data_1U4L
# 
_entry.id   1U4L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1U4L         
RCSB  RCSB023237   
WWPDB D_1000023237 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1hrj . unspecified 
PDB 1rtn . unspecified 
PDB 1rto . unspecified 
PDB 1b3a . unspecified 
PDB 1eqt . unspecified 
PDB 1u4r . unspecified 
PDB 1u4m . unspecified 
PDB 1u4p . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1U4L 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shaw, J.P.'        1 
'Johnson, Z.'       2 
'Borlat, F.'        3 
'Zwahlen, C.'       4 
'Kungl, A.'         5 
'Roulin, K.'        6 
'Harrenga, A.'      7 
'Wells, T.N.C.'     8 
'Proudfoot, A.E.I.' 9 
# 
_citation.id                        primary 
_citation.title                     
'The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            12 
_citation.page_first                2081 
_citation.page_last                 2093 
_citation.year                      2004 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15530372 
_citation.pdbx_database_id_DOI      10.1016/j.str.2004.08.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shaw, J.P.'      1 ? 
primary 'Johnson, Z.'     2 ? 
primary 'Borlat, F.'      3 ? 
primary 'Zwahlen, C.'     4 ? 
primary 'Kungl, A.'       5 ? 
primary 'Roulin, K.'      6 ? 
primary 'Harrenga, A.'    7 ? 
primary 'Wells, T.N.'     8 ? 
primary 'Proudfoot, A.E.' 9 ? 
# 
_cell.entry_id           1U4L 
_cell.length_a           24.017 
_cell.length_b           56.350 
_cell.length_c           94.412 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1U4L 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Small inducible cytokine A5' 7862.011 2   ? ? ? ? 
2 branched    man 
'4-deoxy-2-O-sulfo-alpha-L-threo-hex-4-enopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose' 577.470  
1   ? ? ? ? 
3 non-polymer syn 'ACETIC ACID' 60.052   1   ? ? ? ? 
4 water       nat water 18.015   159 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CCL5, T-cell specific RANTES protein, SIS-delta, T cell-specific protein P228, TCP228' 
2 'HEPARIN DISACCHARIDE I-S,'                                                             
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_entity_poly.pdbx_seq_one_letter_code_can   SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  PRO n 
1 3  TYR n 
1 4  SER n 
1 5  SER n 
1 6  ASP n 
1 7  THR n 
1 8  THR n 
1 9  PRO n 
1 10 CYS n 
1 11 CYS n 
1 12 PHE n 
1 13 ALA n 
1 14 TYR n 
1 15 ILE n 
1 16 ALA n 
1 17 ARG n 
1 18 PRO n 
1 19 LEU n 
1 20 PRO n 
1 21 ARG n 
1 22 ALA n 
1 23 HIS n 
1 24 ILE n 
1 25 LYS n 
1 26 GLU n 
1 27 TYR n 
1 28 PHE n 
1 29 TYR n 
1 30 THR n 
1 31 SER n 
1 32 GLY n 
1 33 LYS n 
1 34 CYS n 
1 35 SER n 
1 36 ASN n 
1 37 PRO n 
1 38 ALA n 
1 39 VAL n 
1 40 VAL n 
1 41 PHE n 
1 42 VAL n 
1 43 THR n 
1 44 ARG n 
1 45 LYS n 
1 46 ASN n 
1 47 ARG n 
1 48 GLN n 
1 49 VAL n 
1 50 CYS n 
1 51 ALA n 
1 52 ASN n 
1 53 PRO n 
1 54 GLU n 
1 55 LYS n 
1 56 LYS n 
1 57 TRP n 
1 58 VAL n 
1 59 ARG n 
1 60 GLU n 
1 61 TYR n 
1 62 ILE n 
1 63 ASN n 
1 64 SER n 
1 65 LEU n 
1 66 GLU n 
1 67 MET n 
1 68 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'CCL5, SCYA5' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET32a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCL5_HUMAN 
_struct_ref.pdbx_db_accession          P13501 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_struct_ref.pdbx_align_begin           24 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1U4L A 1 ? 68 ? P13501 24 ? 91 ? 1 68 
2 1 1U4L B 1 ? 68 ? P13501 24 ? 91 ? 1 68 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer                   . 'ACETIC ACID'                                               ? 'C2 H4 O2'        60.052  
ALA 'L-peptide linking'           y ALANINE                                                     ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'           y ARGININE                                                    ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                  ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                             ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                    ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                                   ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                             ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE                                                     ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                   ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                   . WATER                                                       ? 'H2 O'            18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                  ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE                                                     ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE                                                      ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'           y METHIONINE                                                  ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking'           y PHENYLALANINE                                               ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'           y PROLINE                                                     ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE                                                      ? 'C3 H7 N O3'      105.093 
SGN 'D-saccharide, alpha linking' n '2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose'    ? 'C6 H13 N O11 S2' 339.298 
THR 'L-peptide linking'           y THREONINE                                                   ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                  ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE                                                    ? 'C9 H11 N O3'     181.189 
UAP 'L-saccharide, alpha linking' . '4-deoxy-2-O-sulfo-alpha-L-threo-hex-4-enopyranuronic acid' ? 'C6 H8 O9 S'      256.187 
VAL 'L-peptide linking'           y VALINE                                                      ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1U4L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.0 
_exptl_crystal.density_percent_sol   37.9 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    
;15% (w/v) PEG 400, 100mM acetate buffer, 1mM Heparin Disaccharide I-S, 10% (w/v) glycerol, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-07-19 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Osmic MaxFlux Confocal Mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ENRAF-NONIUS FR571' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1U4L 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   9099 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.3 
_reflns.B_iso_Wilson_estimate        12.8 
_reflns.pdbx_redundancy              4.25 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           0.216 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.75 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      860 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1U4L 
_refine.ls_number_reflns_obs                     9067 
_refine.ls_number_reflns_all                     9067 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1059581.91 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.16 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.255 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.5 
_refine.ls_number_reflns_R_free                  497 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               24.0 
_refine.aniso_B[1][1]                            8.50 
_refine.aniso_B[2][2]                            -7.21 
_refine.aniso_B[3][3]                            -1.29 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    BABINET 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 280.0 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1EQT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1U4L 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.08 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.13 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1030 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             163 
_refine_hist.number_atoms_total               1228 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        15.16 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.81  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.34  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.13  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.97  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.83  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             1378 
_refine_ls_shell.R_factor_R_work                  0.191 
_refine_ls_shell.percent_reflns_obs               97.9 
_refine_ls_shell.R_factor_R_free                  0.255 
_refine_ls_shell.R_factor_R_free_error            0.031 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             66 
_refine_ls_shell.number_reflns_obs                1444 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1U4L 
_struct.title                     'human RANTES complexed to heparin-derived disaccharide I-S' 
_struct.pdbx_descriptor           'Small inducible cytokine A5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1U4L 
_struct_keywords.pdbx_keywords   ATTRACTANT 
_struct_keywords.text            
'CHEMOATTRACTANT, CYTOKINE, CHEMOKINE, RANTES, GLYCOSAMINOGLYCAN, PROTEIN-HEPARIN DISACCHARIDE COMPLEX, attractant' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 21 ? HIS A 23 ? ARG A 21 HIS A 23 1 ? 3  
HELX_P HELX_P2 2 LYS A 56 ? LEU A 65 ? LYS A 56 LEU A 65 1 ? 10 
HELX_P HELX_P3 3 ARG B 21 ? HIS B 23 ? ARG B 21 HIS B 23 1 ? 3  
HELX_P HELX_P4 4 LYS B 56 ? MET B 67 ? LYS B 56 MET B 67 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 10 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 10 A CYS 34 1_555 ? ? ? ? ? ? ? 2.032 ?    ? 
disulf2 disulf ?    ? A CYS 11 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 11 A CYS 50 1_555 ? ? ? ? ? ? ? 2.027 ?    ? 
disulf3 disulf ?    ? B CYS 10 SG ? ? ? 1_555 B CYS 34 SG ? ? B CYS 10 B CYS 34 1_555 ? ? ? ? ? ? ? 2.035 ?    ? 
disulf4 disulf ?    ? B CYS 11 SG ? ? ? 1_555 B CYS 50 SG ? ? B CYS 11 B CYS 50 1_555 ? ? ? ? ? ? ? 2.027 ?    ? 
covale1 covale both ? C SGN .  O4 ? ? ? 1_555 C UAP .  C1 ? ? C SGN 1  C UAP 2  1_555 ? ? ? ? ? ? ? 1.467 sing ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1 ? 1 ? 
2 ? 1 ? 
3 ? 1 ? 
4 ? 1 ? 
5 ? 1 ? 
6 ? 1 ? 
7 ? 1 ? 
8 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1 1 THR A 8  ? CYS A 10 ? THR A 8  CYS A 10 
2 1 ILE A 24 ? TYR A 29 ? ILE A 24 TYR A 29 
3 1 VAL A 39 ? THR A 43 ? VAL A 39 THR A 43 
4 1 GLN A 48 ? ALA A 51 ? GLN A 48 ALA A 51 
5 1 THR B 8  ? CYS B 10 ? THR B 8  CYS B 10 
6 1 ILE B 24 ? TYR B 29 ? ILE B 24 TYR B 29 
7 1 VAL B 39 ? THR B 43 ? VAL B 39 THR B 43 
8 1 GLN B 48 ? ALA B 51 ? GLN B 48 ALA B 51 
# 
_database_PDB_matrix.entry_id          1U4L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1U4L 
_atom_sites.fract_transf_matrix[1][1]   0.041637 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017746 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010592 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 2  ? 17.073  -3.669 40.443 1.00 35.08 ? 2   PRO A N   1 
ATOM   2    C CA  . PRO A 1 2  ? 17.098  -2.552 41.414 1.00 34.21 ? 2   PRO A CA  1 
ATOM   3    C C   . PRO A 1 2  ? 16.749  -1.244 40.714 1.00 33.13 ? 2   PRO A C   1 
ATOM   4    O O   . PRO A 1 2  ? 17.244  -0.964 39.620 1.00 33.52 ? 2   PRO A O   1 
ATOM   5    C CB  . PRO A 1 2  ? 18.509  -2.488 41.985 1.00 36.48 ? 2   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 2  ? 18.999  -3.917 41.757 1.00 37.55 ? 2   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 2  ? 18.391  -4.326 40.407 1.00 37.13 ? 2   PRO A CD  1 
ATOM   8    N N   . TYR A 1 3  ? 15.892  -0.446 41.338 1.00 30.33 ? 3   TYR A N   1 
ATOM   9    C CA  . TYR A 1 3  ? 15.500  0.830  40.756 1.00 28.20 ? 3   TYR A CA  1 
ATOM   10   C C   . TYR A 1 3  ? 14.759  1.647  41.800 1.00 25.53 ? 3   TYR A C   1 
ATOM   11   O O   . TYR A 1 3  ? 14.299  1.113  42.808 1.00 26.73 ? 3   TYR A O   1 
ATOM   12   C CB  . TYR A 1 3  ? 14.586  0.610  39.546 1.00 28.23 ? 3   TYR A CB  1 
ATOM   13   C CG  . TYR A 1 3  ? 14.514  1.798  38.610 1.00 29.35 ? 3   TYR A CG  1 
ATOM   14   C CD1 . TYR A 1 3  ? 15.525  2.034  37.686 1.00 30.30 ? 3   TYR A CD1 1 
ATOM   15   C CD2 . TYR A 1 3  ? 13.448  2.690  38.658 1.00 29.10 ? 3   TYR A CD2 1 
ATOM   16   C CE1 . TYR A 1 3  ? 15.478  3.122  36.833 1.00 29.71 ? 3   TYR A CE1 1 
ATOM   17   C CE2 . TYR A 1 3  ? 13.393  3.786  37.810 1.00 29.01 ? 3   TYR A CE2 1 
ATOM   18   C CZ  . TYR A 1 3  ? 14.413  3.995  36.899 1.00 30.18 ? 3   TYR A CZ  1 
ATOM   19   O OH  . TYR A 1 3  ? 14.377  5.075  36.049 1.00 29.89 ? 3   TYR A OH  1 
ATOM   20   N N   . SER A 1 4  ? 14.645  2.944  41.553 1.00 22.42 ? 4   SER A N   1 
ATOM   21   C CA  . SER A 1 4  ? 13.940  3.823  42.470 1.00 21.65 ? 4   SER A CA  1 
ATOM   22   C C   . SER A 1 4  ? 12.507  3.331  42.658 1.00 20.90 ? 4   SER A C   1 
ATOM   23   O O   . SER A 1 4  ? 11.874  2.860  41.710 1.00 18.67 ? 4   SER A O   1 
ATOM   24   C CB  . SER A 1 4  ? 13.918  5.250  41.914 1.00 22.01 ? 4   SER A CB  1 
ATOM   25   O OG  . SER A 1 4  ? 13.039  6.074  42.662 1.00 23.58 ? 4   SER A OG  1 
ATOM   26   N N   . SER A 1 5  ? 12.008  3.421  43.885 1.00 19.03 ? 5   SER A N   1 
ATOM   27   C CA  . SER A 1 5  ? 10.638  3.021  44.170 1.00 19.42 ? 5   SER A CA  1 
ATOM   28   C C   . SER A 1 5  ? 9.747   4.264  44.166 1.00 18.40 ? 5   SER A C   1 
ATOM   29   O O   . SER A 1 5  ? 8.586   4.214  44.563 1.00 19.43 ? 5   SER A O   1 
ATOM   30   C CB  . SER A 1 5  ? 10.548  2.285  45.513 1.00 18.57 ? 5   SER A CB  1 
ATOM   31   O OG  . SER A 1 5  ? 11.154  3.021  46.557 1.00 23.78 ? 5   SER A OG  1 
ATOM   32   N N   . ASP A 1 6  ? 10.307  5.388  43.725 1.00 18.55 ? 6   ASP A N   1 
ATOM   33   C CA  . ASP A 1 6  ? 9.547   6.630  43.618 1.00 17.99 ? 6   ASP A CA  1 
ATOM   34   C C   . ASP A 1 6  ? 8.997   6.601  42.193 1.00 18.31 ? 6   ASP A C   1 
ATOM   35   O O   . ASP A 1 6  ? 9.552   5.918  41.331 1.00 18.04 ? 6   ASP A O   1 
ATOM   36   C CB  . ASP A 1 6  ? 10.463  7.849  43.787 1.00 20.40 ? 6   ASP A CB  1 
ATOM   37   C CG  . ASP A 1 6  ? 10.506  8.371  45.221 1.00 22.40 ? 6   ASP A CG  1 
ATOM   38   O OD1 . ASP A 1 6  ? 10.270  7.583  46.163 1.00 23.14 ? 6   ASP A OD1 1 
ATOM   39   O OD2 . ASP A 1 6  ? 10.791  9.578  45.403 1.00 21.22 ? 6   ASP A OD2 1 
ATOM   40   N N   . THR A 1 7  ? 7.915   7.325  41.934 1.00 16.29 ? 7   THR A N   1 
ATOM   41   C CA  . THR A 1 7  ? 7.361   7.338  40.586 1.00 17.56 ? 7   THR A CA  1 
ATOM   42   C C   . THR A 1 7  ? 8.361   7.917  39.586 1.00 17.15 ? 7   THR A C   1 
ATOM   43   O O   . THR A 1 7  ? 9.217   8.729  39.936 1.00 16.10 ? 7   THR A O   1 
ATOM   44   C CB  . THR A 1 7  ? 6.057   8.161  40.503 1.00 16.35 ? 7   THR A CB  1 
ATOM   45   O OG1 . THR A 1 7  ? 6.301   9.503  40.946 1.00 15.09 ? 7   THR A OG1 1 
ATOM   46   C CG2 . THR A 1 7  ? 4.975   7.517  41.358 1.00 12.61 ? 7   THR A CG2 1 
ATOM   47   N N   . THR A 1 8  ? 8.235   7.478  38.341 1.00 17.44 ? 8   THR A N   1 
ATOM   48   C CA  . THR A 1 8  ? 9.092   7.918  37.249 1.00 18.09 ? 8   THR A CA  1 
ATOM   49   C C   . THR A 1 8  ? 8.177   8.356  36.114 1.00 16.25 ? 8   THR A C   1 
ATOM   50   O O   . THR A 1 8  ? 7.203   7.677  35.797 1.00 13.68 ? 8   THR A O   1 
ATOM   51   C CB  . THR A 1 8  ? 9.981   6.760  36.750 1.00 20.49 ? 8   THR A CB  1 
ATOM   52   O OG1 . THR A 1 8  ? 10.676  6.184  37.864 1.00 25.45 ? 8   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 8  ? 10.998  7.265  35.740 1.00 21.49 ? 8   THR A CG2 1 
ATOM   54   N N   . PRO A 1 9  ? 8.475   9.501  35.487 1.00 15.92 ? 9   PRO A N   1 
ATOM   55   C CA  . PRO A 1 9  ? 7.629   9.973  34.390 1.00 15.18 ? 9   PRO A CA  1 
ATOM   56   C C   . PRO A 1 9  ? 7.826   9.245  33.060 1.00 14.53 ? 9   PRO A C   1 
ATOM   57   O O   . PRO A 1 9  ? 8.952   8.976  32.640 1.00 11.80 ? 9   PRO A O   1 
ATOM   58   C CB  . PRO A 1 9  ? 7.986   11.453 34.301 1.00 12.65 ? 9   PRO A CB  1 
ATOM   59   C CG  . PRO A 1 9  ? 9.445   11.455 34.660 1.00 15.34 ? 9   PRO A CG  1 
ATOM   60   C CD  . PRO A 1 9  ? 9.503   10.501 35.834 1.00 15.21 ? 9   PRO A CD  1 
