ? 230 CYS A O   1 
ATOM   480  C CB  . CYS A 1 71  ? 14.660 45.966 26.763  1.00 22.93 ? 230 CYS A CB  1 
ATOM   481  S SG  . CYS A 1 71  ? 15.924 46.996 26.015  0.50 27.84 ? 230 CYS A SG  1 
ATOM   482  N N   . LYS A 1 72  ? 13.156 49.199 27.237  1.00 21.88 ? 231 LYS A N   1 
ATOM   483  C CA  . LYS A 1 72  ? 12.707 50.442 26.621  1.00 21.63 ? 231 LYS A CA  1 
ATOM   484  C C   . LYS A 1 72  ? 13.905 51.214 26.156  1.00 22.20 ? 231 LYS A C   1 
ATOM   485  O O   . LYS A 1 72  ? 14.919 51.267 26.855  1.00 22.04 ? 231 LYS A O   1 
ATOM   486  C CB  . LYS A 1 72  ? 11.977 51.289 27.715  1.00 23.02 ? 231 LYS A CB  1 
ATOM   487  C CG  . LYS A 1 72  ? 10.898 50.570 28.531  1.00 25.19 ? 231 LYS A CG  1 
ATOM   488  C CD  . LYS A 1 72  ? 9.649  50.426 27.756  1.00 28.92 ? 231 LYS A CD  1 
ATOM   489  C CE  . LYS A 1 72  ? 8.625  49.649 28.581  1.00 28.95 ? 231 LYS A CE  1 
ATOM   490  N NZ  . LYS A 1 72  ? 7.299  49.852 27.974  1.00 28.40 ? 231 LYS A NZ  1 
ATOM   491  N N   . LEU A 1 73  ? 13.860 51.730 24.934  1.00 22.49 ? 232 LEU A N   1 
ATOM   492  C CA  . LEU A 1 73  ? 14.778 52.745 24.502  1.00 23.38 ? 232 LEU A CA  1 
ATOM   493  C C   . LEU A 1 73  ? 14.285 54.118 24.846  1.00 24.60 ? 232 LEU A C   1 
ATOM   494  O O   . LEU A 1 73  ? 13.211 54.531 24.382  1.00 25.17 ? 232 LEU A O   1 
ATOM   495  C CB  . LEU A 1 73  ? 14.978 52.681 22.989  1.00 23.69 ? 232 LEU A CB  1 
ATOM   496  C CG  . LEU A 1 73  ? 16.050 53.672 22.550  1.00 25.15 ? 232 LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 73  ? 17.448 53.312 23.187  1.00 28.48 ? 232 LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 73  ? 16.112 53.559 21.077  1.00 30.15 ? 232 LEU A CD2 1 
ATOM   499  N N   . LEU A 1 74  ? 15.060 54.836 25.645  1.00 25.95 ? 233 LEU A N   1 
ATOM   500  C CA  . LEU A 1 74  ? 14.746 56.189 26.006  1.00 29.03 ? 233 LEU A CA  1 
ATOM   501  C C   . LEU A 1 74  ? 15.560 57.112 25.117  1.00 33.01 ? 233 LEU A C   1 
ATOM   502  O O   . LEU A 1 74  ? 16.834 56.955 25.021  1.00 30.86 ? 233 LEU A O   1 
ATOM   503  C CB  . LEU A 1 74  ? 15.004 56.478 27.460  1.00 28.12 ? 233 LEU A CB  1 
ATOM   504  C CG  . LEU A 1 74  ? 13.841 56.167 28.399  1.00 28.97 ? 233 LEU A CG  1 
ATOM   505  C CD1 . LEU A 1 74  ? 13.348 54.749 28.195  1.00 31.01 ? 233 LEU A CD1 1 
ATOM   506  C CD2 . LEU A 1 74  ? 14.360 56.325 29.855  1.00 32.59 ? 233 LEU A CD2 1 
ATOM   507  N N   . LYS A 1 75  ? 14.856 57.992 24.383  1.00 33.71 ? 234 LYS A N   1 
ATOM   508  C CA  . LYS A 1 75  ? 15.583 59.029 23.651  1.00 37.39 ? 234 LYS A CA  1 
ATOM   509  C C   . LYS A 1 75  ? 14.862 60.371 23.449  1.00 36.51 ? 234 LYS A C   1 
ATOM   510  O O   . LYS A 1 75  ? 13.681 60.348 23.298  1.00 35.96 ? 234 LYS A O   1 
ATOM   511  C CB  . LYS A 1 75  ? 15.994 58.472 22.289  1.00 37.00 ? 234 LYS A CB  1 
ATOM   512  C CG  . LYS A 1 75  ? 14.881 58.195 21.465  1.00 44.13 ? 234 LYS A CG  1 
ATOM   513  C CD  . LYS A 1 75  ? 15.375 57.640 20.090  1.00 46.85 ? 234 LYS A CD  1 
ATOM   514  C CE  . LYS A 1 75  ? 16.485 58.458 19.473  1.00 50.19 ? 234 LYS A CE  1 
ATOM   515  N NZ  . LYS A 1 75  ? 16.544 57.913 18.044  1.00 53.44 ? 234 LYS A NZ  1 
ATOM   516  N N   . SER A 1 76  ? 15.594 61.493 23.533  1.00 36.59 ? 235 SER A N   1 
ATOM   517  C CA  . SER A 1 76  ? 15.113 62.780 23.062  1.00 37.43 ? 235 SER A CA  1 
ATOM   518  C C   . SER A 1 76  ? 15.103 62.741 21.530  1.00 36.12 ? 235 SER A C   1 
ATOM   519  O O   . SER A 1 76  ? 15.970 62.155 20.877  1.00 37.57 ? 235 SER A O   1 
ATOM   520  C CB  . SER A 1 76  ? 15.955 63.893 23.601  1.00 38.69 ? 235 SER A CB  1 
ATOM   521  O OG  . SER A 1 76  ? 15.839 63.887 25.020  1.00 44.74 ? 235 SER A OG  1 
ATOM   522  N N   . ARG A 1 77  ? 14.009 63.161 20.968  1.00 33.63 ? 236 ARG A N   1 
ATOM   523  C CA  . ARG A 1 77  ? 13.880 63.293 19.515  1.00 32.75 ? 236 ARG A CA  1 
ATOM   524  C C   . ARG A 1 77  ? 12.836 64.377 19.121  1.00 33.52 ? 236 ARG A C   1 
ATOM   525  O O   . ARG A 1 77  ? 12.020 64.792 19.930  1.00 32.22 ? 236 ARG A O   1 
ATOM   526  C CB  . ARG A 1 77  ? 13.454 61.950 18.928  1.00 33.70 ? 236 ARG A CB  1 
ATOM   527  C CG  . ARG A 1 77  ? 12.077 61.496 19.270  1.00 33.05 ? 236 ARG A CG  1 
ATOM   528  C CD  . ARG A 1 77  ? 11.801 60.056 18.859  1.00 35.24 ? 236 ARG A CD  1 
ATOM   529  N NE  . ARG A 1 77  ? 10.418 59.638 19.137  1.00 32.11 ? 236 ARG A NE  1 
ATOM   530  C CZ  . ARG A 1 77  ? 9.411  59.762 18.252  1.00 36.65 ? 236 ARG A CZ  1 
ATOM   531  N NH1 . ARG A 1 77  ? 9.594  60.313 17.058  1.00 40.47 ? 236 ARG A NH1 1 
ATOM   532  N NH2 . ARG A 1 77  ? 8.171  59.361 18.532  1.00 37.12 ? 236 ARG A NH2 1 
ATOM   533  N N   . GLN A 1 78  ? 12.797 64.670 17.847  1.00 34.33 ? 237 GLN A N   1 
ATOM   534  C CA  . GLN A 1 78  ? 11.902 65.618 17.207  1.00 35.04 ? 237 GLN A CA  1 
ATOM   535  C C   . GLN A 1 78  ? 11.045 64.868 16.207  1.00 34.18 ? 237 GLN A C   1 
ATOM   536  O O   . GLN A 1 78  ? 11.564 64.054 15.424  1.00 34.50 ? 237 GLN A O   1 
ATOM   537  C CB  . GLN A 1 78  ? 12.710 66.720 16.460  1.00 34.66 ? 237 GLN A CB  1 
ATOM   538  C CG  . GLN A 1 78  ? 11.697 67.714 15.743  1.00 40.33 ? 237 GLN A CG  1 
ATOM   539  C CD  . GLN A 1 78  ? 12.301 69.140 15.363  1.00 42.31 ? 237 GLN A CD  1 
ATOM   540  O OE1 . GLN A 1 78  ? 13.487 69.330 15.393  1.00 50.02 ? 237 GLN A OE1 1 
ATOM   541  N NE2 . GLN A 1 78  ? 11.444 70.082 14.994  1.00 46.37 ? 237 GLN A NE2 1 
ATOM   542  N N   . THR A 1 79  ? 9.732  64.996 16.337  1.00 32.23 ? 238 THR A N   1 
ATOM   543  C CA  . THR A 1 79  ? 8.824  64.320 15.438  1.00 32.10 ? 238 THR A CA  1 
ATOM   544  C C   . THR A 1 79  ? 8.801  65.035 14.127  1.00 32.83 ? 238 THR A C   1 
ATOM   545  O O   . THR A 1 79  ? 9.180  66.143 14.049  1.00 31.76 ? 238 THR A O   1 
ATOM   546  C CB  . THR A 1 79  ? 7.343  64.305 15.929  1.00 32.03 ? 238 THR A CB  1 
ATOM   547  O OG1 . THR A 1 79  ? 6.842  65.657 15.895  1.00 31.49 ? 238 THR A OG1 1 
ATOM   548  C CG2 . THR A 1 79  ? 7.235  63.764 17.398  1.00 29.76 ? 238 THR A CG2 1 
ATOM   549  N N   . PRO A 1 80  ? 8.337  64.369 13.088  1.00 34.73 ? 239 PRO A N   1 
ATOM   550  C CA  . PRO A 1 80  ? 8.260  65.018 11.785  1.00 36.92 ? 239 PRO A CA  1 
ATOM   551  C C   . PRO A 1 80  ? 7.441  66.285 11.882  1.00 38.97 ? 239 PRO A C   1 
ATOM   552  O O   . PRO A 1 80  ? 7.683  67.169 11.111  1.00 42.82 ? 239 PRO A O   1 
ATOM   553  C CB  . PRO A 1 80  ? 7.612  63.983 10.848  1.00 37.51 ? 239 PRO A CB  1 
ATOM   554  C CG  . PRO A 1 80  ? 7.490  62.669 11.686  1.00 37.68 ? 239 PRO A CG  1 
ATOM   555  C CD  . PRO A 1 80  ? 8.061  62.939 13.083  1.00 33.98 ? 239 PRO A CD  1 
ATOM   556  N N   . GLU A 1 81  ? 6.534  66.428 12.842  1.00 38.25 ? 240 GLU A N   1 
ATOM   557  C CA  . GLU A 1 81  ? 5.650  67.561 12.867  1.00 36.07 ? 240 GLU A CA  1 
ATOM   558  C C   . GLU A 1 81  ? 6.413  68.697 13.527  1.00 36.58 ? 240 GLU A C   1 
ATOM   559  O O   . GLU A 1 81  ? 5.830  69.728 13.794  1.00 36.32 ? 240 GLU A O   1 
ATOM   560  C CB  . GLU A 1 81  ? 4.390  67.267 13.738  1.00 34.35 ? 240 GLU A CB  1 
ATOM   561  C CG  . GLU A 1 81  ? 3.425  66.271 13.221  1.00 31.32 ? 240 GLU A CG  1 
ATOM   562  C CD  . GLU A 1 81  ? 3.902  64.779 13.341  1.00 29.01 ? 240 GLU A CD  1 
ATOM   563  O OE1 . GLU A 1 81  ? 4.892  64.407 14.103  1.00 27.86 ? 240 GLU A OE1 1 
ATOM   564  O OE2 . GLU A 1 81  ? 3.250  63.998 12.631  1.00 29.83 ? 240 GLU A OE2 1 
ATOM   565  N N   . GLY A 1 82  ? 7.649  68.432 13.924  1.00 35.84 ? 241 GLY A N   1 
ATOM   566  C CA  . GLY A 1 82  ? 8.498  69.377 14.633  1.00 34.87 ? 241 GLY A CA  1 
ATOM   567  C C   . GLY A 1 82  ? 8.369  69.475 16.161  1.00 34.86 ? 241 GLY A C   1 
ATOM   568  O O   . GLY A 1 82  ? 8.874  70.425 16.758  1.00 35.35 ? 241 GLY A O   1 
ATOM   569  N N   . GLU A 1 83  ? 7.598  68.599 16.803  1.00 32.16 ? 242 GLU A N   1 
ATOM   570  C CA  . GLU A 1 83  ? 7.536  68.556 18.257  1.00 28.48 ? 242 GLU A CA  1 
ATOM   571  C C   . GLU A 1 83  ? 8.844  67.961 18.857  1.00 29.03 ? 242 GLU A C   1 
ATOM   572  O O   . GLU A 1 83  ? 9.236  66.836 18.501  1.00 29.31 ? 242 GLU A O   1 
ATOM   573  C CB  . GLU A 1 83  ? 6.378  67.639 18.690  1.00 28.38 ? 242 GLU A CB  1 
ATOM   574  C CG  . GLU A 1 83  ? 6.140  67.604 20.178  1.00 27.32 ? 242 GLU A CG  1 
ATOM   575  C CD  . GLU A 1 83  ? 4.929  66.819 20.601  1.00 27.71 ? 242 GLU A CD  1 
ATOM   576  O OE1 . GLU A 1 83  ? 4.623  66.861 21.865  1.00 27.01 ? 242 GLU A OE1 1 
ATOM   577  O OE2 . GLU A 1 83  ? 4.277  66.200 19.713  1.00 26.57 ? 242 GLU A OE2 1 
ATOM   578  N N   . PHE A 1 84  ? 9.405  68.612 19.889  1.00 28.68 ? 243 PHE A N   1 
ATOM   579  C CA  . PHE A 1 84  ? 10.450 68.060 20.700  1.00 30.89 ? 243 PHE A CA  1 
ATOM   580  C C   . PHE A 1 84  ? 9.979  67.167 21.884  1.00 31.79 ? 243 PHE A C   1 
ATOM   581  O O   . PHE A 1 84  ? 9.280  67.580 22.803  1.00 30.24 ? 243 PHE A O   1 
ATOM   582  C CB  . PHE A 1 84  ? 11.413 69.124 21.219  1.00 31.19 ? 243 PHE A CB  1 
ATOM   583  C CG  . PHE A 1 84  ? 12.564 68.535 22.154  1.00 36.75 ? 243 PHE A CG  1 
ATOM   584  C CD1 . PHE A 1 84  ? 13.548 67.614 21.640  1.00 42.88 ? 243 PHE A CD1 1 
ATOM   585  C CD2 . PHE A 1 84  ? 12.719 68.969 23.496  1.00 43.65 ? 243 PHE A CD2 1 
ATOM   586  C CE1 . PHE A 1 84  ? 14.600 67.129 22.426  1.00 39.42 ? 243 PHE A CE1 1 
ATOM   587  C CE2 . PHE A 1 84  ? 13.812 68.490 24.316  1.00 40.53 ? 243 PHE A CE2 1 
ATOM   588  C CZ  . PHE A 1 84  ? 14.714 67.542 23.771  1.00 41.44 ? 243 PHE A CZ  1 
ATOM   589  N N   . LEU A 1 85  ? 10.322 65.899 21.780  1.00 31.23 ? 244 LEU A N   1 
ATOM   590  C CA  . LEU A 1 85  ? 10.028 64.922 22.819  1.00 32.94 ? 244 LEU A CA  1 
ATOM   591  C C   . LEU A 1 85  ? 11.239 64.687 23.701  1.00 34.72 ? 244 LEU A C   1 
ATOM   592  O O   . LEU A 1 85  ? 12.105 63.928 23.331  1.00 35.96 ? 244 LEU A O   1 
ATOM   593  C CB  . LEU A 1 85  ? 9.616  63.604 22.167  1.00 30.83 ? 244 LEU A CB  1 
ATOM   594  C CG  . LEU A 1 85  ? 8.418  63.716 21.257  1.00 30.38 ? 244 LEU A CG  1 
ATOM   595  C CD1 . LEU A 1 85  ? 8.006  62.327 20.587  1.00 29.84 ? 244 LEU A CD1 1 
ATOM   596  C CD2 . LEU A 1 85  ? 7.199  64.407 21.918  1.00 27.46 ? 244 LEU A CD2 1 
ATOM   597  N N   . PRO A 1 86  ? 11.304 65.300 24.865  1.00 37.39 ? 245 PRO A N   1 
ATOM   598  C CA  . PRO A 1 86  ? 12.530 65.241 25.672  1.00 38.57 ? 245 PRO A CA  1 
ATOM   599  C C   . PRO A 1 86  ? 12.956 63.877 26.155  1.00 39.71 ? 245 PRO A C   1 
ATOM   600  O O   . PRO A 1 86  ? 14.205 63.796 26.512  1.00 40.24 ? 245 PRO A O   1 
ATOM   601  C CB  . PRO A 1 86  ? 12.215 66.092 26.882  1.00 38.47 ? 245 PRO A CB  1 
ATOM   602  C CG  . PRO A 1 86  ? 10.727 66.250 26.898  1.00 38.96 ? 245 PRO A CG  1 
ATOM   603  C CD  . PRO A 1 86  ? 10.279 66.143 25.507  1.00 38.07 ? 245 PRO A CD  1 
ATOM   604  N N   . LEU A 1 87  ? 12.049 62.895 26.250  1.00 37.55 ? 246 LEU A N   1 
ATOM   605  C CA  . LEU A 1 87  ? 12.462 61.590 26.723  1.00 38.36 ? 246 LEU A CA  1 
ATOM   606  C C   . LEU A 1 87  ? 11.434 60.480 26.355  1.00 37.70 ? 246 LEU A C   1 
ATOM   607  O O   . LEU A 1 87  ? 10.825 59.849 27.256  1.00 41.75 ? 246 LEU A O   1 
ATOM   608  C CB  . LEU A 1 87  ? 12.646 61.622 28.246  1.00 39.14 ? 246 LEU A CB  1 
ATOM   609  C CG  . LEU A 1 87  ? 13.635 60.536 28.682  1.00 43.52 ? 246 LEU A CG  1 
ATOM   610  C CD1 . LEU A 1 87  ? 15.062 61.063 28.897  1.00 45.48 ? 246 LEU A CD1 1 
ATOM   611  C CD2 . LEU A 1 87  ? 13.090 60.011 29.946  1.00 49.37 ? 246 LEU A CD2 1 
ATOM   612  N N   . ASP A 1 88  ? 11.330 60.201 25.062  1.00 32.44 ? 247 ASP A N   1 
ATOM   613  C CA  . ASP A 1 88  ? 10.344 59.338 24.502  1.00 30.37 ? 247 ASP A CA  1 
ATOM   614  C C   . ASP A 1 88  ? 10.822 57.906 24.781  1.00 28.55 ? 247 ASP A C   1 
ATOM   615  O O   . ASP A 1 88  ? 12.020 57.688 24.854  1.00 29.66 ? 247 ASP A O   1 
ATOM   616  C CB  . ASP A 1 88  ? 10.264 59.628 23.009  1.00 28.68 ? 247 ASP A CB  1 
ATOM   617  C CG  . ASP A 1 88  ? 9.125  59.032 22.402  1.00 31.09 ? 247 ASP A CG  1 
ATOM   618  O OD1 . ASP A 1 88  ? 8.068  58.978 23.038  1.00 27.88 ? 247 ASP A OD1 1 
ATOM   619  O OD2 . ASP A 1 88  ? 9.160  58.632 21.251  1.00 31.29 ? 247 ASP A OD2 1 
ATOM   620  N N   . GLN A 1 89  ? 9.886  56.998 24.948  1.00 26.13 ? 248 GLN A N   1 
ATOM   621  C CA  . GLN A 1 89  ? 10.119 55.591 25.255  1.00 26.25 ? 248 GLN A CA  1 
ATOM   622  C C   . GLN A 1 89  ? 9.672  54.771 24.068  1.00 26.65 ? 248 GLN A C   1 
ATOM   623  O O   . GLN A 1 89  ? 8.523  54.880 23.703  1.00 27.61 ? 248 GLN A O   1 
ATOM   624  C CB  . GLN A 1 89  ? 9.327  55.155 26.445  1.00 27.65 ? 248 GLN A CB  1 
ATOM   625  C CG  . GLN A 1 89  ? 9.865  55.714 27.698  1.00 25.05 ? 248 GLN A CG  1 
ATOM   626  C CD  . GLN A 1 89  ? 9.355  55.056 28.997  1.00 28.13 ? 248 GLN A CD  1 
ATOM   627  O OE1 . GLN A 1 89  ? 8.995  53.887 29.017  1.00 27.89 ? 248 GLN A OE1 1 
ATOM   628  N NE2 . GLN A 1 89  ? 9.370  55.838 30.090  1.00 24.56 ? 248 GLN A NE2 1 
ATOM   629  N N   . LEU A 1 90  ? 10.576 54.029 23.417  1.00 23.69 ? 249 LEU A N   1 
ATOM   630  C CA  . LEU A 1 90  ? 10.233 53.091 22.394  1.00 24.79 ? 249 LEU A CA  1 
ATOM   631  C C   . LEU A 1 90  ? 10.519 51.678 22.876  1.00 25.64 ? 249 LEU A C   1 
ATOM   632  O O   . LEU A 1 90  ? 11.463 51.435 23.555  1.00 26.63 ? 249 LEU A O   1 
ATOM   633  C CB  . LEU A 1 90  ? 11.066 53.437 21.156  1.00 25.94 ? 249 LEU A CB  1 
ATOM   634  C CG  . LEU A 1 90  ? 10.998 54.916 20.702  1.00 35.11 ? 249 LEU A CG  1 
ATOM   635  C CD1 . LEU A 1 90  ? 12.104 55.868 21.127  1.00 40.49 ? 249 LEU A CD1 1 
ATOM   636  C CD2 . LEU A 1 90  ? 10.914 54.933 19.230  1.00 41.93 ? 249 LEU A CD2 1 
ATOM   637  N N   . GLU A 1 91  ? 9.693  50.737 22.488  1.00 25.25 ? 250 GLU A N   1 
ATOM   638  C CA  . GLU A 1 91  ? 9.802  49.373 22.800  1.00 26.64 ? 250 GLU A CA  1 
ATOM   639  C C   . GLU A 1 91  ? 11.026 48.733 22.128  1.00 27.12 ? 250 GLU A C   1 
ATOM   640  O O   . GLU A 1 91  ? 11.283 48.996 20.971  1.00 26.32 ? 250 GLU A O   1 
ATOM   641  C CB  . GLU A 1 91  ? 8.588  48.649 22.241  1.00 26.37 ? 250 GLU A CB  1 
ATOM   642  C CG  . GLU A 1 91  ? 7.422  48.671 23.139  1.00 34.40 ? 250 GLU A CG  1 
ATOM   643  C CD  . GLU A 1 91  ? 7.770  48.500 24.627  1.00 26.73 ? 250 GLU A CD  1 
ATOM   644  O OE1 . GLU A 1 91  ? 7.470  49.485 25.266  1.00 32.63 ? 250 GLU A OE1 1 
ATOM   645  O OE2 . GLU A 1 91  ? 8.232  47.403 25.103  1.00 37.29 ? 250 GLU A OE2 1 
ATOM   646  N N   . LEU A 1 92  ? 11.760 47.880 22.857  1.00 26.97 ? 251 LEU A N   1 
ATOM   647  C CA  . LEU A 1 92  ? 12.763 47.035 22.222  1.00 24.12 ? 251 LEU A CA  1 
ATOM   648  C C   . LEU A 1 92  ? 12.293 45.630 22.410  1.00 23.19 ? 251 LEU A C   1 
ATOM   649  O O   . LEU A 1 92  ? 12.348 45.110 23.531  1.00 21.43 ? 251 LEU A O   1 
ATOM   650  C CB  . LEU A 1 92  ? 14.123 47.265 22.857  1.00 25.95 ? 251 LEU A CB  1 
ATOM   651  C CG  . LEU A 1 92  ? 14.758 48.608 22.655  1.00 33.12 ? 251 LEU A CG  1 
ATOM   652  C CD1 . LEU A 1 92  ? 15.882 48.929 23.617  1.00 34.17 ? 251 LEU A CD1 1 
ATOM   653  C CD2 . LEU A 1 92  ? 15.237 48.620 21.209  1.00 33.50 ? 251 LEU A CD2 1 
ATOM   654  N N   . ASP A 1 93  ? 11.904 44.951 21.344  1.00 21.51 ? 252 ASP A N   1 
ATOM   655  C CA  . ASP A 1 93  ? 11.440 43.602 21.464  1.00 21.35 ? 252 ASP A CA  1 
ATOM   656  C C   . ASP A 1 93  ? 12.492 42.647 22.000  1.00 20.96 ? 252 ASP A C   1 
ATOM   657  O O   . ASP A 1 93  ? 13.547 42.464 21.422  1.00 20.56 ? 252 ASP A O   1 
ATOM   658  C CB  . ASP A 1 93  ? 10.995 43.148 20.054  1.00 24.62 ? 252 ASP A CB  1 
