data_1U65
# 
_entry.id   1U65 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1U65         
RCSB  RCSB023293   
WWPDB D_1000023293 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          W00566 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1U65 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Harel, M.'                                  1 
'Hyatt, J.L.'                                2 
'Brumshtein, B.'                             3 
'Morton, C.L.'                               4 
'Wadkins, R.W.'                              5 
'Silman, I.'                                 6 
'Sussman, J.L.'                              7 
'Potter, P.M.'                               8 
'Israel Structural Proteomics Center (ISPC)' 9 
# 
_citation.id                        primary 
_citation.title                     
;The crystal structure of the complex of the anticancer prodrug 7-ethyl-10-[4-(1-piperidino)-1-piperidino]-carbonyloxycamptothecin (CPT-11) with Torpedo californica acetylcholinesterase provides a molecular explanation for its cholinergic action
;
_citation.journal_abbrev            Mol.Pharmacol. 
_citation.journal_volume            67 
_citation.page_first                1874 
_citation.page_last                 1881 
_citation.year                      2005 
_citation.journal_id_ASTM           MOPMA3 
_citation.country                   US 
_citation.journal_id_ISSN           0026-895X 
_citation.journal_id_CSD            0197 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15772291 
_citation.pdbx_database_id_DOI      10.1124/mol.104.009944 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Harel, M.'      1 ? 
primary 'Hyatt, J.L.'    2 ? 
primary 'Brumshtein, B.' 3 ? 
primary 'Morton, C.L.'   4 ? 
primary 'Yoon, K.J.'     5 ? 
primary 'Wadkins, R.M.'  6 ? 
primary 'Silman, I.'     7 ? 
primary 'Sussman, J.L.'  8 ? 
primary 'Potter, P.M.'   9 ? 
# 
_cell.entry_id           1U65 
_cell.length_a           137.870 
_cell.length_b           137.870 
_cell.length_c           70.890 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1U65 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Acetylcholinesterase 61325.090 1   3.1.1.7 ? ? ? 
2 branched    man 'beta-L-fucopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose' 367.349   1   ?       ? ? ? 
3 branched    man 'alpha-L-fucopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose' 367.349   1   ?       ? ? ? 
4 branched    man 'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 383.349   1   ?       ? ? ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?       ? ? ? 
6 non-polymer syn 
;(4S)-4,11-DIETHYL-4-HYDROXY-3,14-DIOXO-3,4,12,14-TETRAHYDRO-1H-PYRANO[3',4':6,7]INDOLIZINO[1,2-B]QUINOLIN-9-YL 1,4'-BIPIPERIDINE-1'-CARBOXYLATE
;
586.678   1   ?       ? ? ? 
7 non-polymer syn 'IODIDE ION' 126.904   1   ?       ? ? ? 
8 water       nat water 18.015    241 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         W00566 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1U65 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ?                        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE ?                        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE ?                        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ?                        'C4 H7 N O4'     133.103 
CP0 non-polymer                   . 
;(4S)-4,11-DIETHYL-4-HYDROXY-3,14-DIOXO-3,4,12,14-TETRAHYDRO-1H-PYRANO[3',4':6,7]INDOLIZINO[1,2-B]QUINOLIN-9-YL 1,4'-BIPIPERIDINE-1'-CARBOXYLATE
;
'IRINOTECAN; CPT-11'     'C33 H38 N4 O6'  586.678 
CYS 'L-peptide linking'           y CYSTEINE ?                        'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose ?                        'C6 H12 O5'      164.156 
FUL 'L-saccharide, beta linking'  . beta-L-fucopyranose 6-DEOXY-BETA-L-GALACTOSE 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE ?                        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ?                        'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE ?                        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE ?                        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER ?                        'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ?                        'C6 H13 N O2'    131.173 
IOD non-polymer                   . 'IODIDE ION' ?                        'I -1'           126.904 
LEU 'L-peptide linking'           y LEUCINE ?                        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE ?                        'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ?                        'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE ?                        'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                        'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE ?                        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE ?                        'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE ?                        'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE ?                        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ?                        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE ?                        'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE ?                        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1U65 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.17 
_exptl_crystal.density_percent_sol   61.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS4++' 
_diffrn_detector.pdbx_collection_date   2004-02-25 
_diffrn_detector.details                'OSMIC MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5415 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5415 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1U65 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             28.0 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   23820 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            0.094 
_reflns.pdbx_Rsym_value              0.08 
_reflns.pdbx_netI_over_sigmaI        10.3 
_reflns.B_iso_Wilson_estimate        19.7 
_reflns.pdbx_redundancy              3.17 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              2.7 
_reflns_shell.percent_possible_all   90.9 
_reflns_shell.Rmerge_I_obs           0.211 
_reflns_shell.pdbx_Rsym_value        0.24 
_reflns_shell.meanI_over_sigI_obs    4.7 
_reflns_shell.pdbx_redundancy        2.98 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2311 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1U65 
_refine.ls_number_reflns_obs                     23820 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           2989610 
_refine.ls_d_res_low                             27.88 
_refine.ls_d_res_high                            2.61 
_refine.ls_percent_reflns_obs                    99.2 
_refine.ls_R_factor_obs                          0.187 
_refine.ls_R_factor_all                          0.193 
_refine.ls_R_factor_R_work                       0.187 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  2382 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               39.9 
_refine.aniso_B[1][1]                            5.52 
_refine.aniso_B[2][2]                            5.52 
_refine.aniso_B[3][3]                            -11.05 
_refine.aniso_B[1][2]                            5.84 
_refine.aniso_B[1][3]                            0. 
_refine.aniso_B[2][3]                            0. 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.32 
_refine.solvent_model_param_bsol                 35.5 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1U65 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.42 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.52 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4249 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         145 
_refine_hist.number_atoms_solvent             241 
_refine_hist.number_atoms_total               4635 
_refine_hist.d_res_high                       2.61 
_refine_hist.d_res_low                        27.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.7  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.88  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.24  1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.1   2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.86  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.91  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.6 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             3357 
_refine_ls_shell.R_factor_R_work                  0.28 
_refine_ls_shell.percent_reflns_obs               93.9 
_refine_ls_shell.R_factor_R_free                  0.327 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            10. 
_refine_ls_shell.number_reflns_R_free             373 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
3 ION.PARAM          ION.TOP          'X-RAY DIFFRACTION' 
4 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1U65 
_struct.title                     'Ache W. CPT-11' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1U65 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'torpedo ache, anticancer prodrug CPT-11, Israel Structural Proteomics Center, ISPC, Structural Genomics, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 VAL A 238 ? ASN A 251 ? VAL A 238 ASN A 251 1 ? 14 
HELX_P HELX_P11 11 SER A 258 ? ARG A 267 ? SER A 258 ARG A 267 1 ? 10 
HELX_P HELX_P12 12 LYS A 270 ? VAL A 277 ? LYS A 270 VAL A 277 1 ? 8  
HELX_P HELX_P13 13 GLU A 278 ? LEU A 282 ? GLU A 278 LEU A 282 5 ? 5  
HELX_P HELX_P14 14 SER A 304 ? SER A 311 ? SER A 304 SER A 311 1 ? 8  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? THR A 412 ? VAL A 400 THR A 412 1 ? 13 
HELX_P HELX_P20 20 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P21 21 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P22 22 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P23 23 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P24 24 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 1.769 ? ?               
disulf2 disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 1.896 ? ?               
disulf3 disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.110 ? ?               
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  C NAG 1   1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale2 covale one  ? A ASN 416 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 416 A NAG 998 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale3 covale one  ? A ASN 457 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 457 B NAG 1   1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale4 covale both ? B NAG .   O3  ? ? ? 1_555 B FUL .   C1 ? ? B NAG 1   B FUL 2   1_555 ? ? ? ? ? ? ? 1.416 ? ?               
covale5 covale both ? C NAG .   O3  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 2   1_555 ? ? ? ? ? ? ? 1.411 ? ?               
covale6 covale both ? D NAG .   O4  ? ? ? 1_555 D MAN .   C1 ? ? D NAG 1   D MAN 2   1_555 ? ? ? ? ? ? ? 1.382 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
B 1  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? TRP A 100 ? TYR A 96  TRP A 100 
B 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
B 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
B 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
B 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
B 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
C 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
C 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
A 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
B 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
B 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
B 3  4  N ASN A 98  ? N ASN A 98  O SER A 145 ? O SER A 145 
B 4  5  O VAL A 144 ? O VAL A 144 N TRP A 114 ? N TRP A 114 
B 5  6  N VAL A 113 ? N VAL A 113 O PHE A 197 ? O PHE A 197 
B 6  7  N GLY A 198 ? N GLY A 198 O GLN A 225 ? O GLN A 225 
B 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
B 8  9  N ILE A 319 ? N ILE A 319 O GLY A 417 ? O GLY A 417 
B 9  10 N LEU A 420 ? N LEU A 420 O ILE A 503 ? O ILE A 503 
B 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
C 1  2  N VAL A 236 ? N VAL A 236 O ILE A 296 ? O ILE A 296 
# 
_database_PDB_matrix.entry_id          1U65 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1U65 
_atom_sites.fract_transf_matrix[1][1]   0.007253 
_atom_sites.fract_transf_matrix[1][2]   0.004188 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008375 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014106 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -36.166 69.085  52.239 1.00 69.23  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -35.401 70.313  52.602 1.00 68.88  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -34.804 70.980  51.366 1.00 68.06  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -33.584 70.982  51.169 1.00 67.86  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -34.285 69.968  53.593 1.00 69.92  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -34.823 69.470  54.808 1.00 71.08  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -35.672 71.546  50.535 1.00 66.21  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -35.227 72.218  49.327 1.00 64.44  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -34.340 73.395  49.694 1.00 64.23  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -33.648 73.944  48.841 1.00 65.38  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -36.424 72.704  48.516 1.00 62.65  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -37.374 73.583  49.286 1.00 60.95  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -38.483 74.121  48.415 1.00 60.27  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -39.413 74.751  48.955 1.00 59.98  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -38.424 73.919  47.186 1.00 60.95  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -34.364 73.776  50.967 1.00 63.29  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -33.551 74.883  51.452 1.00 63.03  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -32.130 74.433  51.752 1.00 62.91  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -31.226 75.253  51.911 1.00 62.73  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -34.166 75.490  52.711 1.00 63.70  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -35.374 76.409  52.541 1.00 64.23  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -35.815 76.917  53.901 1.00 64.53  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -35.006 77.576  51.639 1.00 64.68  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -31.932 73.126  51.847 1.00 63.68  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -30.600 72.608  52.114 1.00 63.75  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -30.017 72.093  50.804 1.00 63.47  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -30.424 71.041  50.305 1.00 64.47  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -30.658 71.486  53.152 1.00 63.29  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -29.289 71.017  53.654 1.00 64.19  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -28.467 72.216  54.104 1.00 64.64  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -29.466 70.038  54.802 1.00 64.78  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -29.077 72.851  50.241 1.00 62.05  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -28.442 72.483  48.978 1.00 60.27  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -26.956 72.193  49.151 1.00 59.26  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -26.251 72.886  49.887 1.00 58.57  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -28.620 73.597  47.921 1.00 60.27  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -27.966 73.189  46.615 1.00 59.33  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -30.104 73.873  47.707 1.00 60.70  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -26.492 71.154  48.466 1.00 58.71  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -25.097 70.742  48.531 1.00 58.91  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -24.394 71.105  47.221 1.00 58.00  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -24.780 70.635  46.154 1.00 58.66  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -25.020 69.228  48.774 1.00 60.41  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -23.603 68.745  49.054 1.00 62.68  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -23.001 69.096  50.074 1.00 62.52  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -23.061 67.939  48.142 1.00 63.25  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -23.365 71.942  47.305 1.00 56.56  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -22.627 72.364  46.120 1.00 54.79  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -21.212 71.805  46.157 1.00 54.87  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -20.774 71.286  47.178 1.00 53.54  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -22.538 73.897  46.035 1.00 53.74  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -21.430 74.359  46.822 1.00 50.71  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -23.826 74.525  46.554 1.00 51.35  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -20.497 71.927  45.043 1.00 55.65  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -19.133 71.420  44.948 1.00 56.61  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -18.134 72.181  45.821 1.00 57.20  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -16.925 71.962  45.715 1.00 57.35  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -18.657 71.464  43.495 1.00 56.92  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -19.533 70.706  42.507 1.00 57.67  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -19.028 70.921  41.087 1.00 58.16  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -19.930 70.279  40.051 1.00 58.95  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -19.452 70.597  38.671 1.00 60.25  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -18.634 73.067  46.679 1.00 57.71  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -17.769 73.856  47.557 1.00 57.40  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -18.150 73.650  49.018 1.00 56.87  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.365 73.938  49.925 1.00 55.79  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -17.886 75.341  47.211 1.00 58.35  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -17.622 75.574  45.838 1.00 60.15  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -19.367 73.155  49.225 1.00 56.13  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -19.881 72.909  50.559 1.00 55.84  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -21.397 72.967  50.528 1.00 56.30  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -21.989 73.164  49.468 1.00 55.95  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -22.033 72.792  51.681 1.00 56.99  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -23.492 72.844  51.752 1.00 57.14  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -23.908 74.276  52.073 1.00 55.24  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -23.125 75.048  52.630 1.00 54.66  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -24.011 71.928  52.864 1.00 59.63  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -23.202 70.660  53.073 1.00 63.60  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -23.669 69.934  54.327 1.00 66.17  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -22.743 68.785  54.701 1.00 67.86  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -23.139 68.173  56.003 1.00 68.88  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -25.138 74.633  51.727 1.00 53.10  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -25.631 75.971  52.020 1.00 52.30  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -27.066 75.909  52.510 1.00 51.40  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -27.894 75.174  51.975 1.00 50.74  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -25.541 76.916  50.784 1.00 52.03  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -24.115 76.933  50.254 1.00 53.19  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -26.512 76.486  49.703 1.00 51.20  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -27.351 76.677  53.550 1.00 52.20  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -28.685 76.705  54.118 1.00 53.27  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -29.407 77.940  53.601 1.00 52.06  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -28.968 79.069  53.830 1.00 51.22  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -28.595 76.735  55.647 1.00 56.49  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -29.929 76.586  56.372 1.00 59.99  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -30.822 75.074  55.952 1.00 63.61  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -32.327 75.760  55.272 1.00 62.40  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -30.510 77.716  52.898 1.00 50.94  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -31.279 78.817  52.353 1.00 49.86  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -32.260 79.408  53.341 1.00 48.76  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -32.060 79.335  54.550 1.00 49.30  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -33.320 80.005  52.814 1.00 47.95  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -34.352 80.616  53.632 1.00 48.86  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -35.557 80.919  52.761 1.00 49.52  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -35.416 81.387  51.636 1.00 51.23  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -33.856 81.926  54.284 1.00 49.81  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -34.969 82.630  54.849 1.00 49.70  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -33.165 82.813  53.259 1.00 51.01  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -36.744 80.640  53.279 1.00 50.43  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -37.977 80.881  52.542 1.00 51.86  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -38.333 82.357  52.668 1.00 51.55  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -38.151 82.957  53.729 1.00 51.54  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -39.097 80.009  53.116 1.00 53.32  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -40.375 79.937  52.292 1.00 56.91  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -41.341 78.928  52.925 1.00 60.36  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -42.639 78.867  52.257 1.00 63.28  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -42.814 78.477  50.998 1.00 64.49  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -41.766 78.109  50.269 1.00 65.08  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -44.033 78.463  50.468 1.00 62.94  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -38.821 82.948  51.582 1.00 50.90  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -39.192 84.357  51.599 1.00 50.02  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -40.499 84.610  50.872 1.00 50.28  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -40.771 84.012  49.832 1.00 49.54  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -38.094 85.250  50.968 1.00 49.66  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -36.802 85.098  51.746 1.00 49.92  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -37.885 84.888  49.513 1.00 47.57  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -41.331 85.503  51.424 1.00 51.70  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -42.627 85.854  50.844 1.00 52.95  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -42.469 86.689  49.584 1.00 54.61  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -41.553 87.507  49.476 1.00 54.93  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -43.297 86.635  51.963 1.00 52.53  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -42.135 87.357  52.573 1.00 52.04  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -41.097 86.264  52.665 1.00 51.81  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -43.371 86.470  48.636 1.00 55.72  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? -43.366 87.192  47.373 1.00 55.72  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? -44.782 87.203  46.803 1.00 56.65  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? -45.328 86.157  46.437 1.00 55.02  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? -42.396 86.535  46.362 1.00 54.96  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? -42.701 85.053  46.237 1.00 53.94  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? -42.503 87.225  45.007 1.00 54.67  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? -45.379 88.391  46.747 1.00 57.44  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? -46.733 88.538  46.227 1.00 58.11  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? -47.631 87.464  46.819 1.00 58.69  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? -48.171 86.632  46.091 1.00 59.39  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? -46.738 88.396  44.707 1.00 57.79  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? -45.804 89.293  43.901 1.00 58.61  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? -45.823 88.846  42.446 1.00 58.55  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? -46.236 90.745  44.033 1.00 59.29  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? -47.772 87.471  48.140 1.00 58.94  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? -48.618 86.494  48.818 1.00 59.04  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? -48.313 85.051  48.406 1.00 57.17  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? -49.185 84.323  47.934 1.00 56.62  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? -50.096 86.816  48.558 1.00 60.65  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? -50.392 86.830  47.169 1.00 63.46  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? -47.060 84.658  48.592 1.00 55.73  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? -46.586 83.316  48.282 1.00 53.42  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -45.122 83.277  48.689 1.00 54.09  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -44.616 84.240  49.264 1.00 54.61  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? -46.728 83.018  46.795 1.00 51.91  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? -46.285 81.703  46.513 1.00 50.44  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -44.429 82.182  48.407 1.00 54.86  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -43.024 82.105  48.790 1.00 55.90  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -42.146 81.465  47.733 1.00 55.26  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -42.635 80.849  46.793 1.00 55.23  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -42.861 81.304  50.084 1.00 57.84  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -43.734 81.768  51.207 1.00 60.84  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -45.111 81.732  51.144 1.00 62.09  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -43.426 82.262  52.430 1.00 62.03  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -45.613 82.183  52.280 1.00 62.48  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -44.612 82.511  53.078 1.00 62.82  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -40.841 81.637  47.899 1.00 54.84  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -39.846 81.041  47.018 1.00 56.05  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -38.599 80.927  47.878 1.00 55.41  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -38.541 81.503  48.968 1.00 55.12  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -39.517 81.900  45.737 1.00 58.02  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -38.766 83.181  46.111 1.00 58.83  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? -40.796 82.222  44.970 1.00 58.33  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -39.620 84.227  46.787 1.00 61.77  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -37.614 80.176  47.404 1.00 54.89  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -36.378 79.997  48.150 1.00 54.93  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -35.427 81.142  47.841 1.00 54.12  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -35.616 81.877  46.869 1.00 54.03  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -35.723 78.668  47.777 1.00 56.25  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -36.639 77.598  47.923 1.00 58.04  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -34.403 81.290  48.666 1.00 51.60  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -33.446 82.356  48.462 1.00 50.64  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -32.157 82.055  49.195 1.00 49.71  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -32.154 81.888  50.410 1.00 50.82  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -34.028 83.668  48.954 1.00 49.88  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -31.059 81.987  48.459 1.00 48.13  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -29.772 81.718  49.078 1.00 48.04  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -28.896 82.954  48.922 1.00 45.99  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -28.291 83.177  47.875 1.00 47.47  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -29.124 80.494  48.430 1.00 48.90  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -30.024 79.293  48.390 1.00 49.88  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -31.195 79.310  47.632 1.00 51.29  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -29.706 78.144  49.105 1.00 50.15  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -32.040 78.195  47.585 1.00 51.85  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -30.544 77.023  49.065 1.00 50.84  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -31.712 77.050  48.303 1.00 51.01  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -28.836 83.753  49.981 1.00 43.05  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -28.070 84.991  49.978 1.00 39.92  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -26.707 84.842  50.641 1.00 38.78  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -26.606 84.294  51.734 1.00 38.77  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -28.858 86.072  50.720 1.00 37.92  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -30.379 86.051  50.560 1.00 37.50  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -31.003 87.029  51.542 1.00 36.01  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -30.756 86.391  49.128 1.00 35.81  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -25.662 85.334  49.982 1.00 38.25  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -24.332 85.282  50.569 1.00 38.62  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -23.396 84.141  50.212 1.00 39.27  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -22.392 83.937  50.893 1.00 38.97  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -23.707 83.398  49.155 1.00 38.88  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -22.853 82.299  48.738 1.00 38.07  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -21.500 82.861  48.315 1.00 38.50  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -21.427 83.693  47.415 1.00 40.11  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -23.439 81.555  47.527 1.00 39.23  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -24.796 80.945  47.875 1.00 38.44  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -22.466 80.472  47.073 1.00 41.01  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -24.705 79.784  48.797 1.00 40.20  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -20.412 82.420  48.961 1.00 37.77  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -19.074 82.902  48.614 1.00 36.93  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -18.520 82.098  47.441 1.00 36.55  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -18.632 80.873  47.430 1.00 38.47  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -18.290 82.650  49.890 1.00 36.31  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -18.864 81.358  50.340 1.00 37.46  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -20.359 81.579  50.168 1.00 38.67  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -17.927 82.779  46.459 1.00 34.23  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -17.368 82.100  45.293 1.00 30.66  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -15.893 82.414  45.065 1.00 30.61  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -15.360 82.154  43.992 1.00 31.46  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -18.176 82.450  44.040 1.00 29.42  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -18.201 83.920  43.717 1.00 31.06  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -17.079 84.555  43.187 1.00 31.47  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -19.348 84.674  43.945 1.00 31.35  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -17.099 85.914  42.887 1.00 31.40  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -19.378 86.031  43.651 1.00 31.75  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -18.248 86.655  43.118 1.00 31.11  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -15.229 82.961  46.075 1.00 30.11  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -13.817 83.292  45.950 1.00 30.77  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -13.220 83.572  47.310 1.00 32.75  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -13.934 83.877  48.260 1.00 33.62  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.643 84.505  45.071 1.00 28.99  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -11.905 83.454  47.409 1.00 34.70  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -11.240 83.744  48.661 1.00 37.14  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -11.303 85.253  48.814 1.00 37.96  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -11.227 85.980  47.829 1.00 39.86  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -9.783  83.277  48.611 1.00 38.77  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -9.616  81.771  48.796 1.00 42.26  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -10.224 81.282  50.105 1.00 42.55  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -9.721  81.674  51.177 1.00 42.20  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -11.213 80.517  50.060 1.00 43.17  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -11.480 85.746  50.045 1.00 38.43  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -11.549 87.191  50.288 1.00 38.65  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -10.330 87.950  49.742 1.00 38.95  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -9.201  87.730  50.182 1.00 38.48  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -11.650 87.270  51.806 1.00 39.06  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -12.488 86.061  52.120 1.00 38.59  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -11.830 84.995  51.263 1.00 39.21  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -10.552 88.864  48.780 1.00 38.59  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -9.487  89.665  48.163 1.00 38.11  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -8.804  90.614  49.145 1.00 37.69  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -8.504  91.753  48.796 1.00 37.53  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -10.231 90.427  47.078 1.00 38.76  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -11.565 90.661  47.721 1.00 38.02  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -11.874 89.299  48.294 1.00 37.22  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -8.535  90.130  50.354 1.00 36.84  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -7.928  90.948  51.399 1.00 36.82  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -6.409  90.879  51.532 1.00 37.92  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -5.743  90.073  50.888 1.00 39.06  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -8.543  90.593  52.756 1.00 36.21  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -10.036 90.895  52.747 1.00 33.47  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -8.310  89.115  53.049 1.00 36.05  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -5.871  91.742  52.387 1.00 39.64  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -4.439  91.773  52.613 1.00 41.28  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -3.652  91.845  51.323 1.00 43.29  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -3.774  92.810  50.566 1.00 43.94  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -2.842  90.822  51.069 1.00 45.37  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -2.031  90.779  49.858 1.00 46.96  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -2.843  90.393  48.641 1.00 46.59  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -2.346  90.453  47.519 1.00 46.90  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -0.872  89.802  50.023 1.00 50.00  ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? 0.333   90.439  50.677 1.00 53.52  ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? 0.212   91.446  51.383 1.00 53.03  ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? 1.507   89.851  50.454 1.00 55.70  ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -4.091  89.995  48.866 1.00 45.32  ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -4.974  89.616  47.769 1.00 45.10  ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -5.554  90.865  47.100 1.00 43.48  ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -6.023  90.808  45.966 1.00 43.25  ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -6.117  88.746  48.289 1.00 48.08  ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -5.665  87.511  49.044 1.00 52.04  ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -4.923  86.306  47.951 1.00 57.07  ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -6.309  85.168  47.733 1.00 54.98  ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -5.528  91.992  47.806 1.00 42.01  ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -6.052  93.236  47.252 1.00 40.15  ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -5.366  93.505  45.912 1.00 40.56  ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -4.139  93.573  45.835 1.00 40.05  ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -5.812  94.406  48.224 1.00 36.93  ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -6.232  95.775  47.684 1.00 31.93  ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -5.837  96.922  48.615 1.00 27.47  ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -6.687  97.019  49.803 1.00 27.03  ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -6.511  97.898  50.790 1.00 26.45  ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -5.511  98.772  50.749 1.00 25.50  ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -7.338  97.912  51.823 1.00 25.42  ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -6.172  93.630  44.861 1.00 40.15  ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -5.692  93.892  43.509 1.00 40.66  ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -5.374  92.639  42.688 1.00 41.28  ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -5.359  92.699  41.458 1.00 41.48  ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -4.461  94.804  43.530 1.00 39.11  ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -4.691  96.126  44.204 1.00 38.89  ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -5.840  96.865  43.944 1.00 39.93  ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -3.739  96.653  45.072 1.00 39.11  ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -6.040  98.113  44.539 1.00 39.84  ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -3.924  97.901  45.673 1.00 39.61  ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -5.079  98.633  45.405 1.00 39.90  ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -5.118  91.513  43.352 1.00 41.72  ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -4.808  90.271  42.634 1.00 42.01  ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -6.038  89.630  42.029 1.00 39.72  ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -7.160  89.936  42.412 1.00 38.26  ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -4.165  89.230  43.551 1.00 44.50  ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -2.715  89.456  43.870 1.00 49.23  ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -1.987  88.125  43.890 1.00 54.17  ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -0.899  88.122  44.860 1.00 59.80  ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -1.081  88.065  46.176 1.00 62.19  ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -0.035  88.073  46.993 1.00 63.70  ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -2.312  87.982  46.674 1.00 63.81  ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -5.817  88.723  41.086 1.00 39.64  ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -6.924  88.028  40.454 1.00 39.86  ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -7.616  87.230  41.545 1.00 39.27  ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -6.987  86.806  42.514 1.00 39.56  ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -6.422  87.082  39.361 1.00 39.96  ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -5.572  87.756  38.301 1.00 43.75  ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -5.372  86.856  37.081 1.00 45.29  ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -4.631  87.531  36.012 1.00 46.20  ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -3.324  87.793  36.042 1.00 46.26  ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -2.589  87.434  37.091 1.00 46.21  ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -2.750  88.418  35.019 1.00 45.61  ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -8.927  87.028  41.416 1.00 37.84  ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -9.620  86.264  42.448 1.00 39.16  ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -9.214  84.790  42.435 1.00 40.59  ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -8.874  84.237  41.392 1.00 40.36  ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.088 86.466  42.089 1.00 37.95  ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -11.048 86.555  40.600 1.00 37.20  ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -9.852  87.441  40.348 1.00 36.71  ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -9.239  84.173  43.610 1.00 42.25  ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -8.913  82.763  43.761 1.00 43.10  ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -10.212 82.090  44.174 1.00 44.20  ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -10.950 82.624  45.006 1.00 44.97  ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -7.865  82.577  44.854 1.00 43.69  ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -6.471  82.989  44.458 1.00 45.51  ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -5.903  82.095  43.374 1.00 49.00  ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -6.036  80.857  43.501 1.00 50.27  ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -5.320  82.622  42.402 1.00 50.00  ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -10.515 80.916  43.597 1.00 44.87  ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -11.753 80.196  43.934 1.00 45.63  ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -11.904 79.944  45.426 1.00 46.50  ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -10.914 79.810  46.148 1.00 46.06  ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -11.639 78.901  43.126 1.00 44.40  ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -10.169 78.712  42.987 1.00 44.52  ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -9.666  80.108  42.709 1.00 44.44  ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -13.148 79.885  45.883 1.00 48.44  ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -13.421 79.669  47.300 1.00 50.85  ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -13.077 78.249  47.751 1.00 52.40  ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -13.585 77.270  47.194 1.00 52.69  ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -14.895 79.985  47.604 1.00 50.26  ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -15.306 79.788  49.062 1.00 49.44  ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -14.332 80.452  50.033 1.00 48.82  ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -14.742 80.213  51.488 1.00 48.69  ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -13.751 80.774  52.462 1.00 47.62  ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -12.204 78.155  48.755 1.00 53.17  ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -11.783 76.873  49.311 1.00 53.36  ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -13.011 76.194  49.889 1.00 54.22  ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -13.743 76.791  50.678 1.00 54.47  ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -10.751 77.083  50.424 1.00 52.41  ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -9.450  77.726  49.969 1.00 52.63  ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -8.594  78.113  51.168 1.00 53.96  ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -7.281  78.779  50.759 1.00 54.17  ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -6.406  77.885  49.947 1.00 53.44  ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -13.262 74.938  49.494 1.00 55.25  ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -14.423 74.200  49.998 1.00 55.18  ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -14.494 74.300  51.513 1.00 55.05  ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -13.471 74.220  52.194 1.00 54.10  ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -14.152 72.782  49.519 1.00 55.04  ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -13.460 73.015  48.216 1.00 55.39  ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -12.476 74.106  48.566 1.00 55.31  ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -15.699 74.484  52.041 1.00 55.68  ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -15.875 74.603  53.482 1.00 56.78  ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -16.585 73.394  54.061 1.00 58.54  ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -17.161 72.579  53.337 1.00 58.16  ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -16.680 75.856  53.816 1.00 54.98  ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -18.070 75.800  53.292 1.00 53.56  ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -19.145 75.181  53.864 1.00 53.68  ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.531 76.350  52.058 1.00 53.94  ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -20.251 75.311  53.059 1.00 53.52  ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -19.901 76.024  51.942 1.00 54.14  ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -17.917 77.088  51.035 1.00 52.18  ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -20.671 76.412  50.842 1.00 54.20  ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -18.681 77.474  49.943 1.00 53.59  ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -20.046 77.135  49.855 1.00 54.75  ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -16.547 73.303  55.383 1.00 59.71  ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -17.174 72.213  56.098 1.00 61.56  ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -18.424 72.697  56.817 1.00 62.10  ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -18.501 73.858  57.222 1.00 62.14  ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -16.178 71.624  57.101 1.00 62.63  ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -15.319 72.629  57.625 1.00 64.17  ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -19.397 71.803  56.974 1.00 62.37  ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -20.633 72.164  57.643 1.00 62.37  ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.649 72.793  56.705 1.00 61.78  ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -21.595 72.597  55.490 1.00 62.43  ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -22.583 73.551  57.267 1.00 61.31  ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -23.607 74.210  56.461 1.00 61.87  ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -23.445 75.730  56.444 1.00 61.41  ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -23.509 76.381  57.491 1.00 61.30  ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -25.029 73.886  56.976 1.00 61.42  ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -26.059 74.658  56.174 1.00 60.79  ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -25.295 72.398  56.872 1.00 61.04  ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -23.233 76.289  55.254 1.00 60.53  ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -23.080 77.732  55.112 1.00 58.59  ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -24.461 78.367  55.160 1.00 59.57  ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -25.338 78.037  54.354 1.00 58.07  ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -22.397 78.085  53.786 1.00 55.55  ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -22.041 79.542  53.676 1.00 51.74  ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -22.906 80.593  53.514 1.00 49.90  ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -20.735 80.117  53.816 1.00 49.85  ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -22.220 81.781  53.555 1.00 48.26  ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -20.886 81.521  53.740 1.00 48.96  ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -19.450 79.583  54.003 1.00 47.66  ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -19.798 82.401  53.848 1.00 46.75  ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -18.370 80.457  54.108 1.00 46.61  ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.555 81.852  54.031 1.00 46.64  ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -24.656 79.274  56.109 1.00 60.93  ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -25.938 79.939  56.242 1.00 63.05  ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -26.056 81.046  55.205 1.00 61.25  ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -25.303 82.017  55.229 1.00 61.11  ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -26.087 80.517  57.646 1.00 68.62  ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -27.507 80.958  57.942 1.00 75.96  ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -28.454 80.201  57.728 1.00 77.42  ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -27.659 82.181  58.441 1.00 82.46  ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -27.002 80.887  54.288 1.00 58.51  ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -27.216 81.867  53.240 1.00 56.90  ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -28.622 82.417  53.363 1.00 55.94  ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -29.420 82.324  52.429 1.00 56.61  ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -27.024 81.218  51.877 1.00 56.92  ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -28.921 82.997  54.517 1.00 53.98  ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -30.247 83.542  54.771 1.00 52.98  ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -30.295 85.059  54.691 1.00 52.39  ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -31.338 85.640  54.392 1.00 52.57  ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -30.708 83.091  56.143 1.00 52.86  ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -29.641 83.235  57.056 1.00 52.99  ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -29.166 85.700  54.969 1.00 51.03  ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -29.089 87.154  54.915 1.00 49.57  ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -28.224 87.604  53.740 1.00 48.58  ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -27.522 86.798  53.127 1.00 50.23  ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -28.496 87.726  56.215 1.00 48.35  ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -27.276 87.042  56.520 1.00 48.65  ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -29.469 87.550  57.366 1.00 48.58  ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -28.288 88.892  53.425 1.00 45.51  ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -27.504 89.453  52.335 1.00 41.88  ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -26.058 89.644  52.774 1.00 40.18  ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -25.782 89.899  53.949 1.00 40.74  ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -28.069 90.805  51.926 1.00 41.20  ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -29.118 90.773  50.845 1.00 40.23  ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -28.836 90.237  49.592 1.00 39.66  ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -30.346 91.397  51.030 1.00 40.13  ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -29.743 90.339  48.548 1.00 39.53  ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -31.258 91.505  49.995 1.00 40.29  ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -30.948 90.980  48.754 1.00 40.34  ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -31.833 91.134  47.711 1.00 42.44  ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -25.114 89.533  51.830 1.00 38.29  ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -23.690 89.699  52.129 1.00 36.74  ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -23.289 91.163  52.253 1.00 36.53  ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -24.123 92.062  52.154 1.00 36.29  ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -23.015 89.034  50.938 1.00 36.66  ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -23.928 89.390  49.819 1.00 36.75  ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -25.308 89.141  50.421 1.00 38.27  ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -21.998 91.386  52.474 1.00 37.40  ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -21.437 92.726  52.587 1.00 36.44  ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -21.342 93.353  51.201 1.00 35.39  ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -21.447 92.670  50.182 1.00 36.73  ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -20.030 92.663  53.178 1.00 37.64  ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -20.032 92.451  54.665 1.00 38.66  ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -18.998 92.139  55.258 1.00 40.01  ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -21.191 92.632  55.285 1.00 37.04  ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -21.135 94.659  51.169 1.00 32.18  ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -20.994 95.361  49.910 1.00 30.02  ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -19.508 95.682  49.738 1.00 28.50  ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -18.776 95.790  50.725 1.00 27.06  ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -21.850 96.626  49.942 1.00 30.18  ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -23.334 96.316  49.873 1.00 31.19  ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -24.164 97.094  50.338 1.00 34.34  ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -23.675 95.178  49.276 1.00 30.49  ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -19.046 95.813  48.500 1.00 26.28  ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -17.638 96.095  48.295 1.00 25.13  ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -17.323 97.545  48.632 1.00 26.77  ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -18.194 98.417  48.585 1.00 24.37  ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -17.225 95.773  46.854 1.00 24.77  ? 67   CYS A CB  1 
ATOM   496  S SG  . CYS A 1 67  ? -17.440 94.020  46.349 0.80 22.08  ? 67   CYS A SG  1 
ATOM   497  N N   . GLN A 1 68  ? -16.072 97.792  49.001 1.00 27.77  ? 68   GLN A N   1 
ATOM   498  C CA  . GLN A 1 68  ? -15.634 99.131  49.342 1.00 28.97  ? 68   GLN A CA  1 
ATOM   499  C C   . GLN A 1 68  ? -15.865 100.061 48.166 1.00 29.36  ? 68   GLN A C   1 
ATOM   500  O O   . GLN A 1 68  ? -15.379 99.807  47.059 1.00 29.60  ? 68   GLN A O   1 
ATOM   501  C CB  . GLN A 1 68  ? -14.156 99.108  49.715 1.00 30.90  ? 68   GLN A CB  1 
ATOM   502  C CG  . GLN A 1 68  ? -13.911 98.412  51.033 1.00 33.43  ? 68   GLN A CG  1 
ATOM   503  C CD  . GLN A 1 68  ? -14.557 99.146  52.187 1.00 33.84  ? 68   GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 68  ? -14.588 98.651  53.310 1.00 36.84  ? 68   GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 68  ? -15.074 100.338 51.916 1.00 32.53  ? 68   GLN A NE2 1 
ATOM   506  N N   . GLN A 1 69  ? -16.597 101.145 48.406 1.00 28.73  ? 69   GLN A N   1 
ATOM   507  C CA  . GLN A 1 69  ? -16.893 102.086 47.338 1.00 28.95  ? 69   GLN A CA  1 
ATOM   508  C C   . GLN A 1 69  ? -17.128 103.525 47.780 1.00 29.92  ? 69   GLN A C   1 
ATOM   509  O O   . GLN A 1 69  ? -17.269 103.833 48.966 1.00 29.32  ? 69   GLN A O   1 
ATOM   510  C CB  . GLN A 1 69  ? -18.126 101.602 46.560 1.00 25.58  ? 69   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 69  ? -19.326 101.307 47.447 1.00 22.53  ? 69   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 69  ? -20.504 100.705 46.689 1.00 23.45  ? 69   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 69  ? -21.304 101.419 46.087 1.00 24.47  ? 69   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 69  ? -20.608 99.383  46.713 1.00 19.49  ? 69   GLN A NE2 1 
ATOM   515  N N   . TYR A 1 70  ? -17.156 104.404 46.788 1.00 30.54  ? 70   TYR A N   1 
ATOM   516  C CA  . TYR A 1 70  ? -17.437 105.805 47.009 1.00 30.77  ? 70   TYR A CA  1 
ATOM   517  C C   . TYR A 1 70  ? -18.946 105.857 47.255 1.00 28.97  ? 70   TYR A C   1 
ATOM   518  O O   . TYR A 1 70  ? -19.714 105.259 46.511 1.00 29.11  ? 70   TYR A O   1 
ATOM   519  C CB  . TYR A 1 70  ? -17.102 106.620 45.761 1.00 32.46  ? 70   TYR A CB  1 
ATOM   520  C CG  . TYR A 1 70  ? -17.751 107.973 45.798 1.00 35.69  ? 70   TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 70  ? -17.235 108.988 46.603 1.00 36.80  ? 70   TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 70  ? -18.956 108.202 45.132 1.00 35.96  ? 70   TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 70  ? -17.907 110.191 46.756 1.00 38.49  ? 70   TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 70  ? -19.637 109.398 45.280 1.00 37.09  ? 70   TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 70  ? -19.110 110.386 46.098 1.00 39.22  ? 70   TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 70  ? -19.813 111.550 46.296 1.00 42.28  ? 70   TYR A OH  1 
ATOM   527  N N   . VAL A 1 71  ? -19.376 106.565 48.287 1.00 28.33  ? 71   VAL A N   1 
ATOM   528  C CA  . VAL A 1 71  ? -20.799 106.644 48.577 1.00 28.90  ? 71   VAL A CA  1 
ATOM   529  C C   . VAL A 1 71  ? -21.351 107.988 48.157 1.00 28.85  ? 71   VAL A C   1 
ATOM   530  O O   . VAL A 1 71  ? -20.810 109.029 48.511 1.00 28.65  ? 71   VAL A O   1 
ATOM   531  C CB  . VAL A 1 71  ? -21.083 106.426 50.092 1.00 31.03  ? 71   VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 71  ? -22.567 106.614 50.383 1.00 29.82  ? 71   VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 71  ? -20.637 105.020 50.514 1.00 29.65  ? 71   VAL A CG2 1 
ATOM   534  N N   . ASP A 1 72  ? -22.428 107.972 47.388 1.00 30.70  ? 72   ASP A N   1 
ATOM   535  C CA  . ASP A 1 72  ? -23.022 109.222 46.953 1.00 33.46  ? 72   ASP A CA  1 
ATOM   536  C C   . ASP A 1 72  ? -23.814 109.862 48.090 1.00 34.66  ? 72   ASP A C   1 
ATOM   537  O O   . ASP A 1 72  ? -24.771 109.278 48.603 1.00 32.96  ? 72   ASP A O   1 
ATOM   538  C CB  . ASP A 1 72  ? -23.936 109.005 45.745 1.00 32.35  ? 72   ASP A CB  1 
ATOM   539  C CG  . ASP A 1 72  ? -24.795 110.218 45.452 1.00 32.42  ? 72   ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 72  ? -24.374 111.338 45.813 1.00 32.24  ? 72   ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 72  ? -25.881 110.062 44.860 1.00 32.44  ? 72   ASP A OD2 1 
ATOM   542  N N   . GLU A 1 73  ? -23.401 111.064 48.480 1.00 35.53  ? 73   GLU A N   1 
ATOM   543  C CA  . GLU A 1 73  ? -24.066 111.790 49.548 1.00 38.05  ? 73   GLU A CA  1 
ATOM   544  C C   . GLU A 1 73  ? -24.288 113.244 49.151 1.00 37.11  ? 73   GLU A C   1 
ATOM   545  O O   . GLU A 1 73  ? -24.114 114.155 49.953 1.00 35.10  ? 73   GLU A O   1 
ATOM   546  C CB  . GLU A 1 73  ? -23.236 111.701 50.829 1.00 41.34  ? 73   GLU A CB  1 
ATOM   547  C CG  . GLU A 1 73  ? -23.117 110.278 51.337 1.00 46.46  ? 73   GLU A CG  1 
ATOM   548  C CD  . GLU A 1 73  ? -22.206 110.137 52.540 1.00 49.60  ? 73   GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 73  ? -21.039 110.596 52.478 1.00 50.09  ? 73   GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 73  ? -22.658 109.548 53.545 1.00 50.71  ? 73   GLU A OE2 1 
ATOM   551  N N   . GLN A 1 74  ? -24.669 113.437 47.893 1.00 37.72  ? 74   GLN A N   1 
ATOM   552  C CA  . GLN A 1 74  ? -24.944 114.757 47.342 1.00 38.12  ? 74   GLN A CA  1 
ATOM   553  C C   . GLN A 1 74  ? -26.356 115.182 47.692 1.00 36.27  ? 74   GLN A C   1 
ATOM   554  O O   . GLN A 1 74  ? -26.658 116.373 47.746 1.00 34.47  ? 74   GLN A O   1 
ATOM   555  C CB  . GLN A 1 74  ? -24.823 114.724 45.826 1.00 42.57  ? 74   GLN A CB  1 
ATOM   556  C CG  . GLN A 1 74  ? -23.410 114.704 45.298 1.00 49.41  ? 74   GLN A CG  1 
ATOM   557  C CD  . GLN A 1 74  ? -22.853 116.096 45.129 1.00 53.14  ? 74   GLN A CD  1 
ATOM   558  O OE1 . GLN A 1 74  ? -23.480 116.959 44.500 1.00 54.95  ? 74   GLN A OE1 1 
ATOM   559  N NE2 . GLN A 1 74  ? -21.666 116.327 45.683 1.00 56.07  ? 74   GLN A NE2 1 
ATOM   560  N N   . PHE A 1 75  ? -27.224 114.197 47.905 1.00 33.96  ? 75   PHE A N   1 
ATOM   561  C CA  . PHE A 1 75  ? -28.617 114.461 48.233 1.00 32.97  ? 75   PHE A CA  1 
ATOM   562  C C   . PHE A 1 75  ? -29.018 113.575 49.392 1.00 33.09  ? 75   PHE A C   1 
ATOM   563  O O   . PHE A 1 75  ? -29.899 112.723 49.264 1.00 34.34  ? 75   PHE A O   1 
ATOM   564  C CB  . PHE A 1 75  ? -29.517 114.165 47.029 1.00 30.98  ? 75   PHE A CB  1 
ATOM   565  C CG  . PHE A 1 75  ? -29.142 114.926 45.793 1.00 31.07  ? 75   PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 75  ? -29.313 116.306 45.730 1.00 32.88  ? 75   PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 75  ? -28.592 114.268 44.697 1.00 30.98  ? 75   PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 75  ? -28.937 117.023 44.586 1.00 34.05  ? 75   PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 75  ? -28.209 114.972 43.546 1.00 32.12  ? 75   PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 75  ? -28.381 116.350 43.489 1.00 32.81  ? 75   PHE A CZ  1 
ATOM   571  N N   . PRO A 1 76  ? -28.378 113.770 50.550 1.00 33.50  ? 76   PRO A N   1 
ATOM   572  C CA  . PRO A 1 76  ? -28.677 112.969 51.744 1.00 34.11  ? 76   PRO A CA  1 
ATOM   573  C C   . PRO A 1 76  ? -30.152 112.939 52.103 1.00 34.13  ? 76   PRO A C   1 
ATOM   574  O O   . PRO A 1 76  ? -30.828 113.962 52.029 1.00 35.04  ? 76   PRO A O   1 
ATOM   575  C CB  . PRO A 1 76  ? -27.825 113.628 52.834 1.00 32.88  ? 76   PRO A CB  1 
ATOM   576  C CG  . PRO A 1 76  ? -27.692 115.048 52.360 1.00 33.01  ? 76   PRO A CG  1 
ATOM   577  C CD  . PRO A 1 76  ? -27.462 114.875 50.874 1.00 33.58  ? 76   PRO A CD  1 
ATOM   578  N N   . GLY A 1 77  ? -30.637 111.758 52.484 1.00 33.61  ? 77   GLY A N   1 
ATOM   579  C CA  . GLY A 1 77  ? -32.026 111.607 52.871 1.00 32.86  ? 77   GLY A CA  1 
ATOM   580  C C   . GLY A 1 77  ? -32.985 111.814 51.722 1.00 34.79  ? 77   GLY A C   1 
ATOM   581  O O   . GLY A 1 77  ? -34.045 112.422 51.891 1.00 36.50  ? 77   GLY A O   1 
ATOM   582  N N   . PHE A 1 78  ? -32.600 111.329 50.545 1.00 34.19  ? 78   PHE A N   1 
ATOM   583  C CA  . PHE A 1 78  ? -33.429 111.427 49.350 1.00 32.28  ? 78   PHE A CA  1 
ATOM   584  C C   . PHE A 1 78  ? -33.356 110.075 48.641 1.00 33.14  ? 78   PHE A C   1 
ATOM   585  O O   . PHE A 1 78  ? -32.312 109.694 48.102 1.00 31.71  ? 78   PHE A O   1 
ATOM   586  C CB  . PHE A 1 78  ? -32.920 112.534 48.431 1.00 31.91  ? 78   PHE A CB  1 
ATOM   587  C CG  . PHE A 1 78  ? -33.774 112.741 47.217 1.00 32.32  ? 78   PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 78  ? -35.103 113.139 47.347 1.00 32.95  ? 78   PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 78  ? -33.276 112.489 45.948 1.00 31.21  ? 78   PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 78  ? -35.920 113.275 46.231 1.00 30.98  ? 78   PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 78  ? -34.089 112.622 44.825 1.00 31.17  ? 78   PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 78  ? -35.412 113.014 44.969 1.00 29.94  ? 78   PHE A CZ  1 
ATOM   593  N N   . SER A 1 79  ? -34.470 109.350 48.650 1.00 34.02  ? 79   SER A N   1 
ATOM   594  C CA  . SER A 1 79  ? -34.520 108.019 48.050 1.00 34.60  ? 79   SER A CA  1 
ATOM   595  C C   . SER A 1 79  ? -33.964 107.981 46.632 1.00 33.92  ? 79   SER A C   1 
ATOM   596  O O   . SER A 1 79  ? -33.312 107.013 46.236 1.00 33.94  ? 79   SER A O   1 
ATOM   597  C CB  . SER A 1 79  ? -35.954 107.490 48.053 1.00 32.96  ? 79   SER A CB  1 
ATOM   598  O OG  . SER A 1 79  ? -36.720 108.135 47.059 1.00 36.57  ? 79   SER A OG  1 
ATOM   599  N N   . GLY A 1 80  ? -34.229 109.038 45.874 1.00 32.81  ? 80   GLY A N   1 
ATOM   600  C CA  . GLY A 1 80  ? -33.751 109.110 44.506 1.00 32.01  ? 80   GLY A CA  1 
ATOM   601  C C   . GLY A 1 80  ? -32.302 108.708 44.301 1.00 31.69  ? 80   GLY A C   1 
ATOM   602  O O   . GLY A 1 80  ? -32.008 107.937 43.390 1.00 31.97  ? 80   GLY A O   1 
ATOM   603  N N   . SER A 1 81  ? -31.393 109.221 45.131 1.00 30.96  ? 81   SER A N   1 
ATOM   604  C CA  . SER A 1 81  ? -29.980 108.877 44.994 1.00 30.95  ? 81   SER A CA  1 
ATOM   605  C C   . SER A 1 81  ? -29.536 107.824 46.006 1.00 32.59  ? 81   SER A C   1 
ATOM   606  O O   . SER A 1 81  ? -28.618 107.049 45.738 1.00 33.68  ? 81   SER A O   1 
ATOM   607  C CB  . SER A 1 81  ? -29.098 110.121 45.147 1.00 30.15  ? 81   SER A CB  1 
ATOM   608  O OG  . SER A 1 81  ? -28.870 110.442 46.507 1.00 27.40  ? 81   SER A OG  1 
ATOM   609  N N   . GLU A 1 82  ? -30.186 107.786 47.164 1.00 32.99  ? 82   GLU A N   1 
ATOM   610  C CA  . GLU A 1 82  ? -29.806 106.826 48.188 1.00 34.77  ? 82   GLU A CA  1 
ATOM   611  C C   . GLU A 1 82  ? -30.117 105.373 47.818 1.00 34.08  ? 82   GLU A C   1 
ATOM   612  O O   . GLU A 1 82  ? -29.509 104.438 48.358 1.00 33.46  ? 82   GLU A O   1 
ATOM   613  C CB  . GLU A 1 82  ? -30.457 107.194 49.532 1.00 36.97  ? 82   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 82  ? -30.018 108.571 50.064 1.00 40.17  ? 82   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 82  ? -30.233 108.754 51.566 1.00 40.49  ? 82   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 82  ? -31.316 108.383 52.071 1.00 39.45  ? 82   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 82  ? -29.318 109.287 52.237 1.00 39.52  ? 82   GLU A OE2 1 
ATOM   618  N N   . MET A 1 83  ? -31.031 105.177 46.876 1.00 31.49  ? 83   MET A N   1 
ATOM   619  C CA  . MET A 1 83  ? -31.421 103.833 46.466 1.00 30.87  ? 83   MET A CA  1 
ATOM   620  C C   . MET A 1 83  ? -30.291 103.138 45.716 1.00 30.84  ? 83   MET A C   1 
ATOM   621  O O   . MET A 1 83  ? -30.443 101.989 45.290 1.00 31.04  ? 83   MET A O   1 
ATOM   622  C CB  . MET A 1 83  ? -32.684 103.882 45.604 1.00 31.28  ? 83   MET A CB  1 
ATOM   623  C CG  . MET A 1 83  ? -32.469 104.477 44.222 1.00 32.33  ? 83   MET A CG  1 
ATOM   624  S SD  . MET A 1 83  ? -34.016 104.772 43.343 1.00 31.38  ? 83   MET A SD  1 
ATOM   625  C CE  . MET A 1 83  ? -33.893 103.565 42.027 1.00 27.94  ? 83   MET A CE  1 
ATOM   626  N N   . TRP A 1 84  ? -29.164 103.802 45.542 1.00 31.38  ? 84   TRP A N   1 
ATOM   627  C CA  . TRP A 1 84  ? -28.051 103.201 44.823 1.00 30.94  ? 84   TRP A CA  1 
ATOM   628  C C   . TRP A 1 84  ? -26.866 102.974 45.741 1.00 31.05  ? 84   TRP A C   1 
ATOM   629  O O   . TRP A 1 84  ? -25.943 102.232 45.402 1.00 29.68  ? 84   TRP A O   1 
ATOM   630  C CB  . TRP A 1 84  ? -27.641 104.091 43.649 1.00 29.65  ? 84   TRP A CB  1 
ATOM   631  C CG  . TRP A 1 84  ? -28.801 104.461 42.762 1.00 32.11  ? 84   TRP A CG  1 
ATOM   632  C CD1 . TRP A 1 84  ? -29.508 105.635 42.777 1.00 31.73  ? 84   TRP A CD1 1 
ATOM   633  C CD2 . TRP A 1 84  ? -29.402 103.645 41.745 1.00 31.98  ? 84   TRP A CD2 1 
ATOM   634  N NE1 . TRP A 1 84  ? -30.507 105.599 41.831 1.00 31.12  ? 84   TRP A NE1 1 
ATOM   635  C CE2 . TRP A 1 84  ? -30.466 104.392 41.184 1.00 31.87  ? 84   TRP A CE2 1 
ATOM   636  C CE3 . TRP A 1 84  ? -29.148 102.357 41.255 1.00 31.14  ? 84   TRP A CE3 1 
ATOM   637  C CZ2 . TRP A 1 84  ? -31.270 103.893 40.156 1.00 30.56  ? 84   TRP A CZ2 1 
ATOM   638  C CZ3 . TRP A 1 84  ? -29.947 101.861 40.235 1.00 30.75  ? 84   TRP A CZ3 1 
ATOM   639  C CH2 . TRP A 1 84  ? -30.998 102.631 39.697 1.00 31.41  ? 84   TRP A CH2 1 
ATOM   640  N N   . ASN A 1 85  ? -26.905 103.599 46.914 1.00 31.26  ? 85   ASN A N   1 
ATOM   641  C CA  . ASN A 1 85  ? -25.820 103.465 47.876 1.00 31.99  ? 85   ASN A CA  1 
ATOM   642  C C   . ASN A 1 85  ? -25.750 102.088 48.506 1.00 32.02  ? 85   ASN A C   1 
ATOM   643  O O   . ASN A 1 85  ? -26.717 101.326 48.488 1.00 31.55  ? 85   ASN A O   1 
ATOM   644  C CB  . ASN A 1 85  ? -25.955 104.499 48.996 1.00 32.38  ? 85   ASN A CB  1 
ATOM   645  C CG  . ASN A 1 85  ? -25.751 105.907 48.512 1.00 34.38  ? 85   ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 85  ? -24.948 106.161 47.609 1.00 35.93  ? 85   ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 85  ? -26.463 106.842 49.119 1.00 37.40  ? 85   ASN A ND2 1 
ATOM   648  N N   . PRO A 1 86  ? -24.584 101.744 49.067 1.00 32.19  ? 86   PRO A N   1 
ATOM   649  C CA  . PRO A 1 86  ? -24.437 100.438 49.707 1.00 32.58  ? 86   PRO A CA  1 
ATOM   650  C C   . PRO A 1 86  ? -25.470 100.362 50.830 1.00 33.61  ? 86   PRO A C   1 
ATOM   651  O O   . PRO A 1 86  ? -25.513 101.254 51.683 1.00 33.44  ? 86   PRO A O   1 
ATOM   652  C CB  . PRO A 1 86  ? -23.007 100.487 50.247 1.00 33.80  ? 86   PRO A CB  1 
ATOM   653  C CG  . PRO A 1 86  ? -22.296 101.359 49.250 1.00 32.86  ? 86   PRO A CG  1 
ATOM   654  C CD  . PRO A 1 86  ? -23.297 102.465 49.017 1.00 32.26  ? 86   PRO A CD  1 
ATOM   655  N N   . ASN A 1 87  ? -26.314 99.328  50.831 1.00 33.31  ? 87   ASN A N   1 
ATOM   656  C CA  . ASN A 1 87  ? -27.314 99.199  51.890 1.00 32.53  ? 87   ASN A CA  1 
ATOM   657  C C   . ASN A 1 87  ? -26.884 98.171  52.929 1.00 32.52  ? 87   ASN A C   1 
ATOM   658  O O   . ASN A 1 87  ? -27.674 97.741  53.762 1.00 33.11  ? 87   ASN A O   1 
ATOM   659  C CB  . ASN A 1 87  ? -28.683 98.829  51.313 1.00 30.99  ? 87   ASN A CB  1 
ATOM   660  C CG  . ASN A 1 87  ? -28.711 97.447  50.716 1.00 31.03  ? 87   ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 87  ? -29.700 97.046  50.115 1.00 31.30  ? 87   ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 87  ? -27.628 96.707  50.881 1.00 31.37  ? 87   ASN A ND2 1 
ATOM   663  N N   . ARG A 1 88  ? -25.621 97.775  52.862 1.00 32.75  ? 88   ARG A N   1 
ATOM   664  C CA  . ARG A 1 88  ? -25.058 96.814  53.797 1.00 34.93  ? 88   ARG A CA  1 
ATOM   665  C C   . ARG A 1 88  ? -23.723 97.351  54.269 1.00 35.23  ? 88   ARG A C   1 
ATOM   666  O O   . ARG A 1 88  ? -23.334 98.463  53.915 1.00 35.48  ? 88   ARG A O   1 
ATOM   667  C CB  . ARG A 1 88  ? -24.873 95.441  53.132 1.00 36.77  ? 88   ARG A CB  1 
ATOM   668  C CG  . ARG A 1 88  ? -26.121 94.567  53.165 1.00 40.04  ? 88   ARG A CG  1 
ATOM   669  C CD  . ARG A 1 88  ? -26.512 94.289  54.615 1.00 46.41  ? 88   ARG A CD  1 
ATOM   670  N NE  . ARG A 1 88  ? -27.687 93.430  54.762 1.00 51.16  ? 88   ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 88  ? -28.902 93.736  54.313 1.00 54.25  ? 88   ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 88  ? -29.107 94.885  53.680 1.00 55.36  ? 88   ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 88  ? -29.914 92.895  54.501 1.00 54.73  ? 88   ARG A NH2 1 
ATOM   674  N N   . GLU A 1 89  ? -23.016 96.565  55.064 1.00 35.89  ? 89   GLU A N   1 
ATOM   675  C CA  . GLU A 1 89  ? -21.730 97.002  55.580 1.00 38.29  ? 89   GLU A CA  1 
ATOM   676  C C   . GLU A 1 89  ? -20.624 96.794  54.542 1.00 36.66  ? 89   GLU A C   1 
ATOM   677  O O   . GLU A 1 89  ? -20.339 95.667  54.137 1.00 38.35  ? 89   GLU A O   1 
ATOM   678  C CB  . GLU A 1 89  ? -21.417 96.243  56.869 1.00 40.56  ? 89   GLU A CB  1 
ATOM   679  C CG  . GLU A 1 89  ? -20.719 97.085  57.915 1.00 48.44  ? 89   GLU A CG  1 
ATOM   680  C CD  . GLU A 1 89  ? -20.623 96.382  59.258 1.00 53.54  ? 89   GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 89  ? -19.896 95.367  59.354 1.00 55.95  ? 89   GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 89  ? -21.282 96.841  60.221 1.00 56.73  ? 89   GLU A OE2 1 
ATOM   683  N N   . MET A 1 90  ? -20.010 97.886  54.104 1.00 33.91  ? 90   MET A N   1 
ATOM   684  C CA  . MET A 1 90  ? -18.946 97.798  53.113 1.00 32.92  ? 90   MET A CA  1 
ATOM   685  C C   . MET A 1 90  ? -17.733 97.042  53.651 1.00 33.34  ? 90   MET A C   1 
ATOM   686  O O   . MET A 1 90  ? -17.371 97.176  54.819 1.00 34.19  ? 90   MET A O   1 
ATOM   687  C CB  . MET A 1 90  ? -18.511 99.196  52.659 1.00 30.01  ? 90   MET A CB  1 
ATOM   688  C CG  . MET A 1 90  ? -19.503 99.911  51.764 1.00 28.34  ? 90   MET A CG  1 
ATOM   689  S SD  . MET A 1 90  ? -18.774 101.375 50.992 1.00 26.87  ? 90   MET A SD  1 
ATOM   690  C CE  . MET A 1 90  ? -18.701 102.454 52.375 1.00 23.01  ? 90   MET A CE  1 
ATOM   691  N N   . SER A 1 91  ? -17.103 96.256  52.785 1.00 33.36  ? 91   SER A N   1 
ATOM   692  C CA  . SER A 1 91  ? -15.929 95.477  53.161 1.00 33.07  ? 91   SER A CA  1 
ATOM   693  C C   . SER A 1 91  ? -15.281 94.799  51.963 1.00 31.75  ? 91   SER A C   1 
ATOM   694  O O   . SER A 1 91  ? -15.979 94.314  51.067 1.00 29.85  ? 91   SER A O   1 
ATOM   695  C CB  . SER A 1 91  ? -16.314 94.436  54.208 1.00 33.09  ? 91   SER A CB  1 
ATOM   696  O OG  . SER A 1 91  ? -15.335 93.401  54.291 1.00 34.97  ? 91   SER A OG  1 
ATOM   697  N N   . GLU A 1 92  ? -13.950 94.753  51.953 1.00 31.07  ? 92   GLU A N   1 
ATOM   698  C CA  . GLU A 1 92  ? -13.232 94.100  50.861 1.00 31.35  ? 92   GLU A CA  1 
ATOM   699  C C   . GLU A 1 92  ? -13.734 92.662  50.709 1.00 31.84  ? 92   GLU A C   1 
ATOM   700  O O   . GLU A 1 92  ? -13.930 92.179  49.590 1.00 32.63  ? 92   GLU A O   1 
ATOM   701  C CB  . GLU A 1 92  ? -11.729 94.138  51.114 1.00 29.48  ? 92   GLU A CB  1 
ATOM   702  C CG  . GLU A 1 92  ? -11.202 95.555  51.146 1.00 31.48  ? 92   GLU A CG  1 
ATOM   703  C CD  . GLU A 1 92  ? -9.701  95.629  51.226 1.00 33.70  ? 92   GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 92  ? -9.033  95.560  50.168 1.00 35.00  ? 92   GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 92  ? -9.187  95.753  52.356 1.00 35.58  ? 92   GLU A OE2 1 
ATOM   706  N N   . ASP A 1 93  ? -13.924 91.984  51.831 1.00 30.93  ? 93   ASP A N   1 
ATOM   707  C CA  . ASP A 1 93  ? -14.497 90.662  51.791 1.00 30.74  ? 93   ASP A CA  1 
ATOM   708  C C   . ASP A 1 93  ? -15.929 90.838  51.307 1.00 29.42  ? 93   ASP A C   1 
ATOM   709  O O   . ASP A 1 93  ? -16.848 90.978  52.117 1.00 28.91  ? 93   ASP A O   1 
ATOM   710  C CB  . ASP A 1 93  ? -14.492 90.015  53.191 1.00 31.51  ? 93   ASP A CB  1 
ATOM   711  C CG  . ASP A 1 93  ? -15.099 88.611  53.196 1.00 31.87  ? 93   ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 93  ? -15.912 88.293  52.302 1.00 29.48  ? 93   ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 93  ? -14.749 87.829  54.103 1.00 34.24  ? 93   ASP A OD2 1 
ATOM   714  N N   . CYS A 1 94  ? -16.115 90.848  49.993 1.00 27.68  ? 94   CYS A N   1 
ATOM   715  C CA  . CYS A 1 94  ? -17.435 91.099  49.428 1.00 30.90  ? 94   CYS A CA  1 
ATOM   716  C C   . CYS A 1 94  ? -17.764 90.231  48.216 1.00 33.23  ? 94   CYS A C   1 
ATOM   717  O O   . CYS A 1 94  ? -18.745 90.485  47.505 1.00 32.83  ? 94   CYS A O   1 
ATOM   718  C CB  . CYS A 1 94  ? -17.529 92.577  49.022 1.00 27.42  ? 94   CYS A CB  1 
ATOM   719  S SG  . CYS A 1 94  ? -16.587 93.011  47.525 0.80 21.78  ? 94   CYS A SG  1 
ATOM   720  N N   . LEU A 1 95  ? -16.957 89.210  47.971 1.00 34.77  ? 95   LEU A N   1 
ATOM   721  C CA  . LEU A 1 95  ? -17.203 88.360  46.819 1.00 35.80  ? 95   LEU A CA  1 
ATOM   722  C C   . LEU A 1 95  ? -18.185 87.234  47.089 1.00 36.80  ? 95   LEU A C   1 
ATOM   723  O O   . LEU A 1 95  ? -17.788 86.094  47.330 1.00 37.95  ? 95   LEU A O   1 
ATOM   724  C CB  . LEU A 1 95  ? -15.880 87.844  46.299 1.00 35.54  ? 95   LEU A CB  1 
ATOM   725  C CG  . LEU A 1 95  ? -14.981 88.949  45.813 1.00 36.54  ? 95   LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 95  ? -13.626 88.399  45.403 1.00 37.31  ? 95   LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 95  ? -15.623 89.685  44.640 1.00 38.65  ? 95   LEU A CD2 1 
ATOM   728  N N   . TYR A 1 96  ? -19.473 87.570  47.052 1.00 36.86  ? 96   TYR A N   1 
ATOM   729  C CA  . TYR A 1 96  ? -20.543 86.601  47.269 1.00 37.08  ? 96   TYR A CA  1 
ATOM   730  C C   . TYR A 1 96  ? -21.596 86.797  46.196 1.00 37.64  ? 96   TYR A C   1 
ATOM   731  O O   . TYR A 1 96  ? -21.579 87.794  45.473 1.00 38.61  ? 96   TYR A O   1 
ATOM   732  C CB  . TYR A 1 96  ? -21.210 86.801  48.629 1.00 37.77  ? 96   TYR A CB  1 
ATOM   733  C CG  . TYR A 1 96  ? -20.262 86.788  49.796 1.00 38.30  ? 96   TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 96  ? -19.462 87.894  50.077 1.00 37.39  ? 96   TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 96  ? -20.147 85.658  50.608 1.00 36.55  ? 96   TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 96  ? -18.567 87.875  51.140 1.00 39.55  ? 96   TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 96  ? -19.261 85.626  51.666 1.00 37.18  ? 96   TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 96  ? -18.471 86.734  51.930 1.00 38.79  ? 96   TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 96  ? -17.576 86.697  52.974 1.00 40.31  ? 96   TYR A OH  1 
ATOM   740  N N   . LEU A 1 97  ? -22.527 85.855  46.111 1.00 36.67  ? 97   LEU A N   1 
ATOM   741  C CA  . LEU A 1 97  ? -23.586 85.936  45.121 1.00 35.54  ? 97   LEU A CA  1 
ATOM   742  C C   . LEU A 1 97  ? -24.908 85.479  45.733 1.00 35.35  ? 97   LEU A C   1 
ATOM   743  O O   . LEU A 1 97  ? -24.925 84.712  46.688 1.00 33.77  ? 97   LEU A O   1 
ATOM   744  C CB  . LEU A 1 97  ? -23.216 85.089  43.894 1.00 34.88  ? 97   LEU A CB  1 
ATOM   745  C CG  . LEU A 1 97  ? -23.034 83.576  44.046 1.00 34.32  ? 97   LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 97  ? -24.397 82.898  44.087 1.00 34.70  ? 97   LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 97  ? -22.238 83.039  42.878 1.00 32.53  ? 97   LEU A CD2 1 
ATOM   748  N N   . ASN A 1 98  ? -26.014 85.965  45.185 1.00 36.43  ? 98   ASN A N   1 
ATOM   749  C CA  . ASN A 1 98  ? -27.329 85.612  45.695 1.00 37.10  ? 98   ASN A CA  1 
ATOM   750  C C   . ASN A 1 98  ? -28.141 84.891  44.634 1.00 37.80  ? 98   ASN A C   1 
ATOM   751  O O   . ASN A 1 98  ? -28.072 85.218  43.448 1.00 37.55  ? 98   ASN A O   1 
ATOM   752  C CB  . ASN A 1 98  ? -28.082 86.867  46.130 1.00 37.75  ? 98   ASN A CB  1 
ATOM   753  C CG  . ASN A 1 98  ? -27.213 87.821  46.909 1.00 41.04  ? 98   ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 98  ? -26.711 87.486  47.980 1.00 43.29  ? 98   ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 98  ? -27.025 89.025  46.372 1.00 42.68  ? 98   ASN A ND2 1 
ATOM   756  N N   . ILE A 1 99  ? -28.924 83.915  45.074 1.00 38.07  ? 99   ILE A N   1 
ATOM   757  C CA  . ILE A 1 99  ? -29.756 83.142  44.170 1.00 38.06  ? 99   ILE A CA  1 
ATOM   758  C C   . ILE A 1 99  ? -31.205 83.212  44.626 1.00 39.52  ? 99   ILE A C   1 
ATOM   759  O O   . ILE A 1 99  ? -31.487 83.387  45.807 1.00 41.30  ? 99   ILE A O   1 
ATOM   760  C CB  . ILE A 1 99  ? -29.328 81.660  44.154 1.00 34.93  ? 99   ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 99  ? -27.861 81.542  43.737 1.00 32.97  ? 99   ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 99  ? -30.217 80.875  43.219 1.00 34.27  ? 99   ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 99  ? -27.303 80.146  43.865 1.00 29.89  ? 99   ILE A CD1 1 
ATOM   764  N N   . TRP A 1 100 ? -32.119 83.097  43.678 1.00 39.86  ? 100  TRP A N   1 
ATOM   765  C CA  . TRP A 1 100 ? -33.531 83.091  43.988 1.00 42.34  ? 100  TRP A CA  1 
ATOM   766  C C   . TRP A 1 100 ? -34.089 81.905  43.219 1.00 44.38  ? 100  TRP A C   1 
ATOM   767  O O   . TRP A 1 100 ? -34.209 81.956  41.994 1.00 44.74  ? 100  TRP A O   1 
ATOM   768  C CB  . TRP A 1 100 ? -34.193 84.386  43.532 1.00 44.67  ? 100  TRP A CB  1 
ATOM   769  C CG  . TRP A 1 100 ? -34.180 85.467  44.566 1.00 46.36  ? 100  TRP A CG  1 
ATOM   770  C CD1 . TRP A 1 100 ? -35.128 85.705  45.519 1.00 47.26  ? 100  TRP A CD1 1 
ATOM   771  C CD2 . TRP A 1 100 ? -33.160 86.449  44.760 1.00 46.88  ? 100  TRP A CD2 1 
ATOM   772  N NE1 . TRP A 1 100 ? -34.764 86.778  46.295 1.00 47.13  ? 100  TRP A NE1 1 
ATOM   773  C CE2 . TRP A 1 100 ? -33.558 87.253  45.852 1.00 47.81  ? 100  TRP A CE2 1 
ATOM   774  C CE3 . TRP A 1 100 ? -31.946 86.729  44.119 1.00 47.34  ? 100  TRP A CE3 1 
ATOM   775  C CZ2 . TRP A 1 100 ? -32.782 88.322  46.318 1.00 49.18  ? 100  TRP A CZ2 1 
ATOM   776  C CZ3 . TRP A 1 100 ? -31.175 87.789  44.579 1.00 48.11  ? 100  TRP A CZ3 1 
ATOM   777  C CH2 . TRP A 1 100 ? -31.597 88.574  45.670 1.00 48.64  ? 100  TRP A CH2 1 
ATOM   778  N N   . VAL A 1 101 ? -34.395 80.830  43.944 1.00 46.27  ? 101  VAL A N   1 
ATOM   779  C CA  . VAL A 1 101 ? -34.941 79.604  43.357 1.00 46.19  ? 101  VAL A CA  1 
ATOM   780  C C   . VAL A 1 101 ? -36.438 79.505  43.607 1.00 46.95  ? 101  VAL A C   1 
ATOM   781  O O   . VAL A 1 101 ? -36.890 79.633  44.742 1.00 47.54  ? 101  VAL A O   1 
ATOM   782  C CB  . VAL A 1 101 ? -34.297 78.354  43.976 1.00 45.85  ? 101  VAL A CB  1 
ATOM   783  C CG1 . VAL A 1 101 ? -34.859 77.112  43.308 1.00 44.88  ? 101  VAL A CG1 1 
ATOM   784  C CG2 . VAL A 1 101 ? -32.777 78.423  43.854 1.00 44.80  ? 101  VAL A CG2 1 
ATOM   785  N N   . PRO A 1 102 ? -37.229 79.274  42.551 1.00 47.90  ? 102  PRO A N   1 
ATOM   786  C CA  . PRO A 1 102 ? -38.686 79.160  42.698 1.00 50.27  ? 102  PRO A CA  1 
ATOM   787  C C   . PRO A 1 102 ? -39.056 77.943  43.547 1.00 53.08  ? 102  PRO A C   1 
ATOM   788  O O   . PRO A 1 102 ? -38.242 77.029  43.720 1.00 53.56  ? 102  PRO A O   1 
ATOM   789  C CB  . PRO A 1 102 ? -39.171 79.011  41.257 1.00 48.79  ? 102  PRO A CB  1 
ATOM   790  C CG  . PRO A 1 102 ? -38.109 79.703  40.463 1.00 48.32  ? 102  PRO A CG  1 
ATOM   791  C CD  . PRO A 1 102 ? -36.844 79.247  41.133 1.00 47.43  ? 102  PRO A CD  1 
ATOM   792  N N   . SER A 1 103 ? -40.281 77.928  44.072 1.00 55.63  ? 103  SER A N   1 
ATOM   793  C CA  . SER A 1 103 ? -40.737 76.805  44.895 1.00 57.93  ? 103  SER A CA  1 
ATOM   794  C C   . SER A 1 103 ? -42.101 76.272  44.429 1.00 57.60  ? 103  SER A C   1 
ATOM   795  O O   . SER A 1 103 ? -43.045 77.038  44.236 1.00 57.46  ? 103  SER A O   1 
ATOM   796  C CB  . SER A 1 103 ? -40.815 77.225  46.369 1.00 59.01  ? 103  SER A CB  1 
ATOM   797  O OG  . SER A 1 103 ? -40.857 76.090  47.219 1.00 60.44  ? 103  SER A OG  1 
ATOM   798  N N   . PRO A 1 104 ? -42.218 74.943  44.249 1.00 57.82  ? 104  PRO A N   1 
ATOM   799  C CA  . PRO A 1 104 ? -41.159 73.949  44.459 1.00 57.70  ? 104  PRO A CA  1 
ATOM   800  C C   . PRO A 1 104 ? -39.965 74.188  43.550 1.00 58.21  ? 104  PRO A C   1 
ATOM   801  O O   . PRO A 1 104 ? -40.100 74.763  42.470 1.00 57.30  ? 104  PRO A O   1 
ATOM   802  C CB  . PRO A 1 104 ? -41.852 72.625  44.138 1.00 56.81  ? 104  PRO A CB  1 
ATOM   803  C CG  . PRO A 1 104 ? -43.289 72.907  44.421 1.00 57.64  ? 104  PRO A CG  1 
ATOM   804  C CD  . PRO A 1 104 ? -43.464 74.282  43.833 1.00 57.62  ? 104  PRO A CD  1 
ATOM   805  N N   . ARG A 1 105 ? -38.798 73.743  43.999 1.00 59.16  ? 105  ARG A N   1 
ATOM   806  C CA  . ARG A 1 105 ? -37.571 73.889  43.233 1.00 60.26  ? 105  ARG A CA  1 
ATOM   807  C C   . ARG A 1 105 ? -37.695 73.152  41.907 1.00 61.31  ? 105  ARG A C   1 
ATOM   808  O O   . ARG A 1 105 ? -37.762 71.926  41.885 1.00 62.62  ? 105  ARG A O   1 
ATOM   809  C CB  . ARG A 1 105 ? -36.388 73.300  44.006 1.00 59.14  ? 105  ARG A CB  1 
ATOM   810  C CG  . ARG A 1 105 ? -35.067 73.454  43.287 1.00 57.54  ? 105  ARG A CG  1 
ATOM   811  C CD  . ARG A 1 105 ? -34.057 72.397  43.690 1.00 58.75  ? 105  ARG A CD  1 
ATOM   812  N NE  . ARG A 1 105 ? -33.793 72.355  45.126 1.00 59.80  ? 105  ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 105 ? -32.772 71.696  45.669 1.00 59.53  ? 105  ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 105 ? -31.927 71.033  44.889 1.00 59.31  ? 105  ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 105 ? -32.587 71.700  46.983 1.00 58.30  ? 105  ARG A NH2 1 
ATOM   816  N N   . PRO A 1 106 ? -37.739 73.884  40.781 1.00 62.45  ? 106  PRO A N   1 
ATOM   817  C CA  . PRO A 1 106 ? -37.849 73.195  39.489 1.00 61.88  ? 106  PRO A CA  1 
ATOM   818  C C   . PRO A 1 106 ? -36.484 72.597  39.167 1.00 61.30  ? 106  PRO A C   1 
ATOM   819  O O   . PRO A 1 106 ? -35.580 72.602  40.005 1.00 60.96  ? 106  PRO A O   1 
ATOM   820  C CB  . PRO A 1 106 ? -38.207 74.322  38.514 1.00 62.22  ? 106  PRO A CB  1 
ATOM   821  C CG  . PRO A 1 106 ? -38.792 75.406  39.396 1.00 62.86  ? 106  PRO A CG  1 
ATOM   822  C CD  . PRO A 1 106 ? -37.906 75.338  40.615 1.00 62.95  ? 106  PRO A CD  1 
ATOM   823  N N   . LYS A 1 107 ? -36.331 72.068  37.964 1.00 61.58  ? 107  LYS A N   1 
ATOM   824  C CA  . LYS A 1 107 ? -35.033 71.544  37.579 1.00 62.35  ? 107  LYS A CA  1 
ATOM   825  C C   . LYS A 1 107 ? -34.741 71.912  36.135 1.00 61.57  ? 107  LYS A C   1 
ATOM   826  O O   . LYS A 1 107 ? -35.640 71.934  35.288 1.00 61.01  ? 107  LYS A O   1 
ATOM   827  C CB  . LYS A 1 107 ? -34.943 70.031  37.774 1.00 64.04  ? 107  LYS A CB  1 
ATOM   828  C CG  . LYS A 1 107 ? -33.511 69.528  37.623 1.00 66.06  ? 107  LYS A CG  1 
ATOM   829  C CD  . LYS A 1 107 ? -32.565 70.284  38.566 1.00 67.01  ? 107  LYS A CD  1 
ATOM   830  C CE  . LYS A 1 107 ? -31.220 70.593  37.904 1.00 68.58  ? 107  LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 107 ? -30.362 69.386  37.727 1.00 70.79  ? 107  LYS A NZ  1 
ATOM   832  N N   . SER A 1 108 ? -33.477 72.220  35.867 1.00 60.15  ? 108  SER A N   1 
ATOM   833  C CA  . SER A 1 108 ? -33.051 72.623  34.536 1.00 58.21  ? 108  SER A CA  1 
ATOM   834  C C   . SER A 1 108 ? -33.935 73.723  33.955 1.00 56.02  ? 108  SER A C   1 
ATOM   835  O O   . SER A 1 108 ? -34.456 73.585  32.849 1.00 56.01  ? 108  SER A O   1 
ATOM   836  C CB  . SER A 1 108 ? -33.034 71.421  33.593 1.00 59.31  ? 108  SER A CB  1 
ATOM   837  O OG  . SER A 1 108 ? -31.944 70.569  33.896 1.00 61.69  ? 108  SER A OG  1 
ATOM   838  N N   . THR A 1 109 ? -34.112 74.809  34.706 1.00 53.28  ? 109  THR A N   1 
ATOM   839  C CA  . THR A 1 109 ? -34.913 75.930  34.227 1.00 49.94  ? 109  THR A CA  1 
ATOM   840  C C   . THR A 1 109 ? -33.955 77.060  33.874 1.00 49.23  ? 109  THR A C   1 
ATOM   841  O O   . THR A 1 109 ? -32.793 77.067  34.303 1.00 47.82  ? 109  THR A O   1 
ATOM   842  C CB  . THR A 1 109 ? -35.925 76.437  35.286 1.00 49.14  ? 109  THR A CB  1 
ATOM   843  O OG1 . THR A 1 109 ? -36.908 77.270  34.655 1.00 45.99  ? 109  THR A OG1 1 
ATOM   844  C CG2 . THR A 1 109 ? -35.224 77.253  36.348 1.00 49.62  ? 109  THR A CG2 1 
ATOM   845  N N   . THR A 1 110 ? -34.452 78.009  33.089 1.00 47.49  ? 110  THR A N   1 
ATOM   846  C CA  . THR A 1 110 ? -33.666 79.154  32.649 1.00 45.52  ? 110  THR A CA  1 
ATOM   847  C C   . THR A 1 110 ? -32.996 79.920  33.793 1.00 43.08  ? 110  THR A C   1 
ATOM   848  O O   . THR A 1 110 ? -33.644 80.288  34.772 1.00 43.61  ? 110  THR A O   1 
ATOM   849  C CB  . THR A 1 110 ? -34.548 80.129  31.871 1.00 45.20  ? 110  THR A CB  1 
ATOM   850  O OG1 . THR A 1 110 ? -35.278 79.409  30.871 1.00 44.48  ? 110  THR A OG1 1 
ATOM   851  C CG2 . THR A 1 110 ? -33.694 81.200  31.211 1.00 45.54  ? 110  THR A CG2 1 
ATOM   852  N N   . VAL A 1 111 ? -31.697 80.159  33.662 1.00 39.51  ? 111  VAL A N   1 
ATOM   853  C CA  . VAL A 1 111 ? -30.961 80.898  34.679 1.00 36.83  ? 111  VAL A CA  1 
ATOM   854  C C   . VAL A 1 111 ? -30.645 82.304  34.173 1.00 35.18  ? 111  VAL A C   1 
ATOM   855  O O   . VAL A 1 111 ? -30.351 82.496  32.990 1.00 33.43  ? 111  VAL A O   1 
ATOM   856  C CB  . VAL A 1 111 ? -29.645 80.176  35.048 1.00 36.71  ? 111  VAL A CB  1 
ATOM   857  C CG1 . VAL A 1 111 ? -28.823 81.026  36.000 1.00 34.95  ? 111  VAL A CG1 1 
ATOM   858  C CG2 . VAL A 1 111 ? -29.957 78.835  35.690 1.00 37.15  ? 111  VAL A CG2 1 
ATOM   859  N N   . MET A 1 112 ? -30.725 83.283  35.072 1.00 33.23  ? 112  MET A N   1 
ATOM   860  C CA  . MET A 1 112 ? -30.443 84.676  34.728 1.00 32.05  ? 112  MET A CA  1 
ATOM   861  C C   . MET A 1 112 ? -29.533 85.340  35.754 1.00 32.07  ? 112  MET A C   1 
ATOM   862  O O   . MET A 1 112 ? -29.942 85.592  36.889 1.00 33.05  ? 112  MET A O   1 
ATOM   863  C CB  . MET A 1 112 ? -31.739 85.472  34.611 1.00 30.28  ? 112  MET A CB  1 
ATOM   864  C CG  . MET A 1 112 ? -32.566 85.139  33.394 1.00 28.54  ? 112  MET A CG  1 
ATOM   865  S SD  . MET A 1 112 ? -34.018 86.201  33.307 1.00 33.19  ? 112  MET A SD  1 
ATOM   866  C CE  . MET A 1 112 ? -33.636 87.238  31.936 1.00 36.01  ? 112  MET A CE  1 
ATOM   867  N N   . VAL A 1 113 ? -28.302 85.630  35.341 1.00 30.64  ? 113  VAL A N   1 
ATOM   868  C CA  . VAL A 1 113 ? -27.317 86.253  36.218 1.00 30.74  ? 113  VAL A CA  1 
ATOM   869  C C   . VAL A 1 113 ? -27.235 87.771  36.033 1.00 32.22  ? 113  VAL A C   1 
ATOM   870  O O   . VAL A 1 113 ? -26.884 88.257  34.962 1.00 34.06  ? 113  VAL A O   1 
ATOM   871  C CB  . VAL A 1 113 ? -25.916 85.655  35.976 1.00 29.97  ? 113  VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 113 ? -24.942 86.187  37.017 1.00 27.34  ? 113  VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 113 ? -25.983 84.128  36.010 1.00 27.46  ? 113  VAL A CG2 1 
ATOM   874  N N   . TRP A 1 114 ? -27.548 88.515  37.088 1.00 32.48  ? 114  TRP A N   1 
ATOM   875  C CA  . TRP A 1 114 ? -27.519 89.972  37.040 1.00 33.01  ? 114  TRP A CA  1 
ATOM   876  C C   . TRP A 1 114 ? -26.192 90.568  37.471 1.00 34.14  ? 114  TRP A C   1 
ATOM   877  O O   . TRP A 1 114 ? -25.615 90.166  38.477 1.00 36.28  ? 114  TRP A O   1 
ATOM   878  C CB  . TRP A 1 114 ? -28.638 90.540  37.916 1.00 31.75  ? 114  TRP A CB  1 
ATOM   879  C CG  . TRP A 1 114 ? -28.558 92.025  38.176 1.00 30.50  ? 114  TRP A CG  1 
ATOM   880  C CD1 . TRP A 1 114 ? -28.178 92.630  39.339 1.00 30.53  ? 114  TRP A CD1 1 
ATOM   881  C CD2 . TRP A 1 114 ? -28.916 93.082  37.275 1.00 29.10  ? 114  TRP A CD2 1 
ATOM   882  N NE1 . TRP A 1 114 ? -28.286 93.996  39.224 1.00 29.85  ? 114  TRP A NE1 1 
ATOM   883  C CE2 . TRP A 1 114 ? -28.734 94.302  37.968 1.00 29.02  ? 114  TRP A CE2 1 
ATOM   884  C CE3 . TRP A 1 114 ? -29.372 93.118  35.952 1.00 28.56  ? 114  TRP A CE3 1 
ATOM   885  C CZ2 . TRP A 1 114 ? -28.995 95.545  37.382 1.00 27.71  ? 114  TRP A CZ2 1 
ATOM   886  C CZ3 . TRP A 1 114 ? -29.632 94.351  35.369 1.00 28.28  ? 114  TRP A CZ3 1 
ATOM   887  C CH2 . TRP A 1 114 ? -29.443 95.550  36.086 1.00 29.04  ? 114  TRP A CH2 1 
ATOM   888  N N   . ILE A 1 115 ? -25.712 91.537  36.698 1.00 34.93  ? 115  ILE A N   1 
ATOM   889  C CA  . ILE A 1 115 ? -24.462 92.213  37.017 1.00 33.24  ? 115  ILE A CA  1 
ATOM   890  C C   . ILE A 1 115 ? -24.759 93.697  37.167 1.00 30.94  ? 115  ILE A C   1 
ATOM   891  O O   . ILE A 1 115 ? -24.953 94.393  36.179 1.00 30.17  ? 115  ILE A O   1 
ATOM   892  C CB  . ILE A 1 115 ? -23.412 92.020  35.906 1.00 33.44  ? 115  ILE A CB  1 
ATOM   893  C CG1 . ILE A 1 115 ? -23.199 90.530  35.648 1.00 32.37  ? 115  ILE A CG1 1 
ATOM   894  C CG2 . ILE A 1 115 ? -22.096 92.664  36.319 1.00 32.46  ? 115  ILE A CG2 1 
ATOM   895  C CD1 . ILE A 1 115 ? -22.103 90.238  34.650 1.00 32.99  ? 115  ILE A CD1 1 
ATOM   896  N N   . TYR A 1 116 ? -24.800 94.169  38.409 1.00 29.86  ? 116  TYR A N   1 
ATOM   897  C CA  . TYR A 1 116 ? -25.090 95.572  38.704 1.00 27.30  ? 116  TYR A CA  1 
ATOM   898  C C   . TYR A 1 116 ? -24.160 96.571  38.040 1.00 26.70  ? 116  TYR A C   1 
ATOM   899  O O   . TYR A 1 116 ? -22.977 96.286  37.814 1.00 26.19  ? 116  TYR A O   1 
ATOM   900  C CB  . TYR A 1 116 ? -25.073 95.823  40.223 1.00 25.97  ? 116  TYR A CB  1 
ATOM   901  C CG  . TYR A 1 116 ? -23.780 95.462  40.941 1.00 24.79  ? 116  TYR A CG  1 
ATOM   902  C CD1 . TYR A 1 116 ? -22.584 96.132  40.668 1.00 25.65  ? 116  TYR A CD1 1 
ATOM   903  C CD2 . TYR A 1 116 ? -23.761 94.466  41.916 1.00 24.01  ? 116  TYR A CD2 1 