ATOM   61   N N   . CYS A 1 10 ? 6.712   8.917  32.413 1.00 14.61 ? 10  CYS A N   1 
ATOM   62   C CA  . CYS A 1 10 ? 6.726   8.252  31.115 1.00 14.76 ? 10  CYS A CA  1 
ATOM   63   C C   . CYS A 1 10 ? 5.753   8.987  30.196 1.00 16.01 ? 10  CYS A C   1 
ATOM   64   O O   . CYS A 1 10 ? 4.858   9.694  30.664 1.00 15.33 ? 10  CYS A O   1 
ATOM   65   C CB  . CYS A 1 10 ? 6.279   6.792  31.229 1.00 15.55 ? 10  CYS A CB  1 
ATOM   66   S SG  . CYS A 1 10 ? 7.389   5.645  32.109 1.00 14.21 ? 10  CYS A SG  1 
ATOM   67   N N   . CYS A 1 11 ? 5.929   8.807  28.892 1.00 15.64 ? 11  CYS A N   1 
ATOM   68   C CA  . CYS A 1 11 ? 5.073   9.437  27.895 1.00 17.78 ? 11  CYS A CA  1 
ATOM   69   C C   . CYS A 1 11 ? 4.242   8.403  27.148 1.00 19.21 ? 11  CYS A C   1 
ATOM   70   O O   . CYS A 1 11 ? 4.756   7.358  26.754 1.00 20.25 ? 11  CYS A O   1 
ATOM   71   C CB  . CYS A 1 11 ? 5.919   10.191 26.872 1.00 17.28 ? 11  CYS A CB  1 
ATOM   72   S SG  . CYS A 1 11 ? 6.748   11.688 27.482 1.00 16.14 ? 11  CYS A SG  1 
ATOM   73   N N   . PHE A 1 12 ? 2.964   8.704  26.937 1.00 20.63 ? 12  PHE A N   1 
ATOM   74   C CA  . PHE A 1 12 ? 2.087   7.791  26.218 1.00 20.81 ? 12  PHE A CA  1 
ATOM   75   C C   . PHE A 1 12 ? 1.464   8.443  24.991 1.00 22.78 ? 12  PHE A C   1 
ATOM   76   O O   . PHE A 1 12 ? 0.617   7.852  24.316 1.00 23.64 ? 12  PHE A O   1 
ATOM   77   C CB  . PHE A 1 12 ? 1.007   7.253  27.149 1.00 19.84 ? 12  PHE A CB  1 
ATOM   78   C CG  . PHE A 1 12 ? 1.552   6.421  28.269 1.00 17.25 ? 12  PHE A CG  1 
ATOM   79   C CD1 . PHE A 1 12 ? 1.907   5.100  28.052 1.00 17.36 ? 12  PHE A CD1 1 
ATOM   80   C CD2 . PHE A 1 12 ? 1.752   6.968  29.526 1.00 17.29 ? 12  PHE A CD2 1 
ATOM   81   C CE1 . PHE A 1 12 ? 2.455   4.337  29.067 1.00 14.96 ? 12  PHE A CE1 1 
ATOM   82   C CE2 . PHE A 1 12 ? 2.302   6.209  30.547 1.00 17.62 ? 12  PHE A CE2 1 
ATOM   83   C CZ  . PHE A 1 12 ? 2.654   4.890  30.313 1.00 16.17 ? 12  PHE A CZ  1 
ATOM   84   N N   . ALA A 1 13 ? 1.904   9.664  24.710 1.00 21.83 ? 13  ALA A N   1 
ATOM   85   C CA  . ALA A 1 13 ? 1.440   10.423 23.554 1.00 21.73 ? 13  ALA A CA  1 
ATOM   86   C C   . ALA A 1 13 ? 2.522   11.435 23.189 1.00 21.66 ? 13  ALA A C   1 
ATOM   87   O O   . ALA A 1 13 ? 3.260   11.900 24.058 1.00 21.28 ? 13  ALA A O   1 
ATOM   88   C CB  . ALA A 1 13 ? 0.143   11.141 23.884 1.00 22.76 ? 13  ALA A CB  1 
ATOM   89   N N   . TYR A 1 14 ? 2.623   11.766 21.906 1.00 20.29 ? 14  TYR A N   1 
ATOM   90   C CA  . TYR A 1 14 ? 3.612   12.731 21.442 1.00 19.75 ? 14  TYR A CA  1 
ATOM   91   C C   . TYR A 1 14 ? 2.912   13.947 20.848 1.00 19.80 ? 14  TYR A C   1 
ATOM   92   O O   . TYR A 1 14 ? 1.893   13.808 20.173 1.00 19.88 ? 14  TYR A O   1 
ATOM   93   C CB  . TYR A 1 14 ? 4.503   12.113 20.369 1.00 20.80 ? 14  TYR A CB  1 
ATOM   94   C CG  . TYR A 1 14 ? 5.249   10.873 20.796 1.00 23.37 ? 14  TYR A CG  1 
ATOM   95   C CD1 . TYR A 1 14 ? 6.107   10.889 21.890 1.00 21.53 ? 14  TYR A CD1 1 
ATOM   96   C CD2 . TYR A 1 14 ? 5.127   9.692  20.074 1.00 24.80 ? 14  TYR A CD2 1 
ATOM   97   C CE1 . TYR A 1 14 ? 6.825   9.759  22.248 1.00 23.42 ? 14  TYR A CE1 1 
ATOM   98   C CE2 . TYR A 1 14 ? 5.836   8.565  20.422 1.00 25.37 ? 14  TYR A CE2 1 
ATOM   99   C CZ  . TYR A 1 14 ? 6.684   8.599  21.504 1.00 23.93 ? 14  TYR A CZ  1 
ATOM   100  O OH  . TYR A 1 14 ? 7.402   7.467  21.821 1.00 23.55 ? 14  TYR A OH  1 
ATOM   101  N N   . ILE A 1 15 ? 3.446   15.139 21.099 1.00 18.30 ? 15  ILE A N   1 
ATOM   102  C CA  . ILE A 1 15 ? 2.839   16.337 20.541 1.00 19.52 ? 15  ILE A CA  1 
ATOM   103  C C   . ILE A 1 15 ? 2.905   16.170 19.023 1.00 18.43 ? 15  ILE A C   1 
ATOM   104  O O   . ILE A 1 15 ? 3.938   15.789 18.475 1.00 16.68 ? 15  ILE A O   1 
ATOM   105  C CB  . ILE A 1 15 ? 3.583   17.617 21.006 1.00 21.33 ? 15  ILE A CB  1 
ATOM   106  C CG1 . ILE A 1 15 ? 2.799   18.861 20.575 1.00 22.47 ? 15  ILE A CG1 1 
ATOM   107  C CG2 . ILE A 1 15 ? 4.993   17.636 20.458 1.00 22.16 ? 15  ILE A CG2 1 
ATOM   108  C CD1 . ILE A 1 15 ? 3.210   20.125 21.318 1.00 24.11 ? 15  ILE A CD1 1 
ATOM   109  N N   . ALA A 1 16 ? 1.788   16.435 18.358 1.00 17.64 ? 16  ALA A N   1 
ATOM   110  C CA  . ALA A 1 16 ? 1.675   16.266 16.910 1.00 20.30 ? 16  ALA A CA  1 
ATOM   111  C C   . ALA A 1 16 ? 2.568   17.140 16.034 1.00 21.18 ? 16  ALA A C   1 
ATOM   112  O O   . ALA A 1 16 ? 3.073   16.683 15.011 1.00 21.56 ? 16  ALA A O   1 
ATOM   113  C CB  . ALA A 1 16 ? 0.215   16.448 16.490 1.00 19.96 ? 16  ALA A CB  1 
ATOM   114  N N   . ARG A 1 17 ? 2.744   18.398 16.418 1.00 22.42 ? 17  ARG A N   1 
ATOM   115  C CA  . ARG A 1 17 ? 3.561   19.320 15.638 1.00 22.71 ? 17  ARG A CA  1 
ATOM   116  C C   . ARG A 1 17 ? 4.622   19.974 16.515 1.00 22.81 ? 17  ARG A C   1 
ATOM   117  O O   . ARG A 1 17 ? 4.507   19.984 17.739 1.00 20.73 ? 17  ARG A O   1 
ATOM   118  C CB  . ARG A 1 17 ? 2.674   20.380 14.995 1.00 23.42 ? 17  ARG A CB  1 
ATOM   119  N N   . PRO A 1 18 ? 5.669   20.532 15.890 1.00 22.81 ? 18  PRO A N   1 
ATOM   120  C CA  . PRO A 1 18 ? 6.774   21.194 16.588 1.00 22.97 ? 18  PRO A CA  1 
ATOM   121  C C   . PRO A 1 18 ? 6.358   22.343 17.495 1.00 22.92 ? 18  PRO A C   1 
ATOM   122  O O   . PRO A 1 18 ? 5.577   23.206 17.102 1.00 23.59 ? 18  PRO A O   1 
ATOM   123  C CB  . PRO A 1 18 ? 7.668   21.676 15.444 1.00 23.13 ? 18  PRO A CB  1 
ATOM   124  C CG  . PRO A 1 18 ? 7.405   20.676 14.361 1.00 24.83 ? 18  PRO A CG  1 
ATOM   125  C CD  . PRO A 1 18 ? 5.908   20.516 14.436 1.00 24.45 ? 18  PRO A CD  1 
ATOM   126  N N   . LEU A 1 19 ? 6.887   22.341 18.713 1.00 22.70 ? 19  LEU A N   1 
ATOM   127  C CA  . LEU A 1 19 ? 6.618   23.409 19.669 1.00 23.50 ? 19  LEU A CA  1 
ATOM   128  C C   . LEU A 1 19 ? 7.477   24.587 19.225 1.00 21.58 ? 19  LEU A C   1 
ATOM   129  O O   . LEU A 1 19 ? 8.471   24.400 18.523 1.00 22.24 ? 19  LEU A O   1 
ATOM   130  C CB  . LEU A 1 19 ? 7.060   22.989 21.074 1.00 24.34 ? 19  LEU A CB  1 
ATOM   131  C CG  . LEU A 1 19 ? 6.220   21.978 21.850 1.00 25.66 ? 19  LEU A CG  1 
ATOM   132  C CD1 . LEU A 1 19 ? 7.061   21.344 22.950 1.00 25.82 ? 19  LEU A CD1 1 
ATOM   133  C CD2 . LEU A 1 19 ? 5.006   22.682 22.437 1.00 27.13 ? 19  LEU A CD2 1 
ATOM   134  N N   . PRO A 1 20 ? 7.100   25.814 19.611 1.00 21.03 ? 20  PRO A N   1 
ATOM   135  C CA  . PRO A 1 20 ? 7.908   26.969 19.214 1.00 20.31 ? 20  PRO A CA  1 
ATOM   136  C C   . PRO A 1 20 ? 9.280   26.805 19.874 1.00 20.61 ? 20  PRO A C   1 
ATOM   137  O O   . PRO A 1 20 ? 9.363   26.675 21.096 1.00 20.31 ? 20  PRO A O   1 
ATOM   138  C CB  . PRO A 1 20 ? 7.132   28.151 19.796 1.00 21.17 ? 20  PRO A CB  1 
ATOM   139  C CG  . PRO A 1 20 ? 5.718   27.662 19.823 1.00 21.69 ? 20  PRO A CG  1 
ATOM   140  C CD  . PRO A 1 20 ? 5.873   26.241 20.305 1.00 21.73 ? 20  PRO A CD  1 
ATOM   141  N N   . ARG A 1 21 ? 10.345  26.793 19.077 1.00 18.86 ? 21  ARG A N   1 
ATOM   142  C CA  . ARG A 1 21 ? 11.697  26.627 19.616 1.00 16.15 ? 21  ARG A CA  1 
ATOM   143  C C   . ARG A 1 21 ? 12.052  27.591 20.749 1.00 16.24 ? 21  ARG A C   1 
ATOM   144  O O   . ARG A 1 21 ? 12.658  27.189 21.745 1.00 15.05 ? 21  ARG A O   1 
ATOM   145  C CB  . ARG A 1 21 ? 12.733  26.778 18.498 1.00 17.77 ? 21  ARG A CB  1 
ATOM   146  C CG  . ARG A 1 21 ? 14.187  26.862 18.988 1.00 16.68 ? 21  ARG A CG  1 
ATOM   147  C CD  . ARG A 1 21 ? 14.710  25.530 19.522 1.00 20.06 ? 21  ARG A CD  1 
ATOM   148  N NE  . ARG A 1 21 ? 16.052  25.654 20.093 1.00 14.02 ? 21  ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 21 ? 16.304  26.037 21.343 1.00 18.31 ? 21  ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 21 ? 15.306  26.330 22.166 1.00 18.12 ? 21  ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 21 ? 17.556  26.140 21.769 1.00 18.72 ? 21  ARG A NH2 1 
ATOM   152  N N   . ALA A 1 22 ? 11.684  28.861 20.591 1.00 13.98 ? 22  ALA A N   1 
ATOM   153  C CA  . ALA A 1 22 ? 11.989  29.882 21.588 1.00 14.34 ? 22  ALA A CA  1 
ATOM   154  C C   . ALA A 1 22 ? 11.302  29.684 22.936 1.00 16.34 ? 22  ALA A C   1 
ATOM   155  O O   . ALA A 1 22 ? 11.695  30.299 23.928 1.00 17.37 ? 22  ALA A O   1 
ATOM   156  C CB  . ALA A 1 22 ? 11.653  31.262 21.032 1.00 14.07 ? 22  ALA A CB  1 
ATOM   157  N N   . HIS A 1 23 ? 10.279  28.836 22.980 1.00 16.31 ? 23  HIS A N   1 
ATOM   158  C CA  . HIS A 1 23 ? 9.568   28.574 24.231 1.00 17.15 ? 23  HIS A CA  1 
ATOM   159  C C   . HIS A 1 23 ? 10.187  27.411 25.001 1.00 17.65 ? 23  HIS A C   1 
ATOM   160  O O   . HIS A 1 23 ? 9.698   27.053 26.067 1.00 18.88 ? 23  HIS A O   1 
ATOM   161  C CB  . HIS A 1 23 ? 8.094   28.235 23.964 1.00 16.95 ? 23  HIS A CB  1 
ATOM   162  C CG  . HIS A 1 23 ? 7.285   29.384 23.446 1.00 16.98 ? 23  HIS A CG  1 
ATOM   163  N ND1 . HIS A 1 23 ? 5.941   29.275 23.161 1.00 18.85 ? 23  HIS A ND1 1 
ATOM   164  C CD2 . HIS A 1 23 ? 7.630   30.659 23.149 1.00 18.80 ? 23  HIS A CD2 1 
ATOM   165  C CE1 . HIS A 1 23 ? 5.492   30.433 22.709 1.00 19.29 ? 23  HIS A CE1 1 
ATOM   166  N NE2 . HIS A 1 23 ? 6.497   31.289 22.692 1.00 20.22 ? 23  HIS A NE2 1 
ATOM   167  N N   . ILE A 1 24 ? 11.254  26.822 24.466 1.00 17.05 ? 24  ILE A N   1 
ATOM   168  C CA  . ILE A 1 24 ? 11.891  25.676 25.116 1.00 16.55 ? 24  ILE A CA  1 
ATOM   169  C C   . ILE A 1 24 ? 13.224  26.014 25.773 1.00 16.26 ? 24  ILE A C   1 
ATOM   170  O O   . ILE A 1 24 ? 14.117  26.575 25.139 1.00 15.98 ? 24  ILE A O   1 
ATOM   171  C CB  . ILE A 1 24 ? 12.123  24.527 24.107 1.00 16.33 ? 24  ILE A CB  1 
ATOM   172  C CG1 . ILE A 1 24 ? 10.812  24.192 23.397 1.00 16.43 ? 24  ILE A CG1 1 
ATOM   173  C CG2 . ILE A 1 24 ? 12.644  23.283 24.832 1.00 14.62 ? 24  ILE A CG2 1 
ATOM   174  C CD1 . ILE A 1 24 ? 10.935  23.049 22.417 1.00 18.51 ? 24  ILE A CD1 1 
ATOM   175  N N   . LYS A 1 25 ? 13.361  25.658 27.046 1.00 16.13 ? 25  LYS A N   1 
ATOM   176  C CA  . LYS A 1 25 ? 14.595  25.940 27.769 1.00 15.99 ? 25  LYS A CA  1 
ATOM   177  C C   . LYS A 1 25 ? 15.399  24.700 28.142 1.00 16.03 ? 25  LYS A C   1 
ATOM   178  O O   . LYS A 1 25 ? 16.617  24.780 28.285 1.00 16.00 ? 25  LYS A O   1 
ATOM   179  C CB  . LYS A 1 25 ? 14.304  26.764 29.029 1.00 17.53 ? 25  LYS A CB  1 
ATOM   180  C CG  . LYS A 1 25 ? 13.430  26.075 30.067 1.00 16.69 ? 25  LYS A CG  1 
ATOM   181  C CD  . LYS A 1 25 ? 13.268  26.978 31.286 1.00 20.22 ? 25  LYS A CD  1 
ATOM   182  C CE  . LYS A 1 25 ? 12.529  26.287 32.415 1.00 18.12 ? 25  LYS A CE  1 
ATOM   183  N NZ  . LYS A 1 25 ? 12.302  27.212 33.562 1.00 19.79 ? 25  LYS A NZ  1 
ATOM   184  N N   . GLU A 1 26 ? 14.730  23.561 28.304 1.00 15.81 ? 26  GLU A N   1 
ATOM   185  C CA  . GLU A 1 26 ? 15.420  22.315 28.656 1.00 17.57 ? 26  GLU A CA  1 
ATOM   186  C C   . GLU A 1 26 ? 14.727  21.100 28.048 1.00 17.64 ? 26  GLU A C   1 
ATOM   187  O O   . GLU A 1 26 ? 13.626  21.198 27.498 1.00 15.47 ? 26  GLU A O   1 
ATOM   188  C CB  . GLU A 1 26 ? 15.451  22.099 30.175 1.00 17.47 ? 26  GLU A CB  1 
ATOM   189  C CG  . GLU A 1 26 ? 15.956  23.245 31.013 1.00 18.02 ? 26  GLU A CG  1 
ATOM   190  C CD  . GLU A 1 26 ? 15.720  22.997 32.494 1.00 21.58 ? 26  GLU A CD  1 
ATOM   191  O OE1 . GLU A 1 26 ? 15.884  21.838 32.939 1.00 23.12 ? 26  GLU A OE1 1 
ATOM   192  O OE2 . GLU A 1 26 ? 15.372  23.957 33.215 1.00 22.98 ? 26  GLU A OE2 1 
ATOM   193  N N   . TYR A 1 27 ? 15.380  19.948 28.175 1.00 18.51 ? 27  TYR A N   1 
ATOM   194  C CA  . TYR A 1 27 ? 14.834  18.692 27.676 1.00 18.20 ? 27  TYR A CA  1 
ATOM   195  C C   . TYR A 1 27 ? 15.464  17.536 28.443 1.00 18.05 ? 27  TYR A C   1 
ATOM   196  O O   . TYR A 1 27 ? 16.505  17.692 29.078 1.00 18.01 ? 27  TYR A O   1 
ATOM   197  C CB  . TYR A 1 27 ? 15.142  18.521 26.186 1.00 20.54 ? 27  TYR A CB  1 
ATOM   198  C CG  . TYR A 1 27 ? 16.518  17.951 25.913 1.00 21.98 ? 27  TYR A CG  1 
ATOM   199  C CD1 . TYR A 1 27 ? 17.631  18.778 25.830 1.00 23.54 ? 27  TYR A CD1 1 
ATOM   200  C CD2 . TYR A 1 27 ? 16.709  16.579 25.776 1.00 25.21 ? 27  TYR A CD2 1 
ATOM   201  C CE1 . TYR A 1 27 ? 18.901  18.256 25.622 1.00 26.69 ? 27  TYR A CE1 1 
ATOM   202  C CE2 . TYR A 1 27 ? 17.974  16.046 25.564 1.00 26.81 ? 27  TYR A CE2 1 
ATOM   203  C CZ  . TYR A 1 27 ? 19.064  16.889 25.490 1.00 27.92 ? 27  TYR A CZ  1 
ATOM   204  O OH  . TYR A 1 27 ? 20.321  16.364 25.291 1.00 31.25 ? 27  TYR A OH  1 
ATOM   205  N N   . PHE A 1 28 ? 14.815  16.381 28.391 1.00 18.28 ? 28  PHE A N   1 
ATOM   206  C CA  . PHE A 1 28 ? 15.340  15.187 29.023 1.00 18.87 ? 28  PHE A CA  1 
ATOM   207  C C   . PHE A 1 28 ? 14.623  13.985 28.444 1.00 20.94 ? 28  PHE A C   1 
ATOM   208  O O   . PHE A 1 28 ? 13.456  14.072 28.056 1.00 20.22 ? 28  PHE A O   1 
ATOM   209  C CB  . PHE A 1 28 ? 15.197  15.253 30.556 1.00 18.92 ? 28  PHE A CB  1 
ATOM   210  C CG  . PHE A 1 28 ? 13.788  15.093 31.069 1.00 19.12 ? 28  PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 28 ? 13.260  13.836 31.309 1.00 18.61 ? 28  PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 28 ? 13.014  16.204 31.362 1.00 18.32 ? 28  PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 28 ? 11.990  13.689 31.836 1.00 18.64 ? 28  PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 28 ? 11.746  16.064 31.888 1.00 18.78 ? 28  PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 28 ? 11.233  14.802 32.127 1.00 17.04 ? 28  PHE A CZ  1 
ATOM   216  N N   . TYR A 1 29 ? 15.343  12.875 28.334 1.00 21.87 ? 29  TYR A N   1 
ATOM   217  C CA  . TYR A 1 29 ? 14.759  11.653 27.808 1.00 22.89 ? 29  TYR A CA  1 
ATOM   218  C C   . TYR A 1 29 ? 14.112  10.921 28.968 1.00 20.79 ? 29  TYR A C   1 
ATOM   219  O O   . TYR A 1 29 ? 14.653  10.904 30.069 1.00 19.74 ? 29  TYR A O   1 
ATOM   220  C CB  . TYR A 1 29 ? 15.830  10.759 27.184 1.00 24.64 ? 29  TYR A CB  1 
ATOM   221  C CG  . TYR A 1 29 ? 16.401  11.274 25.886 1.00 30.06 ? 29  TYR A CG  1 
ATOM   222  C CD1 . TYR A 1 29 ? 17.417  12.218 25.875 1.00 31.88 ? 29  TYR A CD1 1 
ATOM   223  C CD2 . TYR A 1 29 ? 15.924  10.809 24.666 1.00 31.85 ? 29  TYR A CD2 1 
ATOM   224  C CE1 . TYR A 1 29 ? 17.946  12.684 24.683 1.00 35.53 ? 29  TYR A CE1 1 
ATOM   225  C CE2 . TYR A 1 29 ? 16.444  11.270 23.471 1.00 35.13 ? 29  TYR A CE2 1 
ATOM   226  C CZ  . TYR A 1 29 ? 17.456  12.206 23.487 1.00 35.36 ? 29  TYR A CZ  1 
ATOM   227  O OH  . TYR A 1 29 ? 17.983  12.659 22.301 1.00 39.28 ? 29  TYR A OH  1 
ATOM   228  N N   . THR A 1 30 ? 12.946  10.331 28.734 1.00 19.07 ? 30  THR A N   1 
ATOM   229  C CA  . THR A 1 30 ? 12.286  9.594  29.798 1.00 17.23 ? 30  THR A CA  1 
ATOM   230  C C   . THR A 1 30 ? 13.074  8.313  30.016 1.00 16.74 ? 30  THR A C   1 
ATOM   231  O O   . THR A 1 30 ? 13.803  7.871  29.126 1.00 15.39 ? 30  THR A O   1 
ATOM   232  C CB  . THR A 1 30 ? 10.826  9.261  29.440 1.00 16.43 ? 30  THR A CB  1 
ATOM   233  O OG1 . THR A 1 30 ? 10.761  8.735  28.111 1.00 16.91 ? 30  THR A OG1 1 
ATOM   234  C CG2 . THR A 1 30 ? 9.964   10.511 29.534 1.00 16.74 ? 30  THR A CG2 1 
ATOM   235  N N   . SER A 1 31 ? 12.935  7.733  31.203 1.00 15.16 ? 31  SER A N   1 
ATOM   236  C CA  . SER A 1 31 ? 13.638  6.507  31.556 1.00 16.23 ? 31  SER A CA  1 
ATOM   237  C C   . SER A 1 31 ? 13.503  5.376  30.545 1.00 15.00 ? 31  SER A C   1 
ATOM   238  O O   . SER A 1 31 ? 12.459  5.211  29.920 1.00 14.90 ? 31  SER A O   1 
ATOM   239  C CB  . SER A 1 31 ? 13.153  5.998  32.907 1.00 14.27 ? 31  SER A CB  1 
ATOM   240  O OG  . SER A 1 31 ? 13.667  4.702  33.139 1.00 16.74 ? 31  SER A OG  1 
ATOM   241  N N   . GLY A 1 32 ? 14.566  4.592  30.402 1.00 14.62 ? 32  GLY A N   1 
ATOM   242  C CA  . GLY A 1 32 ? 14.533  3.467  29.487 1.00 14.67 ? 32  GLY A CA  1 
ATOM   243  C C   . GLY A 1 32 ? 13.550  2.419  29.981 1.00 15.37 ? 32  GLY A C   1 
ATOM   244  O O   . GLY A 1 32 ? 13.206  1.494  29.249 1.00 14.95 ? 32  GLY A O   1 
ATOM   245  N N   . LYS A 1 33 ? 13.105  2.564  31.230 1.00 13.24 ? 33  LYS A N   1 
ATOM   246  C CA  . LYS A 1 33 ? 12.143  1.643  31.839 1.00 13.83 ? 33  LYS A CA  1 
ATOM   247  C C   . LYS A 1 33 ? 10.764  1.807  31.200 1.00 13.15 ? 33  LYS A C   1 
ATOM   248  O O   . LYS A 1 33 ? 9.959   0.880  31.187 1.00 12.96 ? 33  LYS A O   1 
ATOM   249  C CB  . LYS A 1 33 ? 12.016  1.922  33.344 1.00 16.64 ? 33  LYS A CB  1 
ATOM   250  C CG  . LYS A 1 33 ? 13.197  1.473  34.211 1.00 18.83 ? 33  LYS A CG  1 
ATOM   251  C CD  . LYS A 1 33 ? 13.162  -0.022 34.430 1.00 19.50 ? 33  LYS A CD  1 
ATOM   252  C CE  . LYS A 1 33 ? 14.129  -0.453 35.520 1.00 23.00 ? 33  LYS A CE  1 
ATOM   253  N NZ  . LYS A 1 33 ? 14.050  -1.929 35.727 1.00 22.39 ? 33  LYS A NZ  1 