ATOM   659  C CG  . ASP A 1 93  ? 10.239 41.849 20.006  1.00 29.01 ? 252 ASP A CG  1 
ATOM   660  O OD1 . ASP A 1 93  ? 10.173 40.986 20.925  1.00 27.25 ? 252 ASP A OD1 1 
ATOM   661  O OD2 . ASP A 1 93  ? 9.694  41.551 18.901  1.00 43.52 ? 252 ASP A OD2 1 
ATOM   662  N N   . VAL A 1 94  ? 12.273 42.078 23.172  1.00 19.70 ? 253 VAL A N   1 
ATOM   663  C CA  . VAL A 1 94  ? 13.180 41.033 23.702  1.00 20.09 ? 253 VAL A CA  1 
ATOM   664  C C   . VAL A 1 94  ? 12.418 39.715 23.994  1.00 23.06 ? 253 VAL A C   1 
ATOM   665  O O   . VAL A 1 94  ? 12.761 38.958 24.960  1.00 19.83 ? 253 VAL A O   1 
ATOM   666  C CB  . VAL A 1 94  ? 13.955 41.509 24.926  1.00 18.89 ? 253 VAL A CB  1 
ATOM   667  C CG1 . VAL A 1 94  ? 15.075 42.574 24.478  1.00 18.97 ? 253 VAL A CG1 1 
ATOM   668  C CG2 . VAL A 1 94  ? 12.985 42.088 26.071  1.00 21.94 ? 253 VAL A CG2 1 
ATOM   669  N N   . GLY A 1 95  ? 11.405 39.427 23.141  1.00 22.78 ? 254 GLY A N   1 
ATOM   670  C CA  . GLY A 1 95  ? 10.703 38.161 23.244  1.00 22.46 ? 254 GLY A CA  1 
ATOM   671  C C   . GLY A 1 95  ? 9.220  38.198 23.295  1.00 22.44 ? 254 GLY A C   1 
ATOM   672  O O   . GLY A 1 95  ? 8.625  37.105 23.358  1.00 20.64 ? 254 GLY A O   1 
ATOM   673  N N   . PHE A 1 96  ? 8.613  39.377 23.439  1.00 24.99 ? 255 PHE A N   1 
ATOM   674  C CA  . PHE A 1 96  ? 7.208  39.402 23.681  1.00 28.11 ? 255 PHE A CA  1 
ATOM   675  C C   . PHE A 1 96  ? 6.523  38.709 22.424  1.00 31.48 ? 255 PHE A C   1 
ATOM   676  O O   . PHE A 1 96  ? 5.504  38.175 22.548  1.00 32.72 ? 255 PHE A O   1 
ATOM   677  C CB  . PHE A 1 96  ? 6.765  40.831 23.940  1.00 31.38 ? 255 PHE A CB  1 
ATOM   678  C CG  . PHE A 1 96  ? 6.241  41.534 22.764  1.00 33.72 ? 255 PHE A CG  1 
ATOM   679  C CD1 . PHE A 1 96  ? 4.845  41.569 22.542  1.00 43.25 ? 255 PHE A CD1 1 
ATOM   680  C CD2 . PHE A 1 96  ? 7.132  42.125 21.833  1.00 41.03 ? 255 PHE A CD2 1 
ATOM   681  C CE1 . PHE A 1 96  ? 4.296  42.153 21.350  1.00 43.70 ? 255 PHE A CE1 1 
ATOM   682  C CE2 . PHE A 1 96  ? 6.630  42.816 20.569  1.00 40.47 ? 255 PHE A CE2 1 
ATOM   683  C CZ  . PHE A 1 96  ? 5.193  42.782 20.335  1.00 43.87 ? 255 PHE A CZ  1 
ATOM   684  N N   . SER A 1 97  ? 7.212  38.658 21.269  1.00 35.27 ? 256 SER A N   1 
ATOM   685  C CA  . SER A 1 97  ? 6.779  37.995 19.943  1.00 39.48 ? 256 SER A CA  1 
ATOM   686  C C   . SER A 1 97  ? 6.838  36.412 19.924  1.00 39.94 ? 256 SER A C   1 
ATOM   687  O O   . SER A 1 97  ? 6.272  35.782 19.056  1.00 42.53 ? 256 SER A O   1 
ATOM   688  C CB  . SER A 1 97  ? 7.792  38.481 18.852  1.00 39.46 ? 256 SER A CB  1 
ATOM   689  O OG  . SER A 1 97  ? 9.072  38.865 19.538  1.00 45.02 ? 256 SER A OG  1 
ATOM   690  N N   . THR A 1 98  ? 7.605  35.772 20.806  1.00 38.49 ? 257 THR A N   1 
ATOM   691  C CA  . THR A 1 98  ? 7.695  34.336 20.838  1.00 36.39 ? 257 THR A CA  1 
ATOM   692  C C   . THR A 1 98  ? 7.422  33.782 22.226  1.00 36.61 ? 257 THR A C   1 
ATOM   693  O O   . THR A 1 98  ? 7.414  32.587 22.409  1.00 36.84 ? 257 THR A O   1 
ATOM   694  C CB  . THR A 1 98  ? 9.116  34.006 20.467  1.00 38.73 ? 257 THR A CB  1 
ATOM   695  O OG1 . THR A 1 98  ? 10.074 34.672 21.352  1.00 38.76 ? 257 THR A OG1 1 
ATOM   696  C CG2 . THR A 1 98  ? 9.501  34.543 19.002  1.00 39.65 ? 257 THR A CG2 1 
ATOM   697  N N   . GLY A 1 99  ? 7.326  34.610 23.270  1.00 33.93 ? 258 GLY A N   1 
ATOM   698  C CA  . GLY A 1 99  ? 7.275  34.094 24.644  1.00 31.14 ? 258 GLY A CA  1 
ATOM   699  C C   . GLY A 1 99  ? 8.683  33.962 25.189  1.00 27.86 ? 258 GLY A C   1 
ATOM   700  O O   . GLY A 1 99  ? 8.894  33.556 26.278  1.00 26.34 ? 258 GLY A O   1 
ATOM   701  N N   . ALA A 1 100 ? 9.686  34.390 24.449  1.00 26.81 ? 259 ALA A N   1 
ATOM   702  C CA  . ALA A 1 100 ? 11.015 34.305 24.981  1.00 24.59 ? 259 ALA A CA  1 
ATOM   703  C C   . ALA A 1 100 ? 11.370 35.299 26.104  1.00 22.91 ? 259 ALA A C   1 
ATOM   704  O O   . ALA A 1 100 ? 12.436 35.139 26.745  1.00 23.08 ? 259 ALA A O   1 
ATOM   705  C CB  . ALA A 1 100 ? 12.074 34.386 23.869  1.00 24.85 ? 259 ALA A CB  1 
ATOM   706  N N   . ASP A 1 101 ? 10.534 36.296 26.311  1.00 19.65 ? 260 ASP A N   1 
ATOM   707  C CA  . ASP A 1 101 ? 10.653 37.170 27.424  1.00 18.52 ? 260 ASP A CA  1 
ATOM   708  C C   . ASP A 1 101 ? 10.253 36.645 28.806  1.00 19.97 ? 260 ASP A C   1 
ATOM   709  O O   . ASP A 1 101 ? 10.472 37.325 29.792  1.00 19.91 ? 260 ASP A O   1 
ATOM   710  C CB  . ASP A 1 101 ? 9.969  38.489 27.193  1.00 17.86 ? 260 ASP A CB  1 
ATOM   711  C CG  . ASP A 1 101 ? 8.472  38.382 27.063  1.00 19.11 ? 260 ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 101 ? 7.896  37.272 26.787  1.00 18.19 ? 260 ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 101 ? 7.840  39.412 27.171  1.00 20.13 ? 260 ASP A OD2 1 
ATOM   714  N N   . GLN A 1 102 ? 9.716  35.441 28.860  1.00 22.61 ? 261 GLN A N   1 
ATOM   715  C CA  . GLN A 1 102 ? 9.389  34.731 30.104  1.00 21.59 ? 261 GLN A CA  1 
ATOM   716  C C   . GLN A 1 102 ? 10.486 33.753 30.377  1.00 22.07 ? 261 GLN A C   1 
ATOM   717  O O   . GLN A 1 102 ? 10.643 32.726 29.718  1.00 23.04 ? 261 GLN A O   1 
ATOM   718  C CB  . GLN A 1 102 ? 8.070  34.014 29.995  1.00 25.02 ? 261 GLN A CB  1 
ATOM   719  C CG  . GLN A 1 102 ? 6.873  34.752 29.435  1.00 30.26 ? 261 GLN A CG  1 
ATOM   720  C CD  . GLN A 1 102 ? 6.367  35.864 30.287  1.00 37.77 ? 261 GLN A CD  1 
ATOM   721  O OE1 . GLN A 1 102 ? 6.112  35.672 31.497  1.00 39.70 ? 261 GLN A OE1 1 
ATOM   722  N NE2 . GLN A 1 102 ? 6.265  37.071 29.683  1.00 36.87 ? 261 GLN A NE2 1 
ATOM   723  N N   . LEU A 1 103 ? 11.389 34.145 31.269  1.00 19.34 ? 262 LEU A N   1 
ATOM   724  C CA  . LEU A 1 103 ? 12.725 33.592 31.305  1.00 20.69 ? 262 LEU A CA  1 
ATOM   725  C C   . LEU A 1 103 ? 12.738 32.370 32.230  1.00 23.51 ? 262 LEU A C   1 
ATOM   726  O O   . LEU A 1 103 ? 11.867 32.302 33.229  1.00 21.83 ? 262 LEU A O   1 
ATOM   727  C CB  . LEU A 1 103 ? 13.654 34.654 31.939  1.00 20.71 ? 262 LEU A CB  1 
ATOM   728  C CG  . LEU A 1 103 ? 13.810 35.901 31.144  1.00 20.43 ? 262 LEU A CG  1 
ATOM   729  C CD1 . LEU A 1 103 ? 14.792 36.753 31.733  1.00 23.81 ? 262 LEU A CD1 1 
ATOM   730  C CD2 . LEU A 1 103 ? 14.190 35.542 29.711  1.00 21.61 ? 262 LEU A CD2 1 
ATOM   731  N N   . PHE A 1 104 ? 13.575 31.374 31.879  1.00 21.74 ? 263 PHE A N   1 
ATOM   732  C CA  . PHE A 1 104 ? 13.970 30.287 32.842  1.00 21.79 ? 263 PHE A CA  1 
ATOM   733  C C   . PHE A 1 104 ? 15.402 30.617 33.218  1.00 21.16 ? 263 PHE A C   1 
ATOM   734  O O   . PHE A 1 104 ? 16.365 30.342 32.470  1.00 22.62 ? 263 PHE A O   1 
ATOM   735  C CB  . PHE A 1 104 ? 13.838 28.929 32.158  1.00 21.91 ? 263 PHE A CB  1 
ATOM   736  C CG  . PHE A 1 104 ? 14.378 27.784 32.918  1.00 24.60 ? 263 PHE A CG  1 
ATOM   737  C CD1 . PHE A 1 104 ? 13.997 27.555 34.277  1.00 27.28 ? 263 PHE A CD1 1 
ATOM   738  C CD2 . PHE A 1 104 ? 15.200 26.834 32.281  1.00 23.23 ? 263 PHE A CD2 1 
ATOM   739  C CE1 . PHE A 1 104 ? 14.494 26.470 34.972  1.00 27.76 ? 263 PHE A CE1 1 
ATOM   740  C CE2 . PHE A 1 104 ? 15.712 25.746 33.002  1.00 26.55 ? 263 PHE A CE2 1 
ATOM   741  C CZ  . PHE A 1 104 ? 15.373 25.610 34.403  1.00 22.69 ? 263 PHE A CZ  1 
ATOM   742  N N   . LEU A 1 105 ? 15.521 31.245 34.348  1.00 22.59 ? 264 LEU A N   1 
ATOM   743  C CA  . LEU A 1 105 ? 16.703 31.975 34.765  1.00 27.19 ? 264 LEU A CA  1 
ATOM   744  C C   . LEU A 1 105 ? 17.249 31.339 36.050  1.00 27.87 ? 264 LEU A C   1 
ATOM   745  O O   . LEU A 1 105 ? 16.823 31.693 37.163  1.00 30.36 ? 264 LEU A O   1 
ATOM   746  C CB  . LEU A 1 105 ? 16.311 33.380 35.162  1.00 26.61 ? 264 LEU A CB  1 
ATOM   747  C CG  . LEU A 1 105 ? 17.271 34.552 35.148  1.00 28.29 ? 264 LEU A CG  1 
ATOM   748  C CD1 . LEU A 1 105 ? 16.934 35.609 36.169  1.00 30.17 ? 264 LEU A CD1 1 
ATOM   749  C CD2 . LEU A 1 105 ? 18.679 34.412 34.839  1.00 32.64 ? 264 LEU A CD2 1 
ATOM   750  N N   . VAL A 1 106 ? 18.129 30.397 35.861  1.00 30.57 ? 265 VAL A N   1 
ATOM   751  C CA  . VAL A 1 106 ? 18.856 29.789 36.954  1.00 32.70 ? 265 VAL A CA  1 
ATOM   752  C C   . VAL A 1 106 ? 20.318 30.081 36.639  1.00 32.49 ? 265 VAL A C   1 
ATOM   753  O O   . VAL A 1 106 ? 20.981 30.642 37.466  1.00 36.96 ? 265 VAL A O   1 
ATOM   754  C CB  . VAL A 1 106 ? 18.605 28.218 37.133  1.00 33.92 ? 265 VAL A CB  1 
ATOM   755  C CG1 . VAL A 1 106 ? 18.687 27.511 35.796  1.00 38.38 ? 265 VAL A CG1 1 
ATOM   756  C CG2 . VAL A 1 106 ? 19.679 27.572 38.115  1.00 36.92 ? 265 VAL A CG2 1 
ATOM   757  N N   . SER A 1 107 ? 20.819 29.758 35.432  1.00 32.70 ? 266 SER A N   1 
ATOM   758  C CA  . SER A 1 107 ? 22.099 30.263 35.084  1.00 30.67 ? 266 SER A CA  1 
ATOM   759  C C   . SER A 1 107 ? 21.943 31.529 34.247  1.00 28.54 ? 266 SER A C   1 
ATOM   760  O O   . SER A 1 107 ? 20.817 31.834 33.862  1.00 28.11 ? 266 SER A O   1 
ATOM   761  C CB  . SER A 1 107 ? 22.874 29.182 34.422  1.00 31.62 ? 266 SER A CB  1 
ATOM   762  O OG  . SER A 1 107 ? 22.078 28.570 33.539  1.00 33.04 ? 266 SER A OG  1 
ATOM   763  N N   . PRO A 1 108 ? 23.041 32.310 34.050  1.00 25.19 ? 267 PRO A N   1 
ATOM   764  C CA  . PRO A 1 108 ? 22.952 33.578 33.353  1.00 22.75 ? 267 PRO A CA  1 
ATOM   765  C C   . PRO A 1 108 ? 22.447 33.377 31.878  1.00 21.00 ? 267 PRO A C   1 
ATOM   766  O O   . PRO A 1 108 ? 22.732 32.357 31.244  1.00 21.43 ? 267 PRO A O   1 
ATOM   767  C CB  . PRO A 1 108 ? 24.400 34.100 33.394  1.00 20.95 ? 267 PRO A CB  1 
ATOM   768  C CG  . PRO A 1 108 ? 24.820 33.553 34.730  1.00 26.84 ? 267 PRO A CG  1 
ATOM   769  C CD  . PRO A 1 108 ? 24.390 32.102 34.576  1.00 25.68 ? 267 PRO A CD  1 
ATOM   770  N N   . LEU A 1 109 ? 21.672 34.334 31.391  1.00 18.43 ? 268 LEU A N   1 
ATOM   771  C CA  . LEU A 1 109 ? 21.258 34.289 29.993  1.00 18.38 ? 268 LEU A CA  1 
ATOM   772  C C   . LEU A 1 109 ? 21.711 35.466 29.256  1.00 17.31 ? 268 LEU A C   1 
ATOM   773  O O   . LEU A 1 109 ? 21.675 36.537 29.811  1.00 17.51 ? 268 LEU A O   1 
ATOM   774  C CB  . LEU A 1 109 ? 19.725 34.316 29.992  1.00 17.40 ? 268 LEU A CB  1 
ATOM   775  C CG  . LEU A 1 109 ? 19.149 33.110 30.631  1.00 22.36 ? 268 LEU A CG  1 
ATOM   776  C CD1 . LEU A 1 109 ? 17.591 33.380 30.858  1.00 26.57 ? 268 LEU A CD1 1 
ATOM   777  C CD2 . LEU A 1 109 ? 19.279 31.796 29.729  1.00 25.46 ? 268 LEU A CD2 1 
ATOM   778  N N   . THR A 1 110 ? 21.993 35.292 27.971  1.00 18.95 ? 269 THR A N   1 
ATOM   779  C CA  . THR A 1 110 ? 22.222 36.400 27.043  1.00 19.30 ? 269 THR A CA  1 
ATOM   780  C C   . THR A 1 110 ? 20.879 36.706 26.374  1.00 19.50 ? 269 THR A C   1 
ATOM   781  O O   . THR A 1 110 ? 20.366 35.908 25.576  1.00 14.39 ? 269 THR A O   1 
ATOM   782  C CB  . THR A 1 110 ? 23.212 35.955 25.962  1.00 20.98 ? 269 THR A CB  1 
ATOM   783  O OG1 . THR A 1 110 ? 24.415 35.610 26.628  1.00 23.28 ? 269 THR A OG1 1 
ATOM   784  C CG2 . THR A 1 110 ? 23.578 37.215 25.017  1.00 22.45 ? 269 THR A CG2 1 
ATOM   785  N N   . ILE A 1 111 ? 20.305 37.833 26.783  1.00 18.28 ? 270 ILE A N   1 
ATOM   786  C CA  . ILE A 1 111 ? 19.080 38.373 26.234  1.00 16.96 ? 270 ILE A CA  1 
ATOM   787  C C   . ILE A 1 111 ? 19.406 38.975 24.900  1.00 20.31 ? 270 ILE A C   1 
ATOM   788  O O   . ILE A 1 111 ? 20.379 39.758 24.788  1.00 18.92 ? 270 ILE A O   1 
ATOM   789  C CB  . ILE A 1 111 ? 18.553 39.460 27.138  1.00 14.53 ? 270 ILE A CB  1 
ATOM   790  C CG1 . ILE A 1 111 ? 18.335 38.863 28.563  1.00 20.06 ? 270 ILE A CG1 1 
ATOM   791  C CG2 . ILE A 1 111 ? 17.215 39.977 26.561  1.00 18.54 ? 270 ILE A CG2 1 
ATOM   792  N N   . CYS A 1 112 ? 18.542 38.700 23.910  1.00 20.30 ? 271 CYS A N   1 
ATOM   793  C CA  . CYS A 1 112 ? 18.814 39.156 22.565  1.00 21.73 ? 271 CYS A CA  1 
ATOM   794  C C   . CYS A 1 112 ? 17.709 40.033 22.003  1.00 22.87 ? 271 CYS A C   1 
ATOM   795  O O   . CYS A 1 112 ? 16.512 39.644 22.114  1.00 23.49 ? 271 CYS A O   1 
ATOM   796  C CB  . CYS A 1 112 ? 19.033 37.962 21.630  1.00 21.94 ? 271 CYS A CB  1 
ATOM   797  S SG  . CYS A 1 112 ? 20.351 36.816 21.994  1.00 24.45 ? 271 CYS A SG  1 
ATOM   798  N N   . HIS A 1 113 ? 18.066 41.184 21.441  1.00 22.62 ? 272 HIS A N   1 
ATOM   799  C CA  . HIS A 1 113 ? 17.137 41.991 20.662  1.00 23.39 ? 272 HIS A CA  1 
ATOM   800  C C   . HIS A 1 113 ? 17.618 41.905 19.207  1.00 26.79 ? 272 HIS A C   1 
ATOM   801  O O   . HIS A 1 113 ? 18.718 42.418 18.884  1.00 23.39 ? 272 HIS A O   1 
ATOM   802  C CB  . HIS A 1 113 ? 17.087 43.432 21.154  1.00 23.60 ? 272 HIS A CB  1 
ATOM   803  C CG  . HIS A 1 113 ? 16.404 44.393 20.200  1.00 26.98 ? 272 HIS A CG  1 
ATOM   804  N ND1 . HIS A 1 113 ? 15.053 44.354 19.923  1.00 27.61 ? 272 HIS A ND1 1 
ATOM   805  C CD2 . HIS A 1 113 ? 16.920 45.390 19.417  1.00 28.45 ? 272 HIS A CD2 1 
ATOM   806  C CE1 . HIS A 1 113 ? 14.750 45.318 19.052  1.00 30.52 ? 272 HIS A CE1 1 
ATOM   807  N NE2 . HIS A 1 113 ? 15.870 45.971 18.728  1.00 32.24 ? 272 HIS A NE2 1 
ATOM   808  N N   . VAL A 1 114 ? 16.864 41.212 18.367  1.00 25.17 ? 273 VAL A N   1 
ATOM   809  C CA  . VAL A 1 114 ? 17.234 41.120 16.970  1.00 29.19 ? 273 VAL A CA  1 
ATOM   810  C C   . VAL A 1 114 ? 16.962 42.504 16.291  1.00 29.64 ? 273 VAL A C   1 
ATOM   811  O O   . VAL A 1 114 ? 15.877 43.080 16.346  1.00 29.69 ? 273 VAL A O   1 
ATOM   812  C CB  . VAL A 1 114 ? 16.479 39.958 16.254  1.00 28.68 ? 273 VAL A CB  1 
ATOM   813  C CG1 . VAL A 1 114 ? 16.710 39.917 14.675  1.00 31.92 ? 273 VAL A CG1 1 
ATOM   814  C CG2 . VAL A 1 114 ? 16.874 38.667 16.833  1.00 31.22 ? 273 VAL A CG2 1 
ATOM   815  N N   . ILE A 1 115 ? 17.980 43.069 15.680  1.00 31.12 ? 274 ILE A N   1 
ATOM   816  C CA  . ILE A 1 115 ? 17.767 44.357 15.028  1.00 32.60 ? 274 ILE A CA  1 
ATOM   817  C C   . ILE A 1 115 ? 17.120 44.113 13.619  1.00 33.41 ? 274 ILE A C   1 
ATOM   818  O O   . ILE A 1 115 ? 17.695 43.532 12.713  1.00 34.90 ? 274 ILE A O   1 
ATOM   819  C CB  . ILE A 1 115 ? 19.015 45.257 15.006  1.00 32.32 ? 274 ILE A CB  1 
ATOM   820  C CG1 . ILE A 1 115 ? 19.669 45.538 16.445  1.00 31.40 ? 274 ILE A CG1 1 
ATOM   821  C CG2 . ILE A 1 115 ? 18.682 46.597 14.281  1.00 29.45 ? 274 ILE A CG2 1 
ATOM   822  N N   . ASP A 1 116 ? 15.892 44.586 13.471  1.00 34.87 ? 275 ASP A N   1 
ATOM   823  C CA  . ASP A 1 116 ? 15.177 44.473 12.186  1.00 35.11 ? 275 ASP A CA  1 
ATOM   824  C C   . ASP A 1 116 ? 14.439 45.729 11.857  1.00 33.70 ? 275 ASP A C   1 
ATOM   825  O O   . ASP A 1 116 ? 14.607 46.736 12.500  1.00 32.83 ? 275 ASP A O   1 
ATOM   826  C CB  . ASP A 1 116 ? 14.289 43.202 12.174  1.00 36.33 ? 275 ASP A CB  1 
ATOM   827  C CG  . ASP A 1 116 ? 13.177 43.236 13.213  1.00 36.14 ? 275 ASP A CG  1 
ATOM   828  O OD1 . ASP A 1 116 ? 12.872 44.332 13.829  1.00 32.67 ? 275 ASP A OD1 1 
ATOM   829  O OD2 . ASP A 1 116 ? 12.556 42.161 13.435  1.00 42.69 ? 275 ASP A OD2 1 
ATOM   830  N N   . ALA A 1 117 ? 13.568 45.674 10.845  1.00 34.91 ? 276 ALA A N   1 
ATOM   831  C CA  . ALA A 1 117 ? 12.855 46.873 10.359  1.00 35.92 ? 276 ALA A CA  1 
ATOM   832  C C   . ALA A 1 117 ? 11.938 47.547 11.375  1.00 36.95 ? 276 ALA A C   1 
ATOM   833  O O   . ALA A 1 117 ? 11.781 48.770 11.375  1.00 38.04 ? 276 ALA A O   1 
ATOM   834  C CB  . ALA A 1 117 ? 12.040 46.483 9.076   1.00 37.60 ? 276 ALA A CB  1 
ATOM   835  N N   . LYS A 1 118 ? 11.357 46.734 12.259  1.00 38.12 ? 277 LYS A N   1 
ATOM   836  C CA  . LYS A 1 118 ? 10.616 47.214 13.448  1.00 39.22 ? 277 LYS A CA  1 
ATOM   837  C C   . LYS A 1 118 ? 11.456 47.692 14.609  1.00 35.98 ? 277 LYS A C   1 
ATOM   838  O O   . LYS A 1 118 ? 10.948 48.372 15.449  1.00 34.28 ? 277 LYS A O   1 