ATOM   904  C CE1 . TYR A 1 116 ? -21.403 95.818  41.349 1.00 23.61  ? 116  TYR A CE1 1 
ATOM   905  C CE2 . TYR A 1 116 ? -22.591 94.145  42.599 1.00 23.65  ? 116  TYR A CE2 1 
ATOM   906  C CZ  . TYR A 1 116 ? -21.416 94.820  42.312 1.00 23.71  ? 116  TYR A CZ  1 
ATOM   907  O OH  . TYR A 1 116 ? -20.257 94.476  42.978 1.00 22.13  ? 116  TYR A OH  1 
ATOM   908  N N   . GLY A 1 117 ? -24.717 97.745  37.740 1.00 25.53  ? 117  GLY A N   1 
ATOM   909  C CA  . GLY A 1 117 ? -23.955 98.822  37.133 1.00 24.21  ? 117  GLY A CA  1 
ATOM   910  C C   . GLY A 1 117 ? -23.383 99.729  38.215 1.00 23.82  ? 117  GLY A C   1 
ATOM   911  O O   . GLY A 1 117 ? -23.338 99.342  39.388 1.00 23.15  ? 117  GLY A O   1 
ATOM   912  N N   . GLY A 1 118 ? -22.949 100.931 37.834 1.00 22.53  ? 118  GLY A N   1 
ATOM   913  C CA  . GLY A 1 118 ? -22.391 101.853 38.807 1.00 18.03  ? 118  GLY A CA  1 
ATOM   914  C C   . GLY A 1 118 ? -21.066 102.445 38.364 1.00 17.48  ? 118  GLY A C   1 
ATOM   915  O O   . GLY A 1 118 ? -20.215 102.777 39.191 1.00 18.66  ? 118  GLY A O   1 
ATOM   916  N N   . GLY A 1 119 ? -20.882 102.567 37.057 1.00 16.32  ? 119  GLY A N   1 
ATOM   917  C CA  . GLY A 1 119 ? -19.658 103.139 36.528 1.00 17.31  ? 119  GLY A CA  1 
ATOM   918  C C   . GLY A 1 119 ? -18.350 102.459 36.900 1.00 20.12  ? 119  GLY A C   1 
ATOM   919  O O   . GLY A 1 119 ? -17.286 103.067 36.764 1.00 21.66  ? 119  GLY A O   1 
ATOM   920  N N   . PHE A 1 120 ? -18.410 101.213 37.366 1.00 20.63  ? 120  PHE A N   1 
ATOM   921  C CA  . PHE A 1 120 ? -17.208 100.470 37.751 1.00 22.44  ? 120  PHE A CA  1 
ATOM   922  C C   . PHE A 1 120 ? -16.552 101.001 39.027 1.00 24.08  ? 120  PHE A C   1 
ATOM   923  O O   . PHE A 1 120 ? -15.511 100.495 39.448 1.00 27.22  ? 120  PHE A O   1 
ATOM   924  C CB  . PHE A 1 120 ? -16.165 100.469 36.613 1.00 20.95  ? 120  PHE A CB  1 
ATOM   925  C CG  . PHE A 1 120 ? -16.559 99.646  35.411 1.00 18.95  ? 120  PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 120 ? -16.763 98.271  35.524 1.00 19.85  ? 120  PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 120 ? -16.764 100.249 34.178 1.00 16.53  ? 120  PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 120 ? -17.176 97.507  34.418 1.00 20.11  ? 120  PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 120 ? -17.175 99.498  33.066 1.00 18.49  ? 120  PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 120 ? -17.384 98.124  33.185 1.00 17.91  ? 120  PHE A CZ  1 
ATOM   931  N N   . TYR A 1 121 ? -17.146 102.019 39.644 1.00 24.50  ? 121  TYR A N   1 
ATOM   932  C CA  . TYR A 1 121 ? -16.585 102.568 40.885 1.00 24.11  ? 121  TYR A CA  1 
ATOM   933  C C   . TYR A 1 121 ? -17.538 102.318 42.053 1.00 23.35  ? 121  TYR A C   1 
ATOM   934  O O   . TYR A 1 121 ? -17.199 102.563 43.207 1.00 25.08  ? 121  TYR A O   1 
ATOM   935  C CB  . TYR A 1 121 ? -16.330 104.080 40.750 1.00 22.88  ? 121  TYR A CB  1 
ATOM   936  C CG  . TYR A 1 121 ? -17.590 104.908 40.730 1.00 19.42  ? 121  TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 121 ? -18.224 105.284 41.912 1.00 18.98  ? 121  TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 121 ? -18.178 105.268 39.529 1.00 21.42  ? 121  TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 121 ? -19.419 105.999 41.895 1.00 19.59  ? 121  TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 121 ? -19.371 105.981 39.494 1.00 23.09  ? 121  TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 121 ? -19.988 106.342 40.680 1.00 22.99  ? 121  TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 121 ? -21.180 107.034 40.629 1.00 25.09  ? 121  TYR A OH  1 
ATOM   943  N N   . SER A 1 122 ? -18.736 101.838 41.750 1.00 21.59  ? 122  SER A N   1 
ATOM   944  C CA  . SER A 1 122 ? -19.715 101.577 42.788 1.00 21.56  ? 122  SER A CA  1 
ATOM   945  C C   . SER A 1 122 ? -20.688 100.479 42.373 1.00 22.03  ? 122  SER A C   1 
ATOM   946  O O   . SER A 1 122 ? -20.623 99.969  41.249 1.00 18.18  ? 122  SER A O   1 
ATOM   947  C CB  . SER A 1 122 ? -20.485 102.860 43.094 1.00 23.15  ? 122  SER A CB  1 
ATOM   948  O OG  . SER A 1 122 ? -21.053 103.390 41.904 1.00 22.85  ? 122  SER A OG  1 
ATOM   949  N N   . GLY A 1 123 ? -21.589 100.123 43.288 1.00 23.08  ? 123  GLY A N   1 
ATOM   950  C CA  . GLY A 1 123 ? -22.565 99.090  42.997 1.00 25.41  ? 123  GLY A CA  1 
ATOM   951  C C   . GLY A 1 123 ? -22.724 98.097  44.128 1.00 27.16  ? 123  GLY A C   1 
ATOM   952  O O   . GLY A 1 123 ? -21.826 97.937  44.955 1.00 26.71  ? 123  GLY A O   1 
ATOM   953  N N   . SER A 1 124 ? -23.877 97.432  44.156 1.00 28.89  ? 124  SER A N   1 
ATOM   954  C CA  . SER A 1 124 ? -24.201 96.442  45.177 1.00 30.25  ? 124  SER A CA  1 
ATOM   955  C C   . SER A 1 124 ? -25.251 95.504  44.629 1.00 31.36  ? 124  SER A C   1 
ATOM   956  O O   . SER A 1 124 ? -26.170 95.944  43.944 1.00 32.73  ? 124  SER A O   1 
ATOM   957  C CB  . SER A 1 124 ? -24.764 97.112  46.422 1.00 30.39  ? 124  SER A CB  1 
ATOM   958  O OG  . SER A 1 124 ? -23.773 97.880  47.066 1.00 31.75  ? 124  SER A OG  1 
ATOM   959  N N   . SER A 1 125 ? -25.115 94.218  44.943 1.00 32.10  ? 125  SER A N   1 
ATOM   960  C CA  . SER A 1 125 ? -26.054 93.198  44.479 1.00 33.25  ? 125  SER A CA  1 
ATOM   961  C C   . SER A 1 125 ? -27.230 93.081  45.425 1.00 32.75  ? 125  SER A C   1 
ATOM   962  O O   . SER A 1 125 ? -28.184 92.359  45.151 1.00 32.76  ? 125  SER A O   1 
ATOM   963  C CB  . SER A 1 125 ? -25.359 91.836  44.397 1.00 35.60  ? 125  SER A CB  1 
ATOM   964  O OG  . SER A 1 125 ? -24.848 91.441  45.664 1.00 34.99  ? 125  SER A OG  1 
ATOM   965  N N   . THR A 1 126 ? -27.152 93.812  46.531 1.00 32.48  ? 126  THR A N   1 
ATOM   966  C CA  . THR A 1 126 ? -28.175 93.779  47.565 1.00 33.12  ? 126  THR A CA  1 
ATOM   967  C C   . THR A 1 126 ? -29.163 94.946  47.614 1.00 34.15  ? 126  THR A C   1 
ATOM   968  O O   . THR A 1 126 ? -29.871 95.099  48.605 1.00 35.83  ? 126  THR A O   1 
ATOM   969  C CB  . THR A 1 126 ? -27.516 93.695  48.935 1.00 33.10  ? 126  THR A CB  1 
ATOM   970  O OG1 . THR A 1 126 ? -26.837 94.931  49.200 1.00 32.91  ? 126  THR A OG1 1 
ATOM   971  C CG2 . THR A 1 126 ? -26.498 92.550  48.970 1.00 32.11  ? 126  THR A CG2 1 
ATOM   972  N N   . LEU A 1 127 ? -29.220 95.774  46.575 1.00 34.34  ? 127  LEU A N   1 
ATOM   973  C CA  . LEU A 1 127 ? -30.157 96.898  46.583 1.00 34.92  ? 127  LEU A CA  1 
ATOM   974  C C   . LEU A 1 127 ? -31.588 96.380  46.511 1.00 36.00  ? 127  LEU A C   1 
ATOM   975  O O   . LEU A 1 127 ? -31.832 95.265  46.048 1.00 35.92  ? 127  LEU A O   1 
ATOM   976  C CB  . LEU A 1 127 ? -29.905 97.837  45.397 1.00 33.74  ? 127  LEU A CB  1 
ATOM   977  C CG  . LEU A 1 127 ? -28.511 98.451  45.263 1.00 33.75  ? 127  LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 127 ? -28.545 99.528  44.184 1.00 32.82  ? 127  LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 127 ? -28.066 99.043  46.599 1.00 31.90  ? 127  LEU A CD2 1 
ATOM   980  N N   . ASP A 1 128 ? -32.537 97.183  46.975 1.00 37.28  ? 128  ASP A N   1 
ATOM   981  C CA  . ASP A 1 128 ? -33.929 96.771  46.927 1.00 38.72  ? 128  ASP A CA  1 
ATOM   982  C C   . ASP A 1 128 ? -34.349 96.629  45.473 1.00 38.40  ? 128  ASP A C   1 
ATOM   983  O O   . ASP A 1 128 ? -34.960 95.636  45.086 1.00 38.93  ? 128  ASP A O   1 
ATOM   984  C CB  . ASP A 1 128 ? -34.835 97.795  47.620 1.00 40.93  ? 128  ASP A CB  1 
ATOM   985  C CG  . ASP A 1 128 ? -34.548 97.920  49.101 1.00 44.38  ? 128  ASP A CG  1 
ATOM   986  O OD1 . ASP A 1 128 ? -34.014 96.954  49.689 1.00 48.12  ? 128  ASP A OD1 1 
ATOM   987  O OD2 . ASP A 1 128 ? -34.870 98.977  49.684 1.00 45.95  ? 128  ASP A OD2 1 
ATOM   988  N N   . VAL A 1 129 ? -34.000 97.626  44.670 1.00 38.30  ? 129  VAL A N   1 
ATOM   989  C CA  . VAL A 1 129 ? -34.354 97.639  43.257 1.00 38.31  ? 129  VAL A CA  1 
ATOM   990  C C   . VAL A 1 129 ? -33.851 96.412  42.478 1.00 37.87  ? 129  VAL A C   1 
ATOM   991  O O   . VAL A 1 129 ? -34.323 96.145  41.376 1.00 38.10  ? 129  VAL A O   1 
ATOM   992  C CB  . VAL A 1 129 ? -33.845 98.942  42.587 1.00 37.99  ? 129  VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 129 ? -32.343 98.868  42.368 1.00 38.86  ? 129  VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 129 ? -34.586 99.189  41.290 1.00 36.63  ? 129  VAL A CG2 1 
ATOM   995  N N   . TYR A 1 130 ? -32.902 95.668  43.045 1.00 37.65  ? 130  TYR A N   1 
ATOM   996  C CA  . TYR A 1 130 ? -32.385 94.469  42.381 1.00 38.18  ? 130  TYR A CA  1 
ATOM   997  C C   . TYR A 1 130 ? -32.830 93.197  43.099 1.00 39.79  ? 130  TYR A C   1 
ATOM   998  O O   . TYR A 1 130 ? -32.129 92.183  43.049 1.00 38.94  ? 130  TYR A O   1 
ATOM   999  C CB  . TYR A 1 130 ? -30.852 94.438  42.342 1.00 36.84  ? 130  TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 130 ? -30.151 95.630  41.739 1.00 36.09  ? 130  TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 130 ? -30.652 96.280  40.611 1.00 36.33  ? 130  TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 130 ? -28.931 96.059  42.255 1.00 34.89  ? 130  TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 130 ? -29.944 97.327  40.012 1.00 34.21  ? 130  TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 130 ? -28.222 97.091  41.667 1.00 32.77  ? 130  TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 130 ? -28.727 97.716  40.549 1.00 32.73  ? 130  TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 130 ? -27.984 98.698  39.951 1.00 31.73  ? 130  TYR A OH  1 
ATOM   1007 N N   . ASN A 1 131 ? -33.967 93.243  43.786 1.00 41.41  ? 131  ASN A N   1 
ATOM   1008 C CA  . ASN A 1 131 ? -34.450 92.056  44.481 1.00 42.44  ? 131  ASN A CA  1 
ATOM   1009 C C   . ASN A 1 131 ? -34.983 91.129  43.408 1.00 42.65  ? 131  ASN A C   1 
ATOM   1010 O O   . ASN A 1 131 ? -35.954 91.454  42.733 1.00 43.18  ? 131  ASN A O   1 
ATOM   1011 C CB  . ASN A 1 131 ? -35.574 92.400  45.451 1.00 43.43  ? 131  ASN A CB  1 
ATOM   1012 C CG  . ASN A 1 131 ? -35.826 91.291  46.454 1.00 45.98  ? 131  ASN A CG  1 
ATOM   1013 O OD1 . ASN A 1 131 ? -35.886 90.110  46.095 1.00 46.64  ? 131  ASN A OD1 1 
ATOM   1014 N ND2 . ASN A 1 131 ? -35.976 91.663  47.719 1.00 46.72  ? 131  ASN A ND2 1 
ATOM   1015 N N   . GLY A 1 132 ? -34.357 89.971  43.256 1.00 42.65  ? 132  GLY A N   1 
ATOM   1016 C CA  . GLY A 1 132 ? -34.778 89.050  42.218 1.00 43.80  ? 132  GLY A CA  1 
ATOM   1017 C C   . GLY A 1 132 ? -35.960 88.144  42.479 1.00 43.74  ? 132  GLY A C   1 
ATOM   1018 O O   . GLY A 1 132 ? -36.334 87.374  41.599 1.00 43.56  ? 132  GLY A O   1 
ATOM   1019 N N   . LYS A 1 133 ? -36.563 88.235  43.660 1.00 44.35  ? 133  LYS A N   1 
ATOM   1020 C CA  . LYS A 1 133 ? -37.691 87.367  43.985 1.00 45.05  ? 133  LYS A CA  1 
ATOM   1021 C C   . LYS A 1 133 ? -38.915 87.482  43.070 1.00 43.92  ? 133  LYS A C   1 
ATOM   1022 O O   . LYS A 1 133 ? -39.596 86.489  42.818 1.00 42.97  ? 133  LYS A O   1 
ATOM   1023 C CB  . LYS A 1 133 ? -38.125 87.574  45.442 1.00 46.81  ? 133  LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 133 ? -38.827 88.896  45.736 1.00 48.39  ? 133  LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 133 ? -39.262 88.965  47.200 1.00 49.31  ? 133  LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 133 ? -39.894 90.310  47.546 1.00 50.29  ? 133  LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 133 ? -40.231 90.419  48.997 1.00 49.23  ? 133  LYS A NZ  1 
ATOM   1028 N N   . TYR A 1 134 ? -39.197 88.676  42.567 1.00 42.82  ? 134  TYR A N   1 
ATOM   1029 C CA  . TYR A 1 134 ? -40.363 88.854  41.709 1.00 43.68  ? 134  TYR A CA  1 
ATOM   1030 C C   . TYR A 1 134 ? -40.183 88.213  40.343 1.00 44.46  ? 134  TYR A C   1 
ATOM   1031 O O   . TYR A 1 134 ? -41.056 87.487  39.864 1.00 44.15  ? 134  TYR A O   1 
ATOM   1032 C CB  . TYR A 1 134 ? -40.662 90.337  41.529 1.00 44.05  ? 134  TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 134 ? -40.811 91.089  42.826 1.00 45.76  ? 134  TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 134 ? -42.000 91.035  43.557 1.00 46.68  ? 134  TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 134 ? -39.756 91.854  43.333 1.00 45.28  ? 134  TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 134 ? -42.133 91.731  44.765 1.00 47.33  ? 134  TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 134 ? -39.878 92.547  44.534 1.00 45.43  ? 134  TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 134 ? -41.065 92.482  45.242 1.00 45.81  ? 134  TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 134 ? -41.181 93.161  46.426 1.00 44.61  ? 134  TYR A OH  1 
ATOM   1040 N N   . LEU A 1 135 ? -39.046 88.490  39.717 1.00 45.28  ? 135  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 135 ? -38.745 87.952  38.398 1.00 46.76  ? 135  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 135 ? -38.651 86.434  38.462 1.00 47.35  ? 135  LEU A C   1 
ATOM   1043 O O   . LEU A 1 135 ? -39.278 85.729  37.669 1.00 48.40  ? 135  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 135 ? -37.427 88.539  37.887 1.00 47.02  ? 135  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 135 ? -37.063 88.313  36.422 1.00 45.22  ? 135  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 135 ? -38.170 88.839  35.537 1.00 43.24  ? 135  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 135 ? -35.752 89.009  36.112 1.00 44.43  ? 135  LEU A CD2 1 
ATOM   1048 N N   . ALA A 1 136 ? -37.865 85.940  39.413 1.00 47.92  ? 136  ALA A N   1 
ATOM   1049 C CA  . ALA A 1 136 ? -37.690 84.501  39.598 1.00 49.27  ? 136  ALA A CA  1 
ATOM   1050 C C   . ALA A 1 136 ? -39.035 83.840  39.869 1.00 49.86  ? 136  ALA A C   1 
ATOM   1051 O O   . ALA A 1 136 ? -39.290 82.724  39.420 1.00 48.89  ? 136  ALA A O   1 
ATOM   1052 C CB  . ALA A 1 136 ? -36.740 84.229  40.764 1.00 48.80  ? 136  ALA A CB  1 
ATOM   1053 N N   . TYR A 1 137 ? -39.888 84.539  40.610 1.00 50.97  ? 137  TYR A N   1 
ATOM   1054 C CA  . TYR A 1 137 ? -41.202 84.021  40.948 1.00 51.49  ? 137  TYR A CA  1 
ATOM   1055 C C   . TYR A 1 137 ? -42.154 84.072  39.770 1.00 51.03  ? 137  TYR A C   1 
ATOM   1056 O O   . TYR A 1 137 ? -42.642 83.040  39.320 1.00 52.34  ? 137  TYR A O   1 
ATOM   1057 C CB  . TYR A 1 137 ? -41.811 84.814  42.107 1.00 54.08  ? 137  TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 137 ? -43.267 84.486  42.354 1.00 55.66  ? 137  TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 137 ? -43.643 83.283  42.959 1.00 56.63  ? 137  TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 137 ? -44.272 85.357  41.938 1.00 55.54  ? 137  TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 137 ? -44.986 82.957  43.141 1.00 56.83  ? 137  TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 137 ? -45.615 85.042  42.112 1.00 57.79  ? 137  TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 137 ? -45.968 83.842  42.713 1.00 57.86  ? 137  TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 137 ? -47.301 83.538  42.885 1.00 57.20  ? 137  TYR A OH  1 
ATOM   1065 N N   . THR A 1 138 ? -42.416 85.277  39.276 1.00 50.32  ? 138  THR A N   1 
ATOM   1066 C CA  . THR A 1 138 ? -43.343 85.466  38.167 1.00 49.74  ? 138  THR A CA  1 
ATOM   1067 C C   . THR A 1 138 ? -42.970 84.725  36.889 1.00 49.62  ? 138  THR A C   1 
ATOM   1068 O O   . THR A 1 138 ? -43.842 84.184  36.205 1.00 49.80  ? 138  THR A O   1 
ATOM   1069 C CB  . THR A 1 138 ? -43.503 86.961  37.815 1.00 50.20  ? 138  THR A CB  1 
ATOM   1070 O OG1 . THR A 1 138 ? -43.804 87.714  38.998 1.00 50.54  ? 138  THR A OG1 1 
ATOM   1071 C CG2 . THR A 1 138 ? -44.634 87.146  36.818 1.00 49.87  ? 138  THR A CG2 1 
ATOM   1072 N N   . GLU A 1 139 ? -41.684 84.691  36.563 1.00 49.19  ? 139  GLU A N   1 
ATOM   1073 C CA  . GLU A 1 139 ? -41.251 84.028  35.342 1.00 50.09  ? 139  GLU A CA  1 
ATOM   1074 C C   . GLU A 1 139 ? -40.659 82.649  35.577 1.00 51.20  ? 139  GLU A C   1 
ATOM   1075 O O   . GLU A 1 139 ? -40.162 82.009  34.645 1.00 50.58  ? 139  GLU A O   1 
ATOM   1076 C CB  . GLU A 1 139 ? -40.245 84.908  34.600 1.00 49.38  ? 139  GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 139 ? -40.824 86.222  34.096 1.00 47.96  ? 139  GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 139 ? -41.974 86.029  33.121 1.00 48.21  ? 139  GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 139 ? -41.819 85.247  32.158 1.00 48.80  ? 139  GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 139 ? -43.032 86.666  33.310 1.00 46.60  ? 139  GLU A OE2 1 
ATOM   1081 N N   . GLU A 1 140 ? -40.721 82.197  36.826 1.00 52.33  ? 140  GLU A N   1 
ATOM   1082 C CA  . GLU A 1 140 ? -40.200 80.886  37.217 1.00 53.19  ? 140  GLU A CA  1 
ATOM   1083 C C   . GLU A 1 140 ? -38.825 80.604  36.621 1.00 50.60  ? 140  GLU A C   1 
ATOM   1084 O O   . GLU A 1 140 ? -38.674 79.763  35.737 1.00 50.85  ? 140  GLU A O   1 
ATOM   1085 C CB  . GLU A 1 140 ? -41.189 79.788  36.808 1.00 56.14  ? 140  GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 140 ? -42.586 79.996  37.379 1.00 60.56  ? 140  GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 140 ? -43.554 78.895  36.986 1.00 63.45  ? 140  GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 140 ? -43.321 77.733  37.386 1.00 64.71  ? 140  GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 140 ? -44.546 79.193  36.278 1.00 64.84  ? 140  GLU A OE2 1 
ATOM   1090 N N   . VAL A 1 141 ? -37.827 81.319  37.123 1.00 47.86  ? 141  VAL A N   1 
ATOM   1091 C CA  . VAL A 1 141 ? -36.460 81.172  36.657 1.00 46.47  ? 141  VAL A CA  1 
ATOM   1092 C C   . VAL A 1 141 ? -35.519 81.230  37.856 1.00 46.11  ? 141  VAL A C   1 
ATOM   1093 O O   . VAL A 1 141 ? -35.909 81.655  38.941 1.00 46.59  ? 141  VAL A O   1 
ATOM   1094 C CB  . VAL A 1 141 ? -36.084 82.317  35.681 1.00 46.94  ? 141  VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 141 ? -37.044 82.337  34.502 1.00 45.97  ? 141  VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 141 ? -36.124 83.659  36.405 1.00 44.94  ? 141  VAL A CG2 1 
ATOM   1097 N N   . VAL A 1 142 ? -34.282 80.794  37.670 1.00 44.26  ? 142  VAL A N   1 
ATOM   1098 C CA  . VAL A 1 142 ? -33.318 80.852  38.752 1.00 43.21  ? 142  VAL A CA  1 
ATOM   1099 C C   . VAL A 1 142 ? -32.521 82.148  38.569 1.00 43.82  ? 142  VAL A C   1 
ATOM   1100 O O   . VAL A 1 142 ? -31.559 82.195  37.797 1.00 45.05  ? 142  VAL A O   1 
ATOM   1101 C CB  . VAL A 1 142 ? -32.369 79.638  38.721 1.00 43.29  ? 142  VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 142 ? -31.285 79.787  39.780 1.00 39.93  ? 142  VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 142 ? -33.165 78.364  38.956 1.00 42.15  ? 142  VAL A CG2 1 
ATOM   1104 N N   . LEU A 1 143 ? -32.946 83.197  39.273 1.00 41.31  ? 143  LEU A N   1 
ATOM   1105 C CA  . LEU A 1 143 ? -32.309 84.508  39.206 1.00 37.98  ? 143  LEU A CA  1 
ATOM   1106 C C   . LEU A 1 143 ? -31.101 84.576  40.138 1.00 36.68  ? 143  LEU A C   1 
ATOM   1107 O O   . LEU A 1 143 ? -31.217 84.337  41.340 1.00 36.84  ? 143  LEU A O   1 
ATOM   1108 C CB  . LEU A 1 143 ? -33.320 85.590  39.599 1.00 38.20  ? 143  LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 143 ? -33.100 87.058  39.194 1.00 38.74  ? 143  LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 143 ? -31.761 87.550  39.702 1.00 37.30  ? 143  LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 143 ? -33.183 87.194  37.679 1.00 38.52  ? 143  LEU A CD2 1 
ATOM   1112 N N   . VAL A 1 144 ? -29.944 84.910  39.577 1.00 35.12  ? 144  VAL A N   1 
ATOM   1113 C CA  . VAL A 1 144 ? -28.712 85.027  40.352 1.00 33.42  ? 144  VAL A CA  1 
ATOM   1114 C C   . VAL A 1 144 ? -28.181 86.451  40.267 1.00 33.37  ? 144  VAL A C   1 
ATOM   1115 O O   . VAL A 1 144 ? -28.279 87.088  39.219 1.00 34.53  ? 144  VAL A O   1 
ATOM   1116 C CB  . VAL A 1 144 ? -27.612 84.106  39.798 1.00 33.21  ? 144  VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 144 ? -26.326 84.270  40.608 1.00 30.51  ? 144  VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 144 ? -28.086 82.667  39.813 1.00 35.07  ? 144  VAL A CG2 1 
ATOM   1119 N N   . SER A 1 145 ? -27.635 86.954  41.368 1.00 31.53  ? 145  SER A N   1 
ATOM   1120 C CA  . SER A 1 145 ? -27.052 88.286  41.373 1.00 29.97  ? 145  SER A CA  1 
ATOM   1121 C C   . SER A 1 145 ? -25.646 88.181  41.940 1.00 31.14  ? 145  SER A C   1 
ATOM   1122 O O   . SER A 1 145 ? -25.454 87.838  43.110 1.00 29.60  ? 145  SER A O   1 
ATOM   1123 C CB  . SER A 1 145 ? -27.899 89.266  42.190 1.00 28.18  ? 145  SER A CB  1 
ATOM   1124 O OG  . SER A 1 145 ? -28.095 88.828  43.516 1.00 27.77  ? 145  SER A OG  1 
ATOM   1125 N N   . LEU A 1 146 ? -24.658 88.452  41.093 1.00 32.03  ? 146  LEU A N   1 
ATOM   1126 C CA  . LEU A 1 146 ? -23.263 88.383  41.507 1.00 32.65  ? 146  LEU A CA  1 
ATOM   1127 C C   . LEU A 1 146 ? -22.752 89.743  41.964 1.00 33.17  ? 146  LEU A C   1 
ATOM   1128 O O   . LEU A 1 146 ? -23.490 90.729  41.982 1.00 32.17  ? 146  LEU A O   1 
ATOM   1129 C CB  . LEU A 1 146 ? -22.397 87.875  40.352 1.00 33.57  ? 146  LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 146 ? -22.303 88.737  39.084 1.00 35.81  ? 146  LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 146 ? -21.406 89.947  39.343 1.00 38.19  ? 146  LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 146 ? -21.717 87.920  37.942 1.00 36.18  ? 146  LEU A CD2 1 
ATOM   1133 N N   . SER A 1 147 ? -21.471 89.778  42.319 1.00 33.52  ? 147  SER A N   1 
ATOM   1134 C CA  . SER A 1 147 ? -20.814 90.995  42.763 1.00 33.00  ? 147  SER A CA  1 
ATOM   1135 C C   . SER A 1 147 ? -19.368 90.936  42.303 1.00 32.94  ? 147  SER A C   1 
ATOM   1136 O O   . SER A 1 147 ? -18.831 89.861  42.057 1.00 34.86  ? 147  SER A O   1 
ATOM   1137 C CB  . SER A 1 147 ? -20.843 91.091  44.280 1.00 34.82  ? 147  SER A CB  1 
ATOM   1138 O OG  . SER A 1 147 ? -20.069 90.050  44.854 1.00 38.15  ? 147  SER A OG  1 
ATOM   1139 N N   . TYR A 1 148 ? -18.731 92.093  42.207 1.00 32.05  ? 148  TYR A N   1 
ATOM   1140 C CA  . TYR A 1 148 ? -17.350 92.165  41.769 1.00 29.48  ? 148  TYR A CA  1 
ATOM   1141 C C   . TYR A 1 148 ? -16.702 93.399  42.365 1.00 29.31  ? 148  TYR A C   1 
ATOM   1142 O O   . TYR A 1 148 ? -17.386 94.366  42.711 1.00 27.99  ? 148  TYR A O   1 
ATOM   1143 C CB  . TYR A 1 148 ? -17.290 92.251  40.245 1.00 29.74  ? 148  TYR A CB  1 
ATOM   1144 C CG  . TYR A 1 148 ? -18.126 93.376  39.672 1.00 31.16  ? 148  TYR A CG  1 
ATOM   1145 C CD1 . TYR A 1 148 ? -19.475 93.177  39.356 1.00 30.84  ? 148  TYR A CD1 1 
ATOM   1146 C CD2 . TYR A 1 148 ? -17.574 94.647  39.452 1.00 30.38  ? 148  TYR A CD2 1 
ATOM   1147 C CE1 . TYR A 1 148 ? -20.255 94.212  38.830 1.00 30.20  ? 148  TYR A CE1 1 
ATOM   1148 C CE2 . TYR A 1 148 ? -18.349 95.693  38.930 1.00 30.49  ? 148  TYR A CE2 1 
ATOM   1149 C CZ  . TYR A 1 148 ? -19.685 95.464  38.621 1.00 30.90  ? 148  TYR A CZ  1 
ATOM   1150 O OH  . TYR A 1 148 ? -20.455 96.476  38.106 1.00 30.35  ? 148  TYR A OH  1 
ATOM   1151 N N   . ARG A 1 149 ? -15.381 93.367  42.477 1.00 28.36  ? 149  ARG A N   1 
ATOM   1152 C CA  . ARG A 1 149 ? -14.648 94.492  43.027 1.00 29.83  ? 149  ARG A CA  1 
ATOM   1153 C C   . ARG A 1 149 ? -14.770 95.728  42.130 1.00 30.01  ? 149  ARG A C   1 
ATOM   1154 O O   . ARG A 1 149 ? -14.878 95.611  40.914 1.00 30.61  ? 149  ARG A O   1 
ATOM   1155 C CB  . ARG A 1 149 ? -13.185 94.107  43.214 1.00 30.83  ? 149  ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 149 ? -12.921 93.369  44.509 1.00 32.24  ? 149  ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 149 ? -11.540 92.753  44.501 1.00 32.05  ? 149  ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 149 ? -11.466 91.622  43.582 1.00 31.18  ? 149  ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 149 ? -10.335 91.006  43.262 1.00 31.02  ? 149  ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 149 ? -9.193  91.426  43.791 1.00 30.32  ? 149  ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 149 ? -10.344 89.978  42.417 1.00 26.90  ? 149  ARG A NH2 1 
ATOM   1162 N N   . VAL A 1 150 ? -14.766 96.908  42.746 1.00 28.23  ? 150  VAL A N   1 
ATOM   1163 C CA  . VAL A 1 150 ? -14.886 98.163  42.019 1.00 27.71  ? 150  VAL A CA  1 
ATOM   1164 C C   . VAL A 1 150 ? -13.824 99.156  42.494 1.00 28.42  ? 150  VAL A C   1 
ATOM   1165 O O   . VAL A 1 150 ? -13.165 98.934  43.517 1.00 30.28  ? 150  VAL A O   1 
ATOM   1166 C CB  . VAL A 1 150 ? -16.301 98.785  42.205 1.00 27.33  ? 150  VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 150 ? -17.360 97.857  41.624 1.00 25.17  ? 150  VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 150 ? -16.580 99.030  43.680 1.00 26.81  ? 150  VAL A CG2 1 
ATOM   1169 N N   . GLY A 1 151 ? -13.659 100.249 41.753 1.00 26.88  ? 151  GLY A N   1 
ATOM   1170 C CA  . GLY A 1 151 ? -12.664 101.235 42.121 1.00 23.97  ? 151  GLY A CA  1 
ATOM   1171 C C   . GLY A 1 151 ? -11.283 100.626 42.033 1.00 23.05  ? 151  GLY A C   1 
ATOM   1172 O O   . GLY A 1 151 ? -11.105 99.575  41.435 1.00 23.88  ? 151  GLY A O   1 
ATOM   1173 N N   . ALA A 1 152 ? -10.297 101.277 42.628 1.00 23.97  ? 152  ALA A N   1 
ATOM   1174 C CA  . ALA A 1 152 ? -8.944  100.761 42.589 1.00 25.24  ? 152  ALA A CA  1 
ATOM   1175 C C   . ALA A 1 152 ? -8.955  99.260  42.883 1.00 27.36  ? 152  ALA A C   1 
ATOM   1176 O O   . ALA A 1 152 ? -8.332  98.470  42.177 1.00 25.82  ? 152  ALA A O   1 
ATOM   1177 C CB  . ALA A 1 152 ? -8.089  101.490 43.605 1.00 25.12  ? 152  ALA A CB  1 
ATOM   1178 N N   . PHE A 1 153 ? -9.684  98.883  43.927 1.00 28.04  ? 153  PHE A N   1 
ATOM   1179 C CA  . PHE A 1 153 ? -9.798  97.493  44.352 1.00 28.98  ? 153  PHE A CA  1 
ATOM   1180 C C   . PHE A 1 153 ? -10.094 96.534  43.206 1.00 27.91  ? 153  PHE A C   1 
ATOM   1181 O O   . PHE A 1 153 ? -9.539  95.439  43.141 1.00 28.34  ? 153  PHE A O   1 
ATOM   1182 C CB  . PHE A 1 153 ? -10.912 97.360  45.395 1.00 31.38  ? 153  PHE A CB  1 
ATOM   1183 C CG  . PHE A 1 153 ? -10.857 98.401  46.479 1.00 33.95  ? 153  PHE A CG  1 
ATOM   1184 C CD1 . PHE A 1 153 ? -9.850  98.376  47.444 1.00 33.61  ? 153  PHE A CD1 1 
ATOM   1185 C CD2 . PHE A 1 153 ? -11.803 99.421  46.526 1.00 35.17  ? 153  PHE A CD2 1 
ATOM   1186 C CE1 . PHE A 1 153 ? -9.784  99.350  48.441 1.00 32.85  ? 153  PHE A CE1 1 
ATOM   1187 C CE2 . PHE A 1 153 ? -11.744 100.400 47.521 1.00 36.93  ? 153  PHE A CE2 1 
ATOM   1188 C CZ  . PHE A 1 153 ? -10.729 100.361 48.480 1.00 35.28  ? 153  PHE A CZ  1 
ATOM   1189 N N   . GLY A 1 154 ? -10.973 96.939  42.303 1.00 26.68  ? 154  GLY A N   1 
ATOM   1190 C CA  . GLY A 1 154 ? -11.327 96.058  41.209 1.00 27.05  ? 154  GLY A CA  1 
ATOM   1191 C C   . GLY A 1 154 ? -10.695 96.341  39.861 1.00 28.48  ? 154  GLY A C   1 
ATOM   1192 O O   . GLY A 1 154 ? -10.753 95.489  38.969 1.00 28.78  ? 154  GLY A O   1 
ATOM   1193 N N   . PHE A 1 155 ? -10.084 97.512  39.692 1.00 27.58  ? 155  PHE A N   1 
ATOM   1194 C CA  . PHE A 1 155 ? -9.495  97.823  38.403 1.00 27.13  ? 155  PHE A CA  1 
ATOM   1195 C C   . PHE A 1 155 ? -8.172  98.582  38.366 1.00 27.58  ? 155  PHE A C   1 
ATOM   1196 O O   . PHE A 1 155 ? -7.788  99.103  37.319 1.00 27.39  ? 155  PHE A O   1 
ATOM   1197 C CB  . PHE A 1 155 ? -10.540 98.537  37.550 1.00 26.13  ? 155  PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 155 ? -11.737 97.692  37.259 1.00 24.94  ? 155  PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 155 ? -11.650 96.632  36.370 1.00 25.16  ? 155  PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 155 ? -12.931 97.898  37.935 1.00 25.12  ? 155  PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 155 ? -12.738 95.783  36.162 1.00 26.06  ? 155  PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 155 ? -14.021 97.057  37.734 1.00 25.69  ? 155  PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 155 ? -13.924 95.995  36.847 1.00 24.58  ? 155  PHE A CZ  1 
ATOM   1204 N N   . LEU A 1 156 ? -7.469  98.652  39.490 1.00 28.68  ? 156  LEU A N   1 
ATOM   1205 C CA  . LEU A 1 156 ? -6.169  99.320  39.503 1.00 30.22  ? 156  LEU A CA  1 
ATOM   1206 C C   . LEU A 1 156 ? -5.332  98.571  38.466 1.00 30.53  ? 156  LEU A C   1 
ATOM   1207 O O   . LEU A 1 156 ? -5.298  97.342  38.465 1.00 30.60  ? 156  LEU A O   1 
ATOM   1208 C CB  . LEU A 1 156 ? -5.519  99.202  40.879 1.00 31.28  ? 156  LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 156 ? -4.151  99.864  40.968 1.00 33.28  ? 156  LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 156 ? -4.295  101.334 40.630 1.00 35.07  ? 156  LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 156 ? -3.570  99.690  42.357 1.00 33.20  ? 156  LEU A CD2 1 
ATOM   1212 N N   . ALA A 1 157 ? -4.654  99.285  37.579 1.00 31.16  ? 157  ALA A N   1 
ATOM   1213 C CA  . ALA A 1 157 ? -3.902  98.578  36.563 1.00 32.28  ? 157  ALA A CA  1 
ATOM   1214 C C   . ALA A 1 157 ? -2.458  98.989  36.318 1.00 34.13  ? 157  ALA A C   1 
ATOM   1215 O O   . ALA A 1 157 ? -2.177  100.042 35.749 1.00 35.43  ? 157  ALA A O   1 
ATOM   1216 C CB  . ALA A 1 157 ? -4.672  98.619  35.255 1.00 31.67  ? 157  ALA A CB  1 
ATOM   1217 N N   . LEU A 1 158 ? -1.542  98.132  36.748 1.00 35.48  ? 158  LEU A N   1 
ATOM   1218 C CA  . LEU A 1 158 ? -0.120  98.347  36.528 1.00 36.61  ? 158  LEU A CA  1 
ATOM   1219 C C   . LEU A 1 158 ? 0.288   97.210  35.594 1.00 37.41  ? 158  LEU A C   1 
ATOM   1220 O O   . LEU A 1 158 ? 0.924   96.239  36.008 1.00 37.72  ? 158  LEU A O   1 
ATOM   1221 C CB  . LEU A 1 158 ? 0.645   98.277  37.851 1.00 35.19  ? 158  LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 158 ? 0.424   99.504  38.734 1.00 33.46  ? 158  LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 158 ? 1.082   99.287  40.057 1.00 33.58  ? 158  LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 158 ? 0.983   100.745 38.054 1.00 32.16  ? 158  LEU A CD2 1 
ATOM   1225 N N   . HIS A 1 159 ? -0.109  97.336  34.330 1.00 38.20  ? 159  HIS A N   1 
ATOM   1226 C CA  . HIS A 1 159 ? 0.168   96.314  33.336 1.00 39.13  ? 159  HIS A CA  1 
ATOM   1227 C C   . HIS A 1 159 ? 1.620   95.892  33.304 1.00 40.43  ? 159  HIS A C   1 
ATOM   1228 O O   . HIS A 1 159 ? 2.511   96.689  33.015 1.00 40.01  ? 159  HIS A O   1 
ATOM   1229 C CB  . HIS A 1 159 ? -0.248  96.776  31.949 1.00 37.74  ? 159  HIS A CB  1 
ATOM   1230 C CG  . HIS A 1 159 ? -0.218  95.683  30.932 1.00 37.07  ? 159  HIS A CG  1 
ATOM   1231 N ND1 . HIS A 1 159 ? -0.966  94.531  31.061 1.00 34.62  ? 159  HIS A ND1 1 
ATOM   1232 C CD2 . HIS A 1 159 ? 0.480   95.553  29.779 1.00 36.67  ? 159  HIS A CD2 1 
ATOM   1233 C CE1 . HIS A 1 159 ? -0.730  93.740  30.031 1.00 34.25  ? 159  HIS A CE1 1 
ATOM   1234 N NE2 . HIS A 1 159 ? 0.144   94.336  29.238 1.00 34.88  ? 159  HIS A NE2 1 
ATOM   1235 N N   . GLY A 1 160 ? 1.833   94.611  33.582 1.00 42.30  ? 160  GLY A N   1 
ATOM   1236 C CA  . GLY A 1 160 ? 3.168   94.055  33.625 1.00 44.58  ? 160  GLY A CA  1 
ATOM   1237 C C   . GLY A 1 160 ? 3.231   93.272  34.917 1.00 45.93  ? 160  GLY A C   1 
ATOM   1238 O O   . GLY A 1 160 ? 3.658   92.115  34.953 1.00 46.88  ? 160  GLY A O   1 
ATOM   1239 N N   . SER A 1 161 ? 2.787   93.914  35.991 1.00 46.05  ? 161  SER A N   1 
ATOM   1240 C CA  . SER A 1 161 ? 2.764   93.271  37.289 1.00 46.45  ? 161  SER A CA  1 
ATOM   1241 C C   . SER A 1 161 ? 1.779   92.110  37.278 1.00 45.46  ? 161  SER A C   1 
ATOM   1242 O O   . SER A 1 161 ? 0.937   91.995  36.386 1.00 45.23  ? 161  SER A O   1 
ATOM   1243 C CB  . SER A 1 161 ? 2.344   94.262  38.370 1.00 46.48  ? 161  SER A CB  1 
ATOM   1244 O OG  . SER A 1 161 ? 2.095   93.577  39.590 1.00 50.19  ? 161  SER A OG  1 
ATOM   1245 N N   . GLN A 1 162 ? 1.901   91.245  38.274 1.00 45.35  ? 162  GLN A N   1 
ATOM   1246 C CA  . GLN A 1 162 ? 1.008   90.109  38.420 1.00 45.61  ? 162  GLN A CA  1 
ATOM   1247 C C   . GLN A 1 162 ? 0.233   90.358  39.696 1.00 44.14  ? 162  GLN A C   1 
ATOM   1248 O O   . GLN A 1 162 ? -0.726  89.655  40.017 1.00 43.07  ? 162  GLN A O   1 
ATOM   1249 C CB  . GLN A 1 162 ? 1.801   88.806  38.524 1.00 47.05  ? 162  GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 162 ? 2.260   88.267  37.181 1.00 48.75  ? 162  GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 162 ? 1.098   88.077  36.225 1.00 50.43  ? 162  GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 162 ? 0.075   87.496  36.588 1.00 52.95  ? 162  GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 162 ? 1.248   88.567  34.999 1.00 50.94  ? 162  GLN A NE2 1 
ATOM   1254 N N   . GLU A 1 163 ? 0.665   91.387  40.417 1.00 42.75  ? 163  GLU A N   1 
ATOM   1255 C CA  . GLU A 1 163 ? 0.028   91.768  41.664 1.00 42.21  ? 163  GLU A CA  1 
ATOM   1256 C C   . GLU A 1 163 ? -1.204  92.645  41.407 1.00 41.38  ? 163  GLU A C   1 
ATOM   1257 O O   . GLU A 1 163 ? -2.248  92.454  42.031 1.00 41.96  ? 163  GLU A O   1 
ATOM   1258 C CB  . GLU A 1 163 ? 1.047   92.486  42.551 1.00 42.68  ? 163  GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 163 ? 2.199   91.583  42.994 1.00 40.39  ? 163  GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 163 ? 1.702   90.281  43.597 1.00 39.73  ? 163  GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 163 ? 0.867   90.347  44.516 1.00 39.04  ? 163  GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 163 ? 2.136   89.196  43.156 1.00 39.47  ? 163  GLU A OE2 1 
ATOM   1263 N N   . ALA A 1 164 ? -1.080  93.591  40.478 1.00 39.88  ? 164  ALA A N   1 
ATOM   1264 C CA  . ALA A 1 164 ? -2.179  94.490  40.109 1.00 37.95  ? 164  ALA A CA  1 
ATOM   1265 C C   . ALA A 1 164 ? -2.288  94.540  38.580 1.00 36.72  ? 164  ALA A C   1 
ATOM   1266 O O   . ALA A 1 164 ? -2.070  95.588  37.962 1.00 37.43  ? 164  ALA A O   1 
ATOM   1267 C CB  . ALA A 1 164 ? -1.919  95.890  40.662 1.00 37.74  ? 164  ALA A CB  1 
ATOM   1268 N N   . PRO A 1 165 ? -2.645  93.404  37.954 1.00 34.83  ? 165  PRO A N   1 
ATOM   1269 C CA  . PRO A 1 165 ? -2.787  93.265  36.500 1.00 32.81  ? 165  PRO A CA  1 
ATOM   1270 C C   . PRO A 1 165 ? -3.947  94.038  35.867 1.00 32.30  ? 165  PRO A C   1 
ATOM   1271 O O   . PRO A 1 165 ? -3.957  94.270  34.655 1.00 30.52  ? 165  PRO A O   1 
ATOM   1272 C CB  . PRO A 1 165 ? -2.949  91.761  36.329 1.00 32.08  ? 165  PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 165 ? -3.773  91.402  37.529 1.00 30.72  ? 165  PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 165 ? -3.094  92.175  38.640 1.00 31.93  ? 165  PRO A CD  1 
ATOM   1275 N N   . GLY A 1 166 ? -4.918  94.433  36.686 1.00 30.56  ? 166  GLY A N   1 
ATOM   1276 C CA  . GLY A 1 166 ? -6.071  95.146  36.168 1.00 31.24  ? 166  GLY A CA  1 
ATOM   1277 C C   . GLY A 1 166 ? -7.168  94.166  35.786 1.00 30.50  ? 166  GLY A C   1 
ATOM   1278 O O   . GLY A 1 166 ? -6.931  92.961  35.732 1.00 31.22  ? 166  GLY A O   1 
ATOM   1279 N N   . ASN A 1 167 ? -8.365  94.679  35.519 1.00 29.66  ? 167  ASN A N   1 
ATOM   1280 C CA  . ASN A 1 167 ? -9.511  93.850  35.149 1.00 30.47  ? 167  ASN A CA  1 
ATOM   1281 C C   . ASN A 1 167 ? -9.890  92.755  36.148 1.00 30.46  ? 167  ASN A C   1 
ATOM   1282 O O   . ASN A 1 167 ? -10.725 91.895  35.845 1.00 29.04  ? 167  ASN A O   1 
ATOM   1283 C CB  . ASN A 1 167 ? -9.288  93.206  33.781 1.00 32.33  ? 167  ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 167 ? -9.208  94.222  32.676 1.00 34.86  ? 167  ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 167 ? -9.930  95.214  32.690 1.00 38.10  ? 167  ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 167 ? -8.340  93.980  31.702 1.00 34.42  ? 167  ASN A ND2 1 
ATOM   1287 N N   . VAL A 1 168 ? -9.297  92.778  37.338 1.00 30.72  ? 168  VAL A N   1 
ATOM   1288 C CA  . VAL A 1 168 ? -9.617  91.749  38.318 1.00 31.96  ? 168  VAL A CA  1 
ATOM   1289 C C   . VAL A 1 168 ? -11.118 91.745  38.567 1.00 32.33  ? 168  VAL A C   1 
ATOM   1290 O O   . VAL A 1 168 ? -11.744 90.682  38.601 1.00 32.98  ? 168  VAL A O   1 
ATOM   1291 C CB  . VAL A 1 168 ? -8.846  91.958  39.645 1.00 32.02  ? 168  VAL A CB  1 
ATOM   1292 C CG1 . VAL A 1 168 ? -7.348  91.946  39.368 1.00 31.49  ? 168  VAL A CG1 1 
ATOM   1293 C CG2 . VAL A 1 168 ? -9.251  93.260  40.303 1.00 32.39  ? 168  VAL A CG2 1 
ATOM   1294 N N   . GLY A 1 169 ? -11.693 92.935  38.710 1.00 32.27  ? 169  GLY A N   1 
ATOM   1295 C CA  . GLY A 1 169 ? -13.123 93.045  38.934 1.00 31.76  ? 169  GLY A CA  1 
ATOM   1296 C C   . GLY A 1 169 ? -13.921 92.247  37.917 1.00 31.70  ? 169  GLY A C   1 
ATOM   1297 O O   . GLY A 1 169 ? -14.915 91.610  38.268 1.00 31.80  ? 169  GLY A O   1 
ATOM   1298 N N   . LEU A 1 170 ? -13.498 92.278  36.654 1.00 31.97  ? 170  LEU A N   1 
ATOM   1299 C CA  . LEU A 1 170 ? -14.198 91.528  35.612 1.00 32.55  ? 170  LEU A CA  1 
ATOM   1300 C C   . LEU A 1 170 ? -13.966 90.047  35.847 1.00 33.78  ? 170  LEU A C   1 
ATOM   1301 O O   . LEU A 1 170 ? -14.875 89.232  35.658 1.00 32.93  ? 170  LEU A O   1 
ATOM   1302 C CB  . LEU A 1 170 ? -13.702 91.914  34.217 1.00 31.38  ? 170  LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 170 ? -14.266 93.202  33.611 1.00 31.53  ? 170  LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 170 ? -13.557 93.512  32.302 1.00 30.32  ? 170  LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 170 ? -15.765 93.047  33.385 1.00 30.20  ? 170  LEU A CD2 1 
ATOM   1306 N N   . LEU A 1 171 ? -12.746 89.705  36.265 1.00 33.57  ? 171  LEU A N   1 
ATOM   1307 C CA  . LEU A 1 171 ? -12.413 88.316  36.554 1.00 33.21  ? 171  LEU A CA  1 
ATOM   1308 C C   . LEU A 1 171 ? -13.306 87.830  37.693 1.00 34.01  ? 171  LEU A C   1 
ATOM   1309 O O   . LEU A 1 171 ? -13.712 86.667  37.713 1.00 33.82  ? 171  LEU A O   1 
ATOM   1310 C CB  . LEU A 1 171 ? -10.934 88.176  36.929 1.00 32.54  ? 171  LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 171 ? -9.938  88.356  35.768 1.00 31.01  ? 171  LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 171 ? -8.523  88.267  36.287 1.00 31.17  ? 171  LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 171 ? -10.163 87.294  34.708 1.00 28.17  ? 171  LEU A CD2 1 
ATOM   1314 N N   . ASP A 1 172 ? -13.620 88.724  38.633 1.00 35.00  ? 172  ASP A N   1 
ATOM   1315 C CA  . ASP A 1 172 ? -14.506 88.366  39.747 1.00 34.68  ? 172  ASP A CA  1 
ATOM   1316 C C   . ASP A 1 172 ? -15.828 87.904  39.152 1.00 34.83  ? 172  ASP A C   1 
ATOM   1317 O O   . ASP A 1 172 ? -16.376 86.881  39.557 1.00 36.46  ? 172  ASP A O   1 
ATOM   1318 C CB  . ASP A 1 172 ? -14.783 89.562  40.667 1.00 32.09  ? 172  ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 172 ? -13.602 89.929  41.537 1.00 33.08  ? 172  ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 172 ? -12.555 89.255  41.457 1.00 33.36  ? 172  ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 172 ? -13.724 90.904  42.312 1.00 33.77  ? 172  ASP A OD2 1 
ATOM   1322 N N   . GLN A 1 173 ? -16.335 88.662  38.184 1.00 34.22  ? 173  GLN A N   1 
ATOM   1323 C CA  . GLN A 1 173 ? -17.602 88.312  37.551 1.00 34.97  ? 173  GLN A CA  1 
ATOM   1324 C C   . GLN A 1 173 ? -17.482 86.975  36.831 1.00 35.06  ? 173  GLN A C   1 
ATOM   1325 O O   . GLN A 1 173 ? -18.413 86.171  36.829 1.00 35.07  ? 173  GLN A O   1 
ATOM   1326 C CB  . GLN A 1 173 ? -18.015 89.377  36.540 1.00 33.50  ? 173  GLN A CB  1 
ATOM   1327 C CG  . GLN A 1 173 ? -17.760 90.806  36.973 1.00 34.56  ? 173  GLN A CG  1 
ATOM   1328 C CD  . GLN A 1 173 ? -18.297 91.800  35.964 1.00 33.66  ? 173  GLN A CD  1 
ATOM   1329 O OE1 . GLN A 1 173 ? -18.147 91.618  34.757 1.00 33.96  ? 173  GLN A OE1 1 
ATOM   1330 N NE2 . GLN A 1 173 ? -18.921 92.858  36.451 1.00 35.24  ? 173  GLN A NE2 1 
ATOM   1331 N N   . ARG A 1 174 ? -16.329 86.750  36.211 1.00 35.61  ? 174  ARG A N   1 
ATOM   1332 C CA  . ARG A 1 174 ? -16.094 85.513  35.480 1.00 36.39  ? 174  ARG A CA  1 
ATOM   1333 C C   . ARG A 1 174 ? -16.138 84.326  36.428 1.00 35.76  ? 174  ARG A C   1 
ATOM   1334 O O   . ARG A 1 174 ? -16.761 83.315  36.123 1.00 34.31  ? 174  ARG A O   1 
ATOM   1335 C CB  . ARG A 1 174 ? -14.737 85.562  34.764 1.00 37.53  ? 174  ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 174 ? -14.389 84.309  33.960 1.00 36.18  ? 174  ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 174 ? -13.017 84.444  33.295 1.00 35.85  ? 174  ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 174 ? -13.043 85.331  32.134 1.00 36.52  ? 174  ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 174 ? -11.968 85.688  31.431 1.00 37.01  ? 174  ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 174 ? -10.760 85.242  31.763 1.00 35.75  ? 174  ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 174 ? -12.100 86.488  30.384 1.00 36.03  ? 174  ARG A NH2 1 
ATOM   1342 N N   . MET A 1 175 ? -15.501 84.457  37.586 1.00 35.69  ? 175  MET A N   1 
ATOM   1343 C CA  . MET A 1 175 ? -15.461 83.363  38.548 1.00 36.69  ? 175  MET A CA  1 
ATOM   1344 C C   . MET A 1 175 ? -16.847 83.073  39.111 1.00 36.86  ? 175  MET A C   1 
ATOM   1345 O O   . MET A 1 175 ? -17.132 81.923  39.474 1.00 37.12  ? 175  MET A O   1 
ATOM   1346 C CB  . MET A 1 175 ? -14.480 83.680  39.679 1.00 38.15  ? 175  MET A CB  1 
ATOM   1347 C CG  . MET A 1 175 ? -14.201 82.506  40.604 1.00 38.33  ? 175  MET A CG  1 
ATOM   1348 S SD  . MET A 1 175 ? -13.034 82.916  41.915 1.00 43.94  ? 175  MET A SD  1 
ATOM   1349 C CE  . MET A 1 175 ? -11.515 83.076  40.979 1.00 38.45  ? 175  MET A CE  1 
ATOM   1350 N N   . ALA A 1 176 ? -17.692 84.081  39.225 1.00 36.55  ? 176  ALA A N   1 
ATOM   1351 C CA  . ALA A 1 176 ? -19.037 83.850  39.730 1.00 36.87  ? 176  ALA A CA  1 
ATOM   1352 C C   . ALA A 1 176 ? -19.780 83.074  38.644 1.00 37.90  ? 176  ALA A C   1 
ATOM   1353 O O   . ALA A 1 176 ? -20.495 82.106  38.926 1.00 38.63  ? 176  ALA A O   1 
ATOM   1354 C CB  . ALA A 1 176 ? -19.732 85.167  40.006 1.00 35.77  ? 176  ALA A CB  1 
ATOM   1355 N N   . LEU A 1 177 ? -19.593 83.502  37.395 1.00 37.68  ? 177  LEU A N   1 
ATOM   1356 C CA  . LEU A 1 177 ? -20.233 82.853  36.257 1.00 37.46  ? 177  LEU A CA  1 
ATOM   1357 C C   . LEU A 1 177 ? -19.766 81.401  36.176 1.00 37.44  ? 177  LEU A C   1 
ATOM   1358 O O   . LEU A 1 177 ? -20.522 80.513  35.781 1.00 35.20  ? 177  LEU A O   1 
ATOM   1359 C CB  . LEU A 1 177 ? -19.876 83.588  34.963 1.00 36.68  ? 177  LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 177 ? -20.428 85.004  34.774 1.00 38.08  ? 177  LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 177 ? -19.733 85.641  33.581 1.00 36.20  ? 177  LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 177 ? -21.943 84.970  34.565 1.00 34.66  ? 177  LEU A CD2 1 
ATOM   1363 N N   . GLN A 1 178 ? -18.508 81.180  36.551 1.00 38.69  ? 178  GLN A N   1 
ATOM   1364 C CA  . GLN A 1 178 ? -17.918 79.848  36.541 1.00 40.25  ? 178  GLN A CA  1 
ATOM   1365 C C   . GLN A 1 178 ? -18.604 79.026  37.623 1.00 42.32  ? 178  GLN A C   1 
ATOM   1366 O O   . GLN A 1 178 ? -18.981 77.870  37.402 1.00 42.78  ? 178  GLN A O   1 
ATOM   1367 C CB  . GLN A 1 178 ? -16.416 79.923  36.827 1.00 39.22  ? 178  GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 178 ? -15.694 78.588  36.699 1.00 40.17  ? 178  GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 178 ? -15.788 78.012  35.295 1.00 41.14  ? 178  GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 178 ? -15.357 78.643  34.329 1.00 42.36  ? 178  GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 178 ? -16.355 76.812  35.173 1.00 39.86  ? 178  GLN A NE2 1 
ATOM   1372 N N   . TRP A 1 179 ? -18.767 79.636  38.795 1.00 42.25  ? 179  TRP A N   1 
ATOM   1373 C CA  . TRP A 1 179 ? -19.418 78.971  39.909 1.00 41.10  ? 179  TRP A CA  1 
ATOM   1374 C C   . TRP A 1 179 ? -20.825 78.597  39.467 1.00 42.22  ? 179  TRP A C   1 
ATOM   1375 O O   . TRP A 1 179 ? -21.212 77.430  39.528 1.00 44.14  ? 179  TRP A O   1 
ATOM   1376 C CB  . TRP A 1 179 ? -19.497 79.899  41.113 1.00 39.41  ? 179  TRP A CB  1 
ATOM   1377 C CG  . TRP A 1 179 ? -19.878 79.191  42.368 1.00 37.52  ? 179  TRP A CG  1 
ATOM   1378 C CD1 . TRP A 1 179 ? -19.033 78.639  43.287 1.00 36.98  ? 179  TRP A CD1 1 
ATOM   1379 C CD2 . TRP A 1 179 ? -21.205 78.943  42.841 1.00 35.22  ? 179  TRP A CD2 1 
ATOM   1380 N NE1 . TRP A 1 179 ? -19.753 78.063  44.306 1.00 36.70  ? 179  TRP A NE1 1 
ATOM   1381 C CE2 . TRP A 1 179 ? -21.090 78.238  44.056 1.00 34.88  ? 179  TRP A CE2 1 
ATOM   1382 C CE3 . TRP A 1 179 ? -22.481 79.249  42.357 1.00 36.19  ? 179  TRP A CE3 1 
ATOM   1383 C CZ2 . TRP A 1 179 ? -22.203 77.835  44.796 1.00 33.23  ? 179  TRP A CZ2 1 
ATOM   1384 C CZ3 . TRP A 1 179 ? -23.592 78.844  43.096 1.00 36.28  ? 179  TRP A CZ3 1 
ATOM   1385 C CH2 . TRP A 1 179 ? -23.442 78.146  44.301 1.00 34.79  ? 179  TRP A CH2 1 
ATOM   1386 N N   . VAL A 1 180 ? -21.587 79.593  39.022 1.00 41.87  ? 180  VAL A N   1 
ATOM   1387 C CA  . VAL A 1 180 ? -22.951 79.356  38.554 1.00 41.49  ? 180  VAL A CA  1 
ATOM   1388 C C   . VAL A 1 180 ? -22.913 78.166  37.607 1.00 43.35  ? 180  VAL A C   1 
ATOM   1389 O O   . VAL A 1 180 ? -23.786 77.297  37.621 1.00 42.70  ? 180  VAL A O   1 
ATOM   1390 C CB  . VAL A 1 180 ? -23.497 80.581  37.784 1.00 39.03  ? 180  VAL A CB  1 
ATOM   1391 C CG1 . VAL A 1 180 ? -24.814 80.242  37.109 1.00 36.20  ? 180  VAL A CG1 1 
ATOM   1392 C CG2 . VAL A 1 180 ? -23.681 81.736  38.735 1.00 40.13  ? 180  VAL A CG2 1 
ATOM   1393 N N   . HIS A 1 181 ? -21.868 78.135  36.794 1.00 43.98  ? 181  HIS A N   1 
ATOM   1394 C CA  . HIS A 1 181 ? -21.685 77.077  35.827 1.00 45.17  ? 181  HIS A CA  1 
ATOM   1395 C C   . HIS A 1 181 ? -21.646 75.696  36.472 1.00 45.99  ? 181  HIS A C   1 
ATOM   1396 O O   . HIS A 1 181 ? -22.407 74.800  36.099 1.00 47.08  ? 181  HIS A O   1 
ATOM   1397 C CB  . HIS A 1 181 ? -20.385 77.304  35.056 1.00 45.35  ? 181  HIS A CB  1 
ATOM   1398 C CG  . HIS A 1 181 ? -20.150 76.295  33.980 1.00 45.21  ? 181  HIS A CG  1 
ATOM   1399 N ND1 . HIS A 1 181 ? -20.973 76.186  32.882 1.00 43.82  ? 181  HIS A ND1 1 
ATOM   1400 C CD2 . HIS A 1 181 ? -19.220 75.318  33.854 1.00 44.92  ? 181  HIS A CD2 1 
ATOM   1401 C CE1 . HIS A 1 181 ? -20.560 75.186  32.128 1.00 42.98  ? 181  HIS A CE1 1 
ATOM   1402 N NE2 . HIS A 1 181 ? -19.500 74.641  32.693 1.00 42.67  ? 181  HIS A NE2 1 
ATOM   1403 N N   . ASP A 1 182 ? -20.756 75.538  37.445 1.00 45.62  ? 182  ASP A N   1 
ATOM   1404 C CA  . ASP A 1 182 ? -20.571 74.267  38.123 1.00 46.13  ? 182  ASP A CA  1 
ATOM   1405 C C   . ASP A 1 182 ? -21.558 73.921  39.238 1.00 47.29  ? 182  ASP A C   1 
ATOM   1406 O O   . ASP A 1 182 ? -21.695 72.751  39.585 1.00 48.84  ? 182  ASP A O   1 
ATOM   1407 C CB  . ASP A 1 182 ? -19.157 74.198  38.700 1.00 44.51  ? 182  ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 182 ? -18.123 74.810  37.783 1.00 44.36  ? 182  ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 182 ? -18.189 74.555  36.563 1.00 42.18  ? 182  ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 182 ? -17.237 75.537  38.288 1.00 43.24  ? 182  ASP A OD2 1 