ATOM   254  N N   . CYS A 1 34 ? 10.497  3.000  30.683 1.00 13.33 ? 34  CYS A N   1 
ATOM   255  C CA  . CYS A 1 34 ? 9.212   3.297  30.063 1.00 13.35 ? 34  CYS A CA  1 
ATOM   256  C C   . CYS A 1 34 ? 8.978   2.483  28.794 1.00 13.34 ? 34  CYS A C   1 
ATOM   257  O O   . CYS A 1 34 ? 9.927   2.095  28.117 1.00 10.87 ? 34  CYS A O   1 
ATOM   258  C CB  . CYS A 1 34 ? 9.118   4.792  29.751 1.00 12.51 ? 34  CYS A CB  1 
ATOM   259  S SG  . CYS A 1 34 ? 9.190   5.898  31.203 1.00 13.60 ? 34  CYS A SG  1 
ATOM   260  N N   . SER A 1 35 ? 7.707   2.238  28.474 1.00 13.95 ? 35  SER A N   1 
ATOM   261  C CA  . SER A 1 35 ? 7.340   1.460  27.290 1.00 15.68 ? 35  SER A CA  1 
ATOM   262  C C   . SER A 1 35 ? 7.698   2.175  25.995 1.00 15.86 ? 35  SER A C   1 
ATOM   263  O O   . SER A 1 35 ? 8.026   1.535  24.995 1.00 16.65 ? 35  SER A O   1 
ATOM   264  C CB  . SER A 1 35 ? 5.834   1.153  27.295 1.00 17.67 ? 35  SER A CB  1 
ATOM   265  O OG  . SER A 1 35 ? 5.066   2.346  27.263 1.00 17.68 ? 35  SER A OG  1 
ATOM   266  N N   . ASN A 1 36 ? 7.629   3.501  26.017 1.00 16.34 ? 36  ASN A N   1 
ATOM   267  C CA  . ASN A 1 36 ? 7.934   4.305  24.840 1.00 17.28 ? 36  ASN A CA  1 
ATOM   268  C C   . ASN A 1 36 ? 9.137   5.200  25.054 1.00 17.21 ? 36  ASN A C   1 
ATOM   269  O O   . ASN A 1 36 ? 9.335   5.746  26.142 1.00 14.98 ? 36  ASN A O   1 
ATOM   270  C CB  . ASN A 1 36 ? 6.768   5.233  24.474 1.00 17.20 ? 36  ASN A CB  1 
ATOM   271  C CG  . ASN A 1 36 ? 5.479   4.494  24.214 1.00 21.43 ? 36  ASN A CG  1 
ATOM   272  O OD1 . ASN A 1 36 ? 5.440   3.547  23.431 1.00 21.98 ? 36  ASN A OD1 1 
ATOM   273  N ND2 . ASN A 1 36 ? 4.403   4.938  24.862 1.00 19.00 ? 36  ASN A ND2 1 
ATOM   274  N N   . PRO A 1 37 ? 9.970   5.346  24.017 1.00 17.89 ? 37  PRO A N   1 
ATOM   275  C CA  . PRO A 1 37 ? 11.138  6.211  24.134 1.00 18.07 ? 37  PRO A CA  1 
ATOM   276  C C   . PRO A 1 37 ? 10.506  7.593  24.000 1.00 17.45 ? 37  PRO A C   1 
ATOM   277  O O   . PRO A 1 37 ? 9.454   7.729  23.373 1.00 17.89 ? 37  PRO A O   1 
ATOM   278  C CB  . PRO A 1 37 ? 11.974  5.821  22.919 1.00 19.04 ? 37  PRO A CB  1 
ATOM   279  C CG  . PRO A 1 37 ? 10.936  5.457  21.909 1.00 20.55 ? 37  PRO A CG  1 
ATOM   280  C CD  . PRO A 1 37 ? 9.962   4.639  22.724 1.00 18.57 ? 37  PRO A CD  1 
ATOM   281  N N   . ALA A 1 38 ? 11.098  8.614  24.595 1.00 16.52 ? 38  ALA A N   1 
ATOM   282  C CA  . ALA A 1 38 ? 10.487  9.927  24.483 1.00 16.92 ? 38  ALA A CA  1 
ATOM   283  C C   . ALA A 1 38 ? 11.382  11.052 24.945 1.00 17.49 ? 38  ALA A C   1 
ATOM   284  O O   . ALA A 1 38 ? 12.288  10.861 25.752 1.00 17.20 ? 38  ALA A O   1 
ATOM   285  C CB  . ALA A 1 38 ? 9.170   9.959  25.276 1.00 14.75 ? 38  ALA A CB  1 
ATOM   286  N N   . VAL A 1 39 ? 11.105  12.233 24.410 1.00 18.98 ? 39  VAL A N   1 
ATOM   287  C CA  . VAL A 1 39 ? 11.829  13.438 24.755 1.00 18.80 ? 39  VAL A CA  1 
ATOM   288  C C   . VAL A 1 39 ? 10.809  14.357 25.408 1.00 17.93 ? 39  VAL A C   1 
ATOM   289  O O   . VAL A 1 39 ? 9.714   14.545 24.881 1.00 19.85 ? 39  VAL A O   1 
ATOM   290  C CB  . VAL A 1 39 ? 12.394  14.139 23.498 1.00 19.70 ? 39  VAL A CB  1 
ATOM   291  C CG1 . VAL A 1 39 ? 12.901  15.529 23.861 1.00 20.92 ? 39  VAL A CG1 1 
ATOM   292  C CG2 . VAL A 1 39 ? 13.522  13.308 22.900 1.00 21.64 ? 39  VAL A CG2 1 
ATOM   293  N N   . VAL A 1 40 ? 11.149  14.901 26.569 1.00 17.10 ? 40  VAL A N   1 
ATOM   294  C CA  . VAL A 1 40 ? 10.247  15.815 27.248 1.00 16.71 ? 40  VAL A CA  1 
ATOM   295  C C   . VAL A 1 40 ? 10.862  17.200 27.234 1.00 16.14 ? 40  VAL A C   1 
ATOM   296  O O   . VAL A 1 40 ? 11.918  17.421 27.822 1.00 16.23 ? 40  VAL A O   1 
ATOM   297  C CB  . VAL A 1 40 ? 9.998   15.413 28.714 1.00 16.63 ? 40  VAL A CB  1 
ATOM   298  C CG1 . VAL A 1 40 ? 9.281   16.551 29.441 1.00 14.25 ? 40  VAL A CG1 1 
ATOM   299  C CG2 . VAL A 1 40 ? 9.165   14.146 28.774 1.00 17.16 ? 40  VAL A CG2 1 
ATOM   300  N N   . PHE A 1 41 ? 10.212  18.130 26.548 1.00 13.67 ? 41  PHE A N   1 
ATOM   301  C CA  . PHE A 1 41 ? 10.716  19.492 26.485 1.00 15.38 ? 41  PHE A CA  1 
ATOM   302  C C   . PHE A 1 41 ? 10.105  20.307 27.612 1.00 14.80 ? 41  PHE A C   1 
ATOM   303  O O   . PHE A 1 41 ? 8.910   20.206 27.878 1.00 15.80 ? 41  PHE A O   1 
ATOM   304  C CB  . PHE A 1 41 ? 10.358  20.143 25.147 1.00 13.05 ? 41  PHE A CB  1 
ATOM   305  C CG  . PHE A 1 41 ? 11.098  19.569 23.975 1.00 12.42 ? 41  PHE A CG  1 
ATOM   306  C CD1 . PHE A 1 41 ? 12.470  19.706 23.874 1.00 11.90 ? 41  PHE A CD1 1 
ATOM   307  C CD2 . PHE A 1 41 ? 10.421  18.896 22.976 1.00 13.40 ? 41  PHE A CD2 1 
ATOM   308  C CE1 . PHE A 1 41 ? 13.156  19.181 22.794 1.00 10.58 ? 41  PHE A CE1 1 
ATOM   309  C CE2 . PHE A 1 41 ? 11.103  18.369 21.894 1.00 14.36 ? 41  PHE A CE2 1 
ATOM   310  C CZ  . PHE A 1 41 ? 12.470  18.513 21.805 1.00 14.24 ? 41  PHE A CZ  1 
ATOM   311  N N   . VAL A 1 42 ? 10.933  21.099 28.284 1.00 14.40 ? 42  VAL A N   1 
ATOM   312  C CA  . VAL A 1 42 ? 10.453  21.947 29.367 1.00 14.17 ? 42  VAL A CA  1 
ATOM   313  C C   . VAL A 1 42 ? 10.384  23.353 28.790 1.00 14.98 ? 42  VAL A C   1 
ATOM   314  O O   . VAL A 1 42 ? 11.403  23.902 28.356 1.00 14.70 ? 42  VAL A O   1 
ATOM   315  C CB  . VAL A 1 42 ? 11.423  21.942 30.569 1.00 13.05 ? 42  VAL A CB  1 
ATOM   316  C CG1 . VAL A 1 42 ? 10.822  22.741 31.718 1.00 11.73 ? 42  VAL A CG1 1 
ATOM   317  C CG2 . VAL A 1 42 ? 11.713  20.510 31.001 1.00 13.51 ? 42  VAL A CG2 1 
ATOM   318  N N   . THR A 1 43 ? 9.185   23.927 28.768 1.00 14.63 ? 43  THR A N   1 
ATOM   319  C CA  . THR A 1 43 ? 9.001   25.268 28.223 1.00 15.57 ? 43  THR A CA  1 
ATOM   320  C C   . THR A 1 43 ? 9.391   26.310 29.259 1.00 16.89 ? 43  THR A C   1 
ATOM   321  O O   . THR A 1 43 ? 9.659   25.983 30.414 1.00 17.39 ? 43  THR A O   1 
ATOM   322  C CB  . THR A 1 43 ? 7.540   25.520 27.810 1.00 15.35 ? 43  THR A CB  1 
ATOM   323  O OG1 . THR A 1 43 ? 6.732   25.651 28.983 1.00 14.08 ? 43  THR A OG1 1 
ATOM   324  C CG2 . THR A 1 43 ? 7.016   24.359 26.969 1.00 17.14 ? 43  THR A CG2 1 
ATOM   325  N N   . ARG A 1 44 ? 9.421   27.569 28.844 1.00 17.81 ? 44  ARG A N   1 
ATOM   326  C CA  . ARG A 1 44 ? 9.799   28.633 29.754 1.00 20.02 ? 44  ARG A CA  1 
ATOM   327  C C   . ARG A 1 44 ? 8.720   28.953 30.781 1.00 21.59 ? 44  ARG A C   1 
ATOM   328  O O   . ARG A 1 44 ? 8.976   29.653 31.756 1.00 24.06 ? 44  ARG A O   1 
ATOM   329  C CB  . ARG A 1 44 ? 10.219  29.864 28.951 1.00 21.48 ? 44  ARG A CB  1 
ATOM   330  C CG  . ARG A 1 44 ? 11.523  29.597 28.200 1.00 20.95 ? 44  ARG A CG  1 
ATOM   331  C CD  . ARG A 1 44 ? 11.963  30.729 27.304 1.00 22.59 ? 44  ARG A CD  1 
ATOM   332  N NE  . ARG A 1 44 ? 13.220  30.391 26.640 1.00 23.04 ? 44  ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 44 ? 14.383  30.247 27.269 1.00 25.10 ? 44  ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 44 ? 14.458  30.418 28.581 1.00 27.29 ? 44  ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 44 ? 15.470  29.915 26.590 1.00 24.00 ? 44  ARG A NH2 1 
ATOM   336  N N   . LYS A 1 45 ? 7.518   28.428 30.567 1.00 21.49 ? 45  LYS A N   1 
ATOM   337  C CA  . LYS A 1 45 ? 6.429   28.616 31.519 1.00 22.18 ? 45  LYS A CA  1 
ATOM   338  C C   . LYS A 1 45 ? 6.449   27.372 32.412 1.00 20.57 ? 45  LYS A C   1 
ATOM   339  O O   . LYS A 1 45 ? 5.554   27.149 33.228 1.00 19.35 ? 45  LYS A O   1 
ATOM   340  C CB  . LYS A 1 45 ? 5.100   28.732 30.795 1.00 22.48 ? 45  LYS A CB  1 
ATOM   341  N N   . ASN A 1 46 ? 7.490   26.565 32.226 1.00 19.45 ? 46  ASN A N   1 
ATOM   342  C CA  . ASN A 1 46 ? 7.713   25.337 32.983 1.00 20.85 ? 46  ASN A CA  1 
ATOM   343  C C   . ASN A 1 46 ? 6.753   24.185 32.729 1.00 22.46 ? 46  ASN A C   1 
ATOM   344  O O   . ASN A 1 46 ? 6.521   23.355 33.609 1.00 24.28 ? 46  ASN A O   1 
ATOM   345  C CB  . ASN A 1 46 ? 7.778   25.650 34.478 1.00 19.95 ? 46  ASN A CB  1 
ATOM   346  C CG  . ASN A 1 46 ? 9.048   26.385 34.848 1.00 17.88 ? 46  ASN A CG  1 
ATOM   347  O OD1 . ASN A 1 46 ? 10.148  25.898 34.595 1.00 16.05 ? 46  ASN A OD1 1 
ATOM   348  N ND2 . ASN A 1 46 ? 8.905   27.565 35.437 1.00 19.60 ? 46  ASN A ND2 1 
ATOM   349  N N   . ARG A 1 47 ? 6.199   24.131 31.524 1.00 21.21 ? 47  ARG A N   1 
ATOM   350  C CA  . ARG A 1 47 ? 5.310   23.040 31.156 1.00 20.63 ? 47  ARG A CA  1 
ATOM   351  C C   . ARG A 1 47 ? 6.206   21.934 30.614 1.00 18.89 ? 47  ARG A C   1 
ATOM   352  O O   . ARG A 1 47 ? 7.323   22.199 30.173 1.00 18.73 ? 47  ARG A O   1 
ATOM   353  C CB  . ARG A 1 47 ? 4.343   23.471 30.058 1.00 21.69 ? 47  ARG A CB  1 
ATOM   354  C CG  . ARG A 1 47 ? 3.292   24.476 30.475 1.00 27.85 ? 47  ARG A CG  1 
ATOM   355  C CD  . ARG A 1 47 ? 2.341   24.691 29.313 1.00 31.88 ? 47  ARG A CD  1 
ATOM   356  N NE  . ARG A 1 47 ? 1.910   23.403 28.769 1.00 35.72 ? 47  ARG A NE  1 
ATOM   357  C CZ  . ARG A 1 47 ? 1.878   23.109 27.473 1.00 35.41 ? 47  ARG A CZ  1 
ATOM   358  N NH1 . ARG A 1 47 ? 2.250   24.013 26.578 1.00 35.04 ? 47  ARG A NH1 1 
ATOM   359  N NH2 . ARG A 1 47 ? 1.485   21.906 27.074 1.00 36.40 ? 47  ARG A NH2 1 
ATOM   360  N N   . GLN A 1 48 ? 5.718   20.702 30.645 1.00 16.16 ? 48  GLN A N   1 
ATOM   361  C CA  . GLN A 1 48 ? 6.481   19.564 30.148 1.00 16.87 ? 48  GLN A CA  1 
ATOM   362  C C   . GLN A 1 48 ? 5.708   18.892 29.020 1.00 15.95 ? 48  GLN A C   1 
ATOM   363  O O   . GLN A 1 48 ? 4.592   18.403 29.216 1.00 16.80 ? 48  GLN A O   1 
ATOM   364  C CB  . GLN A 1 48 ? 6.752   18.581 31.288 1.00 17.36 ? 48  GLN A CB  1 
ATOM   365  C CG  . GLN A 1 48 ? 7.585   19.202 32.407 1.00 20.28 ? 48  GLN A CG  1 
ATOM   366  C CD  . GLN A 1 48 ? 7.898   18.233 33.526 1.00 21.37 ? 48  GLN A CD  1 
ATOM   367  O OE1 . GLN A 1 48 ? 8.637   17.269 33.340 1.00 20.48 ? 48  GLN A OE1 1 
ATOM   368  N NE2 . GLN A 1 48 ? 7.331   18.486 34.700 1.00 24.02 ? 48  GLN A NE2 1 
ATOM   369  N N   . VAL A 1 49 ? 6.314   18.876 27.838 1.00 16.15 ? 49  VAL A N   1 
ATOM   370  C CA  . VAL A 1 49 ? 5.687   18.305 26.650 1.00 16.95 ? 49  VAL A CA  1 
ATOM   371  C C   . VAL A 1 49 ? 6.408   17.082 26.104 1.00 16.80 ? 49  VAL A C   1 
ATOM   372  O O   . VAL A 1 49 ? 7.614   17.114 25.864 1.00 17.94 ? 49  VAL A O   1 
ATOM   373  C CB  . VAL A 1 49 ? 5.615   19.356 25.522 1.00 17.70 ? 49  VAL A CB  1 
ATOM   374  C CG1 . VAL A 1 49 ? 4.997   18.742 24.277 1.00 16.41 ? 49  VAL A CG1 1 
ATOM   375  C CG2 . VAL A 1 49 ? 4.815   20.561 25.989 1.00 18.15 ? 49  VAL A CG2 1 
ATOM   376  N N   . CYS A 1 50 ? 5.657   16.010 25.890 1.00 14.74 ? 50  CYS A N   1 
ATOM   377  C CA  . CYS A 1 50 ? 6.215   14.771 25.363 1.00 16.47 ? 50  CYS A CA  1 
ATOM   378  C C   . CYS A 1 50 ? 6.406   14.869 23.849 1.00 15.63 ? 50  CYS A C   1 
ATOM   379  O O   . CYS A 1 50 ? 5.537   15.378 23.137 1.00 18.24 ? 50  CYS A O   1 
ATOM   380  C CB  . CYS A 1 50 ? 5.285   13.601 25.688 1.00 16.79 ? 50  CYS A CB  1 
ATOM   381  S SG  . CYS A 1 50 ? 5.254   13.057 27.428 1.00 16.99 ? 50  CYS A SG  1 
ATOM   382  N N   . ALA A 1 51 ? 7.539   14.373 23.364 1.00 15.86 ? 51  ALA A N   1 
ATOM   383  C CA  . ALA A 1 51 ? 7.854   14.417 21.940 1.00 17.87 ? 51  ALA A CA  1 
ATOM   384  C C   . ALA A 1 51 ? 8.531   13.134 21.473 1.00 18.74 ? 51  ALA A C   1 
ATOM   385  O O   . ALA A 1 51 ? 9.173   12.435 22.261 1.00 17.78 ? 51  ALA A O   1 
ATOM   386  C CB  . ALA A 1 51 ? 8.751   15.610 21.649 1.00 15.55 ? 51  ALA A CB  1 
ATOM   387  N N   . ASN A 1 52 ? 8.390   12.838 20.184 1.00 20.52 ? 52  ASN A N   1 
ATOM   388  C CA  . ASN A 1 52 ? 8.969   11.633 19.588 1.00 23.24 ? 52  ASN A CA  1 
ATOM   389  C C   . ASN A 1 52 ? 10.410  11.866 19.138 1.00 23.40 ? 52  ASN A C   1 
ATOM   390  O O   . ASN A 1 52 ? 10.672  12.683 18.257 1.00 25.26 ? 52  ASN A O   1 
ATOM   391  C CB  . ASN A 1 52 ? 8.134   11.197 18.384 1.00 25.28 ? 52  ASN A CB  1 
ATOM   392  C CG  . ASN A 1 52 ? 8.532   9.828  17.862 1.00 28.15 ? 52  ASN A CG  1 
ATOM   393  O OD1 . ASN A 1 52 ? 9.711   9.472  17.843 1.00 27.22 ? 52  ASN A OD1 1 
ATOM   394  N ND2 . ASN A 1 52 ? 7.546   9.059  17.420 1.00 29.74 ? 52  ASN A ND2 1 
ATOM   395  N N   . PRO A 1 53 ? 11.360  11.126 19.727 1.00 25.18 ? 53  PRO A N   1 
ATOM   396  C CA  . PRO A 1 53 ? 12.797  11.203 19.439 1.00 26.33 ? 53  PRO A CA  1 
ATOM   397  C C   . PRO A 1 53 ? 13.151  10.887 17.986 1.00 27.73 ? 53  PRO A C   1 
ATOM   398  O O   . PRO A 1 53 ? 14.226  11.251 17.511 1.00 29.23 ? 53  PRO A O   1 
ATOM   399  C CB  . PRO A 1 53 ? 13.398  10.172 20.395 1.00 26.73 ? 53  PRO A CB  1 
ATOM   400  C CG  . PRO A 1 53 ? 12.394  10.088 21.501 1.00 26.31 ? 53  PRO A CG  1 
ATOM   401  C CD  . PRO A 1 53 ? 11.095  10.108 20.754 1.00 24.83 ? 53  PRO A CD  1 
ATOM   402  N N   . GLU A 1 54 ? 12.252  10.204 17.288 1.00 29.18 ? 54  GLU A N   1 
ATOM   403  C CA  . GLU A 1 54 ? 12.497  9.837  15.898 1.00 31.32 ? 54  GLU A CA  1 
ATOM   404  C C   . GLU A 1 54 ? 12.166  10.975 14.945 1.00 32.03 ? 54  GLU A C   1 
ATOM   405  O O   . GLU A 1 54 ? 12.566  10.948 13.782 1.00 33.62 ? 54  GLU A O   1 
ATOM   406  C CB  . GLU A 1 54 ? 11.687  8.596  15.533 1.00 31.94 ? 54  GLU A CB  1 
ATOM   407  N N   . LYS A 1 55 ? 11.431  11.970 15.433 1.00 31.58 ? 55  LYS A N   1 
ATOM   408  C CA  . LYS A 1 55 ? 11.059  13.113 14.608 1.00 30.73 ? 55  LYS A CA  1 
ATOM   409  C C   . LYS A 1 55 ? 12.265  14.002 14.349 1.00 29.69 ? 55  LYS A C   1 
ATOM   410  O O   . LYS A 1 55 ? 13.080  14.241 15.241 1.00 28.96 ? 55  LYS A O   1 
ATOM   411  C CB  . LYS A 1 55 ? 9.956   13.926 15.284 1.00 32.41 ? 55  LYS A CB  1 
ATOM   412  C CG  . LYS A 1 55 ? 8.597   13.248 15.294 1.00 35.02 ? 55  LYS A CG  1 
ATOM   413  C CD  . LYS A 1 55 ? 8.032   13.127 13.889 1.00 39.01 ? 55  LYS A CD  1 
ATOM   414  C CE  . LYS A 1 55 ? 6.632   12.535 13.911 1.00 41.18 ? 55  LYS A CE  1 
ATOM   415  N NZ  . LYS A 1 55 ? 6.023   12.482 12.552 1.00 44.24 ? 55  LYS A NZ  1 
ATOM   416  N N   . LYS A 1 56 ? 12.371  14.495 13.120 1.00 28.46 ? 56  LYS A N   1 
ATOM   417  C CA  . LYS A 1 56 ? 13.482  15.351 12.734 1.00 27.58 ? 56  LYS A CA  1 
ATOM   418  C C   . LYS A 1 56 ? 13.578  16.622 13.573 1.00 25.06 ? 56  LYS A C   1 
ATOM   419  O O   . LYS A 1 56 ? 14.653  16.957 14.071 1.00 24.51 ? 56  LYS A O   1 
ATOM   420  C CB  . LYS A 1 56 ? 13.363  15.717 11.253 1.00 30.19 ? 56  LYS A CB  1 
ATOM   421  C CG  . LYS A 1 56 ? 14.413  16.692 10.752 1.00 33.71 ? 56  LYS A CG  1 
ATOM   422  C CD  . LYS A 1 56 ? 14.279  16.888 9.246  1.00 38.13 ? 56  LYS A CD  1 
ATOM   423  C CE  . LYS A 1 56 ? 15.219  17.964 8.724  1.00 41.56 ? 56  LYS A CE  1 
ATOM   424  N NZ  . LYS A 1 56 ? 14.858  19.315 9.239  1.00 45.84 ? 56  LYS A NZ  1 
ATOM   425  N N   . TRP A 1 57 ? 12.462  17.326 13.739 1.00 23.24 ? 57  TRP A N   1 
ATOM   426  C CA  . TRP A 1 57 ? 12.483  18.563 14.515 1.00 22.60 ? 57  TRP A CA  1 
ATOM   427  C C   . TRP A 1 57 ? 12.881  18.323 15.965 1.00 21.45 ? 57  TRP A C   1 
ATOM   428  O O   . TRP A 1 57 ? 13.483  19.182 16.604 1.00 21.55 ? 57  TRP A O   1 
ATOM   429  C CB  . TRP A 1 57 ? 11.124  19.275 14.458 1.00 22.74 ? 57  TRP A CB  1 
ATOM   430  C CG  . TRP A 1 57 ? 10.001  18.609 15.213 1.00 22.74 ? 57  TRP A CG  1 
ATOM   431  C CD1 . TRP A 1 57 ? 9.099   17.712 14.722 1.00 22.62 ? 57  TRP A CD1 1 
ATOM   432  C CD2 . TRP A 1 57 ? 9.638   18.833 16.583 1.00 23.49 ? 57  TRP A CD2 1 
ATOM   433  N NE1 . TRP A 1 57 ? 8.193   17.368 15.698 1.00 22.58 ? 57  TRP A NE1 1 
ATOM   434  C CE2 . TRP A 1 57 ? 8.503   18.041 16.850 1.00 23.44 ? 57  TRP A CE2 1 
ATOM   435  C CE3 . TRP A 1 57 ? 10.162  19.629 17.608 1.00 23.70 ? 57  TRP A CE3 1 
ATOM   436  C CZ2 . TRP A 1 57 ? 7.880   18.022 18.099 1.00 24.13 ? 57  TRP A CZ2 1 
ATOM   437  C CZ3 . TRP A 1 57 ? 9.544   19.609 18.848 1.00 24.04 ? 57  TRP A CZ3 1 
ATOM   438  C CH2 . TRP A 1 57 ? 8.415   18.811 19.082 1.00 25.11 ? 57  TRP A CH2 1 
ATOM   439  N N   . VAL A 1 58 ? 12.554  17.147 16.485 1.00 22.02 ? 58  VAL A N   1 
ATOM   440  C CA  . VAL A 1 58 ? 12.899  16.833 17.860 1.00 21.14 ? 58  VAL A CA  1 
ATOM   441  C C   . VAL A 1 58 ? 14.406  16.729 18.007 1.00 22.21 ? 58  VAL A C   1 
ATOM   442  O O   . VAL A 1 58 ? 14.983  17.285 18.937 1.00 22.67 ? 58  VAL A O   1 
ATOM   443  C CB  . VAL A 1 58 ? 12.252  15.515 18.314 1.00 20.42 ? 58  VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 58 ? 12.701  15.176 19.729 1.00 19.99 ? 58  VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 58 ? 10.741  15.645 18.256 1.00 19.81 ? 58  VAL A CG2 1 
ATOM   446  N N   . ARG A 1 59 ? 15.046  16.026 17.078 1.00 22.67 ? 59  ARG A N   1 