ATOM   839  C CB  . LYS A 1 118 ? 9.631  46.134 13.975  1.00 41.07 ? 277 LYS A CB  1 
ATOM   840  C CG  . LYS A 1 118 ? 9.162  45.148 12.818  1.00 48.61 ? 277 LYS A CG  1 
ATOM   841  C CD  . LYS A 1 118 ? 7.910  44.231 13.149  1.00 55.80 ? 277 LYS A CD  1 
ATOM   842  C CE  . LYS A 1 118 ? 6.602  44.603 12.329  1.00 56.32 ? 277 LYS A CE  1 
ATOM   843  N NZ  . LYS A 1 118 ? 5.364  43.934 12.888  1.00 55.60 ? 277 LYS A NZ  1 
ATOM   844  N N   . SER A 1 119 ? 12.760 47.384 14.652  1.00 35.06 ? 278 SER A N   1 
ATOM   845  C CA  . SER A 1 119 ? 13.567 47.837 15.788  1.00 29.96 ? 278 SER A CA  1 
ATOM   846  C C   . SER A 1 119 ? 13.807 49.287 15.633  1.00 31.26 ? 278 SER A C   1 
ATOM   847  O O   . SER A 1 119 ? 14.143 49.683 14.626  1.00 30.31 ? 278 SER A O   1 
ATOM   848  C CB  . SER A 1 119 ? 14.917 47.110 15.851  1.00 29.41 ? 278 SER A CB  1 
ATOM   849  O OG  . SER A 1 119 ? 15.750 47.767 16.826  1.00 28.78 ? 278 SER A OG  1 
ATOM   850  N N   . PRO A 1 120 ? 13.748 50.088 16.691  1.00 32.23 ? 279 PRO A N   1 
ATOM   851  C CA  . PRO A 1 120 ? 14.228 51.444 16.662  1.00 30.50 ? 279 PRO A CA  1 
ATOM   852  C C   . PRO A 1 120 ? 15.748 51.526 16.398  1.00 31.03 ? 279 PRO A C   1 
ATOM   853  O O   . PRO A 1 120 ? 16.251 52.605 16.294  1.00 28.95 ? 279 PRO A O   1 
ATOM   854  C CB  . PRO A 1 120 ? 13.962 51.958 18.100  1.00 30.85 ? 279 PRO A CB  1 
ATOM   855  C CG  . PRO A 1 120 ? 13.683 50.762 18.919  1.00 32.76 ? 279 PRO A CG  1 
ATOM   856  C CD  . PRO A 1 120 ? 13.254 49.658 18.014  1.00 33.32 ? 279 PRO A CD  1 
ATOM   857  N N   . PHE A 1 121 ? 16.481 50.425 16.382  1.00 31.33 ? 280 PHE A N   1 
ATOM   858  C CA  . PHE A 1 121 ? 17.944 50.501 16.067  1.00 31.62 ? 280 PHE A CA  1 
ATOM   859  C C   . PHE A 1 121 ? 18.178 50.115 14.611  1.00 31.33 ? 280 PHE A C   1 
ATOM   860  O O   . PHE A 1 121 ? 19.287 49.817 14.219  1.00 31.84 ? 280 PHE A O   1 
ATOM   861  C CB  . PHE A 1 121 ? 18.750 49.575 17.034  1.00 30.75 ? 280 PHE A CB  1 
ATOM   862  C CG  . PHE A 1 121 ? 18.996 50.163 18.358  1.00 30.75 ? 280 PHE A CG  1 
ATOM   863  C CD1 . PHE A 1 121 ? 19.220 51.446 18.516  1.00 29.00 ? 280 PHE A CD1 1 
ATOM   864  C CD2 . PHE A 1 121 ? 19.012 49.373 19.499  1.00 39.69 ? 280 PHE A CD2 1 
ATOM   865  C CE1 . PHE A 1 121 ? 19.455 52.026 19.748  1.00 28.91 ? 280 PHE A CE1 1 
ATOM   866  C CE2 . PHE A 1 121 ? 19.289 49.914 20.742  1.00 36.14 ? 280 PHE A CE2 1 
ATOM   867  C CZ  . PHE A 1 121 ? 19.593 51.200 20.879  1.00 30.45 ? 280 PHE A CZ  1 
ATOM   868  N N   . TYR A 1 122 ? 17.101 49.971 13.849  1.00 32.49 ? 281 TYR A N   1 
ATOM   869  C CA  . TYR A 1 122 ? 17.180 49.557 12.455  1.00 33.27 ? 281 TYR A CA  1 
ATOM   870  C C   . TYR A 1 122 ? 18.286 50.337 11.671  1.00 33.22 ? 281 TYR A C   1 
ATOM   871  O O   . TYR A 1 122 ? 18.955 49.745 10.877  1.00 33.83 ? 281 TYR A O   1 
ATOM   872  C CB  . TYR A 1 122 ? 15.851 49.869 11.779  1.00 33.16 ? 281 TYR A CB  1 
ATOM   873  C CG  . TYR A 1 122 ? 15.718 49.325 10.355  1.00 36.69 ? 281 TYR A CG  1 
ATOM   874  C CD1 . TYR A 1 122 ? 16.183 48.069 10.010  1.00 32.06 ? 281 TYR A CD1 1 
ATOM   875  C CD2 . TYR A 1 122 ? 15.052 50.097 9.346   1.00 38.69 ? 281 TYR A CD2 1 
ATOM   876  C CE1 . TYR A 1 122 ? 16.021 47.557 8.658   1.00 37.24 ? 281 TYR A CE1 1 
ATOM   877  C CE2 . TYR A 1 122 ? 14.868 49.591 8.033   1.00 37.84 ? 281 TYR A CE2 1 
ATOM   878  C CZ  . TYR A 1 122 ? 15.362 48.380 7.681   1.00 40.97 ? 281 TYR A CZ  1 
ATOM   879  O OH  . TYR A 1 122 ? 15.204 47.971 6.343   1.00 44.40 ? 281 TYR A OH  1 
ATOM   880  N N   . ASP A 1 123 ? 18.491 51.624 11.921  1.00 33.70 ? 282 ASP A N   1 
ATOM   881  C CA  . ASP A 1 123 ? 19.530 52.351 11.186  1.00 37.45 ? 282 ASP A CA  1 
ATOM   882  C C   . ASP A 1 123 ? 20.613 52.814 12.089  1.00 36.46 ? 282 ASP A C   1 
ATOM   883  O O   . ASP A 1 123 ? 21.249 53.812 11.822  1.00 35.56 ? 282 ASP A O   1 
ATOM   884  C CB  . ASP A 1 123 ? 18.967 53.517 10.325  1.00 38.21 ? 282 ASP A CB  1 
ATOM   885  C CG  . ASP A 1 123 ? 19.957 53.930 9.101   1.00 46.11 ? 282 ASP A CG  1 
ATOM   886  O OD1 . ASP A 1 123 ? 20.768 53.097 8.454   1.00 40.01 ? 282 ASP A OD1 1 
ATOM   887  O OD2 . ASP A 1 123 ? 19.955 55.136 8.787   1.00 52.95 ? 282 ASP A OD2 1 
ATOM   888  N N   . LEU A 1 124 ? 20.886 52.049 13.164  1.00 35.16 ? 283 LEU A N   1 
ATOM   889  C CA  . LEU A 1 124 ? 22.035 52.348 14.048  1.00 32.82 ? 283 LEU A CA  1 
ATOM   890  C C   . LEU A 1 124 ? 23.225 51.580 13.431  1.00 30.67 ? 283 LEU A C   1 
ATOM   891  O O   . LEU A 1 124 ? 23.171 50.380 13.265  1.00 29.08 ? 283 LEU A O   1 
ATOM   892  C CB  . LEU A 1 124 ? 21.779 51.901 15.474  1.00 31.39 ? 283 LEU A CB  1 
ATOM   893  C CG  . LEU A 1 124 ? 22.862 52.183 16.477  1.00 34.76 ? 283 LEU A CG  1 
ATOM   894  C CD1 . LEU A 1 124 ? 22.870 53.723 16.848  1.00 36.12 ? 283 LEU A CD1 1 
ATOM   895  C CD2 . LEU A 1 124 ? 22.664 51.239 17.723  1.00 33.75 ? 283 LEU A CD2 1 
ATOM   896  N N   . SER A 1 125 ? 24.232 52.347 13.014  1.00 29.85 ? 284 SER A N   1 
ATOM   897  C CA  . SER A 1 125 ? 25.513 51.841 12.461  1.00 29.79 ? 284 SER A CA  1 
ATOM   898  C C   . SER A 1 125 ? 26.568 52.155 13.526  1.00 28.55 ? 284 SER A C   1 
ATOM   899  O O   . SER A 1 125 ? 26.350 52.967 14.387  1.00 28.21 ? 284 SER A O   1 
ATOM   900  C CB  . SER A 1 125 ? 25.906 52.689 11.203  1.00 27.51 ? 284 SER A CB  1 
ATOM   901  O OG  . SER A 1 125 ? 26.226 53.963 11.739  1.00 25.16 ? 284 SER A OG  1 
ATOM   902  N N   . GLN A 1 126 ? 27.737 51.570 13.388  1.00 30.56 ? 285 GLN A N   1 
ATOM   903  C CA  . GLN A 1 126 ? 28.886 51.825 14.289  1.00 31.79 ? 285 GLN A CA  1 
ATOM   904  C C   . GLN A 1 126 ? 29.274 53.299 14.221  1.00 33.39 ? 285 GLN A C   1 
ATOM   905  O O   . GLN A 1 126 ? 29.567 53.926 15.220  1.00 31.55 ? 285 GLN A O   1 
ATOM   906  C CB  . GLN A 1 126 ? 30.051 50.915 13.865  1.00 32.28 ? 285 GLN A CB  1 
ATOM   907  C CG  . GLN A 1 126 ? 31.384 51.158 14.479  1.00 34.90 ? 285 GLN A CG  1 
ATOM   908  C CD  . GLN A 1 126 ? 32.388 50.021 14.322  1.00 35.66 ? 285 GLN A CD  1 
ATOM   909  O OE1 . GLN A 1 126 ? 32.364 49.315 13.356  1.00 39.92 ? 285 GLN A OE1 1 
ATOM   910  N NE2 . GLN A 1 126 ? 33.220 49.815 15.350  1.00 40.12 ? 285 GLN A NE2 1 
ATOM   911  N N   . ARG A 1 127 ? 29.197 53.888 13.032  1.00 36.04 ? 286 ARG A N   1 
ATOM   912  C CA  . ARG A 1 127 ? 29.548 55.307 12.969  1.00 39.56 ? 286 ARG A CA  1 
ATOM   913  C C   . ARG A 1 127 ? 28.473 56.213 13.583  1.00 40.55 ? 286 ARG A C   1 
ATOM   914  O O   . ARG A 1 127 ? 28.785 57.066 14.456  1.00 37.60 ? 286 ARG A O   1 
ATOM   915  C CB  . ARG A 1 127 ? 29.950 55.669 11.524  1.00 42.74 ? 286 ARG A CB  1 
ATOM   916  C CG  . ARG A 1 127 ? 28.893 56.183 10.563  1.00 47.76 ? 286 ARG A CG  1 
ATOM   917  C CD  . ARG A 1 127 ? 29.244 55.878 9.081   1.00 58.25 ? 286 ARG A CD  1 
ATOM   918  N NE  . ARG A 1 127 ? 28.051 55.806 8.214   1.00 64.45 ? 286 ARG A NE  1 
ATOM   919  C CZ  . ARG A 1 127 ? 27.356 56.868 7.840   1.00 70.14 ? 286 ARG A CZ  1 
ATOM   920  N NH1 . ARG A 1 127 ? 27.728 58.099 8.224   1.00 72.25 ? 286 ARG A NH1 1 
ATOM   921  N NH2 . ARG A 1 127 ? 26.311 56.709 7.034   1.00 73.16 ? 286 ARG A NH2 1 
ATOM   922  N N   . SER A 1 128 ? 27.192 55.943 13.226  1.00 42.45 ? 287 SER A N   1 
ATOM   923  C CA  . SER A 1 128 ? 26.098 56.703 13.831  1.00 44.79 ? 287 SER A CA  1 
ATOM   924  C C   . SER A 1 128 ? 26.066 56.557 15.325  1.00 46.22 ? 287 SER A C   1 
ATOM   925  O O   . SER A 1 128 ? 25.581 57.421 15.964  1.00 45.04 ? 287 SER A O   1 
ATOM   926  C CB  . SER A 1 128 ? 24.718 56.413 13.230  1.00 44.57 ? 287 SER A CB  1 
ATOM   927  O OG  . SER A 1 128 ? 24.199 55.228 13.726  1.00 44.93 ? 287 SER A OG  1 
ATOM   928  N N   . MET A 1 129 ? 26.680 55.523 15.904  1.00 48.45 ? 288 MET A N   1 
ATOM   929  C CA  . MET A 1 129 ? 26.657 55.440 17.343  1.00 49.96 ? 288 MET A CA  1 
ATOM   930  C C   . MET A 1 129 ? 27.516 56.452 18.084  1.00 51.46 ? 288 MET A C   1 
ATOM   931  O O   . MET A 1 129 ? 27.228 56.869 19.233  1.00 50.88 ? 288 MET A O   1 
ATOM   932  C CB  . MET A 1 129 ? 27.052 54.034 17.800  1.00 51.91 ? 288 MET A CB  1 
ATOM   933  C CG  . MET A 1 129 ? 26.080 53.564 18.977  1.00 51.03 ? 288 MET A CG  1 
ATOM   934  S SD  . MET A 1 129 ? 26.156 51.903 19.299  1.00 51.34 ? 288 MET A SD  1 
ATOM   935  C CE  . MET A 1 129 ? 27.663 51.887 20.224  1.00 50.74 ? 288 MET A CE  1 
ATOM   936  N N   . GLN A 1 130 ? 28.596 56.861 17.447  1.00 52.50 ? 289 GLN A N   1 
ATOM   937  C CA  . GLN A 1 130 ? 29.467 57.877 18.044  1.00 54.06 ? 289 GLN A CA  1 
ATOM   938  C C   . GLN A 1 130 ? 28.781 59.220 18.190  1.00 52.71 ? 289 GLN A C   1 
ATOM   939  O O   . GLN A 1 130 ? 29.293 60.077 18.866  1.00 53.92 ? 289 GLN A O   1 
ATOM   940  C CB  . GLN A 1 130 ? 30.714 58.072 17.144  1.00 55.39 ? 289 GLN A CB  1 
ATOM   941  C CG  . GLN A 1 130 ? 31.586 56.779 16.943  1.00 59.36 ? 289 GLN A CG  1 
ATOM   942  C CD  . GLN A 1 130 ? 32.252 56.731 15.555  1.00 66.18 ? 289 GLN A CD  1 
ATOM   943  O OE1 . GLN A 1 130 ? 32.441 57.797 14.922  1.00 66.66 ? 289 GLN A OE1 1 
ATOM   944  N NE2 . GLN A 1 130 ? 32.626 55.506 15.083  1.00 69.58 ? 289 GLN A NE2 1 
ATOM   945  N N   . THR A 1 131 ? 27.655 59.422 17.508  1.00 51.65 ? 290 THR A N   1 
ATOM   946  C CA  . THR A 1 131 ? 26.926 60.692 17.552  1.00 51.53 ? 290 THR A CA  1 
ATOM   947  C C   . THR A 1 131 ? 25.566 60.653 18.366  1.00 50.17 ? 290 THR A C   1 
ATOM   948  O O   . THR A 1 131 ? 25.207 61.661 19.035  1.00 49.96 ? 290 THR A O   1 
ATOM   949  C CB  . THR A 1 131 ? 26.654 61.218 16.090  1.00 51.21 ? 290 THR A CB  1 
ATOM   950  O OG1 . THR A 1 131 ? 26.030 60.201 15.304  1.00 52.49 ? 290 THR A OG1 1 
ATOM   951  C CG2 . THR A 1 131 ? 27.953 61.534 15.321  1.00 53.16 ? 290 THR A CG2 1 
ATOM   952  N N   . GLU A 1 132 ? 24.865 59.505 18.312  1.00 47.47 ? 291 GLU A N   1 
ATOM   953  C CA  . GLU A 1 132 ? 23.551 59.308 18.977  1.00 45.31 ? 291 GLU A CA  1 
ATOM   954  C C   . GLU A 1 132 ? 23.638 59.326 20.525  1.00 42.19 ? 291 GLU A C   1 
ATOM   955  O O   . GLU A 1 132 ? 24.702 59.171 21.164  1.00 41.04 ? 291 GLU A O   1 
ATOM   956  C CB  . GLU A 1 132 ? 22.725 58.079 18.380  1.00 47.61 ? 291 GLU A CB  1 
ATOM   957  C CG  . GLU A 1 132 ? 22.886 57.782 16.848  1.00 49.30 ? 291 GLU A CG  1 
ATOM   958  C CD  . GLU A 1 132 ? 21.635 57.659 15.898  1.00 58.46 ? 291 GLU A CD  1 
ATOM   959  O OE1 . GLU A 1 132 ? 20.904 58.693 15.777  1.00 63.10 ? 291 GLU A OE1 1 
ATOM   960  O OE2 . GLU A 1 132 ? 21.457 56.578 15.135  1.00 58.56 ? 291 GLU A OE2 1 
ATOM   961  N N   . GLN A 1 133 ? 22.551 59.748 21.134  1.00 38.18 ? 292 GLN A N   1 
ATOM   962  C CA  . GLN A 1 133 ? 22.416 59.674 22.532  1.00 38.33 ? 292 GLN A CA  1 
ATOM   963  C C   . GLN A 1 133 ? 21.116 58.928 22.812  1.00 36.30 ? 292 GLN A C   1 
ATOM   964  O O   . GLN A 1 133 ? 20.020 59.324 22.369  1.00 34.58 ? 292 GLN A O   1 
ATOM   965  C CB  . GLN A 1 133 ? 22.336 61.023 23.139  1.00 39.81 ? 292 GLN A CB  1 
ATOM   966  C CG  . GLN A 1 133 ? 23.705 61.565 23.368  1.00 47.44 ? 292 GLN A CG  1 
ATOM   967  C CD  . GLN A 1 133 ? 23.642 62.995 23.892  1.00 54.37 ? 292 GLN A CD  1 
ATOM   968  O OE1 . GLN A 1 133 ? 22.539 63.492 24.175  1.00 58.85 ? 292 GLN A OE1 1 
ATOM   969  N NE2 . GLN A 1 133 ? 24.818 63.655 24.042  1.00 58.25 ? 292 GLN A NE2 1 
ATOM   970  N N   . PHE A 1 134 ? 21.248 57.881 23.596  1.00 33.93 ? 293 PHE A N   1 
ATOM   971  C CA  . PHE A 1 134 ? 20.105 57.004 23.923  1.00 30.68 ? 293 PHE A CA  1 
ATOM   972  C C   . PHE A 1 134 ? 20.410 56.321 25.182  1.00 29.30 ? 293 PHE A C   1 
ATOM   973  O O   . PHE A 1 134 ? 21.572 56.332 25.673  1.00 26.96 ? 293 PHE A O   1 
ATOM   974  C CB  . PHE A 1 134 ? 19.769 56.073 22.720  1.00 31.41 ? 293 PHE A CB  1 
ATOM   975  C CG  . PHE A 1 134 ? 20.874 55.079 22.294  1.00 34.20 ? 293 PHE A CG  1 
ATOM   976  C CD1 . PHE A 1 134 ? 21.129 53.950 23.032  1.00 33.07 ? 293 PHE A CD1 1 
ATOM   977  C CD2 . PHE A 1 134 ? 21.576 55.229 21.077  1.00 36.11 ? 293 PHE A CD2 1 
ATOM   978  C CE1 . PHE A 1 134 ? 22.099 53.073 22.654  1.00 36.89 ? 293 PHE A CE1 1 
ATOM   979  C CE2 . PHE A 1 134 ? 22.537 54.317 20.691  1.00 34.83 ? 293 PHE A CE2 1 
ATOM   980  C CZ  . PHE A 1 134 ? 22.789 53.256 21.466  1.00 38.83 ? 293 PHE A CZ  1 
ATOM   981  N N   . GLU A 1 135 ? 19.384 55.696 25.753  1.00 27.27 ? 294 GLU A N   1 
ATOM   982  C CA  . GLU A 1 135 ? 19.540 54.911 26.949  1.00 27.00 ? 294 GLU A CA  1 
ATOM   983  C C   . GLU A 1 135 ? 18.602 53.713 26.859  1.00 26.21 ? 294 GLU A C   1 
ATOM   984  O O   . GLU A 1 135 ? 17.379 53.862 26.837  1.00 24.22 ? 294 GLU A O   1 
ATOM   985  C CB  . GLU A 1 135 ? 19.203 55.723 28.136  1.00 25.84 ? 294 GLU A CB  1 
ATOM   986  C CG  . GLU A 1 135 ? 19.674 55.152 29.418  1.00 30.50 ? 294 GLU A CG  1 
ATOM   987  C CD  . GLU A 1 135 ? 19.414 56.057 30.633  1.00 31.81 ? 294 GLU A CD  1 
ATOM   988  O OE1 . GLU A 1 135 ? 19.308 57.250 30.463  1.00 31.20 ? 294 GLU A OE1 1 
ATOM   989  O OE2 . GLU A 1 135 ? 19.458 55.628 31.790  1.00 30.77 ? 294 GLU A OE2 1 
ATOM   990  N N   . VAL A 1 136 ? 19.196 52.516 26.828  1.00 24.73 ? 295 VAL A N   1 
ATOM   991  C CA  . VAL A 1 136 ? 18.443 51.287 27.011  1.00 22.67 ? 295 VAL A CA  1 
ATOM   992  C C   . VAL A 1 136 ? 18.125 51.037 28.429  1.00 22.86 ? 295 VAL A C   1 
ATOM   993  O O   . VAL A 1 136 ? 19.004 50.747 29.247  1.00 24.77 ? 295 VAL A O   1 
ATOM   994  C CB  . VAL A 1 136 ? 19.190 50.102 26.417  1.00 24.74 ? 295 VAL A CB  1 
ATOM   995  C CG1 . VAL A 1 136 ? 18.399 48.769 26.520  1.00 24.23 ? 295 VAL A CG1 1 
ATOM   996  C CG2 . VAL A 1 136 ? 19.520 50.384 24.953  1.00 21.46 ? 295 VAL A CG2 1 
ATOM   997  N N   . VAL A 1 137 ? 16.848 50.940 28.735  1.00 21.29 ? 296 VAL A N   1 
ATOM   998  C CA  . VAL A 1 137 ? 16.468 50.667 30.079  1.00 20.05 ? 296 VAL A CA  1 
ATOM   999  C C   . VAL A 1 137 ? 15.949 49.214 30.094  1.00 21.58 ? 296 VAL A C   1 
ATOM   1000 O O   . VAL A 1 137 ? 15.093 48.865 29.262  1.00 19.50 ? 296 VAL A O   1 
ATOM   1001 C CB  . VAL A 1 137 ? 15.452 51.649 30.653  1.00 19.88 ? 296 VAL A CB  1 
ATOM   1002 C CG1 . VAL A 1 137 ? 15.049 51.290 32.048  1.00 22.41 ? 296 VAL A CG1 1 
ATOM   1003 C CG2 . VAL A 1 137 ? 16.031 53.090 30.763  1.00 22.96 ? 296 VAL A CG2 1 
ATOM   1004 N N   . VAL A 1 138 ? 16.458 48.407 31.059  1.00 20.41 ? 297 VAL A N   1 
ATOM   1005 C CA  . VAL A 1 138 ? 16.099 46.996 31.216  1.00 20.78 ? 297 VAL A CA  1 
ATOM   1006 C C   . VAL A 1 138 ? 15.315 46.859 32.480  1.00 21.92 ? 297 VAL A C   1 
ATOM   1007 O O   . VAL A 1 138 ? 15.712 47.385 33.508  1.00 21.09 ? 297 VAL A O   1 
ATOM   1008 C CB  . VAL A 1 138 ? 17.304 46.127 31.231  1.00 20.89 ? 297 VAL A CB  1 
ATOM   1009 C CG1 . VAL A 1 138 ? 16.843 44.732 31.439  1.00 24.09 ? 297 VAL A CG1 1 
ATOM   1010 C CG2 . VAL A 1 138 ? 18.138 46.215 29.859  1.00 21.68 ? 297 VAL A CG2 1 
ATOM   1011 N N   . ILE A 1 139 ? 14.177 46.152 32.431  1.00 21.03 ? 298 ILE A N   1 
ATOM   1012 C CA  . ILE A 1 139 ? 13.309 45.885 33.580  1.00 22.45 ? 298 ILE A CA  1 
ATOM   1013 C C   . ILE A 1 139 ? 13.076 44.344 33.690  1.00 22.94 ? 298 ILE A C   1 
ATOM   1014 O O   . ILE A 1 139 ? 12.559 43.681 32.774  1.00 19.01 ? 298 ILE A O   1 
ATOM   1015 C CB  . ILE A 1 139 ? 11.971 46.637 33.501  1.00 23.61 ? 298 ILE A CB  1 
ATOM   1016 C CG1 . ILE A 1 139 ? 12.077 48.201 33.115  1.00 28.41 ? 298 ILE A CG1 1 
ATOM   1017 C CG2 . ILE A 1 139 ? 11.171 46.545 34.807  1.00 26.90 ? 298 ILE A CG2 1 
ATOM   1018 N N   . LEU A 1 140 ? 13.434 43.795 34.867  1.00 22.37 ? 299 LEU A N   1 