ATOM   1411 N N   . ASN A 1 183 ? -22.251 74.909  39.795 1.00 47.19  ? 183  ASN A N   1 
ATOM   1412 C CA  . ASN A 1 183 ? -23.159 74.625  40.900 1.00 46.36  ? 183  ASN A CA  1 
ATOM   1413 C C   . ASN A 1 183 ? -24.632 74.972  40.737 1.00 46.87  ? 183  ASN A C   1 
ATOM   1414 O O   . ASN A 1 183 ? -25.464 74.483  41.498 1.00 47.72  ? 183  ASN A O   1 
ATOM   1415 C CB  . ASN A 1 183 ? -22.640 75.317  42.158 1.00 46.96  ? 183  ASN A CB  1 
ATOM   1416 C CG  . ASN A 1 183 ? -21.261 74.835  42.558 1.00 48.56  ? 183  ASN A CG  1 
ATOM   1417 O OD1 . ASN A 1 183 ? -21.086 73.678  42.941 1.00 51.29  ? 183  ASN A OD1 1 
ATOM   1418 N ND2 . ASN A 1 183 ? -20.272 75.717  42.467 1.00 47.02  ? 183  ASN A ND2 1 
ATOM   1419 N N   . ILE A 1 184 ? -24.974 75.799  39.757 1.00 46.73  ? 184  ILE A N   1 
ATOM   1420 C CA  . ILE A 1 184 ? -26.367 76.199  39.608 1.00 45.09  ? 184  ILE A CA  1 
ATOM   1421 C C   . ILE A 1 184 ? -27.312 75.040  39.351 1.00 46.25  ? 184  ILE A C   1 
ATOM   1422 O O   . ILE A 1 184 ? -28.506 75.148  39.612 1.00 47.45  ? 184  ILE A O   1 
ATOM   1423 C CB  . ILE A 1 184 ? -26.548 77.252  38.485 1.00 42.03  ? 184  ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 184 ? -27.865 78.012  38.688 1.00 39.67  ? 184  ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 184 ? -26.541 76.570  37.128 1.00 41.36  ? 184  ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 184 ? -27.932 78.779  39.984 1.00 33.65  ? 184  ILE A CD1 1 
ATOM   1427 N N   . GLN A 1 185 ? -26.798 73.927  38.844 1.00 48.42  ? 185  GLN A N   1 
ATOM   1428 C CA  . GLN A 1 185 ? -27.672 72.790  38.571 1.00 49.70  ? 185  GLN A CA  1 
ATOM   1429 C C   . GLN A 1 185 ? -28.210 72.221  39.871 1.00 49.11  ? 185  GLN A C   1 
ATOM   1430 O O   . GLN A 1 185 ? -29.300 71.663  39.907 1.00 49.16  ? 185  GLN A O   1 
ATOM   1431 C CB  . GLN A 1 185 ? -26.925 71.698  37.807 1.00 51.34  ? 185  GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 185 ? -26.062 70.788  38.669 1.00 55.07  ? 185  GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 185 ? -25.080 69.973  37.840 1.00 57.14  ? 185  GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 185 ? -24.029 70.471  37.430 1.00 58.71  ? 185  GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 185 ? -25.427 68.717  37.574 1.00 58.84  ? 185  GLN A NE2 1 
ATOM   1436 N N   . PHE A 1 186 ? -27.438 72.369  40.941 1.00 48.49  ? 186  PHE A N   1 
ATOM   1437 C CA  . PHE A 1 186 ? -27.845 71.862  42.237 1.00 47.47  ? 186  PHE A CA  1 
ATOM   1438 C C   . PHE A 1 186 ? -28.961 72.708  42.819 1.00 47.60  ? 186  PHE A C   1 
ATOM   1439 O O   . PHE A 1 186 ? -29.420 72.451  43.931 1.00 49.14  ? 186  PHE A O   1 
ATOM   1440 C CB  . PHE A 1 186 ? -26.665 71.856  43.197 1.00 48.23  ? 186  PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 186 ? -25.477 71.083  42.699 1.00 49.73  ? 186  PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 186 ? -25.626 69.792  42.204 1.00 50.33  ? 186  PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 186 ? -24.193 71.628  42.781 1.00 50.60  ? 186  PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 186 ? -24.516 69.049  41.803 1.00 52.44  ? 186  PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 186 ? -23.073 70.897  42.383 1.00 51.52  ? 186  PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 186 ? -23.233 69.604  41.894 1.00 52.52  ? 186  PHE A CZ  1 
ATOM   1447 N N   . PHE A 1 187 ? -29.392 73.719  42.068 1.00 46.79  ? 187  PHE A N   1 
ATOM   1448 C CA  . PHE A 1 187 ? -30.466 74.612  42.504 1.00 44.35  ? 187  PHE A CA  1 
ATOM   1449 C C   . PHE A 1 187 ? -31.610 74.583  41.512 1.00 45.06  ? 187  PHE A C   1 
ATOM   1450 O O   . PHE A 1 187 ? -32.529 75.399  41.595 1.00 45.42  ? 187  PHE A O   1 
ATOM   1451 C CB  . PHE A 1 187 ? -29.969 76.053  42.627 1.00 41.35  ? 187  PHE A CB  1 
ATOM   1452 C CG  . PHE A 1 187 ? -28.919 76.241  43.668 1.00 39.35  ? 187  PHE A CG  1 
ATOM   1453 C CD1 . PHE A 1 187 ? -27.599 75.894  43.410 1.00 37.83  ? 187  PHE A CD1 1 
ATOM   1454 C CD2 . PHE A 1 187 ? -29.255 76.733  44.926 1.00 40.03  ? 187  PHE A CD2 1 
ATOM   1455 C CE1 . PHE A 1 187 ? -26.623 76.031  44.392 1.00 37.95  ? 187  PHE A CE1 1 
ATOM   1456 C CE2 . PHE A 1 187 ? -28.291 76.875  45.917 1.00 39.53  ? 187  PHE A CE2 1 
ATOM   1457 C CZ  . PHE A 1 187 ? -26.966 76.521  45.649 1.00 39.26  ? 187  PHE A CZ  1 
ATOM   1458 N N   . GLY A 1 188 ? -31.542 73.651  40.567 1.00 45.07  ? 188  GLY A N   1 
ATOM   1459 C CA  . GLY A 1 188 ? -32.587 73.535  39.565 1.00 46.10  ? 188  GLY A CA  1 
ATOM   1460 C C   . GLY A 1 188 ? -32.286 74.375  38.338 1.00 47.69  ? 188  GLY A C   1 
ATOM   1461 O O   . GLY A 1 188 ? -33.133 74.533  37.450 1.00 47.46  ? 188  GLY A O   1 
ATOM   1462 N N   . GLY A 1 189 ? -31.072 74.916  38.286 1.00 47.38  ? 189  GLY A N   1 
ATOM   1463 C CA  . GLY A 1 189 ? -30.686 75.736  37.156 1.00 47.30  ? 189  GLY A CA  1 
ATOM   1464 C C   . GLY A 1 189 ? -30.083 74.915  36.036 1.00 47.46  ? 189  GLY A C   1 
ATOM   1465 O O   . GLY A 1 189 ? -29.562 73.823  36.267 1.00 48.03  ? 189  GLY A O   1 
ATOM   1466 N N   . ASP A 1 190 ? -30.163 75.440  34.818 1.00 47.46  ? 190  ASP A N   1 
ATOM   1467 C CA  . ASP A 1 190 ? -29.615 74.771  33.650 1.00 47.45  ? 190  ASP A CA  1 
ATOM   1468 C C   . ASP A 1 190 ? -28.404 75.557  33.151 1.00 48.32  ? 190  ASP A C   1 
ATOM   1469 O O   . ASP A 1 190 ? -28.535 76.543  32.424 1.00 46.51  ? 190  ASP A O   1 
ATOM   1470 C CB  . ASP A 1 190 ? -30.682 74.674  32.557 1.00 47.44  ? 190  ASP A CB  1 
ATOM   1471 C CG  . ASP A 1 190 ? -30.180 73.965  31.316 1.00 48.34  ? 190  ASP A CG  1 
ATOM   1472 O OD1 . ASP A 1 190 ? -29.295 73.088  31.452 1.00 47.37  ? 190  ASP A OD1 1 
ATOM   1473 O OD2 . ASP A 1 190 ? -30.680 74.276  30.212 1.00 46.66  ? 190  ASP A OD2 1 
ATOM   1474 N N   . PRO A 1 191 ? -27.199 75.125  33.543 1.00 49.61  ? 191  PRO A N   1 
ATOM   1475 C CA  . PRO A 1 191 ? -25.956 75.794  33.140 1.00 51.49  ? 191  PRO A CA  1 
ATOM   1476 C C   . PRO A 1 191 ? -25.776 76.009  31.638 1.00 52.07  ? 191  PRO A C   1 
ATOM   1477 O O   . PRO A 1 191 ? -25.004 76.877  31.218 1.00 52.26  ? 191  PRO A O   1 
ATOM   1478 C CB  . PRO A 1 191 ? -24.865 74.907  33.752 1.00 51.18  ? 191  PRO A CB  1 
ATOM   1479 C CG  . PRO A 1 191 ? -25.528 73.571  33.868 1.00 50.50  ? 191  PRO A CG  1 
ATOM   1480 C CD  . PRO A 1 191 ? -26.914 73.917  34.332 1.00 48.96  ? 191  PRO A CD  1 
ATOM   1481 N N   . LYS A 1 192 ? -26.494 75.228  30.833 1.00 52.80  ? 192  LYS A N   1 
ATOM   1482 C CA  . LYS A 1 192 ? -26.411 75.349  29.378 1.00 52.16  ? 192  LYS A CA  1 
ATOM   1483 C C   . LYS A 1 192 ? -27.455 76.339  28.867 1.00 49.76  ? 192  LYS A C   1 
ATOM   1484 O O   . LYS A 1 192 ? -27.726 76.422  27.668 1.00 50.34  ? 192  LYS A O   1 
ATOM   1485 C CB  . LYS A 1 192 ? -26.606 73.976  28.718 1.00 53.96  ? 192  LYS A CB  1 
ATOM   1486 C CG  . LYS A 1 192 ? -27.804 73.202  29.237 1.00 55.98  ? 192  LYS A CG  1 
ATOM   1487 C CD  . LYS A 1 192 ? -27.882 71.794  28.656 1.00 56.66  ? 192  LYS A CD  1 
ATOM   1488 C CE  . LYS A 1 192 ? -28.529 71.793  27.282 1.00 57.47  ? 192  LYS A CE  1 
ATOM   1489 N NZ  . LYS A 1 192 ? -28.713 70.409  26.766 1.00 58.29  ? 192  LYS A NZ  1 
ATOM   1490 N N   . THR A 1 193 ? -28.033 77.094  29.791 1.00 47.03  ? 193  THR A N   1 
ATOM   1491 C CA  . THR A 1 193 ? -29.039 78.080  29.438 1.00 44.74  ? 193  THR A CA  1 
ATOM   1492 C C   . THR A 1 193 ? -28.980 79.264  30.390 1.00 43.10  ? 193  THR A C   1 
ATOM   1493 O O   . THR A 1 193 ? -29.956 79.585  31.070 1.00 42.59  ? 193  THR A O   1 
ATOM   1494 C CB  . THR A 1 193 ? -30.439 77.460  29.477 1.00 44.34  ? 193  THR A CB  1 
ATOM   1495 O OG1 . THR A 1 193 ? -30.443 76.277  28.671 1.00 47.43  ? 193  THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 193 ? -31.479 78.435  28.939 1.00 43.43  ? 193  THR A CG2 1 
ATOM   1497 N N   . VAL A 1 194 ? -27.817 79.907  30.435 1.00 41.34  ? 194  VAL A N   1 
ATOM   1498 C CA  . VAL A 1 194 ? -27.615 81.058  31.298 1.00 38.65  ? 194  VAL A CA  1 
ATOM   1499 C C   . VAL A 1 194 ? -27.558 82.350  30.494 1.00 36.98  ? 194  VAL A C   1 
ATOM   1500 O O   . VAL A 1 194 ? -26.856 82.442  29.482 1.00 35.18  ? 194  VAL A O   1 
ATOM   1501 C CB  . VAL A 1 194 ? -26.302 80.943  32.095 1.00 39.56  ? 194  VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 194 ? -26.149 82.130  33.011 1.00 39.28  ? 194  VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 194 ? -26.286 79.659  32.890 1.00 41.42  ? 194  VAL A CG2 1 
ATOM   1504 N N   . THR A 1 195 ? -28.320 83.337  30.959 1.00 36.49  ? 195  THR A N   1 
ATOM   1505 C CA  . THR A 1 195 ? -28.366 84.664  30.349 1.00 34.01  ? 195  THR A CA  1 
ATOM   1506 C C   . THR A 1 195 ? -27.787 85.661  31.337 1.00 33.75  ? 195  THR A C   1 
ATOM   1507 O O   . THR A 1 195 ? -28.311 85.814  32.441 1.00 33.32  ? 195  THR A O   1 
ATOM   1508 C CB  . THR A 1 195 ? -29.797 85.120  30.050 1.00 30.99  ? 195  THR A CB  1 
ATOM   1509 O OG1 . THR A 1 195 ? -30.302 84.396  28.928 1.00 32.94  ? 195  THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 195 ? -29.830 86.610  29.743 1.00 29.78  ? 195  THR A CG2 1 
ATOM   1511 N N   . ILE A 1 196 ? -26.700 86.321  30.946 1.00 33.13  ? 196  ILE A N   1 
ATOM   1512 C CA  . ILE A 1 196 ? -26.080 87.334  31.795 1.00 32.16  ? 196  ILE A CA  1 
ATOM   1513 C C   . ILE A 1 196 ? -26.660 88.673  31.364 1.00 32.67  ? 196  ILE A C   1 
ATOM   1514 O O   . ILE A 1 196 ? -26.693 88.973  30.171 1.00 33.44  ? 196  ILE A O   1 
ATOM   1515 C CB  . ILE A 1 196 ? -24.532 87.386  31.625 1.00 30.98  ? 196  ILE A CB  1 
ATOM   1516 C CG1 . ILE A 1 196 ? -24.168 87.627  30.160 1.00 27.73  ? 196  ILE A CG1 1 
ATOM   1517 C CG2 . ILE A 1 196 ? -23.902 86.101  32.154 1.00 30.75  ? 196  ILE A CG2 1 
ATOM   1518 C CD1 . ILE A 1 196 ? -22.681 87.645  29.889 1.00 27.60  ? 196  ILE A CD1 1 
ATOM   1519 N N   . PHE A 1 197 ? -27.139 89.463  32.327 1.00 33.08  ? 197  PHE A N   1 
ATOM   1520 C CA  . PHE A 1 197 ? -27.706 90.781  32.030 1.00 31.31  ? 197  PHE A CA  1 
ATOM   1521 C C   . PHE A 1 197 ? -27.283 91.839  33.067 1.00 31.22  ? 197  PHE A C   1 
ATOM   1522 O O   . PHE A 1 197 ? -27.025 91.527  34.235 1.00 30.93  ? 197  PHE A O   1 
ATOM   1523 C CB  . PHE A 1 197 ? -29.240 90.687  31.923 1.00 30.21  ? 197  PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 197 ? -29.947 90.500  33.241 1.00 29.00  ? 197  PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 197 ? -29.535 89.527  34.144 1.00 28.62  ? 197  PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 197 ? -31.044 91.299  33.570 1.00 29.34  ? 197  PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 197 ? -30.203 89.351  35.360 1.00 29.55  ? 197  PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 197 ? -31.722 91.135  34.780 1.00 29.14  ? 197  PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 197 ? -31.301 90.158  35.679 1.00 30.00  ? 197  PHE A CZ  1 
ATOM   1530 N N   . GLY A 1 198 ? -27.192 93.089  32.628 1.00 30.86  ? 198  GLY A N   1 
ATOM   1531 C CA  . GLY A 1 198 ? -26.781 94.154  33.524 1.00 30.51  ? 198  GLY A CA  1 
ATOM   1532 C C   . GLY A 1 198 ? -27.072 95.517  32.937 1.00 30.48  ? 198  GLY A C   1 
ATOM   1533 O O   . GLY A 1 198 ? -27.381 95.628  31.747 1.00 33.47  ? 198  GLY A O   1 
ATOM   1534 N N   . GLU A 1 199 ? -26.976 96.558  33.757 1.00 27.97  ? 199  GLU A N   1 
ATOM   1535 C CA  . GLU A 1 199 ? -27.256 97.905  33.283 1.00 26.47  ? 199  GLU A CA  1 
ATOM   1536 C C   . GLU A 1 199 ? -26.049 98.808  33.464 1.00 25.99  ? 199  GLU A C   1 
ATOM   1537 O O   . GLU A 1 199 ? -25.259 98.643  34.390 1.00 25.96  ? 199  GLU A O   1 
ATOM   1538 C CB  . GLU A 1 199 ? -28.459 98.478  34.036 1.00 25.61  ? 199  GLU A CB  1 
ATOM   1539 C CG  . GLU A 1 199 ? -29.033 99.768  33.464 1.00 26.05  ? 199  GLU A CG  1 
ATOM   1540 C CD  . GLU A 1 199 ? -28.553 101.030 34.180 1.00 24.41  ? 199  GLU A CD  1 
ATOM   1541 O OE1 . GLU A 1 199 ? -27.878 100.921 35.224 1.00 21.61  ? 199  GLU A OE1 1 
ATOM   1542 O OE2 . GLU A 1 199 ? -28.867 102.138 33.693 1.00 22.82  ? 199  GLU A OE2 1 
ATOM   1543 N N   . SER A 1 200 ? -25.911 99.764  32.561 1.00 26.67  ? 200  SER A N   1 
ATOM   1544 C CA  . SER A 1 200 ? -24.810 100.708 32.611 1.00 26.51  ? 200  SER A CA  1 
ATOM   1545 C C   . SER A 1 200 ? -23.483 99.954  32.666 1.00 24.75  ? 200  SER A C   1 
ATOM   1546 O O   . SER A 1 200 ? -23.184 99.184  31.759 1.00 26.07  ? 200  SER A O   1 
ATOM   1547 C CB  . SER A 1 200 ? -24.974 101.624 33.821 1.00 26.43  ? 200  SER A CB  1 
ATOM   1548 O OG  . SER A 1 200 ? -24.214 102.803 33.644 1.00 31.87  ? 200  SER A OG  1 
ATOM   1549 N N   . ALA A 1 201 ? -22.686 100.164 33.711 1.00 24.11  ? 201  ALA A N   1 
ATOM   1550 C CA  . ALA A 1 201 ? -21.399 99.465  33.820 1.00 24.68  ? 201  ALA A CA  1 
ATOM   1551 C C   . ALA A 1 201 ? -21.616 97.958  33.779 1.00 23.37  ? 201  ALA A C   1 
ATOM   1552 O O   . ALA A 1 201 ? -20.743 97.205  33.343 1.00 21.12  ? 201  ALA A O   1 
ATOM   1553 C CB  . ALA A 1 201 ? -20.670 99.854  35.119 1.00 24.05  ? 201  ALA A CB  1 
ATOM   1554 N N   . GLY A 1 202 ? -22.785 97.529  34.241 1.00 22.55  ? 202  GLY A N   1 
ATOM   1555 C CA  . GLY A 1 202 ? -23.111 96.120  34.236 1.00 24.46  ? 202  GLY A CA  1 
ATOM   1556 C C   . GLY A 1 202 ? -23.330 95.668  32.810 1.00 27.35  ? 202  GLY A C   1 
ATOM   1557 O O   . GLY A 1 202 ? -22.909 94.571  32.421 1.00 28.98  ? 202  GLY A O   1 
ATOM   1558 N N   . GLY A 1 203 ? -23.993 96.520  32.028 1.00 27.59  ? 203  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 203 ? -24.246 96.207  30.632 1.00 28.35  ? 203  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 203 ? -22.928 96.127  29.889 1.00 29.25  ? 203  GLY A C   1 
ATOM   1561 O O   . GLY A 1 203 ? -22.672 95.176  29.145 1.00 30.46  ? 203  GLY A O   1 
ATOM   1562 N N   . ALA A 1 204 ? -22.080 97.129  30.094 1.00 29.27  ? 204  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 204 ? -20.778 97.147  29.447 1.00 28.77  ? 204  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 204 ? -20.065 95.847  29.820 1.00 28.37  ? 204  ALA A C   1 
ATOM   1565 O O   . ALA A 1 204 ? -19.375 95.247  29.004 1.00 28.48  ? 204  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 204 ? -19.979 98.351  29.917 1.00 28.23  ? 204  ALA A CB  1 
ATOM   1567 N N   . SER A 1 205 ? -20.251 95.411  31.060 1.00 28.12  ? 205  SER A N   1 
ATOM   1568 C CA  . SER A 1 205 ? -19.637 94.180  31.524 1.00 25.73  ? 205  SER A CA  1 
ATOM   1569 C C   . SER A 1 205 ? -20.102 93.014  30.661 1.00 26.39  ? 205  SER A C   1 
ATOM   1570 O O   . SER A 1 205 ? -19.280 92.267  30.124 1.00 27.25  ? 205  SER A O   1 
ATOM   1571 C CB  . SER A 1 205 ? -19.996 93.932  32.984 1.00 25.42  ? 205  SER A CB  1 
ATOM   1572 O OG  . SER A 1 205 ? -19.266 94.800  33.832 1.00 24.45  ? 205  SER A OG  1 
ATOM   1573 N N   . VAL A 1 206 ? -21.415 92.855  30.521 1.00 24.26  ? 206  VAL A N   1 
ATOM   1574 C CA  . VAL A 1 206 ? -21.940 91.775  29.699 1.00 25.13  ? 206  VAL A CA  1 
ATOM   1575 C C   . VAL A 1 206 ? -21.211 91.760  28.357 1.00 27.33  ? 206  VAL A C   1 
ATOM   1576 O O   . VAL A 1 206 ? -20.695 90.724  27.921 1.00 27.90  ? 206  VAL A O   1 
ATOM   1577 C CB  . VAL A 1 206 ? -23.438 91.956  29.421 1.00 23.88  ? 206  VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 206 ? -23.875 91.007  28.342 1.00 21.39  ? 206  VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 206 ? -24.230 91.711  30.680 1.00 25.47  ? 206  VAL A CG2 1 
ATOM   1580 N N   . GLY A 1 207 ? -21.170 92.925  27.716 1.00 28.49  ? 207  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 207 ? -20.522 93.051  26.422 1.00 27.99  ? 207  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 207 ? -19.063 92.649  26.433 1.00 27.51  ? 207  GLY A C   1 
ATOM   1583 O O   . GLY A 1 207 ? -18.546 92.119  25.453 1.00 26.07  ? 207  GLY A O   1 
ATOM   1584 N N   . MET A 1 208 ? -18.390 92.898  27.546 1.00 27.58  ? 208  MET A N   1 
ATOM   1585 C CA  . MET A 1 208 ? -16.987 92.550  27.651 1.00 29.60  ? 208  MET A CA  1 
ATOM   1586 C C   . MET A 1 208 ? -16.833 91.042  27.801 1.00 31.59  ? 208  MET A C   1 
ATOM   1587 O O   . MET A 1 208 ? -15.810 90.480  27.429 1.00 33.27  ? 208  MET A O   1 
ATOM   1588 C CB  . MET A 1 208 ? -16.352 93.285  28.834 1.00 28.07  ? 208  MET A CB  1 
ATOM   1589 C CG  . MET A 1 208 ? -16.498 94.798  28.726 1.00 26.95  ? 208  MET A CG  1 
ATOM   1590 S SD  . MET A 1 208 ? -15.830 95.753  30.090 1.00 27.47  ? 208  MET A SD  1 
ATOM   1591 C CE  . MET A 1 208 ? -14.829 96.932  29.229 1.00 23.61  ? 208  MET A CE  1 
ATOM   1592 N N   . HIS A 1 209 ? -17.854 90.381  28.336 1.00 33.06  ? 209  HIS A N   1 
ATOM   1593 C CA  . HIS A 1 209 ? -17.790 88.934  28.493 1.00 33.06  ? 209  HIS A CA  1 
ATOM   1594 C C   . HIS A 1 209 ? -18.038 88.290  27.149 1.00 32.72  ? 209  HIS A C   1 
ATOM   1595 O O   . HIS A 1 209 ? -17.538 87.203  26.875 1.00 32.99  ? 209  HIS A O   1 
ATOM   1596 C CB  . HIS A 1 209 ? -18.808 88.449  29.532 1.00 33.99  ? 209  HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 209 ? -18.395 88.741  30.941 1.00 33.17  ? 209  HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 209 ? -17.208 88.282  31.475 1.00 31.91  ? 209  HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 209 ? -18.969 89.504  31.901 1.00 32.41  ? 209  HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 209 ? -17.066 88.757  32.699 1.00 30.90  ? 209  HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 209 ? -18.120 89.502  32.981 1.00 32.14  ? 209  HIS A NE2 1 
ATOM   1602 N N   . ILE A 1 210 ? -18.802 88.975  26.307 1.00 31.53  ? 210  ILE A N   1 
ATOM   1603 C CA  . ILE A 1 210 ? -19.085 88.482  24.967 1.00 32.41  ? 210  ILE A CA  1 
ATOM   1604 C C   . ILE A 1 210 ? -17.789 88.523  24.166 1.00 33.70  ? 210  ILE A C   1 
ATOM   1605 O O   . ILE A 1 210 ? -17.484 87.607  23.401 1.00 34.83  ? 210  ILE A O   1 
ATOM   1606 C CB  . ILE A 1 210 ? -20.140 89.361  24.243 1.00 31.28  ? 210  ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 210 ? -21.524 89.103  24.835 1.00 30.90  ? 210  ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 210 ? -20.134 89.070  22.749 1.00 31.18  ? 210  ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 210 ? -22.642 89.867  24.154 1.00 31.20  ? 210  ILE A CD1 1 
ATOM   1610 N N   . LEU A 1 211 ? -17.023 89.591  24.348 1.00 34.32  ? 211  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 211 ? -15.766 89.743  23.633 1.00 35.24  ? 211  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 211 ? -14.647 88.846  24.164 1.00 35.94  ? 211  LEU A C   1 
ATOM   1613 O O   . LEU A 1 211 ? -13.969 88.175  23.390 1.00 36.97  ? 211  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 211 ? -15.309 91.207  23.677 1.00 34.76  ? 211  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 211 ? -16.235 92.241  23.030 1.00 33.57  ? 211  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 211 ? -15.611 93.624  23.101 1.00 32.34  ? 211  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 211 ? -16.482 91.859  21.594 1.00 34.02  ? 211  LEU A CD2 1 
ATOM   1618 N N   . SER A 1 212 ? -14.464 88.831  25.482 1.00 36.66  ? 212  SER A N   1 
ATOM   1619 C CA  . SER A 1 212 ? -13.405 88.044  26.118 1.00 38.04  ? 212  SER A CA  1 
ATOM   1620 C C   . SER A 1 212 ? -13.458 86.527  25.891 1.00 40.29  ? 212  SER A C   1 
ATOM   1621 O O   . SER A 1 212 ? -14.392 85.853  26.320 1.00 42.19  ? 212  SER A O   1 
ATOM   1622 C CB  . SER A 1 212 ? -13.389 88.324  27.618 1.00 36.14  ? 212  SER A CB  1 
ATOM   1623 O OG  . SER A 1 212 ? -12.234 87.776  28.225 1.00 34.49  ? 212  SER A OG  1 
ATOM   1624 N N   . PRO A 1 213 ? -12.436 85.973  25.218 1.00 41.35  ? 213  PRO A N   1 
ATOM   1625 C CA  . PRO A 1 213 ? -12.318 84.542  24.912 1.00 41.73  ? 213  PRO A CA  1 
ATOM   1626 C C   . PRO A 1 213 ? -12.467 83.640  26.133 1.00 42.34  ? 213  PRO A C   1 
ATOM   1627 O O   . PRO A 1 213 ? -12.933 82.500  26.024 1.00 43.38  ? 213  PRO A O   1 
ATOM   1628 C CB  . PRO A 1 213 ? -10.923 84.438  24.308 1.00 40.90  ? 213  PRO A CB  1 
ATOM   1629 C CG  . PRO A 1 213 ? -10.790 85.734  23.593 1.00 41.86  ? 213  PRO A CG  1 
ATOM   1630 C CD  . PRO A 1 213 ? -11.328 86.726  24.602 1.00 41.29  ? 213  PRO A CD  1 
ATOM   1631 N N   . GLY A 1 214 ? -12.066 84.154  27.293 1.00 41.06  ? 214  GLY A N   1 
ATOM   1632 C CA  . GLY A 1 214 ? -12.152 83.373  28.510 1.00 39.59  ? 214  GLY A CA  1 
ATOM   1633 C C   . GLY A 1 214 ? -13.464 83.478  29.266 1.00 38.99  ? 214  GLY A C   1 
ATOM   1634 O O   . GLY A 1 214 ? -13.529 83.126  30.444 1.00 39.74  ? 214  GLY A O   1 
ATOM   1635 N N   . SER A 1 215 ? -14.513 83.957  28.614 1.00 36.97  ? 215  SER A N   1 
ATOM   1636 C CA  . SER A 1 215 ? -15.797 84.073  29.289 1.00 36.54  ? 215  SER A CA  1 
ATOM   1637 C C   . SER A 1 215 ? -16.907 83.543  28.410 1.00 37.30  ? 215  SER A C   1 
ATOM   1638 O O   . SER A 1 215 ? -17.935 83.084  28.897 1.00 38.28  ? 215  SER A O   1 
ATOM   1639 C CB  . SER A 1 215 ? -16.077 85.532  29.652 1.00 35.23  ? 215  SER A CB  1 
ATOM   1640 O OG  . SER A 1 215 ? -15.073 86.031  30.523 1.00 34.08  ? 215  SER A OG  1 
ATOM   1641 N N   . ARG A 1 216 ? -16.680 83.591  27.106 1.00 37.53  ? 216  ARG A N   1 
ATOM   1642 C CA  . ARG A 1 216 ? -17.669 83.143  26.137 1.00 38.78  ? 216  ARG A CA  1 
ATOM   1643 C C   . ARG A 1 216 ? -18.403 81.840  26.480 1.00 39.08  ? 216  ARG A C   1 
ATOM   1644 O O   . ARG A 1 216 ? -19.627 81.776  26.375 1.00 37.93  ? 216  ARG A O   1 
ATOM   1645 C CB  . ARG A 1 216 ? -17.014 83.016  24.756 1.00 39.02  ? 216  ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 216 ? -16.354 84.293  24.274 1.00 40.25  ? 216  ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 216 ? -15.718 84.134  22.901 1.00 40.69  ? 216  ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 216 ? -14.978 85.333  22.510 1.00 41.30  ? 216  ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 216 ? -14.163 85.404  21.465 1.00 40.50  ? 216  ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 216 ? -13.979 84.343  20.696 1.00 41.64  ? 216  ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 216 ? -13.527 86.532  21.192 1.00 40.06  ? 216  ARG A NH2 1 
ATOM   1652 N N   . ASP A 1 217 ? -17.665 80.811  26.894 1.00 40.00  ? 217  ASP A N   1 
ATOM   1653 C CA  . ASP A 1 217 ? -18.278 79.517  27.202 1.00 41.58  ? 217  ASP A CA  1 
ATOM   1654 C C   . ASP A 1 217 ? -19.056 79.456  28.513 1.00 41.17  ? 217  ASP A C   1 
ATOM   1655 O O   . ASP A 1 217 ? -19.641 78.424  28.846 1.00 42.88  ? 217  ASP A O   1 
ATOM   1656 C CB  . ASP A 1 217 ? -17.217 78.406  27.209 1.00 43.30  ? 217  ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 217 ? -16.481 78.289  25.887 1.00 46.44  ? 217  ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 217 ? -17.137 78.435  24.829 1.00 47.55  ? 217  ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 217 ? -15.253 78.040  25.905 1.00 45.99  ? 217  ASP A OD2 1 
ATOM   1660 N N   . LEU A 1 218 ? -19.085 80.551  29.258 1.00 38.84  ? 218  LEU A N   1 
ATOM   1661 C CA  . LEU A 1 218 ? -19.794 80.534  30.523 1.00 36.88  ? 218  LEU A CA  1 
ATOM   1662 C C   . LEU A 1 218 ? -21.264 80.952  30.470 1.00 36.05  ? 218  LEU A C   1 
ATOM   1663 O O   . LEU A 1 218 ? -21.928 80.953  31.496 1.00 36.19  ? 218  LEU A O   1 
ATOM   1664 C CB  . LEU A 1 218 ? -19.046 81.395  31.536 1.00 36.51  ? 218  LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 218 ? -17.622 80.932  31.843 1.00 36.38  ? 218  LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 218 ? -16.923 81.948  32.727 1.00 36.18  ? 218  LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 218 ? -17.662 79.574  32.515 1.00 37.70  ? 218  LEU A CD2 1 
ATOM   1668 N N   . PHE A 1 219 ? -21.781 81.298  29.292 1.00 35.08  ? 219  PHE A N   1 
ATOM   1669 C CA  . PHE A 1 219 ? -23.184 81.705  29.191 1.00 34.63  ? 219  PHE A CA  1 
ATOM   1670 C C   . PHE A 1 219 ? -23.752 81.488  27.797 1.00 36.64  ? 219  PHE A C   1 
ATOM   1671 O O   . PHE A 1 219 ? -23.003 81.328  26.835 1.00 38.33  ? 219  PHE A O   1 
ATOM   1672 C CB  . PHE A 1 219 ? -23.362 83.176  29.592 1.00 32.11  ? 219  PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 219 ? -22.599 84.140  28.731 1.00 29.07  ? 219  PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 219 ? -21.224 84.298  28.891 1.00 27.68  ? 219  PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 219 ? -23.253 84.876  27.746 1.00 27.91  ? 219  PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 219 ? -20.506 85.177  28.081 1.00 28.79  ? 219  PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 219 ? -22.555 85.754  26.931 1.00 28.15  ? 219  PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 219 ? -21.172 85.908  27.098 1.00 29.42  ? 219  PHE A CZ  1 
ATOM   1679 N N   . ARG A 1 220 ? -25.080 81.496  27.693 1.00 37.58  ? 220  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 220 ? -25.753 81.267  26.418 1.00 38.05  ? 220  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 220 ? -26.068 82.546  25.644 1.00 38.41  ? 220  ARG A C   1 
ATOM   1682 O O   . ARG A 1 220 ? -25.568 82.762  24.541 1.00 38.48  ? 220  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 220 ? -27.045 80.484  26.655 1.00 38.28  ? 220  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 220 ? -27.787 80.118  25.385 1.00 40.08  ? 220  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 220 ? -26.974 79.159  24.517 1.00 44.81  ? 220  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 220 ? -27.659 78.899  23.258 1.00 50.51  ? 220  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 220 ? -27.900 79.829  22.337 1.00 53.53  ? 220  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 220 ? -27.501 81.079  22.534 1.00 57.51  ? 220  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 220 ? -28.561 79.522  21.227 1.00 54.76  ? 220  ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 221 ? -26.927 83.380  26.215 1.00 38.14  ? 221  ARG A N   1 
ATOM   1691 C CA  . ARG A 1 221 ? -27.303 84.632  25.580 1.00 35.99  ? 221  ARG A CA  1 
ATOM   1692 C C   . ARG A 1 221 ? -27.099 85.795  26.559 1.00 35.55  ? 221  ARG A C   1 
ATOM   1693 O O   . ARG A 1 221 ? -26.852 85.582  27.749 1.00 35.01  ? 221  ARG A O   1 
ATOM   1694 C CB  . ARG A 1 221 ? -28.749 84.545  25.083 1.00 34.01  ? 221  ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 221 ? -29.664 83.711  25.954 1.00 35.40  ? 221  ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 221 ? -31.076 83.633  25.381 1.00 35.61  ? 221  ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 221 ? -31.176 82.807  24.179 1.00 36.57  ? 221  ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 221 ? -31.106 81.479  24.171 1.00 37.06  ? 221  ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 221 ? -30.933 80.818  25.304 1.00 38.42  ? 221  ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 221 ? -31.220 80.810  23.035 1.00 37.02  ? 221  ARG A NH2 1 
ATOM   1701 N N   . ALA A 1 222 ? -27.187 87.022  26.062 1.00 34.36  ? 222  ALA A N   1 
ATOM   1702 C CA  . ALA A 1 222 ? -26.954 88.178  26.914 1.00 33.39  ? 222  ALA A CA  1 
ATOM   1703 C C   . ALA A 1 222 ? -27.882 89.351  26.659 1.00 32.80  ? 222  ALA A C   1 
ATOM   1704 O O   . ALA A 1 222 ? -28.463 89.484  25.581 1.00 35.70  ? 222  ALA A O   1 
ATOM   1705 C CB  . ALA A 1 222 ? -25.504 88.628  26.769 1.00 31.57  ? 222  ALA A CB  1 
ATOM   1706 N N   . ILE A 1 223 ? -28.003 90.205  27.670 1.00 30.40  ? 223  ILE A N   1 
ATOM   1707 C CA  . ILE A 1 223 ? -28.840 91.393  27.602 1.00 27.60  ? 223  ILE A CA  1 
ATOM   1708 C C   . ILE A 1 223 ? -28.013 92.595  28.046 1.00 27.77  ? 223  ILE A C   1 
ATOM   1709 O O   . ILE A 1 223 ? -27.243 92.507  29.012 1.00 26.91  ? 223  ILE A O   1 
ATOM   1710 C CB  . ILE A 1 223 ? -30.071 91.259  28.530 1.00 27.18  ? 223  ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 223 ? -30.987 90.148  28.012 1.00 27.39  ? 223  ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 223 ? -30.809 92.594  28.624 1.00 22.21  ? 223  ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 223 ? -32.135 89.825  28.936 1.00 28.56  ? 223  ILE A CD1 1 
ATOM   1714 N N   . LEU A 1 224 ? -28.167 93.711  27.335 1.00 25.68  ? 224  LEU A N   1 
ATOM   1715 C CA  . LEU A 1 224 ? -27.440 94.930  27.667 1.00 24.15  ? 224  LEU A CA  1 
ATOM   1716 C C   . LEU A 1 224 ? -28.380 96.118  27.834 1.00 22.85  ? 224  LEU A C   1 
ATOM   1717 O O   . LEU A 1 224 ? -29.072 96.517  26.894 1.00 23.06  ? 224  LEU A O   1 
ATOM   1718 C CB  . LEU A 1 224 ? -26.394 95.242  26.595 1.00 21.91  ? 224  LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 224 ? -25.398 94.111  26.351 1.00 20.95  ? 224  LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 224 ? -25.985 93.156  25.308 1.00 19.53  ? 224  LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 224 ? -24.066 94.674  25.871 1.00 19.64  ? 224  LEU A CD2 1 
ATOM   1722 N N   . GLN A 1 225 ? -28.390 96.682  29.037 1.00 21.70  ? 225  GLN A N   1 
ATOM   1723 C CA  . GLN A 1 225 ? -29.244 97.820  29.348 1.00 22.47  ? 225  GLN A CA  1 
ATOM   1724 C C   . GLN A 1 225 ? -28.455 99.118  29.560 1.00 20.26  ? 225  GLN A C   1 
ATOM   1725 O O   . GLN A 1 225 ? -27.688 99.237  30.519 1.00 17.59  ? 225  GLN A O   1 
ATOM   1726 C CB  . GLN A 1 225 ? -30.069 97.500  30.592 1.00 26.20  ? 225  GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 225 ? -30.898 96.241  30.455 1.00 29.55  ? 225  GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 225 ? -31.551 95.829  31.757 1.00 32.04  ? 225  GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 225 ? -32.068 94.719  31.874 1.00 32.37  ? 225  GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 225 ? -31.534 96.724  32.744 1.00 31.74  ? 225  GLN A NE2 1 
ATOM   1731 N N   . SER A 1 226 ? -28.658 100.082 28.661 1.00 19.41  ? 226  SER A N   1 
ATOM   1732 C CA  . SER A 1 226 ? -27.980 101.380 28.726 1.00 20.31  ? 226  SER A CA  1 
ATOM   1733 C C   . SER A 1 226 ? -26.474 101.255 28.986 1.00 22.55  ? 226  SER A C   1 
ATOM   1734 O O   . SER A 1 226 ? -25.914 102.034 29.766 1.00 23.18  ? 226  SER A O   1 
ATOM   1735 C CB  . SER A 1 226 ? -28.588 102.246 29.831 1.00 17.20  ? 226  SER A CB  1 
ATOM   1736 O OG  . SER A 1 226 ? -29.960 102.487 29.608 1.00 17.52  ? 226  SER A OG  1 
ATOM   1737 N N   . GLY A 1 227 ? -25.824 100.287 28.346 1.00 21.38  ? 227  GLY A N   1 
ATOM   1738 C CA  . GLY A 1 227 ? -24.398 100.113 28.549 1.00 22.20  ? 227  GLY A CA  1 
ATOM   1739 C C   . GLY A 1 227 ? -23.781 99.342  27.405 1.00 24.44  ? 227  GLY A C   1 
ATOM   1740 O O   . GLY A 1 227 ? -24.397 98.416  26.877 1.00 24.94  ? 227  GLY A O   1 
ATOM   1741 N N   . SER A 1 228 ? -22.565 99.713  27.014 1.00 25.44  ? 228  SER A N   1 
ATOM   1742 C CA  . SER A 1 228 ? -21.889 99.033  25.914 1.00 25.89  ? 228  SER A CA  1 
ATOM   1743 C C   . SER A 1 228 ? -20.389 98.923  26.206 1.00 25.80  ? 228  SER A C   1 
ATOM   1744 O O   . SER A 1 228 ? -19.779 99.861  26.716 1.00 26.08  ? 228  SER A O   1 
ATOM   1745 C CB  . SER A 1 228 ? -22.127 99.798  24.613 1.00 26.02  ? 228  SER A CB  1 
ATOM   1746 O OG  . SER A 1 228 ? -21.806 98.997  23.492 1.00 30.07  ? 228  SER A OG  1 
ATOM   1747 N N   . PRO A 1 229 ? -19.774 97.776  25.868 1.00 24.77  ? 229  PRO A N   1 
ATOM   1748 C CA  . PRO A 1 229 ? -18.343 97.547  26.106 1.00 23.96  ? 229  PRO A CA  1 
ATOM   1749 C C   . PRO A 1 229 ? -17.415 98.591  25.493 1.00 24.80  ? 229  PRO A C   1 
ATOM   1750 O O   . PRO A 1 229 ? -16.305 98.814  25.987 1.00 23.71  ? 229  PRO A O   1 
ATOM   1751 C CB  . PRO A 1 229 ? -18.116 96.149  25.530 1.00 22.69  ? 229  PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 229 ? -19.106 96.072  24.432 1.00 23.67  ? 229  PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 229 ? -20.344 96.695  25.047 1.00 24.54  ? 229  PRO A CD  1 
ATOM   1754 N N   . ASN A 1 230 ? -17.878 99.233  24.424 1.00 24.13  ? 230  ASN A N   1 
ATOM   1755 C CA  . ASN A 1 230 ? -17.085 100.246 23.740 1.00 23.90  ? 230  ASN A CA  1 
ATOM   1756 C C   . ASN A 1 230 ? -17.395 101.671 24.195 1.00 23.75  ? 230  ASN A C   1 
ATOM   1757 O O   . ASN A 1 230 ? -17.017 102.622 23.518 1.00 21.71  ? 230  ASN A O   1 
ATOM   1758 C CB  . ASN A 1 230 ? -17.322 100.151 22.241 1.00 24.37  ? 230  ASN A CB  1 
ATOM   1759 C CG  . ASN A 1 230 ? -18.763 100.399 21.878 1.00 26.28  ? 230  ASN A CG  1 
ATOM   1760 O OD1 . ASN A 1 230 ? -19.664 99.871  22.525 1.00 28.85  ? 230  ASN A OD1 1 
ATOM   1761 N ND2 . ASN A 1 230 ? -18.996 101.198 20.840 1.00 25.34  ? 230  ASN A ND2 1 
ATOM   1762 N N   . CYS A 1 231 ? -18.086 101.826 25.323 1.00 23.45  ? 231  CYS A N   1 
ATOM   1763 C CA  . CYS A 1 231 ? -18.407 103.162 25.819 1.00 24.45  ? 231  CYS A CA  1 
ATOM   1764 C C   . CYS A 1 231 ? -17.154 103.954 26.180 1.00 25.36  ? 231  CYS A C   1 
ATOM   1765 O O   . CYS A 1 231 ? -16.183 103.402 26.697 1.00 25.56  ? 231  CYS A O   1 
ATOM   1766 C CB  . CYS A 1 231 ? -19.321 103.081 27.035 1.00 24.23  ? 231  CYS A CB  1 
ATOM   1767 S SG  . CYS A 1 231 ? -21.018 102.680 26.617 1.00 23.74  ? 231  CYS A SG  1 
ATOM   1768 N N   . PRO A 1 232 ? -17.209 105.272 25.868 1.00 25.96  ? 232  PRO A N   1 
ATOM   1769 C CA  . PRO A 1 232 ? -16.087 106.220 26.188 1.00 25.74  ? 232  PRO A CA  1 
ATOM   1770 C C   . PRO A 1 232 ? -15.525 106.110 27.593 1.00 26.94  ? 232  PRO A C   1 
ATOM   1771 O O   . PRO A 1 232 ? -14.339 106.334 27.837 1.00 29.11  ? 232  PRO A O   1 
ATOM   1772 C CB  . PRO A 1 232 ? -16.688 107.572 25.904 1.00 24.86  ? 232  PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 232 ? -17.066 107.267 24.512 1.00 26.41  ? 232  PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 232 ? -17.430 105.800 24.504 1.00 25.93  ? 232  PRO A CD  1 
ATOM   1775 N N   . TRP A 1 233 ? -16.397 105.764 28.519 1.00 26.06  ? 233  TRP A N   1 
ATOM   1776 C CA  . TRP A 1 233 ? -16.021 105.657 29.908 1.00 26.03  ? 233  TRP A CA  1 
ATOM   1777 C C   . TRP A 1 233 ? -15.742 104.235 30.383 1.00 26.28  ? 233  TRP A C   1 
ATOM   1778 O O   . TRP A 1 233 ? -15.212 104.051 31.476 1.00 27.39  ? 233  TRP A O   1 
ATOM   1779 C CB  . TRP A 1 233 ? -17.147 106.238 30.788 1.00 25.79  ? 233  TRP A CB  1 
ATOM   1780 C CG  . TRP A 1 233 ? -18.490 105.707 30.347 1.00 24.78  ? 233  TRP A CG  1 
ATOM   1781 C CD1 . TRP A 1 233 ? -19.326 106.230 29.401 1.00 25.01  ? 233  TRP A CD1 1 
ATOM   1782 C CD2 . TRP A 1 233 ? -19.126 104.517 30.827 1.00 23.72  ? 233  TRP A CD2 1 
ATOM   1783 N NE1 . TRP A 1 233 ? -20.441 105.441 29.262 1.00 24.04  ? 233  TRP A NE1 1 
ATOM   1784 C CE2 . TRP A 1 233 ? -20.346 104.382 30.125 1.00 22.26  ? 233  TRP A CE2 1 
ATOM   1785 C CE3 . TRP A 1 233 ? -18.784 103.550 31.782 1.00 23.74  ? 233  TRP A CE3 1 
ATOM   1786 C CZ2 . TRP A 1 233 ? -21.226 103.320 30.347 1.00 21.05  ? 233  TRP A CZ2 1 
ATOM   1787 C CZ3 . TRP A 1 233 ? -19.668 102.484 32.004 1.00 23.06  ? 233  TRP A CZ3 1 
ATOM   1788 C CH2 . TRP A 1 233 ? -20.871 102.384 31.289 1.00 21.60  ? 233  TRP A CH2 1 
ATOM   1789 N N   . ALA A 1 234 ? -16.049 103.235 29.576 1.00 25.94  ? 234  ALA A N   1 
ATOM   1790 C CA  . ALA A 1 234 ? -15.916 101.816 30.006 1.00 26.66  ? 234  ALA A CA  1 
ATOM   1791 C C   . ALA A 1 234 ? -14.528 101.202 29.990 1.00 26.46  ? 234  ALA A C   1 
ATOM   1792 O O   . ALA A 1 234 ? -14.394 100.045 30.379 1.00 27.35  ? 234  ALA A O   1 
ATOM   1793 C CB  . ALA A 1 234 ? -16.847 100.955 29.161 1.00 25.37  ? 234  ALA A CB  1 
ATOM   1794 N N   . SER A 1 235 ? -13.500 101.922 29.556 1.00 25.61  ? 235  SER A N   1 
ATOM   1795 C CA  . SER A 1 235 ? -12.159 101.342 29.548 1.00 25.28  ? 235  SER A CA  1 
ATOM   1796 C C   . SER A 1 235 ? -11.076 102.353 29.225 1.00 24.51  ? 235  SER A C   1 
ATOM   1797 O O   . SER A 1 235 ? -11.355 103.448 28.755 1.00 25.02  ? 235  SER A O   1 
ATOM   1798 C CB  . SER A 1 235 ? -12.103 100.195 28.540 1.00 24.56  ? 235  SER A CB  1 
ATOM   1799 O OG  . SER A 1 235 ? -12.047 100.688 27.213 1.00 27.91  ? 235  SER A OG  1 
ATOM   1800 N N   . VAL A 1 236 ? -9.836  101.974 29.495 1.00 23.42  ? 236  VAL A N   1 
ATOM   1801 C CA  . VAL A 1 236 ? -8.695  102.827 29.208 1.00 24.35  ? 236  VAL A CA  1 
ATOM   1802 C C   . VAL A 1 236 ? -7.552  101.987 28.656 1.00 25.15  ? 236  VAL A C   1 
ATOM   1803 O O   . VAL A 1 236 ? -7.568  100.754 28.722 1.00 23.62  ? 236  VAL A O   1 
ATOM   1804 C CB  . VAL A 1 236 ? -8.178  103.535 30.460 1.00 23.92  ? 236  VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 236 ? -9.235  104.468 31.036 1.00 22.69  ? 236  VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 236 ? -7.728  102.502 31.492 1.00 25.06  ? 236  VAL A CG2 1 
ATOM   1807 N N   . SER A 1 237 ? -6.558  102.665 28.105 1.00 25.59  ? 237  SER A N   1 
ATOM   1808 C CA  . SER A 1 237 ? -5.406  101.972 27.561 1.00 26.53  ? 237  SER A CA  1 
ATOM   1809 C C   . SER A 1 237 ? -4.532  101.561 28.740 1.00 28.20  ? 237  SER A C   1 
ATOM   1810 O O   . SER A 1 237 ? -4.664  102.100 29.854 1.00 28.62  ? 237  SER A O   1 
ATOM   1811 C CB  . SER A 1 237 ? -4.615  102.903 26.652 1.00 24.07  ? 237  SER A CB  1 
ATOM   1812 O OG  . SER A 1 237 ? -3.999  103.915 27.428 1.00 25.47  ? 237  SER A OG  1 
ATOM   1813 N N   . VAL A 1 238 ? -3.645  100.604 28.489 1.00 28.33  ? 238  VAL A N   1 
ATOM   1814 C CA  . VAL A 1 238 ? -2.720  100.124 29.502 1.00 27.49  ? 238  VAL A CA  1 
ATOM   1815 C C   . VAL A 1 238 ? -1.918  101.306 30.049 1.00 25.96  ? 238  VAL A C   1 
ATOM   1816 O O   . VAL A 1 238 ? -1.652  101.390 31.246 1.00 24.58  ? 238  VAL A O   1 
ATOM   1817 C CB  . VAL A 1 238 ? -1.771  99.061  28.893 1.00 29.82  ? 238  VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 238 ? -0.526  98.918  29.741 1.00 33.89  ? 238  VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 238 ? -2.491  97.710  28.807 1.00 29.40  ? 238  VAL A CG2 1 
ATOM   1820 N N   . ALA A 1 239 ? -1.551  102.230 29.170 1.00 25.58  ? 239  ALA A N   1 
ATOM   1821 C CA  . ALA A 1 239 ? -0.788  103.406 29.577 1.00 27.89  ? 239  ALA A CA  1 
ATOM   1822 C C   . ALA A 1 239 ? -1.561  104.325 30.525 1.00 28.91  ? 239  ALA A C   1 
ATOM   1823 O O   . ALA A 1 239 ? -1.054  104.701 31.585 1.00 27.84  ? 239  ALA A O   1 
ATOM   1824 C CB  . ALA A 1 239 ? -0.345  104.188 28.352 1.00 28.84  ? 239  ALA A CB  1 
ATOM   1825 N N   . GLU A 1 240 ? -2.779  104.701 30.144 1.00 29.09  ? 240  GLU A N   1 
ATOM   1826 C CA  . GLU A 1 240 ? -3.576  105.572 30.998 1.00 30.27  ? 240  GLU A CA  1 
ATOM   1827 C C   . GLU A 1 240 ? -3.830  104.849 32.316 1.00 29.75  ? 240  GLU A C   1 
ATOM   1828 O O   . GLU A 1 240 ? -3.790  105.457 33.387 1.00 28.03  ? 240  GLU A O   1 
ATOM   1829 C CB  . GLU A 1 240 ? -4.903  105.927 30.309 1.00 32.56  ? 240  GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 240 ? -5.856  106.803 31.136 1.00 31.58  ? 240  GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 240 ? -5.269  108.164 31.485 1.00 32.82  ? 240  GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 240 ? -4.131  108.466 31.048 1.00 33.95  ? 240  GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 240 ? -5.952  108.932 32.195 1.00 27.33  ? 240  GLU A OE2 1 
ATOM   1834 N N   . GLY A 1 241 ? -4.076  103.542 32.225 1.00 30.27  ? 241  GLY A N   1 
ATOM   1835 C CA  . GLY A 1 241 ? -4.316  102.743 33.417 1.00 30.94  ? 241  GLY A CA  1 
ATOM   1836 C C   . GLY A 1 241 ? -3.148  102.833 34.385 1.00 30.90  ? 241  GLY A C   1 
ATOM   1837 O O   . GLY A 1 241 ? -3.327  102.938 35.602 1.00 30.50  ? 241  GLY A O   1 
ATOM   1838 N N   . ARG A 1 242 ? -1.941  102.793 33.832 1.00 30.77  ? 242  ARG A N   1 
ATOM   1839 C CA  . ARG A 1 242 ? -0.732  102.886 34.634 1.00 31.98  ? 242  ARG A CA  1 
ATOM   1840 C C   . ARG A 1 242 ? -0.520  104.322 35.114 1.00 31.80  ? 242  ARG A C   1 
ATOM   1841 O O   . ARG A 1 242 ? 0.011   104.549 36.200 1.00 32.49  ? 242  ARG A O   1 
ATOM   1842 C CB  . ARG A 1 242 ? 0.462   102.414 33.809 1.00 33.35  ? 242  ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 242 ? 1.822   102.698 34.408 1.00 35.50  ? 242  ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 242 ? 2.886   102.005 33.575 1.00 38.98  ? 242  ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 242 ? 2.753   100.556 33.687 1.00 39.52  ? 242  ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 242 ? 3.233   99.853  34.704 1.00 38.18  ? 242  ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 242 ? 3.886   100.473 35.677 1.00 37.42  ? 242  ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 242 ? 3.030   98.545  34.768 1.00 38.08  ? 242  ARG A NH2 1 
ATOM   1849 N N   . ARG A 1 243 ? -0.940  105.295 34.315 1.00 31.13  ? 243  ARG A N   1 
ATOM   1850 C CA  . ARG A 1 243 ? -0.781  106.683 34.720 1.00 31.29  ? 243  ARG A CA  1 
ATOM   1851 C C   . ARG A 1 243 ? -1.626  106.946 35.961 1.00 31.82  ? 243  ARG A C   1 
ATOM   1852 O O   . ARG A 1 243 ? -1.134  107.469 36.958 1.00 31.99  ? 243  ARG A O   1 
ATOM   1853 C CB  . ARG A 1 243 ? -1.214  107.629 33.601 1.00 31.56  ? 243  ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 243 ? -0.834  109.089 33.841 1.00 32.90  ? 243  ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 243 ? -1.545  110.015 32.865 1.00 34.06  ? 243  ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 243 ? -2.999  109.984 33.054 1.00 36.98  ? 243  ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 243 ? -3.658  110.613 34.029 1.00 37.35  ? 243  ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 243 ? -3.011  111.349 34.927 1.00 36.95  ? 243  ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 243 ? -4.975  110.492 34.118 1.00 39.64  ? 243  ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 244 ? -2.899  106.566 35.907 1.00 32.84  ? 244  ARG A N   1 
ATOM   1861 C CA  . ARG A 1 244 ? -3.796  106.796 37.035 1.00 33.62  ? 244  ARG A CA  1 
ATOM   1862 C C   . ARG A 1 244 ? -3.342  106.073 38.291 1.00 35.08  ? 244  ARG A C   1 
ATOM   1863 O O   . ARG A 1 244 ? -3.389  106.637 39.389 1.00 35.50  ? 244  ARG A O   1 
ATOM   1864 C CB  . ARG A 1 244 ? -5.216  106.383 36.667 1.00 30.93  ? 244  ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 244 ? -5.740  107.172 35.484 1.00 30.39  ? 244  ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 244 ? -7.177  106.837 35.157 1.00 29.04  ? 244  ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 244 ? -7.614  107.515 33.943 1.00 27.39  ? 244  ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 244 ? -8.861  107.503 33.491 1.00 25.72  ? 244  ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 244 ? -9.795  106.842 34.160 1.00 24.58  ? 244  ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 244 ? -9.172  108.154 32.377 1.00 23.57  ? 244  ARG A NH2 1 
ATOM   1871 N N   . ALA A 1 245 ? -2.898  104.828 38.127 1.00 35.07  ? 245  ALA A N   1 
ATOM   1872 C CA  . ALA A 1 245 ? -2.420  104.043 39.255 1.00 33.18  ? 245  ALA A CA  1 
ATOM   1873 C C   . ALA A 1 245 ? -1.298  104.818 39.944 1.00 33.19  ? 245  ALA A C   1 
ATOM   1874 O O   . ALA A 1 245 ? -1.302  104.978 41.165 1.00 33.67  ? 245  ALA A O   1 
ATOM   1875 C CB  . ALA A 1 245 ? -1.915  102.692 38.776 1.00 34.27  ? 245  ALA A CB  1 
ATOM   1876 N N   . VAL A 1 246 ? -0.342  105.311 39.164 1.00 31.49  ? 246  VAL A N   1 
ATOM   1877 C CA  . VAL A 1 246 ? 0.752   106.070 39.744 1.00 30.65  ? 246  VAL A CA  1 
ATOM   1878 C C   . VAL A 1 246 ? 0.201   107.301 40.434 1.00 31.39  ? 246  VAL A C   1 
ATOM   1879 O O   . VAL A 1 246 ? 0.528   107.574 41.590 1.00 31.43  ? 246  VAL A O   1 
ATOM   1880 C CB  . VAL A 1 246 ? 1.749   106.541 38.688 1.00 30.86  ? 246  VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 246 ? 2.848   107.360 39.357 1.00 29.55  ? 246  VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 246 ? 2.334   105.349 37.961 1.00 29.61  ? 246  VAL A CG2 1 
ATOM   1883 N N   . GLU A 1 247 ? -0.648  108.035 39.718 1.00 32.28  ? 247  GLU A N   1 
ATOM   1884 C CA  . GLU A 1 247 ? -1.242  109.255 40.249 1.00 32.62  ? 247  GLU A CA  1 
ATOM   1885 C C   . GLU A 1 247 ? -1.905  109.002 41.592 1.00 30.64  ? 247  GLU A C   1 
ATOM   1886 O O   . GLU A 1 247 ? -1.780  109.800 42.511 1.00 28.41  ? 247  GLU A O   1 
ATOM   1887 C CB  . GLU A 1 247 ? -2.257  109.817 39.260 1.00 35.91  ? 247  GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 247 ? -2.571  111.293 39.482 1.00 41.42  ? 247  GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 247 ? -1.327  112.172 39.441 1.00 43.65  ? 247  GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 247 ? -0.561  112.079 38.460 1.00 48.68  ? 247  GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 247 ? -1.114  112.961 40.384 1.00 43.38  ? 247  GLU A OE2 1 
ATOM   1892 N N   . LEU A 1 248 ? -2.613  107.886 41.701 1.00 31.78  ? 248  LEU A N   1 
ATOM   1893 C CA  . LEU A 1 248 ? -3.272  107.527 42.950 1.00 33.03  ? 248  LEU A CA  1 
ATOM   1894 C C   . LEU A 1 248 ? -2.191  107.450 44.031 1.00 35.10  ? 248  LEU A C   1 
ATOM   1895 O O   . LEU A 1 248 ? -2.344  107.989 45.129 1.00 34.56  ? 248  LEU A O   1 
ATOM   1896 C CB  . LEU A 1 248 ? -3.965  106.171 42.807 1.00 30.23  ? 248  LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 248 ? -4.679  105.604 44.036 1.00 30.04  ? 248  LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 248 ? -5.891  106.473 44.358 1.00 28.79  ? 248  LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 248 ? -5.108  104.153 43.776 1.00 26.89  ? 248  LEU A CD2 1 
ATOM   1900 N N   . GLY A 1 249 ? -1.091  106.778 43.698 1.00 37.47  ? 249  GLY A N   1 
ATOM   1901 C CA  . GLY A 1 249 ? 0.011   106.636 44.632 1.00 37.31  ? 249  GLY A CA  1 
ATOM   1902 C C   . GLY A 1 249 ? 0.568   107.981 45.043 1.00 37.01  ? 249  GLY A C   1 
ATOM   1903 O O   . GLY A 1 249 ? 0.817   108.231 46.221 1.00 36.54  ? 249  GLY A O   1 
ATOM   1904 N N   . ARG A 1 250 ? 0.773   108.854 44.067 1.00 37.89  ? 250  ARG A N   1 
ATOM   1905 C CA  . ARG A 1 250 ? 1.286   110.183 44.356 1.00 39.58  ? 250  ARG A CA  1 
ATOM   1906 C C   . ARG A 1 250 ? 0.305   110.860 45.305 1.00 39.85  ? 250  ARG A C   1 
ATOM   1907 O O   . ARG A 1 250 ? 0.701   111.493 46.283 1.00 39.19  ? 250  ARG A O   1 
ATOM   1908 C CB  . ARG A 1 250 ? 1.405   110.990 43.063 1.00 41.32  ? 250  ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 250 ? 1.940   112.394 43.251 1.00 43.71  ? 250  ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 250 ? 1.983   113.160 41.933 1.00 47.77  ? 250  ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 250 ? 2.924   112.595 40.958 1.00 52.50  ? 250  ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 250 ? 2.648   111.619 40.089 1.00 54.28  ? 250  ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 250 ? 1.440   111.061 40.046 1.00 54.12  ? 250  ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 250 ? 3.587   111.205 39.245 1.00 53.53  ? 250  ARG A NH2 1 
ATOM   1915 N N   . ASN A 1 251 ? -0.981  110.698 45.004 1.00 40.79  ? 251  ASN A N   1 
ATOM   1916 C CA  . ASN A 1 251 ? -2.072  111.265 45.794 1.00 41.24  ? 251  ASN A CA  1 