ATOM   447  C CA  . ARG A 1 59 ? 16.494  15.863 17.121 1.00 21.14 ? 59  ARG A CA  1 
ATOM   448  C C   . ARG A 1 59 ? 17.204  17.194 16.923 1.00 21.47 ? 59  ARG A C   1 
ATOM   449  O O   . ARG A 1 59 ? 18.236  17.453 17.543 1.00 20.45 ? 59  ARG A O   1 
ATOM   450  C CB  . ARG A 1 59 ? 16.945  14.869 16.050 1.00 21.26 ? 59  ARG A CB  1 
ATOM   451  N N   . GLU A 1 60 ? 16.653  18.038 16.056 1.00 21.56 ? 60  GLU A N   1 
ATOM   452  C CA  . GLU A 1 60 ? 17.253  19.339 15.787 1.00 22.82 ? 60  GLU A CA  1 
ATOM   453  C C   . GLU A 1 60 ? 17.150  20.237 17.015 1.00 21.67 ? 60  GLU A C   1 
ATOM   454  O O   . GLU A 1 60 ? 18.109  20.916 17.374 1.00 23.23 ? 60  GLU A O   1 
ATOM   455  C CB  . GLU A 1 60 ? 16.576  19.994 14.575 1.00 24.38 ? 60  GLU A CB  1 
ATOM   456  C CG  . GLU A 1 60 ? 16.645  19.125 13.318 1.00 28.21 ? 60  GLU A CG  1 
ATOM   457  C CD  . GLU A 1 60 ? 16.105  19.811 12.075 1.00 31.34 ? 60  GLU A CD  1 
ATOM   458  O OE1 . GLU A 1 60 ? 14.991  20.378 12.134 1.00 31.97 ? 60  GLU A OE1 1 
ATOM   459  O OE2 . GLU A 1 60 ? 16.794  19.769 11.032 1.00 30.90 ? 60  GLU A OE2 1 
ATOM   460  N N   . TYR A 1 61 ? 15.988  20.232 17.663 1.00 21.71 ? 61  TYR A N   1 
ATOM   461  C CA  . TYR A 1 61 ? 15.789  21.037 18.866 1.00 21.12 ? 61  TYR A CA  1 
ATOM   462  C C   . TYR A 1 61 ? 16.805  20.627 19.928 1.00 20.79 ? 61  TYR A C   1 
ATOM   463  O O   . TYR A 1 61 ? 17.360  21.472 20.631 1.00 19.74 ? 61  TYR A O   1 
ATOM   464  C CB  . TYR A 1 61 ? 14.368  20.843 19.404 1.00 22.40 ? 61  TYR A CB  1 
ATOM   465  C CG  . TYR A 1 61 ? 13.315  21.704 18.735 1.00 22.23 ? 61  TYR A CG  1 
ATOM   466  C CD1 . TYR A 1 61 ? 13.445  22.101 17.409 1.00 22.08 ? 61  TYR A CD1 1 
ATOM   467  C CD2 . TYR A 1 61 ? 12.180  22.103 19.427 1.00 20.44 ? 61  TYR A CD2 1 
ATOM   468  C CE1 . TYR A 1 61 ? 12.477  22.874 16.796 1.00 21.40 ? 61  TYR A CE1 1 
ATOM   469  C CE2 . TYR A 1 61 ? 11.206  22.874 18.820 1.00 21.91 ? 61  TYR A CE2 1 
ATOM   470  C CZ  . TYR A 1 61 ? 11.360  23.256 17.507 1.00 20.15 ? 61  TYR A CZ  1 
ATOM   471  O OH  . TYR A 1 61 ? 10.393  24.024 16.903 1.00 22.71 ? 61  TYR A OH  1 
ATOM   472  N N   . ILE A 1 62 ? 17.046  19.323 20.041 1.00 22.18 ? 62  ILE A N   1 
ATOM   473  C CA  . ILE A 1 62 ? 18.005  18.807 21.009 1.00 21.50 ? 62  ILE A CA  1 
ATOM   474  C C   . ILE A 1 62 ? 19.408  19.301 20.681 1.00 22.53 ? 62  ILE A C   1 
ATOM   475  O O   . ILE A 1 62 ? 20.134  19.774 21.557 1.00 21.59 ? 62  ILE A O   1 
ATOM   476  C CB  . ILE A 1 62 ? 17.999  17.258 21.023 1.00 23.66 ? 62  ILE A CB  1 
ATOM   477  C CG1 . ILE A 1 62 ? 16.697  16.756 21.653 1.00 23.48 ? 62  ILE A CG1 1 
ATOM   478  C CG2 . ILE A 1 62 ? 19.214  16.732 21.778 1.00 24.65 ? 62  ILE A CG2 1 
ATOM   479  C CD1 . ILE A 1 62 ? 16.559  15.248 21.678 1.00 24.61 ? 62  ILE A CD1 1 
ATOM   480  N N   . ASN A 1 63 ? 19.789  19.191 19.412 1.00 22.95 ? 63  ASN A N   1 
ATOM   481  C CA  . ASN A 1 63 ? 21.107  19.639 18.988 1.00 22.91 ? 63  ASN A CA  1 
ATOM   482  C C   . ASN A 1 63 ? 21.270  21.126 19.301 1.00 22.15 ? 63  ASN A C   1 
ATOM   483  O O   . ASN A 1 63 ? 22.346  21.580 19.686 1.00 22.88 ? 63  ASN A O   1 
ATOM   484  C CB  . ASN A 1 63 ? 21.295  19.393 17.485 1.00 23.89 ? 63  ASN A CB  1 
ATOM   485  C CG  . ASN A 1 63 ? 21.165  17.923 17.109 1.00 26.78 ? 63  ASN A CG  1 
ATOM   486  O OD1 . ASN A 1 63 ? 21.491  17.035 17.898 1.00 26.70 ? 63  ASN A OD1 1 
ATOM   487  N ND2 . ASN A 1 63 ? 20.706  17.662 15.889 1.00 28.66 ? 63  ASN A ND2 1 
ATOM   488  N N   . SER A 1 64 ? 20.189  21.880 19.146 1.00 22.64 ? 64  SER A N   1 
ATOM   489  C CA  . SER A 1 64 ? 20.221  23.312 19.420 1.00 23.14 ? 64  SER A CA  1 
ATOM   490  C C   . SER A 1 64 ? 20.359  23.576 20.919 1.00 22.91 ? 64  SER A C   1 
ATOM   491  O O   . SER A 1 64 ? 21.177  24.394 21.347 1.00 22.21 ? 64  SER A O   1 
ATOM   492  C CB  . SER A 1 64 ? 18.946  23.976 18.883 1.00 21.36 ? 64  SER A CB  1 
ATOM   493  O OG  . SER A 1 64 ? 18.899  25.350 19.225 1.00 24.13 ? 64  SER A OG  1 
ATOM   494  N N   . LEU A 1 65 ? 19.559  22.876 21.716 1.00 22.25 ? 65  LEU A N   1 
ATOM   495  C CA  . LEU A 1 65 ? 19.596  23.041 23.163 1.00 21.62 ? 65  LEU A CA  1 
ATOM   496  C C   . LEU A 1 65 ? 20.968  22.714 23.741 1.00 24.27 ? 65  LEU A C   1 
ATOM   497  O O   . LEU A 1 65 ? 21.390  23.314 24.728 1.00 23.74 ? 65  LEU A O   1 
ATOM   498  C CB  . LEU A 1 65 ? 18.526  22.159 23.816 1.00 19.13 ? 65  LEU A CB  1 
ATOM   499  C CG  . LEU A 1 65 ? 17.084  22.613 23.559 1.00 17.22 ? 65  LEU A CG  1 
ATOM   500  C CD1 . LEU A 1 65 ? 16.104  21.517 23.917 1.00 16.15 ? 65  LEU A CD1 1 
ATOM   501  C CD2 . LEU A 1 65 ? 16.813  23.867 24.369 1.00 17.71 ? 65  LEU A CD2 1 
ATOM   502  N N   . GLU A 1 66 ? 21.666  21.767 23.124 1.00 26.61 ? 66  GLU A N   1 
ATOM   503  C CA  . GLU A 1 66 ? 22.989  21.376 23.600 1.00 31.31 ? 66  GLU A CA  1 
ATOM   504  C C   . GLU A 1 66 ? 24.049  22.427 23.289 1.00 33.42 ? 66  GLU A C   1 
ATOM   505  O O   . GLU A 1 66 ? 25.172  22.350 23.779 1.00 34.91 ? 66  GLU A O   1 
ATOM   506  C CB  . GLU A 1 66 ? 23.390  20.030 22.991 1.00 31.96 ? 66  GLU A CB  1 
ATOM   507  C CG  . GLU A 1 66 ? 22.624  18.850 23.568 1.00 34.81 ? 66  GLU A CG  1 
ATOM   508  C CD  . GLU A 1 66 ? 23.009  18.550 25.009 1.00 38.28 ? 66  GLU A CD  1 
ATOM   509  O OE1 . GLU A 1 66 ? 24.051  19.065 25.471 1.00 39.07 ? 66  GLU A OE1 1 
ATOM   510  O OE2 . GLU A 1 66 ? 22.276  17.789 25.676 1.00 37.99 ? 66  GLU A OE2 1 
ATOM   511  N N   . MET A 1 67 ? 23.688  23.414 22.477 1.00 37.73 ? 67  MET A N   1 
ATOM   512  C CA  . MET A 1 67 ? 24.619  24.478 22.117 1.00 40.74 ? 67  MET A CA  1 
ATOM   513  C C   . MET A 1 67 ? 24.507  25.646 23.083 1.00 43.72 ? 67  MET A C   1 
ATOM   514  O O   . MET A 1 67 ? 25.512  26.158 23.577 1.00 45.50 ? 67  MET A O   1 
ATOM   515  C CB  . MET A 1 67 ? 24.340  24.970 20.696 1.00 39.73 ? 67  MET A CB  1 
ATOM   516  C CG  . MET A 1 67 ? 24.755  24.004 19.609 1.00 39.22 ? 67  MET A CG  1 
ATOM   517  S SD  . MET A 1 67 ? 26.536  23.705 19.595 1.00 38.56 ? 67  MET A SD  1 
ATOM   518  C CE  . MET A 1 67 ? 26.608  22.213 18.599 1.00 36.78 ? 67  MET A CE  1 
ATOM   519  N N   . SER A 1 68 ? 23.274  26.065 23.346 1.00 47.04 ? 68  SER A N   1 
ATOM   520  C CA  . SER A 1 68 ? 23.013  27.181 24.245 1.00 49.32 ? 68  SER A CA  1 
ATOM   521  C C   . SER A 1 68 ? 23.634  26.941 25.618 1.00 50.48 ? 68  SER A C   1 
ATOM   522  O O   . SER A 1 68 ? 24.089  25.804 25.871 1.00 51.77 ? 68  SER A O   1 
ATOM   523  C CB  . SER A 1 68 ? 21.505  27.381 24.389 1.00 49.36 ? 68  SER A CB  1 
ATOM   524  O OG  . SER A 1 68 ? 20.883  27.442 23.116 1.00 50.97 ? 68  SER A OG  1 
ATOM   525  O OXT . SER A 1 68 ? 23.650  27.890 26.428 1.00 51.50 ? 68  SER A OXT 1 
ATOM   526  N N   . SER B 1 4  ? 0.071   20.945 34.108 1.00 41.68 ? 4   SER B N   1 
ATOM   527  C CA  . SER B 1 4  ? 0.762   21.526 32.918 1.00 40.02 ? 4   SER B CA  1 
ATOM   528  C C   . SER B 1 4  ? 1.822   20.582 32.358 1.00 38.09 ? 4   SER B C   1 
ATOM   529  O O   . SER B 1 4  ? 2.793   21.022 31.742 1.00 38.16 ? 4   SER B O   1 
ATOM   530  C CB  . SER B 1 4  ? 1.414   22.861 33.290 1.00 41.07 ? 4   SER B CB  1 
ATOM   531  O OG  . SER B 1 4  ? 2.318   22.706 34.370 1.00 40.88 ? 4   SER B OG  1 
ATOM   532  N N   . SER B 1 5  ? 1.629   19.284 32.570 1.00 35.54 ? 5   SER B N   1 
ATOM   533  C CA  . SER B 1 5  ? 2.572   18.281 32.087 1.00 32.01 ? 5   SER B CA  1 
ATOM   534  C C   . SER B 1 5  ? 1.861   17.154 31.341 1.00 30.05 ? 5   SER B C   1 
ATOM   535  O O   . SER B 1 5  ? 0.762   16.747 31.716 1.00 29.36 ? 5   SER B O   1 
ATOM   536  C CB  . SER B 1 5  ? 3.365   17.701 33.261 1.00 30.75 ? 5   SER B CB  1 
ATOM   537  O OG  . SER B 1 5  ? 4.172   16.615 32.842 1.00 29.74 ? 5   SER B OG  1 
ATOM   538  N N   . ASP B 1 6  ? 2.499   16.656 30.286 1.00 27.79 ? 6   ASP B N   1 
ATOM   539  C CA  . ASP B 1 6  ? 1.938   15.576 29.479 1.00 24.61 ? 6   ASP B CA  1 
ATOM   540  C C   . ASP B 1 6  ? 2.425   14.211 29.948 1.00 22.98 ? 6   ASP B C   1 
ATOM   541  O O   . ASP B 1 6  ? 1.967   13.182 29.448 1.00 19.97 ? 6   ASP B O   1 
ATOM   542  C CB  . ASP B 1 6  ? 2.309   15.772 28.006 1.00 25.96 ? 6   ASP B CB  1 
ATOM   543  N N   . THR B 1 7  ? 3.354   14.201 30.900 1.00 19.34 ? 7   THR B N   1 
ATOM   544  C CA  . THR B 1 7  ? 3.885   12.943 31.408 1.00 18.59 ? 7   THR B CA  1 
ATOM   545  C C   . THR B 1 7  ? 2.934   12.258 32.384 1.00 17.29 ? 7   THR B C   1 
ATOM   546  O O   . THR B 1 7  ? 2.010   12.872 32.918 1.00 17.66 ? 7   THR B O   1 
ATOM   547  C CB  . THR B 1 7  ? 5.249   13.128 32.101 1.00 17.34 ? 7   THR B CB  1 
ATOM   548  O OG1 . THR B 1 7  ? 5.095   13.967 33.251 1.00 17.66 ? 7   THR B OG1 1 
ATOM   549  C CG2 . THR B 1 7  ? 6.248   13.752 31.135 1.00 17.54 ? 7   THR B CG2 1 
ATOM   550  N N   . THR B 1 8  ? 3.188   10.974 32.599 1.00 14.65 ? 8   THR B N   1 
ATOM   551  C CA  . THR B 1 8  ? 2.391   10.128 33.470 1.00 15.26 ? 8   THR B CA  1 
ATOM   552  C C   . THR B 1 8  ? 3.327   9.440  34.451 1.00 14.83 ? 8   THR B C   1 
ATOM   553  O O   . THR B 1 8  ? 4.332   8.860  34.049 1.00 15.21 ? 8   THR B O   1 
ATOM   554  C CB  . THR B 1 8  ? 1.685   9.046  32.640 1.00 18.63 ? 8   THR B CB  1 
ATOM   555  O OG1 . THR B 1 8  ? 0.691   9.658  31.813 1.00 19.53 ? 8   THR B OG1 1 
ATOM   556  C CG2 . THR B 1 8  ? 1.057   7.981  33.542 1.00 18.13 ? 8   THR B CG2 1 
ATOM   557  N N   . PRO B 1 9  ? 3.021   9.506  35.753 1.00 15.51 ? 9   PRO B N   1 
ATOM   558  C CA  . PRO B 1 9  ? 3.901   8.850  36.718 1.00 14.54 ? 9   PRO B CA  1 
ATOM   559  C C   . PRO B 1 9  ? 3.667   7.340  36.730 1.00 14.93 ? 9   PRO B C   1 
ATOM   560  O O   . PRO B 1 9  ? 2.534   6.879  36.874 1.00 12.28 ? 9   PRO B O   1 
ATOM   561  C CB  . PRO B 1 9  ? 3.511   9.511  38.035 1.00 16.66 ? 9   PRO B CB  1 
ATOM   562  C CG  . PRO B 1 9  ? 2.031   9.729  37.849 1.00 16.81 ? 9   PRO B CG  1 
ATOM   563  C CD  . PRO B 1 9  ? 1.954   10.262 36.437 1.00 13.91 ? 9   PRO B CD  1 
ATOM   564  N N   . CYS B 1 10 ? 4.740   6.576  36.553 1.00 12.57 ? 10  CYS B N   1 
ATOM   565  C CA  . CYS B 1 10 ? 4.652   5.125  36.569 1.00 12.37 ? 10  CYS B CA  1 
ATOM   566  C C   . CYS B 1 10 ? 5.621   4.564  37.608 1.00 12.97 ? 10  CYS B C   1 
ATOM   567  O O   . CYS B 1 10 ? 6.546   5.252  38.043 1.00 12.86 ? 10  CYS B O   1 
ATOM   568  C CB  . CYS B 1 10 ? 4.989   4.540  35.196 1.00 13.64 ? 10  CYS B CB  1 
ATOM   569  S SG  . CYS B 1 10 ? 3.762   4.812  33.875 1.00 14.11 ? 10  CYS B SG  1 
ATOM   570  N N   . CYS B 1 11 ? 5.407   3.307  37.986 1.00 13.08 ? 11  CYS B N   1 
ATOM   571  C CA  . CYS B 1 11 ? 6.242   2.634  38.972 1.00 13.92 ? 11  CYS B CA  1 
ATOM   572  C C   . CYS B 1 11 ? 6.993   1.438  38.407 1.00 15.49 ? 11  CYS B C   1 
ATOM   573  O O   . CYS B 1 11 ? 6.419   0.615  37.687 1.00 13.62 ? 11  CYS B O   1 
ATOM   574  C CB  . CYS B 1 11 ? 5.389   2.161  40.139 1.00 13.99 ? 11  CYS B CB  1 
ATOM   575  S SG  . CYS B 1 11 ? 4.740   3.503  41.168 1.00 14.55 ? 11  CYS B SG  1 
ATOM   576  N N   . PHE B 1 12 ? 8.275   1.338  38.749 1.00 14.45 ? 12  PHE B N   1 
ATOM   577  C CA  . PHE B 1 12 ? 9.094   0.233  38.277 1.00 14.96 ? 12  PHE B CA  1 
ATOM   578  C C   . PHE B 1 12 ? 9.729   -0.563 39.410 1.00 16.82 ? 12  PHE B C   1 
ATOM   579  O O   . PHE B 1 12 ? 10.478  -1.509 39.173 1.00 18.89 ? 12  PHE B O   1 
ATOM   580  C CB  . PHE B 1 12 ? 10.156  0.751  37.310 1.00 15.11 ? 12  PHE B CB  1 
ATOM   581  C CG  . PHE B 1 12 ? 9.576   1.402  36.095 1.00 12.42 ? 12  PHE B CG  1 
ATOM   582  C CD1 . PHE B 1 12 ? 8.998   0.633  35.096 1.00 14.43 ? 12  PHE B CD1 1 
ATOM   583  C CD2 . PHE B 1 12 ? 9.540   2.782  35.980 1.00 11.97 ? 12  PHE B CD2 1 
ATOM   584  C CE1 . PHE B 1 12 ? 8.391   1.229  34.006 1.00 13.48 ? 12  PHE B CE1 1 
ATOM   585  C CE2 . PHE B 1 12 ? 8.933   3.387  34.892 1.00 13.51 ? 12  PHE B CE2 1 
ATOM   586  C CZ  . PHE B 1 12 ? 8.357   2.611  33.905 1.00 13.68 ? 12  PHE B CZ  1 
ATOM   587  N N   . ALA B 1 13 ? 9.411   -0.177 40.640 1.00 16.46 ? 13  ALA B N   1 
ATOM   588  C CA  . ALA B 1 13 ? 9.899   -0.860 41.833 1.00 16.26 ? 13  ALA B CA  1 
ATOM   589  C C   . ALA B 1 13 ? 8.953   -0.517 42.980 1.00 16.28 ? 13  ALA B C   1 
ATOM   590  O O   . ALA B 1 13 ? 8.316   0.537  42.965 1.00 14.68 ? 13  ALA B O   1 
ATOM   591  C CB  . ALA B 1 13 ? 11.316  -0.406 42.164 1.00 18.41 ? 13  ALA B CB  1 
ATOM   592  N N   . TYR B 1 14 ? 8.845   -1.411 43.957 1.00 16.78 ? 14  TYR B N   1 
ATOM   593  C CA  . TYR B 1 14 ? 7.980   -1.181 45.114 1.00 18.87 ? 14  TYR B CA  1 
ATOM   594  C C   . TYR B 1 14 ? 8.828   -0.999 46.366 1.00 20.31 ? 14  TYR B C   1 
ATOM   595  O O   . TYR B 1 14 ? 9.847   -1.667 46.532 1.00 20.60 ? 14  TYR B O   1 
ATOM   596  C CB  . TYR B 1 14 ? 7.044   -2.366 45.339 1.00 17.72 ? 14  TYR B CB  1 
ATOM   597  C CG  . TYR B 1 14 ? 6.143   -2.696 44.178 1.00 16.51 ? 14  TYR B CG  1 
ATOM   598  C CD1 . TYR B 1 14 ? 5.250   -1.756 43.674 1.00 18.04 ? 14  TYR B CD1 1 
ATOM   599  C CD2 . TYR B 1 14 ? 6.161   -3.959 43.603 1.00 17.35 ? 14  TYR B CD2 1 
ATOM   600  C CE1 . TYR B 1 14 ? 4.398   -2.066 42.632 1.00 14.35 ? 14  TYR B CE1 1 
ATOM   601  C CE2 . TYR B 1 14 ? 5.315   -4.281 42.562 1.00 18.22 ? 14  TYR B CE2 1 
ATOM   602  C CZ  . TYR B 1 14 ? 4.436   -3.334 42.080 1.00 18.81 ? 14  TYR B CZ  1 
ATOM   603  O OH  . TYR B 1 14 ? 3.596   -3.659 41.040 1.00 17.61 ? 14  TYR B OH  1 
ATOM   604  N N   . ILE B 1 15 ? 8.415   -0.101 47.252 1.00 19.22 ? 15  ILE B N   1 
ATOM   605  C CA  . ILE B 1 15 ? 9.176   0.102  48.472 1.00 19.49 ? 15  ILE B CA  1 
ATOM   606  C C   . ILE B 1 15 ? 9.167   -1.226 49.241 1.00 20.15 ? 15  ILE B C   1 
ATOM   607  O O   . ILE B 1 15 ? 8.134   -1.880 49.366 1.00 16.23 ? 15  ILE B O   1 
ATOM   608  C CB  . ILE B 1 15 ? 8.580   1.250  49.317 1.00 19.82 ? 15  ILE B CB  1 
ATOM   609  C CG1 . ILE B 1 15 ? 9.509   1.548  50.497 1.00 20.32 ? 15  ILE B CG1 1 
ATOM   610  C CG2 . ILE B 1 15 ? 7.165   0.896  49.771 1.00 18.96 ? 15  ILE B CG2 1 
ATOM   611  C CD1 . ILE B 1 15 ? 9.175   2.826  51.234 1.00 20.80 ? 15  ILE B CD1 1 
ATOM   612  N N   . ALA B 1 16 ? 10.333  -1.626 49.733 1.00 21.06 ? 16  ALA B N   1 
ATOM   613  C CA  . ALA B 1 16 ? 10.488  -2.894 50.436 1.00 23.83 ? 16  ALA B CA  1 
ATOM   614  C C   . ALA B 1 16 ? 9.767   -3.028 51.774 1.00 25.02 ? 16  ALA B C   1 
ATOM   615  O O   . ALA B 1 16 ? 9.205   -4.081 52.077 1.00 26.51 ? 16  ALA B O   1 
ATOM   616  C CB  . ALA B 1 16 ? 11.976  -3.189 50.623 1.00 24.54 ? 16  ALA B CB  1 
ATOM   617  N N   . ARG B 1 17 ? 9.784   -1.972 52.576 1.00 24.52 ? 17  ARG B N   1 
ATOM   618  C CA  . ARG B 1 17 ? 9.151   -2.019 53.887 1.00 24.11 ? 17  ARG B CA  1 
ATOM   619  C C   . ARG B 1 17 ? 8.018   -1.013 54.005 1.00 24.25 ? 17  ARG B C   1 
ATOM   620  O O   . ARG B 1 17 ? 7.992   -0.004 53.304 1.00 23.73 ? 17  ARG B O   1 
ATOM   621  C CB  . ARG B 1 17 ? 10.193  -1.765 54.969 1.00 22.85 ? 17  ARG B CB  1 
ATOM   622  N N   . PRO B 1 18 ? 7.061   -1.280 54.903 1.00 24.78 ? 18  PRO B N   1 
ATOM   623  C CA  . PRO B 1 18 ? 5.928   -0.374 55.093 1.00 24.67 ? 18  PRO B CA  1 
ATOM   624  C C   . PRO B 1 18 ? 6.388   1.048  55.388 1.00 24.78 ? 18  PRO B C   1 
ATOM   625  O O   . PRO B 1 18 ? 7.260   1.274  56.222 1.00 24.42 ? 18  PRO B O   1 
ATOM   626  C CB  . PRO B 1 18 ? 5.181   -0.999 56.269 1.00 23.84 ? 18  PRO B CB  1 
ATOM   627  C CG  . PRO B 1 18 ? 5.450   -2.462 56.092 1.00 23.40 ? 18  PRO B CG  1 
ATOM   628  C CD  . PRO B 1 18 ? 6.930   -2.472 55.758 1.00 24.89 ? 18  PRO B CD  1 
ATOM   629  N N   . LEU B 1 19 ? 5.801   2.003  54.684 1.00 23.69 ? 19  LEU B N   1 
ATOM   630  C CA  . LEU B 1 19 ? 6.129   3.407  54.873 1.00 24.85 ? 19  LEU B CA  1 
ATOM   631  C C   . LEU B 1 19 ? 5.446   3.834  56.171 1.00 23.81 ? 19  LEU B C   1 
ATOM   632  O O   . LEU B 1 19 ? 4.456   3.231  56.580 1.00 22.68 ? 19  LEU B O   1 
ATOM   633  C CB  . LEU B 1 19 ? 5.576   4.209  53.689 1.00 27.47 ? 19  LEU B CB  1 
ATOM   634  C CG  . LEU B 1 19 ? 6.115   5.597  53.343 1.00 30.52 ? 19  LEU B CG  1 
ATOM   635  C CD1 . LEU B 1 19 ? 7.592   5.508  52.984 1.00 30.15 ? 19  LEU B CD1 1 
ATOM   636  C CD2 . LEU B 1 19 ? 5.319   6.158  52.169 1.00 28.52 ? 19  LEU B CD2 1 
ATOM   637  N N   . PRO B 1 20 ? 5.980   4.855  56.856 1.00 24.62 ? 20  PRO B N   1 
ATOM   638  C CA  . PRO B 1 20 ? 5.324   5.277  58.100 1.00 24.81 ? 20  PRO B CA  1 
ATOM   639  C C   . PRO B 1 20 ? 3.952   5.864  57.757 1.00 23.33 ? 20  PRO B C   1 
ATOM   640  O O   . PRO B 1 20 ? 3.849   6.737  56.897 1.00 23.31 ? 20  PRO B O   1 