ATOM   1019 C CA  . LEU A 1 140 ? 13.295 42.407 35.159  1.00 23.32 ? 299 LEU A CA  1 
ATOM   1020 C C   . LEU A 1 140 ? 12.406 42.264 36.379  1.00 23.08 ? 299 LEU A C   1 
ATOM   1021 O O   . LEU A 1 140 ? 12.666 42.852 37.419  1.00 24.63 ? 299 LEU A O   1 
ATOM   1022 C CB  . LEU A 1 140 ? 14.638 41.817 35.503  1.00 24.52 ? 299 LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 140 ? 14.540 40.316 35.925  1.00 31.51 ? 299 LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 140 ? 13.968 39.383 34.857  1.00 37.29 ? 299 LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 140 ? 15.900 39.812 36.179  1.00 37.61 ? 299 LEU A CD2 1 
ATOM   1026 N N   . GLU A 1 141 ? 11.315 41.557 36.213  1.00 22.70 ? 300 GLU A N   1 
ATOM   1027 C CA  . GLU A 1 141 ? 10.301 41.369 37.251  1.00 23.78 ? 300 GLU A CA  1 
ATOM   1028 C C   . GLU A 1 141 ? 10.096 39.894 37.506  1.00 25.42 ? 300 GLU A C   1 
ATOM   1029 O O   . GLU A 1 141 ? 10.220 39.039 36.597  1.00 24.79 ? 300 GLU A O   1 
ATOM   1030 C CB  . GLU A 1 141 ? 8.981  42.037 36.836  1.00 22.42 ? 300 GLU A CB  1 
ATOM   1031 C CG  . GLU A 1 141 ? 9.114  43.533 36.751  1.00 27.13 ? 300 GLU A CG  1 
ATOM   1032 C CD  . GLU A 1 141 ? 7.783  44.208 36.338  1.00 38.14 ? 300 GLU A CD  1 
ATOM   1033 O OE1 . GLU A 1 141 ? 6.870  43.460 35.920  1.00 40.15 ? 300 GLU A OE1 1 
ATOM   1034 O OE2 . GLU A 1 141 ? 7.675  45.466 36.408  1.00 39.83 ? 300 GLU A OE2 1 
ATOM   1035 N N   . GLY A 1 142 ? 9.857  39.539 38.742  1.00 27.03 ? 301 GLY A N   1 
ATOM   1036 C CA  . GLY A 1 142 ? 9.453  38.171 39.066  1.00 29.61 ? 301 GLY A CA  1 
ATOM   1037 C C   . GLY A 1 142 ? 8.891  38.052 40.456  1.00 31.12 ? 301 GLY A C   1 
ATOM   1038 O O   . GLY A 1 142 ? 8.718  39.049 41.213  1.00 31.21 ? 301 GLY A O   1 
ATOM   1039 N N   . ILE A 1 143 ? 8.514  36.861 40.771  1.00 32.40 ? 302 ILE A N   1 
ATOM   1040 C CA  . ILE A 1 143 ? 7.928  36.618 42.073  1.00 35.56 ? 302 ILE A CA  1 
ATOM   1041 C C   . ILE A 1 143 ? 8.940  35.804 42.880  1.00 37.45 ? 302 ILE A C   1 
ATOM   1042 O O   . ILE A 1 143 ? 9.405  34.785 42.461  1.00 38.60 ? 302 ILE A O   1 
ATOM   1043 C CB  . ILE A 1 143 ? 6.571  35.924 41.948  1.00 36.38 ? 302 ILE A CB  1 
ATOM   1044 C CG1 . ILE A 1 143 ? 5.534  36.881 41.323  1.00 35.07 ? 302 ILE A CG1 1 
ATOM   1045 C CG2 . ILE A 1 143 ? 6.021  35.542 43.309  1.00 36.93 ? 302 ILE A CG2 1 
ATOM   1046 C CD1 . ILE A 1 143 ? 4.370  36.214 40.896  1.00 36.49 ? 302 ILE A CD1 1 
ATOM   1047 N N   . VAL A 1 144 ? 9.368  36.298 44.007  1.00 40.51 ? 303 VAL A N   1 
ATOM   1048 C CA  . VAL A 1 144 ? 10.201 35.426 44.862  1.00 43.06 ? 303 VAL A CA  1 
ATOM   1049 C C   . VAL A 1 144 ? 9.300  34.287 45.458  1.00 43.51 ? 303 VAL A C   1 
ATOM   1050 O O   . VAL A 1 144 ? 8.332  34.560 46.246  1.00 41.66 ? 303 VAL A O   1 
ATOM   1051 C CB  . VAL A 1 144 ? 10.979 36.154 46.004  1.00 43.67 ? 303 VAL A CB  1 
ATOM   1052 C CG1 . VAL A 1 144 ? 11.124 37.636 45.780  1.00 40.80 ? 303 VAL A CG1 1 
ATOM   1053 C CG2 . VAL A 1 144 ? 10.337 35.883 47.402  1.00 47.16 ? 303 VAL A CG2 1 
ATOM   1054 N N   . GLU A 1 145 ? 9.585  33.053 45.024  1.00 45.19 ? 304 GLU A N   1 
ATOM   1055 C CA  . GLU A 1 145 ? 8.732  31.897 45.395  1.00 47.54 ? 304 GLU A CA  1 
ATOM   1056 C C   . GLU A 1 145 ? 8.616  31.751 46.902  1.00 49.27 ? 304 GLU A C   1 
ATOM   1057 O O   . GLU A 1 145 ? 7.519  31.579 47.443  1.00 48.34 ? 304 GLU A O   1 
ATOM   1058 C CB  . GLU A 1 145 ? 9.239  30.560 44.823  1.00 47.91 ? 304 GLU A CB  1 
ATOM   1059 C CG  . GLU A 1 145 ? 8.104  29.507 44.879  1.00 46.00 ? 304 GLU A CG  1 
ATOM   1060 C CD  . GLU A 1 145 ? 8.350  28.286 44.034  1.00 47.25 ? 304 GLU A CD  1 
ATOM   1061 O OE1 . GLU A 1 145 ? 9.571  28.034 43.655  1.00 46.06 ? 304 GLU A OE1 1 
ATOM   1062 O OE2 . GLU A 1 145 ? 7.321  27.546 43.802  1.00 45.92 ? 304 GLU A OE2 1 
ATOM   1063 N N   . THR A 1 146 ? 9.775  31.862 47.555  1.00 52.31 ? 305 THR A N   1 
ATOM   1064 C CA  . THR A 1 146 ? 9.876  32.042 49.030  1.00 55.15 ? 305 THR A CA  1 
ATOM   1065 C C   . THR A 1 146 ? 8.728  32.773 49.759  1.00 55.40 ? 305 THR A C   1 
ATOM   1066 O O   . THR A 1 146 ? 8.275  32.247 50.769  1.00 56.47 ? 305 THR A O   1 
ATOM   1067 C CB  . THR A 1 146 ? 11.204 32.737 49.344  1.00 56.39 ? 305 THR A CB  1 
ATOM   1068 O OG1 . THR A 1 146 ? 12.263 31.763 49.326  1.00 54.95 ? 305 THR A OG1 1 
ATOM   1069 C CG2 . THR A 1 146 ? 11.173 33.354 50.793  1.00 60.08 ? 305 THR A CG2 1 
ATOM   1070 N N   . THR A 1 147 ? 8.269  33.940 49.253  1.00 55.10 ? 306 THR A N   1 
ATOM   1071 C CA  . THR A 1 147 ? 7.248  34.816 49.893  1.00 54.86 ? 306 THR A CA  1 
ATOM   1072 C C   . THR A 1 147 ? 6.062  35.263 49.013  1.00 54.16 ? 306 THR A C   1 
ATOM   1073 O O   . THR A 1 147 ? 5.119  35.980 49.506  1.00 53.48 ? 306 THR A O   1 
ATOM   1074 C CB  . THR A 1 147 ? 7.877  36.174 50.373  1.00 55.70 ? 306 THR A CB  1 
ATOM   1075 O OG1 . THR A 1 147 ? 8.186  36.965 49.220  1.00 58.08 ? 306 THR A OG1 1 
ATOM   1076 C CG2 . THR A 1 147 ? 9.277  36.039 51.064  1.00 55.96 ? 306 THR A CG2 1 
ATOM   1077 N N   . GLY A 1 148 ? 6.076  34.924 47.721  1.00 51.83 ? 307 GLY A N   1 
ATOM   1078 C CA  . GLY A 1 148 ? 4.995  35.424 46.862  1.00 50.63 ? 307 GLY A CA  1 
ATOM   1079 C C   . GLY A 1 148 ? 5.066  36.887 46.561  1.00 47.76 ? 307 GLY A C   1 
ATOM   1080 O O   . GLY A 1 148 ? 4.162  37.451 45.907  1.00 47.87 ? 307 GLY A O   1 
ATOM   1081 N N   . MET A 1 149 ? 6.152  37.521 46.987  1.00 45.65 ? 308 MET A N   1 
ATOM   1082 C CA  . MET A 1 149 ? 6.310  38.956 46.732  1.00 45.73 ? 308 MET A CA  1 
ATOM   1083 C C   . MET A 1 149 ? 6.867  39.210 45.328  1.00 41.85 ? 308 MET A C   1 
ATOM   1084 O O   . MET A 1 149 ? 7.779  38.565 44.898  1.00 39.17 ? 308 MET A O   1 
ATOM   1085 C CB  . MET A 1 149 ? 7.278  39.592 47.741  1.00 47.75 ? 308 MET A CB  1 
ATOM   1086 C CG  . MET A 1 149 ? 6.750  40.965 48.295  1.00 55.25 ? 308 MET A CG  1 
ATOM   1087 S SD  . MET A 1 149 ? 5.508  40.895 49.796  1.00 62.19 ? 308 MET A SD  1 
ATOM   1088 C CE  . MET A 1 149 ? 4.314  39.591 49.249  1.00 60.98 ? 308 MET A CE  1 
ATOM   1089 N N   . THR A 1 150 ? 6.334  40.206 44.683  1.00 41.99 ? 309 THR A N   1 
ATOM   1090 C CA  . THR A 1 150 ? 6.774  40.621 43.344  1.00 42.12 ? 309 THR A CA  1 
ATOM   1091 C C   . THR A 1 150 ? 7.850  41.609 43.474  1.00 41.84 ? 309 THR A C   1 
ATOM   1092 O O   . THR A 1 150 ? 7.579  42.696 43.979  1.00 43.79 ? 309 THR A O   1 
ATOM   1093 C CB  . THR A 1 150 ? 5.632  41.250 42.488  1.00 42.98 ? 309 THR A CB  1 
ATOM   1094 O OG1 . THR A 1 150 ? 4.549  40.307 42.257  1.00 41.56 ? 309 THR A OG1 1 
ATOM   1095 C CG2 . THR A 1 150 ? 6.120  41.552 41.004  1.00 44.75 ? 309 THR A CG2 1 
ATOM   1096 N N   . CYS A 1 151 ? 9.038  41.296 42.944  1.00 40.32 ? 310 CYS A N   1 
ATOM   1097 C CA  . CYS A 1 151 ? 10.123 42.278 42.823  1.00 41.20 ? 310 CYS A CA  1 
ATOM   1098 C C   . CYS A 1 151 ? 10.541 42.734 41.386  1.00 38.71 ? 310 CYS A C   1 
ATOM   1099 O O   . CYS A 1 151 ? 10.280 42.042 40.357  1.00 33.30 ? 310 CYS A O   1 
ATOM   1100 C CB  . CYS A 1 151 ? 11.356 41.719 43.490  1.00 42.33 ? 310 CYS A CB  1 
ATOM   1101 S SG  . CYS A 1 151 ? 11.959 40.149 42.801  1.00 55.17 ? 310 CYS A SG  1 
ATOM   1102 N N   . GLN A 1 152 ? 11.199 43.893 41.348  1.00 35.30 ? 311 GLN A N   1 
ATOM   1103 C CA  . GLN A 1 152 ? 11.663 44.523 40.119  1.00 32.08 ? 311 GLN A CA  1 
ATOM   1104 C C   . GLN A 1 152 ? 13.113 44.938 40.261  1.00 32.29 ? 311 GLN A C   1 
ATOM   1105 O O   . GLN A 1 152 ? 13.414 45.772 41.156  1.00 32.29 ? 311 GLN A O   1 
ATOM   1106 C CB  . GLN A 1 152 ? 10.833 45.738 39.744  1.00 31.91 ? 311 GLN A CB  1 
ATOM   1107 C CG  . GLN A 1 152 ? 10.966 46.259 38.302  0.50 25.32 ? 311 GLN A CG  1 
ATOM   1108 C CD  . GLN A 1 152 ? 10.142 47.517 37.943  0.50 19.40 ? 311 GLN A CD  1 
ATOM   1109 O OE1 . GLN A 1 152 ? 10.602 48.645 38.141  0.50 19.69 ? 311 GLN A OE1 1 
ATOM   1110 N NE2 . GLN A 1 152 ? 9.007  47.335 37.328  0.50 14.95 ? 311 GLN A NE2 1 
ATOM   1111 N N   . ALA A 1 153 ? 13.985 44.523 39.294  1.00 28.98 ? 312 ALA A N   1 
ATOM   1112 C CA  . ALA A 1 153 ? 15.269 45.096 39.174  1.00 26.96 ? 312 ALA A CA  1 
ATOM   1113 C C   . ALA A 1 153 ? 15.481 45.772 37.788  1.00 26.29 ? 312 ALA A C   1 
ATOM   1114 O O   . ALA A 1 153 ? 14.872 45.387 36.796  1.00 25.05 ? 312 ALA A O   1 
ATOM   1115 C CB  . ALA A 1 153 ? 16.301 44.060 39.451  1.00 27.11 ? 312 ALA A CB  1 
ATOM   1116 N N   . ARG A 1 154 ? 16.296 46.833 37.751  1.00 23.95 ? 313 ARG A N   1 
ATOM   1117 C CA  . ARG A 1 154 ? 16.555 47.552 36.530  1.00 23.91 ? 313 ARG A CA  1 
ATOM   1118 C C   . ARG A 1 154 ? 17.986 47.860 36.271  1.00 22.90 ? 313 ARG A C   1 
ATOM   1119 O O   . ARG A 1 154 ? 18.708 48.008 37.243  1.00 23.58 ? 313 ARG A O   1 
ATOM   1120 C CB  . ARG A 1 154 ? 15.831 48.900 36.622  1.00 24.68 ? 313 ARG A CB  1 
ATOM   1121 C CG  . ARG A 1 154 ? 14.290 48.759 36.868  1.00 29.60 ? 313 ARG A CG  1 
ATOM   1122 C CD  . ARG A 1 154 ? 13.523 50.174 36.983  1.00 30.19 ? 313 ARG A CD  1 
ATOM   1123 N NE  . ARG A 1 154 ? 14.079 50.889 38.101  1.00 31.93 ? 313 ARG A NE  1 
ATOM   1124 C CZ  . ARG A 1 154 ? 13.859 50.600 39.393  1.00 35.99 ? 313 ARG A CZ  1 
ATOM   1125 N NH1 . ARG A 1 154 ? 13.037 49.667 39.779  1.00 39.87 ? 313 ARG A NH1 1 
ATOM   1126 N NH2 . ARG A 1 154 ? 14.529 51.217 40.352  1.00 44.09 ? 313 ARG A NH2 1 
ATOM   1127 N N   . THR A 1 155 ? 18.363 48.106 35.015  1.00 20.87 ? 314 THR A N   1 
ATOM   1128 C CA  . THR A 1 155 ? 19.635 48.729 34.721  1.00 20.86 ? 314 THR A CA  1 
ATOM   1129 C C   . THR A 1 155 ? 19.476 49.524 33.466  1.00 22.24 ? 314 THR A C   1 
ATOM   1130 O O   . THR A 1 155 ? 18.356 49.634 32.821  1.00 23.43 ? 314 THR A O   1 
ATOM   1131 C CB  . THR A 1 155 ? 20.741 47.682 34.615  1.00 21.13 ? 314 THR A CB  1 
ATOM   1132 O OG1 . THR A 1 155 ? 22.062 48.285 34.565  1.00 20.80 ? 314 THR A OG1 1 
ATOM   1133 C CG2 . THR A 1 155 ? 20.673 46.944 33.192  1.00 16.92 ? 314 THR A CG2 1 
ATOM   1134 N N   . SER A 1 156 ? 20.565 50.150 33.127  1.00 21.85 ? 315 SER A N   1 
ATOM   1135 C CA  . SER A 1 156 ? 20.635 51.023 32.025  1.00 22.47 ? 315 SER A CA  1 
ATOM   1136 C C   . SER A 1 156 ? 21.949 50.907 31.235  1.00 22.95 ? 315 SER A C   1 
ATOM   1137 O O   . SER A 1 156 ? 22.979 50.674 31.818  1.00 23.24 ? 315 SER A O   1 
ATOM   1138 C CB  . SER A 1 156 ? 20.509 52.471 32.572  1.00 23.97 ? 315 SER A CB  1 
ATOM   1139 O OG  . SER A 1 156 ? 20.991 53.419 31.682  1.00 20.96 ? 315 SER A OG  1 
ATOM   1140 N N   . TYR A 1 157 ? 21.845 51.012 29.900  1.00 21.39 ? 316 TYR A N   1 
ATOM   1141 C CA  . TYR A 1 157 ? 22.975 51.155 29.018  1.00 21.88 ? 316 TYR A CA  1 
ATOM   1142 C C   . TYR A 1 157 ? 22.866 52.472 28.215  1.00 23.26 ? 316 TYR A C   1 
ATOM   1143 O O   . TYR A 1 157 ? 22.066 52.601 27.356  1.00 23.20 ? 316 TYR A O   1 
ATOM   1144 C CB  . TYR A 1 157 ? 23.146 49.986 28.089  1.00 21.48 ? 316 TYR A CB  1 
ATOM   1145 C CG  . TYR A 1 157 ? 23.113 48.657 28.861  1.00 21.87 ? 316 TYR A CG  1 
ATOM   1146 C CD1 . TYR A 1 157 ? 21.962 47.896 28.963  1.00 21.17 ? 316 TYR A CD1 1 
ATOM   1147 C CD2 . TYR A 1 157 ? 24.277 48.162 29.505  1.00 20.34 ? 316 TYR A CD2 1 
ATOM   1148 C CE1 . TYR A 1 157 ? 21.955 46.645 29.640  1.00 20.93 ? 316 TYR A CE1 1 
ATOM   1149 C CE2 . TYR A 1 157 ? 24.275 46.940 30.134  1.00 20.39 ? 316 TYR A CE2 1 
ATOM   1150 C CZ  . TYR A 1 157 ? 23.118 46.182 30.253  1.00 19.50 ? 316 TYR A CZ  1 
ATOM   1151 O OH  . TYR A 1 157 ? 23.139 44.954 30.932  1.00 15.74 ? 316 TYR A OH  1 
ATOM   1152 N N   . THR A 1 158 ? 23.817 53.379 28.445  1.00 25.05 ? 317 THR A N   1 
ATOM   1153 C CA  . THR A 1 158 ? 23.965 54.494 27.548  1.00 28.42 ? 317 THR A CA  1 
ATOM   1154 C C   . THR A 1 158 ? 24.709 54.112 26.242  1.00 27.62 ? 317 THR A C   1 
ATOM   1155 O O   . THR A 1 158 ? 25.250 53.008 26.133  1.00 25.66 ? 317 THR A O   1 
ATOM   1156 C CB  . THR A 1 158 ? 24.644 55.697 28.256  1.00 28.16 ? 317 THR A CB  1 
ATOM   1157 O OG1 . THR A 1 158 ? 25.837 55.350 28.947  1.00 31.12 ? 317 THR A OG1 1 
ATOM   1158 C CG2 . THR A 1 158 ? 23.759 56.318 29.367  1.00 32.03 ? 317 THR A CG2 1 
ATOM   1159 N N   . GLU A 1 159 ? 24.639 54.998 25.238  1.00 25.67 ? 318 GLU A N   1 
ATOM   1160 C CA  . GLU A 1 159 ? 25.279 54.771 23.959  1.00 26.66 ? 318 GLU A CA  1 
ATOM   1161 C C   . GLU A 1 159 ? 26.787 54.346 24.152  1.00 27.51 ? 318 GLU A C   1 
ATOM   1162 O O   . GLU A 1 159 ? 27.227 53.457 23.422  1.00 30.50 ? 318 GLU A O   1 
ATOM   1163 C CB  . GLU A 1 159 ? 25.244 55.974 22.947  1.00 25.00 ? 318 GLU A CB  1 
ATOM   1164 C CG  . GLU A 1 159 ? 26.016 57.232 23.378  1.00 26.28 ? 318 GLU A CG  1 
ATOM   1165 C CD  . GLU A 1 159 ? 25.332 58.001 24.473  1.00 31.93 ? 318 GLU A CD  1 
ATOM   1166 O OE1 . GLU A 1 159 ? 26.050 58.707 25.205  1.00 40.88 ? 318 GLU A OE1 1 
ATOM   1167 O OE2 . GLU A 1 159 ? 24.063 57.832 24.737  1.00 34.00 ? 318 GLU A OE2 1 
ATOM   1168 N N   . ASP A 1 160 ? 27.498 54.886 25.137  1.00 28.25 ? 319 ASP A N   1 
ATOM   1169 C CA  . ASP A 1 160 ? 28.905 54.552 25.325  1.00 31.48 ? 319 ASP A CA  1 
ATOM   1170 C C   . ASP A 1 160 ? 29.090 53.204 26.096  1.00 30.72 ? 319 ASP A C   1 
ATOM   1171 O O   . ASP A 1 160 ? 30.245 52.743 26.272  1.00 28.21 ? 319 ASP A O   1 
ATOM   1172 C CB  . ASP A 1 160 ? 29.659 55.728 26.016  1.00 34.23 ? 319 ASP A CB  1 
ATOM   1173 C CG  . ASP A 1 160 ? 29.122 56.007 27.446  1.00 41.81 ? 319 ASP A CG  1 
ATOM   1174 O OD1 . ASP A 1 160 ? 27.915 55.801 27.694  1.00 56.72 ? 319 ASP A OD1 1 
ATOM   1175 O OD2 . ASP A 1 160 ? 29.784 56.496 28.364  1.00 53.90 ? 319 ASP A OD2 1 
ATOM   1176 N N   . GLU A 1 161 ? 27.960 52.578 26.551  1.00 25.76 ? 320 GLU A N   1 
ATOM   1177 C CA  . GLU A 1 161 ? 28.032 51.307 27.233  1.00 24.60 ? 320 GLU A CA  1 
ATOM   1178 C C   . GLU A 1 161 ? 27.502 50.195 26.363  1.00 22.99 ? 320 GLU A C   1 
ATOM   1179 O O   . GLU A 1 161 ? 27.367 49.049 26.814  1.00 23.95 ? 320 GLU A O   1 
ATOM   1180 C CB  . GLU A 1 161 ? 27.335 51.344 28.626  1.00 25.24 ? 320 GLU A CB  1 
ATOM   1181 C CG  . GLU A 1 161 ? 27.657 52.624 29.362  1.00 27.64 ? 320 GLU A CG  1 
ATOM   1182 C CD  . GLU A 1 161 ? 26.810 52.854 30.621  1.00 30.32 ? 320 GLU A CD  1 
ATOM   1183 O OE1 . GLU A 1 161 ? 25.659 52.332 30.703  1.00 27.78 ? 320 GLU A OE1 1 
ATOM   1184 O OE2 . GLU A 1 161 ? 27.298 53.577 31.515  1.00 28.32 ? 320 GLU A OE2 1 
ATOM   1185 N N   . VAL A 1 162 ? 27.295 50.481 25.102  1.00 21.89 ? 321 VAL A N   1 
ATOM   1186 C CA  . VAL A 1 162 ? 26.871 49.476 24.092  1.00 21.94 ? 321 VAL A CA  1 
ATOM   1187 C C   . VAL A 1 162 ? 28.042 49.319 23.176  1.00 24.26 ? 321 VAL A C   1 
ATOM   1188 O O   . VAL A 1 162 ? 28.470 50.365 22.622  1.00 26.16 ? 321 VAL A O   1 
ATOM   1189 C CB  . VAL A 1 162 ? 25.669 49.917 23.272  1.00 21.57 ? 321 VAL A CB  1 
ATOM   1190 C CG1 . VAL A 1 162 ? 25.297 48.909 22.279  1.00 22.89 ? 321 VAL A CG1 1 
ATOM   1191 C CG2 . VAL A 1 162 ? 24.456 50.116 24.239  1.00 26.63 ? 321 VAL A CG2 1 
ATOM   1192 N N   . LEU A 1 163 ? 28.598 48.099 23.032  1.00 22.01 ? 322 LEU A N   1 
ATOM   1193 C CA  . LEU A 1 163 ? 29.873 47.892 22.302  1.00 22.25 ? 322 LEU A CA  1 
ATOM   1194 C C   . LEU A 1 163 ? 29.688 47.212 20.985  1.00 22.67 ? 322 LEU A C   1 
ATOM   1195 O O   . LEU A 1 163 ? 29.349 46.005 20.839  1.00 19.59 ? 322 LEU A O   1 
ATOM   1196 C CB  . LEU A 1 163 ? 30.928 47.204 23.106  1.00 23.53 ? 322 LEU A CB  1 
ATOM   1197 C CG  . LEU A 1 163 ? 31.045 47.637 24.599  1.00 24.93 ? 322 LEU A CG  1 
ATOM   1198 C CD1 . LEU A 1 163 ? 31.812 46.610 25.303  1.00 22.87 ? 322 LEU A CD1 1 