ATOM   1917 C C   . ASN A 1 251 ? -2.090  110.749 47.224 1.00 40.45  ? 251  ASN A C   1 
ATOM   1918 O O   . ASN A 1 251 ? -2.784  111.299 48.078 1.00 40.61  ? 251  ASN A O   1 
ATOM   1919 C CB  . ASN A 1 251 ? -3.414  110.940 45.130 1.00 43.72  ? 251  ASN A CB  1 
ATOM   1920 C CG  . ASN A 1 251 ? -3.991  112.115 44.361 1.00 44.21  ? 251  ASN A CG  1 
ATOM   1921 O OD1 . ASN A 1 251 ? -4.721  112.936 44.922 1.00 44.93  ? 251  ASN A OD1 1 
ATOM   1922 N ND2 . ASN A 1 251 ? -3.659  112.205 43.072 1.00 41.97  ? 251  ASN A ND2 1 
ATOM   1923 N N   . LEU A 1 252 ? -1.332  109.690 47.483 1.00 40.31  ? 252  LEU A N   1 
ATOM   1924 C CA  . LEU A 1 252 ? -1.282  109.103 48.811 1.00 40.00  ? 252  LEU A CA  1 
ATOM   1925 C C   . LEU A 1 252 ? 0.136   109.048 49.374 1.00 41.71  ? 252  LEU A C   1 
ATOM   1926 O O   . LEU A 1 252 ? 0.419   108.278 50.292 1.00 42.22  ? 252  LEU A O   1 
ATOM   1927 C CB  . LEU A 1 252 ? -1.894  107.702 48.779 1.00 37.04  ? 252  LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 252 ? -3.392  107.658 48.455 1.00 35.87  ? 252  LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 252 ? -3.833  106.224 48.285 1.00 34.85  ? 252  LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 252 ? -4.190  108.325 49.565 1.00 34.69  ? 252  LEU A CD2 1 
ATOM   1931 N N   . ASN A 1 253 ? 1.021   109.875 48.828 1.00 43.35  ? 253  ASN A N   1 
ATOM   1932 C CA  . ASN A 1 253 ? 2.408   109.930 49.286 1.00 47.00  ? 253  ASN A CA  1 
ATOM   1933 C C   . ASN A 1 253 ? 3.028   108.532 49.339 1.00 47.19  ? 253  ASN A C   1 
ATOM   1934 O O   . ASN A 1 253 ? 3.315   108.005 50.415 1.00 47.19  ? 253  ASN A O   1 
ATOM   1935 C CB  . ASN A 1 253 ? 2.475   110.580 50.668 1.00 49.42  ? 253  ASN A CB  1 
ATOM   1936 C CG  . ASN A 1 253 ? 3.900   110.817 51.130 1.00 54.32  ? 253  ASN A CG  1 
ATOM   1937 O OD1 . ASN A 1 253 ? 4.659   111.557 50.492 1.00 56.11  ? 253  ASN A OD1 1 
ATOM   1938 N ND2 . ASN A 1 253 ? 4.276   110.189 52.245 1.00 55.92  ? 253  ASN A ND2 1 
ATOM   1939 N N   . CYS A 1 254 ? 3.241   107.953 48.161 1.00 46.55  ? 254  CYS A N   1 
ATOM   1940 C CA  . CYS A 1 254 ? 3.794   106.613 48.021 1.00 45.51  ? 254  CYS A CA  1 
ATOM   1941 C C   . CYS A 1 254 ? 5.128   106.573 47.281 1.00 47.36  ? 254  CYS A C   1 
ATOM   1942 O O   . CYS A 1 254 ? 5.469   107.501 46.543 1.00 46.97  ? 254  CYS A O   1 
ATOM   1943 C CB  . CYS A 1 254 ? 2.819   105.713 47.234 1.00 43.87  ? 254  CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 254 ? 1.416   105.073 48.206 1.00 44.18  ? 254  CYS A SG  1 
ATOM   1945 N N   . ASN A 1 255 ? 5.913   105.523 47.513 1.00 49.22  ? 255  ASN A N   1 
ATOM   1946 C CA  . ASN A 1 255 ? 7.134   105.306 46.757 1.00 49.94  ? 255  ASN A CA  1 
ATOM   1947 C C   . ASN A 1 255 ? 6.634   104.995 45.348 1.00 49.91  ? 255  ASN A C   1 
ATOM   1948 O O   . ASN A 1 255 ? 5.749   104.152 45.172 1.00 48.77  ? 255  ASN A O   1 
ATOM   1949 C CB  . ASN A 1 255 ? 7.929   104.103 47.288 1.00 51.76  ? 255  ASN A CB  1 
ATOM   1950 C CG  . ASN A 1 255 ? 8.956   104.487 48.350 1.00 54.30  ? 255  ASN A CG  1 
ATOM   1951 O OD1 . ASN A 1 255 ? 9.445   105.606 48.356 1.00 56.20  ? 255  ASN A OD1 1 
ATOM   1952 N ND2 . ASN A 1 255 ? 9.275   103.544 49.238 1.00 54.04  ? 255  ASN A ND2 1 
ATOM   1953 N N   . LEU A 1 256 ? 7.186   105.671 44.350 1.00 49.99  ? 256  LEU A N   1 
ATOM   1954 C CA  . LEU A 1 256 ? 6.750   105.453 42.977 1.00 50.94  ? 256  LEU A CA  1 
ATOM   1955 C C   . LEU A 1 256 ? 7.757   104.687 42.116 1.00 51.77  ? 256  LEU A C   1 
ATOM   1956 O O   . LEU A 1 256 ? 7.378   104.040 41.138 1.00 52.81  ? 256  LEU A O   1 
ATOM   1957 C CB  . LEU A 1 256 ? 6.398   106.802 42.339 1.00 50.07  ? 256  LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 256 ? 5.490   107.653 43.196 1.00 48.41  ? 256  LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 256 ? 5.308   109.026 42.577 1.00 48.24  ? 256  LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 256 ? 4.139   106.988 43.383 1.00 47.84  ? 256  LEU A CD2 1 
ATOM   1961 N N   . ASN A 1 257 ? 9.032   104.730 42.493 1.00 51.57  ? 257  ASN A N   1 
ATOM   1962 C CA  . ASN A 1 257 ? 10.130  104.096 41.786 1.00 50.77  ? 257  ASN A CA  1 
ATOM   1963 C C   . ASN A 1 257 ? 9.815   102.800 41.029 1.00 49.58  ? 257  ASN A C   1 
ATOM   1964 O O   . ASN A 1 257 ? 10.406  102.553 39.981 1.00 49.59  ? 257  ASN A O   1 
ATOM   1965 C CB  . ASN A 1 257 ? 11.295  103.838 42.758 1.00 51.64  ? 257  ASN A CB  1 
ATOM   1966 C CG  . ASN A 1 257 ? 10.860  103.104 44.024 1.00 53.30  ? 257  ASN A CG  1 
ATOM   1967 O OD1 . ASN A 1 257 ? 11.664  102.859 44.923 1.00 54.28  ? 257  ASN A OD1 1 
ATOM   1968 N ND2 . ASN A 1 257 ? 9.585   102.754 44.098 1.00 56.05  ? 257  ASN A ND2 1 
ATOM   1969 N N   . SER A 1 258 ? 8.900   101.975 41.540 1.00 47.98  ? 258  SER A N   1 
ATOM   1970 C CA  . SER A 1 258 ? 8.573   100.713 40.868 1.00 46.28  ? 258  SER A CA  1 
ATOM   1971 C C   . SER A 1 258 ? 7.221   100.138 41.270 1.00 44.96  ? 258  SER A C   1 
ATOM   1972 O O   . SER A 1 258 ? 6.710   100.429 42.354 1.00 43.66  ? 258  SER A O   1 
ATOM   1973 C CB  . SER A 1 258 ? 9.653   99.669  41.164 1.00 45.85  ? 258  SER A CB  1 
ATOM   1974 O OG  . SER A 1 258 ? 9.660   99.322  42.538 1.00 45.22  ? 258  SER A OG  1 
ATOM   1975 N N   . ASP A 1 259 ? 6.656   99.306  40.396 1.00 43.34  ? 259  ASP A N   1 
ATOM   1976 C CA  . ASP A 1 259 ? 5.362   98.682  40.661 1.00 43.34  ? 259  ASP A CA  1 
ATOM   1977 C C   . ASP A 1 259 ? 5.302   98.078  42.059 1.00 42.96  ? 259  ASP A C   1 
ATOM   1978 O O   . ASP A 1 259 ? 4.379   98.352  42.826 1.00 43.35  ? 259  ASP A O   1 
ATOM   1979 C CB  . ASP A 1 259 ? 5.071   97.582  39.638 1.00 43.53  ? 259  ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 259 ? 4.836   98.124  38.245 1.00 44.74  ? 259  ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 259 ? 3.880   98.900  38.062 1.00 46.92  ? 259  ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 259 ? 5.602   97.772  37.328 1.00 45.37  ? 259  ASP A OD2 1 
ATOM   1983 N N   . GLU A 1 260 ? 6.297   97.260  42.381 1.00 43.19  ? 260  GLU A N   1 
ATOM   1984 C CA  . GLU A 1 260 ? 6.377   96.592  43.677 1.00 43.00  ? 260  GLU A CA  1 
ATOM   1985 C C   . GLU A 1 260 ? 6.251   97.557  44.864 1.00 42.48  ? 260  GLU A C   1 
ATOM   1986 O O   . GLU A 1 260 ? 5.512   97.292  45.811 1.00 41.55  ? 260  GLU A O   1 
ATOM   1987 C CB  . GLU A 1 260 ? 7.696   95.820  43.782 1.00 42.38  ? 260  GLU A CB  1 
ATOM   1988 C CG  . GLU A 1 260 ? 7.964   94.823  42.651 1.00 43.65  ? 260  GLU A CG  1 
ATOM   1989 C CD  . GLU A 1 260 ? 8.290   95.487  41.315 1.00 45.05  ? 260  GLU A CD  1 
ATOM   1990 O OE1 . GLU A 1 260 ? 9.014   96.509  41.302 1.00 46.47  ? 260  GLU A OE1 1 
ATOM   1991 O OE2 . GLU A 1 260 ? 7.837   94.974  40.270 1.00 46.71  ? 260  GLU A OE2 1 
ATOM   1992 N N   . GLU A 1 261 ? 6.981   98.667  44.818 1.00 42.08  ? 261  GLU A N   1 
ATOM   1993 C CA  . GLU A 1 261 ? 6.933   99.653  45.895 1.00 42.86  ? 261  GLU A CA  1 
ATOM   1994 C C   . GLU A 1 261 ? 5.560   100.321 45.977 1.00 42.23  ? 261  GLU A C   1 
ATOM   1995 O O   . GLU A 1 261 ? 5.027   100.538 47.067 1.00 42.14  ? 261  GLU A O   1 
ATOM   1996 C CB  . GLU A 1 261 ? 8.010   100.716 45.676 1.00 45.21  ? 261  GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 261 ? 9.429   100.182 45.771 1.00 48.98  ? 261  GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 261 ? 9.977   100.213 47.189 1.00 51.66  ? 261  GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 261 ? 9.248   99.817  48.126 1.00 52.09  ? 261  GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 261 ? 11.144  100.629 47.363 1.00 53.76  ? 261  GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 262 ? 4.997   100.645 44.815 1.00 41.66  ? 262  LEU A N   1 
ATOM   2002 C CA  . LEU A 1 262 ? 3.690   101.285 44.741 1.00 39.88  ? 262  LEU A CA  1 
ATOM   2003 C C   . LEU A 1 262 ? 2.578   100.353 45.210 1.00 39.06  ? 262  LEU A C   1 
ATOM   2004 O O   . LEU A 1 262 ? 1.654   100.787 45.896 1.00 40.61  ? 262  LEU A O   1 
ATOM   2005 C CB  . LEU A 1 262 ? 3.403   101.753 43.306 1.00 39.18  ? 262  LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 262 ? 2.026   102.378 43.021 1.00 37.89  ? 262  LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 262 ? 1.784   103.554 43.946 1.00 35.67  ? 262  LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 262 ? 1.947   102.825 41.566 1.00 35.99  ? 262  LEU A CD2 1 
ATOM   2009 N N   . ILE A 1 263 ? 2.659   99.080  44.844 1.00 36.40  ? 263  ILE A N   1 
ATOM   2010 C CA  . ILE A 1 263 ? 1.634   98.133  45.252 1.00 36.80  ? 263  ILE A CA  1 
ATOM   2011 C C   . ILE A 1 263 ? 1.654   97.982  46.770 1.00 39.22  ? 263  ILE A C   1 
ATOM   2012 O O   . ILE A 1 263 ? 0.601   97.914  47.416 1.00 40.49  ? 263  ILE A O   1 
ATOM   2013 C CB  . ILE A 1 263 ? 1.857   96.722  44.651 1.00 35.58  ? 263  ILE A CB  1 
ATOM   2014 C CG1 . ILE A 1 263 ? 1.987   96.785  43.125 1.00 33.29  ? 263  ILE A CG1 1 
ATOM   2015 C CG2 . ILE A 1 263 ? 0.710   95.806  45.069 1.00 32.04  ? 263  ILE A CG2 1 
ATOM   2016 C CD1 . ILE A 1 263 ? 0.718   97.113  42.413 1.00 35.53  ? 263  ILE A CD1 1 
ATOM   2017 N N   . HIS A 1 264 ? 2.857   97.920  47.337 1.00 40.31  ? 264  HIS A N   1 
ATOM   2018 C CA  . HIS A 1 264 ? 3.008   97.752  48.779 1.00 40.66  ? 264  HIS A CA  1 
ATOM   2019 C C   . HIS A 1 264 ? 2.380   98.899  49.532 1.00 40.24  ? 264  HIS A C   1 
ATOM   2020 O O   . HIS A 1 264 ? 1.762   98.706  50.581 1.00 40.50  ? 264  HIS A O   1 
ATOM   2021 C CB  . HIS A 1 264 ? 4.481   97.670  49.183 1.00 41.57  ? 264  HIS A CB  1 
ATOM   2022 C CG  . HIS A 1 264 ? 4.691   97.726  50.665 1.00 43.76  ? 264  HIS A CG  1 
ATOM   2023 N ND1 . HIS A 1 264 ? 4.313   96.703  51.510 1.00 45.71  ? 264  HIS A ND1 1 
ATOM   2024 C CD2 . HIS A 1 264 ? 5.161   98.715  51.462 1.00 43.54  ? 264  HIS A CD2 1 
ATOM   2025 C CE1 . HIS A 1 264 ? 4.538   97.062  52.762 1.00 44.57  ? 264  HIS A CE1 1 
ATOM   2026 N NE2 . HIS A 1 264 ? 5.051   98.279  52.761 1.00 43.58  ? 264  HIS A NE2 1 
ATOM   2027 N N   . CYS A 1 265 ? 2.561   100.096 48.991 1.00 39.38  ? 265  CYS A N   1 
ATOM   2028 C CA  . CYS A 1 265 ? 2.029   101.303 49.594 1.00 39.12  ? 265  CYS A CA  1 
ATOM   2029 C C   . CYS A 1 265 ? 0.514   101.337 49.557 1.00 38.11  ? 265  CYS A C   1 
ATOM   2030 O O   . CYS A 1 265 ? -0.134  101.631 50.557 1.00 38.71  ? 265  CYS A O   1 
ATOM   2031 C CB  . CYS A 1 265 ? 2.581   102.508 48.866 1.00 39.86  ? 265  CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 265 ? 2.187   104.099 49.639 1.00 44.83  ? 265  CYS A SG  1 
ATOM   2033 N N   . LEU A 1 266 ? -0.053  101.031 48.399 1.00 36.90  ? 266  LEU A N   1 
ATOM   2034 C CA  . LEU A 1 266 ? -1.499  101.038 48.253 1.00 36.26  ? 266  LEU A CA  1 
ATOM   2035 C C   . LEU A 1 266 ? -2.144  99.901  49.021 1.00 36.81  ? 266  LEU A C   1 
ATOM   2036 O O   . LEU A 1 266 ? -3.340  99.947  49.313 1.00 35.88  ? 266  LEU A O   1 
ATOM   2037 C CB  . LEU A 1 266 ? -1.882  100.938 46.779 1.00 33.40  ? 266  LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 266 ? -1.292  102.066 45.939 1.00 30.92  ? 266  LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 266 ? -1.673  101.868 44.485 1.00 29.42  ? 266  LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 266 ? -1.787  103.406 46.468 1.00 30.12  ? 266  LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 267 ? -1.355  98.883  49.353 1.00 37.68  ? 267  ARG A N   1 
ATOM   2042 C CA  . ARG A 1 267 ? -1.889  97.739  50.083 1.00 38.58  ? 267  ARG A CA  1 
ATOM   2043 C C   . ARG A 1 267 ? -1.925  97.947  51.595 1.00 39.09  ? 267  ARG A C   1 
ATOM   2044 O O   . ARG A 1 267 ? -2.508  97.139  52.324 1.00 38.88  ? 267  ARG A O   1 
ATOM   2045 C CB  . ARG A 1 267 ? -1.103  96.468  49.742 1.00 39.16  ? 267  ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 267 ? -1.374  95.935  48.343 1.00 40.23  ? 267  ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 267 ? -0.892  94.503  48.193 1.00 40.96  ? 267  ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 267 ? -1.211  93.968  46.874 1.00 43.86  ? 267  ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 267 ? -0.906  92.742  46.462 1.00 44.02  ? 267  ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 267 ? -0.267  91.906  47.271 1.00 46.48  ? 267  ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 267 ? -1.240  92.349  45.240 1.00 43.04  ? 267  ARG A NH2 1 
ATOM   2052 N N   . GLU A 1 268 ? -1.310  99.028  52.069 1.00 38.09  ? 268  GLU A N   1 
ATOM   2053 C CA  . GLU A 1 268 ? -1.314  99.308  53.497 1.00 38.09  ? 268  GLU A CA  1 
ATOM   2054 C C   . GLU A 1 268 ? -2.426  100.279 53.816 1.00 38.52  ? 268  GLU A C   1 
ATOM   2055 O O   . GLU A 1 268 ? -3.047  100.191 54.878 1.00 40.31  ? 268  GLU A O   1 
ATOM   2056 C CB  . GLU A 1 268 ? -0.008  99.937  53.945 1.00 38.08  ? 268  GLU A CB  1 
ATOM   2057 C CG  . GLU A 1 268 ? 1.217   99.091  53.753 1.00 37.52  ? 268  GLU A CG  1 
ATOM   2058 C CD  . GLU A 1 268 ? 2.452   99.819  54.216 1.00 36.31  ? 268  GLU A CD  1 
ATOM   2059 O OE1 . GLU A 1 268 ? 2.480   101.060 54.054 1.00 34.77  ? 268  GLU A OE1 1 
ATOM   2060 O OE2 . GLU A 1 268 ? 3.388   99.164  54.724 1.00 36.08  ? 268  GLU A OE2 1 
ATOM   2061 N N   . LYS A 1 269 ? -2.662  101.211 52.897 1.00 37.45  ? 269  LYS A N   1 
ATOM   2062 C CA  . LYS A 1 269 ? -3.697  102.227 53.066 1.00 35.99  ? 269  LYS A CA  1 
ATOM   2063 C C   . LYS A 1 269 ? -5.069  101.620 53.319 1.00 36.21  ? 269  LYS A C   1 
ATOM   2064 O O   . LYS A 1 269 ? -5.437  100.616 52.698 1.00 36.43  ? 269  LYS A O   1 
ATOM   2065 C CB  . LYS A 1 269 ? -3.769  103.112 51.825 1.00 34.17  ? 269  LYS A CB  1 
ATOM   2066 C CG  . LYS A 1 269 ? -2.438  103.678 51.392 1.00 33.67  ? 269  LYS A CG  1 
ATOM   2067 C CD  . LYS A 1 269 ? -1.808  104.521 52.482 1.00 34.28  ? 269  LYS A CD  1 
ATOM   2068 C CE  . LYS A 1 269 ? -0.469  105.072 52.023 1.00 36.11  ? 269  LYS A CE  1 
ATOM   2069 N NZ  . LYS A 1 269 ? 0.150   105.988 53.023 1.00 37.79  ? 269  LYS A NZ  1 
ATOM   2070 N N   . LYS A 1 270 ? -5.823  102.224 54.235 1.00 36.09  ? 270  LYS A N   1 
ATOM   2071 C CA  . LYS A 1 270 ? -7.166  101.739 54.535 1.00 37.84  ? 270  LYS A CA  1 
ATOM   2072 C C   . LYS A 1 270 ? -8.047  102.014 53.324 1.00 36.27  ? 270  LYS A C   1 
ATOM   2073 O O   . LYS A 1 270 ? -7.772  102.931 52.553 1.00 38.00  ? 270  LYS A O   1 
ATOM   2074 C CB  . LYS A 1 270 ? -7.745  102.452 55.755 1.00 38.53  ? 270  LYS A CB  1 
ATOM   2075 C CG  . LYS A 1 270 ? -7.166  102.004 57.071 1.00 42.42  ? 270  LYS A CG  1 
ATOM   2076 C CD  . LYS A 1 270 ? -7.876  102.700 58.220 1.00 48.82  ? 270  LYS A CD  1 
ATOM   2077 C CE  . LYS A 1 270 ? -7.324  102.274 59.584 1.00 52.47  ? 270  LYS A CE  1 
ATOM   2078 N NZ  . LYS A 1 270 ? -7.922  103.064 60.709 1.00 52.61  ? 270  LYS A NZ  1 
ATOM   2079 N N   . PRO A 1 271 ? -9.116  101.228 53.141 1.00 34.53  ? 271  PRO A N   1 
ATOM   2080 C CA  . PRO A 1 271 ? -10.013 101.425 52.001 1.00 34.78  ? 271  PRO A CA  1 
ATOM   2081 C C   . PRO A 1 271 ? -10.471 102.868 51.784 1.00 34.49  ? 271  PRO A C   1 
ATOM   2082 O O   . PRO A 1 271 ? -10.489 103.347 50.652 1.00 35.92  ? 271  PRO A O   1 
ATOM   2083 C CB  . PRO A 1 271 ? -11.179 100.488 52.313 1.00 33.82  ? 271  PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 271 ? -10.504 99.360  53.010 1.00 33.61  ? 271  PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 271 ? -9.552  100.079 53.953 1.00 34.60  ? 271  PRO A CD  1 
ATOM   2086 N N   . GLN A 1 272 ? -10.822 103.575 52.852 1.00 33.80  ? 272  GLN A N   1 
ATOM   2087 C CA  . GLN A 1 272 ? -11.301 104.946 52.685 1.00 35.84  ? 272  GLN A CA  1 
ATOM   2088 C C   . GLN A 1 272 ? -10.247 105.917 52.183 1.00 36.19  ? 272  GLN A C   1 
ATOM   2089 O O   . GLN A 1 272 ? -10.571 106.904 51.520 1.00 35.58  ? 272  GLN A O   1 
ATOM   2090 C CB  . GLN A 1 272 ? -11.893 105.489 53.989 1.00 36.78  ? 272  GLN A CB  1 
ATOM   2091 C CG  . GLN A 1 272 ? -12.794 106.705 53.773 1.00 36.05  ? 272  GLN A CG  1 
ATOM   2092 C CD  . GLN A 1 272 ? -13.939 106.403 52.813 1.00 35.40  ? 272  GLN A CD  1 
ATOM   2093 O OE1 . GLN A 1 272 ? -14.677 105.433 53.001 1.00 34.89  ? 272  GLN A OE1 1 
ATOM   2094 N NE2 . GLN A 1 272 ? -14.090 107.228 51.781 1.00 33.08  ? 272  GLN A NE2 1 
ATOM   2095 N N   . GLU A 1 273 ? -8.989  105.643 52.510 1.00 36.57  ? 273  GLU A N   1 
ATOM   2096 C CA  . GLU A 1 273 ? -7.896  106.503 52.088 1.00 36.67  ? 273  GLU A CA  1 
ATOM   2097 C C   . GLU A 1 273 ? -7.835  106.523 50.571 1.00 35.92  ? 273  GLU A C   1 
ATOM   2098 O O   . GLU A 1 273 ? -7.791  107.585 49.957 1.00 35.99  ? 273  GLU A O   1 
ATOM   2099 C CB  . GLU A 1 273 ? -6.577  105.988 52.648 1.00 38.97  ? 273  GLU A CB  1 
ATOM   2100 C CG  . GLU A 1 273 ? -6.575  105.806 54.148 1.00 40.01  ? 273  GLU A CG  1 
ATOM   2101 C CD  . GLU A 1 273 ? -5.172  105.711 54.700 1.00 41.74  ? 273  GLU A CD  1 
ATOM   2102 O OE1 . GLU A 1 273 ? -4.421  106.700 54.557 1.00 40.32  ? 273  GLU A OE1 1 
ATOM   2103 O OE2 . GLU A 1 273 ? -4.821  104.652 55.268 1.00 44.03  ? 273  GLU A OE2 1 
ATOM   2104 N N   . LEU A 1 274 ? -7.831  105.335 49.977 1.00 34.94  ? 274  LEU A N   1 
ATOM   2105 C CA  . LEU A 1 274 ? -7.787  105.202 48.532 1.00 34.55  ? 274  LEU A CA  1 
ATOM   2106 C C   . LEU A 1 274 ? -8.999  105.904 47.939 1.00 34.45  ? 274  LEU A C   1 
ATOM   2107 O O   . LEU A 1 274 ? -8.866  106.750 47.051 1.00 35.17  ? 274  LEU A O   1 
ATOM   2108 C CB  . LEU A 1 274 ? -7.796  103.719 48.135 1.00 35.90  ? 274  LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 274 ? -6.457  102.988 47.939 1.00 38.86  ? 274  LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 274 ? -5.490  103.364 49.033 1.00 39.82  ? 274  LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 274 ? -6.681  101.480 47.921 1.00 38.27  ? 274  LEU A CD2 1 
ATOM   2112 N N   . ILE A 1 275 ? -10.177 105.560 48.452 1.00 31.05  ? 275  ILE A N   1 
ATOM   2113 C CA  . ILE A 1 275 ? -11.422 106.136 47.974 1.00 28.75  ? 275  ILE A CA  1 
ATOM   2114 C C   . ILE A 1 275 ? -11.482 107.652 48.039 1.00 27.73  ? 275  ILE A C   1 
ATOM   2115 O O   . ILE A 1 275 ? -12.030 108.282 47.149 1.00 27.37  ? 275  ILE A O   1 
ATOM   2116 C CB  . ILE A 1 275 ? -12.618 105.579 48.753 1.00 29.35  ? 275  ILE A CB  1 
ATOM   2117 C CG1 . ILE A 1 275 ? -12.731 104.076 48.499 1.00 28.95  ? 275  ILE A CG1 1 
ATOM   2118 C CG2 . ILE A 1 275 ? -13.903 106.298 48.334 1.00 26.74  ? 275  ILE A CG2 1 
ATOM   2119 C CD1 . ILE A 1 275 ? -13.723 103.381 49.406 1.00 30.20  ? 275  ILE A CD1 1 
ATOM   2120 N N   . ASP A 1 276 ? -10.920 108.246 49.081 1.00 28.69  ? 276  ASP A N   1 
ATOM   2121 C CA  . ASP A 1 276 ? -10.979 109.693 49.197 1.00 30.66  ? 276  ASP A CA  1 
ATOM   2122 C C   . ASP A 1 276 ? -10.255 110.463 48.113 1.00 31.24  ? 276  ASP A C   1 
ATOM   2123 O O   . ASP A 1 276 ? -10.626 111.594 47.809 1.00 32.78  ? 276  ASP A O   1 
ATOM   2124 C CB  . ASP A 1 276 ? -10.479 110.144 50.565 1.00 31.57  ? 276  ASP A CB  1 
ATOM   2125 C CG  . ASP A 1 276 ? -11.488 109.878 51.655 1.00 33.09  ? 276  ASP A CG  1 
ATOM   2126 O OD1 . ASP A 1 276 ? -12.669 109.646 51.313 1.00 30.87  ? 276  ASP A OD1 1 
ATOM   2127 O OD2 . ASP A 1 276 ? -11.107 109.912 52.845 1.00 35.63  ? 276  ASP A OD2 1 
ATOM   2128 N N   . VAL A 1 277 ? -9.237  109.865 47.513 1.00 31.40  ? 277  VAL A N   1 
ATOM   2129 C CA  . VAL A 1 277 ? -8.501  110.570 46.475 1.00 31.70  ? 277  VAL A CA  1 
ATOM   2130 C C   . VAL A 1 277 ? -8.700  109.923 45.119 1.00 30.98  ? 277  VAL A C   1 
ATOM   2131 O O   . VAL A 1 277 ? -8.008  110.248 44.158 1.00 32.32  ? 277  VAL A O   1 
ATOM   2132 C CB  . VAL A 1 277 ? -6.992  110.629 46.810 1.00 32.93  ? 277  VAL A CB  1 
ATOM   2133 C CG1 . VAL A 1 277 ? -6.816  111.087 48.253 1.00 32.47  ? 277  VAL A CG1 1 
ATOM   2134 C CG2 . VAL A 1 277 ? -6.339  109.266 46.599 1.00 34.89  ? 277  VAL A CG2 1 
ATOM   2135 N N   . GLU A 1 278 ? -9.670  109.023 45.047 1.00 29.82  ? 278  GLU A N   1 
ATOM   2136 C CA  . GLU A 1 278 ? -9.974  108.302 43.821 1.00 29.25  ? 278  GLU A CA  1 
ATOM   2137 C C   . GLU A 1 278 ? -10.295 109.173 42.604 1.00 30.44  ? 278  GLU A C   1 
ATOM   2138 O O   . GLU A 1 278 ? -9.869  108.871 41.484 1.00 31.10  ? 278  GLU A O   1 
ATOM   2139 C CB  . GLU A 1 278 ? -11.139 107.356 44.062 1.00 28.49  ? 278  GLU A CB  1 
ATOM   2140 C CG  . GLU A 1 278 ? -11.461 106.498 42.872 1.00 31.03  ? 278  GLU A CG  1 
ATOM   2141 C CD  . GLU A 1 278 ? -12.784 105.794 43.028 1.00 33.50  ? 278  GLU A CD  1 
ATOM   2142 O OE1 . GLU A 1 278 ? -12.996 105.163 44.086 1.00 34.11  ? 278  GLU A OE1 1 
ATOM   2143 O OE2 . GLU A 1 278 ? -13.611 105.869 42.093 1.00 36.26  ? 278  GLU A OE2 1 
ATOM   2144 N N   . TRP A 1 279 ? -11.052 110.245 42.801 1.00 29.83  ? 279  TRP A N   1 
ATOM   2145 C CA  . TRP A 1 279 ? -11.404 111.089 41.671 1.00 28.46  ? 279  TRP A CA  1 
ATOM   2146 C C   . TRP A 1 279 ? -10.256 111.945 41.174 1.00 29.26  ? 279  TRP A C   1 
ATOM   2147 O O   . TRP A 1 279 ? -10.265 112.406 40.030 1.00 30.37  ? 279  TRP A O   1 
ATOM   2148 C CB  . TRP A 1 279 ? -12.583 111.980 42.028 1.00 25.52  ? 279  TRP A CB  1 
ATOM   2149 C CG  . TRP A 1 279 ? -13.800 111.211 42.365 1.00 24.44  ? 279  TRP A CG  1 
ATOM   2150 C CD1 . TRP A 1 279 ? -14.267 110.926 43.613 1.00 26.00  ? 279  TRP A CD1 1 
ATOM   2151 C CD2 . TRP A 1 279 ? -14.699 110.584 41.444 1.00 23.34  ? 279  TRP A CD2 1 
ATOM   2152 N NE1 . TRP A 1 279 ? -15.408 110.157 43.528 1.00 26.13  ? 279  TRP A NE1 1 
ATOM   2153 C CE2 . TRP A 1 279 ? -15.694 109.933 42.208 1.00 23.24  ? 279  TRP A CE2 1 
ATOM   2154 C CE3 . TRP A 1 279 ? -14.762 110.508 40.045 1.00 24.00  ? 279  TRP A CE3 1 
ATOM   2155 C CZ2 . TRP A 1 279 ? -16.739 109.214 41.622 1.00 22.95  ? 279  TRP A CZ2 1 
ATOM   2156 C CZ3 . TRP A 1 279 ? -15.806 109.790 39.461 1.00 23.12  ? 279  TRP A CZ3 1 
ATOM   2157 C CH2 . TRP A 1 279 ? -16.778 109.154 40.252 1.00 23.23  ? 279  TRP A CH2 1 
ATOM   2158 N N   . ASN A 1 280 ? -9.256  112.138 42.021 1.00 29.86  ? 280  ASN A N   1 
ATOM   2159 C CA  . ASN A 1 280 ? -8.122  112.974 41.663 1.00 31.30  ? 280  ASN A CA  1 
ATOM   2160 C C   . ASN A 1 280 ? -7.235  112.485 40.525 1.00 31.42  ? 280  ASN A C   1 
ATOM   2161 O O   . ASN A 1 280 ? -6.362  113.225 40.067 1.00 31.68  ? 280  ASN A O   1 
ATOM   2162 C CB  . ASN A 1 280 ? -7.261  113.222 42.899 1.00 33.13  ? 280  ASN A CB  1 
ATOM   2163 C CG  . ASN A 1 280 ? -8.041  113.860 44.026 1.00 35.00  ? 280  ASN A CG  1 
ATOM   2164 O OD1 . ASN A 1 280 ? -8.891  114.719 43.795 1.00 36.41  ? 280  ASN A OD1 1 
ATOM   2165 N ND2 . ASN A 1 280 ? -7.750  113.454 45.254 1.00 36.35  ? 280  ASN A ND2 1 
ATOM   2166 N N   . VAL A 1 281 ? -7.452  111.259 40.052 1.00 31.09  ? 281  VAL A N   1 
ATOM   2167 C CA  . VAL A 1 281 ? -6.618  110.723 38.975 1.00 29.70  ? 281  VAL A CA  1 
ATOM   2168 C C   . VAL A 1 281 ? -7.126  110.951 37.556 1.00 29.83  ? 281  VAL A C   1 
ATOM   2169 O O   . VAL A 1 281 ? -6.357  110.810 36.603 1.00 30.82  ? 281  VAL A O   1 
ATOM   2170 C CB  . VAL A 1 281 ? -6.349  109.214 39.165 1.00 29.71  ? 281  VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 281 ? -5.701  108.978 40.524 1.00 28.95  ? 281  VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 281 ? -7.648  108.421 39.030 1.00 29.55  ? 281  VAL A CG2 1 
ATOM   2173 N N   . LEU A 1 282 ? -8.405  111.297 37.404 1.00 29.17  ? 282  LEU A N   1 
ATOM   2174 C CA  . LEU A 1 282 ? -8.969  111.560 36.074 1.00 28.56  ? 282  LEU A CA  1 
ATOM   2175 C C   . LEU A 1 282 ? -8.130  112.622 35.361 1.00 28.69  ? 282  LEU A C   1 
ATOM   2176 O O   . LEU A 1 282 ? -7.673  113.575 35.977 1.00 29.17  ? 282  LEU A O   1 
ATOM   2177 C CB  . LEU A 1 282 ? -10.411 112.040 36.204 1.00 27.80  ? 282  LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 282 ? -11.385 110.959 36.671 1.00 28.09  ? 282  LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 282 ? -12.674 111.594 37.122 1.00 25.65  ? 282  LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 282 ? -11.629 109.953 35.536 1.00 26.37  ? 282  LEU A CD2 1 
ATOM   2181 N N   . PRO A 1 283 ? -7.977  112.470 33.956 1.00 28.50  ? 283  PRO A N   1 
ATOM   2182 C CA  . PRO A 1 283 ? -7.138  113.506 33.236 1.00 28.58  ? 283  PRO A CA  1 
ATOM   2183 C C   . PRO A 1 283 ? -7.835  114.796 33.009 1.00 29.50  ? 283  PRO A C   1 
ATOM   2184 O O   . PRO A 1 283 ? -7.211  115.806 32.649 1.00 31.01  ? 283  PRO A O   1 
ATOM   2185 C CB  . PRO A 1 283 ? -6.907  113.102 31.774 1.00 27.60  ? 283  PRO A CB  1 
ATOM   2186 C CG  . PRO A 1 283 ? -6.715  111.676 31.915 1.00 27.08  ? 283  PRO A CG  1 
ATOM   2187 C CD  . PRO A 1 283 ? -6.993  111.439 33.371 1.00 28.04  ? 283  PRO A CD  1 
ATOM   2188 N N   . PHE A 1 284 ? -9.145  114.816 33.187 1.00 30.83  ? 284  PHE A N   1 
ATOM   2189 C CA  . PHE A 1 284 ? -9.902  116.018 32.866 1.00 31.48  ? 284  PHE A CA  1 
ATOM   2190 C C   . PHE A 1 284 ? -10.953 116.399 33.881 1.00 31.38  ? 284  PHE A C   1 
ATOM   2191 O O   . PHE A 1 284 ? -11.258 115.642 34.794 1.00 31.41  ? 284  PHE A O   1 
ATOM   2192 C CB  . PHE A 1 284 ? -10.651 115.824 31.551 1.00 31.37  ? 284  PHE A CB  1 
ATOM   2193 C CG  . PHE A 1 284 ? -9.789  115.447 30.396 1.00 33.37  ? 284  PHE A CG  1 
ATOM   2194 C CD1 . PHE A 1 284 ? -8.840  116.329 29.899 1.00 34.18  ? 284  PHE A CD1 1 
ATOM   2195 C CD2 . PHE A 1 284 ? -9.961  114.218 29.766 1.00 35.05  ? 284  PHE A CD2 1 
ATOM   2196 C CE1 . PHE A 1 284 ? -8.064  115.995 28.774 1.00 36.39  ? 284  PHE A CE1 1 
ATOM   2197 C CE2 . PHE A 1 284 ? -9.195  113.872 28.646 1.00 36.88  ? 284  PHE A CE2 1 
ATOM   2198 C CZ  . PHE A 1 284 ? -8.243  114.766 28.148 1.00 35.46  ? 284  PHE A CZ  1 
ATOM   2199 N N   . ASP A 1 285 ? -11.468 117.598 33.714 1.00 31.86  ? 285  ASP A N   1 
ATOM   2200 C CA  . ASP A 1 285 ? -12.565 118.033 34.522 1.00 32.31  ? 285  ASP A CA  1 
ATOM   2201 C C   . ASP A 1 285 ? -13.706 117.454 33.713 1.00 30.02  ? 285  ASP A C   1 
ATOM   2202 O O   . ASP A 1 285 ? -13.749 117.662 32.506 1.00 28.46  ? 285  ASP A O   1 
ATOM   2203 C CB  . ASP A 1 285 ? -12.707 119.549 34.602 1.00 36.97  ? 285  ASP A CB  1 
ATOM   2204 C CG  . ASP A 1 285 ? -11.768 120.161 35.607 1.00 41.91  ? 285  ASP A CG  1 
ATOM   2205 O OD1 . ASP A 1 285 ? -11.800 121.399 35.758 1.00 46.94  ? 285  ASP A OD1 1 
ATOM   2206 O OD2 . ASP A 1 285 ? -10.998 119.409 36.246 1.00 43.76  ? 285  ASP A OD2 1 
ATOM   2207 N N   . SER A 1 286 ? -14.629 116.719 34.318 1.00 29.94  ? 286  SER A N   1 
ATOM   2208 C CA  . SER A 1 286 ? -15.657 116.097 33.503 1.00 30.04  ? 286  SER A CA  1 
ATOM   2209 C C   . SER A 1 286 ? -16.776 115.386 34.235 1.00 27.94  ? 286  SER A C   1 
ATOM   2210 O O   . SER A 1 286 ? -16.733 115.174 35.444 1.00 28.07  ? 286  SER A O   1 
ATOM   2211 C CB  . SER A 1 286 ? -14.998 115.064 32.596 1.00 31.09  ? 286  SER A CB  1 
ATOM   2212 O OG  . SER A 1 286 ? -14.571 113.927 33.326 1.00 28.62  ? 286  SER A OG  1 
ATOM   2213 N N   . ILE A 1 287 ? -17.784 115.017 33.457 1.00 27.48  ? 287  ILE A N   1 
ATOM   2214 C CA  . ILE A 1 287 ? -18.899 114.247 33.941 1.00 27.47  ? 287  ILE A CA  1 
ATOM   2215 C C   . ILE A 1 287 ? -18.892 112.965 33.136 1.00 26.78  ? 287  ILE A C   1 
ATOM   2216 O O   . ILE A 1 287 ? -18.365 112.931 32.028 1.00 25.83  ? 287  ILE A O   1 
ATOM   2217 C CB  . ILE A 1 287 ? -20.259 114.991 33.853 1.00 25.89  ? 287  ILE A CB  1 
ATOM   2218 C CG1 . ILE A 1 287 ? -20.574 115.334 32.401 1.00 23.91  ? 287  ILE A CG1 1 
ATOM   2219 C CG2 . ILE A 1 287 ? -20.258 116.248 34.706 1.00 26.34  ? 287  ILE A CG2 1 
ATOM   2220 C CD1 . ILE A 1 287 ? -21.843 116.142 32.222 1.00 22.64  ? 287  ILE A CD1 1 
ATOM   2221 N N   . PHE A 1 288 ? -19.481 111.915 33.691 1.00 23.60  ? 288  PHE A N   1 
ATOM   2222 C CA  . PHE A 1 288 ? -19.530 110.616 33.045 1.00 22.45  ? 288  PHE A CA  1 
ATOM   2223 C C   . PHE A 1 288 ? -18.149 110.059 32.699 1.00 21.38  ? 288  PHE A C   1 
ATOM   2224 O O   . PHE A 1 288 ? -17.922 109.566 31.601 1.00 22.06  ? 288  PHE A O   1 
ATOM   2225 C CB  . PHE A 1 288 ? -20.393 110.656 31.789 1.00 21.01  ? 288  PHE A CB  1 
ATOM   2226 C CG  . PHE A 1 288 ? -21.276 109.451 31.638 1.00 21.74  ? 288  PHE A CG  1 
ATOM   2227 C CD1 . PHE A 1 288 ? -20.788 108.175 31.924 1.00 21.22  ? 288  PHE A CD1 1 
ATOM   2228 C CD2 . PHE A 1 288 ? -22.606 109.587 31.235 1.00 18.81  ? 288  PHE A CD2 1 
ATOM   2229 C CE1 . PHE A 1 288 ? -21.615 107.060 31.816 1.00 21.53  ? 288  PHE A CE1 1 
ATOM   2230 C CE2 . PHE A 1 288 ? -23.440 108.476 31.122 1.00 17.12  ? 288  PHE A CE2 1 
ATOM   2231 C CZ  . PHE A 1 288 ? -22.950 107.215 31.413 1.00 19.12  ? 288  PHE A CZ  1 
ATOM   2232 N N   . ARG A 1 289 ? -17.227 110.151 33.647 1.00 20.82  ? 289  ARG A N   1 
ATOM   2233 C CA  . ARG A 1 289 ? -15.883 109.605 33.483 1.00 21.93  ? 289  ARG A CA  1 
ATOM   2234 C C   . ARG A 1 289 ? -15.503 108.982 34.819 1.00 21.95  ? 289  ARG A C   1 
ATOM   2235 O O   . ARG A 1 289 ? -15.674 109.595 35.874 1.00 21.59  ? 289  ARG A O   1 
ATOM   2236 C CB  . ARG A 1 289 ? -14.883 110.691 33.081 1.00 18.87  ? 289  ARG A CB  1 
ATOM   2237 C CG  . ARG A 1 289 ? -14.960 111.063 31.609 1.00 19.33  ? 289  ARG A CG  1 
ATOM   2238 C CD  . ARG A 1 289 ? -14.513 109.919 30.714 1.00 19.79  ? 289  ARG A CD  1 
ATOM   2239 N NE  . ARG A 1 289 ? -14.622 110.259 29.295 1.00 22.40  ? 289  ARG A NE  1 
ATOM   2240 C CZ  . ARG A 1 289 ? -15.774 110.384 28.639 1.00 23.31  ? 289  ARG A CZ  1 
ATOM   2241 N NH1 . ARG A 1 289 ? -16.921 110.190 29.271 1.00 23.07  ? 289  ARG A NH1 1 
ATOM   2242 N NH2 . ARG A 1 289 ? -15.783 110.713 27.351 1.00 22.77  ? 289  ARG A NH2 1 
ATOM   2243 N N   . PHE A 1 290 ? -14.979 107.764 34.776 1.00 23.21  ? 290  PHE A N   1 
ATOM   2244 C CA  . PHE A 1 290 ? -14.651 107.067 36.006 1.00 23.46  ? 290  PHE A CA  1 
ATOM   2245 C C   . PHE A 1 290 ? -13.187 106.676 36.090 1.00 24.83  ? 290  PHE A C   1 
ATOM   2246 O O   . PHE A 1 290 ? -12.597 106.214 35.118 1.00 27.06  ? 290  PHE A O   1 
ATOM   2247 C CB  . PHE A 1 290 ? -15.633 105.876 36.174 1.00 21.04  ? 290  PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 290 ? -17.028 106.275 35.765 1.00 19.37  ? 290  PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 290 ? -17.728 107.208 36.544 1.00 17.31  ? 290  PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 290 ? -17.637 105.779 34.612 1.00 18.08  ? 290  PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 290 ? -19.008 107.614 36.172 1.00 15.62  ? 290  PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 290 ? -18.919 106.209 34.234 1.00 16.38  ? 290  PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 290 ? -19.602 107.115 35.017 1.00 13.90  ? 290  PHE A CZ  1 
ATOM   2254 N N   . SER A 1 291 ? -12.610 106.852 37.266 1.00 25.80  ? 291  SER A N   1 
ATOM   2255 C CA  . SER A 1 291 ? -11.202 106.618 37.507 1.00 26.99  ? 291  SER A CA  1 
ATOM   2256 C C   . SER A 1 291 ? -10.625 105.257 37.158 1.00 28.56  ? 291  SER A C   1 
ATOM   2257 O O   . SER A 1 291 ? -9.731  105.168 36.312 1.00 28.52  ? 291  SER A O   1 
ATOM   2258 C CB  . SER A 1 291 ? -10.889 106.947 38.962 1.00 28.19  ? 291  SER A CB  1 
ATOM   2259 O OG  . SER A 1 291 ? -10.677 108.336 39.132 1.00 28.38  ? 291  SER A OG  1 
ATOM   2260 N N   . PHE A 1 292 ? -11.115 104.198 37.800 1.00 29.76  ? 292  PHE A N   1 
ATOM   2261 C CA  . PHE A 1 292 ? -10.563 102.859 37.554 1.00 30.26  ? 292  PHE A CA  1 
ATOM   2262 C C   . PHE A 1 292 ? -11.485 101.891 36.833 1.00 27.66  ? 292  PHE A C   1 
ATOM   2263 O O   . PHE A 1 292 ? -12.359 101.279 37.444 1.00 27.24  ? 292  PHE A O   1 
ATOM   2264 C CB  . PHE A 1 292 ? -10.083 102.258 38.885 1.00 30.24  ? 292  PHE A CB  1 
ATOM   2265 C CG  . PHE A 1 292 ? -9.010  103.105 39.559 1.00 28.96  ? 292  PHE A CG  1 
ATOM   2266 C CD1 . PHE A 1 292 ? -7.735  103.197 39.001 1.00 28.81  ? 292  PHE A CD1 1 
ATOM   2267 C CD2 . PHE A 1 292 ? -9.288  103.797 40.715 1.00 29.48  ? 292  PHE A CD2 1 
ATOM   2268 C CE1 . PHE A 1 292 ? -6.753  103.970 39.579 1.00 29.41  ? 292  PHE A CE1 1 
ATOM   2269 C CE2 . PHE A 1 292 ? -8.314  104.607 41.303 1.00 30.06  ? 292  PHE A CE2 1 
ATOM   2270 C CZ  . PHE A 1 292 ? -7.043  104.695 40.732 1.00 30.36  ? 292  PHE A CZ  1 
ATOM   2271 N N   . VAL A 1 293 ? -11.286 101.769 35.527 1.00 27.61  ? 293  VAL A N   1 
ATOM   2272 C CA  . VAL A 1 293 ? -12.122 100.905 34.698 1.00 28.06  ? 293  VAL A CA  1 
ATOM   2273 C C   . VAL A 1 293 ? -11.328 99.834  33.942 1.00 29.13  ? 293  VAL A C   1 
ATOM   2274 O O   . VAL A 1 293 ? -10.095 99.822  34.007 1.00 31.17  ? 293  VAL A O   1 
ATOM   2275 C CB  . VAL A 1 293 ? -12.909 101.751 33.668 1.00 25.86  ? 293  VAL A CB  1 
ATOM   2276 C CG1 . VAL A 1 293 ? -13.791 102.771 34.369 1.00 24.31  ? 293  VAL A CG1 1 
ATOM   2277 C CG2 . VAL A 1 293 ? -11.944 102.441 32.708 1.00 26.23  ? 293  VAL A CG2 1 
ATOM   2278 N N   . PRO A 1 294 ? -12.031 98.948  33.219 1.00 27.51  ? 294  PRO A N   1 
ATOM   2279 C CA  . PRO A 1 294 ? -11.352 97.899  32.466 1.00 28.55  ? 294  PRO A CA  1 
ATOM   2280 C C   . PRO A 1 294 ? -10.229 98.462  31.612 1.00 30.97  ? 294  PRO A C   1 
ATOM   2281 O O   . PRO A 1 294 ? -10.351 99.550  31.057 1.00 34.80  ? 294  PRO A O   1 
ATOM   2282 C CB  . PRO A 1 294 ? -12.472 97.316  31.630 1.00 27.13  ? 294  PRO A CB  1 
ATOM   2283 C CG  . PRO A 1 294 ? -13.628 97.386  32.566 1.00 26.09  ? 294  PRO A CG  1 
ATOM   2284 C CD  . PRO A 1 294 ? -13.492 98.765  33.160 1.00 26.58  ? 294  PRO A CD  1 
ATOM   2285 N N   . VAL A 1 295 ? -9.131  97.727  31.509 1.00 31.88  ? 295  VAL A N   1 
ATOM   2286 C CA  . VAL A 1 295 ? -8.003  98.175  30.705 1.00 32.37  ? 295  VAL A CA  1 
ATOM   2287 C C   . VAL A 1 295 ? -7.748  97.207  29.549 1.00 34.45  ? 295  VAL A C   1 
ATOM   2288 O O   . VAL A 1 295 ? -7.728  95.992  29.737 1.00 34.78  ? 295  VAL A O   1 
ATOM   2289 C CB  . VAL A 1 295 ? -6.727  98.291  31.562 1.00 30.00  ? 295  VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 295 ? -6.435  96.971  32.261 1.00 29.00  ? 295  VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 295 ? -5.531  98.718  30.701 1.00 29.50  ? 295  VAL A CG2 1 
ATOM   2292 N N   . ILE A 1 296 ? -7.569  97.755  28.353 1.00 36.17  ? 296  ILE A N   1 
ATOM   2293 C CA  . ILE A 1 296 ? -7.263  96.978  27.166 1.00 38.06  ? 296  ILE A CA  1 
ATOM   2294 C C   . ILE A 1 296 ? -5.867  96.368  27.377 1.00 38.61  ? 296  ILE A C   1 
ATOM   2295 O O   . ILE A 1 296 ? -4.859  97.003  27.056 1.00 38.28  ? 296  ILE A O   1 
ATOM   2296 C CB  . ILE A 1 296 ? -7.302  97.828  25.895 1.00 39.19  ? 296  ILE A CB  1 
ATOM   2297 C CG1 . ILE A 1 296 ? -8.604  98.644  25.847 1.00 37.45  ? 296  ILE A CG1 1 
ATOM   2298 C CG2 . ILE A 1 296 ? -7.206  96.959  24.644 1.00 39.37  ? 296  ILE A CG2 1 
ATOM   2299 C CD1 . ILE A 1 296 ? -9.851  97.803  26.003 1.00 35.11  ? 296  ILE A CD1 1 
ATOM   2300 N N   . ASP A 1 297 ? -5.837  95.121  27.888 1.00 39.19  ? 297  ASP A N   1 
ATOM   2301 C CA  . ASP A 1 297 ? -4.607  94.454  28.286 1.00 40.64  ? 297  ASP A CA  1 
ATOM   2302 C C   . ASP A 1 297 ? -3.964  93.481  27.312 1.00 43.03  ? 297  ASP A C   1 
ATOM   2303 O O   . ASP A 1 297 ? -2.812  93.103  27.478 1.00 43.61  ? 297  ASP A O   1 
ATOM   2304 C CB  . ASP A 1 297 ? -4.841  93.703  29.595 1.00 38.59  ? 297  ASP A CB  1 
ATOM   2305 C CG  . ASP A 1 297 ? -5.884  92.606  29.458 1.00 37.69  ? 297  ASP A CG  1 
ATOM   2306 O OD1 . ASP A 1 297 ? -6.494  92.483  28.372 1.00 35.50  ? 297  ASP A OD1 1 
ATOM   2307 O OD2 . ASP A 1 297 ? -6.096  91.865  30.440 1.00 38.68  ? 297  ASP A OD2 1 
ATOM   2308 N N   . GLY A 1 298 ? -4.690  93.053  26.286 1.00 44.45  ? 298  GLY A N   1 
ATOM   2309 C CA  . GLY A 1 298 ? -4.114  92.100  25.351 1.00 45.43  ? 298  GLY A CA  1 
ATOM   2310 C C   . GLY A 1 298 ? -4.331  90.666  25.814 1.00 47.15  ? 298  GLY A C   1 
ATOM   2311 O O   . GLY A 1 298 ? -4.014  89.715  25.092 1.00 46.53  ? 298  GLY A O   1 
ATOM   2312 N N   . GLU A 1 299 ? -4.872  90.514  27.025 1.00 47.47  ? 299  GLU A N   1 
ATOM   2313 C CA  . GLU A 1 299 ? -5.148  89.201  27.603 1.00 47.01  ? 299  GLU A CA  1 
ATOM   2314 C C   . GLU A 1 299 ? -6.654  88.985  27.734 1.00 45.81  ? 299  GLU A C   1 
ATOM   2315 O O   . GLU A 1 299 ? -7.241  88.232  26.956 1.00 46.48  ? 299  GLU A O   1 
ATOM   2316 C CB  . GLU A 1 299 ? -4.474  89.066  28.971 1.00 48.99  ? 299  GLU A CB  1 
ATOM   2317 C CG  . GLU A 1 299 ? -4.634  87.696  29.620 1.00 53.97  ? 299  GLU A CG  1 
ATOM   2318 C CD  . GLU A 1 299 ? -3.889  87.584  30.949 1.00 59.33  ? 299  GLU A CD  1 
ATOM   2319 O OE1 . GLU A 1 299 ? -4.043  86.551  31.641 1.00 61.35  ? 299  GLU A OE1 1 
ATOM   2320 O OE2 . GLU A 1 299 ? -3.146  88.527  31.304 1.00 61.74  ? 299  GLU A OE2 1 
ATOM   2321 N N   . PHE A 1 300 ? -7.280  89.635  28.715 1.00 44.14  ? 300  PHE A N   1 
ATOM   2322 C CA  . PHE A 1 300 ? -8.724  89.502  28.893 1.00 40.33  ? 300  PHE A CA  1 
ATOM   2323 C C   . PHE A 1 300 ? -9.342  89.947  27.576 1.00 40.30  ? 300  PHE A C   1 
ATOM   2324 O O   . PHE A 1 300 ? -10.293 89.336  27.080 1.00 41.51  ? 300  PHE A O   1 
ATOM   2325 C CB  . PHE A 1 300 ? -9.208  90.384  30.041 1.00 38.52  ? 300  PHE A CB  1 
ATOM   2326 C CG  . PHE A 1 300 ? -10.683 90.249  30.334 1.00 35.53  ? 300  PHE A CG  1 
ATOM   2327 C CD1 . PHE A 1 300 ? -11.633 90.852  29.512 1.00 34.01  ? 300  PHE A CD1 1 
ATOM   2328 C CD2 . PHE A 1 300 ? -11.120 89.513  31.430 1.00 32.47  ? 300  PHE A CD2 1 
ATOM   2329 C CE1 . PHE A 1 300 ? -12.996 90.723  29.781 1.00 33.60  ? 300  PHE A CE1 1 
ATOM   2330 C CE2 . PHE A 1 300 ? -12.480 89.380  31.703 1.00 32.95  ? 300  PHE A CE2 1 
ATOM   2331 C CZ  . PHE A 1 300 ? -13.419 89.986  30.877 1.00 31.53  ? 300  PHE A CZ  1 
ATOM   2332 N N   . PHE A 1 301 ? -8.789  91.021  27.016 1.00 38.25  ? 301  PHE A N   1 
ATOM   2333 C CA  . PHE A 1 301 ? -9.227  91.534  25.722 1.00 36.62  ? 301  PHE A CA  1 
ATOM   2334 C C   . PHE A 1 301 ? -8.053  91.267  24.770 1.00 36.81  ? 301  PHE A C   1 
ATOM   2335 O O   . PHE A 1 301 ? -7.007  91.904  24.874 1.00 36.24  ? 301  PHE A O   1 
ATOM   2336 C CB  . PHE A 1 301 ? -9.506  93.040  25.790 1.00 34.80  ? 301  PHE A CB  1 
ATOM   2337 C CG  . PHE A 1 301 ? -10.644 93.418  26.710 1.00 32.97  ? 301  PHE A CG  1 
ATOM   2338 C CD1 . PHE A 1 301 ? -11.946 93.032  26.426 1.00 31.18  ? 301  PHE A CD1 1 
ATOM   2339 C CD2 . PHE A 1 301 ? -10.408 94.175  27.858 1.00 31.29  ? 301  PHE A CD2 1 
ATOM   2340 C CE1 . PHE A 1 301 ? -12.993 93.392  27.270 1.00 29.17  ? 301  PHE A CE1 1 
ATOM   2341 C CE2 . PHE A 1 301 ? -11.448 94.535  28.702 1.00 25.82  ? 301  PHE A CE2 1 
ATOM   2342 C CZ  . PHE A 1 301 ? -12.739 94.143  28.408 1.00 26.83  ? 301  PHE A CZ  1 
ATOM   2343 N N   . PRO A 1 302 ? -8.205  90.304  23.846 1.00 36.99  ? 302  PRO A N   1 
ATOM   2344 C CA  . PRO A 1 302 ? -7.158  89.951  22.881 1.00 36.70  ? 302  PRO A CA  1 
ATOM   2345 C C   . PRO A 1 302 ? -6.493  91.169  22.257 1.00 37.05  ? 302  PRO A C   1 
ATOM   2346 O O   . PRO A 1 302 ? -5.281  91.343  22.361 1.00 37.15  ? 302  PRO A O   1 
ATOM   2347 C CB  . PRO A 1 302 ? -7.911  89.128  21.846 1.00 35.56  ? 302  PRO A CB  1 
ATOM   2348 C CG  . PRO A 1 302 ? -8.927  88.441  22.667 1.00 37.27  ? 302  PRO A CG  1 
ATOM   2349 C CD  . PRO A 1 302 ? -9.428  89.527  23.586 1.00 37.46  ? 302  PRO A CD  1 
ATOM   2350 N N   . THR A 1 303 ? -7.301  92.004  21.608 1.00 36.16  ? 303  THR A N   1 
ATOM   2351 C CA  . THR A 1 303 ? -6.815  93.209  20.947 1.00 35.79  ? 303  THR A CA  1 
ATOM   2352 C C   . THR A 1 303 ? -7.783  94.350  21.209 1.00 35.50  ? 303  THR A C   1 
ATOM   2353 O O   . THR A 1 303 ? -8.697  94.202  22.012 1.00 37.02  ? 303  THR A O   1 
ATOM   2354 C CB  . THR A 1 303 ? -6.720  92.991  19.442 1.00 37.01  ? 303  THR A CB  1 
ATOM   2355 O OG1 . THR A 1 303 ? -8.010  92.616  18.940 1.00 33.81  ? 303  THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 303 ? -5.712  91.886  19.129 1.00 37.17  ? 303  THR A CG2 1 
ATOM   2357 N N   . SER A 1 304 ? -7.594  95.482  20.533 1.00 34.89  ? 304  SER A N   1 
ATOM   2358 C CA  . SER A 1 304 ? -8.479  96.634  20.729 1.00 32.75  ? 304  SER A CA  1 
ATOM   2359 C C   . SER A 1 304 ? -9.930  96.228  20.499 1.00 30.29  ? 304  SER A C   1 
ATOM   2360 O O   . SER A 1 304 ? -10.218 95.383  19.649 1.00 29.36  ? 304  SER A O   1 
ATOM   2361 C CB  . SER A 1 304 ? -8.111  97.779  19.779 1.00 33.37  ? 304  SER A CB  1 
ATOM   2362 O OG  . SER A 1 304 ? -8.472  97.487  18.435 1.00 36.19  ? 304  SER A OG  1 
ATOM   2363 N N   . LEU A 1 305 ? -10.834 96.827  21.268 1.00 28.13  ? 305  LEU A N   1 
ATOM   2364 C CA  . LEU A 1 305 ? -12.255 96.526  21.158 1.00 27.86  ? 305  LEU A CA  1 
ATOM   2365 C C   . LEU A 1 305 ? -12.744 96.679  19.724 1.00 29.60  ? 305  LEU A C   1 
ATOM   2366 O O   . LEU A 1 305 ? -13.379 95.775  19.181 1.00 29.70  ? 305  LEU A O   1 
ATOM   2367 C CB  . LEU A 1 305 ? -13.072 97.434  22.089 1.00 25.12  ? 305  LEU A CB  1 
ATOM   2368 C CG  . LEU A 1 305 ? -12.710 97.382  23.582 1.00 23.97  ? 305  LEU A CG  1 
ATOM   2369 C CD1 . LEU A 1 305 ? -13.750 98.122  24.398 1.00 22.26  ? 305  LEU A CD1 1 
ATOM   2370 C CD2 . LEU A 1 305 ? -12.638 95.944  24.051 1.00 23.82  ? 305  LEU A CD2 1 
ATOM   2371 N N   . GLU A 1 306 ? -12.432 97.810  19.097 1.00 31.09  ? 306  GLU A N   1 
ATOM   2372 C CA  . GLU A 1 306 ? -12.874 98.040  17.726 1.00 31.88  ? 306  GLU A CA  1 
ATOM   2373 C C   . GLU A 1 306 ? -12.413 96.950  16.763 1.00 31.70  ? 306  GLU A C   1 
ATOM   2374 O O   . GLU A 1 306 ? -13.188 96.513  15.912 1.00 30.55  ? 306  GLU A O   1 
ATOM   2375 C CB  . GLU A 1 306 ? -12.387 99.394  17.215 1.00 33.40  ? 306  GLU A CB  1 
ATOM   2376 C CG  . GLU A 1 306 ? -12.985 99.771  15.872 1.00 38.57  ? 306  GLU A CG  1 
ATOM   2377 C CD  . GLU A 1 306 ? -14.441 100.225 15.968 1.00 43.92  ? 306  GLU A CD  1 
ATOM   2378 O OE1 . GLU A 1 306 ? -15.238 99.585  16.691 1.00 46.16  ? 306  GLU A OE1 1 
ATOM   2379 O OE2 . GLU A 1 306 ? -14.792 101.226 15.305 1.00 47.12  ? 306  GLU A OE2 1 
ATOM   2380 N N   . SER A 1 307 ? -11.162 96.510  16.887 1.00 31.35  ? 307  SER A N   1 
ATOM   2381 C CA  . SER A 1 307 ? -10.653 95.470  15.994 1.00 32.10  ? 307  SER A CA  1 
ATOM   2382 C C   . SER A 1 307 ? -11.400 94.159  16.222 1.00 33.21  ? 307  SER A C   1 
ATOM   2383 O O   . SER A 1 307 ? -11.769 93.471  15.266 1.00 33.65  ? 307  SER A O   1 
ATOM   2384 C CB  . SER A 1 307 ? -9.152  95.259  16.199 1.00 30.22  ? 307  SER A CB  1 
ATOM   2385 O OG  . SER A 1 307 ? -8.873  94.844  17.524 1.00 35.66  ? 307  SER A OG  1 
ATOM   2386 N N   . MET A 1 308 ? -11.640 93.827  17.489 1.00 34.24  ? 308  MET A N   1 
ATOM   2387 C CA  . MET A 1 308 ? -12.358 92.600  17.836 1.00 34.72  ? 308  MET A CA  1 
ATOM   2388 C C   . MET A 1 308 ? -13.764 92.583  17.232 1.00 35.19  ? 308  MET A C   1 
ATOM   2389 O O   . MET A 1 308 ? -14.252 91.540  16.788 1.00 34.54  ? 308  MET A O   1 
ATOM   2390 C CB  . MET A 1 308 ? -12.453 92.451  19.356 1.00 33.99  ? 308  MET A CB  1 
ATOM   2391 C CG  . MET A 1 308 ? -11.118 92.254  20.044 1.00 33.29  ? 308  MET A CG  1 
ATOM   2392 S SD  . MET A 1 308 ? -11.311 91.844  21.790 1.00 33.60  ? 308  MET A SD  1 
ATOM   2393 C CE  . MET A 1 308 ? -11.878 90.119  21.651 1.00 32.94  ? 308  MET A CE  1 
ATOM   2394 N N   . LEU A 1 309 ? -14.409 93.746  17.221 1.00 35.41  ? 309  LEU A N   1 
ATOM   2395 C CA  . LEU A 1 309 ? -15.749 93.865  16.664 1.00 36.75  ? 309  LEU A CA  1 
ATOM   2396 C C   . LEU A 1 309 ? -15.744 93.752  15.141 1.00 37.70  ? 309  LEU A C   1 
ATOM   2397 O O   . LEU A 1 309 ? -16.660 93.167  14.560 1.00 37.72  ? 309  LEU A O   1 
ATOM   2398 C CB  . LEU A 1 309 ? -16.376 95.190  17.097 1.00 36.99  ? 309  LEU A CB  1 
ATOM   2399 C CG  . LEU A 1 309 ? -16.861 95.218  18.550 1.00 36.88  ? 309  LEU A CG  1 
ATOM   2400 C CD1 . LEU A 1 309 ? -17.024 96.641  19.032 1.00 37.95  ? 309  LEU A CD1 1 
ATOM   2401 C CD2 . LEU A 1 309 ? -18.177 94.467  18.649 1.00 36.18  ? 309  LEU A CD2 1 
ATOM   2402 N N   . ASN A 1 310 ? -14.714 94.302  14.497 1.00 38.26  ? 310  ASN A N   1 
ATOM   2403 C CA  . ASN A 1 310 ? -14.611 94.242  13.036 1.00 38.91  ? 310  ASN A CA  1 
ATOM   2404 C C   . ASN A 1 310 ? -14.346 92.825  12.555 1.00 38.83  ? 310  ASN A C   1 
ATOM   2405 O O   . ASN A 1 310 ? -15.010 92.343  11.633 1.00 39.06  ? 310  ASN A O   1 
ATOM   2406 C CB  . ASN A 1 310 ? -13.477 95.132  12.507 1.00 38.42  ? 310  ASN A CB  1 
ATOM   2407 C CG  . ASN A 1 310 ? -13.799 96.612  12.579 1.00 37.89  ? 310  ASN A CG  1 
ATOM   2408 O OD1 . ASN A 1 310 ? -14.898 97.049  12.235 1.00 34.00  ? 310  ASN A OD1 1 
ATOM   2409 N ND2 . ASN A 1 310 ? -12.820 97.399  13.008 1.00 39.56  ? 310  ASN A ND2 1 
ATOM   2410 N N   . SER A 1 311 ? -13.362 92.172  13.175 1.00 37.65  ? 311  SER A N   1 
ATOM   2411 C CA  . SER A 1 311 ? -12.978 90.814  12.809 1.00 36.11  ? 311  SER A CA  1 
ATOM   2412 C C   . SER A 1 311 ? -13.995 89.776  13.253 1.00 35.74  ? 311  SER A C   1 
ATOM   2413 O O   . SER A 1 311 ? -13.895 88.607  12.889 1.00 34.92  ? 311  SER A O   1 
ATOM   2414 C CB  . SER A 1 311 ? -11.625 90.474  13.417 1.00 35.33  ? 311  SER A CB  1 
ATOM   2415 O OG  . SER A 1 311 ? -11.688 90.587  14.824 1.00 37.25  ? 311  SER A OG  1 
ATOM   2416 N N   . GLY A 1 312 ? -14.972 90.204  14.043 1.00 36.85  ? 312  GLY A N   1 
ATOM   2417 C CA  . GLY A 1 312 ? -15.987 89.281  14.517 1.00 36.54  ? 312  GLY A CA  1 
ATOM   2418 C C   . GLY A 1 312 ? -15.453 88.395  15.626 1.00 36.84  ? 312  GLY A C   1 
ATOM   2419 O O   . GLY A 1 312 ? -16.095 87.417  16.009 1.00 38.50  ? 312  GLY A O   1 
ATOM   2420 N N   . ASN A 1 313 ? -14.273 88.733  16.135 1.00 35.29  ? 313  ASN A N   1 
ATOM   2421 C CA  . ASN A 1 313 ? -13.643 87.971  17.205 1.00 34.55  ? 313  ASN A CA  1 
ATOM   2422 C C   . ASN A 1 313 ? -14.391 88.186  18.521 1.00 35.53  ? 313  ASN A C   1 
ATOM   2423 O O   . ASN A 1 313 ? -13.968 88.983  19.366 1.00 35.66  ? 313  ASN A O   1 
ATOM   2424 C CB  . ASN A 1 313 ? -12.180 88.405  17.345 1.00 35.47  ? 313  ASN A CB  1 
ATOM   2425 C CG  . ASN A 1 313 ? -11.412 87.582  18.364 1.00 36.42  ? 313  ASN A CG  1 
ATOM   2426 O OD1 . ASN A 1 313 ? -11.802 86.457  18.701 1.00 36.73  ? 313  ASN A OD1 1 
ATOM   2427 N ND2 . ASN A 1 313 ? -10.300 88.134  18.851 1.00 35.34  ? 313  ASN A ND2 1 
ATOM   2428 N N   . PHE A 1 314 ? -15.505 87.473  18.683 1.00 34.11  ? 314  PHE A N   1 
ATOM   2429 C CA  . PHE A 1 314 ? -16.328 87.574  19.882 1.00 33.38  ? 314  PHE A CA  1 
ATOM   2430 C C   . PHE A 1 314 ? -17.432 86.529  19.841 1.00 34.22  ? 314  PHE A C   1 
ATOM   2431 O O   . PHE A 1 314 ? -17.790 86.055  18.766 1.00 33.71  ? 314  PHE A O   1 
ATOM   2432 C CB  . PHE A 1 314 ? -16.937 88.976  19.987 1.00 32.75  ? 314  PHE A CB  1 
ATOM   2433 C CG  . PHE A 1 314 ? -17.764 89.376  18.794 1.00 30.69  ? 314  PHE A CG  1 
ATOM   2434 C CD1 . PHE A 1 314 ? -19.088 88.965  18.674 1.00 29.67  ? 314  PHE A CD1 1 