ATOM   641  C CB  . PRO B 1 20 ? 6.283   6.326  58.658 1.00 25.93 ? 20  PRO B CB  1 
ATOM   642  C CG  . PRO B 1 20 ? 7.624   5.873  58.123 1.00 26.23 ? 20  PRO B CG  1 
ATOM   643  C CD  . PRO B 1 20 ? 7.287   5.512  56.699 1.00 25.17 ? 20  PRO B CD  1 
ATOM   644  N N   . ARG B 1 21 ? 2.904   5.385  58.423 1.00 20.64 ? 21  ARG B N   1 
ATOM   645  C CA  . ARG B 1 21 ? 1.551   5.862  58.149 1.00 19.19 ? 21  ARG B CA  1 
ATOM   646  C C   . ARG B 1 21 ? 1.339   7.334  58.468 1.00 19.20 ? 21  ARG B C   1 
ATOM   647  O O   . ARG B 1 21 ? 0.616   8.037  57.759 1.00 17.65 ? 21  ARG B O   1 
ATOM   648  C CB  . ARG B 1 21 ? 0.528   5.043  58.937 1.00 17.48 ? 21  ARG B CB  1 
ATOM   649  C CG  . ARG B 1 21 ? -0.903  5.563  58.817 1.00 17.86 ? 21  ARG B CG  1 
ATOM   650  C CD  . ARG B 1 21 ? -1.427  5.414  57.394 1.00 19.07 ? 21  ARG B CD  1 
ATOM   651  N NE  . ARG B 1 21 ? -2.777  5.955  57.222 1.00 18.62 ? 21  ARG B NE  1 
ATOM   652  C CZ  . ARG B 1 21 ? -3.068  7.251  57.162 1.00 19.28 ? 21  ARG B CZ  1 
ATOM   653  N NH1 . ARG B 1 21 ? -2.105  8.158  57.259 1.00 19.52 ? 21  ARG B NH1 1 
ATOM   654  N NH2 . ARG B 1 21 ? -4.324  7.643  56.996 1.00 18.14 ? 21  ARG B NH2 1 
ATOM   655  N N   . ALA B 1 22 ? 1.975   7.789  59.540 1.00 20.29 ? 22  ALA B N   1 
ATOM   656  C CA  . ALA B 1 22 ? 1.849   9.163  60.010 1.00 21.33 ? 22  ALA B CA  1 
ATOM   657  C C   . ALA B 1 22 ? 2.185   10.259 59.014 1.00 22.55 ? 22  ALA B C   1 
ATOM   658  O O   . ALA B 1 22 ? 1.669   11.364 59.124 1.00 24.06 ? 22  ALA B O   1 
ATOM   659  C CB  . ALA B 1 22 ? 2.698   9.353  61.258 1.00 18.13 ? 22  ALA B CB  1 
ATOM   660  N N   . HIS B 1 23 ? 3.042   9.976  58.045 1.00 23.23 ? 23  HIS B N   1 
ATOM   661  C CA  . HIS B 1 23 ? 3.423   11.025 57.111 1.00 25.88 ? 23  HIS B CA  1 
ATOM   662  C C   . HIS B 1 23 ? 2.856   10.921 55.700 1.00 24.37 ? 23  HIS B C   1 
ATOM   663  O O   . HIS B 1 23 ? 3.355   11.558 54.774 1.00 24.63 ? 23  HIS B O   1 
ATOM   664  C CB  . HIS B 1 23 ? 4.944   11.125 57.086 1.00 28.77 ? 23  HIS B CB  1 
ATOM   665  C CG  . HIS B 1 23 ? 5.535   11.414 58.430 1.00 31.74 ? 23  HIS B CG  1 
ATOM   666  N ND1 . HIS B 1 23 ? 5.294   12.590 59.108 1.00 35.03 ? 23  HIS B ND1 1 
ATOM   667  C CD2 . HIS B 1 23 ? 6.310   10.662 59.246 1.00 32.75 ? 23  HIS B CD2 1 
ATOM   668  C CE1 . HIS B 1 23 ? 5.892   12.549 60.285 1.00 35.16 ? 23  HIS B CE1 1 
ATOM   669  N NE2 . HIS B 1 23 ? 6.515   11.389 60.394 1.00 35.28 ? 23  HIS B NE2 1 
ATOM   670  N N   . ILE B 1 24 ? 1.801   10.132 55.548 1.00 22.92 ? 24  ILE B N   1 
ATOM   671  C CA  . ILE B 1 24 ? 1.150   9.970  54.255 1.00 20.70 ? 24  ILE B CA  1 
ATOM   672  C C   . ILE B 1 24 ? -0.104  10.839 54.238 1.00 20.53 ? 24  ILE B C   1 
ATOM   673  O O   . ILE B 1 24 ? -0.935  10.740 55.138 1.00 21.88 ? 24  ILE B O   1 
ATOM   674  C CB  . ILE B 1 24 ? 0.753   8.500  54.021 1.00 18.77 ? 24  ILE B CB  1 
ATOM   675  C CG1 . ILE B 1 24 ? 2.009   7.627  53.969 1.00 17.01 ? 24  ILE B CG1 1 
ATOM   676  C CG2 . ILE B 1 24 ? -0.038  8.371  52.724 1.00 18.84 ? 24  ILE B CG2 1 
ATOM   677  C CD1 . ILE B 1 24 ? 1.719   6.140  53.846 1.00 15.65 ? 24  ILE B CD1 1 
ATOM   678  N N   . LYS B 1 25 ? -0.248  11.703 53.236 1.00 19.76 ? 25  LYS B N   1 
ATOM   679  C CA  . LYS B 1 25 ? -1.440  12.543 53.186 1.00 19.50 ? 25  LYS B CA  1 
ATOM   680  C C   . LYS B 1 25 ? -2.520  12.030 52.234 1.00 19.44 ? 25  LYS B C   1 
ATOM   681  O O   . LYS B 1 25 ? -3.697  12.365 52.385 1.00 19.22 ? 25  LYS B O   1 
ATOM   682  C CB  . LYS B 1 25 ? -1.073  13.998 52.861 1.00 20.80 ? 25  LYS B CB  1 
ATOM   683  C CG  . LYS B 1 25 ? -0.184  14.216 51.651 1.00 20.84 ? 25  LYS B CG  1 
ATOM   684  C CD  . LYS B 1 25 ? 0.071   15.710 51.482 1.00 19.80 ? 25  LYS B CD  1 
ATOM   685  C CE  . LYS B 1 25 ? 0.877   16.022 50.234 1.00 19.42 ? 25  LYS B CE  1 
ATOM   686  N NZ  . LYS B 1 25 ? 1.066   17.492 50.073 1.00 21.40 ? 25  LYS B NZ  1 
ATOM   687  N N   . GLU B 1 26 ? -2.127  11.216 51.258 1.00 17.63 ? 26  GLU B N   1 
ATOM   688  C CA  . GLU B 1 26 ? -3.088  10.644 50.322 1.00 17.17 ? 26  GLU B CA  1 
ATOM   689  C C   . GLU B 1 26 ? -2.436  9.564  49.470 1.00 16.71 ? 26  GLU B C   1 
ATOM   690  O O   . GLU B 1 26 ? -1.253  9.263  49.624 1.00 14.72 ? 26  GLU B O   1 
ATOM   691  C CB  . GLU B 1 26 ? -3.688  11.723 49.411 1.00 18.39 ? 26  GLU B CB  1 
ATOM   692  C CG  . GLU B 1 26 ? -2.746  12.243 48.342 1.00 19.07 ? 26  GLU B CG  1 
ATOM   693  C CD  . GLU B 1 26 ? -2.440  13.716 48.506 1.00 19.83 ? 26  GLU B CD  1 
ATOM   694  O OE1 . GLU B 1 26 ? -2.911  14.316 49.497 1.00 21.19 ? 26  GLU B OE1 1 
ATOM   695  O OE2 . GLU B 1 26 ? -1.726  14.272 47.648 1.00 19.05 ? 26  GLU B OE2 1 
ATOM   696  N N   . TYR B 1 27 ? -3.223  8.975  48.579 1.00 16.38 ? 27  TYR B N   1 
ATOM   697  C CA  . TYR B 1 27 ? -2.722  7.933  47.697 1.00 17.30 ? 27  TYR B CA  1 
ATOM   698  C C   . TYR B 1 27 ? -3.513  7.961  46.400 1.00 15.30 ? 27  TYR B C   1 
ATOM   699  O O   . TYR B 1 27 ? -4.577  8.574  46.321 1.00 16.76 ? 27  TYR B O   1 
ATOM   700  C CB  . TYR B 1 27 ? -2.904  6.559  48.348 1.00 16.85 ? 27  TYR B CB  1 
ATOM   701  C CG  . TYR B 1 27 ? -4.270  5.957  48.084 1.00 22.84 ? 27  TYR B CG  1 
ATOM   702  C CD1 . TYR B 1 27 ? -5.354  6.248  48.908 1.00 23.77 ? 27  TYR B CD1 1 
ATOM   703  C CD2 . TYR B 1 27 ? -4.491  5.148  46.974 1.00 23.45 ? 27  TYR B CD2 1 
ATOM   704  C CE1 . TYR B 1 27 ? -6.617  5.753  48.630 1.00 26.52 ? 27  TYR B CE1 1 
ATOM   705  C CE2 . TYR B 1 27 ? -5.745  4.652  46.690 1.00 26.12 ? 27  TYR B CE2 1 
ATOM   706  C CZ  . TYR B 1 27 ? -6.805  4.955  47.517 1.00 28.80 ? 27  TYR B CZ  1 
ATOM   707  O OH  . TYR B 1 27 ? -8.056  4.459  47.227 1.00 32.11 ? 27  TYR B OH  1 
ATOM   708  N N   . PHE B 1 28 ? -2.980  7.299  45.383 1.00 14.84 ? 28  PHE B N   1 
ATOM   709  C CA  . PHE B 1 28 ? -3.662  7.175  44.102 1.00 16.20 ? 28  PHE B CA  1 
ATOM   710  C C   . PHE B 1 28 ? -3.025  5.998  43.371 1.00 16.85 ? 28  PHE B C   1 
ATOM   711  O O   . PHE B 1 28 ? -1.896  5.604  43.681 1.00 14.23 ? 28  PHE B O   1 
ATOM   712  C CB  . PHE B 1 28 ? -3.588  8.482  43.276 1.00 14.42 ? 28  PHE B CB  1 
ATOM   713  C CG  . PHE B 1 28 ? -2.209  8.844  42.786 1.00 15.83 ? 28  PHE B CG  1 
ATOM   714  C CD1 . PHE B 1 28 ? -1.695  8.278  41.628 1.00 16.52 ? 28  PHE B CD1 1 
ATOM   715  C CD2 . PHE B 1 28 ? -1.427  9.753  43.486 1.00 16.04 ? 28  PHE B CD2 1 
ATOM   716  C CE1 . PHE B 1 28 ? -0.425  8.612  41.173 1.00 17.69 ? 28  PHE B CE1 1 
ATOM   717  C CE2 . PHE B 1 28 ? -0.153  10.092 43.039 1.00 14.61 ? 28  PHE B CE2 1 
ATOM   718  C CZ  . PHE B 1 28 ? 0.347   9.519  41.880 1.00 16.34 ? 28  PHE B CZ  1 
ATOM   719  N N   . TYR B 1 29 ? -3.767  5.407  42.439 1.00 15.68 ? 29  TYR B N   1 
ATOM   720  C CA  . TYR B 1 29 ? -3.253  4.282  41.669 1.00 17.20 ? 29  TYR B CA  1 
ATOM   721  C C   . TYR B 1 29 ? -2.637  4.819  40.386 1.00 17.20 ? 29  TYR B C   1 
ATOM   722  O O   . TYR B 1 29 ? -3.212  5.702  39.744 1.00 17.52 ? 29  TYR B O   1 
ATOM   723  C CB  . TYR B 1 29 ? -4.374  3.301  41.304 1.00 18.08 ? 29  TYR B CB  1 
ATOM   724  C CG  . TYR B 1 29 ? -5.028  2.604  42.478 1.00 20.70 ? 29  TYR B CG  1 
ATOM   725  C CD1 . TYR B 1 29 ? -4.519  1.407  42.965 1.00 22.36 ? 29  TYR B CD1 1 
ATOM   726  C CD2 . TYR B 1 29 ? -6.145  3.143  43.102 1.00 22.76 ? 29  TYR B CD2 1 
ATOM   727  C CE1 . TYR B 1 29 ? -5.101  0.768  44.039 1.00 23.56 ? 29  TYR B CE1 1 
ATOM   728  C CE2 . TYR B 1 29 ? -6.738  2.506  44.178 1.00 24.03 ? 29  TYR B CE2 1 
ATOM   729  C CZ  . TYR B 1 29 ? -6.209  1.321  44.641 1.00 24.20 ? 29  TYR B CZ  1 
ATOM   730  O OH  . TYR B 1 29 ? -6.786  0.680  45.713 1.00 27.84 ? 29  TYR B OH  1 
ATOM   731  N N   . THR B 1 30 ? -1.473  4.298  40.012 1.00 15.38 ? 30  THR B N   1 
ATOM   732  C CA  . THR B 1 30 ? -0.832  4.743  38.783 1.00 15.43 ? 30  THR B CA  1 
ATOM   733  C C   . THR B 1 30 ? -1.716  4.316  37.616 1.00 15.70 ? 30  THR B C   1 
ATOM   734  O O   . THR B 1 30 ? -2.451  3.336  37.712 1.00 17.94 ? 30  THR B O   1 
ATOM   735  C CB  . THR B 1 30 ? 0.568   4.122  38.595 1.00 13.08 ? 30  THR B CB  1 
ATOM   736  O OG1 . THR B 1 30 ? 0.486   2.699  38.725 1.00 16.02 ? 30  THR B OG1 1 
ATOM   737  C CG2 . THR B 1 30 ? 1.540   4.667  39.621 1.00 15.00 ? 30  THR B CG2 1 
ATOM   738  N N   . SER B 1 31 ? -1.634  5.068  36.525 1.00 16.51 ? 31  SER B N   1 
ATOM   739  C CA  . SER B 1 31 ? -2.408  4.819  35.315 1.00 16.05 ? 31  SER B CA  1 
ATOM   740  C C   . SER B 1 31 ? -2.305  3.395  34.791 1.00 16.58 ? 31  SER B C   1 
ATOM   741  O O   . SER B 1 31 ? -1.245  2.763  34.873 1.00 16.35 ? 31  SER B O   1 
ATOM   742  C CB  . SER B 1 31 ? -1.959  5.789  34.216 1.00 16.24 ? 31  SER B CB  1 
ATOM   743  O OG  . SER B 1 31 ? -2.585  5.493  32.979 1.00 17.58 ? 31  SER B OG  1 
ATOM   744  N N   . GLY B 1 32 ? -3.415  2.903  34.244 1.00 14.34 ? 32  GLY B N   1 
ATOM   745  C CA  . GLY B 1 32 ? -3.445  1.566  33.678 1.00 15.14 ? 32  GLY B CA  1 
ATOM   746  C C   . GLY B 1 32 ? -2.528  1.494  32.471 1.00 16.72 ? 32  GLY B C   1 
ATOM   747  O O   . GLY B 1 32 ? -2.162  0.409  32.019 1.00 17.53 ? 32  GLY B O   1 
ATOM   748  N N   . LYS B 1 33 ? -2.165  2.658  31.939 1.00 15.45 ? 33  LYS B N   1 
ATOM   749  C CA  . LYS B 1 33 ? -1.266  2.724  30.796 1.00 17.11 ? 33  LYS B CA  1 
ATOM   750  C C   . LYS B 1 33 ? 0.115   2.210  31.201 1.00 17.40 ? 33  LYS B C   1 
ATOM   751  O O   . LYS B 1 33 ? 0.856   1.677  30.376 1.00 16.49 ? 33  LYS B O   1 
ATOM   752  C CB  . LYS B 1 33 ? -1.135  4.162  30.291 1.00 19.64 ? 33  LYS B CB  1 
ATOM   753  C CG  . LYS B 1 33 ? -2.371  4.721  29.608 1.00 22.25 ? 33  LYS B CG  1 
ATOM   754  C CD  . LYS B 1 33 ? -2.090  6.126  29.097 1.00 23.92 ? 33  LYS B CD  1 
ATOM   755  C CE  . LYS B 1 33 ? -3.323  6.750  28.465 1.00 28.46 ? 33  LYS B CE  1 
ATOM   756  N NZ  . LYS B 1 33 ? -3.815  5.941  27.314 1.00 32.21 ? 33  LYS B NZ  1 
ATOM   757  N N   . CYS B 1 34 ? 0.463   2.394  32.472 1.00 16.67 ? 34  CYS B N   1 
ATOM   758  C CA  . CYS B 1 34 ? 1.752   1.936  32.980 1.00 16.18 ? 34  CYS B CA  1 
ATOM   759  C C   . CYS B 1 34 ? 1.772   0.408  32.936 1.00 16.76 ? 34  CYS B C   1 
ATOM   760  O O   . CYS B 1 34 ? 0.742   -0.235 33.130 1.00 16.39 ? 34  CYS B O   1 
ATOM   761  C CB  . CYS B 1 34 ? 1.964   2.416  34.420 1.00 13.32 ? 34  CYS B CB  1 
ATOM   762  S SG  . CYS B 1 34 ? 1.994   4.221  34.692 1.00 15.30 ? 34  CYS B SG  1 
ATOM   763  N N   . SER B 1 35 ? 2.943   -0.170 32.685 1.00 17.02 ? 35  SER B N   1 
ATOM   764  C CA  . SER B 1 35 ? 3.076   -1.622 32.598 1.00 18.68 ? 35  SER B CA  1 
ATOM   765  C C   . SER B 1 35 ? 2.862   -2.359 33.912 1.00 17.93 ? 35  SER B C   1 
ATOM   766  O O   . SER B 1 35 ? 2.313   -3.459 33.920 1.00 17.61 ? 35  SER B O   1 
ATOM   767  C CB  . SER B 1 35 ? 4.445   -1.992 32.019 1.00 19.32 ? 35  SER B CB  1 
ATOM   768  O OG  . SER B 1 35 ? 4.509   -1.661 30.640 1.00 24.81 ? 35  SER B OG  1 
ATOM   769  N N   . ASN B 1 36 ? 3.297   -1.763 35.019 1.00 18.22 ? 36  ASN B N   1 
ATOM   770  C CA  . ASN B 1 36 ? 3.138   -2.391 36.327 1.00 19.15 ? 36  ASN B CA  1 
ATOM   771  C C   . ASN B 1 36 ? 2.035   -1.729 37.139 1.00 18.11 ? 36  ASN B C   1 
ATOM   772  O O   . ASN B 1 36 ? 1.924   -0.505 37.172 1.00 18.56 ? 36  ASN B O   1 
ATOM   773  C CB  . ASN B 1 36 ? 4.430   -2.300 37.147 1.00 17.49 ? 36  ASN B CB  1 
ATOM   774  C CG  . ASN B 1 36 ? 5.642   -2.792 36.396 1.00 20.88 ? 36  ASN B CG  1 
ATOM   775  O OD1 . ASN B 1 36 ? 5.644   -3.890 35.845 1.00 21.89 ? 36  ASN B OD1 1 
ATOM   776  N ND2 . ASN B 1 36 ? 6.693   -1.981 36.381 1.00 17.03 ? 36  ASN B ND2 1 
ATOM   777  N N   . PRO B 1 37 ? 1.204   -2.534 37.813 1.00 19.34 ? 37  PRO B N   1 
ATOM   778  C CA  . PRO B 1 37 ? 0.132   -1.953 38.622 1.00 18.53 ? 37  PRO B CA  1 
ATOM   779  C C   . PRO B 1 37 ? 0.796   -1.392 39.871 1.00 17.70 ? 37  PRO B C   1 
ATOM   780  O O   . PRO B 1 37 ? 1.809   -1.925 40.325 1.00 19.09 ? 37  PRO B O   1 
ATOM   781  C CB  . PRO B 1 37 ? -0.756  -3.152 38.926 1.00 19.50 ? 37  PRO B CB  1 
ATOM   782  C CG  . PRO B 1 37 ? 0.236   -4.266 39.039 1.00 21.57 ? 37  PRO B CG  1 
ATOM   783  C CD  . PRO B 1 37 ? 1.161   -4.008 37.860 1.00 20.52 ? 37  PRO B CD  1 
ATOM   784  N N   . ALA B 1 38 ? 0.256   -0.318 40.427 1.00 16.26 ? 38  ALA B N   1 
ATOM   785  C CA  . ALA B 1 38 ? 0.877   0.243  41.615 1.00 17.40 ? 38  ALA B CA  1 
ATOM   786  C C   . ALA B 1 38 ? 0.029   1.245  42.370 1.00 17.34 ? 38  ALA B C   1 
ATOM   787  O O   . ALA B 1 38 ? -0.859  1.885  41.813 1.00 16.91 ? 38  ALA B O   1 
ATOM   788  C CB  . ALA B 1 38 ? 2.221   0.889  41.243 1.00 13.95 ? 38  ALA B CB  1 
ATOM   789  N N   . VAL B 1 39 ? 0.316   1.352  43.661 1.00 18.13 ? 39  VAL B N   1 
ATOM   790  C CA  . VAL B 1 39 ? -0.349  2.306  44.523 1.00 18.69 ? 39  VAL B CA  1 
ATOM   791  C C   . VAL B 1 39 ? 0.738   3.321  44.832 1.00 18.15 ? 39  VAL B C   1 
ATOM   792  O O   . VAL B 1 39 ? 1.881   2.946  45.095 1.00 19.30 ? 39  VAL B O   1 
ATOM   793  C CB  . VAL B 1 39 ? -0.803  1.680  45.856 1.00 19.62 ? 39  VAL B CB  1 
ATOM   794  C CG1 . VAL B 1 39 ? -1.195  2.779  46.828 1.00 21.79 ? 39  VAL B CG1 1 
ATOM   795  C CG2 . VAL B 1 39 ? -1.975  0.743  45.624 1.00 22.29 ? 39  VAL B CG2 1 
ATOM   796  N N   . VAL B 1 40 ? 0.394   4.600  44.771 1.00 16.28 ? 40  VAL B N   1 
ATOM   797  C CA  . VAL B 1 40 ? 1.351   5.647  45.082 1.00 14.44 ? 40  VAL B CA  1 
ATOM   798  C C   . VAL B 1 40 ? 0.928   6.330  46.376 1.00 14.58 ? 40  VAL B C   1 
ATOM   799  O O   . VAL B 1 40 ? -0.177  6.862  46.468 1.00 16.59 ? 40  VAL B O   1 
ATOM   800  C CB  . VAL B 1 40 ? 1.406   6.727  43.989 1.00 12.72 ? 40  VAL B CB  1 
ATOM   801  C CG1 . VAL B 1 40 ? 2.423   7.792  44.379 1.00 11.48 ? 40  VAL B CG1 1 
ATOM   802  C CG2 . VAL B 1 40 ? 1.775   6.113  42.663 1.00 11.68 ? 40  VAL B CG2 1 
ATOM   803  N N   . PHE B 1 41 ? 1.792   6.286  47.381 1.00 13.58 ? 41  PHE B N   1 
ATOM   804  C CA  . PHE B 1 41 ? 1.507   6.946  48.646 1.00 13.97 ? 41  PHE B CA  1 
ATOM   805  C C   . PHE B 1 41 ? 2.271   8.252  48.584 1.00 14.00 ? 41  PHE B C   1 
ATOM   806  O O   . PHE B 1 41 ? 3.483   8.256  48.355 1.00 14.07 ? 41  PHE B O   1 
ATOM   807  C CB  . PHE B 1 41 ? 1.987   6.102  49.836 1.00 12.47 ? 41  PHE B CB  1 
ATOM   808  C CG  . PHE B 1 41 ? 1.119   4.905  50.119 1.00 14.74 ? 41  PHE B CG  1 
ATOM   809  C CD1 . PHE B 1 41 ? -0.199  5.071  50.516 1.00 14.12 ? 41  PHE B CD1 1 
ATOM   810  C CD2 . PHE B 1 41 ? 1.613   3.616  49.966 1.00 15.88 ? 41  PHE B CD2 1 
ATOM   811  C CE1 . PHE B 1 41 ? -1.013  3.974  50.753 1.00 16.15 ? 41  PHE B CE1 1 
ATOM   812  C CE2 . PHE B 1 41 ? 0.807   2.515  50.201 1.00 15.35 ? 41  PHE B CE2 1 
ATOM   813  C CZ  . PHE B 1 41 ? -0.508  2.694  50.595 1.00 15.41 ? 41  PHE B CZ  1 
ATOM   814  N N   . VAL B 1 42 ? 1.557   9.361  48.757 1.00 14.15 ? 42  VAL B N   1 
ATOM   815  C CA  . VAL B 1 42 ? 2.174   10.678 48.708 1.00 13.22 ? 42  VAL B CA  1 
ATOM   816  C C   . VAL B 1 42 ? 2.420   11.147 50.136 1.00 14.47 ? 42  VAL B C   1 
ATOM   817  O O   . VAL B 1 42 ? 1.492   11.225 50.941 1.00 14.57 ? 42  VAL B O   1 
ATOM   818  C CB  . VAL B 1 42 ? 1.258   11.692 47.989 1.00 14.20 ? 42  VAL B CB  1 
ATOM   819  C CG1 . VAL B 1 42 ? 1.991   13.011 47.798 1.00 13.67 ? 42  VAL B CG1 1 
ATOM   820  C CG2 . VAL B 1 42 ? 0.806   11.127 46.646 1.00 13.29 ? 42  VAL B CG2 1 
ATOM   821  N N   . THR B 1 43 ? 3.672   11.447 50.452 1.00 13.95 ? 43  THR B N   1 
ATOM   822  C CA  . THR B 1 43 ? 4.011   11.892 51.795 1.00 15.90 ? 43  THR B CA  1 
ATOM   823  C C   . THR B 1 43 ? 3.861   13.401 51.929 1.00 17.22 ? 43  THR B C   1 
ATOM   824  O O   . THR B 1 43 ? 3.762   14.123 50.934 1.00 15.87 ? 43  THR B O   1 
ATOM   825  C CB  . THR B 1 43 ? 5.458   11.504 52.171 1.00 16.30 ? 43  THR B CB  1 
ATOM   826  O OG1 . THR B 1 43 ? 6.383   12.271 51.393 1.00 14.21 ? 43  THR B OG1 1 
ATOM   827  C CG2 . THR B 1 43 ? 5.695   10.020 51.908 1.00 16.92 ? 43  THR B CG2 1 
ATOM   828  N N   . ARG B 1 44 ? 3.847   13.869 53.172 1.00 17.70 ? 44  ARG B N   1 
ATOM   829  C CA  . ARG B 1 44 ? 3.711   15.288 53.459 1.00 18.44 ? 44  ARG B CA  1 
ATOM   830  C C   . ARG B 1 44 ? 4.829   16.115 52.815 1.00 17.80 ? 44  ARG B C   1 
ATOM   831  O O   . ARG B 1 44 ? 4.677   17.320 52.607 1.00 17.77 ? 44  ARG B O   1 
ATOM   832  C CB  . ARG B 1 44 ? 3.680   15.491 54.971 1.00 20.76 ? 44  ARG B CB  1 
ATOM   833  C CG  . ARG B 1 44 ? 2.406   14.999 55.638 1.00 26.36 ? 44  ARG B CG  1 
ATOM   834  C CD  . ARG B 1 44 ? 1.267   15.975 55.414 1.00 28.25 ? 44  ARG B CD  1 