ATOM   1199 C CD2 . LEU A 1 163 ? 31.674 49.043 24.869  1.00 27.41 ? 322 LEU A CD2 1 
ATOM   1200 N N   . TRP A 1 164 ? 29.879 48.023 19.949  1.00 20.71 ? 323 TRP A N   1 
ATOM   1201 C CA  . TRP A 1 164 ? 29.678 47.518 18.613  1.00 21.81 ? 323 TRP A CA  1 
ATOM   1202 C C   . TRP A 1 164 ? 30.772 46.483 18.333  1.00 24.82 ? 323 TRP A C   1 
ATOM   1203 O O   . TRP A 1 164 ? 31.916 46.664 18.750  1.00 24.44 ? 323 TRP A O   1 
ATOM   1204 C CB  . TRP A 1 164 ? 29.793 48.710 17.611  1.00 23.05 ? 323 TRP A CB  1 
ATOM   1205 C CG  . TRP A 1 164 ? 29.378 48.327 16.286  1.00 27.51 ? 323 TRP A CG  1 
ATOM   1206 C CD1 . TRP A 1 164 ? 30.086 47.633 15.356  1.00 27.67 ? 323 TRP A CD1 1 
ATOM   1207 C CD2 . TRP A 1 164 ? 28.100 48.536 15.745  1.00 28.05 ? 323 TRP A CD2 1 
ATOM   1208 N NE1 . TRP A 1 164 ? 29.306 47.365 14.262  1.00 27.89 ? 323 TRP A NE1 1 
ATOM   1209 C CE2 . TRP A 1 164 ? 28.082 47.961 14.471  1.00 30.24 ? 323 TRP A CE2 1 
ATOM   1210 C CE3 . TRP A 1 164 ? 26.950 49.179 16.206  1.00 28.92 ? 323 TRP A CE3 1 
ATOM   1211 C CZ2 . TRP A 1 164 ? 26.973 47.993 13.679  1.00 29.24 ? 323 TRP A CZ2 1 
ATOM   1212 C CZ3 . TRP A 1 164 ? 25.848 49.239 15.352  1.00 30.51 ? 323 TRP A CZ3 1 
ATOM   1213 C CH2 . TRP A 1 164 ? 25.866 48.644 14.153  1.00 29.10 ? 323 TRP A CH2 1 
ATOM   1214 N N   . GLY A 1 165 ? 30.469 45.415 17.635  1.00 23.47 ? 324 GLY A N   1 
ATOM   1215 C CA  . GLY A 1 165 ? 31.478 44.403 17.399  1.00 26.69 ? 324 GLY A CA  1 
ATOM   1216 C C   . GLY A 1 165 ? 32.124 43.618 18.566  1.00 27.03 ? 324 GLY A C   1 
ATOM   1217 O O   . GLY A 1 165 ? 33.252 43.083 18.360  1.00 27.68 ? 324 GLY A O   1 
ATOM   1218 N N   . HIS A 1 166 ? 31.441 43.566 19.729  1.00 25.58 ? 325 HIS A N   1 
ATOM   1219 C CA  . HIS A 1 166 ? 31.719 42.662 20.820  1.00 25.20 ? 325 HIS A CA  1 
ATOM   1220 C C   . HIS A 1 166 ? 30.740 41.485 21.012  1.00 22.75 ? 325 HIS A C   1 
ATOM   1221 O O   . HIS A 1 166 ? 29.591 41.521 20.517  1.00 25.12 ? 325 HIS A O   1 
ATOM   1222 C CB  . HIS A 1 166 ? 31.829 43.455 22.080  1.00 26.56 ? 325 HIS A CB  1 
ATOM   1223 C CG  . HIS A 1 166 ? 33.017 44.351 22.110  1.00 28.58 ? 325 HIS A CG  1 
ATOM   1224 N ND1 . HIS A 1 166 ? 33.890 44.343 23.172  1.00 30.82 ? 325 HIS A ND1 1 
ATOM   1225 C CD2 . HIS A 1 166 ? 33.427 45.353 21.272  1.00 30.83 ? 325 HIS A CD2 1 
ATOM   1226 C CE1 . HIS A 1 166 ? 34.834 45.259 22.960  1.00 34.02 ? 325 HIS A CE1 1 
ATOM   1227 N NE2 . HIS A 1 166 ? 34.551 45.909 21.835  1.00 32.74 ? 325 HIS A NE2 1 
ATOM   1228 N N   . ARG A 1 167 ? 31.265 40.437 21.625  1.00 19.14 ? 326 ARG A N   1 
ATOM   1229 C CA  . ARG A 1 167 ? 30.621 39.180 21.861  1.00 19.89 ? 326 ARG A CA  1 
ATOM   1230 C C   . ARG A 1 167 ? 30.876 38.809 23.328  1.00 20.50 ? 326 ARG A C   1 
ATOM   1231 O O   . ARG A 1 167 ? 32.000 38.966 23.816  1.00 20.34 ? 326 ARG A O   1 
ATOM   1232 C CB  . ARG A 1 167 ? 31.192 38.110 21.045  1.00 19.74 ? 326 ARG A CB  1 
ATOM   1233 C CG  . ARG A 1 167 ? 30.438 36.820 20.996  1.00 20.87 ? 326 ARG A CG  1 
ATOM   1234 C CD  . ARG A 1 167 ? 30.893 35.796 19.978  1.00 19.80 ? 326 ARG A CD  1 
ATOM   1235 N NE  . ARG A 1 167 ? 30.318 36.219 18.740  1.00 24.71 ? 326 ARG A NE  1 
ATOM   1236 C CZ  . ARG A 1 167 ? 30.812 35.895 17.520  1.00 28.77 ? 326 ARG A CZ  1 
ATOM   1237 N NH1 . ARG A 1 167 ? 31.725 35.019 17.424  1.00 27.25 ? 326 ARG A NH1 1 
ATOM   1238 N NH2 . ARG A 1 167 ? 30.241 36.372 16.411  1.00 33.73 ? 326 ARG A NH2 1 
ATOM   1239 N N   . PHE A 1 168 ? 29.869 38.334 24.031  1.00 19.79 ? 327 PHE A N   1 
ATOM   1240 C CA  . PHE A 1 168 ? 30.065 37.850 25.431  1.00 19.00 ? 327 PHE A CA  1 
ATOM   1241 C C   . PHE A 1 168 ? 30.848 36.534 25.457  1.00 20.19 ? 327 PHE A C   1 
ATOM   1242 O O   . PHE A 1 168 ? 30.711 35.740 24.497  1.00 21.07 ? 327 PHE A O   1 
ATOM   1243 C CB  . PHE A 1 168 ? 28.746 37.635 26.130  1.00 19.08 ? 327 PHE A CB  1 
ATOM   1244 C CG  . PHE A 1 168 ? 28.149 38.907 26.616  1.00 20.53 ? 327 PHE A CG  1 
ATOM   1245 C CD1 . PHE A 1 168 ? 27.094 39.524 25.908  1.00 23.75 ? 327 PHE A CD1 1 
ATOM   1246 C CD2 . PHE A 1 168 ? 28.673 39.578 27.701  1.00 18.50 ? 327 PHE A CD2 1 
ATOM   1247 C CE1 . PHE A 1 168 ? 26.604 40.729 26.316  1.00 20.07 ? 327 PHE A CE1 1 
ATOM   1248 C CE2 . PHE A 1 168 ? 28.143 40.762 28.134  1.00 24.42 ? 327 PHE A CE2 1 
ATOM   1249 C CZ  . PHE A 1 168 ? 27.123 41.355 27.465  1.00 20.43 ? 327 PHE A CZ  1 
ATOM   1250 N N   . PHE A 1 169 ? 31.779 36.367 26.404  1.00 17.93 ? 328 PHE A N   1 
ATOM   1251 C CA  . PHE A 1 169 ? 32.304 35.025 26.683  1.00 21.84 ? 328 PHE A CA  1 
ATOM   1252 C C   . PHE A 1 169 ? 31.165 34.129 27.303  1.00 23.34 ? 328 PHE A C   1 
ATOM   1253 O O   . PHE A 1 169 ? 30.316 34.643 28.008  1.00 21.61 ? 328 PHE A O   1 
ATOM   1254 C CB  . PHE A 1 169 ? 33.443 35.117 27.722  1.00 21.86 ? 328 PHE A CB  1 
ATOM   1255 C CG  . PHE A 1 169 ? 34.774 35.620 27.149  1.00 21.28 ? 328 PHE A CG  1 
ATOM   1256 C CD1 . PHE A 1 169 ? 35.120 36.967 27.211  1.00 25.15 ? 328 PHE A CD1 1 
ATOM   1257 C CD2 . PHE A 1 169 ? 35.663 34.740 26.555  1.00 24.96 ? 328 PHE A CD2 1 
ATOM   1258 C CE1 . PHE A 1 169 ? 36.357 37.433 26.688  1.00 27.41 ? 328 PHE A CE1 1 
ATOM   1259 C CE2 . PHE A 1 169 ? 36.899 35.211 25.975  1.00 25.80 ? 328 PHE A CE2 1 
ATOM   1260 C CZ  . PHE A 1 169 ? 37.290 36.505 26.132  1.00 22.19 ? 328 PHE A CZ  1 
ATOM   1261 N N   . PRO A 1 170 ? 31.278 32.820 27.170  1.00 23.37 ? 329 PRO A N   1 
ATOM   1262 C CA  . PRO A 1 170 ? 30.400 31.873 27.833  1.00 24.20 ? 329 PRO A CA  1 
ATOM   1263 C C   . PRO A 1 170 ? 30.781 31.790 29.324  1.00 26.55 ? 329 PRO A C   1 
ATOM   1264 O O   . PRO A 1 170 ? 31.977 31.966 29.688  1.00 24.72 ? 329 PRO A O   1 
ATOM   1265 C CB  . PRO A 1 170 ? 30.750 30.529 27.098  1.00 23.89 ? 329 PRO A CB  1 
ATOM   1266 C CG  . PRO A 1 170 ? 32.153 30.686 26.759  1.00 24.12 ? 329 PRO A CG  1 
ATOM   1267 C CD  . PRO A 1 170 ? 32.208 32.105 26.238  1.00 25.65 ? 329 PRO A CD  1 
ATOM   1268 N N   . VAL A 1 171 ? 29.779 31.653 30.195  1.00 25.09 ? 330 VAL A N   1 
ATOM   1269 C CA  . VAL A 1 171 ? 29.988 31.554 31.580  1.00 26.23 ? 330 VAL A CA  1 
ATOM   1270 C C   . VAL A 1 171 ? 29.663 30.143 32.109  1.00 28.08 ? 330 VAL A C   1 
ATOM   1271 O O   . VAL A 1 171 ? 29.930 29.843 33.279  1.00 26.59 ? 330 VAL A O   1 
ATOM   1272 C CB  . VAL A 1 171 ? 29.182 32.619 32.387  1.00 27.39 ? 330 VAL A CB  1 
ATOM   1273 C CG1 . VAL A 1 171 ? 29.761 33.969 32.165  1.00 33.15 ? 330 VAL A CG1 1 
ATOM   1274 C CG2 . VAL A 1 171 ? 27.668 32.538 32.123  1.00 27.49 ? 330 VAL A CG2 1 
ATOM   1275 N N   . ILE A 1 172 ? 29.157 29.227 31.292  1.00 31.17 ? 331 ILE A N   1 
ATOM   1276 C CA  . ILE A 1 172 ? 28.753 27.863 31.788  1.00 32.59 ? 331 ILE A CA  1 
ATOM   1277 C C   . ILE A 1 172 ? 29.675 26.827 31.230  1.00 35.02 ? 331 ILE A C   1 
ATOM   1278 O O   . ILE A 1 172 ? 29.973 26.849 30.082  1.00 35.07 ? 331 ILE A O   1 
ATOM   1279 C CB  . ILE A 1 172 ? 27.355 27.454 31.257  1.00 33.36 ? 331 ILE A CB  1 
ATOM   1280 C CG1 . ILE A 1 172 ? 26.270 28.415 31.701  1.00 34.86 ? 331 ILE A CG1 1 
ATOM   1281 C CG2 . ILE A 1 172 ? 26.970 26.019 31.716  1.00 37.45 ? 331 ILE A CG2 1 
ATOM   1282 N N   . SER A 1 173 ? 30.135 25.913 32.048  1.00 38.45 ? 332 SER A N   1 
ATOM   1283 C CA  . SER A 1 173 ? 30.843 24.741 31.558  1.00 41.26 ? 332 SER A CA  1 
ATOM   1284 C C   . SER A 1 173 ? 30.363 23.444 32.238  1.00 44.32 ? 332 SER A C   1 
ATOM   1285 O O   . SER A 1 173 ? 29.826 23.477 33.389  1.00 41.57 ? 332 SER A O   1 
ATOM   1286 C CB  . SER A 1 173 ? 32.366 24.886 31.792  1.00 41.98 ? 332 SER A CB  1 
ATOM   1287 O OG  . SER A 1 173 ? 32.636 25.239 33.113  1.00 36.98 ? 332 SER A OG  1 
ATOM   1288 N N   . LEU A 1 174 ? 30.614 22.323 31.551  1.00 48.98 ? 333 LEU A N   1 
ATOM   1289 C CA  . LEU A 1 174 ? 30.447 20.977 32.175  1.00 53.39 ? 333 LEU A CA  1 
ATOM   1290 C C   . LEU A 1 174 ? 31.676 20.426 32.982  1.00 55.78 ? 333 LEU A C   1 
ATOM   1291 O O   . LEU A 1 174 ? 32.813 20.283 32.502  1.00 56.33 ? 333 LEU A O   1 
ATOM   1292 C CB  . LEU A 1 174 ? 29.942 19.939 31.166  1.00 53.70 ? 333 LEU A CB  1 
ATOM   1293 C CG  . LEU A 1 174 ? 29.535 18.517 31.720  1.00 54.77 ? 333 LEU A CG  1 
ATOM   1294 C CD1 . LEU A 1 174 ? 28.626 18.441 32.909  1.00 53.16 ? 333 LEU A CD1 1 
ATOM   1295 C CD2 . LEU A 1 174 ? 28.850 17.744 30.591  1.00 58.38 ? 333 LEU A CD2 1 
ATOM   1296 N N   . GLU A 1 175 ? 31.390 20.129 34.232  1.00 59.21 ? 334 GLU A N   1 
ATOM   1297 C CA  . GLU A 1 175 ? 32.355 19.559 35.165  1.00 62.80 ? 334 GLU A CA  1 
ATOM   1298 C C   . GLU A 1 175 ? 31.679 18.627 36.192  1.00 64.16 ? 334 GLU A C   1 
ATOM   1299 O O   . GLU A 1 175 ? 30.984 19.128 37.117  1.00 65.40 ? 334 GLU A O   1 
ATOM   1300 C CB  . GLU A 1 175 ? 32.966 20.707 35.960  1.00 63.90 ? 334 GLU A CB  1 
ATOM   1301 C CG  . GLU A 1 175 ? 34.460 20.956 35.781  1.00 66.43 ? 334 GLU A CG  1 
ATOM   1302 C CD  . GLU A 1 175 ? 34.797 22.349 36.264  1.00 70.74 ? 334 GLU A CD  1 
ATOM   1303 O OE1 . GLU A 1 175 ? 35.631 22.468 37.211  1.00 73.04 ? 334 GLU A OE1 1 
ATOM   1304 O OE2 . GLU A 1 175 ? 34.176 23.316 35.726  1.00 70.16 ? 334 GLU A OE2 1 
ATOM   1305 N N   . GLU A 1 176 ? 31.904 17.311 36.053  1.00 64.90 ? 335 GLU A N   1 
ATOM   1306 C CA  . GLU A 1 176 ? 31.584 16.297 37.089  1.00 64.69 ? 335 GLU A CA  1 
ATOM   1307 C C   . GLU A 1 176 ? 30.199 16.368 37.736  1.00 63.48 ? 335 GLU A C   1 
ATOM   1308 O O   . GLU A 1 176 ? 30.098 16.639 38.941  1.00 63.68 ? 335 GLU A O   1 
ATOM   1309 C CB  . GLU A 1 176 ? 32.634 16.267 38.234  1.00 65.73 ? 335 GLU A CB  1 
ATOM   1310 C CG  . GLU A 1 176 ? 33.799 17.276 38.172  1.00 69.65 ? 335 GLU A CG  1 
ATOM   1311 C CD  . GLU A 1 176 ? 34.223 17.801 39.553  1.00 73.71 ? 335 GLU A CD  1 
ATOM   1312 O OE1 . GLU A 1 176 ? 35.104 17.139 40.199  1.00 75.99 ? 335 GLU A OE1 1 
ATOM   1313 O OE2 . GLU A 1 176 ? 33.673 18.860 39.985  1.00 73.52 ? 335 GLU A OE2 1 
ATOM   1314 N N   . GLY A 1 177 ? 29.137 16.116 36.970  1.00 61.42 ? 336 GLY A N   1 
ATOM   1315 C CA  . GLY A 1 177 ? 27.830 15.972 37.590  1.00 60.29 ? 336 GLY A CA  1 
ATOM   1316 C C   . GLY A 1 177 ? 27.112 17.282 37.900  1.00 59.26 ? 336 GLY A C   1 
ATOM   1317 O O   . GLY A 1 177 ? 26.027 17.287 38.495  1.00 60.15 ? 336 GLY A O   1 
ATOM   1318 N N   . PHE A 1 178 ? 27.683 18.410 37.475  1.00 57.70 ? 337 PHE A N   1 
ATOM   1319 C CA  . PHE A 1 178 ? 26.959 19.700 37.524  1.00 55.50 ? 337 PHE A CA  1 
ATOM   1320 C C   . PHE A 1 178 ? 27.546 20.678 36.480  1.00 51.38 ? 337 PHE A C   1 
ATOM   1321 O O   . PHE A 1 178 ? 28.678 20.524 35.949  1.00 48.81 ? 337 PHE A O   1 
ATOM   1322 C CB  . PHE A 1 178 ? 27.031 20.325 38.946  1.00 56.75 ? 337 PHE A CB  1 
ATOM   1323 C CG  . PHE A 1 178 ? 28.450 20.614 39.361  1.00 63.16 ? 337 PHE A CG  1 
ATOM   1324 C CD1 . PHE A 1 178 ? 29.037 21.867 39.089  1.00 68.70 ? 337 PHE A CD1 1 
ATOM   1325 C CD2 . PHE A 1 178 ? 29.258 19.590 39.878  1.00 68.45 ? 337 PHE A CD2 1 
ATOM   1326 C CE1 . PHE A 1 178 ? 30.406 22.119 39.401  1.00 70.80 ? 337 PHE A CE1 1 
ATOM   1327 C CE2 . PHE A 1 178 ? 30.634 19.839 40.185  1.00 70.82 ? 337 PHE A CE2 1 
ATOM   1328 C CZ  . PHE A 1 178 ? 31.195 21.116 39.948  1.00 70.40 ? 337 PHE A CZ  1 
ATOM   1329 N N   . PHE A 1 179 ? 26.747 21.715 36.237  1.00 46.59 ? 338 PHE A N   1 
ATOM   1330 C CA  . PHE A 1 179 ? 27.079 22.723 35.253  1.00 43.93 ? 338 PHE A CA  1 
ATOM   1331 C C   . PHE A 1 179 ? 27.550 23.844 36.123  1.00 42.18 ? 338 PHE A C   1 
ATOM   1332 O O   . PHE A 1 179 ? 26.865 24.271 37.063  1.00 43.23 ? 338 PHE A O   1 
ATOM   1333 C CB  . PHE A 1 179 ? 25.839 23.124 34.427  1.00 44.40 ? 338 PHE A CB  1 
ATOM   1334 C CG  . PHE A 1 179 ? 25.486 22.150 33.376  1.00 42.07 ? 338 PHE A CG  1 
ATOM   1335 C CD1 . PHE A 1 179 ? 24.673 21.063 33.675  1.00 43.09 ? 338 PHE A CD1 1 
ATOM   1336 C CD2 . PHE A 1 179 ? 26.039 22.275 32.081  1.00 46.43 ? 338 PHE A CD2 1 
ATOM   1337 C CE1 . PHE A 1 179 ? 24.324 20.093 32.686  1.00 41.74 ? 338 PHE A CE1 1 
ATOM   1338 C CE2 . PHE A 1 179 ? 25.703 21.354 31.109  1.00 48.92 ? 338 PHE A CE2 1 
ATOM   1339 C CZ  . PHE A 1 179 ? 24.831 20.255 31.418  1.00 48.29 ? 338 PHE A CZ  1 
ATOM   1340 N N   . LYS A 1 180 ? 28.757 24.305 35.854  1.00 38.94 ? 339 LYS A N   1 
ATOM   1341 C CA  . LYS A 1 180 ? 29.326 25.350 36.678  1.00 36.10 ? 339 LYS A CA  1 
ATOM   1342 C C   . LYS A 1 180 ? 29.234 26.687 35.971  1.00 31.91 ? 339 LYS A C   1 
ATOM   1343 O O   . LYS A 1 180 ? 29.464 26.755 34.812  1.00 26.97 ? 339 LYS A O   1 
ATOM   1344 C CB  . LYS A 1 180 ? 30.819 25.043 37.002  1.00 37.58 ? 339 LYS A CB  1 
ATOM   1345 C CG  . LYS A 1 180 ? 31.382 26.113 38.083  1.00 46.76 ? 339 LYS A CG  1 
ATOM   1346 C CD  . LYS A 1 180 ? 32.504 25.648 39.130  1.00 56.81 ? 339 LYS A CD  1 
ATOM   1347 C CE  . LYS A 1 180 ? 34.028 25.757 38.575  1.00 61.65 ? 339 LYS A CE  1 
ATOM   1348 N NZ  . LYS A 1 180 ? 35.213 25.545 39.637  1.00 62.46 ? 339 LYS A NZ  1 
ATOM   1349 N N   . VAL A 1 181 ? 28.877 27.716 36.715  1.00 30.08 ? 340 VAL A N   1 
ATOM   1350 C CA  . VAL A 1 181 ? 28.787 29.087 36.219  1.00 28.79 ? 340 VAL A CA  1 
ATOM   1351 C C   . VAL A 1 181 ? 30.027 29.841 36.796  1.00 28.21 ? 340 VAL A C   1 
ATOM   1352 O O   . VAL A 1 181 ? 30.187 29.943 38.000  1.00 29.43 ? 340 VAL A O   1 
ATOM   1353 C CB  . VAL A 1 181 ? 27.517 29.834 36.697  1.00 29.17 ? 340 VAL A CB  1 
ATOM   1354 C CG1 . VAL A 1 181 ? 27.604 31.266 36.233  1.00 26.27 ? 340 VAL A CG1 1 
ATOM   1355 C CG2 . VAL A 1 181 ? 26.099 29.133 36.291  1.00 26.24 ? 340 VAL A CG2 1 
ATOM   1356 N N   . ASP A 1 182 ? 30.847 30.346 35.935  1.00 26.63 ? 341 ASP A N   1 
ATOM   1357 C CA  . ASP A 1 182 ? 32.021 31.176 36.262  1.00 27.35 ? 341 ASP A CA  1 
ATOM   1358 C C   . ASP A 1 182 ? 31.690 32.664 36.216  1.00 25.99 ? 341 ASP A C   1 
ATOM   1359 O O   . ASP A 1 182 ? 31.686 33.309 35.197  1.00 25.25 ? 341 ASP A O   1 
ATOM   1360 C CB  . ASP A 1 182 ? 33.134 30.805 35.291  1.00 27.21 ? 341 ASP A CB  1 
ATOM   1361 C CG  . ASP A 1 182 ? 34.421 31.527 35.586  1.00 32.41 ? 341 ASP A CG  1 
ATOM   1362 O OD1 . ASP A 1 182 ? 34.481 32.369 36.498  1.00 24.53 ? 341 ASP A OD1 1 
ATOM   1363 O OD2 . ASP A 1 182 ? 35.370 31.387 34.839  1.00 33.56 ? 341 ASP A OD2 1 
ATOM   1364 N N   . TYR A 1 183 ? 31.328 33.208 37.359  1.00 26.68 ? 342 TYR A N   1 
ATOM   1365 C CA  . TYR A 1 183 ? 31.012 34.603 37.476  1.00 28.20 ? 342 TYR A CA  1 
ATOM   1366 C C   . TYR A 1 183 ? 32.128 35.562 37.252  1.00 29.85 ? 342 TYR A C   1 
ATOM   1367 O O   . TYR A 1 183 ? 31.855 36.695 36.847  1.00 30.95 ? 342 TYR A O   1 
ATOM   1368 C CB  . TYR A 1 183 ? 30.307 34.874 38.769  1.00 30.56 ? 342 TYR A CB  1 
ATOM   1369 C CG  . TYR A 1 183 ? 28.930 34.281 38.772  1.00 30.29 ? 342 TYR A CG  1 
ATOM   1370 C CD1 . TYR A 1 183 ? 28.694 32.977 39.195  1.00 33.50 ? 342 TYR A CD1 1 
ATOM   1371 C CD2 . TYR A 1 183 ? 27.831 35.047 38.333  1.00 35.70 ? 342 TYR A CD2 1 
ATOM   1372 C CE1 . TYR A 1 183 ? 27.387 32.423 39.169  1.00 35.14 ? 342 TYR A CE1 1 
ATOM   1373 C CE2 . TYR A 1 183 ? 26.502 34.526 38.380  1.00 30.56 ? 342 TYR A CE2 1 
ATOM   1374 C CZ  . TYR A 1 183 ? 26.294 33.216 38.789  1.00 33.15 ? 342 TYR A CZ  1 
ATOM   1375 O OH  . TYR A 1 183 ? 25.031 32.680 38.801  1.00 32.28 ? 342 TYR A OH  1 
ATOM   1376 N N   . SER A 1 184 ? 33.378 35.118 37.303  1.00 30.37 ? 343 SER A N   1 
ATOM   1377 C CA  . SER A 1 184 ? 34.505 35.976 36.756  1.00 29.34 ? 343 SER A CA  1 