ATOM   2435 C CD2 . PHE A 1 314 ? -17.214 90.158  17.780 1.00 29.21  ? 314  PHE A CD2 1 
ATOM   2436 C CE1 . PHE A 1 314 ? -19.852 89.327  17.562 1.00 28.11  ? 314  PHE A CE1 1 
ATOM   2437 C CE2 . PHE A 1 314 ? -17.971 90.521  16.670 1.00 27.82  ? 314  PHE A CE2 1 
ATOM   2438 C CZ  . PHE A 1 314 ? -19.293 90.105  16.559 1.00 26.23  ? 314  PHE A CZ  1 
ATOM   2439 N N   . LYS A 1 315 ? -17.966 86.175  21.011 1.00 35.78  ? 315  LYS A N   1 
ATOM   2440 C CA  . LYS A 1 315 ? -19.029 85.177  21.109 1.00 36.42  ? 315  LYS A CA  1 
ATOM   2441 C C   . LYS A 1 315 ? -20.212 85.560  20.239 1.00 36.60  ? 315  LYS A C   1 
ATOM   2442 O O   . LYS A 1 315 ? -20.686 86.695  20.296 1.00 38.61  ? 315  LYS A O   1 
ATOM   2443 C CB  . LYS A 1 315 ? -19.493 85.024  22.559 1.00 36.95  ? 315  LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 315 ? -20.539 83.937  22.753 1.00 36.23  ? 315  LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 315 ? -20.790 83.672  24.231 1.00 38.66  ? 315  LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 315 ? -21.637 82.426  24.454 1.00 38.47  ? 315  LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 315 ? -22.979 82.550  23.829 1.00 40.72  ? 315  LYS A NZ  1 
ATOM   2448 N N   . LYS A 1 316 ? -20.692 84.609  19.442 1.00 36.57  ? 316  LYS A N   1 
ATOM   2449 C CA  . LYS A 1 316 ? -21.816 84.853  18.539 1.00 37.05  ? 316  LYS A CA  1 
ATOM   2450 C C   . LYS A 1 316 ? -23.099 84.179  19.008 1.00 35.63  ? 316  LYS A C   1 
ATOM   2451 O O   . LYS A 1 316 ? -23.247 82.968  18.884 1.00 36.14  ? 316  LYS A O   1 
ATOM   2452 C CB  . LYS A 1 316 ? -21.455 84.362  17.134 1.00 38.57  ? 316  LYS A CB  1 
ATOM   2453 C CG  . LYS A 1 316 ? -20.141 84.939  16.624 1.00 39.61  ? 316  LYS A CG  1 
ATOM   2454 C CD  . LYS A 1 316 ? -19.805 84.486  15.218 1.00 38.99  ? 316  LYS A CD  1 
ATOM   2455 C CE  . LYS A 1 316 ? -18.417 84.983  14.837 1.00 41.10  ? 316  LYS A CE  1 
ATOM   2456 N NZ  . LYS A 1 316 ? -17.383 84.557  15.833 1.00 40.59  ? 316  LYS A NZ  1 
ATOM   2457 N N   . THR A 1 317 ? -24.027 84.967  19.541 1.00 35.28  ? 317  THR A N   1 
ATOM   2458 C CA  . THR A 1 317 ? -25.296 84.428  20.041 1.00 33.98  ? 317  THR A CA  1 
ATOM   2459 C C   . THR A 1 317 ? -26.428 85.441  19.881 1.00 31.07  ? 317  THR A C   1 
ATOM   2460 O O   . THR A 1 317 ? -26.343 86.324  19.032 1.00 30.48  ? 317  THR A O   1 
ATOM   2461 C CB  . THR A 1 317 ? -25.166 84.029  21.530 1.00 34.36  ? 317  THR A CB  1 
ATOM   2462 O OG1 . THR A 1 317 ? -26.454 83.667  22.047 1.00 35.43  ? 317  THR A OG1 1 
ATOM   2463 C CG2 . THR A 1 317 ? -24.577 85.177  22.341 1.00 32.29  ? 317  THR A CG2 1 
ATOM   2464 N N   . GLN A 1 318 ? -27.493 85.304  20.667 1.00 29.04  ? 318  GLN A N   1 
ATOM   2465 C CA  . GLN A 1 318 ? -28.601 86.256  20.590 1.00 29.68  ? 318  GLN A CA  1 
ATOM   2466 C C   . GLN A 1 318 ? -28.426 87.307  21.688 1.00 29.98  ? 318  GLN A C   1 
ATOM   2467 O O   . GLN A 1 318 ? -27.962 86.995  22.781 1.00 30.82  ? 318  GLN A O   1 
ATOM   2468 C CB  . GLN A 1 318 ? -29.952 85.567  20.793 1.00 28.63  ? 318  GLN A CB  1 
ATOM   2469 C CG  . GLN A 1 318 ? -30.186 84.322  19.959 1.00 31.51  ? 318  GLN A CG  1 
ATOM   2470 C CD  . GLN A 1 318 ? -29.545 83.098  20.568 1.00 31.44  ? 318  GLN A CD  1 
ATOM   2471 O OE1 . GLN A 1 318 ? -29.738 82.793  21.736 1.00 32.88  ? 318  GLN A OE1 1 
ATOM   2472 N NE2 . GLN A 1 318 ? -28.747 82.231  19.937 1.00 30.99  ? 318  GLN A NE2 1 
ATOM   2473 N N   . ILE A 1 319 ? -28.783 88.554  21.402 1.00 29.93  ? 319  ILE A N   1 
ATOM   2474 C CA  . ILE A 1 319 ? -28.672 89.609  22.405 1.00 28.57  ? 319  ILE A CA  1 
ATOM   2475 C C   . ILE A 1 319 ? -29.889 90.512  22.355 1.00 28.18  ? 319  ILE A C   1 
ATOM   2476 O O   . ILE A 1 319 ? -30.438 90.787  21.288 1.00 29.52  ? 319  ILE A O   1 
ATOM   2477 C CB  . ILE A 1 319 ? -27.445 90.512  22.183 1.00 29.12  ? 319  ILE A CB  1 
ATOM   2478 C CG1 . ILE A 1 319 ? -27.549 91.191  20.814 1.00 29.36  ? 319  ILE A CG1 1 
ATOM   2479 C CG2 . ILE A 1 319 ? -26.168 89.709  22.282 1.00 30.72  ? 319  ILE A CG2 1 
ATOM   2480 C CD1 . ILE A 1 319 ? -26.571 92.332  20.619 1.00 29.40  ? 319  ILE A CD1 1 
ATOM   2481 N N   . LEU A 1 320 ? -30.308 90.970  23.490 1.00 26.56  ? 320  LEU A N   1 
ATOM   2482 C CA  . LEU A 1 320 ? -31.435 91.878  23.654 1.00 26.41  ? 320  LEU A CA  1 
ATOM   2483 C C   . LEU A 1 320 ? -30.847 93.077  24.365 1.00 26.75  ? 320  LEU A C   1 
ATOM   2484 O O   . LEU A 1 320 ? -30.242 92.917  25.428 1.00 28.07  ? 320  LEU A O   1 
ATOM   2485 C CB  . LEU A 1 320 ? -32.569 91.221  24.448 1.00 25.19  ? 320  LEU A CB  1 
ATOM   2486 C CG  . LEU A 1 320 ? -33.893 91.974  24.583 1.00 23.84  ? 320  LEU A CG  1 
ATOM   2487 C CD1 . LEU A 1 320 ? -35.061 90.998  24.720 1.00 24.00  ? 320  LEU A CD1 1 
ATOM   2488 C CD2 . LEU A 1 320 ? -33.844 92.917  25.778 1.00 20.64  ? 320  LEU A CD2 1 
ATOM   2489 N N   . LEU A 1 321 ? -30.986 94.269  23.795 1.00 25.78  ? 321  LEU A N   1 
ATOM   2490 C CA  . LEU A 1 321 ? -30.428 95.461  24.418 1.00 25.36  ? 321  LEU A CA  1 
ATOM   2491 C C   . LEU A 1 321 ? -31.186 96.702  24.000 1.00 24.78  ? 321  LEU A C   1 
ATOM   2492 O O   . LEU A 1 321 ? -31.981 96.664  23.069 1.00 24.60  ? 321  LEU A O   1 
ATOM   2493 C CB  . LEU A 1 321 ? -28.948 95.614  24.038 1.00 24.50  ? 321  LEU A CB  1 
ATOM   2494 C CG  . LEU A 1 321 ? -28.593 96.054  22.605 1.00 25.07  ? 321  LEU A CG  1 
ATOM   2495 C CD1 . LEU A 1 321 ? -27.080 95.955  22.377 1.00 20.03  ? 321  LEU A CD1 1 
ATOM   2496 C CD2 . LEU A 1 321 ? -29.345 95.213  21.569 1.00 21.06  ? 321  LEU A CD2 1 
ATOM   2497 N N   . GLY A 1 322 ? -30.929 97.806  24.690 1.00 24.27  ? 322  GLY A N   1 
ATOM   2498 C CA  . GLY A 1 322 ? -31.612 99.039  24.355 1.00 24.25  ? 322  GLY A CA  1 
ATOM   2499 C C   . GLY A 1 322 ? -31.174 100.178 25.242 1.00 23.46  ? 322  GLY A C   1 
ATOM   2500 O O   . GLY A 1 322 ? -30.186 100.067 25.961 1.00 25.11  ? 322  GLY A O   1 
ATOM   2501 N N   . VAL A 1 323 ? -31.919 101.271 25.207 1.00 22.67  ? 323  VAL A N   1 
ATOM   2502 C CA  . VAL A 1 323 ? -31.575 102.432 26.006 1.00 24.25  ? 323  VAL A CA  1 
ATOM   2503 C C   . VAL A 1 323 ? -32.817 103.145 26.532 1.00 26.92  ? 323  VAL A C   1 
ATOM   2504 O O   . VAL A 1 323 ? -33.949 102.714 26.286 1.00 28.41  ? 323  VAL A O   1 
ATOM   2505 C CB  . VAL A 1 323 ? -30.737 103.441 25.177 1.00 22.79  ? 323  VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 323 ? -29.494 102.753 24.611 1.00 16.95  ? 323  VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 323 ? -31.593 104.032 24.055 1.00 18.53  ? 323  VAL A CG2 1 
ATOM   2508 N N   . ASN A 1 324 ? -32.592 104.232 27.267 1.00 26.81  ? 324  ASN A N   1 
ATOM   2509 C CA  . ASN A 1 324 ? -33.674 105.032 27.823 1.00 28.25  ? 324  ASN A CA  1 
ATOM   2510 C C   . ASN A 1 324 ? -33.657 106.404 27.163 1.00 28.83  ? 324  ASN A C   1 
ATOM   2511 O O   . ASN A 1 324 ? -32.601 106.882 26.737 1.00 30.59  ? 324  ASN A O   1 
ATOM   2512 C CB  . ASN A 1 324 ? -33.511 105.179 29.338 1.00 29.46  ? 324  ASN A CB  1 
ATOM   2513 C CG  . ASN A 1 324 ? -33.597 103.849 30.069 1.00 29.78  ? 324  ASN A CG  1 
ATOM   2514 O OD1 . ASN A 1 324 ? -34.086 102.856 29.523 1.00 30.48  ? 324  ASN A OD1 1 
ATOM   2515 N ND2 . ASN A 1 324 ? -33.137 103.829 31.317 1.00 29.53  ? 324  ASN A ND2 1 
ATOM   2516 N N   . LYS A 1 325 ? -34.818 107.046 27.085 1.00 27.26  ? 325  LYS A N   1 
ATOM   2517 C CA  . LYS A 1 325 ? -34.907 108.350 26.442 1.00 26.22  ? 325  LYS A CA  1 
ATOM   2518 C C   . LYS A 1 325 ? -33.954 109.433 26.945 1.00 25.04  ? 325  LYS A C   1 
ATOM   2519 O O   . LYS A 1 325 ? -33.316 110.101 26.132 1.00 26.90  ? 325  LYS A O   1 
ATOM   2520 C CB  . LYS A 1 325 ? -36.345 108.869 26.495 1.00 27.91  ? 325  LYS A CB  1 
ATOM   2521 C CG  . LYS A 1 325 ? -36.490 110.325 26.082 1.00 29.93  ? 325  LYS A CG  1 
ATOM   2522 C CD  . LYS A 1 325 ? -37.938 110.651 25.748 1.00 34.82  ? 325  LYS A CD  1 
ATOM   2523 C CE  . LYS A 1 325 ? -38.223 112.153 25.800 1.00 37.31  ? 325  LYS A CE  1 
ATOM   2524 N NZ  . LYS A 1 325 ? -38.252 112.666 27.211 1.00 39.30  ? 325  LYS A NZ  1 
ATOM   2525 N N   . ASP A 1 326 ? -33.829 109.610 28.257 1.00 22.56  ? 326  ASP A N   1 
ATOM   2526 C CA  . ASP A 1 326 ? -32.949 110.667 28.774 1.00 23.32  ? 326  ASP A CA  1 
ATOM   2527 C C   . ASP A 1 326 ? -31.758 110.177 29.607 1.00 22.92  ? 326  ASP A C   1 
ATOM   2528 O O   . ASP A 1 326 ? -31.685 110.417 30.809 1.00 21.66  ? 326  ASP A O   1 
ATOM   2529 C CB  . ASP A 1 326 ? -33.802 111.656 29.571 1.00 24.70  ? 326  ASP A CB  1 
ATOM   2530 C CG  . ASP A 1 326 ? -35.028 112.116 28.787 1.00 28.20  ? 326  ASP A CG  1 
ATOM   2531 O OD1 . ASP A 1 326 ? -34.864 112.903 27.830 1.00 26.43  ? 326  ASP A OD1 1 
ATOM   2532 O OD2 . ASP A 1 326 ? -36.156 111.700 29.147 1.00 30.20  ? 326  ASP A OD2 1 
ATOM   2533 N N   . GLU A 1 327 ? -30.839 109.481 28.945 1.00 22.22  ? 327  GLU A N   1 
ATOM   2534 C CA  . GLU A 1 327 ? -29.676 108.911 29.619 1.00 23.43  ? 327  GLU A CA  1 
ATOM   2535 C C   . GLU A 1 327 ? -28.763 109.904 30.327 1.00 24.38  ? 327  GLU A C   1 
ATOM   2536 O O   . GLU A 1 327 ? -28.227 109.598 31.401 1.00 23.68  ? 327  GLU A O   1 
ATOM   2537 C CB  . GLU A 1 327 ? -28.848 108.084 28.626 1.00 21.40  ? 327  GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 327 ? -29.629 106.943 27.978 1.00 22.89  ? 327  GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 327 ? -29.756 105.716 28.865 1.00 21.00  ? 327  GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 327 ? -29.644 105.869 30.100 1.00 22.32  ? 327  GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 327 ? -29.984 104.620 28.323 1.00 22.53  ? 327  GLU A OE2 1 
ATOM   2542 N N   . GLY A 1 328 ? -28.623 111.085 29.763 1.00 23.98  ? 328  GLY A N   1 
ATOM   2543 C CA  . GLY A 1 328 ? -27.702 112.082 30.274 1.00 23.66  ? 328  GLY A CA  1 
ATOM   2544 C C   . GLY A 1 328 ? -28.156 112.937 31.475 1.00 24.44  ? 328  GLY A C   1 
ATOM   2545 O O   . GLY A 1 328 ? -27.315 113.398 32.257 1.00 25.09  ? 328  GLY A O   1 
ATOM   2546 N N   . SER A 1 329 ? -29.464 113.138 31.623 1.00 23.46  ? 329  SER A N   1 
ATOM   2547 C CA  . SER A 1 329 ? -29.981 113.995 32.687 1.00 21.98  ? 329  SER A CA  1 
ATOM   2548 C C   . SER A 1 329 ? -29.379 113.753 34.053 1.00 21.23  ? 329  SER A C   1 
ATOM   2549 O O   . SER A 1 329 ? -28.982 114.693 34.724 1.00 21.78  ? 329  SER A O   1 
ATOM   2550 C CB  . SER A 1 329 ? -31.504 113.880 32.754 1.00 23.11  ? 329  SER A CB  1 
ATOM   2551 O OG  . SER A 1 329 ? -31.891 112.608 33.237 1.00 25.07  ? 329  SER A OG  1 
ATOM   2552 N N   . PHE A 1 330 ? -29.299 112.496 34.464 1.00 21.95  ? 330  PHE A N   1 
ATOM   2553 C CA  . PHE A 1 330 ? -28.768 112.159 35.781 1.00 23.23  ? 330  PHE A CA  1 
ATOM   2554 C C   . PHE A 1 330 ? -27.358 112.718 36.036 1.00 25.43  ? 330  PHE A C   1 
ATOM   2555 O O   . PHE A 1 330 ? -27.054 113.208 37.129 1.00 25.44  ? 330  PHE A O   1 
ATOM   2556 C CB  . PHE A 1 330 ? -28.775 110.638 35.945 1.00 24.62  ? 330  PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 330 ? -29.011 110.160 37.352 1.00 25.17  ? 330  PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 330 ? -28.902 111.023 38.439 1.00 23.97  ? 330  PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 330 ? -29.355 108.825 37.586 1.00 25.36  ? 330  PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 330 ? -29.131 110.566 39.738 1.00 26.45  ? 330  PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 330 ? -29.585 108.357 38.881 1.00 25.31  ? 330  PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 330 ? -29.472 109.228 39.958 1.00 26.15  ? 330  PHE A CZ  1 
ATOM   2563 N N   . PHE A 1 331 ? -26.496 112.645 35.029 1.00 25.16  ? 331  PHE A N   1 
ATOM   2564 C CA  . PHE A 1 331 ? -25.135 113.128 35.193 1.00 25.53  ? 331  PHE A CA  1 
ATOM   2565 C C   . PHE A 1 331 ? -24.997 114.649 35.192 1.00 24.77  ? 331  PHE A C   1 
ATOM   2566 O O   . PHE A 1 331 ? -24.159 115.188 35.910 1.00 23.28  ? 331  PHE A O   1 
ATOM   2567 C CB  . PHE A 1 331 ? -24.239 112.474 34.137 1.00 25.60  ? 331  PHE A CB  1 
ATOM   2568 C CG  . PHE A 1 331 ? -24.245 110.979 34.221 1.00 24.21  ? 331  PHE A CG  1 
ATOM   2569 C CD1 . PHE A 1 331 ? -25.312 110.250 33.704 1.00 23.15  ? 331  PHE A CD1 1 
ATOM   2570 C CD2 . PHE A 1 331 ? -23.261 110.307 34.947 1.00 23.02  ? 331  PHE A CD2 1 
ATOM   2571 C CE1 . PHE A 1 331 ? -25.408 108.877 33.917 1.00 22.11  ? 331  PHE A CE1 1 
ATOM   2572 C CE2 . PHE A 1 331 ? -23.347 108.933 35.169 1.00 21.38  ? 331  PHE A CE2 1 
ATOM   2573 C CZ  . PHE A 1 331 ? -24.423 108.218 34.656 1.00 22.15  ? 331  PHE A CZ  1 
ATOM   2574 N N   . LEU A 1 332 ? -25.826 115.336 34.411 1.00 24.91  ? 332  LEU A N   1 
ATOM   2575 C CA  . LEU A 1 332 ? -25.798 116.803 34.355 1.00 26.14  ? 332  LEU A CA  1 
ATOM   2576 C C   . LEU A 1 332 ? -26.171 117.380 35.716 1.00 26.13  ? 332  LEU A C   1 
ATOM   2577 O O   . LEU A 1 332 ? -25.569 118.345 36.191 1.00 25.18  ? 332  LEU A O   1 
ATOM   2578 C CB  . LEU A 1 332 ? -26.782 117.320 33.299 1.00 25.03  ? 332  LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 332 ? -26.399 117.040 31.844 1.00 25.78  ? 332  LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 332 ? -27.570 117.323 30.926 1.00 27.33  ? 332  LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 332 ? -25.202 117.897 31.473 1.00 25.06  ? 332  LEU A CD2 1 
ATOM   2582 N N   . LEU A 1 333 ? -27.178 116.777 36.335 1.00 26.75  ? 333  LEU A N   1 
ATOM   2583 C CA  . LEU A 1 333 ? -27.644 117.202 37.641 1.00 27.67  ? 333  LEU A CA  1 
ATOM   2584 C C   . LEU A 1 333 ? -26.483 117.213 38.613 1.00 28.63  ? 333  LEU A C   1 
ATOM   2585 O O   . LEU A 1 333 ? -26.310 118.158 39.378 1.00 29.34  ? 333  LEU A O   1 
ATOM   2586 C CB  . LEU A 1 333 ? -28.753 116.272 38.139 1.00 28.77  ? 333  LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 333 ? -29.237 116.375 39.581 1.00 30.99  ? 333  LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 333 ? -29.579 117.805 39.935 1.00 31.56  ? 333  LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 333 ? -30.450 115.477 39.800 1.00 31.03  ? 333  LEU A CD2 1 
ATOM   2590 N N   . TYR A 1 334 ? -25.683 116.151 38.571 1.00 29.12  ? 334  TYR A N   1 
ATOM   2591 C CA  . TYR A 1 334 ? -24.530 116.006 39.451 1.00 27.85  ? 334  TYR A CA  1 
ATOM   2592 C C   . TYR A 1 334 ? -23.271 116.784 39.078 1.00 29.42  ? 334  TYR A C   1 
ATOM   2593 O O   . TYR A 1 334 ? -22.464 117.081 39.948 1.00 32.11  ? 334  TYR A O   1 
ATOM   2594 C CB  . TYR A 1 334 ? -24.143 114.531 39.530 1.00 27.72  ? 334  TYR A CB  1 
ATOM   2595 C CG  . TYR A 1 334 ? -24.977 113.731 40.525 1.00 26.91  ? 334  TYR A CG  1 
ATOM   2596 C CD1 . TYR A 1 334 ? -26.333 113.527 40.302 1.00 28.55  ? 334  TYR A CD1 1 
ATOM   2597 C CD2 . TYR A 1 334 ? -24.414 113.201 41.681 1.00 25.93  ? 334  TYR A CD2 1 
ATOM   2598 C CE1 . TYR A 1 334 ? -27.112 112.812 41.216 1.00 28.24  ? 334  TYR A CE1 1 
ATOM   2599 C CE2 . TYR A 1 334 ? -25.177 112.493 42.594 1.00 27.94  ? 334  TYR A CE2 1 
ATOM   2600 C CZ  . TYR A 1 334 ? -26.526 112.299 42.357 1.00 28.03  ? 334  TYR A CZ  1 
ATOM   2601 O OH  . TYR A 1 334 ? -27.281 111.577 43.254 1.00 28.62  ? 334  TYR A OH  1 
ATOM   2602 N N   . GLY A 1 335 ? -23.045 117.113 37.805 1.00 30.89  ? 335  GLY A N   1 
ATOM   2603 C CA  . GLY A 1 335 ? -21.785 117.776 37.416 1.00 32.23  ? 335  GLY A CA  1 
ATOM   2604 C C   . GLY A 1 335 ? -21.822 119.114 36.614 1.00 33.00  ? 335  GLY A C   1 
ATOM   2605 O O   . GLY A 1 335 ? -20.910 119.929 36.750 1.00 33.85  ? 335  GLY A O   1 
ATOM   2606 N N   . ALA A 1 336 ? -22.854 119.340 35.818 1.00 30.98  ? 336  ALA A N   1 
ATOM   2607 C CA  . ALA A 1 336 ? -23.013 120.542 35.002 1.00 29.36  ? 336  ALA A CA  1 
ATOM   2608 C C   . ALA A 1 336 ? -23.446 121.787 35.775 1.00 30.06  ? 336  ALA A C   1 
ATOM   2609 O O   . ALA A 1 336 ? -24.037 121.730 36.867 1.00 29.21  ? 336  ALA A O   1 
ATOM   2610 C CB  . ALA A 1 336 ? -23.975 120.255 33.861 1.00 29.11  ? 336  ALA A CB  1 
ATOM   2611 N N   . PRO A 1 337 ? -23.078 122.960 35.160 1.00 30.03  ? 337  PRO A N   1 
ATOM   2612 C CA  . PRO A 1 337 ? -23.441 124.182 35.927 1.00 28.64  ? 337  PRO A CA  1 
ATOM   2613 C C   . PRO A 1 337 ? -24.875 124.528 35.664 1.00 28.26  ? 337  PRO A C   1 
ATOM   2614 O O   . PRO A 1 337 ? -25.282 124.399 34.496 1.00 27.55  ? 337  PRO A O   1 
ATOM   2615 C CB  . PRO A 1 337 ? -22.684 125.371 35.397 1.00 28.86  ? 337  PRO A CB  1 
ATOM   2616 C CG  . PRO A 1 337 ? -21.440 124.736 34.981 1.00 29.13  ? 337  PRO A CG  1 
ATOM   2617 C CD  . PRO A 1 337 ? -21.630 123.301 35.352 1.00 29.44  ? 337  PRO A CD  1 
ATOM   2618 N N   . GLY A 1 338 ? -25.662 124.934 36.569 1.00 28.01  ? 338  GLY A N   1 
ATOM   2619 C CA  . GLY A 1 338 ? -26.990 125.342 36.157 1.00 28.97  ? 338  GLY A CA  1 
ATOM   2620 C C   . GLY A 1 338 ? -28.089 124.349 36.459 1.00 30.36  ? 338  GLY A C   1 
ATOM   2621 O O   . GLY A 1 338 ? -29.264 124.714 36.506 1.00 31.60  ? 338  GLY A O   1 
ATOM   2622 N N   . PHE A 1 339 ? -27.722 123.091 36.674 1.00 29.87  ? 339  PHE A N   1 
ATOM   2623 C CA  . PHE A 1 339 ? -28.724 122.076 36.947 1.00 29.28  ? 339  PHE A CA  1 
ATOM   2624 C C   . PHE A 1 339 ? -29.138 121.976 38.396 1.00 28.67  ? 339  PHE A C   1 
ATOM   2625 O O   . PHE A 1 339 ? -28.323 122.088 39.313 1.00 28.30  ? 339  PHE A O   1 
ATOM   2626 C CB  . PHE A 1 339 ? -28.261 120.710 36.432 1.00 27.27  ? 339  PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 339 ? -28.155 120.646 34.937 1.00 25.10  ? 339  PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 339 ? -27.004 121.087 34.289 1.00 22.34  ? 339  PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 339 ? -29.229 120.185 34.173 1.00 24.67  ? 339  PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 339 ? -26.919 121.070 32.908 1.00 22.32  ? 339  PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 339 ? -29.158 120.163 32.786 1.00 22.64  ? 339  PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 339 ? -27.997 120.608 32.152 1.00 25.19  ? 339  PHE A CZ  1 
ATOM   2633 N N   . SER A 1 340 ? -30.428 121.754 38.584 1.00 27.73  ? 340  SER A N   1 
ATOM   2634 C CA  . SER A 1 340 ? -30.991 121.648 39.906 1.00 29.47  ? 340  SER A CA  1 
ATOM   2635 C C   . SER A 1 340 ? -32.112 120.619 39.973 1.00 31.87  ? 340  SER A C   1 
ATOM   2636 O O   . SER A 1 340 ? -32.742 120.285 38.966 1.00 32.12  ? 340  SER A O   1 
ATOM   2637 C CB  . SER A 1 340 ? -31.520 123.009 40.335 1.00 27.09  ? 340  SER A CB  1 
ATOM   2638 O OG  . SER A 1 340 ? -32.324 122.884 41.488 1.00 28.48  ? 340  SER A OG  1 
ATOM   2639 N N   . LYS A 1 341 ? -32.351 120.130 41.182 1.00 34.24  ? 341  LYS A N   1 
ATOM   2640 C CA  . LYS A 1 341 ? -33.394 119.152 41.444 1.00 37.00  ? 341  LYS A CA  1 
ATOM   2641 C C   . LYS A 1 341 ? -34.625 119.926 41.891 1.00 38.12  ? 341  LYS A C   1 
ATOM   2642 O O   . LYS A 1 341 ? -35.740 119.406 41.879 1.00 39.15  ? 341  LYS A O   1 
ATOM   2643 C CB  . LYS A 1 341 ? -32.938 118.207 42.564 1.00 38.13  ? 341  LYS A CB  1 
ATOM   2644 C CG  . LYS A 1 341 ? -33.884 117.061 42.872 1.00 37.73  ? 341  LYS A CG  1 
ATOM   2645 C CD  . LYS A 1 341 ? -33.344 116.199 44.009 1.00 37.95  ? 341  LYS A CD  1 
ATOM   2646 C CE  . LYS A 1 341 ? -33.363 116.946 45.325 1.00 37.18  ? 341  LYS A CE  1 
ATOM   2647 N NZ  . LYS A 1 341 ? -34.756 117.330 45.678 1.00 37.10  ? 341  LYS A NZ  1 
ATOM   2648 N N   . ASP A 1 342 ? -34.407 121.180 42.273 1.00 40.36  ? 342  ASP A N   1 
ATOM   2649 C CA  . ASP A 1 342 ? -35.479 122.048 42.748 1.00 42.57  ? 342  ASP A CA  1 
ATOM   2650 C C   . ASP A 1 342 ? -35.919 123.114 41.745 1.00 44.25  ? 342  ASP A C   1 
ATOM   2651 O O   . ASP A 1 342 ? -36.339 124.203 42.142 1.00 46.50  ? 342  ASP A O   1 
ATOM   2652 C CB  . ASP A 1 342 ? -35.055 122.733 44.054 1.00 42.52  ? 342  ASP A CB  1 
ATOM   2653 C CG  . ASP A 1 342 ? -34.627 121.742 45.122 1.00 42.78  ? 342  ASP A CG  1 
ATOM   2654 O OD1 . ASP A 1 342 ? -35.341 120.733 45.321 1.00 44.71  ? 342  ASP A OD1 1 
ATOM   2655 O OD2 . ASP A 1 342 ? -33.584 121.975 45.769 1.00 40.87  ? 342  ASP A OD2 1 
ATOM   2656 N N   . SER A 1 343 ? -35.823 122.807 40.454 1.00 44.06  ? 343  SER A N   1 
ATOM   2657 C CA  . SER A 1 343 ? -36.237 123.742 39.409 1.00 43.10  ? 343  SER A CA  1 
ATOM   2658 C C   . SER A 1 343 ? -36.193 123.039 38.059 1.00 43.38  ? 343  SER A C   1 
ATOM   2659 O O   . SER A 1 343 ? -35.626 121.954 37.939 1.00 43.40  ? 343  SER A O   1 
ATOM   2660 C CB  . SER A 1 343 ? -35.321 124.971 39.379 1.00 42.62  ? 343  SER A CB  1 
ATOM   2661 O OG  . SER A 1 343 ? -34.052 124.665 38.830 1.00 42.57  ? 343  SER A OG  1 
ATOM   2662 N N   . GLU A 1 344 ? -36.788 123.661 37.044 1.00 43.56  ? 344  GLU A N   1 
ATOM   2663 C CA  . GLU A 1 344 ? -36.818 123.087 35.706 1.00 42.83  ? 344  GLU A CA  1 
ATOM   2664 C C   . GLU A 1 344 ? -35.478 123.231 34.985 1.00 40.58  ? 344  GLU A C   1 
ATOM   2665 O O   . GLU A 1 344 ? -35.371 122.960 33.789 1.00 39.41  ? 344  GLU A O   1 
ATOM   2666 C CB  . GLU A 1 344 ? -37.947 123.726 34.893 1.00 46.67  ? 344  GLU A CB  1 
ATOM   2667 C CG  . GLU A 1 344 ? -38.053 125.239 35.027 1.00 53.16  ? 344  GLU A CG  1 
ATOM   2668 C CD  . GLU A 1 344 ? -39.253 125.816 34.269 1.00 57.55  ? 344  GLU A CD  1 
ATOM   2669 O OE1 . GLU A 1 344 ? -39.467 127.049 34.336 1.00 59.17  ? 344  GLU A OE1 1 
ATOM   2670 O OE2 . GLU A 1 344 ? -39.980 125.039 33.606 1.00 58.58  ? 344  GLU A OE2 1 
ATOM   2671 N N   . SER A 1 345 ? -34.463 123.648 35.736 1.00 37.95  ? 345  SER A N   1 
ATOM   2672 C CA  . SER A 1 345 ? -33.104 123.821 35.238 1.00 36.54  ? 345  SER A CA  1 
ATOM   2673 C C   . SER A 1 345 ? -32.963 124.382 33.828 1.00 37.21  ? 345  SER A C   1 
ATOM   2674 O O   . SER A 1 345 ? -32.292 123.789 32.977 1.00 37.63  ? 345  SER A O   1 
ATOM   2675 C CB  . SER A 1 345 ? -32.345 122.494 35.320 1.00 35.64  ? 345  SER A CB  1 
ATOM   2676 O OG  . SER A 1 345 ? -32.310 122.002 36.644 1.00 36.27  ? 345  SER A OG  1 
ATOM   2677 N N   . LYS A 1 346 ? -33.593 125.517 33.565 1.00 36.85  ? 346  LYS A N   1 
ATOM   2678 C CA  . LYS A 1 346 ? -33.456 126.122 32.254 1.00 37.44  ? 346  LYS A CA  1 
ATOM   2679 C C   . LYS A 1 346 ? -31.994 126.565 32.178 1.00 38.16  ? 346  LYS A C   1 
ATOM   2680 O O   . LYS A 1 346 ? -31.544 127.382 32.979 1.00 40.55  ? 346  LYS A O   1 
ATOM   2681 C CB  . LYS A 1 346 ? -34.399 127.313 32.128 1.00 38.42  ? 346  LYS A CB  1 
ATOM   2682 C CG  . LYS A 1 346 ? -35.868 126.937 32.241 1.00 40.89  ? 346  LYS A CG  1 
ATOM   2683 C CD  . LYS A 1 346 ? -36.743 128.154 31.995 1.00 43.85  ? 346  LYS A CD  1 
ATOM   2684 C CE  . LYS A 1 346 ? -38.197 127.766 31.793 1.00 45.87  ? 346  LYS A CE  1 
ATOM   2685 N NZ  . LYS A 1 346 ? -39.053 128.957 31.525 1.00 47.16  ? 346  LYS A NZ  1 
ATOM   2686 N N   . ILE A 1 347 ? -31.247 126.011 31.230 1.00 37.46  ? 347  ILE A N   1 
ATOM   2687 C CA  . ILE A 1 347 ? -29.831 126.327 31.091 1.00 35.53  ? 347  ILE A CA  1 
ATOM   2688 C C   . ILE A 1 347 ? -29.553 127.528 30.193 1.00 35.31  ? 347  ILE A C   1 
ATOM   2689 O O   . ILE A 1 347 ? -30.160 127.690 29.136 1.00 34.76  ? 347  ILE A O   1 
ATOM   2690 C CB  . ILE A 1 347 ? -29.055 125.084 30.555 1.00 36.49  ? 347  ILE A CB  1 
ATOM   2691 C CG1 . ILE A 1 347 ? -29.335 123.873 31.457 1.00 34.99  ? 347  ILE A CG1 1 
ATOM   2692 C CG2 . ILE A 1 347 ? -27.561 125.367 30.482 1.00 33.42  ? 347  ILE A CG2 1 
ATOM   2693 C CD1 . ILE A 1 347 ? -29.051 124.109 32.932 1.00 34.52  ? 347  ILE A CD1 1 
ATOM   2694 N N   . SER A 1 348 ? -28.622 128.369 30.630 1.00 36.28  ? 348  SER A N   1 
ATOM   2695 C CA  . SER A 1 348 ? -28.236 129.556 29.878 1.00 36.07  ? 348  SER A CA  1 
ATOM   2696 C C   . SER A 1 348 ? -27.195 129.203 28.818 1.00 37.60  ? 348  SER A C   1 
ATOM   2697 O O   . SER A 1 348 ? -26.629 128.108 28.825 1.00 36.75  ? 348  SER A O   1 
ATOM   2698 C CB  . SER A 1 348 ? -27.665 130.620 30.818 1.00 34.32  ? 348  SER A CB  1 
ATOM   2699 O OG  . SER A 1 348 ? -26.439 130.202 31.388 1.00 33.75  ? 348  SER A OG  1 
ATOM   2700 N N   . ARG A 1 349 ? -26.940 130.146 27.917 1.00 38.90  ? 349  ARG A N   1 
ATOM   2701 C CA  . ARG A 1 349 ? -25.982 129.941 26.844 1.00 40.00  ? 349  ARG A CA  1 
ATOM   2702 C C   . ARG A 1 349 ? -24.561 129.743 27.363 1.00 41.50  ? 349  ARG A C   1 
ATOM   2703 O O   . ARG A 1 349 ? -23.785 128.971 26.798 1.00 41.91  ? 349  ARG A O   1 
ATOM   2704 C CB  . ARG A 1 349 ? -25.995 131.135 25.893 1.00 40.31  ? 349  ARG A CB  1 
ATOM   2705 C CG  . ARG A 1 349 ? -25.337 130.839 24.562 1.00 41.69  ? 349  ARG A CG  1 
ATOM   2706 C CD  . ARG A 1 349 ? -26.176 129.833 23.807 1.00 41.92  ? 349  ARG A CD  1 
ATOM   2707 N NE  . ARG A 1 349 ? -25.376 129.034 22.895 1.00 43.26  ? 349  ARG A NE  1 
ATOM   2708 C CZ  . ARG A 1 349 ? -25.814 127.926 22.310 1.00 44.89  ? 349  ARG A CZ  1 
ATOM   2709 N NH1 . ARG A 1 349 ? -27.048 127.497 22.547 1.00 44.43  ? 349  ARG A NH1 1 
ATOM   2710 N NH2 . ARG A 1 349 ? -25.014 127.240 21.501 1.00 44.75  ? 349  ARG A NH2 1 
ATOM   2711 N N   . GLU A 1 350 ? -24.221 130.446 28.436 1.00 42.07  ? 350  GLU A N   1 
ATOM   2712 C CA  . GLU A 1 350 ? -22.887 130.355 29.004 1.00 43.35  ? 350  GLU A CA  1 
ATOM   2713 C C   . GLU A 1 350 ? -22.691 129.040 29.750 1.00 43.07  ? 350  GLU A C   1 
ATOM   2714 O O   . GLU A 1 350 ? -21.616 128.436 29.682 1.00 41.49  ? 350  GLU A O   1 
ATOM   2715 C CB  . GLU A 1 350 ? -22.639 131.532 29.943 1.00 46.69  ? 350  GLU A CB  1 
ATOM   2716 C CG  . GLU A 1 350 ? -21.219 131.606 30.472 1.00 54.26  ? 350  GLU A CG  1 
ATOM   2717 C CD  . GLU A 1 350 ? -21.058 132.664 31.555 1.00 59.40  ? 350  GLU A CD  1 
ATOM   2718 O OE1 . GLU A 1 350 ? -21.200 133.869 31.242 1.00 62.22  ? 350  GLU A OE1 1 
ATOM   2719 O OE2 . GLU A 1 350 ? -20.795 132.286 32.722 1.00 60.37  ? 350  GLU A OE2 1 
ATOM   2720 N N   . ASP A 1 351 ? -23.724 128.602 30.469 1.00 41.55  ? 351  ASP A N   1 
ATOM   2721 C CA  . ASP A 1 351 ? -23.641 127.344 31.199 1.00 39.61  ? 351  ASP A CA  1 
ATOM   2722 C C   . ASP A 1 351 ? -23.663 126.199 30.195 1.00 38.67  ? 351  ASP A C   1 
ATOM   2723 O O   . ASP A 1 351 ? -23.045 125.155 30.413 1.00 37.58  ? 351  ASP A O   1 
ATOM   2724 C CB  . ASP A 1 351 ? -24.805 127.197 32.183 1.00 39.87  ? 351  ASP A CB  1 
ATOM   2725 C CG  . ASP A 1 351 ? -24.653 128.081 33.411 1.00 39.35  ? 351  ASP A CG  1 
ATOM   2726 O OD1 . ASP A 1 351 ? -23.502 128.340 33.819 1.00 38.65  ? 351  ASP A OD1 1 
ATOM   2727 O OD2 . ASP A 1 351 ? -25.685 128.499 33.979 1.00 39.09  ? 351  ASP A OD2 1 
ATOM   2728 N N   . PHE A 1 352 ? -24.376 126.405 29.092 1.00 37.57  ? 352  PHE A N   1 
ATOM   2729 C CA  . PHE A 1 352 ? -24.466 125.402 28.042 1.00 37.57  ? 352  PHE A CA  1 
ATOM   2730 C C   . PHE A 1 352 ? -23.059 125.132 27.515 1.00 38.61  ? 352  PHE A C   1 
ATOM   2731 O O   . PHE A 1 352 ? -22.633 123.976 27.407 1.00 38.46  ? 352  PHE A O   1 
ATOM   2732 C CB  . PHE A 1 352 ? -25.352 125.905 26.896 1.00 36.91  ? 352  PHE A CB  1 
ATOM   2733 C CG  . PHE A 1 352 ? -25.447 124.949 25.737 1.00 36.35  ? 352  PHE A CG  1 
ATOM   2734 C CD1 . PHE A 1 352 ? -26.298 123.853 25.788 1.00 37.23  ? 352  PHE A CD1 1 
ATOM   2735 C CD2 . PHE A 1 352 ? -24.669 125.133 24.601 1.00 37.68  ? 352  PHE A CD2 1 
ATOM   2736 C CE1 . PHE A 1 352 ? -26.372 122.952 24.724 1.00 36.77  ? 352  PHE A CE1 1 
ATOM   2737 C CE2 . PHE A 1 352 ? -24.738 124.235 23.532 1.00 37.34  ? 352  PHE A CE2 1 
ATOM   2738 C CZ  . PHE A 1 352 ? -25.591 123.144 23.597 1.00 35.19  ? 352  PHE A CZ  1 
ATOM   2739 N N   . MET A 1 353 ? -22.352 126.212 27.184 1.00 38.10  ? 353  MET A N   1 
ATOM   2740 C CA  . MET A 1 353 ? -20.990 126.079 26.681 1.00 38.43  ? 353  MET A CA  1 
ATOM   2741 C C   . MET A 1 353 ? -20.106 125.337 27.677 1.00 36.82  ? 353  MET A C   1 
ATOM   2742 O O   . MET A 1 353 ? -19.252 124.555 27.312 1.00 35.81  ? 353  MET A O   1 
ATOM   2743 C CB  . MET A 1 353 ? -20.399 127.454 26.364 1.00 41.52  ? 353  MET A CB  1 
ATOM   2744 C CG  . MET A 1 353 ? -21.162 128.227 25.301 1.00 47.15  ? 353  MET A CG  1 
ATOM   2745 S SD  . MET A 1 353 ? -21.708 127.180 23.938 1.00 52.13  ? 353  MET A SD  1 
ATOM   2746 C CE  . MET A 1 353 ? -20.147 126.830 23.134 1.00 51.98  ? 353  MET A CE  1 
ATOM   2747 N N   . SER A 1 354 ? -20.370 125.599 28.951 1.00 35.58  ? 354  SER A N   1 
ATOM   2748 C CA  . SER A 1 354 ? -19.609 124.951 29.998 1.00 36.11  ? 354  SER A CA  1 
ATOM   2749 C C   . SER A 1 354 ? -19.922 123.452 30.039 1.00 36.28  ? 354  SER A C   1 
ATOM   2750 O O   . SER A 1 354 ? -19.014 122.625 30.089 1.00 36.84  ? 354  SER A O   1 
ATOM   2751 C CB  . SER A 1 354 ? -19.919 125.608 31.345 1.00 35.25  ? 354  SER A CB  1 
ATOM   2752 O OG  . SER A 1 354 ? -19.483 126.955 31.351 1.00 31.93  ? 354  SER A OG  1 
ATOM   2753 N N   . GLY A 1 355 ? -21.204 123.106 30.000 1.00 35.33  ? 355  GLY A N   1 
ATOM   2754 C CA  . GLY A 1 355 ? -21.587 121.704 30.038 1.00 33.52  ? 355  GLY A CA  1 
ATOM   2755 C C   . GLY A 1 355 ? -21.028 120.919 28.868 1.00 30.88  ? 355  GLY A C   1 
ATOM   2756 O O   . GLY A 1 355 ? -20.665 119.757 28.999 1.00 30.51  ? 355  GLY A O   1 
ATOM   2757 N N   . VAL A 1 356 ? -20.969 121.561 27.713 1.00 29.33  ? 356  VAL A N   1 
ATOM   2758 C CA  . VAL A 1 356 ? -20.437 120.922 26.528 1.00 29.35  ? 356  VAL A CA  1 
ATOM   2759 C C   . VAL A 1 356 ? -19.004 120.452 26.788 1.00 29.68  ? 356  VAL A C   1 
ATOM   2760 O O   . VAL A 1 356 ? -18.617 119.362 26.377 1.00 31.71  ? 356  VAL A O   1 
ATOM   2761 C CB  . VAL A 1 356 ? -20.451 121.901 25.321 1.00 29.34  ? 356  VAL A CB  1 
ATOM   2762 C CG1 . VAL A 1 356 ? -19.605 121.349 24.180 1.00 28.72  ? 356  VAL A CG1 1 
ATOM   2763 C CG2 . VAL A 1 356 ? -21.881 122.125 24.856 1.00 27.73  ? 356  VAL A CG2 1 
ATOM   2764 N N   . LYS A 1 357 ? -18.223 121.269 27.484 1.00 29.44  ? 357  LYS A N   1 
ATOM   2765 C CA  . LYS A 1 357 ? -16.834 120.927 27.772 1.00 29.52  ? 357  LYS A CA  1 
ATOM   2766 C C   . LYS A 1 357 ? -16.733 119.734 28.712 1.00 28.93  ? 357  LYS A C   1 
ATOM   2767 O O   . LYS A 1 357 ? -15.977 118.793 28.463 1.00 29.62  ? 357  LYS A O   1 
ATOM   2768 C CB  . LYS A 1 357 ? -16.113 122.119 28.398 1.00 29.39  ? 357  LYS A CB  1 
ATOM   2769 C CG  . LYS A 1 357 ? -14.674 122.273 27.939 1.00 31.83  ? 357  LYS A CG  1 
ATOM   2770 C CD  . LYS A 1 357 ? -13.896 123.188 28.875 1.00 37.67  ? 357  LYS A CD  1 
ATOM   2771 C CE  . LYS A 1 357 ? -12.631 123.723 28.228 1.00 38.74  ? 357  LYS A CE  1 
ATOM   2772 N NZ  . LYS A 1 357 ? -11.736 122.657 27.702 1.00 42.04  ? 357  LYS A NZ  1 
ATOM   2773 N N   . LEU A 1 358 ? -17.485 119.795 29.805 1.00 28.59  ? 358  LEU A N   1 
ATOM   2774 C CA  . LEU A 1 358 ? -17.504 118.731 30.796 1.00 27.57  ? 358  LEU A CA  1 
ATOM   2775 C C   . LEU A 1 358 ? -17.988 117.424 30.194 1.00 27.51  ? 358  LEU A C   1 
ATOM   2776 O O   . LEU A 1 358 ? -17.535 116.356 30.596 1.00 29.00  ? 358  LEU A O   1 
ATOM   2777 C CB  . LEU A 1 358 ? -18.419 119.112 31.950 1.00 28.67  ? 358  LEU A CB  1 
ATOM   2778 C CG  . LEU A 1 358 ? -17.884 120.246 32.815 1.00 30.92  ? 358  LEU A CG  1 
ATOM   2779 C CD1 . LEU A 1 358 ? -18.950 120.683 33.819 1.00 31.33  ? 358  LEU A CD1 1 
ATOM   2780 C CD2 . LEU A 1 358 ? -16.619 119.777 33.524 1.00 29.02  ? 358  LEU A CD2 1 
ATOM   2781 N N   . SER A 1 359 ? -18.908 117.519 29.237 1.00 25.00  ? 359  SER A N   1 
ATOM   2782 C CA  . SER A 1 359 ? -19.473 116.350 28.567 1.00 24.55  ? 359  SER A CA  1 
ATOM   2783 C C   . SER A 1 359 ? -18.558 115.687 27.539 1.00 26.28  ? 359  SER A C   1 
ATOM   2784 O O   . SER A 1 359 ? -18.654 114.480 27.304 1.00 25.95  ? 359  SER A O   1 
ATOM   2785 C CB  . SER A 1 359 ? -20.776 116.736 27.884 1.00 21.20  ? 359  SER A CB  1 
ATOM   2786 O OG  . SER A 1 359 ? -21.712 117.165 28.846 1.00 22.33  ? 359  SER A OG  1 
ATOM   2787 N N   . VAL A 1 360 ? -17.679 116.476 26.926 1.00 27.54  ? 360  VAL A N   1 
ATOM   2788 C CA  . VAL A 1 360 ? -16.759 115.968 25.909 1.00 27.59  ? 360  VAL A CA  1 
ATOM   2789 C C   . VAL A 1 360 ? -15.328 116.403 26.244 1.00 29.04  ? 360  VAL A C   1 
ATOM   2790 O O   . VAL A 1 360 ? -14.635 117.007 25.417 1.00 29.30  ? 360  VAL A O   1 
ATOM   2791 C CB  . VAL A 1 360 ? -17.141 116.518 24.511 1.00 27.30  ? 360  VAL A CB  1 
ATOM   2792 C CG1 . VAL A 1 360 ? -16.467 115.688 23.418 1.00 24.01  ? 360  VAL A CG1 1 
ATOM   2793 C CG2 . VAL A 1 360 ? -18.663 116.535 24.352 1.00 23.45  ? 360  VAL A CG2 1 
ATOM   2794 N N   . PRO A 1 361 ? -14.863 116.075 27.457 1.00 29.06  ? 361  PRO A N   1 
ATOM   2795 C CA  . PRO A 1 361 ? -13.532 116.400 27.983 1.00 30.31  ? 361  PRO A CA  1 
ATOM   2796 C C   . PRO A 1 361 ? -12.331 116.143 27.072 1.00 30.80  ? 361  PRO A C   1 
ATOM   2797 O O   . PRO A 1 361 ? -11.371 116.918 27.064 1.00 33.03  ? 361  PRO A O   1 
ATOM   2798 C CB  . PRO A 1 361 ? -13.462 115.577 29.269 1.00 31.51  ? 361  PRO A CB  1 
ATOM   2799 C CG  . PRO A 1 361 ? -14.350 114.403 28.970 1.00 32.93  ? 361  PRO A CG  1 
ATOM   2800 C CD  . PRO A 1 361 ? -15.524 115.077 28.313 1.00 30.48  ? 361  PRO A CD  1 
ATOM   2801 N N   . HIS A 1 362 ? -12.377 115.063 26.307 1.00 29.40  ? 362  HIS A N   1 
ATOM   2802 C CA  . HIS A 1 362 ? -11.270 114.714 25.420 1.00 28.74  ? 362  HIS A CA  1 
ATOM   2803 C C   . HIS A 1 362 ? -11.220 115.555 24.150 1.00 28.50  ? 362  HIS A C   1 
ATOM   2804 O O   . HIS A 1 362 ? -10.287 115.422 23.356 1.00 27.96  ? 362  HIS A O   1 
ATOM   2805 C CB  . HIS A 1 362 ? -11.393 113.255 24.999 1.00 25.88  ? 362  HIS A CB  1 
ATOM   2806 C CG  . HIS A 1 362 ? -12.656 112.963 24.251 1.00 26.95  ? 362  HIS A CG  1 
ATOM   2807 N ND1 . HIS A 1 362 ? -13.897 112.971 24.855 1.00 28.26  ? 362  HIS A ND1 1 
ATOM   2808 C CD2 . HIS A 1 362 ? -12.874 112.659 22.949 1.00 27.27  ? 362  HIS A CD2 1 
ATOM   2809 C CE1 . HIS A 1 362 ? -14.823 112.679 23.958 1.00 27.35  ? 362  HIS A CE1 1 
ATOM   2810 N NE2 . HIS A 1 362 ? -14.230 112.484 22.793 1.00 26.06  ? 362  HIS A NE2 1 
ATOM   2811 N N   . ALA A 1 363 ? -12.217 116.409 23.951 1.00 27.97  ? 363  ALA A N   1 
ATOM   2812 C CA  . ALA A 1 363 ? -12.291 117.202 22.731 1.00 27.78  ? 363  ALA A CA  1 
ATOM   2813 C C   . ALA A 1 363 ? -11.422 118.436 22.693 1.00 28.08  ? 363  ALA A C   1 
ATOM   2814 O O   . ALA A 1 363 ? -11.227 119.098 23.704 1.00 29.74  ? 363  ALA A O   1 
ATOM   2815 C CB  . ALA A 1 363 ? -13.733 117.594 22.464 1.00 26.10  ? 363  ALA A CB  1 
ATOM   2816 N N   . ASN A 1 364 ? -10.890 118.737 21.513 1.00 29.31  ? 364  ASN A N   1 
ATOM   2817 C CA  . ASN A 1 364 ? -10.088 119.936 21.350 1.00 31.09  ? 364  ASN A CA  1 
ATOM   2818 C C   . ASN A 1 364 ? -11.099 121.039 21.066 1.00 32.17  ? 364  ASN A C   1 
ATOM   2819 O O   . ASN A 1 364 ? -12.287 120.772 20.891 1.00 32.29  ? 364  ASN A O   1 
ATOM   2820 C CB  . ASN A 1 364 ? -9.103  119.809 20.185 1.00 30.60  ? 364  ASN A CB  1 
ATOM   2821 C CG  . ASN A 1 364 ? -9.781  119.462 18.880 1.00 33.15  ? 364  ASN A CG  1 
ATOM   2822 O OD1 . ASN A 1 364 ? -10.901 119.895 18.611 1.00 32.91  ? 364  ASN A OD1 1 
ATOM   2823 N ND2 . ASN A 1 364 ? -9.096  118.684 18.050 1.00 35.11  ? 364  ASN A ND2 1 
ATOM   2824 N N   . ASP A 1 365 ? -10.632 122.274 21.004 1.00 33.95  ? 365  ASP A N   1 
ATOM   2825 C CA  . ASP A 1 365 ? -11.527 123.390 20.778 1.00 35.25  ? 365  ASP A CA  1 
ATOM   2826 C C   . ASP A 1 365 ? -12.422 123.258 19.544 1.00 34.16  ? 365  ASP A C   1 
ATOM   2827 O O   . ASP A 1 365 ? -13.612 123.575 19.598 1.00 33.97  ? 365  ASP A O   1 
ATOM   2828 C CB  . ASP A 1 365 ? -10.724 124.679 20.715 1.00 39.87  ? 365  ASP A CB  1 
ATOM   2829 C CG  . ASP A 1 365 ? -11.604 125.887 20.658 1.00 45.93  ? 365  ASP A CG  1 
ATOM   2830 O OD1 . ASP A 1 365 ? -12.096 126.214 19.555 1.00 50.04  ? 365  ASP A OD1 1 
ATOM   2831 O OD2 . ASP A 1 365 ? -11.825 126.498 21.725 1.00 51.51  ? 365  ASP A OD2 1 
ATOM   2832 N N   . LEU A 1 366 ? -11.857 122.796 18.433 1.00 31.62  ? 366  LEU A N   1 
ATOM   2833 C CA  . LEU A 1 366 ? -12.637 122.625 17.210 1.00 28.89  ? 366  LEU A CA  1 
ATOM   2834 C C   . LEU A 1 366 ? -13.692 121.552 17.442 1.00 28.50  ? 366  LEU A C   1 
ATOM   2835 O O   . LEU A 1 366 ? -14.809 121.643 16.935 1.00 30.08  ? 366  LEU A O   1 
ATOM   2836 C CB  . LEU A 1 366 ? -11.735 122.197 16.049 1.00 27.03  ? 366  LEU A CB  1 
ATOM   2837 C CG  . LEU A 1 366 ? -12.361 122.039 14.661 1.00 26.47  ? 366  LEU A CG  1 
ATOM   2838 C CD1 . LEU A 1 366 ? -12.793 123.398 14.122 1.00 26.11  ? 366  LEU A CD1 1 
ATOM   2839 C CD2 . LEU A 1 366 ? -11.358 121.411 13.726 1.00 24.91  ? 366  LEU A CD2 1 
ATOM   2840 N N   . GLY A 1 367 ? -13.327 120.531 18.211 1.00 26.77  ? 367  GLY A N   1 
ATOM   2841 C CA  . GLY A 1 367 ? -14.258 119.462 18.487 1.00 25.20  ? 367  GLY A CA  1 
ATOM   2842 C C   . GLY A 1 367 ? -15.452 120.039 19.203 1.00 25.36  ? 367  GLY A C   1 
ATOM   2843 O O   . GLY A 1 367 ? -16.600 119.796 18.827 1.00 26.36  ? 367  GLY A O   1 
ATOM   2844 N N   . LEU A 1 368 ? -15.176 120.815 20.244 1.00 24.02  ? 368  LEU A N   1 
ATOM   2845 C CA  . LEU A 1 368 ? -16.230 121.443 21.013 1.00 24.52  ? 368  LEU A CA  1 
ATOM   2846 C C   . LEU A 1 368 ? -17.142 122.250 20.095 1.00 24.93  ? 368  LEU A C   1 
ATOM   2847 O O   . LEU A 1 368 ? -18.358 122.226 20.249 1.00 25.19  ? 368  LEU A O   1 
ATOM   2848 C CB  . LEU A 1 368 ? -15.622 122.329 22.095 1.00 24.15  ? 368  LEU A CB  1 
ATOM   2849 C CG  . LEU A 1 368 ? -14.773 121.539 23.102 1.00 24.89  ? 368  LEU A CG  1 
ATOM   2850 C CD1 . LEU A 1 368 ? -14.209 122.473 24.165 1.00 25.75  ? 368  LEU A CD1 1 
ATOM   2851 C CD2 . LEU A 1 368 ? -15.625 120.456 23.756 1.00 25.68  ? 368  LEU A CD2 1 
ATOM   2852 N N   . ASP A 1 369 ? -16.561 122.946 19.128 1.00 25.19  ? 369  ASP A N   1 
ATOM   2853 C CA  . ASP A 1 369 ? -17.369 123.718 18.206 1.00 27.29  ? 369  ASP A CA  1 
ATOM   2854 C C   . ASP A 1 369 ? -18.313 122.772 17.476 1.00 27.52  ? 369  ASP A C   1 
ATOM   2855 O O   . ASP A 1 369 ? -19.521 123.012 17.404 1.00 26.22  ? 369  ASP A O   1 
ATOM   2856 C CB  . ASP A 1 369 ? -16.482 124.462 17.202 1.00 30.83  ? 369  ASP A CB  1 
ATOM   2857 C CG  . ASP A 1 369 ? -15.733 125.629 17.834 1.00 34.02  ? 369  ASP A CG  1 
ATOM   2858 O OD1 . ASP A 1 369 ? -16.056 125.981 18.991 1.00 34.43  ? 369  ASP A OD1 1 
ATOM   2859 O OD2 . ASP A 1 369 ? -14.833 126.199 17.171 1.00 34.44  ? 369  ASP A OD2 1 
ATOM   2860 N N   . ALA A 1 370 ? -17.756 121.690 16.942 1.00 27.13  ? 370  ALA A N   1 
ATOM   2861 C CA  . ALA A 1 370 ? -18.540 120.694 16.223 1.00 26.81  ? 370  ALA A CA  1 
ATOM   2862 C C   . ALA A 1 370 ? -19.761 120.275 17.040 1.00 27.79  ? 370  ALA A C   1 
ATOM   2863 O O   . ALA A 1 370 ? -20.901 120.348 16.564 1.00 29.10  ? 370  ALA A O   1 
ATOM   2864 C CB  . ALA A 1 370 ? -17.679 119.479 15.931 1.00 27.10  ? 370  ALA A CB  1 
ATOM   2865 N N   . VAL A 1 371 ? -19.513 119.836 18.271 1.00 26.50  ? 371  VAL A N   1 
ATOM   2866 C CA  . VAL A 1 371 ? -20.580 119.397 19.164 1.00 25.70  ? 371  VAL A CA  1 
ATOM   2867 C C   . VAL A 1 371 ? -21.639 120.473 19.353 1.00 26.16  ? 371  VAL A C   1 
ATOM   2868 O O   . VAL A 1 371 ? -22.842 120.193 19.264 1.00 24.43  ? 371  VAL A O   1 
ATOM   2869 C CB  . VAL A 1 371 ? -20.028 119.021 20.551 1.00 24.11  ? 371  VAL A CB  1 
ATOM   2870 C CG1 . VAL A 1 371 ? -21.159 118.513 21.447 1.00 20.02  ? 371  VAL A CG1 1 
ATOM   2871 C CG2 . VAL A 1 371 ? -18.940 117.979 20.398 1.00 22.87  ? 371  VAL A CG2 1 
ATOM   2872 N N   . THR A 1 372 ? -21.174 121.694 19.624 1.00 25.62  ? 372  THR A N   1 
ATOM   2873 C CA  . THR A 1 372 ? -22.040 122.849 19.845 1.00 26.20  ? 372  THR A CA  1 
ATOM   2874 C C   . THR A 1 372 ? -22.942 123.121 18.647 1.00 25.94  ? 372  THR A C   1 
ATOM   2875 O O   . THR A 1 372 ? -24.159 123.237 18.782 1.00 25.96  ? 372  THR A O   1 
ATOM   2876 C CB  . THR A 1 372 ? -21.214 124.122 20.107 1.00 27.46  ? 372  THR A CB  1 
ATOM   2877 O OG1 . THR A 1 372 ? -20.365 123.923 21.242 1.00 27.21  ? 372  THR A OG1 1 
ATOM   2878 C CG2 . THR A 1 372 ? -22.136 125.305 20.363 1.00 28.33  ? 372  THR A CG2 1 
ATOM   2879 N N   . LEU A 1 373 ? -22.330 123.229 17.475 1.00 25.44  ? 373  LEU A N   1 
ATOM   2880 C CA  . LEU A 1 373 ? -23.066 123.488 16.250 1.00 24.99  ? 373  LEU A CA  1 
ATOM   2881 C C   . LEU A 1 373 ? -24.108 122.403 16.018 1.00 27.31  ? 373  LEU A C   1 
ATOM   2882 O O   . LEU A 1 373 ? -25.244 122.683 15.628 1.00 27.56  ? 373  LEU A O   1 
ATOM   2883 C CB  . LEU A 1 373 ? -22.097 123.535 15.073 1.00 21.24  ? 373  LEU A CB  1 
ATOM   2884 C CG  . LEU A 1 373 ? -22.684 123.671 13.669 1.00 22.89  ? 373  LEU A CG  1 
ATOM   2885 C CD1 . LEU A 1 373 ? -23.338 125.040 13.494 1.00 19.47  ? 373  LEU A CD1 1 
ATOM   2886 C CD2 . LEU A 1 373 ? -21.572 123.457 12.644 1.00 21.67  ? 373  LEU A CD2 1 
ATOM   2887 N N   . GLN A 1 374 ? -23.720 121.158 16.267 1.00 29.00  ? 374  GLN A N   1 
ATOM   2888 C CA  . GLN A 1 374 ? -24.628 120.039 16.059 1.00 30.68  ? 374  GLN A CA  1 
ATOM   2889 C C   . GLN A 1 374 ? -25.854 120.104 16.970 1.00 29.63  ? 374  GLN A C   1 
ATOM   2890 O O   . GLN A 1 374 ? -26.969 119.808 16.543 1.00 29.33  ? 374  GLN A O   1 
ATOM   2891 C CB  . GLN A 1 374 ? -23.890 118.718 16.288 1.00 33.77  ? 374  GLN A CB  1 
ATOM   2892 C CG  . GLN A 1 374 ? -24.639 117.497 15.797 1.00 36.18  ? 374  GLN A CG  1 
ATOM   2893 C CD  . GLN A 1 374 ? -24.620 117.368 14.286 1.00 40.54  ? 374  GLN A CD  1 
ATOM   2894 O OE1 . GLN A 1 374 ? -25.260 116.476 13.723 1.00 44.15  ? 374  GLN A OE1 1 
ATOM   2895 N NE2 . GLN A 1 374 ? -23.878 118.250 13.619 1.00 40.49  ? 374  GLN A NE2 1 
ATOM   2896 N N   . TYR A 1 375 ? -25.661 120.500 18.220 1.00 27.81  ? 375  TYR A N   1 
ATOM   2897 C CA  . TYR A 1 375 ? -26.790 120.547 19.135 1.00 28.85  ? 375  TYR A CA  1 
ATOM   2898 C C   . TYR A 1 375 ? -27.369 121.924 19.469 1.00 28.94  ? 375  TYR A C   1 
ATOM   2899 O O   . TYR A 1 375 ? -28.107 122.073 20.447 1.00 29.20  ? 375  TYR A O   1 
ATOM   2900 C CB  . TYR A 1 375 ? -26.442 119.813 20.434 1.00 26.93  ? 375  TYR A CB  1 
ATOM   2901 C CG  . TYR A 1 375 ? -26.283 118.322 20.275 1.00 25.36  ? 375  TYR A CG  1 
ATOM   2902 C CD1 . TYR A 1 375 ? -25.059 117.765 19.885 1.00 24.44  ? 375  TYR A CD1 1 
ATOM   2903 C CD2 . TYR A 1 375 ? -27.353 117.461 20.520 1.00 22.72  ? 375  TYR A CD2 1 
ATOM   2904 C CE1 . TYR A 1 375 ? -24.907 116.386 19.750 1.00 21.76  ? 375  TYR A CE1 1 
ATOM   2905 C CE2 . TYR A 1 375 ? -27.212 116.080 20.387 1.00 20.03  ? 375  TYR A CE2 1 
ATOM   2906 C CZ  . TYR A 1 375 ? -25.989 115.547 20.008 1.00 20.93  ? 375  TYR A CZ  1 
ATOM   2907 O OH  . TYR A 1 375 ? -25.841 114.180 19.923 1.00 16.52  ? 375  TYR A OH  1 
ATOM   2908 N N   . THR A 1 376 ? -27.051 122.936 18.675 1.00 28.50  ? 376  THR A N   1 
ATOM   2909 C CA  . THR A 1 376 ? -27.610 124.248 18.946 1.00 27.78  ? 376  THR A CA  1 
ATOM   2910 C C   . THR A 1 376 ? -28.576 124.657 17.851 1.00 28.14  ? 376  THR A C   1 
ATOM   2911 O O   . THR A 1 376 ? -28.284 124.497 16.665 1.00 28.08  ? 376  THR A O   1 
ATOM   2912 C CB  . THR A 1 376 ? -26.525 125.322 19.046 1.00 28.18  ? 376  THR A CB  1 
ATOM   2913 O OG1 . THR A 1 376 ? -25.626 124.993 20.111 1.00 30.13  ? 376  THR A OG1 1 
ATOM   2914 C CG2 . THR A 1 376 ? -27.157 126.681 19.325 1.00 28.27  ? 376  THR A CG2 1 
ATOM   2915 N N   . ASP A 1 377 ? -29.743 125.150 18.247 1.00 29.54  ? 377  ASP A N   1 
ATOM   2916 C CA  . ASP A 1 377 ? -30.726 125.629 17.282 1.00 30.51  ? 377  ASP A CA  1 
ATOM   2917 C C   . ASP A 1 377 ? -30.541 127.146 17.264 1.00 31.43  ? 377  ASP A C   1 
ATOM   2918 O O   . ASP A 1 377 ? -30.955 127.836 18.188 1.00 29.78  ? 377  ASP A O   1 
ATOM   2919 C CB  . ASP A 1 377 ? -32.143 125.260 17.722 1.00 30.21  ? 377  ASP A CB  1 
ATOM   2920 C CG  . ASP A 1 377 ? -33.209 126.073 17.004 1.00 31.74  ? 377  ASP A CG  1 
ATOM   2921 O OD1 . ASP A 1 377 ? -32.971 126.513 15.858 1.00 33.37  ? 377  ASP A OD1 1 
ATOM   2922 O OD2 . ASP A 1 377 ? -34.294 126.264 17.584 1.00 32.54  ? 377  ASP A OD2 1 
ATOM   2923 N N   . TRP A 1 378 ? -29.897 127.662 16.223 1.00 33.96  ? 378  TRP A N   1 
ATOM   2924 C CA  . TRP A 1 378 ? -29.639 129.092 16.153 1.00 37.09  ? 378  TRP A CA  1 
ATOM   2925 C C   . TRP A 1 378 ? -30.827 129.964 15.819 1.00 39.81  ? 378  TRP A C   1 
ATOM   2926 O O   . TRP A 1 378 ? -30.677 131.170 15.647 1.00 40.99  ? 378  TRP A O   1 
ATOM   2927 C CB  . TRP A 1 378 ? -28.503 129.372 15.189 1.00 36.39  ? 378  TRP A CB  1 
ATOM   2928 C CG  . TRP A 1 378 ? -27.248 128.763 15.659 1.00 36.66  ? 378  TRP A CG  1 
ATOM   2929 C CD1 . TRP A 1 378 ? -26.681 127.611 15.212 1.00 37.23  ? 378  TRP A CD1 1 
ATOM   2930 C CD2 . TRP A 1 378 ? -26.410 129.246 16.710 1.00 36.53  ? 378  TRP A CD2 1 
ATOM   2931 N NE1 . TRP A 1 378 ? -25.536 127.341 15.917 1.00 38.90  ? 378  TRP A NE1 1 
ATOM   2932 C CE2 . TRP A 1 378 ? -25.344 128.329 16.846 1.00 37.99  ? 378  TRP A CE2 1 
ATOM   2933 C CE3 . TRP A 1 378 ? -26.455 130.364 17.552 1.00 36.76  ? 378  TRP A CE3 1 
ATOM   2934 C CZ2 . TRP A 1 378 ? -24.324 128.495 17.792 1.00 38.60  ? 378  TRP A CZ2 1 
ATOM   2935 C CZ3 . TRP A 1 378 ? -25.442 130.533 18.496 1.00 38.16  ? 378  TRP A CZ3 1 
ATOM   2936 C CH2 . TRP A 1 378 ? -24.389 129.599 18.606 1.00 38.93  ? 378  TRP A CH2 1 
ATOM   2937 N N   . MET A 1 379 ? -32.004 129.352 15.733 1.00 42.16  ? 379  MET A N   1 
ATOM   2938 C CA  . MET A 1 379 ? -33.230 130.087 15.466 1.00 43.57  ? 379  MET A CA  1 
ATOM   2939 C C   . MET A 1 379 ? -33.816 130.475 16.812 1.00 43.92  ? 379  MET A C   1 
ATOM   2940 O O   . MET A 1 379 ? -34.763 131.257 16.893 1.00 46.06  ? 379  MET A O   1 
ATOM   2941 C CB  . MET A 1 379 ? -34.238 129.207 14.744 1.00 47.45  ? 379  MET A CB  1 
ATOM   2942 C CG  . MET A 1 379 ? -33.869 128.870 13.330 1.00 53.57  ? 379  MET A CG  1 
ATOM   2943 S SD  . MET A 1 379 ? -35.260 129.246 12.268 1.00 61.39  ? 379  MET A SD  1 
ATOM   2944 C CE  . MET A 1 379 ? -36.395 127.910 12.729 1.00 57.33  ? 379  MET A CE  1 
ATOM   2945 N N   . ASP A 1 380 ? -33.241 129.914 17.870 1.00 42.99  ? 380  ASP A N   1 
ATOM   2946 C CA  . ASP A 1 380 ? -33.710 130.162 19.223 1.00 41.71  ? 380  ASP A CA  1 
ATOM   2947 C C   . ASP A 1 380 ? -32.699 129.552 20.195 1.00 40.73  ? 380  ASP A C   1 
ATOM   2948 O O   . ASP A 1 380 ? -32.992 128.570 20.882 1.00 40.38  ? 380  ASP A O   1 
ATOM   2949 C CB  . ASP A 1 380 ? -35.088 129.514 19.379 1.00 41.17  ? 380  ASP A CB  1 
ATOM   2950 C CG  . ASP A 1 380 ? -35.720 129.802 20.711 1.00 41.58  ? 380  ASP A CG  1 
ATOM   2951 O OD1 . ASP A 1 380 ? -35.371 130.840 21.323 1.00 39.70  ? 380  ASP A OD1 1 
ATOM   2952 O OD2 . ASP A 1 380 ? -36.576 128.993 21.132 1.00 41.21  ? 380  ASP A OD2 1 
ATOM   2953 N N   . ASP A 1 381 ? -31.516 130.159 20.251 1.00 39.09  ? 381  ASP A N   1 
ATOM   2954 C CA  . ASP A 1 381 ? -30.417 129.673 21.079 1.00 38.88  ? 381  ASP A CA  1 
ATOM   2955 C C   . ASP A 1 381 ? -30.353 130.155 22.527 1.00 38.64  ? 381  ASP A C   1 
ATOM   2956 O O   . ASP A 1 381 ? -29.452 129.764 23.274 1.00 37.69  ? 381  ASP A O   1 