ATOM   835  N NE  . ARG B 1 44 ? -0.019  15.447 55.866 1.00 31.19 ? 44  ARG B NE  1 
ATOM   836  C CZ  . ARG B 1 44 ? -1.169  16.101 55.742 1.00 29.88 ? 44  ARG B CZ  1 
ATOM   837  N NH1 . ARG B 1 44 ? -1.182  17.305 55.190 1.00 30.27 ? 44  ARG B NH1 1 
ATOM   838  N NH2 . ARG B 1 44 ? -2.304  15.546 56.144 1.00 29.81 ? 44  ARG B NH2 1 
ATOM   839  N N   . LYS B 1 45 ? 5.951   15.473 52.504 1.00 15.87 ? 45  LYS B N   1 
ATOM   840  C CA  . LYS B 1 45 ? 7.054   16.167 51.845 1.00 16.57 ? 45  LYS B CA  1 
ATOM   841  C C   . LYS B 1 45 ? 6.936   15.957 50.337 1.00 15.95 ? 45  LYS B C   1 
ATOM   842  O O   . LYS B 1 45 ? 7.891   16.135 49.580 1.00 14.88 ? 45  LYS B O   1 
ATOM   843  C CB  . LYS B 1 45 ? 8.401   15.653 52.349 1.00 16.25 ? 45  LYS B CB  1 
ATOM   844  C CG  . LYS B 1 45 ? 8.763   16.182 53.729 1.00 20.90 ? 45  LYS B CG  1 
ATOM   845  C CD  . LYS B 1 45 ? 10.189  15.832 54.103 1.00 21.50 ? 45  LYS B CD  1 
ATOM   846  C CE  . LYS B 1 45 ? 10.551  16.426 55.449 1.00 22.49 ? 45  LYS B CE  1 
ATOM   847  N NZ  . LYS B 1 45 ? 9.680   15.881 56.520 1.00 22.06 ? 45  LYS B NZ  1 
ATOM   848  N N   . ASN B 1 46 ? 5.739   15.566 49.921 1.00 16.65 ? 46  ASN B N   1 
ATOM   849  C CA  . ASN B 1 46 ? 5.419   15.337 48.520 1.00 18.50 ? 46  ASN B CA  1 
ATOM   850  C C   . ASN B 1 46 ? 6.224   14.276 47.785 1.00 18.73 ? 46  ASN B C   1 
ATOM   851  O O   . ASN B 1 46 ? 6.438   14.369 46.577 1.00 16.10 ? 46  ASN B O   1 
ATOM   852  C CB  . ASN B 1 46 ? 5.466   16.661 47.762 1.00 18.46 ? 46  ASN B CB  1 
ATOM   853  C CG  . ASN B 1 46 ? 4.378   17.605 48.210 1.00 19.75 ? 46  ASN B CG  1 
ATOM   854  O OD1 . ASN B 1 46 ? 3.201   17.243 48.219 1.00 20.77 ? 46  ASN B OD1 1 
ATOM   855  N ND2 . ASN B 1 46 ? 4.758   18.816 48.592 1.00 21.34 ? 46  ASN B ND2 1 
ATOM   856  N N   . ARG B 1 47 ? 6.668   13.266 48.522 1.00 18.82 ? 47  ARG B N   1 
ATOM   857  C CA  . ARG B 1 47 ? 7.394   12.154 47.926 1.00 20.40 ? 47  ARG B CA  1 
ATOM   858  C C   . ARG B 1 47 ? 6.318   11.231 47.344 1.00 20.09 ? 47  ARG B C   1 
ATOM   859  O O   . ARG B 1 47 ? 5.284   11.013 47.980 1.00 19.14 ? 47  ARG B O   1 
ATOM   860  C CB  . ARG B 1 47 ? 8.171   11.399 49.004 1.00 24.14 ? 47  ARG B CB  1 
ATOM   861  C CG  . ARG B 1 47 ? 9.353   12.152 49.580 1.00 29.18 ? 47  ARG B CG  1 
ATOM   862  C CD  . ARG B 1 47 ? 10.666  11.715 48.937 1.00 35.82 ? 47  ARG B CD  1 
ATOM   863  N NE  . ARG B 1 47 ? 11.058  10.365 49.337 1.00 39.22 ? 47  ARG B NE  1 
ATOM   864  C CZ  . ARG B 1 47 ? 10.512  9.247  48.867 1.00 39.42 ? 47  ARG B CZ  1 
ATOM   865  N NH1 . ARG B 1 47 ? 9.544   9.305  47.965 1.00 40.97 ? 47  ARG B NH1 1 
ATOM   866  N NH2 . ARG B 1 47 ? 10.935  8.068  49.303 1.00 40.37 ? 47  ARG B NH2 1 
ATOM   867  N N   . GLN B 1 48 ? 6.535   10.712 46.139 1.00 18.32 ? 48  GLN B N   1 
ATOM   868  C CA  . GLN B 1 48 ? 5.565   9.797  45.540 1.00 17.31 ? 48  GLN B CA  1 
ATOM   869  C C   . GLN B 1 48 ? 6.174   8.405  45.620 1.00 16.27 ? 48  GLN B C   1 
ATOM   870  O O   . GLN B 1 48 ? 6.991   8.021  44.782 1.00 14.60 ? 48  GLN B O   1 
ATOM   871  C CB  . GLN B 1 48 ? 5.276   10.159 44.076 1.00 17.94 ? 48  GLN B CB  1 
ATOM   872  C CG  . GLN B 1 48 ? 4.700   11.559 43.866 1.00 20.43 ? 48  GLN B CG  1 
ATOM   873  C CD  . GLN B 1 48 ? 3.906   11.687 42.572 1.00 21.25 ? 48  GLN B CD  1 
ATOM   874  O OE1 . GLN B 1 48 ? 4.214   11.041 41.564 1.00 21.77 ? 48  GLN B OE1 1 
ATOM   875  N NE2 . GLN B 1 48 ? 2.883   12.534 42.593 1.00 23.89 ? 48  GLN B NE2 1 
ATOM   876  N N   . VAL B 1 49 ? 5.770   7.657  46.640 1.00 15.15 ? 49  VAL B N   1 
ATOM   877  C CA  . VAL B 1 49 ? 6.294   6.318  46.865 1.00 15.19 ? 49  VAL B CA  1 
ATOM   878  C C   . VAL B 1 49 ? 5.438   5.203  46.287 1.00 14.24 ? 49  VAL B C   1 
ATOM   879  O O   . VAL B 1 49 ? 4.236   5.124  46.554 1.00 14.91 ? 49  VAL B O   1 
ATOM   880  C CB  . VAL B 1 49 ? 6.477   6.059  48.365 1.00 14.07 ? 49  VAL B CB  1 
ATOM   881  C CG1 . VAL B 1 49 ? 7.088   4.687  48.582 1.00 14.96 ? 49  VAL B CG1 1 
ATOM   882  C CG2 . VAL B 1 49 ? 7.348   7.143  48.969 1.00 15.57 ? 49  VAL B CG2 1 
ATOM   883  N N   . CYS B 1 50 ? 6.082   4.338  45.505 1.00 12.46 ? 50  CYS B N   1 
ATOM   884  C CA  . CYS B 1 50 ? 5.429   3.200  44.868 1.00 13.31 ? 50  CYS B CA  1 
ATOM   885  C C   . CYS B 1 50 ? 5.298   2.007  45.806 1.00 13.39 ? 50  CYS B C   1 
ATOM   886  O O   . CYS B 1 50 ? 6.255   1.639  46.483 1.00 12.86 ? 50  CYS B O   1 
ATOM   887  C CB  . CYS B 1 50 ? 6.225   2.758  43.651 1.00 13.33 ? 50  CYS B CB  1 
ATOM   888  S SG  . CYS B 1 50 ? 6.345   3.977  42.311 1.00 13.55 ? 50  CYS B SG  1 
ATOM   889  N N   . ALA B 1 51 ? 4.120   1.389  45.827 1.00 13.56 ? 51  ALA B N   1 
ATOM   890  C CA  . ALA B 1 51 ? 3.892   0.231  46.684 1.00 14.40 ? 51  ALA B CA  1 
ATOM   891  C C   . ALA B 1 51 ? 3.084   -0.846 45.968 1.00 15.62 ? 51  ALA B C   1 
ATOM   892  O O   . ALA B 1 51 ? 2.269   -0.549 45.097 1.00 14.80 ? 51  ALA B O   1 
ATOM   893  C CB  . ALA B 1 51 ? 3.189   0.661  47.963 1.00 15.27 ? 51  ALA B CB  1 
ATOM   894  N N   . ASN B 1 52 ? 3.321   -2.101 46.340 1.00 17.85 ? 52  ASN B N   1 
ATOM   895  C CA  . ASN B 1 52 ? 2.637   -3.242 45.730 1.00 19.16 ? 52  ASN B CA  1 
ATOM   896  C C   . ASN B 1 52 ? 1.200   -3.369 46.236 1.00 19.08 ? 52  ASN B C   1 
ATOM   897  O O   . ASN B 1 52 ? 0.970   -3.649 47.408 1.00 18.72 ? 52  ASN B O   1 
ATOM   898  C CB  . ASN B 1 52 ? 3.401   -4.530 46.050 1.00 21.85 ? 52  ASN B CB  1 
ATOM   899  C CG  . ASN B 1 52 ? 2.937   -5.706 45.217 1.00 23.71 ? 52  ASN B CG  1 
ATOM   900  O OD1 . ASN B 1 52 ? 1.818   -5.719 44.704 1.00 25.55 ? 52  ASN B OD1 1 
ATOM   901  N ND2 . ASN B 1 52 ? 3.794   -6.706 45.086 1.00 24.74 ? 52  ASN B ND2 1 
ATOM   902  N N   . PRO B 1 53 ? 0.217   -3.190 45.343 1.00 20.00 ? 53  PRO B N   1 
ATOM   903  C CA  . PRO B 1 53 ? -1.213  -3.269 45.654 1.00 22.23 ? 53  PRO B CA  1 
ATOM   904  C C   . PRO B 1 53 ? -1.638  -4.557 46.357 1.00 22.49 ? 53  PRO B C   1 
ATOM   905  O O   . PRO B 1 53 ? -2.640  -4.577 47.071 1.00 22.68 ? 53  PRO B O   1 
ATOM   906  C CB  . PRO B 1 53 ? -1.874  -3.128 44.282 1.00 22.47 ? 53  PRO B CB  1 
ATOM   907  C CG  . PRO B 1 53 ? -0.893  -2.291 43.519 1.00 21.69 ? 53  PRO B CG  1 
ATOM   908  C CD  . PRO B 1 53 ? 0.421   -2.912 43.911 1.00 22.86 ? 53  PRO B CD  1 
ATOM   909  N N   . GLU B 1 54 ? -0.872  -5.626 46.158 1.00 23.30 ? 54  GLU B N   1 
ATOM   910  C CA  . GLU B 1 54 ? -1.197  -6.914 46.756 1.00 23.77 ? 54  GLU B CA  1 
ATOM   911  C C   . GLU B 1 54 ? -0.746  -7.067 48.206 1.00 24.47 ? 54  GLU B C   1 
ATOM   912  O O   . GLU B 1 54 ? -1.166  -8.000 48.889 1.00 26.16 ? 54  GLU B O   1 
ATOM   913  C CB  . GLU B 1 54 ? -0.609  -8.038 45.908 1.00 26.39 ? 54  GLU B CB  1 
ATOM   914  N N   . LYS B 1 55 ? 0.098   -6.160 48.685 1.00 22.11 ? 55  LYS B N   1 
ATOM   915  C CA  . LYS B 1 55 ? 0.581   -6.254 50.057 1.00 21.18 ? 55  LYS B CA  1 
ATOM   916  C C   . LYS B 1 55 ? -0.502  -5.904 51.074 1.00 21.87 ? 55  LYS B C   1 
ATOM   917  O O   . LYS B 1 55 ? -1.301  -4.990 50.869 1.00 20.06 ? 55  LYS B O   1 
ATOM   918  C CB  . LYS B 1 55 ? 1.795   -5.353 50.247 1.00 21.54 ? 55  LYS B CB  1 
ATOM   919  N N   . LYS B 1 56 ? -0.527  -6.644 52.176 1.00 20.76 ? 56  LYS B N   1 
ATOM   920  C CA  . LYS B 1 56 ? -1.515  -6.406 53.218 1.00 19.96 ? 56  LYS B CA  1 
ATOM   921  C C   . LYS B 1 56 ? -1.451  -4.982 53.768 1.00 19.30 ? 56  LYS B C   1 
ATOM   922  O O   . LYS B 1 56 ? -2.467  -4.288 53.818 1.00 17.91 ? 56  LYS B O   1 
ATOM   923  C CB  . LYS B 1 56 ? -1.334  -7.415 54.352 1.00 21.49 ? 56  LYS B CB  1 
ATOM   924  N N   . TRP B 1 57 ? -0.266  -4.536 54.176 1.00 18.11 ? 57  TRP B N   1 
ATOM   925  C CA  . TRP B 1 57 ? -0.151  -3.189 54.725 1.00 18.47 ? 57  TRP B CA  1 
ATOM   926  C C   . TRP B 1 57 ? -0.630  -2.124 53.747 1.00 18.41 ? 57  TRP B C   1 
ATOM   927  O O   . TRP B 1 57 ? -1.192  -1.102 54.150 1.00 18.96 ? 57  TRP B O   1 
ATOM   928  C CB  . TRP B 1 57 ? 1.290   -2.882 55.161 1.00 19.40 ? 57  TRP B CB  1 
ATOM   929  C CG  . TRP B 1 57 ? 2.295   -2.712 54.047 1.00 19.33 ? 57  TRP B CG  1 
ATOM   930  C CD1 . TRP B 1 57 ? 3.031   -3.690 53.449 1.00 20.77 ? 57  TRP B CD1 1 
ATOM   931  C CD2 . TRP B 1 57 ? 2.700   -1.479 53.439 1.00 19.16 ? 57  TRP B CD2 1 
ATOM   932  N NE1 . TRP B 1 57 ? 3.875   -3.145 52.512 1.00 19.52 ? 57  TRP B NE1 1 
ATOM   933  C CE2 . TRP B 1 57 ? 3.690   -1.788 52.486 1.00 20.27 ? 57  TRP B CE2 1 
ATOM   934  C CE3 . TRP B 1 57 ? 2.321   -0.143 53.610 1.00 19.12 ? 57  TRP B CE3 1 
ATOM   935  C CZ2 . TRP B 1 57 ? 4.309   -0.811 51.707 1.00 17.51 ? 57  TRP B CZ2 1 
ATOM   936  C CZ3 . TRP B 1 57 ? 2.938   0.827  52.835 1.00 19.85 ? 57  TRP B CZ3 1 
ATOM   937  C CH2 . TRP B 1 57 ? 3.921   0.486  51.895 1.00 18.90 ? 57  TRP B CH2 1 
ATOM   938  N N   . VAL B 1 58 ? -0.422  -2.365 52.460 1.00 19.02 ? 58  VAL B N   1 
ATOM   939  C CA  . VAL B 1 58 ? -0.845  -1.412 51.443 1.00 18.33 ? 58  VAL B CA  1 
ATOM   940  C C   . VAL B 1 58 ? -2.370  -1.298 51.409 1.00 18.29 ? 58  VAL B C   1 
ATOM   941  O O   . VAL B 1 58 ? -2.921  -0.193 51.383 1.00 16.62 ? 58  VAL B O   1 
ATOM   942  C CB  . VAL B 1 58 ? -0.320  -1.829 50.059 1.00 18.06 ? 58  VAL B CB  1 
ATOM   943  C CG1 . VAL B 1 58 ? -0.867  -0.893 48.989 1.00 13.73 ? 58  VAL B CG1 1 
ATOM   944  C CG2 . VAL B 1 58 ? 1.214   -1.800 50.061 1.00 17.39 ? 58  VAL B CG2 1 
ATOM   945  N N   . ARG B 1 59 ? -3.047  -2.442 51.418 1.00 19.76 ? 59  ARG B N   1 
ATOM   946  C CA  . ARG B 1 59 ? -4.507  -2.469 51.399 1.00 21.20 ? 59  ARG B CA  1 
ATOM   947  C C   . ARG B 1 59 ? -5.052  -1.807 52.661 1.00 20.17 ? 59  ARG B C   1 
ATOM   948  O O   . ARG B 1 59 ? -6.063  -1.109 52.620 1.00 19.74 ? 59  ARG B O   1 
ATOM   949  C CB  . ARG B 1 59 ? -5.011  -3.912 51.329 1.00 23.05 ? 59  ARG B CB  1 
ATOM   950  C CG  . ARG B 1 59 ? -4.580  -4.670 50.085 1.00 30.03 ? 59  ARG B CG  1 
ATOM   951  C CD  . ARG B 1 59 ? -4.950  -6.142 50.201 1.00 34.43 ? 59  ARG B CD  1 
ATOM   952  N NE  . ARG B 1 59 ? -4.510  -6.923 49.049 1.00 40.43 ? 59  ARG B NE  1 
ATOM   953  C CZ  . ARG B 1 59 ? -4.996  -6.782 47.821 1.00 43.02 ? 59  ARG B CZ  1 
ATOM   954  N NH1 . ARG B 1 59 ? -5.943  -5.886 47.578 1.00 46.37 ? 59  ARG B NH1 1 
ATOM   955  N NH2 . ARG B 1 59 ? -4.536  -7.538 46.833 1.00 45.15 ? 59  ARG B NH2 1 
ATOM   956  N N   . GLU B 1 60 ? -4.377  -2.037 53.784 1.00 19.68 ? 60  GLU B N   1 
ATOM   957  C CA  . GLU B 1 60 ? -4.794  -1.455 55.057 1.00 20.65 ? 60  GLU B CA  1 
ATOM   958  C C   . GLU B 1 60 ? -4.629  0.061  55.060 1.00 19.22 ? 60  GLU B C   1 
ATOM   959  O O   . GLU B 1 60 ? -5.506  0.785  55.538 1.00 17.09 ? 60  GLU B O   1 
ATOM   960  C CB  . GLU B 1 60 ? -3.995  -2.073 56.206 1.00 21.35 ? 60  GLU B CB  1 
ATOM   961  C CG  . GLU B 1 60 ? -4.400  -3.504 56.522 1.00 27.74 ? 60  GLU B CG  1 
ATOM   962  C CD  . GLU B 1 60 ? -3.422  -4.206 57.441 1.00 32.63 ? 60  GLU B CD  1 
ATOM   963  O OE1 . GLU B 1 60 ? -2.313  -3.669 57.662 1.00 36.26 ? 60  GLU B OE1 1 
ATOM   964  O OE2 . GLU B 1 60 ? -3.759  -5.305 57.935 1.00 33.81 ? 60  GLU B OE2 1 
ATOM   965  N N   . TYR B 1 61 ? -3.503  0.540  54.536 1.00 17.58 ? 61  TYR B N   1 
ATOM   966  C CA  . TYR B 1 61 ? -3.257  1.975  54.473 1.00 15.92 ? 61  TYR B CA  1 
ATOM   967  C C   . TYR B 1 61 ? -4.322  2.611  53.592 1.00 16.54 ? 61  TYR B C   1 
ATOM   968  O O   . TYR B 1 61 ? -4.860  3.665  53.921 1.00 17.23 ? 61  TYR B O   1 
ATOM   969  C CB  . TYR B 1 61 ? -1.862  2.263  53.898 1.00 16.24 ? 61  TYR B CB  1 
ATOM   970  C CG  . TYR B 1 61 ? -0.730  2.207  54.912 1.00 15.13 ? 61  TYR B CG  1 
ATOM   971  C CD1 . TYR B 1 61 ? -0.812  1.394  56.037 1.00 17.59 ? 61  TYR B CD1 1 
ATOM   972  C CD2 . TYR B 1 61 ? 0.431   2.946  54.725 1.00 16.44 ? 61  TYR B CD2 1 
ATOM   973  C CE1 . TYR B 1 61 ? 0.231   1.322  56.947 1.00 17.44 ? 61  TYR B CE1 1 
ATOM   974  C CE2 . TYR B 1 61 ? 1.485   2.876  55.626 1.00 13.58 ? 61  TYR B CE2 1 
ATOM   975  C CZ  . TYR B 1 61 ? 1.379   2.064  56.736 1.00 17.16 ? 61  TYR B CZ  1 
ATOM   976  O OH  . TYR B 1 61 ? 2.421   1.989  57.637 1.00 15.07 ? 61  TYR B OH  1 
ATOM   977  N N   . ILE B 1 62 ? -4.628  1.970  52.467 1.00 16.89 ? 62  ILE B N   1 
ATOM   978  C CA  . ILE B 1 62 ? -5.642  2.500  51.561 1.00 17.69 ? 62  ILE B CA  1 
ATOM   979  C C   . ILE B 1 62 ? -6.991  2.579  52.273 1.00 18.93 ? 62  ILE B C   1 
ATOM   980  O O   . ILE B 1 62 ? -7.713  3.567  52.146 1.00 17.54 ? 62  ILE B O   1 
ATOM   981  C CB  . ILE B 1 62 ? -5.785  1.625  50.300 1.00 17.67 ? 62  ILE B CB  1 
ATOM   982  C CG1 . ILE B 1 62 ? -4.550  1.788  49.410 1.00 15.28 ? 62  ILE B CG1 1 
ATOM   983  C CG2 . ILE B 1 62 ? -7.051  2.012  49.542 1.00 17.66 ? 62  ILE B CG2 1 
ATOM   984  C CD1 . ILE B 1 62 ? -4.518  0.833  48.226 1.00 14.15 ? 62  ILE B CD1 1 
ATOM   985  N N   . ASN B 1 63 ? -7.324  1.538  53.029 1.00 20.32 ? 63  ASN B N   1 
ATOM   986  C CA  . ASN B 1 63 ? -8.580  1.518  53.766 1.00 23.20 ? 63  ASN B CA  1 
ATOM   987  C C   . ASN B 1 63 ? -8.659  2.699  54.725 1.00 22.62 ? 63  ASN B C   1 
ATOM   988  O O   . ASN B 1 63 ? -9.676  3.385  54.785 1.00 22.16 ? 63  ASN B O   1 
ATOM   989  C CB  . ASN B 1 63 ? -8.721  0.210  54.553 1.00 26.50 ? 63  ASN B CB  1 
ATOM   990  C CG  . ASN B 1 63 ? -9.089  -0.967 53.669 1.00 31.61 ? 63  ASN B CG  1 
ATOM   991  O OD1 . ASN B 1 63 ? -9.109  -2.114 54.118 1.00 35.18 ? 63  ASN B OD1 1 
ATOM   992  N ND2 . ASN B 1 63 ? -9.389  -0.687 52.406 1.00 34.05 ? 63  ASN B ND2 1 
ATOM   993  N N   . SER B 1 64 ? -7.583  2.949  55.467 1.00 22.41 ? 64  SER B N   1 
ATOM   994  C CA  . SER B 1 64 ? -7.584  4.051  56.421 1.00 23.05 ? 64  SER B CA  1 
ATOM   995  C C   . SER B 1 64 ? -7.709  5.394  55.714 1.00 24.51 ? 64  SER B C   1 
ATOM   996  O O   . SER B 1 64 ? -8.336  6.316  56.233 1.00 24.21 ? 64  SER B O   1 
ATOM   997  C CB  . SER B 1 64 ? -6.313  4.033  57.284 1.00 23.04 ? 64  SER B CB  1 
ATOM   998  O OG  . SER B 1 64 ? -5.176  4.424  56.541 1.00 24.72 ? 64  SER B OG  1 
ATOM   999  N N   . LEU B 1 65 ? -7.113  5.507  54.530 1.00 24.47 ? 65  LEU B N   1 
ATOM   1000 C CA  . LEU B 1 65 ? -7.185  6.752  53.774 1.00 26.61 ? 65  LEU B CA  1 
ATOM   1001 C C   . LEU B 1 65 ? -8.571  6.931  53.154 1.00 29.85 ? 65  LEU B C   1 
ATOM   1002 O O   . LEU B 1 65 ? -8.979  8.047  52.836 1.00 31.52 ? 65  LEU B O   1 
ATOM   1003 C CB  . LEU B 1 65 ? -6.105  6.772  52.684 1.00 23.46 ? 65  LEU B CB  1 
ATOM   1004 C CG  . LEU B 1 65 ? -4.669  6.882  53.213 1.00 20.81 ? 65  LEU B CG  1 
ATOM   1005 C CD1 . LEU B 1 65 ? -3.664  6.585  52.116 1.00 21.81 ? 65  LEU B CD1 1 
ATOM   1006 C CD2 . LEU B 1 65 ? -4.452  8.274  53.776 1.00 20.71 ? 65  LEU B CD2 1 
ATOM   1007 N N   . GLU B 1 66 ? -9.291  5.823  52.994 1.00 32.91 ? 66  GLU B N   1 
ATOM   1008 C CA  . GLU B 1 66 ? -10.634 5.841  52.422 1.00 36.41 ? 66  GLU B CA  1 
ATOM   1009 C C   . GLU B 1 66 ? -11.708 6.191  53.445 1.00 38.50 ? 66  GLU B C   1 
ATOM   1010 O O   . GLU B 1 66 ? -12.778 6.681  53.086 1.00 38.90 ? 66  GLU B O   1 
ATOM   1011 C CB  . GLU B 1 66 ? -10.964 4.481  51.803 1.00 36.71 ? 66  GLU B CB  1 
ATOM   1012 C CG  . GLU B 1 66 ? -10.340 4.259  50.446 1.00 39.98 ? 66  GLU B CG  1 
ATOM   1013 C CD  . GLU B 1 66 ? -10.770 5.312  49.451 1.00 42.16 ? 66  GLU B CD  1 
ATOM   1014 O OE1 . GLU B 1 66 ? -11.993 5.530  49.313 1.00 42.79 ? 66  GLU B OE1 1 
ATOM   1015 O OE2 . GLU B 1 66 ? -9.889  5.921  48.809 1.00 45.34 ? 66  GLU B OE2 1 
ATOM   1016 N N   . MET B 1 67 ? -11.425 5.928  54.715 1.00 42.05 ? 67  MET B N   1 
ATOM   1017 C CA  . MET B 1 67 ? -12.377 6.218  55.780 1.00 46.21 ? 67  MET B CA  1 
ATOM   1018 C C   . MET B 1 67 ? -12.301 7.682  56.197 1.00 48.22 ? 67  MET B C   1 
ATOM   1019 O O   . MET B 1 67 ? -13.194 8.192  56.875 1.00 48.88 ? 67  MET B O   1 
ATOM   1020 C CB  . MET B 1 67 ? -12.102 5.318  56.986 1.00 47.54 ? 67  MET B CB  1 
ATOM   1021 C CG  . MET B 1 67 ? -12.200 3.834  56.673 1.00 50.08 ? 67  MET B CG  1 
ATOM   1022 S SD  . MET B 1 67 ? -13.827 3.375  56.046 1.00 53.67 ? 67  MET B SD  1 
ATOM   1023 C CE  . MET B 1 67 ? -14.666 2.969  57.582 1.00 53.13 ? 67  MET B CE  1 
ATOM   1024 N N   . SER B 1 68 ? -11.225 8.348  55.787 1.00 50.29 ? 68  SER B N   1 
ATOM   1025 C CA  . SER B 1 68 ? -11.011 9.757  56.103 1.00 51.69 ? 68  SER B CA  1 
ATOM   1026 C C   . SER B 1 68 ? -11.233 10.068 57.579 1.00 51.85 ? 68  SER B C   1 
ATOM   1027 O O   . SER B 1 68 ? -12.134 10.879 57.879 1.00 52.24 ? 68  SER B O   1 