ATOM   1378 C C   . SER A 1 184 ? 34.393 36.366 35.268  1.00 26.79 ? 343 SER A C   1 
ATOM   1379 O O   . SER A 1 184 ? 34.977 37.296 34.831  1.00 25.85 ? 343 SER A O   1 
ATOM   1380 C CB  . SER A 1 184 ? 35.949 35.269 37.025  1.00 29.97 ? 343 SER A CB  1 
ATOM   1381 O OG  . SER A 1 184 ? 36.295 34.265 36.106  1.00 30.10 ? 343 SER A OG  1 
ATOM   1382 N N   . GLN A 1 185 ? 33.688 35.615 34.468  1.00 25.02 ? 344 GLN A N   1 
ATOM   1383 C CA  . GLN A 1 185 ? 33.524 35.960 33.093  1.00 25.93 ? 344 GLN A CA  1 
ATOM   1384 C C   . GLN A 1 185 ? 32.148 36.684 32.738  1.00 24.66 ? 344 GLN A C   1 
ATOM   1385 O O   . GLN A 1 185 ? 31.797 36.829 31.540  1.00 24.13 ? 344 GLN A O   1 
ATOM   1386 C CB  . GLN A 1 185 ? 33.507 34.659 32.310  1.00 25.86 ? 344 GLN A CB  1 
ATOM   1387 C CG  . GLN A 1 185 ? 34.741 33.818 32.276  1.00 35.93 ? 344 GLN A CG  1 
ATOM   1388 C CD  . GLN A 1 185 ? 35.830 34.468 31.520  1.00 39.30 ? 344 GLN A CD  1 
ATOM   1389 O OE1 . GLN A 1 185 ? 36.108 34.072 30.420  1.00 44.33 ? 344 GLN A OE1 1 
ATOM   1390 N NE2 . GLN A 1 185 ? 36.429 35.512 32.098  1.00 44.04 ? 344 GLN A NE2 1 
ATOM   1391 N N   . PHE A 1 186 ? 31.370 36.949 33.742  1.00 24.12 ? 345 PHE A N   1 
ATOM   1392 C CA  . PHE A 1 186 ? 29.978 37.486 33.579  1.00 23.49 ? 345 PHE A CA  1 
ATOM   1393 C C   . PHE A 1 186 ? 29.926 38.770 32.727  1.00 22.16 ? 345 PHE A C   1 
ATOM   1394 O O   . PHE A 1 186 ? 28.997 38.936 31.934  1.00 22.18 ? 345 PHE A O   1 
ATOM   1395 C CB  . PHE A 1 186 ? 29.390 37.760 34.934  1.00 23.28 ? 345 PHE A CB  1 
ATOM   1396 C CG  . PHE A 1 186 ? 27.861 38.096 34.935  1.00 23.77 ? 345 PHE A CG  1 
ATOM   1397 C CD1 . PHE A 1 186 ? 26.910 37.084 35.046  1.00 21.22 ? 345 PHE A CD1 1 
ATOM   1398 C CD2 . PHE A 1 186 ? 27.428 39.386 34.787  1.00 26.91 ? 345 PHE A CD2 1 
ATOM   1399 C CE1 . PHE A 1 186 ? 25.495 37.420 34.994  1.00 24.21 ? 345 PHE A CE1 1 
ATOM   1400 C CE2 . PHE A 1 186 ? 26.069 39.705 34.759  1.00 26.59 ? 345 PHE A CE2 1 
ATOM   1401 C CZ  . PHE A 1 186 ? 25.121 38.710 34.855  1.00 24.12 ? 345 PHE A CZ  1 
ATOM   1402 N N   . HIS A 1 187 ? 30.811 39.695 32.996  1.00 19.81 ? 346 HIS A N   1 
ATOM   1403 C CA  . HIS A 1 187 ? 30.859 40.973 32.333  1.00 20.97 ? 346 HIS A CA  1 
ATOM   1404 C C   . HIS A 1 187 ? 31.757 40.971 31.142  1.00 20.94 ? 346 HIS A C   1 
ATOM   1405 O O   . HIS A 1 187 ? 31.841 41.930 30.456  1.00 19.90 ? 346 HIS A O   1 
ATOM   1406 C CB  . HIS A 1 187 ? 31.334 42.027 33.336  1.00 21.04 ? 346 HIS A CB  1 
ATOM   1407 C CG  . HIS A 1 187 ? 30.428 42.177 34.508  1.00 23.56 ? 346 HIS A CG  1 
ATOM   1408 N ND1 . HIS A 1 187 ? 29.212 42.851 34.388  1.00 21.22 ? 346 HIS A ND1 1 
ATOM   1409 C CD2 . HIS A 1 187 ? 30.531 41.760 35.814  1.00 22.25 ? 346 HIS A CD2 1 
ATOM   1410 C CE1 . HIS A 1 187 ? 28.628 42.856 35.577  1.00 27.25 ? 346 HIS A CE1 1 
ATOM   1411 N NE2 . HIS A 1 187 ? 29.359 42.145 36.434  1.00 22.85 ? 346 HIS A NE2 1 
ATOM   1412 N N   . ALA A 1 188 ? 32.524 39.902 30.918  1.00 22.64 ? 347 ALA A N   1 
ATOM   1413 C CA  . ALA A 1 188 ? 33.671 39.950 29.957  1.00 21.71 ? 347 ALA A CA  1 
ATOM   1414 C C   . ALA A 1 188 ? 33.167 39.827 28.535  1.00 20.41 ? 347 ALA A C   1 
ATOM   1415 O O   . ALA A 1 188 ? 32.324 39.022 28.249  1.00 23.14 ? 347 ALA A O   1 
ATOM   1416 C CB  . ALA A 1 188 ? 34.683 38.727 30.293  1.00 21.31 ? 347 ALA A CB  1 
ATOM   1417 N N   . THR A 1 189 ? 33.699 40.607 27.633  1.00 21.29 ? 348 THR A N   1 
ATOM   1418 C CA  . THR A 1 189 ? 33.439 40.554 26.171  1.00 21.52 ? 348 THR A CA  1 
ATOM   1419 C C   . THR A 1 189 ? 34.710 40.595 25.390  1.00 22.92 ? 348 THR A C   1 
ATOM   1420 O O   . THR A 1 189 ? 35.743 40.939 25.915  1.00 21.24 ? 348 THR A O   1 
ATOM   1421 C CB  . THR A 1 189 ? 32.618 41.781 25.732  1.00 20.34 ? 348 THR A CB  1 
ATOM   1422 O OG1 . THR A 1 189 ? 33.316 43.051 25.928  1.00 21.60 ? 348 THR A OG1 1 
ATOM   1423 C CG2 . THR A 1 189 ? 31.346 41.992 26.589  1.00 24.42 ? 348 THR A CG2 1 
ATOM   1424 N N   . PHE A 1 190 ? 34.619 40.285 24.117  1.00 24.33 ? 349 PHE A N   1 
ATOM   1425 C CA  . PHE A 1 190 ? 35.789 40.433 23.240  1.00 24.18 ? 349 PHE A CA  1 
ATOM   1426 C C   . PHE A 1 190 ? 35.286 40.875 21.933  1.00 25.51 ? 349 PHE A C   1 
ATOM   1427 O O   . PHE A 1 190 ? 34.095 40.637 21.553  1.00 23.47 ? 349 PHE A O   1 
ATOM   1428 C CB  . PHE A 1 190 ? 36.631 39.124 23.122  1.00 21.91 ? 349 PHE A CB  1 
ATOM   1429 C CG  . PHE A 1 190 ? 35.876 37.920 22.575  1.00 21.57 ? 349 PHE A CG  1 
ATOM   1430 C CD1 . PHE A 1 190 ? 36.101 37.480 21.254  1.00 24.87 ? 349 PHE A CD1 1 
ATOM   1431 C CD2 . PHE A 1 190 ? 34.974 37.216 23.319  1.00 20.33 ? 349 PHE A CD2 1 
ATOM   1432 C CE1 . PHE A 1 190 ? 35.411 36.369 20.696  1.00 26.05 ? 349 PHE A CE1 1 
ATOM   1433 C CE2 . PHE A 1 190 ? 34.360 36.140 22.803  1.00 27.77 ? 349 PHE A CE2 1 
ATOM   1434 C CZ  . PHE A 1 190 ? 34.525 35.738 21.431  1.00 24.53 ? 349 PHE A CZ  1 
ATOM   1435 N N   . GLU A 1 191 ? 36.217 41.467 21.188  1.00 25.87 ? 350 GLU A N   1 
ATOM   1436 C CA  . GLU A 1 191 ? 35.990 41.905 19.841  1.00 25.21 ? 350 GLU A CA  1 
ATOM   1437 C C   . GLU A 1 191 ? 36.045 40.794 18.889  1.00 27.26 ? 350 GLU A C   1 
ATOM   1438 O O   . GLU A 1 191 ? 36.863 39.846 19.018  1.00 27.19 ? 350 GLU A O   1 
ATOM   1439 C CB  . GLU A 1 191 ? 37.062 42.946 19.421  1.00 27.06 ? 350 GLU A CB  1 
ATOM   1440 C CG  . GLU A 1 191 ? 37.348 44.062 20.408  1.00 30.64 ? 350 GLU A CG  1 
ATOM   1441 C CD  . GLU A 1 191 ? 38.519 44.929 19.883  1.00 41.37 ? 350 GLU A CD  1 
ATOM   1442 O OE1 . GLU A 1 191 ? 38.413 46.133 20.047  1.00 43.11 ? 350 GLU A OE1 1 
ATOM   1443 O OE2 . GLU A 1 191 ? 39.545 44.391 19.313  1.00 47.36 ? 350 GLU A OE2 1 
ATOM   1444 N N   . VAL A 1 192 ? 35.069 40.857 17.982  1.00 27.07 ? 351 VAL A N   1 
ATOM   1445 C CA  . VAL A 1 192 ? 34.911 39.935 16.898  1.00 28.05 ? 351 VAL A CA  1 
ATOM   1446 C C   . VAL A 1 192 ? 34.663 40.729 15.645  1.00 28.83 ? 351 VAL A C   1 
ATOM   1447 O O   . VAL A 1 192 ? 34.071 41.789 15.701  1.00 29.20 ? 351 VAL A O   1 
ATOM   1448 C CB  . VAL A 1 192 ? 33.749 38.934 17.061  1.00 27.31 ? 351 VAL A CB  1 
ATOM   1449 C CG1 . VAL A 1 192 ? 34.122 37.921 18.134  1.00 28.67 ? 351 VAL A CG1 1 
ATOM   1450 C CG2 . VAL A 1 192 ? 32.367 39.622 17.300  1.00 28.74 ? 351 VAL A CG2 1 
ATOM   1451 N N   . PRO A 1 193 ? 35.122 40.239 14.495  1.00 32.70 ? 352 PRO A N   1 
ATOM   1452 C CA  . PRO A 1 193 ? 34.865 40.936 13.227  1.00 32.25 ? 352 PRO A CA  1 
ATOM   1453 C C   . PRO A 1 193 ? 33.389 41.104 12.912  1.00 31.83 ? 352 PRO A C   1 
ATOM   1454 O O   . PRO A 1 193 ? 32.715 40.095 12.780  1.00 28.71 ? 352 PRO A O   1 
ATOM   1455 C CB  . PRO A 1 193 ? 35.481 39.997 12.175  1.00 33.25 ? 352 PRO A CB  1 
ATOM   1456 C CG  . PRO A 1 193 ? 36.618 39.376 12.916  1.00 35.34 ? 352 PRO A CG  1 
ATOM   1457 C CD  . PRO A 1 193 ? 35.922 39.001 14.271  1.00 33.80 ? 352 PRO A CD  1 
ATOM   1458 N N   . THR A 1 194 ? 32.944 42.344 12.695  1.00 33.05 ? 353 THR A N   1 
ATOM   1459 C CA  . THR A 1 194 ? 31.522 42.667 12.528  1.00 35.06 ? 353 THR A CA  1 
ATOM   1460 C C   . THR A 1 194 ? 31.340 43.832 11.560  1.00 35.98 ? 353 THR A C   1 
ATOM   1461 O O   . THR A 1 194 ? 31.993 44.865 11.733  1.00 35.21 ? 353 THR A O   1 
ATOM   1462 C CB  . THR A 1 194 ? 30.987 43.127 13.921  1.00 35.97 ? 353 THR A CB  1 
ATOM   1463 O OG1 . THR A 1 194 ? 31.150 42.062 14.842  1.00 32.62 ? 353 THR A OG1 1 
ATOM   1464 C CG2 . THR A 1 194 ? 29.522 43.537 13.853  1.00 32.89 ? 353 THR A CG2 1 
ATOM   1465 N N   . PRO A 1 195 ? 30.444 43.694 10.586  1.00 37.56 ? 354 PRO A N   1 
ATOM   1466 C CA  . PRO A 1 195 ? 30.223 44.788 9.614   1.00 37.74 ? 354 PRO A CA  1 
ATOM   1467 C C   . PRO A 1 195 ? 29.962 46.069 10.356  1.00 38.23 ? 354 PRO A C   1 
ATOM   1468 O O   . PRO A 1 195 ? 29.440 46.034 11.467  1.00 35.64 ? 354 PRO A O   1 
ATOM   1469 C CB  . PRO A 1 195 ? 29.004 44.326 8.791   1.00 37.63 ? 354 PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 195 ? 29.102 42.834 8.748   1.00 36.72 ? 354 PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 195 ? 29.675 42.487 10.203  1.00 38.25 ? 354 PRO A CD  1 
ATOM   1472 N N   . PRO A 1 196 ? 30.387 47.187 9.781   1.00 37.73 ? 355 PRO A N   1 
ATOM   1473 C CA  . PRO A 1 196 ? 30.101 48.474 10.371  1.00 38.19 ? 355 PRO A CA  1 
ATOM   1474 C C   . PRO A 1 196 ? 28.727 49.047 10.071  1.00 36.98 ? 355 PRO A C   1 
ATOM   1475 O O   . PRO A 1 196 ? 28.320 50.008 10.716  1.00 37.83 ? 355 PRO A O   1 
ATOM   1476 C CB  . PRO A 1 196 ? 31.250 49.341 9.855   1.00 37.87 ? 355 PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 196 ? 31.535 48.760 8.511   1.00 39.31 ? 355 PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 196 ? 31.211 47.296 8.561   1.00 40.09 ? 355 PRO A CD  1 
ATOM   1479 N N   . TYR A 1 197 ? 28.006 48.449 9.155   1.00 38.40 ? 356 TYR A N   1 
ATOM   1480 C CA  . TYR A 1 197 ? 26.835 49.073 8.613   1.00 40.09 ? 356 TYR A CA  1 
ATOM   1481 C C   . TYR A 1 197 ? 25.589 48.740 9.518   1.00 40.21 ? 356 TYR A C   1 
ATOM   1482 O O   . TYR A 1 197 ? 25.529 47.705 10.118  1.00 40.53 ? 356 TYR A O   1 
ATOM   1483 C CB  . TYR A 1 197 ? 26.565 48.483 7.244   1.00 39.45 ? 356 TYR A CB  1 
ATOM   1484 C CG  . TYR A 1 197 ? 27.744 48.518 6.273   1.00 48.07 ? 356 TYR A CG  1 
ATOM   1485 C CD1 . TYR A 1 197 ? 28.480 47.365 5.976   1.00 54.06 ? 356 TYR A CD1 1 
ATOM   1486 C CD2 . TYR A 1 197 ? 28.086 49.686 5.625   1.00 53.64 ? 356 TYR A CD2 1 
ATOM   1487 C CE1 . TYR A 1 197 ? 29.555 47.381 5.067   1.00 57.54 ? 356 TYR A CE1 1 
ATOM   1488 C CE2 . TYR A 1 197 ? 29.154 49.715 4.686   1.00 60.93 ? 356 TYR A CE2 1 
ATOM   1489 C CZ  . TYR A 1 197 ? 29.893 48.563 4.436   1.00 60.65 ? 356 TYR A CZ  1 
ATOM   1490 O OH  . TYR A 1 197 ? 30.930 48.590 3.528   1.00 63.31 ? 356 TYR A OH  1 
ATOM   1491 N N   . SER A 1 198 ? 24.567 49.565 9.446   1.00 39.67 ? 357 SER A N   1 
ATOM   1492 C CA  . SER A 1 198 ? 23.275 49.316 10.042  1.00 37.90 ? 357 SER A CA  1 
ATOM   1493 C C   . SER A 1 198 ? 22.597 48.324 9.198   1.00 36.85 ? 357 SER A C   1 
ATOM   1494 O O   . SER A 1 198 ? 23.071 47.940 8.101   1.00 37.85 ? 357 SER A O   1 
ATOM   1495 C CB  . SER A 1 198 ? 22.482 50.607 10.098  1.00 39.27 ? 357 SER A CB  1 
ATOM   1496 O OG  . SER A 1 198 ? 22.095 51.001 8.807   1.00 36.63 ? 357 SER A OG  1 
ATOM   1497 N N   . VAL A 1 199 ? 21.569 47.748 9.782   1.00 34.40 ? 358 VAL A N   1 
ATOM   1498 C CA  . VAL A 1 199 ? 20.819 46.724 9.126   1.00 33.26 ? 358 VAL A CA  1 
ATOM   1499 C C   . VAL A 1 199 ? 20.068 47.292 7.943   1.00 34.17 ? 358 VAL A C   1 
ATOM   1500 O O   . VAL A 1 199 ? 19.986 46.607 6.933   1.00 33.03 ? 358 VAL A O   1 
ATOM   1501 C CB  . VAL A 1 199 ? 19.796 46.010 10.058  1.00 32.96 ? 358 VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 199 ? 18.937 45.051 9.291   1.00 31.85 ? 358 VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 199 ? 20.562 45.190 11.229  1.00 34.92 ? 358 VAL A CG2 1 
ATOM   1504 N N   . LYS A 1 200 ? 19.512 48.486 8.119   1.00 36.38 ? 359 LYS A N   1 
ATOM   1505 C CA  . LYS A 1 200 ? 18.883 49.219 7.069   1.00 40.18 ? 359 LYS A CA  1 
ATOM   1506 C C   . LYS A 1 200 ? 19.913 49.464 5.900   1.00 41.75 ? 359 LYS A C   1 
ATOM   1507 O O   . LYS A 1 200 ? 19.548 49.235 4.807   1.00 42.23 ? 359 LYS A O   1 
ATOM   1508 C CB  . LYS A 1 200 ? 18.439 50.553 7.551   1.00 40.37 ? 359 LYS A CB  1 
ATOM   1509 C CG  . LYS A 1 200 ? 17.512 51.304 6.495   1.00 45.15 ? 359 LYS A CG  1 
ATOM   1510 C CD  . LYS A 1 200 ? 17.353 52.765 6.924   1.00 49.50 ? 359 LYS A CD  1 
ATOM   1511 C CE  . LYS A 1 200 ? 16.435 53.619 5.975   1.00 53.77 ? 359 LYS A CE  1 
ATOM   1512 N NZ  . LYS A 1 200 ? 16.992 55.058 6.105   1.00 53.71 ? 359 LYS A NZ  1 
ATOM   1513 N N   . GLU A 1 201 ? 21.156 49.870 6.182   1.00 41.49 ? 360 GLU A N   1 
ATOM   1514 C CA  . GLU A 1 201 ? 22.199 50.044 5.149   1.00 42.74 ? 360 GLU A CA  1 
ATOM   1515 C C   . GLU A 1 201 ? 22.538 48.758 4.514   1.00 46.74 ? 360 GLU A C   1 
ATOM   1516 O O   . GLU A 1 201 ? 22.596 48.727 3.304   1.00 49.12 ? 360 GLU A O   1 
ATOM   1517 C CB  . GLU A 1 201 ? 23.467 50.676 5.707   1.00 40.75 ? 360 GLU A CB  1 
ATOM   1518 C CG  . GLU A 1 201 ? 23.158 52.045 6.216   1.00 35.88 ? 360 GLU A CG  1 
ATOM   1519 C CD  . GLU A 1 201 ? 24.287 52.717 6.953   1.00 37.40 ? 360 GLU A CD  1 
ATOM   1520 O OE1 . GLU A 1 201 ? 25.191 52.067 7.414   1.00 42.20 ? 360 GLU A OE1 1 
ATOM   1521 O OE2 . GLU A 1 201 ? 24.269 53.941 7.147   1.00 41.68 ? 360 GLU A OE2 1 
ATOM   1522 N N   . GLN A 1 202 ? 22.721 47.692 5.304   1.00 49.50 ? 361 GLN A N   1 
ATOM   1523 C CA  . GLN A 1 202 ? 22.900 46.325 4.804   1.00 51.96 ? 361 GLN A CA  1 
ATOM   1524 C C   . GLN A 1 202 ? 21.784 45.917 3.887   1.00 53.55 ? 361 GLN A C   1 
ATOM   1525 O O   . GLN A 1 202 ? 21.985 45.234 2.883   1.00 53.62 ? 361 GLN A O   1 
ATOM   1526 C CB  . GLN A 1 202 ? 22.963 45.299 5.980   1.00 52.89 ? 361 GLN A CB  1 
ATOM   1527 C CG  . GLN A 1 202 ? 24.384 45.089 6.656   1.00 55.20 ? 361 GLN A CG  1 
ATOM   1528 C CD  . GLN A 1 202 ? 24.381 44.621 8.195   1.00 61.99 ? 361 GLN A CD  1 
ATOM   1529 O OE1 . GLN A 1 202 ? 23.977 43.468 8.549   1.00 64.02 ? 361 GLN A OE1 1 
ATOM   1530 N NE2 . GLN A 1 202 ? 24.866 45.514 9.083   1.00 61.93 ? 361 GLN A NE2 1 
ATOM   1531 N N   . GLU A 1 203 ? 20.583 46.324 4.238   1.00 56.24 ? 362 GLU A N   1 
ATOM   1532 C CA  . GLU A 1 203 ? 19.418 45.966 3.461   1.00 58.40 ? 362 GLU A CA  1 
ATOM   1533 C C   . GLU A 1 203 ? 19.514 46.795 2.159   1.00 60.66 ? 362 GLU A C   1 
ATOM   1534 O O   . GLU A 1 203 ? 19.580 46.209 1.080   1.00 61.52 ? 362 GLU A O   1 
ATOM   1535 C CB  . GLU A 1 203 ? 18.128 46.236 4.252   1.00 59.16 ? 362 GLU A CB  1 
ATOM   1536 C CG  . GLU A 1 203 ? 17.281 44.963 4.468   1.00 61.22 ? 362 GLU A CG  1 
ATOM   1537 C CD  . GLU A 1 203 ? 16.405 44.919 5.724   1.00 62.70 ? 362 GLU A CD  1 
ATOM   1538 O OE1 . GLU A 1 203 ? 15.661 45.887 6.041   1.00 60.80 ? 362 GLU A OE1 1 
ATOM   1539 O OE2 . GLU A 1 203 ? 16.440 43.844 6.384   1.00 67.40 ? 362 GLU A OE2 1 
ATOM   1540 N N   . GLU A 1 204 ? 19.623 48.129 2.272   1.00 61.01 ? 363 GLU A N   1 
ATOM   1541 C CA  . GLU A 1 204 ? 19.814 49.014 1.119   1.00 62.03 ? 363 GLU A CA  1 
ATOM   1542 C C   . GLU A 1 204 ? 20.854 48.388 0.131   1.00 63.04 ? 363 GLU A C   1 
ATOM   1543 O O   . GLU A 1 204 ? 20.517 48.182 -1.009  1.00 62.84 ? 363 GLU A O   1 
ATOM   1544 C CB  . GLU A 1 204 ? 20.207 50.458 1.541   1.00 61.89 ? 363 GLU A CB  1 
ATOM   1545 C CG  . GLU A 1 204 ? 19.069 51.351 2.054   1.00 63.22 ? 363 GLU A CG  1 
ATOM   1546 C CD  . GLU A 1 204 ? 19.541 52.577 2.874   1.00 66.85 ? 363 GLU A CD  1 
ATOM   1547 O OE1 . GLU A 1 204 ? 20.788 52.849 2.959   1.00 65.31 ? 363 GLU A OE1 1 
ATOM   1548 O OE2 . GLU A 1 204 ? 18.654 53.305 3.421   1.00 69.60 ? 363 GLU A OE2 1 
ATOM   1549 N N   . MET A 1 205 ? 22.051 48.002 0.601   1.00 64.03 ? 364 MET A N   1 
ATOM   1550 C CA  . MET A 1 205 ? 23.183 47.541 -0.238  1.00 65.05 ? 364 MET A CA  1 
ATOM   1551 C C   . MET A 1 205 ? 23.010 46.174 -0.903  1.00 67.39 ? 364 MET A C   1 
ATOM   1552 O O   . MET A 1 205 ? 23.881 45.718 -1.655  1.00 67.68 ? 364 MET A O   1 
ATOM   1553 C CB  . MET A 1 205 ? 24.460 47.484 0.598   1.00 63.67 ? 364 MET A CB  1 
ATOM   1554 C CG  . MET A 1 205 ? 24.887 48.827 1.043   1.00 62.57 ? 364 MET A CG  1 
ATOM   1555 S SD  . MET A 1 205 ? 26.497 48.891 1.845   1.00 60.46 ? 364 MET A SD  1 
ATOM   1556 C CE  . MET A 1 205 ? 26.586 47.240 2.648   1.00 63.77 ? 364 MET A CE  1 