ATOM   2957 C CB  . ASP A 1 381 ? -29.092 129.997 20.396 1.00 39.66  ? 381  ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 381 ? -28.796 131.473 20.396 1.00 39.68  ? 381  ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 381 ? -29.584 132.238 19.803 1.00 40.34  ? 381  ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 381 ? -27.778 131.869 21.000 1.00 42.58  ? 381  ASP A OD2 1 
ATOM   2961 N N   . ASN A 1 382 ? -31.282 131.016 22.921 1.00 38.94  ? 382  ASN A N   1 
ATOM   2962 C CA  . ASN A 1 382 ? -31.314 131.504 24.297 1.00 38.23  ? 382  ASN A CA  1 
ATOM   2963 C C   . ASN A 1 382 ? -32.468 130.830 25.030 1.00 36.81  ? 382  ASN A C   1 
ATOM   2964 O O   . ASN A 1 382 ? -32.776 131.167 26.171 1.00 37.23  ? 382  ASN A O   1 
ATOM   2965 C CB  . ASN A 1 382 ? -31.480 133.027 24.328 1.00 40.49  ? 382  ASN A CB  1 
ATOM   2966 C CG  . ASN A 1 382 ? -30.157 133.769 24.158 1.00 42.78  ? 382  ASN A CG  1 
ATOM   2967 O OD1 . ASN A 1 382 ? -30.136 134.918 23.717 1.00 43.88  ? 382  ASN A OD1 1 
ATOM   2968 N ND2 . ASN A 1 382 ? -29.050 133.120 24.523 1.00 43.00  ? 382  ASN A ND2 1 
ATOM   2969 N N   . ASN A 1 383 ? -33.098 129.872 24.357 1.00 34.41  ? 383  ASN A N   1 
ATOM   2970 C CA  . ASN A 1 383 ? -34.212 129.121 24.917 1.00 33.72  ? 383  ASN A CA  1 
ATOM   2971 C C   . ASN A 1 383 ? -33.697 128.225 26.044 1.00 34.73  ? 383  ASN A C   1 
ATOM   2972 O O   . ASN A 1 383 ? -33.087 127.185 25.788 1.00 34.47  ? 383  ASN A O   1 
ATOM   2973 C CB  . ASN A 1 383 ? -34.841 128.255 23.826 1.00 32.76  ? 383  ASN A CB  1 
ATOM   2974 C CG  . ASN A 1 383 ? -36.174 127.670 24.233 1.00 30.05  ? 383  ASN A CG  1 
ATOM   2975 O OD1 . ASN A 1 383 ? -36.309 127.049 25.286 1.00 29.48  ? 383  ASN A OD1 1 
ATOM   2976 N ND2 . ASN A 1 383 ? -37.167 127.853 23.384 1.00 31.65  ? 383  ASN A ND2 1 
ATOM   2977 N N   . GLY A 1 384 ? -33.944 128.632 27.286 1.00 35.28  ? 384  GLY A N   1 
ATOM   2978 C CA  . GLY A 1 384 ? -33.497 127.855 28.431 1.00 35.70  ? 384  GLY A CA  1 
ATOM   2979 C C   . GLY A 1 384 ? -33.801 126.371 28.317 1.00 35.71  ? 384  GLY A C   1 
ATOM   2980 O O   . GLY A 1 384 ? -32.934 125.533 28.556 1.00 35.76  ? 384  GLY A O   1 
ATOM   2981 N N   . ILE A 1 385 ? -35.034 126.038 27.959 1.00 34.84  ? 385  ILE A N   1 
ATOM   2982 C CA  . ILE A 1 385 ? -35.411 124.642 27.813 1.00 34.96  ? 385  ILE A CA  1 
ATOM   2983 C C   . ILE A 1 385 ? -34.470 123.932 26.827 1.00 35.48  ? 385  ILE A C   1 
ATOM   2984 O O   . ILE A 1 385 ? -33.716 123.033 27.202 1.00 35.86  ? 385  ILE A O   1 
ATOM   2985 C CB  . ILE A 1 385 ? -36.852 124.509 27.290 1.00 33.99  ? 385  ILE A CB  1 
ATOM   2986 C CG1 . ILE A 1 385 ? -37.817 125.266 28.205 1.00 34.35  ? 385  ILE A CG1 1 
ATOM   2987 C CG2 . ILE A 1 385 ? -37.238 123.039 27.217 1.00 31.47  ? 385  ILE A CG2 1 
ATOM   2988 C CD1 . ILE A 1 385 ? -37.977 124.652 29.569 1.00 34.62  ? 385  ILE A CD1 1 
ATOM   2989 N N   . LYS A 1 386 ? -34.526 124.355 25.568 1.00 34.09  ? 386  LYS A N   1 
ATOM   2990 C CA  . LYS A 1 386 ? -33.716 123.776 24.504 1.00 32.91  ? 386  LYS A CA  1 
ATOM   2991 C C   . LYS A 1 386 ? -32.277 123.451 24.875 1.00 33.22  ? 386  LYS A C   1 
ATOM   2992 O O   . LYS A 1 386 ? -31.799 122.344 24.615 1.00 34.08  ? 386  LYS A O   1 
ATOM   2993 C CB  . LYS A 1 386 ? -33.733 124.699 23.284 1.00 31.28  ? 386  LYS A CB  1 
ATOM   2994 C CG  . LYS A 1 386 ? -35.031 124.631 22.511 1.00 31.76  ? 386  LYS A CG  1 
ATOM   2995 C CD  . LYS A 1 386 ? -35.050 125.602 21.365 1.00 32.80  ? 386  LYS A CD  1 
ATOM   2996 C CE  . LYS A 1 386 ? -36.321 125.457 20.557 1.00 31.40  ? 386  LYS A CE  1 
ATOM   2997 N NZ  . LYS A 1 386 ? -36.396 126.503 19.498 1.00 30.76  ? 386  LYS A NZ  1 
ATOM   2998 N N   . ASN A 1 387 ? -31.583 124.411 25.477 1.00 32.04  ? 387  ASN A N   1 
ATOM   2999 C CA  . ASN A 1 387 ? -30.195 124.195 25.851 1.00 30.93  ? 387  ASN A CA  1 
ATOM   3000 C C   . ASN A 1 387 ? -30.078 123.025 26.809 1.00 28.99  ? 387  ASN A C   1 
ATOM   3001 O O   . ASN A 1 387 ? -29.169 122.207 26.693 1.00 28.94  ? 387  ASN A O   1 
ATOM   3002 C CB  . ASN A 1 387 ? -29.605 125.445 26.510 1.00 31.05  ? 387  ASN A CB  1 
ATOM   3003 C CG  . ASN A 1 387 ? -29.610 126.644 25.592 1.00 34.06  ? 387  ASN A CG  1 
ATOM   3004 O OD1 . ASN A 1 387 ? -29.136 126.583 24.456 1.00 32.65  ? 387  ASN A OD1 1 
ATOM   3005 N ND2 . ASN A 1 387 ? -30.143 127.754 26.086 1.00 37.83  ? 387  ASN A ND2 1 
ATOM   3006 N N   . ARG A 1 388 ? -31.002 122.959 27.757 1.00 26.94  ? 388  ARG A N   1 
ATOM   3007 C CA  . ARG A 1 388 ? -31.000 121.904 28.750 1.00 26.77  ? 388  ARG A CA  1 
ATOM   3008 C C   . ARG A 1 388 ? -31.174 120.552 28.077 1.00 26.66  ? 388  ARG A C   1 
ATOM   3009 O O   . ARG A 1 388 ? -30.366 119.652 28.284 1.00 25.98  ? 388  ARG A O   1 
ATOM   3010 C CB  . ARG A 1 388 ? -32.117 122.148 29.766 1.00 28.36  ? 388  ARG A CB  1 
ATOM   3011 C CG  . ARG A 1 388 ? -32.151 121.149 30.904 1.00 29.35  ? 388  ARG A CG  1 
ATOM   3012 C CD  . ARG A 1 388 ? -33.477 120.447 30.940 1.00 28.30  ? 388  ARG A CD  1 
ATOM   3013 N NE  . ARG A 1 388 ? -34.536 121.363 31.333 1.00 31.66  ? 388  ARG A NE  1 
ATOM   3014 C CZ  . ARG A 1 388 ? -35.812 121.208 31.005 1.00 31.30  ? 388  ARG A CZ  1 
ATOM   3015 N NH1 . ARG A 1 388 ? -36.193 120.171 30.271 1.00 30.35  ? 388  ARG A NH1 1 
ATOM   3016 N NH2 . ARG A 1 388 ? -36.706 122.095 31.409 1.00 32.55  ? 388  ARG A NH2 1 
ATOM   3017 N N   . ASP A 1 389 ? -32.223 120.411 27.268 1.00 27.18  ? 389  ASP A N   1 
ATOM   3018 C CA  . ASP A 1 389 ? -32.463 119.154 26.571 1.00 27.31  ? 389  ASP A CA  1 
ATOM   3019 C C   . ASP A 1 389 ? -31.296 118.836 25.648 1.00 27.55  ? 389  ASP A C   1 
ATOM   3020 O O   . ASP A 1 389 ? -30.989 117.667 25.410 1.00 26.66  ? 389  ASP A O   1 
ATOM   3021 C CB  . ASP A 1 389 ? -33.747 119.210 25.743 1.00 28.32  ? 389  ASP A CB  1 
ATOM   3022 C CG  . ASP A 1 389 ? -34.999 119.243 26.599 1.00 31.06  ? 389  ASP A CG  1 
ATOM   3023 O OD1 . ASP A 1 389 ? -35.016 118.591 27.665 1.00 31.75  ? 389  ASP A OD1 1 
ATOM   3024 O OD2 . ASP A 1 389 ? -35.980 119.909 26.194 1.00 34.20  ? 389  ASP A OD2 1 
ATOM   3025 N N   . GLY A 1 390 ? -30.657 119.881 25.126 1.00 26.59  ? 390  GLY A N   1 
ATOM   3026 C CA  . GLY A 1 390 ? -29.527 119.695 24.240 1.00 25.35  ? 390  GLY A CA  1 
ATOM   3027 C C   . GLY A 1 390 ? -28.373 118.999 24.942 1.00 25.85  ? 390  GLY A C   1 
ATOM   3028 O O   . GLY A 1 390 ? -27.713 118.120 24.373 1.00 24.09  ? 390  GLY A O   1 
ATOM   3029 N N   . LEU A 1 391 ? -28.129 119.396 26.186 1.00 24.85  ? 391  LEU A N   1 
ATOM   3030 C CA  . LEU A 1 391 ? -27.063 118.808 26.972 1.00 24.98  ? 391  LEU A CA  1 
ATOM   3031 C C   . LEU A 1 391 ? -27.431 117.380 27.295 1.00 25.60  ? 391  LEU A C   1 
ATOM   3032 O O   . LEU A 1 391 ? -26.607 116.473 27.185 1.00 26.39  ? 391  LEU A O   1 
ATOM   3033 C CB  . LEU A 1 391 ? -26.849 119.601 28.260 1.00 25.06  ? 391  LEU A CB  1 
ATOM   3034 C CG  . LEU A 1 391 ? -26.005 120.865 28.076 1.00 26.85  ? 391  LEU A CG  1 
ATOM   3035 C CD1 . LEU A 1 391 ? -25.946 121.672 29.371 1.00 27.85  ? 391  LEU A CD1 1 
ATOM   3036 C CD2 . LEU A 1 391 ? -24.614 120.458 27.650 1.00 26.26  ? 391  LEU A CD2 1 
ATOM   3037 N N   . ASP A 1 392 ? -28.677 117.178 27.700 1.00 26.58  ? 392  ASP A N   1 
ATOM   3038 C CA  . ASP A 1 392 ? -29.137 115.843 28.025 1.00 26.48  ? 392  ASP A CA  1 
ATOM   3039 C C   . ASP A 1 392 ? -28.821 114.910 26.863 1.00 25.62  ? 392  ASP A C   1 
ATOM   3040 O O   . ASP A 1 392 ? -28.208 113.861 27.046 1.00 24.68  ? 392  ASP A O   1 
ATOM   3041 C CB  . ASP A 1 392 ? -30.634 115.862 28.310 1.00 27.76  ? 392  ASP A CB  1 
ATOM   3042 C CG  . ASP A 1 392 ? -31.209 114.474 28.503 1.00 30.02  ? 392  ASP A CG  1 
ATOM   3043 O OD1 . ASP A 1 392 ? -30.498 113.581 29.014 1.00 28.82  ? 392  ASP A OD1 1 
ATOM   3044 O OD2 . ASP A 1 392 ? -32.390 114.283 28.152 1.00 34.23  ? 392  ASP A OD2 1 
ATOM   3045 N N   . ASP A 1 393 ? -29.212 115.308 25.658 1.00 24.97  ? 393  ASP A N   1 
ATOM   3046 C CA  . ASP A 1 393 ? -28.947 114.489 24.489 1.00 24.07  ? 393  ASP A CA  1 
ATOM   3047 C C   . ASP A 1 393 ? -27.462 114.272 24.247 1.00 22.58  ? 393  ASP A C   1 
ATOM   3048 O O   . ASP A 1 393 ? -27.045 113.162 23.935 1.00 22.82  ? 393  ASP A O   1 
ATOM   3049 C CB  . ASP A 1 393 ? -29.585 115.093 23.235 1.00 25.80  ? 393  ASP A CB  1 
ATOM   3050 C CG  . ASP A 1 393 ? -31.090 114.881 23.184 1.00 27.97  ? 393  ASP A CG  1 
ATOM   3051 O OD1 . ASP A 1 393 ? -31.553 113.813 23.650 1.00 26.30  ? 393  ASP A OD1 1 
ATOM   3052 O OD2 . ASP A 1 393 ? -31.804 115.774 22.665 1.00 28.99  ? 393  ASP A OD2 1 
ATOM   3053 N N   . ILE A 1 394 ? -26.665 115.327 24.382 1.00 22.03  ? 394  ILE A N   1 
ATOM   3054 C CA  . ILE A 1 394 ? -25.226 115.209 24.167 1.00 20.36  ? 394  ILE A CA  1 
ATOM   3055 C C   . ILE A 1 394 ? -24.656 114.160 25.106 1.00 21.10  ? 394  ILE A C   1 
ATOM   3056 O O   . ILE A 1 394 ? -24.008 113.206 24.669 1.00 22.32  ? 394  ILE A O   1 
ATOM   3057 C CB  . ILE A 1 394 ? -24.497 116.553 24.415 1.00 19.37  ? 394  ILE A CB  1 
ATOM   3058 C CG1 . ILE A 1 394 ? -24.724 117.495 23.233 1.00 18.42  ? 394  ILE A CG1 1 
ATOM   3059 C CG2 . ILE A 1 394 ? -23.001 116.322 24.603 1.00 17.22  ? 394  ILE A CG2 1 
ATOM   3060 C CD1 . ILE A 1 394 ? -24.153 118.876 23.464 1.00 18.75  ? 394  ILE A CD1 1 
ATOM   3061 N N   . VAL A 1 395 ? -24.904 114.335 26.398 1.00 20.07  ? 395  VAL A N   1 
ATOM   3062 C CA  . VAL A 1 395 ? -24.402 113.401 27.380 1.00 20.51  ? 395  VAL A CA  1 
ATOM   3063 C C   . VAL A 1 395 ? -24.941 112.007 27.091 1.00 21.41  ? 395  VAL A C   1 
ATOM   3064 O O   . VAL A 1 395 ? -24.216 111.023 27.211 1.00 22.77  ? 395  VAL A O   1 
ATOM   3065 C CB  . VAL A 1 395 ? -24.804 113.820 28.810 1.00 21.09  ? 395  VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 395 ? -24.177 112.878 29.827 1.00 19.37  ? 395  VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 395 ? -24.363 115.248 29.074 1.00 18.78  ? 395  VAL A CG2 1 
ATOM   3068 N N   . GLY A 1 396 ? -26.209 111.931 26.693 1.00 22.40  ? 396  GLY A N   1 
ATOM   3069 C CA  . GLY A 1 396 ? -26.825 110.648 26.405 1.00 22.00  ? 396  GLY A CA  1 
ATOM   3070 C C   . GLY A 1 396 ? -26.227 109.954 25.200 1.00 24.73  ? 396  GLY A C   1 
ATOM   3071 O O   . GLY A 1 396 ? -25.712 108.836 25.308 1.00 26.63  ? 396  GLY A O   1 
ATOM   3072 N N   . ASP A 1 397 ? -26.286 110.623 24.051 1.00 24.81  ? 397  ASP A N   1 
ATOM   3073 C CA  . ASP A 1 397 ? -25.769 110.078 22.808 1.00 24.23  ? 397  ASP A CA  1 
ATOM   3074 C C   . ASP A 1 397 ? -24.287 109.730 22.870 1.00 25.85  ? 397  ASP A C   1 
ATOM   3075 O O   . ASP A 1 397 ? -23.882 108.645 22.460 1.00 29.88  ? 397  ASP A O   1 
ATOM   3076 C CB  . ASP A 1 397 ? -26.002 111.059 21.658 1.00 24.51  ? 397  ASP A CB  1 
ATOM   3077 C CG  . ASP A 1 397 ? -27.457 111.463 21.518 1.00 24.47  ? 397  ASP A CG  1 
ATOM   3078 O OD1 . ASP A 1 397 ? -28.336 110.655 21.877 1.00 23.24  ? 397  ASP A OD1 1 
ATOM   3079 O OD2 . ASP A 1 397 ? -27.723 112.583 21.034 1.00 25.06  ? 397  ASP A OD2 1 
ATOM   3080 N N   . HIS A 1 398 ? -23.470 110.637 23.381 1.00 23.37  ? 398  HIS A N   1 
ATOM   3081 C CA  . HIS A 1 398 ? -22.043 110.369 23.443 1.00 22.61  ? 398  HIS A CA  1 
ATOM   3082 C C   . HIS A 1 398 ? -21.612 109.230 24.363 1.00 24.04  ? 398  HIS A C   1 
ATOM   3083 O O   . HIS A 1 398 ? -20.720 108.465 24.009 1.00 22.90  ? 398  HIS A O   1 
ATOM   3084 C CB  . HIS A 1 398 ? -21.277 111.629 23.850 1.00 20.75  ? 398  HIS A CB  1 
ATOM   3085 C CG  . HIS A 1 398 ? -19.827 111.380 24.144 1.00 20.31  ? 398  HIS A CG  1 
ATOM   3086 N ND1 . HIS A 1 398 ? -18.944 110.901 23.197 1.00 19.24  ? 398  HIS A ND1 1 
ATOM   3087 C CD2 . HIS A 1 398 ? -19.114 111.517 25.287 1.00 17.13  ? 398  HIS A CD2 1 
ATOM   3088 C CE1 . HIS A 1 398 ? -17.752 110.752 23.746 1.00 15.50  ? 398  HIS A CE1 1 
ATOM   3089 N NE2 . HIS A 1 398 ? -17.829 111.119 25.013 1.00 15.96  ? 398  HIS A NE2 1 
ATOM   3090 N N   . ASN A 1 399 ? -22.265 109.119 25.538 1.00 26.46  ? 399  ASN A N   1 
ATOM   3091 C CA  . ASN A 1 399 ? -21.853 108.102 26.523 1.00 26.26  ? 399  ASN A CA  1 
ATOM   3092 C C   . ASN A 1 399 ? -22.611 106.771 26.535 1.00 27.16  ? 399  ASN A C   1 
ATOM   3093 O O   . ASN A 1 399 ? -22.074 105.756 26.989 1.00 24.32  ? 399  ASN A O   1 
ATOM   3094 C CB  . ASN A 1 399 ? -21.908 108.710 27.922 1.00 26.86  ? 399  ASN A CB  1 
ATOM   3095 C CG  . ASN A 1 399 ? -20.917 109.848 28.104 1.00 31.06  ? 399  ASN A CG  1 
ATOM   3096 O OD1 . ASN A 1 399 ? -19.699 109.640 28.053 1.00 32.53  ? 399  ASN A OD1 1 
ATOM   3097 N ND2 . ASN A 1 399 ? -21.433 111.064 28.318 1.00 29.13  ? 399  ASN A ND2 1 
ATOM   3098 N N   . VAL A 1 400 ? -23.850 106.761 26.049 1.00 27.10  ? 400  VAL A N   1 
ATOM   3099 C CA  . VAL A 1 400 ? -24.619 105.523 26.053 1.00 24.79  ? 400  VAL A CA  1 
ATOM   3100 C C   . VAL A 1 400 ? -25.231 105.154 24.714 1.00 25.33  ? 400  VAL A C   1 
ATOM   3101 O O   . VAL A 1 400 ? -24.828 104.175 24.097 1.00 27.74  ? 400  VAL A O   1 
ATOM   3102 C CB  . VAL A 1 400 ? -25.749 105.572 27.096 1.00 23.21  ? 400  VAL A CB  1 
ATOM   3103 C CG1 . VAL A 1 400 ? -26.639 104.348 26.994 1.00 23.75  ? 400  VAL A CG1 1 
ATOM   3104 C CG2 . VAL A 1 400 ? -25.171 105.685 28.507 1.00 22.85  ? 400  VAL A CG2 1 
ATOM   3105 N N   . ILE A 1 401 ? -26.160 105.975 24.221 1.00 24.49  ? 401  ILE A N   1 
ATOM   3106 C CA  . ILE A 1 401 ? -26.879 105.637 23.001 1.00 24.77  ? 401  ILE A CA  1 
ATOM   3107 C C   . ILE A 1 401 ? -26.052 105.366 21.740 1.00 26.06  ? 401  ILE A C   1 
ATOM   3108 O O   . ILE A 1 401 ? -26.173 104.294 21.151 1.00 26.13  ? 401  ILE A O   1 
ATOM   3109 C CB  . ILE A 1 401 ? -27.929 106.706 22.695 1.00 22.95  ? 401  ILE A CB  1 
ATOM   3110 C CG1 . ILE A 1 401 ? -28.935 106.755 23.852 1.00 20.77  ? 401  ILE A CG1 1 
ATOM   3111 C CG2 . ILE A 1 401 ? -28.646 106.428 21.376 1.00 20.66  ? 401  ILE A CG2 1 
ATOM   3112 C CD1 . ILE A 1 401 ? -30.029 107.781 23.667 1.00 18.40  ? 401  ILE A CD1 1 
ATOM   3113 N N   . CYS A 1 402 ? -25.219 106.304 21.306 1.00 26.55  ? 402  CYS A N   1 
ATOM   3114 C CA  . CYS A 1 402 ? -24.445 106.044 20.068 1.00 28.02  ? 402  CYS A CA  1 
ATOM   3115 C C   . CYS A 1 402 ? -23.383 104.948 20.260 1.00 29.30  ? 402  CYS A C   1 
ATOM   3116 O O   . CYS A 1 402 ? -23.144 104.157 19.359 1.00 28.88  ? 402  CYS A O   1 
ATOM   3117 C CB  . CYS A 1 402 ? -23.841 107.340 19.569 1.00 27.26  ? 402  CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 402 ? -25.059 108.524 18.908 1.00 27.82  ? 402  CYS A SG  1 
ATOM   3119 N N   . PRO A 1 403 ? -22.759 104.912 21.440 1.00 30.04  ? 403  PRO A N   1 
ATOM   3120 C CA  . PRO A 1 403 ? -21.787 103.809 21.611 1.00 30.86  ? 403  PRO A CA  1 
ATOM   3121 C C   . PRO A 1 403 ? -22.455 102.432 21.530 1.00 31.05  ? 403  PRO A C   1 
ATOM   3122 O O   . PRO A 1 403 ? -21.889 101.469 21.017 1.00 31.28  ? 403  PRO A O   1 
ATOM   3123 C CB  . PRO A 1 403 ? -21.212 104.071 23.009 1.00 32.37  ? 403  PRO A CB  1 
ATOM   3124 C CG  . PRO A 1 403 ? -21.917 105.292 23.489 1.00 32.53  ? 403  PRO A CG  1 
ATOM   3125 C CD  . PRO A 1 403 ? -22.845 105.679 22.387 1.00 31.42  ? 403  PRO A CD  1 
ATOM   3126 N N   . LEU A 1 404 ? -23.679 102.380 22.046 1.00 29.14  ? 404  LEU A N   1 
ATOM   3127 C CA  . LEU A 1 404 ? -24.439 101.142 22.008 1.00 28.96  ? 404  LEU A CA  1 
ATOM   3128 C C   . LEU A 1 404 ? -24.847 100.859 20.576 1.00 28.71  ? 404  LEU A C   1 
ATOM   3129 O O   . LEU A 1 404 ? -24.748 99.725  20.125 1.00 30.46  ? 404  LEU A O   1 
ATOM   3130 C CB  . LEU A 1 404 ? -25.687 101.210 22.904 1.00 28.88  ? 404  LEU A CB  1 
ATOM   3131 C CG  . LEU A 1 404 ? -26.610 99.978  22.843 1.00 27.60  ? 404  LEU A CG  1 
ATOM   3132 C CD1 . LEU A 1 404 ? -27.315 99.738  24.166 1.00 26.55  ? 404  LEU A CD1 1 
ATOM   3133 C CD2 . LEU A 1 404 ? -27.624 100.174 21.741 1.00 27.29  ? 404  LEU A CD2 1 
ATOM   3134 N N   . MET A 1 405 ? -25.294 101.888 19.861 1.00 28.12  ? 405  MET A N   1 
ATOM   3135 C CA  . MET A 1 405 ? -25.707 101.721 18.470 1.00 27.09  ? 405  MET A CA  1 
ATOM   3136 C C   . MET A 1 405 ? -24.547 101.242 17.609 1.00 26.85  ? 405  MET A C   1 
ATOM   3137 O O   . MET A 1 405 ? -24.733 100.424 16.715 1.00 28.23  ? 405  MET A O   1 
ATOM   3138 C CB  . MET A 1 405 ? -26.264 103.029 17.899 1.00 26.56  ? 405  MET A CB  1 
ATOM   3139 C CG  . MET A 1 405 ? -27.643 103.411 18.431 1.00 26.81  ? 405  MET A CG  1 
ATOM   3140 S SD  . MET A 1 405 ? -28.838 102.063 18.330 1.00 26.53  ? 405  MET A SD  1 
ATOM   3141 C CE  . MET A 1 405 ? -28.988 101.822 16.598 1.00 22.89  ? 405  MET A CE  1 
ATOM   3142 N N   . HIS A 1 406 ? -23.351 101.756 17.861 1.00 27.45  ? 406  HIS A N   1 
ATOM   3143 C CA  . HIS A 1 406 ? -22.189 101.317 17.101 1.00 28.91  ? 406  HIS A CA  1 
ATOM   3144 C C   . HIS A 1 406 ? -22.042 99.826  17.395 1.00 29.67  ? 406  HIS A C   1 
ATOM   3145 O O   . HIS A 1 406 ? -21.885 99.014  16.483 1.00 29.48  ? 406  HIS A O   1 
ATOM   3146 C CB  . HIS A 1 406 ? -20.939 102.077 17.549 1.00 30.75  ? 406  HIS A CB  1 
ATOM   3147 C CG  . HIS A 1 406 ? -19.694 101.707 16.800 1.00 32.18  ? 406  HIS A CG  1 
ATOM   3148 N ND1 . HIS A 1 406 ? -19.556 101.896 15.441 1.00 33.05  ? 406  HIS A ND1 1 
ATOM   3149 C CD2 . HIS A 1 406 ? -18.515 101.196 17.231 1.00 33.45  ? 406  HIS A CD2 1 
ATOM   3150 C CE1 . HIS A 1 406 ? -18.345 101.521 15.068 1.00 33.11  ? 406  HIS A CE1 1 
ATOM   3151 N NE2 . HIS A 1 406 ? -17.693 101.092 16.135 1.00 33.54  ? 406  HIS A NE2 1 
ATOM   3152 N N   . PHE A 1 407 ? -22.127 99.466  18.672 1.00 29.66  ? 407  PHE A N   1 
ATOM   3153 C CA  . PHE A 1 407 ? -22.012 98.070  19.066 1.00 30.77  ? 407  PHE A CA  1 
ATOM   3154 C C   . PHE A 1 407 ? -23.061 97.216  18.371 1.00 32.58  ? 407  PHE A C   1 
ATOM   3155 O O   . PHE A 1 407 ? -22.759 96.127  17.876 1.00 32.81  ? 407  PHE A O   1 
ATOM   3156 C CB  . PHE A 1 407 ? -22.189 97.914  20.572 1.00 31.37  ? 407  PHE A CB  1 
ATOM   3157 C CG  . PHE A 1 407 ? -22.089 96.486  21.041 1.00 33.32  ? 407  PHE A CG  1 
ATOM   3158 C CD1 . PHE A 1 407 ? -20.851 95.858  21.145 1.00 30.63  ? 407  PHE A CD1 1 
ATOM   3159 C CD2 . PHE A 1 407 ? -23.237 95.752  21.339 1.00 32.54  ? 407  PHE A CD2 1 
ATOM   3160 C CE1 . PHE A 1 407 ? -20.760 94.524  21.538 1.00 29.30  ? 407  PHE A CE1 1 
ATOM   3161 C CE2 . PHE A 1 407 ? -23.148 94.416  21.733 1.00 31.13  ? 407  PHE A CE2 1 
ATOM   3162 C CZ  . PHE A 1 407 ? -21.905 93.804  21.832 1.00 27.82  ? 407  PHE A CZ  1 
ATOM   3163 N N   . VAL A 1 408 ? -24.299 97.705  18.352 1.00 33.45  ? 408  VAL A N   1 
ATOM   3164 C CA  . VAL A 1 408 ? -25.397 96.976  17.730 1.00 34.10  ? 408  VAL A CA  1 
ATOM   3165 C C   . VAL A 1 408 ? -25.060 96.665  16.289 1.00 34.62  ? 408  VAL A C   1 
ATOM   3166 O O   . VAL A 1 408 ? -24.962 95.503  15.905 1.00 36.03  ? 408  VAL A O   1 
ATOM   3167 C CB  . VAL A 1 408 ? -26.713 97.781  17.747 1.00 34.16  ? 408  VAL A CB  1 
ATOM   3168 C CG1 . VAL A 1 408 ? -27.862 96.907  17.279 1.00 33.23  ? 408  VAL A CG1 1 
ATOM   3169 C CG2 . VAL A 1 408 ? -26.989 98.291  19.130 1.00 35.41  ? 408  VAL A CG2 1 
ATOM   3170 N N   . ASN A 1 409 ? -24.872 97.709  15.491 1.00 34.72  ? 409  ASN A N   1 
ATOM   3171 C CA  . ASN A 1 409 ? -24.555 97.526  14.083 1.00 35.06  ? 409  ASN A CA  1 
ATOM   3172 C C   . ASN A 1 409 ? -23.383 96.576  13.880 1.00 33.88  ? 409  ASN A C   1 
ATOM   3173 O O   . ASN A 1 409 ? -23.498 95.615  13.124 1.00 34.80  ? 409  ASN A O   1 
ATOM   3174 C CB  . ASN A 1 409 ? -24.286 98.880  13.428 1.00 35.49  ? 409  ASN A CB  1 
ATOM   3175 C CG  . ASN A 1 409 ? -25.540 99.753  13.371 1.00 37.58  ? 409  ASN A CG  1 
ATOM   3176 O OD1 . ASN A 1 409 ? -26.510 99.419  12.691 1.00 39.28  ? 409  ASN A OD1 1 
ATOM   3177 N ND2 . ASN A 1 409 ? -25.525 100.868 14.094 1.00 37.38  ? 409  ASN A ND2 1 
ATOM   3178 N N   . LYS A 1 410 ? -22.273 96.818  14.571 1.00 33.40  ? 410  LYS A N   1 
ATOM   3179 C CA  . LYS A 1 410 ? -21.094 95.953  14.448 1.00 32.86  ? 410  LYS A CA  1 
ATOM   3180 C C   . LYS A 1 410 ? -21.366 94.489  14.815 1.00 31.88  ? 410  LYS A C   1 
ATOM   3181 O O   . LYS A 1 410 ? -20.919 93.586  14.111 1.00 31.44  ? 410  LYS A O   1 
ATOM   3182 C CB  . LYS A 1 410 ? -19.937 96.477  15.314 1.00 32.83  ? 410  LYS A CB  1 
ATOM   3183 C CG  . LYS A 1 410 ? -19.241 97.724  14.785 1.00 33.51  ? 410  LYS A CG  1 
ATOM   3184 C CD  . LYS A 1 410 ? -18.465 97.418  13.515 1.00 36.54  ? 410  LYS A CD  1 
ATOM   3185 C CE  . LYS A 1 410 ? -17.747 98.653  12.976 1.00 37.41  ? 410  LYS A CE  1 
ATOM   3186 N NZ  . LYS A 1 410 ? -17.160 98.409  11.626 1.00 36.86  ? 410  LYS A NZ  1 
ATOM   3187 N N   . TYR A 1 411 ? -22.090 94.263  15.911 1.00 30.99  ? 411  TYR A N   1 
ATOM   3188 C CA  . TYR A 1 411 ? -22.408 92.907  16.374 1.00 30.96  ? 411  TYR A CA  1 
ATOM   3189 C C   . TYR A 1 411 ? -23.333 92.157  15.417 1.00 30.93  ? 411  TYR A C   1 
ATOM   3190 O O   . TYR A 1 411 ? -23.060 91.022  15.034 1.00 32.09  ? 411  TYR A O   1 
ATOM   3191 C CB  . TYR A 1 411 ? -23.080 92.943  17.757 1.00 28.95  ? 411  TYR A CB  1 
ATOM   3192 C CG  . TYR A 1 411 ? -23.244 91.572  18.377 1.00 28.62  ? 411  TYR A CG  1 
ATOM   3193 C CD1 . TYR A 1 411 ? -22.198 90.984  19.093 1.00 29.21  ? 411  TYR A CD1 1 
ATOM   3194 C CD2 . TYR A 1 411 ? -24.407 90.820  18.178 1.00 27.99  ? 411  TYR A CD2 1 
ATOM   3195 C CE1 . TYR A 1 411 ? -22.295 89.672  19.590 1.00 28.20  ? 411  TYR A CE1 1 
ATOM   3196 C CE2 . TYR A 1 411 ? -24.518 89.504  18.668 1.00 26.09  ? 411  TYR A CE2 1 
ATOM   3197 C CZ  . TYR A 1 411 ? -23.452 88.934  19.371 1.00 28.13  ? 411  TYR A CZ  1 
ATOM   3198 O OH  . TYR A 1 411 ? -23.511 87.628  19.824 1.00 22.61  ? 411  TYR A OH  1 
ATOM   3199 N N   . THR A 1 412 ? -24.428 92.802  15.039 1.00 30.16  ? 412  THR A N   1 
ATOM   3200 C CA  . THR A 1 412 ? -25.419 92.202  14.158 1.00 31.14  ? 412  THR A CA  1 
ATOM   3201 C C   . THR A 1 412 ? -24.896 91.608  12.845 1.00 33.49  ? 412  THR A C   1 
ATOM   3202 O O   . THR A 1 412 ? -25.627 90.899  12.154 1.00 32.52  ? 412  THR A O   1 
ATOM   3203 C CB  . THR A 1 412 ? -26.526 93.221  13.852 1.00 28.79  ? 412  THR A CB  1 
ATOM   3204 O OG1 . THR A 1 412 ? -27.058 93.700  15.087 1.00 25.42  ? 412  THR A OG1 1 
ATOM   3205 C CG2 . THR A 1 412 ? -27.657 92.583  13.063 1.00 28.49  ? 412  THR A CG2 1 
ATOM   3206 N N   . LYS A 1 413 ? -23.644 91.886  12.496 1.00 36.49  ? 413  LYS A N   1 
ATOM   3207 C CA  . LYS A 1 413 ? -23.074 91.346  11.264 1.00 39.94  ? 413  LYS A CA  1 
ATOM   3208 C C   . LYS A 1 413 ? -22.670 89.887  11.439 1.00 42.29  ? 413  LYS A C   1 
ATOM   3209 O O   . LYS A 1 413 ? -22.623 89.130  10.469 1.00 43.04  ? 413  LYS A O   1 
ATOM   3210 C CB  . LYS A 1 413 ? -21.850 92.151  10.828 1.00 41.86  ? 413  LYS A CB  1 
ATOM   3211 C CG  . LYS A 1 413 ? -22.169 93.498  10.217 1.00 44.97  ? 413  LYS A CG  1 
ATOM   3212 C CD  . LYS A 1 413 ? -20.883 94.237  9.885  1.00 48.91  ? 413  LYS A CD  1 
ATOM   3213 C CE  . LYS A 1 413 ? -21.163 95.604  9.292  1.00 51.18  ? 413  LYS A CE  1 
ATOM   3214 N NZ  . LYS A 1 413 ? -19.901 96.360  9.058  1.00 54.40  ? 413  LYS A NZ  1 
ATOM   3215 N N   . PHE A 1 414 ? -22.377 89.496  12.677 1.00 43.76  ? 414  PHE A N   1 
ATOM   3216 C CA  . PHE A 1 414 ? -21.977 88.124  12.968 1.00 45.01  ? 414  PHE A CA  1 
ATOM   3217 C C   . PHE A 1 414 ? -22.900 87.480  13.993 1.00 46.18  ? 414  PHE A C   1 
ATOM   3218 O O   . PHE A 1 414 ? -22.865 86.269  14.197 1.00 46.93  ? 414  PHE A O   1 
ATOM   3219 C CB  . PHE A 1 414 ? -20.550 88.104  13.499 1.00 44.53  ? 414  PHE A CB  1 
ATOM   3220 C CG  . PHE A 1 414 ? -19.560 88.743  12.581 1.00 46.04  ? 414  PHE A CG  1 
ATOM   3221 C CD1 . PHE A 1 414 ? -19.256 88.165  11.358 1.00 46.21  ? 414  PHE A CD1 1 
ATOM   3222 C CD2 . PHE A 1 414 ? -18.928 89.930  12.934 1.00 47.80  ? 414  PHE A CD2 1 
ATOM   3223 C CE1 . PHE A 1 414 ? -18.336 88.761  10.500 1.00 47.41  ? 414  PHE A CE1 1 
ATOM   3224 C CE2 . PHE A 1 414 ? -18.004 90.534  12.080 1.00 46.55  ? 414  PHE A CE2 1 
ATOM   3225 C CZ  . PHE A 1 414 ? -17.709 89.951  10.865 1.00 46.16  ? 414  PHE A CZ  1 
ATOM   3226 N N   . GLY A 1 415 ? -23.725 88.303  14.632 1.00 47.76  ? 415  GLY A N   1 
ATOM   3227 C CA  . GLY A 1 415 ? -24.640 87.812  15.648 1.00 48.38  ? 415  GLY A CA  1 
ATOM   3228 C C   . GLY A 1 415 ? -25.597 86.746  15.162 1.00 48.99  ? 415  GLY A C   1 
ATOM   3229 O O   . GLY A 1 415 ? -25.508 86.291  14.020 1.00 49.33  ? 415  GLY A O   1 
ATOM   3230 N N   . ASN A 1 416 ? -26.517 86.345  16.035 1.00 48.82  ? 416  ASN A N   1 
ATOM   3231 C CA  . ASN A 1 416 ? -27.501 85.330  15.692 1.00 48.71  ? 416  ASN A CA  1 
ATOM   3232 C C   . ASN A 1 416 ? -28.914 85.844  15.941 1.00 46.74  ? 416  ASN A C   1 
ATOM   3233 O O   . ASN A 1 416 ? -29.892 85.153  15.670 1.00 47.56  ? 416  ASN A O   1 
ATOM   3234 C CB  . ASN A 1 416 ? -27.260 84.060  16.515 1.00 52.47  ? 416  ASN A CB  1 
ATOM   3235 C CG  . ASN A 1 416 ? -28.109 82.888  16.042 1.00 56.29  ? 416  ASN A CG  1 
ATOM   3236 O OD1 . ASN A 1 416 ? -28.858 82.301  16.819 1.00 57.29  ? 416  ASN A OD1 1 
ATOM   3237 N ND2 . ASN A 1 416 ? -27.989 82.546  14.764 1.00 59.78  ? 416  ASN A ND2 1 
ATOM   3238 N N   . GLY A 1 417 ? -29.020 87.060  16.460 1.00 44.44  ? 417  GLY A N   1 
ATOM   3239 C CA  . GLY A 1 417 ? -30.328 87.625  16.729 1.00 41.08  ? 417  GLY A CA  1 
ATOM   3240 C C   . GLY A 1 417 ? -30.204 88.853  17.601 1.00 38.88  ? 417  GLY A C   1 
ATOM   3241 O O   . GLY A 1 417 ? -29.738 88.769  18.734 1.00 38.42  ? 417  GLY A O   1 
ATOM   3242 N N   . THR A 1 418 ? -30.626 89.996  17.075 1.00 36.77  ? 418  THR A N   1 
ATOM   3243 C CA  . THR A 1 418 ? -30.534 91.241  17.813 1.00 34.43  ? 418  THR A CA  1 
ATOM   3244 C C   . THR A 1 418 ? -31.889 91.911  18.007 1.00 34.68  ? 418  THR A C   1 
ATOM   3245 O O   . THR A 1 418 ? -32.623 92.128  17.045 1.00 34.38  ? 418  THR A O   1 
ATOM   3246 C CB  . THR A 1 418 ? -29.591 92.223  17.098 1.00 33.10  ? 418  THR A CB  1 
ATOM   3247 O OG1 . THR A 1 418 ? -28.306 91.605  16.924 1.00 31.75  ? 418  THR A OG1 1 
ATOM   3248 C CG2 . THR A 1 418 ? -29.438 93.498  17.907 1.00 29.81  ? 418  THR A CG2 1 
ATOM   3249 N N   . TYR A 1 419 ? -32.202 92.231  19.263 1.00 34.05  ? 419  TYR A N   1 
ATOM   3250 C CA  . TYR A 1 419 ? -33.449 92.891  19.636 1.00 34.15  ? 419  TYR A CA  1 
ATOM   3251 C C   . TYR A 1 419 ? -33.139 94.236  20.294 1.00 32.23  ? 419  TYR A C   1 
ATOM   3252 O O   . TYR A 1 419 ? -32.492 94.290  21.338 1.00 29.91  ? 419  TYR A O   1 
ATOM   3253 C CB  . TYR A 1 419 ? -34.244 91.992  20.585 1.00 37.08  ? 419  TYR A CB  1 
ATOM   3254 C CG  . TYR A 1 419 ? -34.770 90.757  19.897 1.00 40.52  ? 419  TYR A CG  1 
ATOM   3255 C CD1 . TYR A 1 419 ? -35.824 90.844  18.977 1.00 41.47  ? 419  TYR A CD1 1 
ATOM   3256 C CD2 . TYR A 1 419 ? -34.165 89.511  20.099 1.00 41.86  ? 419  TYR A CD2 1 
ATOM   3257 C CE1 . TYR A 1 419 ? -36.259 89.720  18.269 1.00 43.02  ? 419  TYR A CE1 1 
ATOM   3258 C CE2 . TYR A 1 419 ? -34.589 88.379  19.398 1.00 42.91  ? 419  TYR A CE2 1 
ATOM   3259 C CZ  . TYR A 1 419 ? -35.635 88.491  18.482 1.00 44.24  ? 419  TYR A CZ  1 
ATOM   3260 O OH  . TYR A 1 419 ? -36.033 87.384  17.766 1.00 43.52  ? 419  TYR A OH  1 
ATOM   3261 N N   . LEU A 1 420 ? -33.607 95.315  19.673 1.00 30.99  ? 420  LEU A N   1 
ATOM   3262 C CA  . LEU A 1 420 ? -33.350 96.662  20.167 1.00 30.76  ? 420  LEU A CA  1 
ATOM   3263 C C   . LEU A 1 420 ? -34.595 97.371  20.722 1.00 31.64  ? 420  LEU A C   1 
ATOM   3264 O O   . LEU A 1 420 ? -35.625 97.460  20.049 1.00 32.01  ? 420  LEU A O   1 
ATOM   3265 C CB  . LEU A 1 420 ? -32.735 97.494  19.036 1.00 30.52  ? 420  LEU A CB  1 
ATOM   3266 C CG  . LEU A 1 420 ? -32.060 98.827  19.383 1.00 30.52  ? 420  LEU A CG  1 
ATOM   3267 C CD1 . LEU A 1 420 ? -30.951 98.588  20.399 1.00 28.68  ? 420  LEU A CD1 1 
ATOM   3268 C CD2 . LEU A 1 420 ? -31.495 99.465  18.113 1.00 29.06  ? 420  LEU A CD2 1 
ATOM   3269 N N   . TYR A 1 421 ? -34.490 97.879  21.950 1.00 31.40  ? 421  TYR A N   1 
ATOM   3270 C CA  . TYR A 1 421 ? -35.602 98.590  22.584 1.00 32.28  ? 421  TYR A CA  1 
ATOM   3271 C C   . TYR A 1 421 ? -35.246 100.034 22.960 1.00 32.71  ? 421  TYR A C   1 
ATOM   3272 O O   . TYR A 1 421 ? -34.073 100.375 23.123 1.00 32.82  ? 421  TYR A O   1 
ATOM   3273 C CB  . TYR A 1 421 ? -36.053 97.849  23.844 1.00 31.64  ? 421  TYR A CB  1 
ATOM   3274 C CG  . TYR A 1 421 ? -35.119 97.998  25.022 1.00 30.76  ? 421  TYR A CG  1 
ATOM   3275 C CD1 . TYR A 1 421 ? -35.063 99.187  25.751 1.00 28.83  ? 421  TYR A CD1 1 
ATOM   3276 C CD2 . TYR A 1 421 ? -34.300 96.942  25.421 1.00 32.18  ? 421  TYR A CD2 1 
ATOM   3277 C CE1 . TYR A 1 421 ? -34.219 99.318  26.847 1.00 30.00  ? 421  TYR A CE1 1 
ATOM   3278 C CE2 . TYR A 1 421 ? -33.449 97.062  26.519 1.00 31.06  ? 421  TYR A CE2 1 
ATOM   3279 C CZ  . TYR A 1 421 ? -33.414 98.252  27.226 1.00 30.58  ? 421  TYR A CZ  1 
ATOM   3280 O OH  . TYR A 1 421 ? -32.575 98.377  28.310 1.00 32.68  ? 421  TYR A OH  1 
ATOM   3281 N N   . PHE A 1 422 ? -36.267 100.874 23.103 1.00 31.75  ? 422  PHE A N   1 
ATOM   3282 C CA  . PHE A 1 422 ? -36.069 102.266 23.489 1.00 30.92  ? 422  PHE A CA  1 
ATOM   3283 C C   . PHE A 1 422 ? -37.035 102.572 24.632 1.00 32.20  ? 422  PHE A C   1 
ATOM   3284 O O   . PHE A 1 422 ? -38.174 102.965 24.402 1.00 30.41  ? 422  PHE A O   1 
ATOM   3285 C CB  . PHE A 1 422 ? -36.354 103.198 22.312 1.00 28.07  ? 422  PHE A CB  1 
ATOM   3286 C CG  . PHE A 1 422 ? -36.130 104.660 22.615 1.00 26.86  ? 422  PHE A CG  1 
ATOM   3287 C CD1 . PHE A 1 422 ? -34.842 105.172 22.731 1.00 25.22  ? 422  PHE A CD1 1 
ATOM   3288 C CD2 . PHE A 1 422 ? -37.212 105.534 22.748 1.00 27.30  ? 422  PHE A CD2 1 
ATOM   3289 C CE1 . PHE A 1 422 ? -34.626 106.536 22.970 1.00 24.07  ? 422  PHE A CE1 1 
ATOM   3290 C CE2 . PHE A 1 422 ? -37.011 106.899 22.988 1.00 26.09  ? 422  PHE A CE2 1 
ATOM   3291 C CZ  . PHE A 1 422 ? -35.711 107.400 23.097 1.00 25.67  ? 422  PHE A CZ  1 
ATOM   3292 N N   . PHE A 1 423 ? -36.576 102.376 25.863 1.00 33.94  ? 423  PHE A N   1 
ATOM   3293 C CA  . PHE A 1 423 ? -37.405 102.633 27.037 1.00 35.57  ? 423  PHE A CA  1 
ATOM   3294 C C   . PHE A 1 423 ? -37.675 104.130 27.202 1.00 36.03  ? 423  PHE A C   1 
ATOM   3295 O O   . PHE A 1 423 ? -36.754 104.909 27.470 1.00 36.19  ? 423  PHE A O   1 
ATOM   3296 C CB  . PHE A 1 423 ? -36.708 102.104 28.292 1.00 35.54  ? 423  PHE A CB  1 
ATOM   3297 C CG  . PHE A 1 423 ? -37.569 102.131 29.524 1.00 36.38  ? 423  PHE A CG  1 
ATOM   3298 C CD1 . PHE A 1 423 ? -38.533 101.146 29.739 1.00 35.63  ? 423  PHE A CD1 1 
ATOM   3299 C CD2 . PHE A 1 423 ? -37.420 103.141 30.470 1.00 36.48  ? 423  PHE A CD2 1 
ATOM   3300 C CE1 . PHE A 1 423 ? -39.336 101.168 30.881 1.00 36.26  ? 423  PHE A CE1 1 
ATOM   3301 C CE2 . PHE A 1 423 ? -38.222 103.172 31.619 1.00 37.99  ? 423  PHE A CE2 1 
ATOM   3302 C CZ  . PHE A 1 423 ? -39.180 102.183 31.824 1.00 35.99  ? 423  PHE A CZ  1 
ATOM   3303 N N   . ASN A 1 424 ? -38.933 104.533 27.041 1.00 35.83  ? 424  ASN A N   1 
ATOM   3304 C CA  . ASN A 1 424 ? -39.286 105.935 27.190 1.00 35.37  ? 424  ASN A CA  1 
ATOM   3305 C C   . ASN A 1 424 ? -40.532 106.144 28.023 1.00 36.13  ? 424  ASN A C   1 
ATOM   3306 O O   . ASN A 1 424 ? -41.417 106.916 27.660 1.00 37.57  ? 424  ASN A O   1 
ATOM   3307 C CB  . ASN A 1 424 ? -39.434 106.618 25.821 1.00 36.94  ? 424  ASN A CB  1 
ATOM   3308 C CG  . ASN A 1 424 ? -40.573 106.051 24.986 1.00 37.50  ? 424  ASN A CG  1 
ATOM   3309 O OD1 . ASN A 1 424 ? -40.927 104.875 25.102 1.00 39.24  ? 424  ASN A OD1 1 
ATOM   3310 N ND2 . ASN A 1 424 ? -41.135 106.884 24.119 1.00 33.87  ? 424  ASN A ND2 1 
ATOM   3311 N N   . HIS A 1 425 ? -40.607 105.439 29.144 1.00 36.72  ? 425  HIS A N   1 
ATOM   3312 C CA  . HIS A 1 425 ? -41.730 105.611 30.049 1.00 36.27  ? 425  HIS A CA  1 
ATOM   3313 C C   . HIS A 1 425 ? -41.280 106.296 31.340 1.00 36.08  ? 425  HIS A C   1 
ATOM   3314 O O   . HIS A 1 425 ? -40.347 105.850 32.016 1.00 35.13  ? 425  HIS A O   1 
ATOM   3315 C CB  . HIS A 1 425 ? -42.387 104.280 30.416 1.00 37.27  ? 425  HIS A CB  1 
ATOM   3316 C CG  . HIS A 1 425 ? -43.418 104.418 31.495 1.00 37.06  ? 425  HIS A CG  1 
ATOM   3317 N ND1 . HIS A 1 425 ? -44.583 105.135 31.317 1.00 36.70  ? 425  HIS A ND1 1 
ATOM   3318 C CD2 . HIS A 1 425 ? -43.403 104.042 32.796 1.00 37.07  ? 425  HIS A CD2 1 
ATOM   3319 C CE1 . HIS A 1 425 ? -45.235 105.203 32.464 1.00 37.26  ? 425  HIS A CE1 1 
ATOM   3320 N NE2 . HIS A 1 425 ? -44.540 104.549 33.377 1.00 37.90  ? 425  HIS A NE2 1 
ATOM   3321 N N   . ARG A 1 426 ? -41.967 107.383 31.670 1.00 36.03  ? 426  ARG A N   1 
ATOM   3322 C CA  . ARG A 1 426 ? -41.695 108.161 32.867 1.00 35.79  ? 426  ARG A CA  1 
ATOM   3323 C C   . ARG A 1 426 ? -42.578 107.646 34.007 1.00 35.01  ? 426  ARG A C   1 
ATOM   3324 O O   . ARG A 1 426 ? -43.777 107.915 34.048 1.00 34.45  ? 426  ARG A O   1 
ATOM   3325 C CB  . ARG A 1 426 ? -41.993 109.637 32.574 1.00 36.66  ? 426  ARG A CB  1 
ATOM   3326 C CG  . ARG A 1 426 ? -42.160 110.523 33.791 1.00 37.56  ? 426  ARG A CG  1 
ATOM   3327 C CD  . ARG A 1 426 ? -40.842 110.972 34.370 1.00 39.00  ? 426  ARG A CD  1 
ATOM   3328 N NE  . ARG A 1 426 ? -41.058 111.782 35.565 1.00 41.10  ? 426  ARG A NE  1 
ATOM   3329 C CZ  . ARG A 1 426 ? -40.102 112.441 36.207 1.00 41.75  ? 426  ARG A CZ  1 
ATOM   3330 N NH1 . ARG A 1 426 ? -38.848 112.391 35.770 1.00 42.53  ? 426  ARG A NH1 1 
ATOM   3331 N NH2 . ARG A 1 426 ? -40.402 113.154 37.284 1.00 42.68  ? 426  ARG A NH2 1 
ATOM   3332 N N   . ALA A 1 427 ? -41.981 106.895 34.924 1.00 35.40  ? 427  ALA A N   1 
ATOM   3333 C CA  . ALA A 1 427 ? -42.714 106.345 36.061 1.00 36.91  ? 427  ALA A CA  1 
ATOM   3334 C C   . ALA A 1 427 ? -43.625 107.391 36.706 1.00 37.98  ? 427  ALA A C   1 
ATOM   3335 O O   . ALA A 1 427 ? -43.243 108.550 36.869 1.00 39.61  ? 427  ALA A O   1 
ATOM   3336 C CB  . ALA A 1 427 ? -41.736 105.789 37.098 1.00 37.60  ? 427  ALA A CB  1 
ATOM   3337 N N   . SER A 1 428 ? -44.827 106.966 37.080 1.00 37.56  ? 428  SER A N   1 
ATOM   3338 C CA  . SER A 1 428 ? -45.809 107.857 37.684 1.00 36.85  ? 428  SER A CA  1 
ATOM   3339 C C   . SER A 1 428 ? -45.405 108.363 39.066 1.00 36.58  ? 428  SER A C   1 
ATOM   3340 O O   . SER A 1 428 ? -45.797 109.459 39.474 1.00 36.65  ? 428  SER A O   1 
ATOM   3341 C CB  . SER A 1 428 ? -47.157 107.139 37.784 1.00 36.55  ? 428  SER A CB  1 
ATOM   3342 O OG  . SER A 1 428 ? -47.045 105.962 38.570 1.00 34.24  ? 428  SER A OG  1 
ATOM   3343 N N   . ASN A 1 429 ? -44.617 107.568 39.778 1.00 34.72  ? 429  ASN A N   1 
ATOM   3344 C CA  . ASN A 1 429 ? -44.196 107.928 41.124 1.00 34.50  ? 429  ASN A CA  1 
ATOM   3345 C C   . ASN A 1 429 ? -42.733 108.353 41.262 1.00 34.27  ? 429  ASN A C   1 
ATOM   3346 O O   . ASN A 1 429 ? -42.220 108.439 42.377 1.00 34.32  ? 429  ASN A O   1 
ATOM   3347 C CB  . ASN A 1 429 ? -44.446 106.745 42.042 1.00 34.59  ? 429  ASN A CB  1 
ATOM   3348 C CG  . ASN A 1 429 ? -43.934 105.455 41.451 1.00 37.49  ? 429  ASN A CG  1 
ATOM   3349 O OD1 . ASN A 1 429 ? -42.908 105.440 40.766 1.00 36.88  ? 429  ASN A OD1 1 
ATOM   3350 N ND2 . ASN A 1 429 ? -44.639 104.359 41.713 1.00 40.96  ? 429  ASN A ND2 1 
ATOM   3351 N N   . LEU A 1 430 ? -42.066 108.614 40.142 1.00 33.49  ? 430  LEU A N   1 
ATOM   3352 C CA  . LEU A 1 430 ? -40.658 109.007 40.160 1.00 32.73  ? 430  LEU A CA  1 
ATOM   3353 C C   . LEU A 1 430 ? -40.398 110.141 41.163 1.00 33.05  ? 430  LEU A C   1 
ATOM   3354 O O   . LEU A 1 430 ? -41.108 111.152 41.167 1.00 33.92  ? 430  LEU A O   1 
ATOM   3355 C CB  . LEU A 1 430 ? -40.235 109.439 38.754 1.00 32.28  ? 430  LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 430 ? -38.769 109.228 38.373 1.00 33.19  ? 430  LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 430 ? -38.453 107.740 38.349 1.00 30.37  ? 430  LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 430 ? -38.509 109.825 37.003 1.00 33.17  ? 430  LEU A CD2 1 
ATOM   3359 N N   . VAL A 1 431 ? -39.391 109.976 42.016 1.00 32.04  ? 431  VAL A N   1 
ATOM   3360 C CA  . VAL A 1 431 ? -39.082 111.008 43.001 1.00 31.70  ? 431  VAL A CA  1 
ATOM   3361 C C   . VAL A 1 431 ? -38.311 112.197 42.421 1.00 32.44  ? 431  VAL A C   1 
ATOM   3362 O O   . VAL A 1 431 ? -38.299 113.270 43.023 1.00 32.90  ? 431  VAL A O   1 
ATOM   3363 C CB  . VAL A 1 431 ? -38.283 110.445 44.197 1.00 31.91  ? 431  VAL A CB  1 
ATOM   3364 C CG1 . VAL A 1 431 ? -39.140 109.480 44.989 1.00 30.49  ? 431  VAL A CG1 1 
ATOM   3365 C CG2 . VAL A 1 431 ? -37.032 109.748 43.704 1.00 33.76  ? 431  VAL A CG2 1 
ATOM   3366 N N   . TRP A 1 432 ? -37.671 112.019 41.264 1.00 31.76  ? 432  TRP A N   1 
ATOM   3367 C CA  . TRP A 1 432 ? -36.928 113.121 40.648 1.00 31.90  ? 432  TRP A CA  1 
ATOM   3368 C C   . TRP A 1 432 ? -37.874 114.082 39.916 1.00 32.96  ? 432  TRP A C   1 
ATOM   3369 O O   . TRP A 1 432 ? -38.987 113.711 39.545 1.00 31.20  ? 432  TRP A O   1 
ATOM   3370 C CB  . TRP A 1 432 ? -35.879 112.601 39.659 1.00 30.70  ? 432  TRP A CB  1 
ATOM   3371 C CG  . TRP A 1 432 ? -34.796 111.765 40.271 1.00 31.16  ? 432  TRP A CG  1 
ATOM   3372 C CD1 . TRP A 1 432 ? -34.706 110.403 40.260 1.00 30.18  ? 432  TRP A CD1 1 
ATOM   3373 C CD2 . TRP A 1 432 ? -33.650 112.235 40.994 1.00 30.59  ? 432  TRP A CD2 1 
ATOM   3374 N NE1 . TRP A 1 432 ? -33.577 109.997 40.931 1.00 28.80  ? 432  TRP A NE1 1 
ATOM   3375 C CE2 . TRP A 1 432 ? -32.911 111.099 41.391 1.00 29.25  ? 432  TRP A CE2 1 
ATOM   3376 C CE3 . TRP A 1 432 ? -33.177 113.505 41.344 1.00 31.55  ? 432  TRP A CE3 1 
ATOM   3377 C CZ2 . TRP A 1 432 ? -31.725 111.193 42.119 1.00 31.80  ? 432  TRP A CZ2 1 
ATOM   3378 C CZ3 . TRP A 1 432 ? -31.992 113.601 42.072 1.00 33.93  ? 432  TRP A CZ3 1 
ATOM   3379 C CH2 . TRP A 1 432 ? -31.280 112.448 42.451 1.00 33.28  ? 432  TRP A CH2 1 
ATOM   3380 N N   . PRO A 1 433 ? -37.431 115.331 39.685 1.00 34.14  ? 433  PRO A N   1 
ATOM   3381 C CA  . PRO A 1 433 ? -38.267 116.319 38.995 1.00 34.90  ? 433  PRO A CA  1 
ATOM   3382 C C   . PRO A 1 433 ? -38.600 115.873 37.582 1.00 36.60  ? 433  PRO A C   1 
ATOM   3383 O O   . PRO A 1 433 ? -38.043 114.901 37.092 1.00 37.95  ? 433  PRO A O   1 
ATOM   3384 C CB  . PRO A 1 433 ? -37.409 117.578 39.028 1.00 33.86  ? 433  PRO A CB  1 
ATOM   3385 C CG  . PRO A 1 433 ? -36.023 117.028 38.946 1.00 35.65  ? 433  PRO A CG  1 
ATOM   3386 C CD  . PRO A 1 433 ? -36.076 115.866 39.920 1.00 34.37  ? 433  PRO A CD  1 
ATOM   3387 N N   . GLU A 1 434 ? -39.503 116.585 36.921 1.00 38.56  ? 434  GLU A N   1 
ATOM   3388 C CA  . GLU A 1 434 ? -39.890 116.209 35.570 1.00 40.15  ? 434  GLU A CA  1 
ATOM   3389 C C   . GLU A 1 434 ? -38.871 116.453 34.465 1.00 37.88  ? 434  GLU A C   1 
ATOM   3390 O O   . GLU A 1 434 ? -38.758 115.641 33.543 1.00 37.04  ? 434  GLU A O   1 
ATOM   3391 C CB  . GLU A 1 434 ? -41.207 116.883 35.188 1.00 44.99  ? 434  GLU A CB  1 
ATOM   3392 C CG  . GLU A 1 434 ? -42.411 116.249 35.841 1.00 54.62  ? 434  GLU A CG  1 
ATOM   3393 C CD  . GLU A 1 434 ? -43.538 116.012 34.853 1.00 61.55  ? 434  GLU A CD  1 
ATOM   3394 O OE1 . GLU A 1 434 ? -44.101 117.007 34.340 1.00 65.40  ? 434  GLU A OE1 1 
ATOM   3395 O OE2 . GLU A 1 434 ? -43.855 114.829 34.584 1.00 65.46  ? 434  GLU A OE2 1 
ATOM   3396 N N   . TRP A 1 435 ? -38.125 117.549 34.533 1.00 34.46  ? 435  TRP A N   1 
ATOM   3397 C CA  . TRP A 1 435 ? -37.176 117.799 33.461 1.00 32.03  ? 435  TRP A CA  1 
ATOM   3398 C C   . TRP A 1 435 ? -36.230 116.622 33.245 1.00 31.63  ? 435  TRP A C   1 
ATOM   3399 O O   . TRP A 1 435 ? -35.814 116.356 32.119 1.00 32.77  ? 435  TRP A O   1 
ATOM   3400 C CB  . TRP A 1 435 ? -36.391 119.092 33.700 1.00 31.12  ? 435  TRP A CB  1 
ATOM   3401 C CG  . TRP A 1 435 ? -35.413 119.057 34.829 1.00 30.91  ? 435  TRP A CG  1 
ATOM   3402 C CD1 . TRP A 1 435 ? -35.606 119.513 36.100 1.00 30.33  ? 435  TRP A CD1 1 
ATOM   3403 C CD2 . TRP A 1 435 ? -34.063 118.582 34.772 1.00 29.35  ? 435  TRP A CD2 1 
ATOM   3404 N NE1 . TRP A 1 435 ? -34.454 119.359 36.839 1.00 30.22  ? 435  TRP A NE1 1 
ATOM   3405 C CE2 . TRP A 1 435 ? -33.494 118.787 36.045 1.00 30.52  ? 435  TRP A CE2 1 
ATOM   3406 C CE3 . TRP A 1 435 ? -33.280 118.003 33.764 1.00 28.21  ? 435  TRP A CE3 1 
ATOM   3407 C CZ2 . TRP A 1 435 ? -32.174 118.435 36.339 1.00 31.95  ? 435  TRP A CZ2 1 
ATOM   3408 C CZ3 . TRP A 1 435 ? -31.969 117.654 34.052 1.00 29.80  ? 435  TRP A CZ3 1 
ATOM   3409 C CH2 . TRP A 1 435 ? -31.427 117.871 35.330 1.00 32.68  ? 435  TRP A CH2 1 
ATOM   3410 N N   . MET A 1 436 ? -35.916 115.893 34.310 1.00 29.58  ? 436  MET A N   1 
ATOM   3411 C CA  . MET A 1 436 ? -35.016 114.755 34.190 1.00 28.24  ? 436  MET A CA  1 
ATOM   3412 C C   . MET A 1 436 ? -35.539 113.591 33.337 1.00 28.74  ? 436  MET A C   1 
ATOM   3413 O O   . MET A 1 436 ? -34.826 112.607 33.098 1.00 29.05  ? 436  MET A O   1 
ATOM   3414 C CB  . MET A 1 436 ? -34.622 114.271 35.583 1.00 26.59  ? 436  MET A CB  1 
ATOM   3415 C CG  . MET A 1 436 ? -33.715 115.261 36.285 1.00 25.96  ? 436  MET A CG  1 
ATOM   3416 S SD  . MET A 1 436 ? -33.194 114.729 37.895 1.00 26.34  ? 436  MET A SD  1 
ATOM   3417 C CE  . MET A 1 436 ? -32.015 113.496 37.472 1.00 26.30  ? 436  MET A CE  1 
ATOM   3418 N N   . GLY A 1 437 ? -36.780 113.708 32.872 1.00 27.67  ? 437  GLY A N   1 
ATOM   3419 C CA  . GLY A 1 437 ? -37.367 112.677 32.028 1.00 24.47  ? 437  GLY A CA  1 
ATOM   3420 C C   . GLY A 1 437 ? -37.214 111.224 32.448 1.00 21.73  ? 437  GLY A C   1 
ATOM   3421 O O   . GLY A 1 437 ? -37.460 110.859 33.601 1.00 19.88  ? 437  GLY A O   1 
ATOM   3422 N N   . VAL A 1 438 ? -36.840 110.384 31.488 1.00 19.27  ? 438  VAL A N   1 
ATOM   3423 C CA  . VAL A 1 438 ? -36.657 108.964 31.747 1.00 20.15  ? 438  VAL A CA  1 
ATOM   3424 C C   . VAL A 1 438 ? -35.186 108.769 32.050 1.00 21.35  ? 438  VAL A C   1 
ATOM   3425 O O   . VAL A 1 438 ? -34.363 108.511 31.164 1.00 21.42  ? 438  VAL A O   1 
ATOM   3426 C CB  . VAL A 1 438 ? -37.077 108.115 30.533 1.00 20.19  ? 438  VAL A CB  1 
ATOM   3427 C CG1 . VAL A 1 438 ? -36.919 106.635 30.851 1.00 21.52  ? 438  VAL A CG1 1 
ATOM   3428 C CG2 . VAL A 1 438 ? -38.518 108.421 30.172 1.00 18.70  ? 438  VAL A CG2 1 
ATOM   3429 N N   . ILE A 1 439 ? -34.874 108.901 33.330 1.00 21.74  ? 439  ILE A N   1 
ATOM   3430 C CA  . ILE A 1 439 ? -33.516 108.826 33.824 1.00 21.40  ? 439  ILE A CA  1 
ATOM   3431 C C   . ILE A 1 439 ? -32.762 107.510 33.693 1.00 23.95  ? 439  ILE A C   1 
ATOM   3432 O O   . ILE A 1 439 ? -33.331 106.420 33.789 1.00 24.61  ? 439  ILE A O   1 
ATOM   3433 C CB  . ILE A 1 439 ? -33.508 109.273 35.278 1.00 20.18  ? 439  ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 439 ? -34.223 110.624 35.369 1.00 18.42  ? 439  ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 439 ? -32.085 109.355 35.802 1.00 19.19  ? 439  ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 439 ? -34.457 111.104 36.763 1.00 19.07  ? 439  ILE A CD1 1 
ATOM   3437 N N   . HIS A 1 440 ? -31.462 107.652 33.459 1.00 24.17  ? 440  HIS A N   1 
ATOM   3438 C CA  . HIS A 1 440 ? -30.530 106.548 33.328 1.00 23.69  ? 440  HIS A CA  1 
ATOM   3439 C C   . HIS A 1 440 ? -30.723 105.602 34.516 1.00 25.71  ? 440  HIS A C   1 
ATOM   3440 O O   . HIS A 1 440 ? -30.678 106.022 35.676 1.00 25.82  ? 440  HIS A O   1 
ATOM   3441 C CB  . HIS A 1 440 ? -29.106 107.119 33.322 1.00 23.89  ? 440  HIS A CB  1 
ATOM   3442 C CG  . HIS A 1 440 ? -28.031 106.106 33.078 1.00 23.67  ? 440  HIS A CG  1 
ATOM   3443 N ND1 . HIS A 1 440 ? -27.930 105.391 31.904 1.00 22.19  ? 440  HIS A ND1 1 
ATOM   3444 C CD2 . HIS A 1 440 ? -26.965 105.743 33.832 1.00 23.89  ? 440  HIS A CD2 1 
ATOM   3445 C CE1 . HIS A 1 440 ? -26.848 104.635 31.943 1.00 24.49  ? 440  HIS A CE1 1 
ATOM   3446 N NE2 . HIS A 1 440 ? -26.243 104.831 33.102 1.00 25.37  ? 440  HIS A NE2 1 
ATOM   3447 N N   . GLY A 1 441 ? -30.962 104.327 34.222 1.00 27.86  ? 441  GLY A N   1 
ATOM   3448 C CA  . GLY A 1 441 ? -31.143 103.343 35.276 1.00 26.42  ? 441  GLY A CA  1 
ATOM   3449 C C   . GLY A 1 441 ? -32.552 103.149 35.803 1.00 26.04  ? 441  GLY A C   1 
ATOM   3450 O O   . GLY A 1 441 ? -32.788 102.243 36.601 1.00 27.74  ? 441  GLY A O   1 
ATOM   3451 N N   . TYR A 1 442 ? -33.503 103.968 35.370 1.00 25.72  ? 442  TYR A N   1 
ATOM   3452 C CA  . TYR A 1 442 ? -34.853 103.806 35.887 1.00 26.43  ? 442  TYR A CA  1 
ATOM   3453 C C   . TYR A 1 442 ? -35.768 102.872 35.126 1.00 27.46  ? 442  TYR A C   1 
ATOM   3454 O O   . TYR A 1 442 ? -36.981 102.941 35.264 1.00 28.30  ? 442  TYR A O   1 
ATOM   3455 C CB  . TYR A 1 442 ? -35.512 105.164 36.095 1.00 24.57  ? 442  TYR A CB  1 
ATOM   3456 C CG  . TYR A 1 442 ? -34.945 105.823 37.321 1.00 25.89  ? 442  TYR A CG  1 
ATOM   3457 C CD1 . TYR A 1 442 ? -33.672 106.409 37.300 1.00 25.39  ? 442  TYR A CD1 1 
ATOM   3458 C CD2 . TYR A 1 442 ? -35.605 105.730 38.545 1.00 24.97  ? 442  TYR A CD2 1 
ATOM   3459 C CE1 . TYR A 1 442 ? -33.075 106.866 38.467 1.00 21.98  ? 442  TYR A CE1 1 
ATOM   3460 C CE2 . TYR A 1 442 ? -35.012 106.184 39.714 1.00 23.06  ? 442  TYR A CE2 1 
ATOM   3461 C CZ  . TYR A 1 442 ? -33.753 106.743 39.664 1.00 22.06  ? 442  TYR A CZ  1 
ATOM   3462 O OH  . TYR A 1 442 ? -33.164 107.157 40.825 1.00 25.74  ? 442  TYR A OH  1 
ATOM   3463 N N   . GLU A 1 443 ? -35.177 101.987 34.335 1.00 29.03  ? 443  GLU A N   1 
ATOM   3464 C CA  . GLU A 1 443 ? -35.947 100.999 33.604 1.00 29.82  ? 443  GLU A CA  1 
ATOM   3465 C C   . GLU A 1 443 ? -35.807 99.734  34.439 1.00 31.32  ? 443  GLU A C   1 
ATOM   3466 O O   . GLU A 1 443 ? -36.584 98.791  34.307 1.00 31.41  ? 443  GLU A O   1 
ATOM   3467 C CB  . GLU A 1 443 ? -35.358 100.761 32.212 1.00 29.60  ? 443  GLU A CB  1 
ATOM   3468 C CG  . GLU A 1 443 ? -34.169 99.807  32.142 1.00 29.23  ? 443  GLU A CG  1 
ATOM   3469 C CD  . GLU A 1 443 ? -32.858 100.413 32.620 1.00 32.20  ? 443  GLU A CD  1 
ATOM   3470 O OE1 . GLU A 1 443 ? -32.652 101.632 32.443 1.00 33.99  ? 443  GLU A OE1 1 
ATOM   3471 O OE2 . GLU A 1 443 ? -32.014 99.662  33.152 1.00 31.90  ? 443  GLU A OE2 1 
ATOM   3472 N N   . ILE A 1 444 ? -34.809 99.740  35.319 1.00 32.08  ? 444  ILE A N   1 
ATOM   3473 C CA  . ILE A 1 444 ? -34.521 98.593  36.173 1.00 32.27  ? 444  ILE A CA  1 
ATOM   3474 C C   . ILE A 1 444 ? -35.691 98.168  37.059 1.00 33.12  ? 444  ILE A C   1 
ATOM   3475 O O   . ILE A 1 444 ? -36.011 96.973  37.148 1.00 31.89  ? 444  ILE A O   1 
ATOM   3476 C CB  . ILE A 1 444 ? -33.273 98.871  37.044 1.00 30.42  ? 444  ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 444 ? -32.077 99.150  36.132 1.00 31.01  ? 444  ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 444 ? -32.969 97.676  37.930 1.00 28.54  ? 444  ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 444 ? -30.766 99.342  36.848 1.00 32.43  ? 444  ILE A CD1 1 
ATOM   3480 N N   . GLU A 1 445 ? -36.328 99.141  37.708 1.00 33.08  ? 445  GLU A N   1 