ATOM   1028 C CB  . SER B 1 68 ? -11.933 10.628 55.249 1.00 51.29 ? 68  SER B CB  1 
ATOM   1029 O OG  . SER B 1 68 ? -11.638 10.466 53.874 1.00 53.59 ? 68  SER B OG  1 
ATOM   1030 O OXT . SER B 1 68 ? -10.500 9.501  58.416 1.00 52.60 ? 68  SER B OXT 1 
HETATM 1031 C C1  . SGN C 2 .  ? 17.826  7.465  32.230 1.00 35.11 ? 1   SGN C C1  1 
HETATM 1032 C C2  . SGN C 2 .  ? 17.902  6.234  33.153 1.00 35.13 ? 1   SGN C C2  1 
HETATM 1033 C C3  . SGN C 2 .  ? 17.578  6.681  34.581 1.00 35.76 ? 1   SGN C C3  1 
HETATM 1034 C C4  . SGN C 2 .  ? 18.604  7.744  35.047 1.00 35.96 ? 1   SGN C C4  1 
HETATM 1035 C C5  . SGN C 2 .  ? 18.562  8.923  34.009 1.00 36.40 ? 1   SGN C C5  1 
HETATM 1036 C C6  . SGN C 2 .  ? 19.597  10.006 34.392 1.00 40.05 ? 1   SGN C C6  1 
HETATM 1037 N N2  . SGN C 2 .  ? 16.931  5.233  32.726 1.00 33.86 ? 1   SGN C N2  1 
HETATM 1038 O O1  . SGN C 2 .  ? 16.495  8.016  32.257 1.00 35.70 ? 1   SGN C O1  1 
HETATM 1039 O O3  . SGN C 2 .  ? 17.625  5.571  35.485 1.00 37.26 ? 1   SGN C O3  1 
HETATM 1040 O O4  . SGN C 2 .  ? 18.409  8.245  36.398 1.00 33.86 ? 1   SGN C O4  1 
HETATM 1041 O O5  . SGN C 2 .  ? 18.783  8.478  32.639 1.00 35.62 ? 1   SGN C O5  1 
HETATM 1042 O O6  . SGN C 2 .  ? 20.894  9.715  33.851 1.00 43.90 ? 1   SGN C O6  1 
HETATM 1043 S S1  . SGN C 2 .  ? 17.386  3.649  32.636 1.00 36.11 ? 1   SGN C S1  1 
HETATM 1044 O O1S . SGN C 2 .  ? 17.659  3.154  33.941 1.00 33.93 ? 1   SGN C O1S 1 
HETATM 1045 O O2S . SGN C 2 .  ? 16.333  2.889  32.058 1.00 34.82 ? 1   SGN C O2S 1 
HETATM 1046 O O3S . SGN C 2 .  ? 18.744  3.525  31.692 1.00 33.86 ? 1   SGN C O3S 1 
HETATM 1047 S S2  . SGN C 2 .  ? 21.952  10.298 34.806 1.00 45.69 ? 1   SGN C S2  1 
HETATM 1048 O O4S . SGN C 2 .  ? 21.850  9.682  36.091 1.00 43.57 ? 1   SGN C O4S 1 
HETATM 1049 O O5S . SGN C 2 .  ? 23.241  10.041 34.284 1.00 46.05 ? 1   SGN C O5S 1 
HETATM 1050 O O6S . SGN C 2 .  ? 21.744  11.939 34.961 1.00 45.09 ? 1   SGN C O6S 1 
HETATM 1051 S S   . UAP C 2 .  ? 14.095  8.167  38.026 1.00 38.82 ? 2   UAP C S   1 
HETATM 1052 C C1  . UAP C 2 .  ? 17.081  8.840  36.581 1.00 33.76 ? 2   UAP C C1  1 
HETATM 1053 C C2  . UAP C 2 .  ? 16.533  8.572  38.015 1.00 33.45 ? 2   UAP C C2  1 
HETATM 1054 O O2  . UAP C 2 .  ? 15.233  9.199  38.134 1.00 36.99 ? 2   UAP C O2  1 
HETATM 1055 C C3  . UAP C 2 .  ? 17.499  9.228  39.057 1.00 32.80 ? 2   UAP C C3  1 
HETATM 1056 O O3  . UAP C 2 .  ? 18.641  8.383  39.252 1.00 30.27 ? 2   UAP C O3  1 
HETATM 1057 C C4  . UAP C 2 .  ? 17.970  10.611 38.609 1.00 31.68 ? 2   UAP C C4  1 
HETATM 1058 C C5  . UAP C 2 .  ? 17.781  11.065 37.347 1.00 32.25 ? 2   UAP C C5  1 
HETATM 1059 O O5  . UAP C 2 .  ? 17.156  10.296 36.402 1.00 33.44 ? 2   UAP C O5  1 
HETATM 1060 C C6  . UAP C 2 .  ? 18.232  12.409 36.961 1.00 30.64 ? 2   UAP C C6  1 
HETATM 1061 O O1S . UAP C 2 .  ? 12.869  8.830  38.306 1.00 38.15 ? 2   UAP C O1S 1 
HETATM 1062 O O2S . UAP C 2 .  ? 14.038  7.626  36.705 1.00 34.55 ? 2   UAP C O2S 1 
HETATM 1063 O O3S . UAP C 2 .  ? 14.315  6.943  39.128 1.00 37.78 ? 2   UAP C O3S 1 
HETATM 1064 O O6B . UAP C 2 .  ? 17.702  12.970 36.025 1.00 33.65 ? 2   UAP C O6B 1 
HETATM 1065 O O6A . UAP C 2 .  ? 19.255  13.054 37.667 1.00 30.87 ? 2   UAP C O6A 1 
HETATM 1066 C C   . ACY D 3 .  ? -0.783  13.066 57.970 1.00 44.30 ? 201 ACY B C   1 
HETATM 1067 O O   . ACY D 3 .  ? 0.204   13.774 58.407 1.00 43.82 ? 201 ACY B O   1 
HETATM 1068 O OXT . ACY D 3 .  ? -1.408  13.178 56.706 1.00 43.66 ? 201 ACY B OXT 1 
HETATM 1069 C CH3 . ACY D 3 .  ? -1.278  12.017 58.972 1.00 42.75 ? 201 ACY B CH3 1 
HETATM 1070 O O   . HOH E 4 .  ? 5.792   4.996  28.057 1.00 14.49 ? 302 HOH A O   1 
HETATM 1071 O O   . HOH E 4 .  ? 8.197   7.611  27.845 1.00 9.35  ? 303 HOH A O   1 
HETATM 1072 O O   . HOH E 4 .  ? 9.724   3.475  40.088 1.00 19.66 ? 304 HOH A O   1 
HETATM 1073 O O   . HOH E 4 .  ? 11.426  8.993  33.141 1.00 16.53 ? 305 HOH A O   1 
HETATM 1074 O O   . HOH E 4 .  ? 11.630  6.345  27.546 1.00 16.41 ? 306 HOH A O   1 
HETATM 1075 O O   . HOH E 4 .  ? 5.531   2.975  30.295 1.00 16.66 ? 307 HOH A O   1 
HETATM 1076 O O   . HOH E 4 .  ? 23.380  17.277 19.608 1.00 24.28 ? 308 HOH A O   1 
HETATM 1077 O O   . HOH E 4 .  ? 10.418  -1.594 32.202 1.00 15.93 ? 309 HOH A O   1 
HETATM 1078 O O   . HOH E 4 .  ? 17.501  27.399 24.300 1.00 27.12 ? 310 HOH A O   1 
HETATM 1079 O O   . HOH E 4 .  ? 9.834   26.840 16.117 1.00 31.58 ? 311 HOH A O   1 
HETATM 1080 O O   . HOH E 4 .  ? 13.522  7.865  26.068 1.00 20.70 ? 312 HOH A O   1 
HETATM 1081 O O   . HOH E 4 .  ? 1.270   10.276 20.057 1.00 35.11 ? 313 HOH A O   1 
HETATM 1082 O O   . HOH E 4 .  ? 3.660   23.688 14.968 1.00 25.44 ? 314 HOH A O   1 
HETATM 1083 O O   . HOH E 4 .  ? 8.568   11.127 41.927 1.00 20.68 ? 315 HOH A O   1 
HETATM 1084 O O   . HOH E 4 .  ? 7.207   -0.036 30.813 1.00 12.42 ? 316 HOH A O   1 
HETATM 1085 O O   . HOH E 4 .  ? 6.440   14.519 18.667 1.00 23.62 ? 317 HOH A O   1 
HETATM 1086 O O   . HOH E 4 .  ? 5.619   20.990 34.653 1.00 25.30 ? 318 HOH A O   1 
HETATM 1087 O O   . HOH E 4 .  ? 5.521   15.652 15.647 1.00 35.95 ? 319 HOH A O   1 
HETATM 1088 O O   . HOH E 4 .  ? 24.272  20.175 18.308 1.00 28.40 ? 320 HOH A O   1 
HETATM 1089 O O   . HOH E 4 .  ? 7.534   15.006 34.329 1.00 22.32 ? 321 HOH A O   1 
HETATM 1090 O O   . HOH E 4 .  ? 7.363   10.737 38.438 1.00 22.84 ? 322 HOH A O   1 
HETATM 1091 O O   . HOH E 4 .  ? 6.026   12.647 37.329 1.00 30.08 ? 323 HOH A O   1 
HETATM 1092 O O   . HOH E 4 .  ? 14.454  0.766  45.521 1.00 41.26 ? 324 HOH A O   1 
HETATM 1093 O O   . HOH E 4 .  ? 20.804  19.533 13.818 1.00 41.23 ? 325 HOH A O   1 
HETATM 1094 O O   . HOH E 4 .  ? 1.614   4.928  24.379 1.00 26.62 ? 326 HOH A O   1 
HETATM 1095 O O   . HOH E 4 .  ? 19.357  22.174 15.435 1.00 37.60 ? 327 HOH A O   1 
HETATM 1096 O O   . HOH E 4 .  ? 18.292  26.526 26.792 1.00 34.83 ? 328 HOH A O   1 
HETATM 1097 O O   . HOH E 4 .  ? 8.530   6.258  19.480 1.00 52.19 ? 329 HOH A O   1 
HETATM 1098 O O   . HOH E 4 .  ? 18.219  20.459 29.083 1.00 25.12 ? 330 HOH A O   1 
HETATM 1099 O O   . HOH E 4 .  ? 20.764  7.844  37.844 1.00 24.32 ? 331 HOH A O   1 
HETATM 1100 O O   . HOH E 4 .  ? 2.784   1.736  26.095 1.00 30.26 ? 332 HOH A O   1 
HETATM 1101 O O   . HOH E 4 .  ? 11.991  8.045  40.655 1.00 25.65 ? 333 HOH A O   1 
HETATM 1102 O O   . HOH E 4 .  ? 1.151   23.604 15.316 1.00 32.42 ? 334 HOH A O   1 
HETATM 1103 O O   . HOH E 4 .  ? 16.722  26.264 32.978 1.00 33.49 ? 335 HOH A O   1 
HETATM 1104 O O   . HOH E 4 .  ? 13.610  9.866  35.108 1.00 28.62 ? 336 HOH A O   1 
HETATM 1105 O O   . HOH E 4 .  ? 18.174  13.317 29.170 1.00 32.92 ? 337 HOH A O   1 
HETATM 1106 O O   . HOH E 4 .  ? 16.695  7.343  28.842 1.00 36.38 ? 338 HOH A O   1 
HETATM 1107 O O   . HOH E 4 .  ? 17.310  23.629 13.640 1.00 33.75 ? 339 HOH A O   1 
HETATM 1108 O O   . HOH E 4 .  ? 14.540  29.248 24.325 1.00 34.58 ? 340 HOH A O   1 
HETATM 1109 O O   . HOH E 4 .  ? 4.547   26.853 23.852 1.00 28.36 ? 341 HOH A O   1 
HETATM 1110 O O   . HOH E 4 .  ? 14.731  22.923 13.287 1.00 45.79 ? 342 HOH A O   1 
HETATM 1111 O O   . HOH E 4 .  ? 1.837   19.704 28.674 1.00 39.15 ? 343 HOH A O   1 
HETATM 1112 O O   . HOH E 4 .  ? 18.494  12.768 31.696 1.00 44.80 ? 344 HOH A O   1 
HETATM 1113 O O   . HOH E 4 .  ? 21.747  23.025 15.911 1.00 40.51 ? 345 HOH A O   1 
HETATM 1114 O O   . HOH E 4 .  ? 0.794   26.358 16.136 1.00 49.31 ? 346 HOH A O   1 
HETATM 1115 O O   . HOH E 4 .  ? 7.106   13.370 41.482 1.00 33.17 ? 347 HOH A O   1 
HETATM 1116 O O   . HOH E 4 .  ? 16.601  11.631 19.365 1.00 46.32 ? 348 HOH A O   1 
HETATM 1117 O O   . HOH E 4 .  ? 16.364  0.218  31.902 1.00 41.72 ? 349 HOH A O   1 
HETATM 1118 O O   . HOH E 4 .  ? -1.143  25.515 17.760 1.00 34.49 ? 350 HOH A O   1 
HETATM 1119 O O   . HOH E 4 .  ? 18.619  -0.547 30.837 1.00 37.67 ? 351 HOH A O   1 
HETATM 1120 O O   . HOH E 4 .  ? 13.977  4.715  45.402 1.00 36.60 ? 352 HOH A O   1 
HETATM 1121 O O   . HOH E 4 .  ? 4.638   12.666 16.864 1.00 34.91 ? 353 HOH A O   1 
HETATM 1122 O O   . HOH E 4 .  ? 0.096   21.973 30.187 1.00 29.34 ? 354 HOH A O   1 
HETATM 1123 O O   . HOH E 4 .  ? -1.224  14.019 20.975 1.00 45.05 ? 355 HOH A O   1 
HETATM 1124 O O   . HOH E 4 .  ? 14.120  7.830  44.467 1.00 33.43 ? 356 HOH A O   1 
HETATM 1125 O O   . HOH E 4 .  ? 18.989  14.861 39.651 1.00 34.71 ? 357 HOH A O   1 
HETATM 1126 O O   . HOH E 4 .  ? 4.468   27.461 27.129 1.00 25.25 ? 358 HOH A O   1 
HETATM 1127 O O   . HOH E 4 .  ? 6.722   29.060 27.329 1.00 29.10 ? 359 HOH A O   1 
HETATM 1128 O O   . HOH E 4 .  ? 11.351  29.886 32.655 1.00 34.88 ? 360 HOH A O   1 
HETATM 1129 O O   . HOH E 4 .  ? 14.357  -4.474 34.971 1.00 50.85 ? 361 HOH A O   1 
HETATM 1130 O O   . HOH E 4 .  ? 0.781   25.762 32.979 1.00 55.76 ? 362 HOH A O   1 
HETATM 1131 O O   . HOH E 4 .  ? 7.049   31.125 26.344 1.00 44.49 ? 363 HOH A O   1 
HETATM 1132 O O   . HOH E 4 .  ? 23.421  12.977 10.868 1.00 45.15 ? 364 HOH A O   1 
HETATM 1133 O O   . HOH E 4 .  ? 16.359  8.324  43.073 1.00 37.18 ? 365 HOH A O   1 
HETATM 1134 O O   . HOH E 4 .  ? 18.215  20.418 32.012 1.00 36.98 ? 366 HOH A O   1 
HETATM 1135 O O   . HOH E 4 .  ? 7.591   9.327  12.553 1.00 58.33 ? 367 HOH A O   1 
HETATM 1136 O O   . HOH E 4 .  ? 10.432  33.749 28.117 1.00 35.40 ? 368 HOH A O   1 
HETATM 1137 O O   . HOH E 4 .  ? 9.304   32.138 25.908 1.00 40.28 ? 369 HOH A O   1 
HETATM 1138 O O   . HOH E 4 .  ? 9.974   16.802 11.789 1.00 32.37 ? 370 HOH A O   1 
HETATM 1139 O O   . HOH E 4 .  ? 15.506  12.003 34.249 1.00 32.39 ? 371 HOH A O   1 
HETATM 1140 O O   . HOH E 4 .  ? 5.364   10.223 16.418 1.00 39.81 ? 372 HOH A O   1 
HETATM 1141 O O   . HOH E 4 .  ? 7.802   14.386 36.849 1.00 33.86 ? 373 HOH A O   1 
HETATM 1142 O O   . HOH E 4 .  ? 0.450   17.116 12.297 1.00 47.01 ? 374 HOH A O   1 
HETATM 1143 O O   . HOH E 4 .  ? 19.019  25.574 34.377 1.00 47.68 ? 375 HOH A O   1 
HETATM 1144 O O   . HOH E 4 .  ? 9.340   10.488 10.781 1.00 49.01 ? 376 HOH A O   1 
HETATM 1145 O O   . HOH E 4 .  ? 4.930   32.418 26.888 1.00 59.64 ? 377 HOH A O   1 
HETATM 1146 O O   . HOH E 4 .  ? 16.561  -1.713 36.985 1.00 38.78 ? 378 HOH A O   1 
HETATM 1147 O O   . HOH E 4 .  ? 3.672   8.067  17.394 1.00 50.24 ? 379 HOH A O   1 
HETATM 1148 O O   . HOH E 4 .  ? 20.742  14.749 18.623 1.00 47.12 ? 380 HOH A O   1 
HETATM 1149 O O   . HOH E 4 .  ? 1.589   12.741 17.733 1.00 44.77 ? 381 HOH A O   1 
HETATM 1150 O O   . HOH E 4 .  ? 12.228  22.335 13.015 1.00 65.54 ? 382 HOH A O   1 
HETATM 1151 O O   . HOH E 4 .  ? 16.603  -2.621 31.769 1.00 55.08 ? 383 HOH A O   1 
HETATM 1152 O O   . HOH E 4 .  ? 1.956   33.053 25.742 1.00 60.33 ? 384 HOH A O   1 
HETATM 1153 O O   . HOH E 4 .  ? 5.345   9.713  9.720  1.00 57.10 ? 385 HOH A O   1 
HETATM 1154 O O   . HOH E 4 .  ? 2.608   28.196 32.666 1.00 36.72 ? 386 HOH A O   1 
HETATM 1155 O O   . HOH E 4 .  ? 19.218  23.074 28.015 1.00 46.07 ? 387 HOH A O   1 
HETATM 1156 O O   . HOH E 4 .  ? 15.206  12.187 13.455 1.00 46.74 ? 388 HOH A O   1 
HETATM 1157 O O   . HOH E 4 .  ? 11.119  13.225 10.676 1.00 40.51 ? 389 HOH A O   1 
HETATM 1158 O O   . HOH E 4 .  ? 18.131  8.126  26.453 1.00 47.78 ? 390 HOH A O   1 
HETATM 1159 O O   . HOH F 4 .  ? 2.995   2.006  37.722 1.00 12.31 ? 202 HOH B O   1 
HETATM 1160 O O   . HOH F 4 .  ? 3.493   1.077  29.767 1.00 16.33 ? 203 HOH B O   1 
HETATM 1161 O O   . HOH F 4 .  ? -0.522  1.082  36.824 1.00 13.92 ? 204 HOH B O   1 
HETATM 1162 O O   . HOH F 4 .  ? 4.207   12.757 35.382 1.00 19.67 ? 205 HOH B O   1 
HETATM 1163 O O   . HOH F 4 .  ? -3.074  16.937 49.794 1.00 17.28 ? 206 HOH B O   1 
HETATM 1164 O O   . HOH F 4 .  ? 0.457   1.532  27.690 1.00 23.20 ? 207 HOH B O   1 
HETATM 1165 O O   . HOH F 4 .  ? 5.191   -2.563 48.415 1.00 24.61 ? 208 HOH B O   1 
HETATM 1166 O O   . HOH F 4 .  ? 5.381   1.556  32.547 1.00 15.94 ? 209 HOH B O   1 
HETATM 1167 O O   . HOH F 4 .  ? 1.980   -6.662 54.665 1.00 33.69 ? 210 HOH B O   1 
HETATM 1168 O O   . HOH F 4 .  ? -3.335  -1.902 32.844 1.00 36.04 ? 211 HOH B O   1 
HETATM 1169 O O   . HOH F 4 .  ? -1.213  -1.574 58.691 1.00 22.94 ? 212 HOH B O   1 
HETATM 1170 O O   . HOH F 4 .  ? -2.114  0.511  39.321 1.00 23.71 ? 213 HOH B O   1 
HETATM 1171 O O   . HOH F 4 .  ? -6.110  9.275  49.521 1.00 18.05 ? 214 HOH B O   1 
HETATM 1172 O O   . HOH F 4 .  ? -6.278  0.076  58.019 1.00 39.54 ? 215 HOH B O   1 
HETATM 1173 O O   . HOH F 4 .  ? -5.166  2.617  37.316 1.00 22.31 ? 216 HOH B O   1 
HETATM 1174 O O   . HOH F 4 .  ? 5.142   0.836  35.220 1.00 15.41 ? 217 HOH B O   1 
HETATM 1175 O O   . HOH F 4 .  ? -0.894  -1.809 34.841 1.00 32.28 ? 218 HOH B O   1 
HETATM 1176 O O   . HOH F 4 .  ? 2.955   0.273  59.622 1.00 35.75 ? 219 HOH B O   1 
HETATM 1177 O O   . HOH F 4 .  ? 1.618   10.599 29.227 1.00 20.30 ? 220 HOH B O   1 
HETATM 1178 O O   . HOH F 4 .  ? -1.556  13.088 45.286 1.00 20.82 ? 221 HOH B O   1 
HETATM 1179 O O   . HOH F 4 .  ? -13.464 5.316  47.246 1.00 23.11 ? 222 HOH B O   1 
HETATM 1180 O O   . HOH F 4 .  ? 10.316  -3.740 43.799 1.00 20.15 ? 223 HOH B O   1 
HETATM 1181 O O   . HOH F 4 .  ? 7.656   -2.869 30.418 1.00 37.87 ? 224 HOH B O   1 
HETATM 1182 O O   . HOH F 4 .  ? 11.041  -2.733 36.846 1.00 35.72 ? 225 HOH B O   1 
HETATM 1183 O O   . HOH F 4 .  ? 8.832   -4.255 36.685 1.00 48.60 ? 226 HOH B O   1 
HETATM 1184 O O   . HOH F 4 .  ? 4.071   -6.283 36.329 1.00 51.48 ? 227 HOH B O   1 
HETATM 1185 O O   . HOH F 4 .  ? -6.232  6.441  41.550 1.00 24.73 ? 228 HOH B O   1 
HETATM 1186 O O   . HOH F 4 .  ? -7.622  4.938  39.750 1.00 22.65 ? 229 HOH B O   1 
HETATM 1187 O O   . HOH F 4 .  ? -0.195  7.263  36.978 1.00 15.69 ? 230 HOH B O   1 
HETATM 1188 O O   . HOH F 4 .  ? 2.037   18.566 52.559 1.00 36.19 ? 231 HOH B O   1 
HETATM 1189 O O   . HOH F 4 .  ? -11.197 -0.160 49.544 1.00 30.25 ? 232 HOH B O   1 
HETATM 1190 O O   . HOH F 4 .  ? -9.123  8.723  49.188 1.00 35.77 ? 233 HOH B O   1 
HETATM 1191 O O   . HOH F 4 .  ? 1.743   16.626 45.709 1.00 42.15 ? 234 HOH B O   1 
HETATM 1192 O O   . HOH F 4 .  ? 2.855   -0.914 28.167 1.00 33.66 ? 235 HOH B O   1 
HETATM 1193 O O   . HOH F 4 .  ? 4.959   13.106 39.691 1.00 24.13 ? 236 HOH B O   1 
HETATM 1194 O O   . HOH F 4 .  ? -2.924  -0.835 36.635 1.00 25.26 ? 237 HOH B O   1 
HETATM 1195 O O   . HOH F 4 .  ? -0.737  3.328  26.070 1.00 48.23 ? 238 HOH B O   1 
HETATM 1196 O O   . HOH F 4 .  ? -2.045  0.510  27.610 1.00 37.08 ? 239 HOH B O   1 
HETATM 1197 O O   . HOH F 4 .  ? -3.623  10.603 56.936 1.00 43.40 ? 240 HOH B O   1 
HETATM 1198 O O   . HOH F 4 .  ? -4.496  12.296 55.074 1.00 27.57 ? 241 HOH B O   1 
HETATM 1199 O O   . HOH F 4 .  ? -12.066 -0.354 52.080 1.00 41.01 ? 242 HOH B O   1 
HETATM 1200 O O   . HOH F 4 .  ? 12.424  -0.629 46.164 1.00 42.94 ? 243 HOH B O   1 
HETATM 1201 O O   . HOH F 4 .  ? -13.391 12.974 56.560 1.00 41.07 ? 244 HOH B O   1 
HETATM 1202 O O   . HOH F 4 .  ? 1.016   -9.024 52.727 1.00 48.71 ? 245 HOH B O   1 
HETATM 1203 O O   . HOH F 4 .  ? -6.412  11.497 51.686 1.00 30.81 ? 246 HOH B O   1 
HETATM 1204 O O   . HOH F 4 .  ? -12.466 12.906 51.793 1.00 43.34 ? 247 HOH B O   1 
HETATM 1205 O O   . HOH F 4 .  ? 2.398   14.369 36.260 1.00 40.17 ? 248 HOH B O   1 
HETATM 1206 O O   . HOH F 4 .  ? -7.743  10.928 53.838 1.00 40.71 ? 249 HOH B O   1 
HETATM 1207 O O   . HOH F 4 .  ? 3.743   14.685 44.265 1.00 42.14 ? 250 HOH B O   1 
HETATM 1208 O O   . HOH F 4 .  ? 8.779   11.978 52.634 1.00 27.83 ? 251 HOH B O   1 
HETATM 1209 O O   . HOH F 4 .  ? 0.540   -6.198 42.397 1.00 54.33 ? 252 HOH B O   1 
HETATM 1210 O O   . HOH F 4 .  ? -14.730 8.240  54.670 1.00 56.44 ? 253 HOH B O   1 
HETATM 1211 O O   . HOH F 4 .  ? -2.596  4.893  25.360 1.00 51.70 ? 254 HOH B O   1 
HETATM 1212 O O   . HOH F 4 .  ? 5.102   16.429 35.908 1.00 44.29 ? 255 HOH B O   1 
HETATM 1213 O O   . HOH F 4 .  ? 7.124   -4.010 39.510 1.00 39.50 ? 256 HOH B O   1 
HETATM 1214 O O   . HOH F 4 .  ? 1.376   -2.382 58.784 1.00 52.65 ? 257 HOH B O   1 
HETATM 1215 O O   . HOH F 4 .  ? 6.669   -5.181 47.932 1.00 41.37 ? 258 HOH B O   1 
HETATM 1216 O O   . HOH F 4 .  ? -2.119  -5.706 41.168 1.00 34.48 ? 259 HOH B O   1 
HETATM 1217 O O   . HOH F 4 .  ? -5.530  4.918  37.989 1.00 22.71 ? 260 HOH B O   1 
HETATM 1218 O O   . HOH F 4 .  ? 9.228   -2.680 34.864 1.00 34.23 ? 261 HOH B O   1 
HETATM 1219 O O   . HOH F 4 .  ? -8.307  1.591  58.739 1.00 35.61 ? 262 HOH B O   1 
HETATM 1220 O O   . HOH F 4 .  ? -5.725  0.175  35.880 1.00 37.94 ? 263 HOH B O   1 
HETATM 1221 O O   . HOH F 4 .  ? -9.000  7.444  58.623 1.00 32.24 ? 264 HOH B O   1 