ATOM   1557 N N   . LEU A 1 206 ? 21.906 45.510 -0.585  1.00 70.25 ? 365 LEU A N   1 
ATOM   1558 C CA  . LEU A 1 206 ? 21.483 44.263 -1.239  1.00 72.47 ? 365 LEU A CA  1 
ATOM   1559 C C   . LEU A 1 206 ? 20.408 44.490 -2.313  1.00 73.54 ? 365 LEU A C   1 
ATOM   1560 O O   . LEU A 1 206 ? 20.335 43.762 -3.301  1.00 75.47 ? 365 LEU A O   1 
ATOM   1561 C CB  . LEU A 1 206 ? 20.907 43.277 -0.206  1.00 72.34 ? 365 LEU A CB  1 
ATOM   1562 C CG  . LEU A 1 206 ? 21.817 42.135 0.198   1.00 72.96 ? 365 LEU A CG  1 
ATOM   1563 C CD1 . LEU A 1 206 ? 22.579 42.482 1.505   1.00 73.86 ? 365 LEU A CD1 1 
ATOM   1564 C CD2 . LEU A 1 206 ? 20.988 40.868 0.337   1.00 74.29 ? 365 LEU A CD2 1 
ATOM   1565 N N   . LEU A 1 207 ? 19.530 45.449 -2.099  1.00 75.28 ? 366 LEU A N   1 
ATOM   1566 C CA  . LEU A 1 207 ? 18.531 45.751 -3.107  1.00 77.35 ? 366 LEU A CA  1 
ATOM   1567 C C   . LEU A 1 207 ? 19.214 46.671 -4.147  1.00 78.32 ? 366 LEU A C   1 
ATOM   1568 O O   . LEU A 1 207 ? 18.551 47.164 -5.086  1.00 78.52 ? 366 LEU A O   1 
ATOM   1569 C CB  . LEU A 1 207 ? 17.245 46.379 -2.494  1.00 77.92 ? 366 LEU A CB  1 
ATOM   1570 C CG  . LEU A 1 207 ? 16.251 45.406 -1.760  1.00 80.87 ? 366 LEU A CG  1 
ATOM   1571 C CD1 . LEU A 1 207 ? 15.530 46.097 -0.519  1.00 81.23 ? 366 LEU A CD1 1 
ATOM   1572 C CD2 . LEU A 1 207 ? 15.192 44.693 -2.689  1.00 81.09 ? 366 LEU A CD2 1 
ATOM   1573 N N   . MET A 1 208 ? 20.524 46.919 -3.944  1.00 78.53 ? 367 MET A N   1 
ATOM   1574 C CA  . MET A 1 208 ? 21.391 47.538 -4.936  1.00 78.57 ? 367 MET A CA  1 
ATOM   1575 C C   . MET A 1 208 ? 21.979 46.330 -5.685  1.00 80.50 ? 367 MET A C   1 
ATOM   1576 O O   . MET A 1 208 ? 21.437 45.925 -6.712  1.00 80.71 ? 367 MET A O   1 
ATOM   1577 C CB  . MET A 1 208 ? 22.513 48.393 -4.290  1.00 78.05 ? 367 MET A CB  1 
ATOM   1578 C CG  . MET A 1 208 ? 22.256 49.879 -4.017  1.00 73.87 ? 367 MET A CG  1 
ATOM   1579 S SD  . MET A 1 208 ? 23.801 50.552 -3.358  1.00 68.17 ? 367 MET A SD  1 
ATOM   1580 C CE  . MET A 1 208 ? 23.250 52.043 -2.507  1.00 68.07 ? 367 MET A CE  1 
ATOM   1581 N N   . SER A 1 209 ? 23.047 45.729 -5.127  1.00 82.40 ? 368 SER A N   1 
ATOM   1582 C CA  . SER A 1 209 ? 23.833 44.649 -5.777  1.00 83.40 ? 368 SER A CA  1 
ATOM   1583 C C   . SER A 1 209 ? 23.121 43.301 -5.772  1.00 84.45 ? 368 SER A C   1 
ATOM   1584 O O   . SER A 1 209 ? 23.526 42.347 -5.091  1.00 85.00 ? 368 SER A O   1 
ATOM   1585 C CB  . SER A 1 209 ? 25.216 44.514 -5.132  1.00 83.10 ? 368 SER A CB  1 
ATOM   1586 O OG  . SER A 1 209 ? 25.935 43.413 -5.659  1.00 83.37 ? 368 SER A OG  1 
ATOM   1587 N N   . SER A 1 210 ? 22.056 43.243 -6.563  1.00 85.96 ? 369 SER A N   1 
ATOM   1588 C CA  . SER A 1 210 ? 21.239 42.043 -6.734  1.00 86.54 ? 369 SER A CA  1 
ATOM   1589 C C   . SER A 1 210 ? 20.926 41.872 -8.242  1.00 87.35 ? 369 SER A C   1 
ATOM   1590 O O   . SER A 1 210 ? 20.380 42.799 -8.900  1.00 86.83 ? 369 SER A O   1 
ATOM   1591 C CB  . SER A 1 210 ? 19.953 42.117 -5.878  1.00 86.34 ? 369 SER A CB  1 
ATOM   1592 O OG  . SER A 1 210 ? 18.896 41.342 -6.435  1.00 86.14 ? 369 SER A OG  1 
ATOM   1593 N N   . PRO A 1 211 ? 21.376 40.728 -8.795  1.00 88.40 ? 370 PRO A N   1 
ATOM   1594 C CA  . PRO A 1 211 ? 20.679 40.062 -9.917  1.00 88.84 ? 370 PRO A CA  1 
ATOM   1595 C C   . PRO A 1 211 ? 19.720 38.935 -9.406  1.00 88.77 ? 370 PRO A C   1 
ATOM   1596 O O   . PRO A 1 211 ? 20.085 37.954 -8.722  1.00 88.08 ? 370 PRO A O   1 
ATOM   1597 C CB  . PRO A 1 211 ? 21.846 39.485 -10.768 1.00 89.02 ? 370 PRO A CB  1 
ATOM   1598 C CG  . PRO A 1 211 ? 23.098 39.399 -9.761  1.00 88.87 ? 370 PRO A CG  1 
ATOM   1599 C CD  . PRO A 1 211 ? 22.641 40.031 -8.454  1.00 88.42 ? 370 PRO A CD  1 
HETATM 1600 O O   . HOH B 2 .   ? 27.245 30.650 28.770  1.00 18.55 ? 372 HOH A O   1 
HETATM 1601 O O   . HOH B 2 .   ? 16.404 12.777 37.543  1.00 24.88 ? 373 HOH A O   1 
HETATM 1602 O O   . HOH B 2 .   ? 24.435 47.413 33.585  1.00 25.59 ? 374 HOH A O   1 
HETATM 1603 O O   . HOH B 2 .   ? 21.908 32.371 26.940  1.00 23.36 ? 375 HOH A O   1 
HETATM 1604 O O   . HOH B 2 .   ? 16.367 23.719 41.934  1.00 24.59 ? 376 HOH A O   1 
HETATM 1605 O O   . HOH B 2 .   ? 10.562 44.825 25.733  1.00 24.57 ? 377 HOH A O   1 
HETATM 1606 O O   . HOH B 2 .   ? 27.289 37.872 22.768  1.00 20.58 ? 378 HOH A O   1 
HETATM 1607 O O   . HOH B 2 .   ? 29.747 43.671 30.159  1.00 30.57 ? 379 HOH A O   1 
HETATM 1608 O O   . HOH B 2 .   ? 11.739 46.334 18.664  1.00 25.88 ? 380 HOH A O   1 
HETATM 1609 O O   . HOH B 2 .   ? 9.667  42.153 24.501  1.00 19.67 ? 381 HOH A O   1 
HETATM 1610 O O   . HOH B 2 .   ? 29.700 39.846 14.488  1.00 24.09 ? 382 HOH A O   1 
HETATM 1611 O O   . HOH B 2 .   ? 4.261  65.569 17.040  1.00 25.84 ? 383 HOH A O   1 
HETATM 1612 O O   . HOH B 2 .   ? 8.917  41.743 27.017  1.00 20.42 ? 384 HOH A O   1 
HETATM 1613 O O   . HOH B 2 .   ? 24.938 34.013 29.051  1.00 22.33 ? 385 HOH A O   1 
HETATM 1614 O O   . HOH B 2 .   ? 2.239  64.657 20.326  1.00 22.47 ? 386 HOH A O   1 
HETATM 1615 O O   . HOH B 2 .   ? 27.338 31.755 25.962  1.00 32.70 ? 387 HOH A O   1 
HETATM 1616 O O   . HOH B 2 .   ? 9.437  20.537 40.344  1.00 30.29 ? 388 HOH A O   1 
HETATM 1617 O O   . HOH B 2 .   ? 18.816 29.675 33.333  1.00 31.43 ? 389 HOH A O   1 
HETATM 1618 O O   . HOH B 2 .   ? 38.906 41.688 22.674  1.00 24.90 ? 390 HOH A O   1 
HETATM 1619 O O   . HOH B 2 .   ? 26.177 34.130 24.907  1.00 23.51 ? 391 HOH A O   1 
HETATM 1620 O O   . HOH B 2 .   ? 16.383 36.755 24.705  1.00 24.15 ? 392 HOH A O   1 
HETATM 1621 O O   . HOH B 2 .   ? 12.016 44.513 16.427  1.00 31.97 ? 393 HOH A O   1 
HETATM 1622 O O   . HOH B 2 .   ? 2.778  66.150 23.362  1.00 25.71 ? 394 HOH A O   1 
HETATM 1623 O O   . HOH B 2 .   ? 36.752 43.801 26.342  1.00 43.02 ? 395 HOH A O   1 
HETATM 1624 O O   . HOH B 2 .   ? 13.217 42.288 17.341  1.00 37.96 ? 396 HOH A O   1 
HETATM 1625 O O   . HOH B 2 .   ? 29.337 52.692 10.526  1.00 33.70 ? 397 HOH A O   1 
HETATM 1626 O O   . HOH B 2 .   ? 22.617 33.109 37.485  1.00 31.95 ? 398 HOH A O   1 
HETATM 1627 O O   . HOH B 2 .   ? 5.446  36.553 26.280  1.00 29.91 ? 399 HOH A O   1 
HETATM 1628 O O   . HOH B 2 .   ? 7.518  33.964 33.133  1.00 38.33 ? 400 HOH A O   1 
HETATM 1629 O O   . HOH B 2 .   ? 6.646  52.637 29.152  1.00 27.65 ? 401 HOH A O   1 
HETATM 1630 O O   . HOH B 2 .   ? 38.149 38.164 17.404  0.50 22.37 ? 402 HOH A O   1 
HETATM 1631 O O   . HOH B 2 .   ? 14.056 40.431 19.152  1.00 26.97 ? 403 HOH A O   1 
HETATM 1632 O O   . HOH B 2 .   ? 21.354 48.553 12.976  1.00 35.13 ? 404 HOH A O   1 
HETATM 1633 O O   . HOH B 2 .   ? 20.166 36.770 16.423  1.00 31.86 ? 405 HOH A O   1 
HETATM 1634 O O   . HOH B 2 .   ? 14.388 37.350 26.285  1.00 23.92 ? 406 HOH A O   1 
HETATM 1635 O O   . HOH B 2 .   ? 35.054 44.225 16.359  1.00 30.34 ? 407 HOH A O   1 
HETATM 1636 O O   . HOH B 2 .   ? 27.899 37.728 18.364  1.00 27.73 ? 408 HOH A O   1 
HETATM 1637 O O   . HOH B 2 .   ? 6.814  67.392 23.953  1.00 32.67 ? 409 HOH A O   1 
HETATM 1638 O O   . HOH B 2 .   ? 7.239  46.296 27.566  1.00 32.10 ? 410 HOH A O   1 
HETATM 1639 O O   . HOH B 2 .   ? 27.414 53.402 8.122   1.00 49.76 ? 411 HOH A O   1 
HETATM 1640 O O   . HOH B 2 .   ? 14.737 13.265 39.681  1.00 37.02 ? 412 HOH A O   1 
HETATM 1641 O O   . HOH B 2 .   ? 32.107 27.850 33.804  1.00 39.55 ? 413 HOH A O   1 
HETATM 1642 O O   . HOH B 2 .   ? 31.418 33.417 23.231  1.00 33.88 ? 414 HOH A O   1 
HETATM 1643 O O   . HOH B 2 .   ? 33.257 39.708 34.584  1.00 31.08 ? 415 HOH A O   1 
HETATM 1644 O O   . HOH B 2 .   ? 12.117 48.319 41.884  1.00 41.16 ? 416 HOH A O   1 
HETATM 1645 O O   . HOH B 2 .   ? 14.858 37.298 22.153  1.00 40.68 ? 417 HOH A O   1 
HETATM 1646 O O   . HOH B 2 .   ? 8.437  44.404 23.334  1.00 27.41 ? 418 HOH A O   1 
HETATM 1647 O O   . HOH B 2 .   ? 18.568 61.232 23.564  1.00 32.14 ? 419 HOH A O   1 
HETATM 1648 O O   . HOH B 2 .   ? 6.830  43.626 27.846  1.00 32.24 ? 420 HOH A O   1 
HETATM 1649 O O   . HOH B 2 .   ? 36.281 42.143 28.724  1.00 45.58 ? 421 HOH A O   1 
HETATM 1650 O O   . HOH B 2 .   ? 18.357 59.041 26.235  1.00 51.41 ? 422 HOH A O   1 
HETATM 1651 O O   . HOH B 2 .   ? 34.589 44.527 13.756  1.00 40.82 ? 423 HOH A O   1 
HETATM 1652 O O   . HOH B 2 .   ? 31.040 50.793 20.238  1.00 37.72 ? 424 HOH A O   1 
HETATM 1653 O O   . HOH B 2 .   ? 8.686  63.024 25.965  1.00 38.78 ? 425 HOH A O   1 
HETATM 1654 O O   . HOH B 2 .   ? 7.980  51.863 20.049  1.00 36.51 ? 426 HOH A O   1 
HETATM 1655 O O   . HOH B 2 .   ? 17.106 53.188 13.571  1.00 46.55 ? 427 HOH A O   1 
HETATM 1656 O O   . HOH B 2 .   ? 19.111 55.023 16.100  1.00 51.05 ? 428 HOH A O   1 
HETATM 1657 O O   . HOH B 2 .   ? 18.735 55.705 18.441  1.00 48.27 ? 429 HOH A O   1 
HETATM 1658 O O   . HOH B 2 .   ? 9.822  42.444 13.959  1.00 47.49 ? 430 HOH A O   1 
HETATM 1659 O O   . HOH B 2 .   ? 6.937  61.131 24.653  1.00 39.02 ? 431 HOH A O   1 
HETATM 1660 O O   . HOH B 2 .   ? 32.997 44.219 28.511  1.00 37.35 ? 432 HOH A O   1 
HETATM 1661 O O   . HOH B 2 .   ? 25.169 47.979 39.457  1.00 59.42 ? 433 HOH A O   1 
HETATM 1662 O O   . HOH B 2 .   ? 13.784 32.883 26.872  1.00 32.44 ? 434 HOH A O   1 
HETATM 1663 O O   . HOH B 2 .   ? 10.011 58.401 29.721  1.00 60.98 ? 435 HOH A O   1 
HETATM 1664 O O   . HOH B 2 .   ? 8.446  71.174 20.823  1.00 33.44 ? 436 HOH A O   1 
HETATM 1665 O O   . HOH B 2 .   ? 32.760 46.883 13.252  1.00 37.85 ? 437 HOH A O   1 
HETATM 1666 O O   . HOH B 2 .   ? 13.184 31.389 36.420  1.00 38.83 ? 438 HOH A O   1 
HETATM 1667 O O   . HOH B 2 .   ? 19.623 32.868 19.847  1.00 54.34 ? 439 HOH A O   1 
HETATM 1668 O O   . HOH B 2 .   ? 4.483  33.580 27.308  1.00 44.84 ? 440 HOH A O   1 
HETATM 1669 O O   . HOH B 2 .   ? 9.351  43.051 16.570  1.00 39.58 ? 441 HOH A O   1 
HETATM 1670 O O   . HOH B 2 .   ? 10.427 32.117 36.225  1.00 45.49 ? 442 HOH A O   1 
HETATM 1671 O O   . HOH B 2 .   ? 35.253 17.307 35.293  1.00 68.13 ? 443 HOH A O   1 
HETATM 1672 O O   . HOH B 2 .   ? 30.213 52.449 21.909  1.00 46.62 ? 444 HOH A O   1 
HETATM 1673 O O   . HOH B 2 .   ? 6.417  53.187 23.420  1.00 54.72 ? 445 HOH A O   1 
HETATM 1674 O O   . HOH B 2 .   ? 25.950 16.203 29.467  1.00 58.60 ? 446 HOH A O   1 
HETATM 1675 O O   . HOH B 2 .   ? 11.174 68.254 12.510  1.00 60.63 ? 447 HOH A O   1 
HETATM 1676 O O   . HOH B 2 .   ? 37.834 31.982 35.307  1.00 49.29 ? 448 HOH A O   1 
HETATM 1677 O O   . HOH B 2 .   ? 30.877 46.359 36.458  1.00 58.91 ? 449 HOH A O   1 
HETATM 1678 O O   . HOH B 2 .   ? 3.370  40.582 44.705  1.00 52.99 ? 450 HOH A O   1 
HETATM 1679 O O   . HOH B 2 .   ? 18.848 31.714 25.849  1.00 50.52 ? 451 HOH A O   1 
HETATM 1680 O O   . HOH B 2 .   ? 17.606 34.341 26.078  1.00 55.54 ? 452 HOH A O   1 
HETATM 1681 O O   . HOH B 2 .   ? 18.696 37.610 45.044  1.00 59.86 ? 453 HOH A O   1 
HETATM 1682 O O   . HOH B 2 .   ? 26.775 45.006 6.180   1.00 67.92 ? 454 HOH A O   1 
HETATM 1683 O O   . HOH B 2 .   ? 33.334 28.770 39.220  1.00 61.97 ? 455 HOH A O   1 
HETATM 1684 O O   . HOH B 2 .   ? 11.886 61.446 15.407  1.00 35.86 ? 456 HOH A O   1 
HETATM 1685 O O   . HOH B 2 .   ? 18.901 35.801 18.524  1.00 42.57 ? 457 HOH A O   1 
HETATM 1686 O O   . HOH B 2 .   ? 33.031 33.404 19.286  1.00 39.27 ? 458 HOH A O   1 
HETATM 1687 O O   . HOH B 2 .   ? 3.095  39.826 39.839  1.00 56.93 ? 459 HOH A O   1 
HETATM 1688 O O   . HOH B 2 .   ? 15.191 63.535 16.270  1.00 36.33 ? 460 HOH A O   1 
HETATM 1689 O O   . HOH B 2 .   ? 18.459 11.182 34.857  1.00 46.61 ? 461 HOH A O   1 
HETATM 1690 O O   . HOH B 2 .   ? 34.884 29.352 33.138  1.00 57.93 ? 462 HOH A O   1 
HETATM 1691 O O   . HOH B 2 .   ? 13.519 28.654 37.907  1.00 49.67 ? 463 HOH A O   1 
HETATM 1692 O O   . HOH B 2 .   ? 7.784  56.454 20.604  1.00 58.55 ? 464 HOH A O   1 
HETATM 1693 O O   . HOH B 2 .   ? 13.825 43.957 8.563   1.00 51.65 ? 465 HOH A O   1 
HETATM 1694 O O   . HOH B 2 .   ? 10.739 30.183 34.723  1.00 39.25 ? 466 HOH A O   1 
HETATM 1695 O O   . HOH B 2 .   ? 34.664 52.988 14.116  1.00 61.10 ? 467 HOH A O   1 
HETATM 1696 O O   . HOH B 2 .   ? 35.570 45.677 26.781  1.00 52.71 ? 468 HOH A O   1 
HETATM 1697 O O   . HOH B 2 .   ? 14.114 71.771 14.407  1.00 53.47 ? 469 HOH A O   1 
HETATM 1698 O O   . HOH B 2 .   ? 38.306 36.116 30.242  1.00 58.13 ? 470 HOH A O   1 
HETATM 1699 O O   . HOH B 2 .   ? 12.621 40.357 15.734  1.00 53.31 ? 471 HOH A O   1 
HETATM 1700 O O   . HOH B 2 .   ? 12.104 28.444 45.018  1.00 56.13 ? 472 HOH A O   1 
HETATM 1701 O O   . HOH B 2 .   ? 12.201 64.397 12.306  1.00 49.48 ? 473 HOH A O   1 
HETATM 1702 O O   . HOH B 2 .   ? 21.262 29.603 31.672  1.00 56.50 ? 474 HOH A O   1 
HETATM 1703 O O   . HOH B 2 .   ? 18.406 54.930 13.027  1.00 65.19 ? 475 HOH A O   1 
HETATM 1704 O O   . HOH B 2 .   ? 32.710 51.626 18.036  1.00 41.44 ? 476 HOH A O   1 
HETATM 1705 O O   . HOH B 2 .   ? 40.350 42.875 17.951  1.00 43.67 ? 477 HOH A O   1 
HETATM 1706 O O   . HOH B 2 .   ? 34.899 32.191 29.589  1.00 34.92 ? 478 HOH A O   1 
HETATM 1707 O O   . HOH B 2 .   ? 14.494 30.743 38.661  1.00 49.78 ? 479 HOH A O   1 
HETATM 1708 O O   . HOH B 2 .   ? 21.243 13.738 36.788  1.00 59.81 ? 480 HOH A O   1 
HETATM 1709 O O   . HOH B 2 .   ? 33.314 32.092 21.527  1.00 45.13 ? 481 HOH A O   1 
HETATM 1710 O O   . HOH B 2 .   ? 3.213  36.751 27.815  1.00 47.57 ? 482 HOH A O   1 
HETATM 1711 O O   . HOH B 2 .   ? 35.692 30.927 27.578  1.00 40.10 ? 483 HOH A O   1 
HETATM 1712 O O   . HOH B 2 .   ? 31.521 51.863 29.624  1.00 49.47 ? 484 HOH A O   1 
HETATM 1713 O O   . HOH B 2 .   ? 31.974 52.831 24.347  1.00 46.89 ? 485 HOH A O   1 
HETATM 1714 O O   . HOH B 2 .   ? 21.146 18.452 28.373  1.00 46.61 ? 486 HOH A O   1 
HETATM 1715 O O   . HOH B 2 .   ? 23.183 31.072 44.829  1.00 61.76 ? 487 HOH A O   1 
HETATM 1716 O O   . HOH B 2 .   ? 12.505 20.383 42.608  1.00 55.61 ? 488 HOH A O   1 
HETATM 1717 O O   . HOH B 2 .   ? 30.213 39.714 43.406  1.00 67.40 ? 489 HOH A O   1 
HETATM 1718 O O   . HOH B 2 .   ? 35.609 41.961 32.670  1.00 51.19 ? 490 HOH A O   1 
HETATM 1719 O O   . HOH B 2 .   ? 5.490  31.765 46.197  1.00 55.14 ? 491 HOH A O   1 
HETATM 1720 O O   . HOH B 2 .   ? 20.723 32.085 21.528  1.00 45.75 ? 492 HOH A O   1 
HETATM 1721 O O   . HOH B 2 .   ? 32.988 22.758 38.160  1.00 70.04 ? 493 HOH A O   1 
HETATM 1722 O O   . HOH B 2 .   ? 12.394 51.004 12.708  1.00 54.92 ? 494 HOH A O   1 
HETATM 1723 O O   . HOH B 2 .   ? 24.172 33.146 24.529  1.00 42.91 ? 495 HOH A O   1 
HETATM 1724 O O   . HOH B 2 .   ? 24.404 31.605 29.323  1.00 41.25 ? 496 HOH A O   1 
HETATM 1725 O O   . HOH B 2 .   ? 31.340 36.921 28.580  1.00 52.58 ? 497 HOH A O   1 
HETATM 1726 O O   . HOH B 2 .   ? 9.100  32.896 32.657  1.00 53.36 ? 498 HOH A O   1 
HETATM 1727 O O   . HOH B 2 .   ? 9.713  30.668 31.783  1.00 40.09 ? 499 HOH A O   1 
HETATM 1728 O O   . HOH B 2 .   ? 6.508  38.440 36.796  1.00 53.35 ? 500 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   35  ?   ?   ?   A . n 
A 1 2   ARG 2   36  ?   ?   ?   A . n 
A 1 3   GLY 3   37  ?   ?   ?   A . n 
A 1 4   SER 4   38  ?   ?   ?   A . n 
A 1 5   HIS 5   39  ?   ?   ?   A . n 
A 1 6   GLY 6   40  ?   ?   ?   A . n 
A 1 7   LYS 7   41  ?   ?   ?   A . n 
A 1 8   LYS 8   42  42  LYS LYS A . n 
A 1 9   ARG 9   43  43  ARG ARG A . n 
A 1 10  GLN 10  44  44  GLN GLN A . n 
A 1 11  ARG 11  45  45  ARG ARG A . n 
A 1 12  PHE 12  46  46  PHE PHE A . n 
A 1 13  VAL 13  47  47  VAL VAL A . n 
A 1 14  ASP 14  48  48  ASP ASP A . n 
A 1 15  LYS 15  49  49  LYS LYS A . n 
A 1 16  ASN 16  50  50  ASN ASN A . n 
A 1 17  GLY 17  51  51  GLY GLY A . n 
A 1 18  ARG 18  52  52  ARG ARG A . n 