HETATM 1222 O O   . HOH F 4 .  ? 7.173   -6.054 53.709 1.00 58.20 ? 265 HOH B O   1 
HETATM 1223 O O   . HOH F 4 .  ? 9.382   -5.299 58.391 1.00 59.73 ? 266 HOH B O   1 
HETATM 1224 O O   . HOH F 4 .  ? 2.926   -9.071 44.094 1.00 36.97 ? 267 HOH B O   1 
HETATM 1225 O O   . HOH F 4 .  ? -0.814  13.490 26.076 1.00 45.84 ? 268 HOH B O   1 
HETATM 1226 O O   . HOH F 4 .  ? -2.567  21.365 33.954 1.00 69.61 ? 269 HOH B O   1 
HETATM 1227 O O   . HOH F 4 .  ? -5.031  -1.757 59.525 1.00 45.44 ? 270 HOH B O   1 
HETATM 1228 O O   . HOH F 4 .  ? -9.886  -0.018 57.576 1.00 37.75 ? 271 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  1  ?  ?   ?   A . n 
A 1 2  PRO 2  2  2  PRO PRO A . n 
A 1 3  TYR 3  3  3  TYR TYR A . n 
A 1 4  SER 4  4  4  SER SER A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  ASP 6  6  6  ASP ASP A . n 
A 1 7  THR 7  7  7  THR THR A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  PRO 9  9  9  PRO PRO A . n 
A 1 10 CYS 10 10 10 CYS CYS A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 PHE 12 12 12 PHE PHE A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 ILE 15 15 15 ILE ILE A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 ARG 17 17 17 ARG ALA A . n 
A 1 18 PRO 18 18 18 PRO PRO A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 ARG 21 21 21 ARG ARG A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 HIS 23 23 23 HIS HIS A . n 
A 1 24 ILE 24 24 24 ILE ILE A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 GLU 26 26 26 GLU GLU A . n 
A 1 27 TYR 27 27 27 TYR TYR A . n 
A 1 28 PHE 28 28 28 PHE PHE A . n 
A 1 29 TYR 29 29 29 TYR TYR A . n 
A 1 30 THR 30 30 30 THR THR A . n 
A 1 31 SER 31 31 31 SER SER A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 LYS 33 33 33 LYS LYS A . n 
A 1 34 CYS 34 34 34 CYS CYS A . n 
A 1 35 SER 35 35 35 SER SER A . n 
A 1 36 ASN 36 36 36 ASN ASN A . n 
A 1 37 PRO 37 37 37 PRO PRO A . n 
A 1 38 ALA 38 38 38 ALA ALA A . n 
A 1 39 VAL 39 39 39 VAL VAL A . n 
A 1 40 VAL 40 40 40 VAL VAL A . n 
A 1 41 PHE 41 41 41 PHE PHE A . n 
A 1 42 VAL 42 42 42 VAL VAL A . n 
A 1 43 THR 43 43 43 THR THR A . n 
A 1 44 ARG 44 44 44 ARG ARG A . n 
A 1 45 LYS 45 45 45 LYS ALA A . n 
A 1 46 ASN 46 46 46 ASN ASN A . n 
A 1 47 ARG 47 47 47 ARG ARG A . n 
A 1 48 GLN 48 48 48 GLN GLN A . n 
A 1 49 VAL 49 49 49 VAL VAL A . n 
A 1 50 CYS 50 50 50 CYS CYS A . n 
A 1 51 ALA 51 51 51 ALA ALA A . n 
A 1 52 ASN 52 52 52 ASN ASN A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 GLU 54 54 54 GLU ALA A . n 
A 1 55 LYS 55 55 55 LYS LYS A . n 
A 1 56 LYS 56 56 56 LYS LYS A . n 
A 1 57 TRP 57 57 57 TRP TRP A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
A 1 59 ARG 59 59 59 ARG ALA A . n 
A 1 60 GLU 60 60 60 GLU GLU A . n 
A 1 61 TYR 61 61 61 TYR TYR A . n 
A 1 62 ILE 62 62 62 ILE ILE A . n 
A 1 63 ASN 63 63 63 ASN ASN A . n 
A 1 64 SER 64 64 64 SER SER A . n 
A 1 65 LEU 65 65 65 LEU LEU A . n 
A 1 66 GLU 66 66 66 GLU GLU A . n 
A 1 67 MET 67 67 67 MET MET A . n 
A 1 68 SER 68 68 68 SER SER A . n 
B 1 1  SER 1  1  ?  ?   ?   B . n 
B 1 2  PRO 2  2  ?  ?   ?   B . n 
B 1 3  TYR 3  3  ?  ?   ?   B . n 
B 1 4  SER 4  4  4  SER SER B . n 
B 1 5  SER 5  5  5  SER SER B . n 
B 1 6  ASP 6  6  6  ASP ALA B . n 
B 1 7  THR 7  7  7  THR THR B . n 
B 1 8  THR 8  8  8  THR THR B . n 
B 1 9  PRO 9  9  9  PRO PRO B . n 
B 1 10 CYS 10 10 10 CYS CYS B . n 
B 1 11 CYS 11 11 11 CYS CYS B . n 
B 1 12 PHE 12 12 12 PHE PHE B . n 
B 1 13 ALA 13 13 13 ALA ALA B . n 
B 1 14 TYR 14 14 14 TYR TYR B . n 
B 1 15 ILE 15 15 15 ILE ILE B . n 
B 1 16 ALA 16 16 16 ALA ALA B . n 
B 1 17 ARG 17 17 17 ARG ALA B . n 
B 1 18 PRO 18 18 18 PRO PRO B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 PRO 20 20 20 PRO PRO B . n 
B 1 21 ARG 21 21 21 ARG ARG B . n 
B 1 22 ALA 22 22 22 ALA ALA B . n 
B 1 23 HIS 23 23 23 HIS HIS B . n 
B 1 24 ILE 24 24 24 ILE ILE B . n 
B 1 25 LYS 25 25 25 LYS LYS B . n 
B 1 26 GLU 26 26 26 GLU GLU B . n 
B 1 27 TYR 27 27 27 TYR TYR B . n 
B 1 28 PHE 28 28 28 PHE PHE B . n 
B 1 29 TYR 29 29 29 TYR TYR B . n 
B 1 30 THR 30 30 30 THR THR B . n 
B 1 31 SER 31 31 31 SER SER B . n 
B 1 32 GLY 32 32 32 GLY GLY B . n 
B 1 33 LYS 33 33 33 LYS LYS B . n 
B 1 34 CYS 34 34 34 CYS CYS B . n 
B 1 35 SER 35 35 35 SER SER B . n 
B 1 36 ASN 36 36 36 ASN ASN B . n 
B 1 37 PRO 37 37 37 PRO PRO B . n 
B 1 38 ALA 38 38 38 ALA ALA B . n 
B 1 39 VAL 39 39 39 VAL VAL B . n 
B 1 40 VAL 40 40 40 VAL VAL B . n 
B 1 41 PHE 41 41 41 PHE PHE B . n 
B 1 42 VAL 42 42 42 VAL VAL B . n 
B 1 43 THR 43 43 43 THR THR B . n 
B 1 44 ARG 44 44 44 ARG ARG B . n 
B 1 45 LYS 45 45 45 LYS LYS B . n 
B 1 46 ASN 46 46 46 ASN ASN B . n 
B 1 47 ARG 47 47 47 ARG ARG B . n 
B 1 48 GLN 48 48 48 GLN GLN B . n 
B 1 49 VAL 49 49 49 VAL VAL B . n 
B 1 50 CYS 50 50 50 CYS CYS B . n 
B 1 51 ALA 51 51 51 ALA ALA B . n 
B 1 52 ASN 52 52 52 ASN ASN B . n 
B 1 53 PRO 53 53 53 PRO PRO B . n 
B 1 54 GLU 54 54 54 GLU ALA B . n 
B 1 55 LYS 55 55 55 LYS ALA B . n 
B 1 56 LYS 56 56 56 LYS ALA B . n 
B 1 57 TRP 57 57 57 TRP TRP B . n 
B 1 58 VAL 58 58 58 VAL VAL B . n 
B 1 59 ARG 59 59 59 ARG ARG B . n 
B 1 60 GLU 60 60 60 GLU GLU B . n 
B 1 61 TYR 61 61 61 TYR TYR B . n 
B 1 62 ILE 62 62 62 ILE ILE B . n 
B 1 63 ASN 63 63 63 ASN ASN B . n 
B 1 64 SER 64 64 64 SER SER B . n 
B 1 65 LEU 65 65 65 LEU LEU B . n 
B 1 66 GLU 66 66 66 GLU GLU B . n 
B 1 67 MET 67 67 67 MET MET B . n 
B 1 68 SER 68 68 68 SER SER B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 ACY 1  201 1   ACY ACY B . 
E 4 HOH 1  302 1   HOH WAT A . 
E 4 HOH 2  303 2   HOH WAT A . 
E 4 HOH 3  304 3   HOH WAT A . 
E 4 HOH 4  305 5   HOH WAT A . 
E 4 HOH 5  306 8   HOH WAT A . 
E 4 HOH 6  307 9   HOH WAT A . 
E 4 HOH 7  308 10  HOH WAT A . 
E 4 HOH 8  309 13  HOH WAT A . 
E 4 HOH 9  310 14  HOH WAT A . 
E 4 HOH 10 311 17  HOH WAT A . 
E 4 HOH 11 312 18  HOH WAT A . 
E 4 HOH 12 313 21  HOH WAT A . 
E 4 HOH 13 314 28  HOH WAT A . 
E 4 HOH 14 315 29  HOH WAT A . 
E 4 HOH 15 316 30  HOH WAT A . 
E 4 HOH 16 317 34  HOH WAT A . 
E 4 HOH 17 318 37  HOH WAT A . 
E 4 HOH 18 319 41  HOH WAT A . 
E 4 HOH 19 320 42  HOH WAT A . 
E 4 HOH 20 321 43  HOH WAT A . 
E 4 HOH 21 322 44  HOH WAT A . 
E 4 HOH 22 323 45  HOH WAT A . 
E 4 HOH 23 324 49  HOH WAT A . 
E 4 HOH 24 325 50  HOH WAT A . 
E 4 HOH 25 326 51  HOH WAT A . 
E 4 HOH 26 327 52  HOH WAT A . 
E 4 HOH 27 328 53  HOH WAT A . 
E 4 HOH 28 329 54  HOH WAT A . 
E 4 HOH 29 330 55  HOH WAT A . 
E 4 HOH 30 331 60  HOH WAT A . 
E 4 HOH 31 332 62  HOH WAT A . 
E 4 HOH 32 333 63  HOH WAT A . 
E 4 HOH 33 334 64  HOH WAT A . 
E 4 HOH 34 335 66  HOH WAT A . 
E 4 HOH 35 336 67  HOH WAT A . 
E 4 HOH 36 337 72  HOH WAT A . 
E 4 HOH 37 338 73  HOH WAT A . 
E 4 HOH 38 339 75  HOH WAT A . 
E 4 HOH 39 340 76  HOH WAT A . 
E 4 HOH 40 341 79  HOH WAT A . 
E 4 HOH 41 342 80  HOH WAT A . 
E 4 HOH 42 343 82  HOH WAT A . 
E 4 HOH 43 344 84  HOH WAT A . 
E 4 HOH 44 345 86  HOH WAT A . 
E 4 HOH 45 346 87  HOH WAT A . 
E 4 HOH 46 347 89  HOH WAT A . 
E 4 HOH 47 348 91  HOH WAT A . 
E 4 HOH 48 349 93  HOH WAT A . 
E 4 HOH 49 350 95  HOH WAT A . 
E 4 HOH 50 351 96  HOH WAT A . 
E 4 HOH 51 352 99  HOH WAT A . 
E 4 HOH 52 353 103 HOH WAT A . 
E 4 HOH 53 354 104 HOH WAT A . 
E 4 HOH 54 355 105 HOH WAT A . 
E 4 HOH 55 356 110 HOH WAT A . 
E 4 HOH 56 357 111 HOH WAT A . 
E 4 HOH 57 358 112 HOH WAT A . 
E 4 HOH 58 359 113 HOH WAT A . 
E 4 HOH 59 360 114 HOH WAT A . 
E 4 HOH 60 361 115 HOH WAT A . 
E 4 HOH 61 362 120 HOH WAT A . 
E 4 HOH 62 363 123 HOH WAT A . 
E 4 HOH 63 364 124 HOH WAT A . 
E 4 HOH 64 365 126 HOH WAT A . 
E 4 HOH 65 366 128 HOH WAT A . 
E 4 HOH 66 367 129 HOH WAT A . 
E 4 HOH 67 368 131 HOH WAT A . 
E 4 HOH 68 369 132 HOH WAT A . 
E 4 HOH 69 370 133 HOH WAT A . 
E 4 HOH 70 371 135 HOH WAT A . 
E 4 HOH 71 372 136 HOH WAT A . 
E 4 HOH 72 373 137 HOH WAT A . 
E 4 HOH 73 374 140 HOH WAT A . 
E 4 HOH 74 375 143 HOH WAT A . 
E 4 HOH 75 376 144 HOH WAT A . 
E 4 HOH 76 377 145 HOH WAT A . 
E 4 HOH 77 378 146 HOH WAT A . 
E 4 HOH 78 379 147 HOH WAT A . 
E 4 HOH 79 380 148 HOH WAT A . 
E 4 HOH 80 381 149 HOH WAT A . 
E 4 HOH 81 382 150 HOH WAT A . 
E 4 HOH 82 383 151 HOH WAT A . 
E 4 HOH 83 384 153 HOH WAT A . 
E 4 HOH 84 385 156 HOH WAT A . 
E 4 HOH 85 386 157 HOH WAT A . 
E 4 HOH 86 387 158 HOH WAT A . 
E 4 HOH 87 388 159 HOH WAT A . 
E 4 HOH 88 389 160 HOH WAT A . 
E 4 HOH 89 390 161 HOH WAT A . 
F 4 HOH 1  202 4   HOH WAT B . 
F 4 HOH 2  203 6   HOH WAT B . 
F 4 HOH 3  204 7   HOH WAT B . 
F 4 HOH 4  205 11  HOH WAT B . 
F 4 HOH 5  206 12  HOH WAT B . 
F 4 HOH 6  207 15  HOH WAT B . 
F 4 HOH 7  208 16  HOH WAT B . 
F 4 HOH 8  209 19  HOH WAT B . 
F 4 HOH 9  210 20  HOH WAT B . 
F 4 HOH 10 211 22  HOH WAT B . 
F 4 HOH 11 212 23  HOH WAT B . 
F 4 HOH 12 213 24  HOH WAT B . 
F 4 HOH 13 214 25  HOH WAT B . 
F 4 HOH 14 215 26  HOH WAT B . 
F 4 HOH 15 216 27  HOH WAT B . 
F 4 HOH 16 217 31  HOH WAT B . 
F 4 HOH 17 218 32  HOH WAT B . 
F 4 HOH 18 219 33  HOH WAT B . 
F 4 HOH 19 220 35  HOH WAT B . 
F 4 HOH 20 221 36  HOH WAT B . 
F 4 HOH 21 222 38  HOH WAT B . 
F 4 HOH 22 223 39  HOH WAT B . 
F 4 HOH 23 224 40  HOH WAT B . 
F 4 HOH 24 225 46  HOH WAT B . 
F 4 HOH 25 226 47  HOH WAT B . 
F 4 HOH 26 227 48  HOH WAT B . 
F 4 HOH 27 228 56  HOH WAT B . 
F 4 HOH 28 229 57  HOH WAT B . 
F 4 HOH 29 230 58  HOH WAT B . 
F 4 HOH 30 231 59  HOH WAT B . 
F 4 HOH 31 232 61  HOH WAT B . 
F 4 HOH 32 233 65  HOH WAT B . 
F 4 HOH 33 234 68  HOH WAT B . 
F 4 HOH 34 235 69  HOH WAT B . 
F 4 HOH 35 236 70  HOH WAT B . 
F 4 HOH 36 237 71  HOH WAT B . 
F 4 HOH 37 238 74  HOH WAT B . 
F 4 HOH 38 239 77  HOH WAT B . 
F 4 HOH 39 240 78  HOH WAT B . 
F 4 HOH 40 241 81  HOH WAT B . 
F 4 HOH 41 242 83  HOH WAT B . 
F 4 HOH 42 243 85  HOH WAT B . 
F 4 HOH 43 244 88  HOH WAT B . 
F 4 HOH 44 245 90  HOH WAT B . 
F 4 HOH 45 246 94  HOH WAT B . 
F 4 HOH 46 247 97  HOH WAT B . 
F 4 HOH 47 248 98  HOH WAT B . 
F 4 HOH 48 249 100 HOH WAT B . 
F 4 HOH 49 250 101 HOH WAT B . 
F 4 HOH 50 251 102 HOH WAT B . 
F 4 HOH 51 252 106 HOH WAT B . 
F 4 HOH 52 253 107 HOH WAT B . 
F 4 HOH 53 254 108 HOH WAT B . 
F 4 HOH 54 255 109 HOH WAT B . 
F 4 HOH 55 256 116 HOH WAT B . 
F 4 HOH 56 257 117 HOH WAT B . 
F 4 HOH 57 258 118 HOH WAT B . 
F 4 HOH 58 259 119 HOH WAT B . 
F 4 HOH 59 260 121 HOH WAT B . 
F 4 HOH 60 261 122 HOH WAT B . 
F 4 HOH 61 262 125 HOH WAT B . 
F 4 HOH 62 263 130 HOH WAT B . 
F 4 HOH 63 264 134 HOH WAT B . 
F 4 HOH 64 265 138 HOH WAT B . 
F 4 HOH 65 266 139 HOH WAT B . 
F 4 HOH 66 267 141 HOH WAT B . 
F 4 HOH 67 268 142 HOH WAT B . 
F 4 HOH 68 269 152 HOH WAT B . 
F 4 HOH 69 270 154 HOH WAT B . 
F 4 HOH 70 271 155 HOH WAT B . 
# 
_pdbx_molecule_features.prd_id    PRD_900026 
_pdbx_molecule_features.name      'HEPARIN DISACCHARIDE I-S,' 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     'Substrate analog' 
_pdbx_molecule_features.details   'oligosaccharide with ring modification on monosaccharide components' 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900026 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1790 ? 
1 MORE         -19  ? 
1 'SSA (A^2)'  8140 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-11-09 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Atomic model'              
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Non-polymer description'   
8 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' software                      
2  5 'Structure model' atom_site                     
3  5 'Structure model' chem_comp                     
4  5 'Structure model' entity                        
5  5 'Structure model' entity_name_com               
6  5 'Structure model' pdbx_branch_scheme            
7  5 'Structure model' pdbx_chem_comp_identifier     
8  5 'Structure model' pdbx_entity_branch            
9  5 'Structure model' pdbx_entity_branch_descriptor 
10 5 'Structure model' pdbx_entity_branch_link       
11 5 'Structure model' pdbx_entity_branch_list       
12 5 'Structure model' pdbx_entity_nonpoly           
13 5 'Structure model' pdbx_molecule_features        
14 5 'Structure model' pdbx_nonpoly_scheme           
15 5 'Structure model' struct_conn                   
16 5 'Structure model' struct_conn_type              
17 5 'Structure model' struct_site                   
18 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_software.classification'  
2  4 'Structure model' '_software.name'            
3  5 'Structure model' '_atom_site.B_iso_or_equiv' 
4  5 'Structure model' '_atom_site.Cartn_x'        
5  5 'Structure model' '_atom_site.Cartn_y'        
6  5 'Structure model' '_atom_site.Cartn_z'        
7  5 'Structure model' '_atom_site.auth_asym_id'   
8  5 'Structure model' '_atom_site.auth_atom_id'   
9  5 'Structure model' '_atom_site.auth_comp_id'   
10 5 'Structure model' '_atom_site.auth_seq_id'    
11 5 'Structure model' '_atom_site.label_atom_id'  
12 5 'Structure model' '_atom_site.label_comp_id'  
13 5 'Structure model' '_atom_site.type_symbol'    
14 5 'Structure model' '_chem_comp.formula'        
15 5 'Structure model' '_chem_comp.formula_weight' 
16 5 'Structure model' '_chem_comp.id'             
17 5 'Structure model' '_chem_comp.mon_nstd_flag'  
18 5 'Structure model' '_chem_comp.name'           
19 5 'Structure model' '_chem_comp.type'           
20 5 'Structure model' '_entity.formula_weight'    
21 5 'Structure model' '_entity.pdbx_description'  
22 5 'Structure model' '_entity.src_method'        
23 5 'Structure model' '_entity.type'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNX       refinement        2002 ? 1 
MAR345    'data collection' .    ? 2 
SCALEPACK 'data scaling'    .    ? 3 
AMoRE     phasing           .    ? 4 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 17 ? CG  ? A ARG 17 CG  
2  1 Y 1 A ARG 17 ? CD  ? A ARG 17 CD  
3  1 Y 1 A ARG 17 ? NE  ? A ARG 17 NE  
4  1 Y 1 A ARG 17 ? CZ  ? A ARG 17 CZ  
5  1 Y 1 A ARG 17 ? NH1 ? A ARG 17 NH1 
6  1 Y 1 A ARG 17 ? NH2 ? A ARG 17 NH2 
7  1 Y 1 A LYS 45 ? CG  ? A LYS 45 CG  
8  1 Y 1 A LYS 45 ? CD  ? A LYS 45 CD  
9  1 Y 1 A LYS 45 ? CE  ? A LYS 45 CE  
10 1 Y 1 A LYS 45 ? NZ  ? A LYS 45 NZ  
11 1 Y 1 A GLU 54 ? CG  ? A GLU 54 CG  
12 1 Y 1 A GLU 54 ? CD  ? A GLU 54 CD  
13 1 Y 1 A GLU 54 ? OE1 ? A GLU 54 OE1 
14 1 Y 1 A GLU 54 ? OE2 ? A GLU 54 OE2 
15 1 Y 1 A ARG 59 ? CG  ? A ARG 59 CG  
16 1 Y 1 A ARG 59 ? CD  ? A ARG 59 CD  
17 1 Y 1 A ARG 59 ? NE  ? A ARG 59 NE  
18 1 Y 1 A ARG 59 ? CZ  ? A ARG 59 CZ  
19 1 Y 1 A ARG 59 ? NH1 ? A ARG 59 NH1 
20 1 Y 1 A ARG 59 ? NH2 ? A ARG 59 NH2 
21 1 Y 1 B ASP 6  ? CG  ? B ASP 6  CG  
22 1 Y 1 B ASP 6  ? OD1 ? B ASP 6  OD1 
23 1 Y 1 B ASP 6  ? OD2 ? B ASP 6  OD2 
24 1 Y 1 B ARG 17 ? CG  ? B ARG 17 CG  
25 1 Y 1 B ARG 17 ? CD  ? B ARG 17 CD  
26 1 Y 1 B ARG 17 ? NE  ? B ARG 17 NE  
27 1 Y 1 B ARG 17 ? CZ  ? B ARG 17 CZ  
28 1 Y 1 B ARG 17 ? NH1 ? B ARG 17 NH1 
29 1 Y 1 B ARG 17 ? NH2 ? B ARG 17 NH2 
30 1 Y 1 B GLU 54 ? CG  ? B GLU 54 CG  
31 1 Y 1 B GLU 54 ? CD  ? B GLU 54 CD  
32 1 Y 1 B GLU 54 ? OE1 ? B GLU 54 OE1 
33 1 Y 1 B GLU 54 ? OE2 ? B GLU 54 OE2 
34 1 Y 1 B LYS 55 ? CG  ? B LYS 55 CG  
35 1 Y 1 B LYS 55 ? CD  ? B LYS 55 CD  
36 1 Y 1 B LYS 55 ? CE  ? B LYS 55 CE  
37 1 Y 1 B LYS 55 ? NZ  ? B LYS 55 NZ  
38 1 Y 1 B LYS 56 ? CG  ? B LYS 56 CG  
39 1 Y 1 B LYS 56 ? CD  ? B LYS 56 CD  
40 1 Y 1 B LYS 56 ? CE  ? B LYS 56 CE  
41 1 Y 1 B LYS 56 ? NZ  ? B LYS 56 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1 ? A SER 1 
2 1 Y 1 B SER 1 ? B SER 1 
3 1 Y 1 B PRO 2 ? B PRO 2 
4 1 Y 1 B TYR 3 ? B TYR 3 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 SGN 1 C SGN 1 H H1S 1 n 
C 2 UAP 2 C UAP 2 H H1S 1 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
SGN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 'DGlcpNS[6S]a'                    
SGN 'COMMON NAME'                         GMML     1.0 N-sulfo-6-sulfo-a-D-glucopyranose 
SGN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-GlcpNSO36SO3                  
UAP 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-4-deoxy-GlcpA2SO3             
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'WURCS=2.0/2,2,1/[a2122h-1a_1-5_2*NSO/3=O/3=O_6*OSO/3=O/3=O][a21eEA-1a_1-5_2*OSO/3=O/3=O]/1-2/a4-b1' WURCS  PDB2Glycan 1.1.0 
2 2 '[][a-D-GlcpNSO36SO3]{[(4+1)][a-L-4-deoxy-IdopA2SO3]{}}'                                             LINUCS PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  UAP 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  SGN 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 SGN 1 n 
2 UAP 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ACETIC ACID' ACY 
4 water         HOH 
#