A 1 19  CYS 19  53  53  CYS CYS A . n 
A 1 20  ASN 20  54  54  ASN ASN A . n 
A 1 21  VAL 21  55  55  VAL VAL A . n 
A 1 22  GLN 22  56  56  GLN GLN A . n 
A 1 23  HIS 23  57  57  HIS HIS A . n 
A 1 24  GLY 24  58  58  GLY GLY A . n 
A 1 25  ASN 25  59  59  ASN ASN A . n 
A 1 26  LEU 26  60  60  LEU LEU A . n 
A 1 27  GLY 27  61  ?   ?   ?   A . n 
A 1 28  SER 28  62  ?   ?   ?   A . n 
A 1 29  GLU 29  63  ?   ?   ?   A . n 
A 1 30  LYS 30  189 ?   ?   ?   A . n 
A 1 31  ARG 31  190 190 ARG ARG A . n 
A 1 32  ALA 32  191 191 ALA ALA A . n 
A 1 33  GLU 33  192 192 GLU GLU A . n 
A 1 34  THR 34  193 193 THR THR A . n 
A 1 35  LEU 35  194 194 LEU LEU A . n 
A 1 36  MET 36  195 195 MET MET A . n 
A 1 37  PHE 37  196 196 PHE PHE A . n 
A 1 38  SER 38  197 197 SER SER A . n 
A 1 39  GLU 39  198 198 GLU GLU A . n 
A 1 40  HIS 40  199 199 HIS HIS A . n 
A 1 41  ALA 41  200 200 ALA ALA A . n 
A 1 42  VAL 42  201 201 VAL VAL A . n 
A 1 43  ILE 43  202 202 ILE ILE A . n 
A 1 44  SER 44  203 203 SER SER A . n 
A 1 45  MET 45  204 204 MET MET A . n 
A 1 46  ARG 46  205 205 ARG ARG A . n 
A 1 47  ASP 47  206 206 ASP ASP A . n 
A 1 48  GLY 48  207 207 GLY GLY A . n 
A 1 49  LYS 49  208 208 LYS LYS A . n 
A 1 50  LEU 50  209 209 LEU LEU A . n 
A 1 51  THR 51  210 210 THR THR A . n 
A 1 52  LEU 52  211 211 LEU LEU A . n 
A 1 53  MET 53  212 212 MET MET A . n 
A 1 54  PHE 54  213 213 PHE PHE A . n 
A 1 55  ARG 55  214 214 ARG ARG A . n 
A 1 56  VAL 56  215 215 VAL VAL A . n 
A 1 57  GLY 57  216 216 GLY GLY A . n 
A 1 58  ASN 58  217 217 ASN ASN A . n 
A 1 59  LEU 59  218 218 LEU LEU A . n 
A 1 60  ARG 60  219 219 ARG ARG A . n 
A 1 61  ASN 61  220 220 ASN ASN A . n 
A 1 62  SER 62  221 221 SER SER A . n 
A 1 63  HIS 63  222 222 HIS HIS A . n 
A 1 64  MET 64  223 223 MET MET A . n 
A 1 65  VAL 65  224 224 VAL VAL A . n 
A 1 66  SER 66  225 225 SER SER A . n 
A 1 67  ALA 67  226 226 ALA ALA A . n 
A 1 68  GLN 68  227 227 GLN GLN A . n 
A 1 69  ILE 69  228 228 ILE ILE A . n 
A 1 70  ARG 70  229 229 ARG ARG A . n 
A 1 71  CYS 71  230 230 CYS CYS A . n 
A 1 72  LYS 72  231 231 LYS LYS A . n 
A 1 73  LEU 73  232 232 LEU LEU A . n 
A 1 74  LEU 74  233 233 LEU LEU A . n 
A 1 75  LYS 75  234 234 LYS LYS A . n 
A 1 76  SER 76  235 235 SER SER A . n 
A 1 77  ARG 77  236 236 ARG ARG A . n 
A 1 78  GLN 78  237 237 GLN GLN A . n 
A 1 79  THR 79  238 238 THR THR A . n 
A 1 80  PRO 80  239 239 PRO PRO A . n 
A 1 81  GLU 81  240 240 GLU GLU A . n 
A 1 82  GLY 82  241 241 GLY GLY A . n 
A 1 83  GLU 83  242 242 GLU GLU A . n 
A 1 84  PHE 84  243 243 PHE PHE A . n 
A 1 85  LEU 85  244 244 LEU LEU A . n 
A 1 86  PRO 86  245 245 PRO PRO A . n 
A 1 87  LEU 87  246 246 LEU LEU A . n 
A 1 88  ASP 88  247 247 ASP ASP A . n 
A 1 89  GLN 89  248 248 GLN GLN A . n 
A 1 90  LEU 90  249 249 LEU LEU A . n 
A 1 91  GLU 91  250 250 GLU GLU A . n 
A 1 92  LEU 92  251 251 LEU LEU A . n 
A 1 93  ASP 93  252 252 ASP ASP A . n 
A 1 94  VAL 94  253 253 VAL VAL A . n 
A 1 95  GLY 95  254 254 GLY GLY A . n 
A 1 96  PHE 96  255 255 PHE PHE A . n 
A 1 97  SER 97  256 256 SER SER A . n 
A 1 98  THR 98  257 257 THR THR A . n 
A 1 99  GLY 99  258 258 GLY GLY A . n 
A 1 100 ALA 100 259 259 ALA ALA A . n 
A 1 101 ASP 101 260 260 ASP ASP A . n 
A 1 102 GLN 102 261 261 GLN GLN A . n 
A 1 103 LEU 103 262 262 LEU LEU A . n 
A 1 104 PHE 104 263 263 PHE PHE A . n 
A 1 105 LEU 105 264 264 LEU LEU A . n 
A 1 106 VAL 106 265 265 VAL VAL A . n 
A 1 107 SER 107 266 266 SER SER A . n 
A 1 108 PRO 108 267 267 PRO PRO A . n 
A 1 109 LEU 109 268 268 LEU LEU A . n 
A 1 110 THR 110 269 269 THR THR A . n 
A 1 111 ILE 111 270 270 ILE ILE A . n 
A 1 112 CYS 112 271 271 CYS CYS A . n 
A 1 113 HIS 113 272 272 HIS HIS A . n 
A 1 114 VAL 114 273 273 VAL VAL A . n 
A 1 115 ILE 115 274 274 ILE ILE A . n 
A 1 116 ASP 116 275 275 ASP ASP A . n 
A 1 117 ALA 117 276 276 ALA ALA A . n 
A 1 118 LYS 118 277 277 LYS LYS A . n 
A 1 119 SER 119 278 278 SER SER A . n 
A 1 120 PRO 120 279 279 PRO PRO A . n 
A 1 121 PHE 121 280 280 PHE PHE A . n 
A 1 122 TYR 122 281 281 TYR TYR A . n 
A 1 123 ASP 123 282 282 ASP ASP A . n 
A 1 124 LEU 124 283 283 LEU LEU A . n 
A 1 125 SER 125 284 284 SER SER A . n 
A 1 126 GLN 126 285 285 GLN GLN A . n 
A 1 127 ARG 127 286 286 ARG ARG A . n 
A 1 128 SER 128 287 287 SER SER A . n 
A 1 129 MET 129 288 288 MET MET A . n 
A 1 130 GLN 130 289 289 GLN GLN A . n 
A 1 131 THR 131 290 290 THR THR A . n 
A 1 132 GLU 132 291 291 GLU GLU A . n 
A 1 133 GLN 133 292 292 GLN GLN A . n 
A 1 134 PHE 134 293 293 PHE PHE A . n 
A 1 135 GLU 135 294 294 GLU GLU A . n 
A 1 136 VAL 136 295 295 VAL VAL A . n 
A 1 137 VAL 137 296 296 VAL VAL A . n 
A 1 138 VAL 138 297 297 VAL VAL A . n 
A 1 139 ILE 139 298 298 ILE ILE A . n 
A 1 140 LEU 140 299 299 LEU LEU A . n 
A 1 141 GLU 141 300 300 GLU GLU A . n 
A 1 142 GLY 142 301 301 GLY GLY A . n 
A 1 143 ILE 143 302 302 ILE ILE A . n 
A 1 144 VAL 144 303 303 VAL VAL A . n 
A 1 145 GLU 145 304 304 GLU GLU A . n 
A 1 146 THR 146 305 305 THR THR A . n 
A 1 147 THR 147 306 306 THR THR A . n 
A 1 148 GLY 148 307 307 GLY GLY A . n 
A 1 149 MET 149 308 308 MET MET A . n 
A 1 150 THR 150 309 309 THR THR A . n 
A 1 151 CYS 151 310 310 CYS CYS A . n 
A 1 152 GLN 152 311 311 GLN GLN A . n 
A 1 153 ALA 153 312 312 ALA ALA A . n 
A 1 154 ARG 154 313 313 ARG ARG A . n 
A 1 155 THR 155 314 314 THR THR A . n 
A 1 156 SER 156 315 315 SER SER A . n 
A 1 157 TYR 157 316 316 TYR TYR A . n 
A 1 158 THR 158 317 317 THR THR A . n 
A 1 159 GLU 159 318 318 GLU GLU A . n 
A 1 160 ASP 160 319 319 ASP ASP A . n 
A 1 161 GLU 161 320 320 GLU GLU A . n 
A 1 162 VAL 162 321 321 VAL VAL A . n 
A 1 163 LEU 163 322 322 LEU LEU A . n 
A 1 164 TRP 164 323 323 TRP TRP A . n 
A 1 165 GLY 165 324 324 GLY GLY A . n 
A 1 166 HIS 166 325 325 HIS HIS A . n 
A 1 167 ARG 167 326 326 ARG ARG A . n 
A 1 168 PHE 168 327 327 PHE PHE A . n 
A 1 169 PHE 169 328 328 PHE PHE A . n 
A 1 170 PRO 170 329 329 PRO PRO A . n 
A 1 171 VAL 171 330 330 VAL VAL A . n 
A 1 172 ILE 172 331 331 ILE ILE A . n 
A 1 173 SER 173 332 332 SER SER A . n 
A 1 174 LEU 174 333 333 LEU LEU A . n 
A 1 175 GLU 175 334 334 GLU GLU A . n 
A 1 176 GLU 176 335 335 GLU GLU A . n 
A 1 177 GLY 177 336 336 GLY GLY A . n 
A 1 178 PHE 178 337 337 PHE PHE A . n 
A 1 179 PHE 179 338 338 PHE PHE A . n 
A 1 180 LYS 180 339 339 LYS LYS A . n 
A 1 181 VAL 181 340 340 VAL VAL A . n 
A 1 182 ASP 182 341 341 ASP ASP A . n 
A 1 183 TYR 183 342 342 TYR TYR A . n 
A 1 184 SER 184 343 343 SER SER A . n 
A 1 185 GLN 185 344 344 GLN GLN A . n 
A 1 186 PHE 186 345 345 PHE PHE A . n 
A 1 187 HIS 187 346 346 HIS HIS A . n 
A 1 188 ALA 188 347 347 ALA ALA A . n 
A 1 189 THR 189 348 348 THR THR A . n 
A 1 190 PHE 190 349 349 PHE PHE A . n 
A 1 191 GLU 191 350 350 GLU GLU A . n 
A 1 192 VAL 192 351 351 VAL VAL A . n 
A 1 193 PRO 193 352 352 PRO PRO A . n 
A 1 194 THR 194 353 353 THR THR A . n 
A 1 195 PRO 195 354 354 PRO PRO A . n 
A 1 196 PRO 196 355 355 PRO PRO A . n 
A 1 197 TYR 197 356 356 TYR TYR A . n 
A 1 198 SER 198 357 357 SER SER A . n 
A 1 199 VAL 199 358 358 VAL VAL A . n 
A 1 200 LYS 200 359 359 LYS LYS A . n 
A 1 201 GLU 201 360 360 GLU GLU A . n 
A 1 202 GLN 202 361 361 GLN GLN A . n 
A 1 203 GLU 203 362 362 GLU GLU A . n 
A 1 204 GLU 204 363 363 GLU GLU A . n 
A 1 205 MET 205 364 364 MET MET A . n 
A 1 206 LEU 206 365 365 LEU LEU A . n 
A 1 207 LEU 207 366 366 LEU LEU A . n 
A 1 208 MET 208 367 367 MET MET A . n 
A 1 209 SER 209 368 368 SER SER A . n 
A 1 210 SER 210 369 369 SER SER A . n 
A 1 211 PRO 211 370 370 PRO PRO A . n 
A 1 212 LEU 212 371 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   372 1   HOH WAT A . 
B 2 HOH 2   373 2   HOH WAT A . 
B 2 HOH 3   374 3   HOH WAT A . 
B 2 HOH 4   375 4   HOH WAT A . 
B 2 HOH 5   376 5   HOH WAT A . 
B 2 HOH 6   377 6   HOH WAT A . 
B 2 HOH 7   378 7   HOH WAT A . 
B 2 HOH 8   379 8   HOH WAT A . 
B 2 HOH 9   380 9   HOH WAT A . 
B 2 HOH 10  381 10  HOH WAT A . 
B 2 HOH 11  382 11  HOH WAT A . 
B 2 HOH 12  383 12  HOH WAT A . 
B 2 HOH 13  384 13  HOH WAT A . 
B 2 HOH 14  385 14  HOH WAT A . 
B 2 HOH 15  386 15  HOH WAT A . 
B 2 HOH 16  387 16  HOH WAT A . 
B 2 HOH 17  388 17  HOH WAT A . 
B 2 HOH 18  389 18  HOH WAT A . 
B 2 HOH 19  390 19  HOH WAT A . 
B 2 HOH 20  391 20  HOH WAT A . 
B 2 HOH 21  392 21  HOH WAT A . 
B 2 HOH 22  393 22  HOH WAT A . 
B 2 HOH 23  394 23  HOH WAT A . 
B 2 HOH 24  395 24  HOH WAT A . 
B 2 HOH 25  396 25  HOH WAT A . 
B 2 HOH 26  397 26  HOH WAT A . 
B 2 HOH 27  398 27  HOH WAT A . 
B 2 HOH 28  399 28  HOH WAT A . 
B 2 HOH 29  400 29  HOH WAT A . 
B 2 HOH 30  401 30  HOH WAT A . 
B 2 HOH 31  402 31  HOH WAT A . 
B 2 HOH 32  403 32  HOH WAT A . 
B 2 HOH 33  404 33  HOH WAT A . 
B 2 HOH 34  405 34  HOH WAT A . 
B 2 HOH 35  406 35  HOH WAT A . 
B 2 HOH 36  407 36  HOH WAT A . 
B 2 HOH 37  408 37  HOH WAT A . 
B 2 HOH 38  409 38  HOH WAT A . 
B 2 HOH 39  410 39  HOH WAT A . 
B 2 HOH 40  411 40  HOH WAT A . 
B 2 HOH 41  412 41  HOH WAT A . 
B 2 HOH 42  413 42  HOH WAT A . 
B 2 HOH 43  414 43  HOH WAT A . 
B 2 HOH 44  415 44  HOH WAT A . 
B 2 HOH 45  416 45  HOH WAT A . 
B 2 HOH 46  417 46  HOH WAT A . 
B 2 HOH 47  418 47  HOH WAT A . 
B 2 HOH 48  419 48  HOH WAT A . 
B 2 HOH 49  420 49  HOH WAT A . 
B 2 HOH 50  421 50  HOH WAT A . 
B 2 HOH 51  422 51  HOH WAT A . 
B 2 HOH 52  423 52  HOH WAT A . 
B 2 HOH 53  424 53  HOH WAT A . 
B 2 HOH 54  425 54  HOH WAT A . 
B 2 HOH 55  426 55  HOH WAT A . 
B 2 HOH 56  427 56  HOH WAT A . 
B 2 HOH 57  428 57  HOH WAT A . 
B 2 HOH 58  429 58  HOH WAT A . 
B 2 HOH 59  430 59  HOH WAT A . 
B 2 HOH 60  431 60  HOH WAT A . 
B 2 HOH 61  432 61  HOH WAT A . 
B 2 HOH 62  433 62  HOH WAT A . 
B 2 HOH 63  434 63  HOH WAT A . 
B 2 HOH 64  435 64  HOH WAT A . 
B 2 HOH 65  436 65  HOH WAT A . 
B 2 HOH 66  437 66  HOH WAT A . 
B 2 HOH 67  438 67  HOH WAT A . 
B 2 HOH 68  439 68  HOH WAT A . 
B 2 HOH 69  440 69  HOH WAT A . 
B 2 HOH 70  441 70  HOH WAT A . 
B 2 HOH 71  442 71  HOH WAT A . 
B 2 HOH 72  443 72  HOH WAT A . 
B 2 HOH 73  444 73  HOH WAT A . 
B 2 HOH 74  445 74  HOH WAT A . 
B 2 HOH 75  446 75  HOH WAT A . 
B 2 HOH 76  447 76  HOH WAT A . 
B 2 HOH 77  448 77  HOH WAT A . 
B 2 HOH 78  449 78  HOH WAT A . 
B 2 HOH 79  450 79  HOH WAT A . 
B 2 HOH 80  451 80  HOH WAT A . 
B 2 HOH 81  452 81  HOH WAT A . 
B 2 HOH 82  453 82  HOH WAT A . 
B 2 HOH 83  454 83  HOH WAT A . 
B 2 HOH 84  455 84  HOH WAT A . 
B 2 HOH 85  456 85  HOH WAT A . 
B 2 HOH 86  457 86  HOH WAT A . 
B 2 HOH 87  458 88  HOH WAT A . 
B 2 HOH 88  459 89  HOH WAT A . 
B 2 HOH 89  460 90  HOH WAT A . 
B 2 HOH 90  461 91  HOH WAT A . 
B 2 HOH 91  462 92  HOH WAT A . 
B 2 HOH 92  463 94  HOH WAT A . 
B 2 HOH 93  464 96  HOH WAT A . 
B 2 HOH 94  465 97  HOH WAT A . 
B 2 HOH 95  466 98  HOH WAT A . 
B 2 HOH 96  467 99  HOH WAT A . 
B 2 HOH 97  468 101 HOH WAT A . 
B 2 HOH 98  469 105 HOH WAT A . 
B 2 HOH 99  470 106 HOH WAT A . 
B 2 HOH 100 471 107 HOH WAT A . 
B 2 HOH 101 472 110 HOH WAT A . 
B 2 HOH 102 473 111 HOH WAT A . 
B 2 HOH 103 474 112 HOH WAT A . 
B 2 HOH 104 475 113 HOH WAT A . 
B 2 HOH 105 476 114 HOH WAT A . 
B 2 HOH 106 477 115 HOH WAT A . 
B 2 HOH 107 478 117 HOH WAT A . 
B 2 HOH 108 479 118 HOH WAT A . 
B 2 HOH 109 480 119 HOH WAT A . 
B 2 HOH 110 481 120 HOH WAT A . 
B 2 HOH 111 482 121 HOH WAT A . 
B 2 HOH 112 483 122 HOH WAT A . 
B 2 HOH 113 484 123 HOH WAT A . 
B 2 HOH 114 485 124 HOH WAT A . 
B 2 HOH 115 486 125 HOH WAT A . 
B 2 HOH 116 487 126 HOH WAT A . 
B 2 HOH 117 488 127 HOH WAT A . 
B 2 HOH 118 489 128 HOH WAT A . 
B 2 HOH 119 490 129 HOH WAT A . 
B 2 HOH 120 491 130 HOH WAT A . 
B 2 HOH 121 492 132 HOH WAT A . 
B 2 HOH 122 493 133 HOH WAT A . 
B 2 HOH 123 494 134 HOH WAT A . 
B 2 HOH 124 495 135 HOH WAT A . 
B 2 HOH 125 496 136 HOH WAT A . 
B 2 HOH 126 497 137 HOH WAT A . 
B 2 HOH 127 498 138 HOH WAT A . 
B 2 HOH 128 499 139 HOH WAT A . 
B 2 HOH 129 500 140 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11580 ? 
1 MORE         -13   ? 
1 'SSA (A^2)'  35800 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_565 -x,-y+1,z      -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 76.3570000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -y+1/2,x+1/2,z 0.0000000000  -1.0000000000 0.0000000000 38.1785000000  1.0000000000  
0.0000000000  0.0000000000 38.1785000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_455 y-1/2,-x+1/2,z 0.0000000000  1.0000000000  0.0000000000 -38.1785000000 -1.0000000000 
0.0000000000  0.0000000000 38.1785000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     402 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-03-08 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-08-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Source and taxonomy'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            entity_src_gen 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 400 ? ? O   A HOH 498 ? ? 1.97 
2 1 OH  A TYR 281 ? ? OE1 A GLU 362 ? ? 2.15 
3 1 O   A HOH 439 ? ? O   A HOH 492 ? ? 2.16 
4 1 OE2 A GLU 350 ? ? O   A HOH 477 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 SD  A MET 204 ? ? CE  A MET 204 ? ? 1.322 1.774 -0.452 0.056 N 
2 1 CE1 A PHE 255 ? ? CZ  A PHE 255 ? ? 1.493 1.369 0.124  0.019 N 
3 1 CE2 A PHE 255 ? ? CD2 A PHE 255 ? ? 1.526 1.388 0.138  0.020 N 
4 1 CB  A SER 256 ? ? OG  A SER 256 ? ? 1.502 1.418 0.084  0.013 N 
5 1 CB  A SER 266 ? ? OG  A SER 266 ? ? 1.337 1.418 -0.081 0.013 N 
6 1 CD  A GLU 291 ? ? OE2 A GLU 291 ? ? 1.335 1.252 0.083  0.011 N 
7 1 CA  A SER 343 ? ? CB  A SER 343 ? ? 1.630 1.525 0.105  0.015 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 45  ? ? CZ A ARG 45  ? ? NH1 A ARG 45  ? ? 123.32 120.30 3.02  0.50 N 
2 1 NE A ARG 214 ? ? CZ A ARG 214 ? ? NH1 A ARG 214 ? ? 123.54 120.30 3.24  0.50 N 
3 1 NE A ARG 214 ? ? CZ A ARG 214 ? ? NH2 A ARG 214 ? ? 115.24 120.30 -5.06 0.50 N 
4 1 NE A ARG 229 ? ? CZ A ARG 229 ? ? NH1 A ARG 229 ? ? 116.43 120.30 -3.87 0.50 N 
5 1 CB A CYS 230 ? ? CA A CYS 230 ? ? C   A CYS 230 ? ? 120.02 111.50 8.52  1.20 N 
6 1 CB A ASP 252 ? ? CG A ASP 252 ? ? OD1 A ASP 252 ? ? 126.41 118.30 8.11  0.90 N 
7 1 CB A LEU 264 ? ? CG A LEU 264 ? ? CD2 A LEU 264 ? ? 122.90 111.00 11.90 1.70 N 
8 1 CB A ASP 282 ? ? CG A ASP 282 ? ? OD1 A ASP 282 ? ? 125.28 118.30 6.98  0.90 N 
9 1 CB A ASP 319 ? ? CG A ASP 319 ? ? OD2 A ASP 319 ? ? 124.84 118.30 6.54  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 54  ? ? -94.66  46.17   
2 1 ALA A 191 ? ? -41.96  108.54  
3 1 GLU A 192 ? ? 115.74  11.49   
4 1 THR A 193 ? ? -131.64 -138.68 
5 1 LEU A 246 ? ? -161.98 67.92   
6 1 THR A 305 ? ? -29.57  -47.63  
7 1 MET A 367 ? ? -92.02  -83.28  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ARG A 190 ? ? ALA A 191 ? ? -147.05 
2 1 SER A 369 ? ? PRO A 370 ? ? 149.01  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ILE 202 ? CD1 ? A ILE 43  CD1 
2 1 Y 1 A ILE 228 ? CD1 ? A ILE 69  CD1 
3 1 Y 1 A ILE 270 ? CD1 ? A ILE 111 CD1 
4 1 Y 1 A ILE 274 ? CD1 ? A ILE 115 CD1 
5 1 Y 1 A ILE 298 ? CD1 ? A ILE 139 CD1 
6 1 Y 1 A ILE 331 ? CD1 ? A ILE 172 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 35  ? A PRO 1   
2  1 Y 1 A ARG 36  ? A ARG 2   
3  1 Y 1 A GLY 37  ? A GLY 3   
4  1 Y 1 A SER 38  ? A SER 4   
5  1 Y 1 A HIS 39  ? A HIS 5   
6  1 Y 1 A GLY 40  ? A GLY 6   
7  1 Y 1 A LYS 41  ? A LYS 7   
8  1 Y 1 A GLY 61  ? A GLY 27  
9  1 Y 1 A SER 62  ? A SER 28  
10 1 Y 1 A GLU 63  ? A GLU 29  
11 1 Y 1 A LYS 189 ? A LYS 30  
12 1 Y 1 A LEU 371 ? A LEU 212 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#