ATOM   3481 C CA  . GLU A 1 445 ? -37.457 98.845  38.580 1.00 33.48  ? 445  GLU A CA  1 
ATOM   3482 C C   . GLU A 1 445 ? -38.561 98.091  37.828 1.00 34.33  ? 445  GLU A C   1 
ATOM   3483 O O   . GLU A 1 445 ? -39.323 97.334  38.429 1.00 34.09  ? 445  GLU A O   1 
ATOM   3484 C CB  . GLU A 1 445 ? -37.995 100.136 39.206 1.00 31.86  ? 445  GLU A CB  1 
ATOM   3485 C CG  . GLU A 1 445 ? -38.256 101.266 38.230 1.00 32.45  ? 445  GLU A CG  1 
ATOM   3486 C CD  . GLU A 1 445 ? -38.571 102.582 38.937 1.00 32.83  ? 445  GLU A CD  1 
ATOM   3487 O OE1 . GLU A 1 445 ? -37.687 103.109 39.652 1.00 32.32  ? 445  GLU A OE1 1 
ATOM   3488 O OE2 . GLU A 1 445 ? -39.702 103.089 38.778 1.00 32.90  ? 445  GLU A OE2 1 
ATOM   3489 N N   . PHE A 1 446 ? -38.641 98.287  36.514 1.00 33.52  ? 446  PHE A N   1 
ATOM   3490 C CA  . PHE A 1 446 ? -39.643 97.586  35.724 1.00 33.20  ? 446  PHE A CA  1 
ATOM   3491 C C   . PHE A 1 446 ? -39.125 96.211  35.326 1.00 34.26  ? 446  PHE A C   1 
ATOM   3492 O O   . PHE A 1 446 ? -39.895 95.253  35.246 1.00 35.99  ? 446  PHE A O   1 
ATOM   3493 C CB  . PHE A 1 446 ? -40.025 98.379  34.476 1.00 30.80  ? 446  PHE A CB  1 
ATOM   3494 C CG  . PHE A 1 446 ? -40.862 99.583  34.768 1.00 33.12  ? 446  PHE A CG  1 
ATOM   3495 C CD1 . PHE A 1 446 ? -40.273 100.772 35.192 1.00 34.47  ? 446  PHE A CD1 1 
ATOM   3496 C CD2 . PHE A 1 446 ? -42.245 99.527  34.649 1.00 33.55  ? 446  PHE A CD2 1 
ATOM   3497 C CE1 . PHE A 1 446 ? -41.051 101.891 35.495 1.00 35.00  ? 446  PHE A CE1 1 
ATOM   3498 C CE2 . PHE A 1 446 ? -43.036 100.638 34.949 1.00 35.15  ? 446  PHE A CE2 1 
ATOM   3499 C CZ  . PHE A 1 446 ? -42.434 101.824 35.373 1.00 35.97  ? 446  PHE A CZ  1 
ATOM   3500 N N   . VAL A 1 447 ? -37.825 96.108  35.074 1.00 33.65  ? 447  VAL A N   1 
ATOM   3501 C CA  . VAL A 1 447 ? -37.242 94.819  34.713 1.00 33.01  ? 447  VAL A CA  1 
ATOM   3502 C C   . VAL A 1 447 ? -37.396 93.851  35.893 1.00 33.25  ? 447  VAL A C   1 
ATOM   3503 O O   . VAL A 1 447 ? -37.733 92.682  35.703 1.00 31.98  ? 447  VAL A O   1 
ATOM   3504 C CB  . VAL A 1 447 ? -35.760 94.955  34.331 1.00 31.95  ? 447  VAL A CB  1 
ATOM   3505 C CG1 . VAL A 1 447 ? -35.009 93.694  34.700 1.00 29.67  ? 447  VAL A CG1 1 
ATOM   3506 C CG2 . VAL A 1 447 ? -35.597 95.239  32.847 1.00 28.98  ? 447  VAL A CG2 1 
ATOM   3507 N N   . PHE A 1 448 ? -37.162 94.337  37.109 1.00 33.44  ? 448  PHE A N   1 
ATOM   3508 C CA  . PHE A 1 448 ? -37.289 93.476  38.277 1.00 34.42  ? 448  PHE A CA  1 
ATOM   3509 C C   . PHE A 1 448 ? -38.726 93.396  38.806 1.00 34.97  ? 448  PHE A C   1 
ATOM   3510 O O   . PHE A 1 448 ? -39.020 92.669  39.759 1.00 33.61  ? 448  PHE A O   1 
ATOM   3511 C CB  . PHE A 1 448 ? -36.297 93.937  39.367 1.00 33.76  ? 448  PHE A CB  1 
ATOM   3512 C CG  . PHE A 1 448 ? -34.866 93.553  39.045 1.00 33.53  ? 448  PHE A CG  1 
ATOM   3513 C CD1 . PHE A 1 448 ? -34.150 94.279  38.095 1.00 34.22  ? 448  PHE A CD1 1 
ATOM   3514 C CD2 . PHE A 1 448 ? -34.246 92.467  39.657 1.00 34.11  ? 448  PHE A CD2 1 
ATOM   3515 C CE1 . PHE A 1 448 ? -32.832 93.929  37.755 1.00 33.14  ? 448  PHE A CE1 1 
ATOM   3516 C CE2 . PHE A 1 448 ? -32.929 92.107  39.325 1.00 34.23  ? 448  PHE A CE2 1 
ATOM   3517 C CZ  . PHE A 1 448 ? -32.222 92.841  38.373 1.00 33.81  ? 448  PHE A CZ  1 
ATOM   3518 N N   . GLY A 1 449 ? -39.619 94.144  38.164 1.00 35.09  ? 449  GLY A N   1 
ATOM   3519 C CA  . GLY A 1 449 ? -41.053 94.107  38.491 1.00 35.64  ? 449  GLY A CA  1 
ATOM   3520 C C   . GLY A 1 449 ? -41.494 94.661  39.845 1.00 37.20  ? 449  GLY A C   1 
ATOM   3521 O O   . GLY A 1 449 ? -42.188 93.987  40.609 1.00 35.94  ? 449  GLY A O   1 
ATOM   3522 N N   . LEU A 1 450 ? -41.101 95.886  40.163 1.00 39.07  ? 450  LEU A N   1 
ATOM   3523 C CA  . LEU A 1 450 ? -41.561 96.485  41.399 1.00 40.96  ? 450  LEU A CA  1 
ATOM   3524 C C   . LEU A 1 450 ? -42.968 97.038  41.205 1.00 43.20  ? 450  LEU A C   1 
ATOM   3525 O O   . LEU A 1 450 ? -43.712 97.194  42.172 1.00 43.76  ? 450  LEU A O   1 
ATOM   3526 C CB  . LEU A 1 450 ? -40.621 97.597  41.858 1.00 41.26  ? 450  LEU A CB  1 
ATOM   3527 C CG  . LEU A 1 450 ? -39.194 97.173  42.215 1.00 41.82  ? 450  LEU A CG  1 
ATOM   3528 C CD1 . LEU A 1 450 ? -38.564 98.181  43.169 1.00 39.90  ? 450  LEU A CD1 1 
ATOM   3529 C CD2 . LEU A 1 450 ? -39.172 95.774  42.830 1.00 41.43  ? 450  LEU A CD2 1 
ATOM   3530 N N   . PRO A 1 451 ? -43.332 97.392  39.983 1.00 45.01  ? 451  PRO A N   1 
ATOM   3531 C CA  . PRO A 1 451 ? -44.708 97.867  39.781 1.00 45.75  ? 451  PRO A CA  1 
ATOM   3532 C C   . PRO A 1 451 ? -45.753 96.813  40.163 1.00 47.14  ? 451  PRO A C   1 
ATOM   3533 O O   . PRO A 1 451 ? -46.961 97.069  40.143 1.00 47.34  ? 451  PRO A O   1 
ATOM   3534 C CB  . PRO A 1 451 ? -44.758 98.175  38.272 1.00 44.97  ? 451  PRO A CB  1 
ATOM   3535 C CG  . PRO A 1 451 ? -43.334 98.318  37.881 1.00 44.72  ? 451  PRO A CG  1 
ATOM   3536 C CD  . PRO A 1 451 ? -42.590 97.260  38.630 1.00 45.32  ? 451  PRO A CD  1 
ATOM   3537 N N   . LEU A 1 452 ? -45.269 95.614  40.512 1.00 47.29  ? 452  LEU A N   1 
ATOM   3538 C CA  . LEU A 1 452 ? -46.133 94.503  40.909 1.00 47.56  ? 452  LEU A CA  1 
ATOM   3539 C C   . LEU A 1 452 ? -46.491 94.640  42.385 1.00 49.04  ? 452  LEU A C   1 
ATOM   3540 O O   . LEU A 1 452 ? -47.506 94.123  42.835 1.00 51.46  ? 452  LEU A O   1 
ATOM   3541 C CB  . LEU A 1 452 ? -45.441 93.151  40.676 1.00 46.79  ? 452  LEU A CB  1 
ATOM   3542 C CG  . LEU A 1 452 ? -45.594 92.497  39.300 1.00 45.04  ? 452  LEU A CG  1 
ATOM   3543 C CD1 . LEU A 1 452 ? -44.947 93.383  38.253 1.00 46.69  ? 452  LEU A CD1 1 
ATOM   3544 C CD2 . LEU A 1 452 ? -44.966 91.114  39.295 1.00 43.29  ? 452  LEU A CD2 1 
ATOM   3545 N N   . VAL A 1 453 ? -45.646 95.332  43.139 1.00 50.03  ? 453  VAL A N   1 
ATOM   3546 C CA  . VAL A 1 453 ? -45.887 95.551  44.557 1.00 50.20  ? 453  VAL A CA  1 
ATOM   3547 C C   . VAL A 1 453 ? -46.886 96.694  44.696 1.00 52.14  ? 453  VAL A C   1 
ATOM   3548 O O   . VAL A 1 453 ? -46.552 97.855  44.457 1.00 51.93  ? 453  VAL A O   1 
ATOM   3549 C CB  . VAL A 1 453 ? -44.581 95.917  45.285 1.00 49.11  ? 453  VAL A CB  1 
ATOM   3550 C CG1 . VAL A 1 453 ? -44.864 96.277  46.726 1.00 49.12  ? 453  VAL A CG1 1 
ATOM   3551 C CG2 . VAL A 1 453 ? -43.619 94.749  45.223 1.00 48.50  ? 453  VAL A CG2 1 
ATOM   3552 N N   . LYS A 1 454 ? -48.113 96.348  45.079 1.00 54.33  ? 454  LYS A N   1 
ATOM   3553 C CA  . LYS A 1 454 ? -49.205 97.312  45.240 1.00 56.02  ? 454  LYS A CA  1 
ATOM   3554 C C   . LYS A 1 454 ? -48.876 98.452  46.193 1.00 54.60  ? 454  LYS A C   1 
ATOM   3555 O O   . LYS A 1 454 ? -49.370 99.565  46.030 1.00 54.71  ? 454  LYS A O   1 
ATOM   3556 C CB  . LYS A 1 454 ? -50.468 96.600  45.745 1.00 59.20  ? 454  LYS A CB  1 
ATOM   3557 C CG  . LYS A 1 454 ? -50.950 95.423  44.884 1.00 62.10  ? 454  LYS A CG  1 
ATOM   3558 C CD  . LYS A 1 454 ? -51.634 95.868  43.590 1.00 63.82  ? 454  LYS A CD  1 
ATOM   3559 C CE  . LYS A 1 454 ? -52.187 94.670  42.821 1.00 64.33  ? 454  LYS A CE  1 
ATOM   3560 N NZ  . LYS A 1 454 ? -52.937 95.084  41.605 1.00 65.82  ? 454  LYS A NZ  1 
ATOM   3561 N N   . GLU A 1 455 ? -48.047 98.161  47.188 1.00 54.05  ? 455  GLU A N   1 
ATOM   3562 C CA  . GLU A 1 455 ? -47.655 99.149  48.189 1.00 54.28  ? 455  GLU A CA  1 
ATOM   3563 C C   . GLU A 1 455 ? -46.698 100.210 47.654 1.00 53.65  ? 455  GLU A C   1 
ATOM   3564 O O   . GLU A 1 455 ? -46.461 101.213 48.315 1.00 51.89  ? 455  GLU A O   1 
ATOM   3565 C CB  . GLU A 1 455 ? -46.997 98.464  49.389 1.00 56.43  ? 455  GLU A CB  1 
ATOM   3566 C CG  . GLU A 1 455 ? -47.862 97.386  50.050 1.00 60.72  ? 455  GLU A CG  1 
ATOM   3567 C CD  . GLU A 1 455 ? -47.878 96.057  49.320 1.00 62.42  ? 455  GLU A CD  1 
ATOM   3568 O OE1 . GLU A 1 455 ? -48.243 95.045  49.940 1.00 63.54  ? 455  GLU A OE1 1 
ATOM   3569 O OE2 . GLU A 1 455 ? -47.530 96.047  48.117 1.00 62.30  ? 455  GLU A OE2 1 
ATOM   3570 N N   . LEU A 1 456 ? -46.140 99.985  46.468 1.00 53.65  ? 456  LEU A N   1 
ATOM   3571 C CA  . LEU A 1 456 ? -45.208 100.938 45.876 1.00 52.59  ? 456  LEU A CA  1 
ATOM   3572 C C   . LEU A 1 456 ? -45.921 101.986 45.040 1.00 53.17  ? 456  LEU A C   1 
ATOM   3573 O O   . LEU A 1 456 ? -45.301 102.688 44.241 1.00 53.23  ? 456  LEU A O   1 
ATOM   3574 C CB  . LEU A 1 456 ? -44.171 100.205 45.031 1.00 51.92  ? 456  LEU A CB  1 
ATOM   3575 C CG  . LEU A 1 456 ? -43.151 99.412  45.845 1.00 50.54  ? 456  LEU A CG  1 
ATOM   3576 C CD1 . LEU A 1 456 ? -42.191 98.642  44.940 1.00 50.18  ? 456  LEU A CD1 1 
ATOM   3577 C CD2 . LEU A 1 456 ? -42.368 100.328 46.770 1.00 49.13  ? 456  LEU A CD2 1 
ATOM   3578 N N   . ASN A 1 457 ? -47.231 102.074 45.238 1.00 53.38  ? 457  ASN A N   1 
ATOM   3579 C CA  . ASN A 1 457 ? -48.123 103.032 44.556 1.00 53.89  ? 457  ASN A CA  1 
ATOM   3580 C C   . ASN A 1 457 ? -47.805 103.396 43.090 1.00 52.21  ? 457  ASN A C   1 
ATOM   3581 O O   . ASN A 1 457 ? -47.614 104.569 42.750 1.00 50.86  ? 457  ASN A O   1 
ATOM   3582 C CB  . ASN A 1 457 ? -48.186 104.304 45.411 1.00 58.38  ? 457  ASN A CB  1 
ATOM   3583 C CG  . ASN A 1 457 ? -48.839 104.042 46.764 1.00 64.39  ? 457  ASN A CG  1 
ATOM   3584 O OD1 . ASN A 1 457 ? -49.865 103.363 46.834 1.00 66.47  ? 457  ASN A OD1 1 
ATOM   3585 N ND2 . ASN A 1 457 ? -48.266 104.573 47.839 1.00 68.61  ? 457  ASN A ND2 1 
ATOM   3586 N N   . TYR A 1 458 ? -47.749 102.381 42.227 1.00 51.03  ? 458  TYR A N   1 
ATOM   3587 C CA  . TYR A 1 458 ? -47.539 102.580 40.819 1.00 50.00  ? 458  TYR A CA  1 
ATOM   3588 C C   . TYR A 1 458 ? -48.942 102.562 40.204 1.00 48.70  ? 458  TYR A C   1 
ATOM   3589 O O   . TYR A 1 458 ? -49.908 102.424 40.947 1.00 49.64  ? 458  TYR A O   1 
ATOM   3590 C CB  . TYR A 1 458 ? -46.747 101.455 40.181 1.00 50.77  ? 458  TYR A CB  1 
ATOM   3591 C CG  . TYR A 1 458 ? -45.250 101.545 40.301 1.00 51.02  ? 458  TYR A CG  1 
ATOM   3592 C CD1 . TYR A 1 458 ? -44.524 102.336 39.413 1.00 49.92  ? 458  TYR A CD1 1 
ATOM   3593 C CD2 . TYR A 1 458 ? -44.550 100.834 41.279 1.00 51.60  ? 458  TYR A CD2 1 
ATOM   3594 C CE1 . TYR A 1 458 ? -43.138 102.409 39.487 1.00 49.59  ? 458  TYR A CE1 1 
ATOM   3595 C CE2 . TYR A 1 458 ? -43.160 100.902 41.364 1.00 50.79  ? 458  TYR A CE2 1 
ATOM   3596 C CZ  . TYR A 1 458 ? -42.465 101.687 40.462 1.00 49.91  ? 458  TYR A CZ  1 
ATOM   3597 O OH  . TYR A 1 458 ? -41.095 101.752 40.543 1.00 49.07  ? 458  TYR A OH  1 
ATOM   3598 N N   . THR A 1 459 ? -49.071 102.693 38.890 1.00 46.86  ? 459  THR A N   1 
ATOM   3599 C CA  . THR A 1 459 ? -50.395 102.659 38.284 1.00 45.46  ? 459  THR A CA  1 
ATOM   3600 C C   . THR A 1 459 ? -50.650 101.243 37.801 1.00 46.99  ? 459  THR A C   1 
ATOM   3601 O O   . THR A 1 459 ? -49.731 100.426 37.746 1.00 47.26  ? 459  THR A O   1 
ATOM   3602 C CB  . THR A 1 459 ? -50.509 103.595 37.076 1.00 42.31  ? 459  THR A CB  1 
ATOM   3603 O OG1 . THR A 1 459 ? -49.816 103.023 35.965 1.00 40.84  ? 459  THR A OG1 1 
ATOM   3604 C CG2 . THR A 1 459 ? -49.892 104.945 37.398 1.00 40.72  ? 459  THR A CG2 1 
ATOM   3605 N N   . ALA A 1 460 ? -51.899 100.955 37.455 1.00 48.20  ? 460  ALA A N   1 
ATOM   3606 C CA  . ALA A 1 460 ? -52.264 99.636  36.963 1.00 48.66  ? 460  ALA A CA  1 
ATOM   3607 C C   . ALA A 1 460 ? -51.537 99.392  35.642 1.00 50.13  ? 460  ALA A C   1 
ATOM   3608 O O   . ALA A 1 460 ? -50.981 98.314  35.406 1.00 50.00  ? 460  ALA A O   1 
ATOM   3609 C CB  . ALA A 1 460 ? -53.758 99.567  36.754 1.00 47.45  ? 460  ALA A CB  1 
ATOM   3610 N N   . GLU A 1 461 ? -51.538 100.416 34.794 1.00 51.47  ? 461  GLU A N   1 
ATOM   3611 C CA  . GLU A 1 461 ? -50.901 100.353 33.485 1.00 52.58  ? 461  GLU A CA  1 
ATOM   3612 C C   . GLU A 1 461 ? -49.411 100.060 33.622 1.00 52.54  ? 461  GLU A C   1 
ATOM   3613 O O   . GLU A 1 461 ? -48.801 99.431  32.747 1.00 52.07  ? 461  GLU A O   1 
ATOM   3614 C CB  . GLU A 1 461 ? -51.094 101.677 32.736 1.00 53.30  ? 461  GLU A CB  1 
ATOM   3615 C CG  . GLU A 1 461 ? -52.536 102.180 32.663 1.00 56.82  ? 461  GLU A CG  1 
ATOM   3616 C CD  . GLU A 1 461 ? -53.023 102.806 33.970 1.00 59.27  ? 461  GLU A CD  1 
ATOM   3617 O OE1 . GLU A 1 461 ? -53.389 102.067 34.917 1.00 60.12  ? 461  GLU A OE1 1 
ATOM   3618 O OE2 . GLU A 1 461 ? -53.034 104.054 34.046 1.00 59.75  ? 461  GLU A OE2 1 
ATOM   3619 N N   . GLU A 1 462 ? -48.829 100.517 34.726 1.00 51.56  ? 462  GLU A N   1 
ATOM   3620 C CA  . GLU A 1 462 ? -47.411 100.302 34.962 1.00 50.45  ? 462  GLU A CA  1 
ATOM   3621 C C   . GLU A 1 462 ? -47.120 98.880  35.445 1.00 50.81  ? 462  GLU A C   1 
ATOM   3622 O O   . GLU A 1 462 ? -45.994 98.394  35.313 1.00 50.27  ? 462  GLU A O   1 
ATOM   3623 C CB  . GLU A 1 462 ? -46.881 101.345 35.949 1.00 48.03  ? 462  GLU A CB  1 
ATOM   3624 C CG  . GLU A 1 462 ? -46.958 102.769 35.406 1.00 43.67  ? 462  GLU A CG  1 
ATOM   3625 C CD  . GLU A 1 462 ? -46.550 103.812 36.427 1.00 42.44  ? 462  GLU A CD  1 
ATOM   3626 O OE1 . GLU A 1 462 ? -47.082 103.775 37.553 1.00 41.75  ? 462  GLU A OE1 1 
ATOM   3627 O OE2 . GLU A 1 462 ? -45.706 104.674 36.106 1.00 39.42  ? 462  GLU A OE2 1 
ATOM   3628 N N   . GLU A 1 463 ? -48.125 98.207  35.998 1.00 50.70  ? 463  GLU A N   1 
ATOM   3629 C CA  . GLU A 1 463 ? -47.916 96.833  36.439 1.00 50.64  ? 463  GLU A CA  1 
ATOM   3630 C C   . GLU A 1 463 ? -47.904 95.950  35.205 1.00 49.14  ? 463  GLU A C   1 
ATOM   3631 O O   . GLU A 1 463 ? -47.220 94.925  35.162 1.00 49.89  ? 463  GLU A O   1 
ATOM   3632 C CB  . GLU A 1 463 ? -49.020 96.365  37.392 1.00 52.60  ? 463  GLU A CB  1 
ATOM   3633 C CG  . GLU A 1 463 ? -49.067 94.841  37.538 1.00 55.60  ? 463  GLU A CG  1 
ATOM   3634 C CD  . GLU A 1 463 ? -49.820 94.368  38.767 1.00 58.07  ? 463  GLU A CD  1 
ATOM   3635 O OE1 . GLU A 1 463 ? -50.865 94.968  39.099 1.00 60.12  ? 463  GLU A OE1 1 
ATOM   3636 O OE2 . GLU A 1 463 ? -49.373 93.382  39.395 1.00 59.35  ? 463  GLU A OE2 1 
ATOM   3637 N N   . ALA A 1 464 ? -48.667 96.358  34.199 1.00 46.62  ? 464  ALA A N   1 
ATOM   3638 C CA  . ALA A 1 464 ? -48.744 95.612  32.954 1.00 45.38  ? 464  ALA A CA  1 
ATOM   3639 C C   . ALA A 1 464 ? -47.384 95.646  32.270 1.00 44.58  ? 464  ALA A C   1 
ATOM   3640 O O   . ALA A 1 464 ? -46.833 94.610  31.881 1.00 42.25  ? 464  ALA A O   1 
ATOM   3641 C CB  . ALA A 1 464 ? -49.793 96.228  32.051 1.00 45.22  ? 464  ALA A CB  1 
ATOM   3642 N N   . LEU A 1 465 ? -46.854 96.859  32.140 1.00 44.05  ? 465  LEU A N   1 
ATOM   3643 C CA  . LEU A 1 465 ? -45.566 97.095  31.504 1.00 43.03  ? 465  LEU A CA  1 
ATOM   3644 C C   . LEU A 1 465 ? -44.463 96.259  32.133 1.00 42.92  ? 465  LEU A C   1 
ATOM   3645 O O   . LEU A 1 465 ? -43.699 95.588  31.435 1.00 44.16  ? 465  LEU A O   1 
ATOM   3646 C CB  . LEU A 1 465 ? -45.204 98.575  31.605 1.00 42.00  ? 465  LEU A CB  1 
ATOM   3647 C CG  . LEU A 1 465 ? -43.966 98.977  30.813 1.00 42.45  ? 465  LEU A CG  1 
ATOM   3648 C CD1 . LEU A 1 465 ? -44.247 98.750  29.352 1.00 42.53  ? 465  LEU A CD1 1 
ATOM   3649 C CD2 . LEU A 1 465 ? -43.614 100.433 31.059 1.00 43.39  ? 465  LEU A CD2 1 
ATOM   3650 N N   . SER A 1 466 ? -44.385 96.307  33.457 1.00 42.21  ? 466  SER A N   1 
ATOM   3651 C CA  . SER A 1 466 ? -43.378 95.562  34.204 1.00 41.98  ? 466  SER A CA  1 
ATOM   3652 C C   . SER A 1 466 ? -43.512 94.062  33.948 1.00 42.11  ? 466  SER A C   1 
ATOM   3653 O O   . SER A 1 466 ? -42.514 93.351  33.838 1.00 41.68  ? 466  SER A O   1 
ATOM   3654 C CB  . SER A 1 466 ? -43.521 95.855  35.698 1.00 41.60  ? 466  SER A CB  1 
ATOM   3655 O OG  . SER A 1 466 ? -42.407 95.381  36.425 1.00 41.61  ? 466  SER A OG  1 
ATOM   3656 N N   . ARG A 1 467 ? -44.750 93.582  33.855 1.00 41.93  ? 467  ARG A N   1 
ATOM   3657 C CA  . ARG A 1 467 ? -44.988 92.167  33.597 1.00 41.23  ? 467  ARG A CA  1 
ATOM   3658 C C   . ARG A 1 467 ? -44.611 91.825  32.159 1.00 39.77  ? 467  ARG A C   1 
ATOM   3659 O O   . ARG A 1 467 ? -44.093 90.745  31.885 1.00 39.55  ? 467  ARG A O   1 
ATOM   3660 C CB  . ARG A 1 467 ? -46.454 91.808  33.859 1.00 42.89  ? 467  ARG A CB  1 
ATOM   3661 C CG  . ARG A 1 467 ? -46.810 91.646  35.337 1.00 43.02  ? 467  ARG A CG  1 
ATOM   3662 C CD  . ARG A 1 467 ? -48.211 91.079  35.501 1.00 43.39  ? 467  ARG A CD  1 
ATOM   3663 N NE  . ARG A 1 467 ? -48.583 90.855  36.899 1.00 45.75  ? 467  ARG A NE  1 
ATOM   3664 C CZ  . ARG A 1 467 ? -48.163 89.836  37.644 1.00 46.37  ? 467  ARG A CZ  1 
ATOM   3665 N NH1 . ARG A 1 467 ? -47.343 88.922  37.139 1.00 47.82  ? 467  ARG A NH1 1 
ATOM   3666 N NH2 . ARG A 1 467 ? -48.579 89.719  38.897 1.00 46.28  ? 467  ARG A NH2 1 
ATOM   3667 N N   . ARG A 1 468 ? -44.870 92.753  31.244 1.00 39.12  ? 468  ARG A N   1 
ATOM   3668 C CA  . ARG A 1 468 ? -44.529 92.553  29.840 1.00 37.90  ? 468  ARG A CA  1 
ATOM   3669 C C   . ARG A 1 468 ? -43.010 92.505  29.731 1.00 37.77  ? 468  ARG A C   1 
ATOM   3670 O O   . ARG A 1 468 ? -42.435 91.536  29.223 1.00 36.06  ? 468  ARG A O   1 
ATOM   3671 C CB  . ARG A 1 468 ? -45.063 93.709  28.988 1.00 38.15  ? 468  ARG A CB  1 
ATOM   3672 C CG  . ARG A 1 468 ? -45.129 93.402  27.492 1.00 42.74  ? 468  ARG A CG  1 
ATOM   3673 C CD  . ARG A 1 468 ? -45.880 94.490  26.725 1.00 46.24  ? 468  ARG A CD  1 
ATOM   3674 N NE  . ARG A 1 468 ? -44.982 95.414  26.037 1.00 48.17  ? 468  ARG A NE  1 
ATOM   3675 C CZ  . ARG A 1 468 ? -45.298 96.664  25.715 1.00 50.03  ? 468  ARG A CZ  1 
ATOM   3676 N NH1 . ARG A 1 468 ? -46.494 97.150  26.021 1.00 52.91  ? 468  ARG A NH1 1 
ATOM   3677 N NH2 . ARG A 1 468 ? -44.419 97.432  25.081 1.00 51.51  ? 468  ARG A NH2 1 
ATOM   3678 N N   . ILE A 1 469 ? -42.371 93.559  30.233 1.00 36.14  ? 469  ILE A N   1 
ATOM   3679 C CA  . ILE A 1 469 ? -40.924 93.673  30.198 1.00 35.22  ? 469  ILE A CA  1 
ATOM   3680 C C   . ILE A 1 469 ? -40.222 92.446  30.776 1.00 35.51  ? 469  ILE A C   1 
ATOM   3681 O O   . ILE A 1 469 ? -39.296 91.907  30.163 1.00 35.79  ? 469  ILE A O   1 
ATOM   3682 C CB  . ILE A 1 469 ? -40.465 94.959  30.930 1.00 34.08  ? 469  ILE A CB  1 
ATOM   3683 C CG1 . ILE A 1 469 ? -40.898 96.182  30.113 1.00 31.55  ? 469  ILE A CG1 1 
ATOM   3684 C CG2 . ILE A 1 469 ? -38.950 94.955  31.125 1.00 31.95  ? 469  ILE A CG2 1 
ATOM   3685 C CD1 . ILE A 1 469 ? -40.522 97.502  30.716 1.00 30.67  ? 469  ILE A CD1 1 
ATOM   3686 N N   . MET A 1 470 ? -40.655 91.995  31.947 1.00 36.06  ? 470  MET A N   1 
ATOM   3687 C CA  . MET A 1 470 ? -40.041 90.817  32.555 1.00 36.50  ? 470  MET A CA  1 
ATOM   3688 C C   . MET A 1 470 ? -40.243 89.622  31.636 1.00 37.80  ? 470  MET A C   1 
ATOM   3689 O O   . MET A 1 470 ? -39.343 88.796  31.460 1.00 37.83  ? 470  MET A O   1 
ATOM   3690 C CB  . MET A 1 470 ? -40.662 90.504  33.915 1.00 35.40  ? 470  MET A CB  1 
ATOM   3691 C CG  . MET A 1 470 ? -40.446 91.548  34.981 1.00 33.96  ? 470  MET A CG  1 
ATOM   3692 S SD  . MET A 1 470 ? -41.032 90.926  36.559 1.00 34.58  ? 470  MET A SD  1 
ATOM   3693 C CE  . MET A 1 470 ? -42.711 91.437  36.503 1.00 36.55  ? 470  MET A CE  1 
ATOM   3694 N N   . HIS A 1 471 ? -41.428 89.534  31.041 1.00 38.67  ? 471  HIS A N   1 
ATOM   3695 C CA  . HIS A 1 471 ? -41.718 88.422  30.153 1.00 40.53  ? 471  HIS A CA  1 
ATOM   3696 C C   . HIS A 1 471 ? -40.781 88.429  28.948 1.00 39.81  ? 471  HIS A C   1 
ATOM   3697 O O   . HIS A 1 471 ? -40.240 87.392  28.568 1.00 39.90  ? 471  HIS A O   1 
ATOM   3698 C CB  . HIS A 1 471 ? -43.172 88.465  29.701 1.00 42.29  ? 471  HIS A CB  1 
ATOM   3699 C CG  . HIS A 1 471 ? -43.693 87.135  29.259 1.00 46.39  ? 471  HIS A CG  1 
ATOM   3700 N ND1 . HIS A 1 471 ? -43.472 85.978  29.978 1.00 46.30  ? 471  HIS A ND1 1 
ATOM   3701 C CD2 . HIS A 1 471 ? -44.436 86.775  28.185 1.00 46.72  ? 471  HIS A CD2 1 
ATOM   3702 C CE1 . HIS A 1 471 ? -44.058 84.965  29.366 1.00 47.17  ? 471  HIS A CE1 1 
ATOM   3703 N NE2 . HIS A 1 471 ? -44.650 85.422  28.277 1.00 46.52  ? 471  HIS A NE2 1 
ATOM   3704 N N   . TYR A 1 472 ? -40.596 89.598  28.345 1.00 39.22  ? 472  TYR A N   1 
ATOM   3705 C CA  . TYR A 1 472 ? -39.687 89.716  27.214 1.00 37.49  ? 472  TYR A CA  1 
ATOM   3706 C C   . TYR A 1 472 ? -38.304 89.243  27.673 1.00 37.60  ? 472  TYR A C   1 
ATOM   3707 O O   . TYR A 1 472 ? -37.657 88.415  27.023 1.00 35.03  ? 472  TYR A O   1 
ATOM   3708 C CB  . TYR A 1 472 ? -39.569 91.169  26.760 1.00 35.21  ? 472  TYR A CB  1 
ATOM   3709 C CG  . TYR A 1 472 ? -40.735 91.710  25.974 1.00 34.13  ? 472  TYR A CG  1 
ATOM   3710 C CD1 . TYR A 1 472 ? -41.382 90.929  25.021 1.00 33.08  ? 472  TYR A CD1 1 
ATOM   3711 C CD2 . TYR A 1 472 ? -41.134 93.044  26.118 1.00 33.85  ? 472  TYR A CD2 1 
ATOM   3712 C CE1 . TYR A 1 472 ? -42.393 91.460  24.224 1.00 33.79  ? 472  TYR A CE1 1 
ATOM   3713 C CE2 . TYR A 1 472 ? -42.138 93.586  25.329 1.00 33.63  ? 472  TYR A CE2 1 
ATOM   3714 C CZ  . TYR A 1 472 ? -42.766 92.789  24.382 1.00 34.75  ? 472  TYR A CZ  1 
ATOM   3715 O OH  . TYR A 1 472 ? -43.764 93.315  23.596 1.00 34.93  ? 472  TYR A OH  1 
ATOM   3716 N N   . TRP A 1 473 ? -37.857 89.793  28.800 1.00 37.34  ? 473  TRP A N   1 
ATOM   3717 C CA  . TRP A 1 473 ? -36.554 89.445  29.356 1.00 38.87  ? 473  TRP A CA  1 
ATOM   3718 C C   . TRP A 1 473 ? -36.446 87.956  29.671 1.00 38.84  ? 473  TRP A C   1 
ATOM   3719 O O   . TRP A 1 473 ? -35.435 87.324  29.367 1.00 37.05  ? 473  TRP A O   1 
ATOM   3720 C CB  . TRP A 1 473 ? -36.278 90.257  30.629 1.00 38.26  ? 473  TRP A CB  1 
ATOM   3721 C CG  . TRP A 1 473 ? -35.579 91.583  30.408 1.00 38.45  ? 473  TRP A CG  1 
ATOM   3722 C CD1 . TRP A 1 473 ? -34.482 92.047  31.082 1.00 38.60  ? 473  TRP A CD1 1 
ATOM   3723 C CD2 . TRP A 1 473 ? -35.947 92.621  29.488 1.00 37.28  ? 473  TRP A CD2 1 
ATOM   3724 N NE1 . TRP A 1 473 ? -34.147 93.304  30.643 1.00 38.63  ? 473  TRP A NE1 1 
ATOM   3725 C CE2 . TRP A 1 473 ? -35.029 93.682  29.666 1.00 38.29  ? 473  TRP A CE2 1 
ATOM   3726 C CE3 . TRP A 1 473 ? -36.960 92.761  28.533 1.00 37.16  ? 473  TRP A CE3 1 
ATOM   3727 C CZ2 . TRP A 1 473 ? -35.096 94.865  28.924 1.00 37.26  ? 473  TRP A CZ2 1 
ATOM   3728 C CZ3 . TRP A 1 473 ? -37.025 93.941  27.793 1.00 36.08  ? 473  TRP A CZ3 1 
ATOM   3729 C CH2 . TRP A 1 473 ? -36.098 94.974  27.996 1.00 36.53  ? 473  TRP A CH2 1 
ATOM   3730 N N   . ALA A 1 474 ? -37.494 87.401  30.276 1.00 38.69  ? 474  ALA A N   1 
ATOM   3731 C CA  . ALA A 1 474 ? -37.509 85.990  30.635 1.00 39.47  ? 474  ALA A CA  1 
ATOM   3732 C C   . ALA A 1 474 ? -37.590 85.100  29.402 1.00 39.82  ? 474  ALA A C   1 
ATOM   3733 O O   . ALA A 1 474 ? -36.774 84.191  29.221 1.00 41.66  ? 474  ALA A O   1 
ATOM   3734 C CB  . ALA A 1 474 ? -38.680 85.706  31.553 1.00 41.49  ? 474  ALA A CB  1 
ATOM   3735 N N   . THR A 1 475 ? -38.576 85.362  28.554 1.00 37.98  ? 475  THR A N   1 
ATOM   3736 C CA  . THR A 1 475 ? -38.756 84.587  27.338 1.00 37.35  ? 475  THR A CA  1 
ATOM   3737 C C   . THR A 1 475 ? -37.486 84.594  26.490 1.00 38.03  ? 475  THR A C   1 
ATOM   3738 O O   . THR A 1 475 ? -37.096 83.573  25.925 1.00 38.11  ? 475  THR A O   1 
ATOM   3739 C CB  . THR A 1 475 ? -39.918 85.148  26.504 1.00 36.30  ? 475  THR A CB  1 
ATOM   3740 O OG1 . THR A 1 475 ? -41.114 85.139  27.294 1.00 35.56  ? 475  THR A OG1 1 
ATOM   3741 C CG2 . THR A 1 475 ? -40.127 84.312  25.250 1.00 34.62  ? 475  THR A CG2 1 
ATOM   3742 N N   . PHE A 1 476 ? -36.843 85.754  26.399 1.00 39.93  ? 476  PHE A N   1 
ATOM   3743 C CA  . PHE A 1 476 ? -35.618 85.880  25.619 1.00 40.19  ? 476  PHE A CA  1 
ATOM   3744 C C   . PHE A 1 476 ? -34.534 84.966  26.178 1.00 41.15  ? 476  PHE A C   1 
ATOM   3745 O O   . PHE A 1 476 ? -33.940 84.174  25.453 1.00 41.52  ? 476  PHE A O   1 
ATOM   3746 C CB  . PHE A 1 476 ? -35.105 87.327  25.631 1.00 37.88  ? 476  PHE A CB  1 
ATOM   3747 C CG  . PHE A 1 476 ? -33.756 87.486  24.992 1.00 35.66  ? 476  PHE A CG  1 
ATOM   3748 C CD1 . PHE A 1 476 ? -33.625 87.493  23.609 1.00 35.10  ? 476  PHE A CD1 1 
ATOM   3749 C CD2 . PHE A 1 476 ? -32.604 87.545  25.774 1.00 35.31  ? 476  PHE A CD2 1 
ATOM   3750 C CE1 . PHE A 1 476 ? -32.365 87.549  23.009 1.00 34.19  ? 476  PHE A CE1 1 
ATOM   3751 C CE2 . PHE A 1 476 ? -31.340 87.602  25.184 1.00 33.56  ? 476  PHE A CE2 1 
ATOM   3752 C CZ  . PHE A 1 476 ? -31.223 87.602  23.799 1.00 33.65  ? 476  PHE A CZ  1 
ATOM   3753 N N   . ALA A 1 477 ? -34.278 85.083  27.474 1.00 42.89  ? 477  ALA A N   1 
ATOM   3754 C CA  . ALA A 1 477 ? -33.254 84.273  28.114 1.00 45.72  ? 477  ALA A CA  1 
ATOM   3755 C C   . ALA A 1 477 ? -33.558 82.790  27.949 1.00 47.92  ? 477  ALA A C   1 
ATOM   3756 O O   . ALA A 1 477 ? -32.652 81.955  27.932 1.00 48.72  ? 477  ALA A O   1 
ATOM   3757 C CB  . ALA A 1 477 ? -33.158 84.627  29.590 1.00 44.25  ? 477  ALA A CB  1 
ATOM   3758 N N   . LYS A 1 478 ? -34.838 82.466  27.817 1.00 49.43  ? 478  LYS A N   1 
ATOM   3759 C CA  . LYS A 1 478 ? -35.235 81.080  27.675 1.00 51.69  ? 478  LYS A CA  1 
ATOM   3760 C C   . LYS A 1 478 ? -35.143 80.556  26.255 1.00 51.70  ? 478  LYS A C   1 
ATOM   3761 O O   . LYS A 1 478 ? -34.734 79.416  26.034 1.00 52.63  ? 478  LYS A O   1 
ATOM   3762 C CB  . LYS A 1 478 ? -36.663 80.881  28.188 1.00 54.42  ? 478  LYS A CB  1 
ATOM   3763 C CG  . LYS A 1 478 ? -37.167 79.454  28.005 1.00 57.70  ? 478  LYS A CG  1 
ATOM   3764 C CD  . LYS A 1 478 ? -38.455 79.201  28.769 1.00 60.22  ? 478  LYS A CD  1 
ATOM   3765 C CE  . LYS A 1 478 ? -38.865 77.735  28.669 1.00 60.70  ? 478  LYS A CE  1 
ATOM   3766 N NZ  . LYS A 1 478 ? -39.993 77.409  29.593 1.00 61.71  ? 478  LYS A NZ  1 
ATOM   3767 N N   . THR A 1 479 ? -35.506 81.389  25.289 1.00 50.52  ? 479  THR A N   1 
ATOM   3768 C CA  . THR A 1 479 ? -35.504 80.960  23.900 1.00 50.05  ? 479  THR A CA  1 
ATOM   3769 C C   . THR A 1 479 ? -34.478 81.637  22.990 1.00 50.45  ? 479  THR A C   1 
ATOM   3770 O O   . THR A 1 479 ? -33.953 81.018  22.066 1.00 51.10  ? 479  THR A O   1 
ATOM   3771 C CB  . THR A 1 479 ? -36.901 81.167  23.294 1.00 49.61  ? 479  THR A CB  1 
ATOM   3772 O OG1 . THR A 1 479 ? -37.159 82.570  23.152 1.00 50.97  ? 479  THR A OG1 1 
ATOM   3773 C CG2 . THR A 1 479 ? -37.958 80.573  24.207 1.00 47.88  ? 479  THR A CG2 1 
ATOM   3774 N N   . GLY A 1 480 ? -34.189 82.904  23.258 1.00 50.68  ? 480  GLY A N   1 
ATOM   3775 C CA  . GLY A 1 480 ? -33.260 83.645  22.428 1.00 47.35  ? 480  GLY A CA  1 
ATOM   3776 C C   . GLY A 1 480 ? -34.112 84.585  21.606 1.00 46.28  ? 480  GLY A C   1 
ATOM   3777 O O   . GLY A 1 480 ? -33.636 85.246  20.686 1.00 45.63  ? 480  GLY A O   1 
ATOM   3778 N N   . ASN A 1 481 ? -35.395 84.618  21.953 1.00 45.90  ? 481  ASN A N   1 
ATOM   3779 C CA  . ASN A 1 481 ? -36.387 85.463  21.300 1.00 46.88  ? 481  ASN A CA  1 
ATOM   3780 C C   . ASN A 1 481 ? -37.357 85.909  22.391 1.00 47.86  ? 481  ASN A C   1 
ATOM   3781 O O   . ASN A 1 481 ? -37.844 85.081  23.159 1.00 49.48  ? 481  ASN A O   1 
ATOM   3782 C CB  . ASN A 1 481 ? -37.149 84.666  20.242 1.00 46.85  ? 481  ASN A CB  1 
ATOM   3783 C CG  . ASN A 1 481 ? -38.174 85.508  19.500 1.00 47.29  ? 481  ASN A CG  1 
ATOM   3784 O OD1 . ASN A 1 481 ? -38.856 86.353  20.090 1.00 46.07  ? 481  ASN A OD1 1 
ATOM   3785 N ND2 . ASN A 1 481 ? -38.298 85.272  18.200 1.00 45.86  ? 481  ASN A ND2 1 
ATOM   3786 N N   . PRO A 1 482 ? -37.643 87.219  22.484 1.00 48.24  ? 482  PRO A N   1 
ATOM   3787 C CA  . PRO A 1 482 ? -38.563 87.739  23.502 1.00 48.43  ? 482  PRO A CA  1 
ATOM   3788 C C   . PRO A 1 482 ? -40.035 87.611  23.118 1.00 48.72  ? 482  PRO A C   1 
ATOM   3789 O O   . PRO A 1 482 ? -40.921 87.714  23.966 1.00 48.73  ? 482  PRO A O   1 
ATOM   3790 C CB  . PRO A 1 482 ? -38.131 89.192  23.631 1.00 47.34  ? 482  PRO A CB  1 
ATOM   3791 C CG  . PRO A 1 482 ? -37.798 89.538  22.220 1.00 47.57  ? 482  PRO A CG  1 
ATOM   3792 C CD  . PRO A 1 482 ? -36.984 88.330  21.772 1.00 48.46  ? 482  PRO A CD  1 
ATOM   3793 N N   . ASN A 1 483 ? -40.294 87.391  21.836 1.00 49.68  ? 483  ASN A N   1 
ATOM   3794 C CA  . ASN A 1 483 ? -41.660 87.258  21.356 1.00 50.04  ? 483  ASN A CA  1 
ATOM   3795 C C   . ASN A 1 483 ? -42.287 85.934  21.768 1.00 52.37  ? 483  ASN A C   1 
ATOM   3796 O O   . ASN A 1 483 ? -41.590 84.937  21.976 1.00 50.51  ? 483  ASN A O   1 
ATOM   3797 C CB  . ASN A 1 483 ? -41.698 87.365  19.835 1.00 47.41  ? 483  ASN A CB  1 
ATOM   3798 C CG  . ASN A 1 483 ? -41.343 88.736  19.344 1.00 44.58  ? 483  ASN A CG  1 
ATOM   3799 O OD1 . ASN A 1 483 ? -42.068 89.695  19.589 1.00 43.99  ? 483  ASN A OD1 1 
ATOM   3800 N ND2 . ASN A 1 483 ? -40.222 88.843  18.645 1.00 43.78  ? 483  ASN A ND2 1 
ATOM   3801 N N   . GLU A 1 484 ? -43.612 85.944  21.888 1.00 55.54  ? 484  GLU A N   1 
ATOM   3802 C CA  . GLU A 1 484 ? -44.365 84.751  22.237 1.00 58.90  ? 484  GLU A CA  1 
ATOM   3803 C C   . GLU A 1 484 ? -44.259 83.832  21.034 1.00 60.72  ? 484  GLU A C   1 
ATOM   3804 O O   . GLU A 1 484 ? -44.454 84.266  19.899 1.00 60.53  ? 484  GLU A O   1 
ATOM   3805 C CB  . GLU A 1 484 ? -45.833 85.099  22.492 1.00 60.95  ? 484  GLU A CB  1 
ATOM   3806 C CG  . GLU A 1 484 ? -46.097 85.814  23.812 1.00 64.97  ? 484  GLU A CG  1 
ATOM   3807 C CD  . GLU A 1 484 ? -45.844 84.926  25.027 1.00 67.20  ? 484  GLU A CD  1 
ATOM   3808 O OE1 . GLU A 1 484 ? -45.886 85.442  26.165 1.00 67.40  ? 484  GLU A OE1 1 
ATOM   3809 O OE2 . GLU A 1 484 ? -45.608 83.711  24.843 1.00 69.71  ? 484  GLU A OE2 1 
ATOM   3810 N N   . PRO A 1 485 ? -43.963 82.545  21.264 1.00 63.16  ? 485  PRO A N   1 
ATOM   3811 C CA  . PRO A 1 485 ? -43.835 81.591  20.156 1.00 64.19  ? 485  PRO A CA  1 
ATOM   3812 C C   . PRO A 1 485 ? -44.825 81.799  19.012 1.00 65.18  ? 485  PRO A C   1 
ATOM   3813 O O   . PRO A 1 485 ? -44.487 81.587  17.848 1.00 65.84  ? 485  PRO A O   1 
ATOM   3814 C CB  . PRO A 1 485 ? -44.008 80.232  20.842 1.00 64.14  ? 485  PRO A CB  1 
ATOM   3815 C CG  . PRO A 1 485 ? -44.806 80.562  22.096 1.00 64.72  ? 485  PRO A CG  1 
ATOM   3816 C CD  . PRO A 1 485 ? -44.137 81.835  22.544 1.00 63.38  ? 485  PRO A CD  1 
ATOM   3817 N N   . HIS A 1 486 ? -46.039 82.231  19.336 1.00 66.02  ? 486  HIS A N   1 
ATOM   3818 C CA  . HIS A 1 486 ? -47.050 82.431  18.311 1.00 67.58  ? 486  HIS A CA  1 
ATOM   3819 C C   . HIS A 1 486 ? -48.266 83.202  18.795 1.00 68.15  ? 486  HIS A C   1 
ATOM   3820 O O   . HIS A 1 486 ? -49.388 82.919  18.381 1.00 68.41  ? 486  HIS A O   1 
ATOM   3821 C CB  . HIS A 1 486 ? -47.493 81.072  17.764 1.00 69.84  ? 486  HIS A CB  1 
ATOM   3822 C CG  . HIS A 1 486 ? -47.474 79.977  18.786 1.00 71.27  ? 486  HIS A CG  1 
ATOM   3823 N ND1 . HIS A 1 486 ? -48.176 80.049  19.970 1.00 71.88  ? 486  HIS A ND1 1 
ATOM   3824 C CD2 . HIS A 1 486 ? -46.805 78.800  18.818 1.00 71.55  ? 486  HIS A CD2 1 
ATOM   3825 C CE1 . HIS A 1 486 ? -47.938 78.966  20.689 1.00 71.90  ? 486  HIS A CE1 1 
ATOM   3826 N NE2 . HIS A 1 486 ? -47.109 78.192  20.012 1.00 72.32  ? 486  HIS A NE2 1 
ATOM   3827 N N   . SER A 1 487 ? -48.052 84.175  19.670 1.00 69.39  ? 487  SER A N   1 
ATOM   3828 C CA  . SER A 1 487 ? -49.168 84.968  20.169 1.00 69.46  ? 487  SER A CA  1 
ATOM   3829 C C   . SER A 1 487 ? -49.675 85.848  19.037 1.00 69.81  ? 487  SER A C   1 
ATOM   3830 O O   . SER A 1 487 ? -49.198 85.756  17.907 1.00 69.37  ? 487  SER A O   1 
ATOM   3831 C CB  . SER A 1 487 ? -48.731 85.843  21.346 1.00 68.70  ? 487  SER A CB  1 
ATOM   3832 O OG  . SER A 1 487 ? -49.838 86.519  21.914 1.00 66.75  ? 487  SER A OG  1 
ATOM   3833 N N   . GLN A 1 488 ? -50.643 86.699  19.344 1.00 71.03  ? 488  GLN A N   1 
ATOM   3834 C CA  . GLN A 1 488 ? -51.206 87.600  18.349 1.00 72.18  ? 488  GLN A CA  1 
ATOM   3835 C C   . GLN A 1 488 ? -50.826 89.027  18.705 1.00 70.97  ? 488  GLN A C   1 
ATOM   3836 O O   . GLN A 1 488 ? -51.184 89.974  18.010 1.00 70.41  ? 488  GLN A O   1 
ATOM   3837 C CB  . GLN A 1 488 ? -52.720 87.449  18.325 1.00 75.70  ? 488  GLN A CB  1 
ATOM   3838 C CG  . GLN A 1 488 ? -53.173 86.034  18.028 1.00 80.76  ? 488  GLN A CG  1 
ATOM   3839 C CD  . GLN A 1 488 ? -54.601 85.800  18.453 1.00 84.01  ? 488  GLN A CD  1 
ATOM   3840 O OE1 . GLN A 1 488 ? -55.507 86.531  18.047 1.00 86.74  ? 488  GLN A OE1 1 
ATOM   3841 N NE2 . GLN A 1 488 ? -54.814 84.778  19.279 1.00 85.80  ? 488  GLN A NE2 1 
ATOM   3842 N N   . GLU A 1 489 ? -50.099 89.161  19.809 1.00 70.18  ? 489  GLU A N   1 
ATOM   3843 C CA  . GLU A 1 489 ? -49.635 90.453  20.284 1.00 69.55  ? 489  GLU A CA  1 
ATOM   3844 C C   . GLU A 1 489 ? -48.585 90.928  19.287 1.00 68.46  ? 489  GLU A C   1 
ATOM   3845 O O   . GLU A 1 489 ? -47.928 90.110  18.642 1.00 69.05  ? 489  GLU A O   1 
ATOM   3846 C CB  . GLU A 1 489 ? -49.002 90.295  21.669 1.00 70.96  ? 489  GLU A CB  1 
ATOM   3847 C CG  . GLU A 1 489 ? -49.820 89.442  22.633 1.00 74.09  ? 489  GLU A CG  1 
ATOM   3848 C CD  . GLU A 1 489 ? -49.088 89.151  23.937 1.00 76.49  ? 489  GLU A CD  1 
ATOM   3849 O OE1 . GLU A 1 489 ? -47.957 88.615  23.885 1.00 76.91  ? 489  GLU A OE1 1 
ATOM   3850 O OE2 . GLU A 1 489 ? -49.647 89.453  25.015 1.00 77.08  ? 489  GLU A OE2 1 
ATOM   3851 N N   . SER A 1 490 ? -48.429 92.241  19.151 1.00 66.35  ? 490  SER A N   1 
ATOM   3852 C CA  . SER A 1 490 ? -47.443 92.790  18.226 1.00 64.27  ? 490  SER A CA  1 
ATOM   3853 C C   . SER A 1 490 ? -46.064 92.204  18.507 1.00 62.86  ? 490  SER A C   1 
ATOM   3854 O O   . SER A 1 490 ? -45.618 92.170  19.657 1.00 62.45  ? 490  SER A O   1 
ATOM   3855 C CB  . SER A 1 490 ? -47.378 94.309  18.329 1.00 64.67  ? 490  SER A CB  1 
ATOM   3856 O OG  . SER A 1 490 ? -48.596 94.907  17.930 1.00 66.42  ? 490  SER A OG  1 
ATOM   3857 N N   . LYS A 1 491 ? -45.389 91.739  17.462 1.00 60.39  ? 491  LYS A N   1 
ATOM   3858 C CA  . LYS A 1 491 ? -44.060 91.173  17.637 1.00 59.13  ? 491  LYS A CA  1 
ATOM   3859 C C   . LYS A 1 491 ? -43.001 92.264  17.753 1.00 56.88  ? 491  LYS A C   1 
ATOM   3860 O O   . LYS A 1 491 ? -43.129 93.316  17.141 1.00 56.44  ? 491  LYS A O   1 
ATOM   3861 C CB  . LYS A 1 491 ? -43.698 90.245  16.466 1.00 60.90  ? 491  LYS A CB  1 
ATOM   3862 C CG  . LYS A 1 491 ? -44.360 88.865  16.512 1.00 65.01  ? 491  LYS A CG  1 
ATOM   3863 C CD  . LYS A 1 491 ? -44.089 88.073  15.240 1.00 66.86  ? 491  LYS A CD  1 
ATOM   3864 C CE  . LYS A 1 491 ? -42.684 87.504  15.259 1.00 68.11  ? 491  LYS A CE  1 
ATOM   3865 N NZ  . LYS A 1 491 ? -42.534 86.418  16.266 1.00 67.85  ? 491  LYS A NZ  1 
ATOM   3866 N N   . TRP A 1 492 ? -42.002 92.005  18.572 1.00 53.01  ? 492  TRP A N   1 
ATOM   3867 C CA  . TRP A 1 492 ? -40.837 92.837  18.723 1.00 49.52  ? 492  TRP A CA  1 
ATOM   3868 C C   . TRP A 1 492 ? -39.910 92.353  17.598 1.00 47.43  ? 492  TRP A C   1 
ATOM   3869 O O   . TRP A 1 492 ? -39.259 91.304  17.745 1.00 47.99  ? 492  TRP A O   1 
ATOM   3870 C CB  . TRP A 1 492 ? -40.233 92.676  20.130 1.00 49.55  ? 492  TRP A CB  1 
ATOM   3871 C CG  . TRP A 1 492 ? -38.884 93.305  20.393 1.00 47.61  ? 492  TRP A CG  1 
ATOM   3872 C CD1 . TRP A 1 492 ? -37.960 93.756  19.489 1.00 47.46  ? 492  TRP A CD1 1 
ATOM   3873 C CD2 . TRP A 1 492 ? -38.307 93.515  21.689 1.00 46.97  ? 492  TRP A CD2 1 
ATOM   3874 N NE1 . TRP A 1 492 ? -36.844 94.228  20.142 1.00 46.29  ? 492  TRP A NE1 1 
ATOM   3875 C CE2 . TRP A 1 492 ? -37.031 94.092  21.492 1.00 47.72  ? 492  TRP A CE2 1 
ATOM   3876 C CE3 . TRP A 1 492 ? -38.744 93.268  22.999 1.00 46.60  ? 492  TRP A CE3 1 
ATOM   3877 C CZ2 . TRP A 1 492 ? -36.185 94.426  22.562 1.00 47.49  ? 492  TRP A CZ2 1 
ATOM   3878 C CZ3 . TRP A 1 492 ? -37.902 93.599  24.064 1.00 45.40  ? 492  TRP A CZ3 1 
ATOM   3879 C CH2 . TRP A 1 492 ? -36.639 94.172  23.836 1.00 47.07  ? 492  TRP A CH2 1 
ATOM   3880 N N   . PRO A 1 493 ? -39.847 93.128  16.488 1.00 44.69  ? 493  PRO A N   1 
ATOM   3881 C CA  . PRO A 1 493 ? -39.052 92.717  15.323 1.00 42.45  ? 493  PRO A CA  1 
ATOM   3882 C C   . PRO A 1 493 ? -37.587 92.446  15.679 1.00 42.14  ? 493  PRO A C   1 
ATOM   3883 O O   . PRO A 1 493 ? -37.066 92.800  16.713 1.00 43.22  ? 493  PRO A O   1 
ATOM   3884 C CB  . PRO A 1 493 ? -39.175 93.921  14.368 1.00 41.42  ? 493  PRO A CB  1 
ATOM   3885 C CG  . PRO A 1 493 ? -40.378 94.646  14.847 1.00 42.80  ? 493  PRO A CG  1 
ATOM   3886 C CD  . PRO A 1 493 ? -40.327 94.593  16.340 1.00 42.94  ? 493  PRO A CD  1 
ATOM   3887 N N   . LEU A 1 494 ? -36.897 91.785  14.723 1.00 41.09  ? 494  LEU A N   1 
ATOM   3888 C CA  . LEU A 1 494 ? -35.495 91.470  14.863 1.00 40.66  ? 494  LEU A CA  1 
ATOM   3889 C C   . LEU A 1 494 ? -34.712 92.608  14.236 1.00 40.98  ? 494  LEU A C   1 
ATOM   3890 O O   . LEU A 1 494 ? -35.027 93.021  13.118 1.00 41.96  ? 494  LEU A O   1 
ATOM   3891 C CB  . LEU A 1 494 ? -35.203 90.135  14.183 1.00 40.49  ? 494  LEU A CB  1 
ATOM   3892 C CG  . LEU A 1 494 ? -33.879 89.428  14.479 1.00 41.65  ? 494  LEU A CG  1 
ATOM   3893 C CD1 . LEU A 1 494 ? -33.612 89.364  15.975 1.00 41.94  ? 494  LEU A CD1 1 
ATOM   3894 C CD2 . LEU A 1 494 ? -33.856 88.046  13.862 1.00 41.19  ? 494  LEU A CD2 1 
ATOM   3895 N N   . PHE A 1 495 ? -33.712 93.137  14.933 1.00 40.80  ? 495  PHE A N   1 
ATOM   3896 C CA  . PHE A 1 495 ? -32.911 94.224  14.381 1.00 40.41  ? 495  PHE A CA  1 
ATOM   3897 C C   . PHE A 1 495 ? -32.016 93.685  13.283 1.00 40.41  ? 495  PHE A C   1 
ATOM   3898 O O   . PHE A 1 495 ? -31.210 92.789  13.523 1.00 41.07  ? 495  PHE A O   1 
ATOM   3899 C CB  . PHE A 1 495 ? -32.060 94.874  15.480 1.00 40.44  ? 495  PHE A CB  1 
ATOM   3900 C CG  . PHE A 1 495 ? -31.062 95.895  14.972 1.00 40.73  ? 495  PHE A CG  1 
ATOM   3901 C CD1 . PHE A 1 495 ? -29.831 95.493  14.453 1.00 39.05  ? 495  PHE A CD1 1 
ATOM   3902 C CD2 . PHE A 1 495 ? -31.353 97.262  15.017 1.00 40.81  ? 495  PHE A CD2 1 
ATOM   3903 C CE1 . PHE A 1 495 ? -28.907 96.437  13.987 1.00 39.23  ? 495  PHE A CE1 1 
ATOM   3904 C CE2 . PHE A 1 495 ? -30.431 98.215  14.552 1.00 38.85  ? 495  PHE A CE2 1 
ATOM   3905 C CZ  . PHE A 1 495 ? -29.209 97.799  14.037 1.00 38.17  ? 495  PHE A CZ  1 
ATOM   3906 N N   . THR A 1 496 ? -32.165 94.217  12.076 1.00 40.70  ? 496  THR A N   1 
ATOM   3907 C CA  . THR A 1 496 ? -31.334 93.771  10.966 1.00 42.78  ? 496  THR A CA  1 
ATOM   3908 C C   . THR A 1 496 ? -30.494 94.928  10.440 1.00 42.55  ? 496  THR A C   1 
ATOM   3909 O O   . THR A 1 496 ? -30.853 96.089  10.603 1.00 40.57  ? 496  THR A O   1 
ATOM   3910 C CB  . THR A 1 496 ? -32.182 93.214  9.804  1.00 44.07  ? 496  THR A CB  1 
ATOM   3911 O OG1 . THR A 1 496 ? -32.962 94.270  9.233  1.00 45.35  ? 496  THR A OG1 1 
ATOM   3912 C CG2 . THR A 1 496 ? -33.106 92.114  10.299 1.00 44.22  ? 496  THR A CG2 1 
ATOM   3913 N N   . THR A 1 497 ? -29.373 94.595  9.812  1.00 43.21  ? 497  THR A N   1 
ATOM   3914 C CA  . THR A 1 497 ? -28.471 95.587  9.253  1.00 44.47  ? 497  THR A CA  1 
ATOM   3915 C C   . THR A 1 497 ? -29.157 96.506  8.246  1.00 45.92  ? 497  THR A C   1 
ATOM   3916 O O   . THR A 1 497 ? -28.842 97.694  8.175  1.00 46.88  ? 497  THR A O   1 
ATOM   3917 C CB  . THR A 1 497 ? -27.274 94.904  8.560  1.00 45.50  ? 497  THR A CB  1 
ATOM   3918 O OG1 . THR A 1 497 ? -26.500 94.195  9.536  1.00 45.70  ? 497  THR A OG1 1 
ATOM   3919 C CG2 . THR A 1 497 ? -26.388 95.936  7.857  1.00 45.12  ? 497  THR A CG2 1 
ATOM   3920 N N   . LYS A 1 498 ? -30.087 95.964  7.466  1.00 46.63  ? 498  LYS A N   1 
ATOM   3921 C CA  . LYS A 1 498 ? -30.787 96.768  6.468  1.00 46.66  ? 498  LYS A CA  1 
ATOM   3922 C C   . LYS A 1 498 ? -31.891 97.641  7.042  1.00 46.09  ? 498  LYS A C   1 
ATOM   3923 O O   . LYS A 1 498 ? -31.816 98.868  6.965  1.00 45.53  ? 498  LYS A O   1 
ATOM   3924 C CB  . LYS A 1 498 ? -31.382 95.877  5.372  1.00 48.39  ? 498  LYS A CB  1 
ATOM   3925 C CG  . LYS A 1 498 ? -30.593 95.871  4.070  1.00 50.87  ? 498  LYS A CG  1 
ATOM   3926 C CD  . LYS A 1 498 ? -31.408 95.260  2.928  1.00 52.68  ? 498  LYS A CD  1 
ATOM   3927 C CE  . LYS A 1 498 ? -30.648 95.301  1.596  1.00 53.95  ? 498  LYS A CE  1 
ATOM   3928 N NZ  . LYS A 1 498 ? -31.451 94.765  0.452  1.00 52.44  ? 498  LYS A NZ  1 
ATOM   3929 N N   . GLU A 1 499 ? -32.915 97.002  7.607  1.00 45.89  ? 499  GLU A N   1 
ATOM   3930 C CA  . GLU A 1 499 ? -34.064 97.702  8.182  1.00 45.48  ? 499  GLU A CA  1 
ATOM   3931 C C   . GLU A 1 499 ? -33.779 98.358  9.540  1.00 44.04  ? 499  GLU A C   1 
ATOM   3932 O O   . GLU A 1 499 ? -34.449 99.316  9.923  1.00 42.79  ? 499  GLU A O   1 
ATOM   3933 C CB  . GLU A 1 499 ? -35.255 96.741  8.313  1.00 48.90  ? 499  GLU A CB  1 
ATOM   3934 C CG  . GLU A 1 499 ? -35.668 96.040  7.016  1.00 53.42  ? 499  GLU A CG  1 
ATOM   3935 C CD  . GLU A 1 499 ? -34.736 94.891  6.633  1.00 57.34  ? 499  GLU A CD  1 
ATOM   3936 O OE1 . GLU A 1 499 ? -34.633 93.911  7.405  1.00 58.80  ? 499  GLU A OE1 1 
ATOM   3937 O OE2 . GLU A 1 499 ? -34.106 94.963  5.554  1.00 60.17  ? 499  GLU A OE2 1 
ATOM   3938 N N   . GLN A 1 500 ? -32.794 97.833  10.266 1.00 43.20  ? 500  GLN A N   1 
ATOM   3939 C CA  . GLN A 1 500 ? -32.395 98.374  11.564 1.00 42.15  ? 500  GLN A CA  1 
ATOM   3940 C C   . GLN A 1 500 ? -33.576 98.759  12.457 1.00 41.79  ? 500  GLN A C   1 
ATOM   3941 O O   . GLN A 1 500 ? -33.583 99.829  13.069 1.00 41.04  ? 500  GLN A O   1 
ATOM   3942 C CB  . GLN A 1 500 ? -31.499 99.592  11.342 1.00 42.96  ? 500  GLN A CB  1 
ATOM   3943 C CG  . GLN A 1 500 ? -30.327 99.317  10.421 1.00 45.40  ? 500  GLN A CG  1 
ATOM   3944 C CD  . GLN A 1 500 ? -29.569 100.571 10.033 1.00 47.91  ? 500  GLN A CD  1 
ATOM   3945 O OE1 . GLN A 1 500 ? -28.722 100.544 9.141  1.00 48.66  ? 500  GLN A OE1 1 
ATOM   3946 N NE2 . GLN A 1 500 ? -29.868 101.677 10.702 1.00 49.55  ? 500  GLN A NE2 1 
ATOM   3947 N N   . LYS A 1 501 ? -34.560 97.872  12.552 1.00 41.78  ? 501  LYS A N   1 
ATOM   3948 C CA  . LYS A 1 501 ? -35.754 98.140  13.345 1.00 40.97  ? 501  LYS A CA  1 
ATOM   3949 C C   . LYS A 1 501 ? -35.586 97.976  14.851 1.00 40.05  ? 501  LYS A C   1 
ATOM   3950 O O   . LYS A 1 501 ? -34.727 97.218  15.324 1.00 38.30  ? 501  LYS A O   1 
ATOM   3951 C CB  . LYS A 1 501 ? -36.892 97.226  12.894 1.00 43.41  ? 501  LYS A CB  1 
ATOM   3952 C CG  . LYS A 1 501 ? -37.117 97.178  11.406 1.00 44.27  ? 501  LYS A CG  1 
ATOM   3953 C CD  . LYS A 1 501 ? -38.329 96.333  11.105 1.00 46.60  ? 501  LYS A CD  1 
ATOM   3954 C CE  . LYS A 1 501 ? -38.548 96.213  9.612  1.00 50.42  ? 501  LYS A CE  1 
ATOM   3955 N NZ  . LYS A 1 501 ? -39.708 95.328  9.315  1.00 53.83  ? 501  LYS A NZ  1 
ATOM   3956 N N   . PHE A 1 502 ? -36.428 98.697  15.592 1.00 38.19  ? 502  PHE A N   1 
ATOM   3957 C CA  . PHE A 1 502 ? -36.465 98.632  17.053 1.00 37.43  ? 502  PHE A CA  1 
ATOM   3958 C C   . PHE A 1 502 ? -37.839 99.098  17.516 1.00 37.79  ? 502  PHE A C   1 
ATOM   3959 O O   . PHE A 1 502 ? -38.604 99.674  16.739 1.00 38.48  ? 502  PHE A O   1 
ATOM   3960 C CB  . PHE A 1 502 ? -35.390 99.512  17.704 1.00 35.03  ? 502  PHE A CB  1 
ATOM   3961 C CG  . PHE A 1 502 ? -35.655 100.992 17.596 1.00 32.66  ? 502  PHE A CG  1 
ATOM   3962 C CD1 . PHE A 1 502 ? -35.307 101.697 16.446 1.00 32.01  ? 502  PHE A CD1 1 
ATOM   3963 C CD2 . PHE A 1 502 ? -36.218 101.687 18.661 1.00 31.17  ? 502  PHE A CD2 1 
ATOM   3964 C CE1 . PHE A 1 502 ? -35.509 103.076 16.362 1.00 31.63  ? 502  PHE A CE1 1 
ATOM   3965 C CE2 . PHE A 1 502 ? -36.426 103.061 18.590 1.00 30.41  ? 502  PHE A CE2 1 
ATOM   3966 C CZ  . PHE A 1 502 ? -36.069 103.759 17.438 1.00 31.25  ? 502  PHE A CZ  1 
ATOM   3967 N N   . ILE A 1 503 ? -38.145 98.847  18.782 1.00 38.08  ? 503  ILE A N   1 
ATOM   3968 C CA  . ILE A 1 503 ? -39.425 99.241  19.351 1.00 39.26  ? 503  ILE A CA  1 
ATOM   3969 C C   . ILE A 1 503 ? -39.211 100.029 20.632 1.00 41.41  ? 503  ILE A C   1 
ATOM   3970 O O   . ILE A 1 503 ? -38.146 99.950  21.253 1.00 41.27  ? 503  ILE A O   1 
ATOM   3971 C CB  . ILE A 1 503 ? -40.277 98.016  19.715 1.00 38.98  ? 503  ILE A CB  1 
ATOM   3972 C CG1 . ILE A 1 503 ? -39.524 97.153  20.728 1.00 38.50  ? 503  ILE A CG1 1 
ATOM   3973 C CG2 . ILE A 1 503 ? -40.595 97.224  18.476 1.00 38.31  ? 503  ILE A CG2 1 
ATOM   3974 C CD1 . ILE A 1 503 ? -40.347 96.059  21.345 1.00 41.08  ? 503  ILE A CD1 1 
ATOM   3975 N N   . ASP A 1 504 ? -40.227 100.789 21.028 1.00 43.81  ? 504  ASP A N   1 
ATOM   3976 C CA  . ASP A 1 504 ? -40.153 101.556 22.263 1.00 46.01  ? 504  ASP A CA  1 
ATOM   3977 C C   . ASP A 1 504 ? -40.857 100.771 23.375 1.00 45.83  ? 504  ASP A C   1 
ATOM   3978 O O   . ASP A 1 504 ? -41.668 99.885  23.099 1.00 45.55  ? 504  ASP A O   1 
ATOM   3979 C CB  . ASP A 1 504 ? -40.776 102.956 22.076 1.00 48.49  ? 504  ASP A CB  1 
ATOM   3980 C CG  . ASP A 1 504 ? -42.207 102.913 21.557 1.00 51.89  ? 504  ASP A CG  1 
ATOM   3981 O OD1 . ASP A 1 504 ? -42.713 103.984 21.139 1.00 52.31  ? 504  ASP A OD1 1 
ATOM   3982 O OD2 . ASP A 1 504 ? -42.829 101.824 21.574 1.00 53.29  ? 504  ASP A OD2 1 
ATOM   3983 N N   . LEU A 1 505 ? -40.525 101.075 24.627 1.00 45.38  ? 505  LEU A N   1 
ATOM   3984 C CA  . LEU A 1 505 ? -41.122 100.389 25.764 1.00 44.60  ? 505  LEU A CA  1 
ATOM   3985 C C   . LEU A 1 505 ? -41.859 101.328 26.701 1.00 46.07  ? 505  LEU A C   1 
ATOM   3986 O O   . LEU A 1 505 ? -41.243 102.089 27.456 1.00 47.29  ? 505  LEU A O   1 
ATOM   3987 C CB  . LEU A 1 505 ? -40.049 99.639  26.544 1.00 42.95  ? 505  LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 505 ? -39.628 98.323  25.910 1.00 42.75  ? 505  LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 505 ? -38.478 97.712  26.679 1.00 42.15  ? 505  LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 505 ? -40.826 97.393  25.901 1.00 43.22  ? 505  LEU A CD2 1 
ATOM   3991 N N   . ASN A 1 506 ? -43.184 101.271 26.655 1.00 46.42  ? 506  ASN A N   1 
ATOM   3992 C CA  . ASN A 1 506 ? -44.003 102.115 27.510 1.00 48.54  ? 506  ASN A CA  1 
ATOM   3993 C C   . ASN A 1 506 ? -45.415 101.554 27.651 1.00 49.94  ? 506  ASN A C   1 
ATOM   3994 O O   . ASN A 1 506 ? -45.707 100.457 27.169 1.00 49.90  ? 506  ASN A O   1 
ATOM   3995 C CB  . ASN A 1 506 ? -44.041 103.551 26.962 1.00 48.01  ? 506  ASN A CB  1 
ATOM   3996 C CG  . ASN A 1 506 ? -44.455 103.612 25.506 1.00 48.49  ? 506  ASN A CG  1 
ATOM   3997 O OD1 . ASN A 1 506 ? -45.537 103.160 25.136 1.00 50.44  ? 506  ASN A OD1 1 
ATOM   3998 N ND2 . ASN A 1 506 ? -43.593 104.175 24.669 1.00 47.38  ? 506  ASN A ND2 1 
ATOM   3999 N N   . THR A 1 507 ? -46.285 102.313 28.310 1.00 51.31  ? 507  THR A N   1 
ATOM   4000 C CA  . THR A 1 507 ? -47.660 101.889 28.534 1.00 52.85  ? 507  THR A CA  1 
ATOM   4001 C C   . THR A 1 507 ? -48.529 101.881 27.274 1.00 54.77  ? 507  THR A C   1 
ATOM   4002 O O   . THR A 1 507 ? -49.461 101.085 27.166 1.00 55.30  ? 507  THR A O   1 
ATOM   4003 C CB  . THR A 1 507 ? -48.328 102.768 29.596 1.00 51.84  ? 507  THR A CB  1 
ATOM   4004 O OG1 . THR A 1 507 ? -48.365 104.123 29.138 1.00 50.33  ? 507  THR A OG1 1 
ATOM   4005 C CG2 . THR A 1 507 ? -47.548 102.687 30.904 1.00 51.46  ? 507  THR A CG2 1 
ATOM   4006 N N   . GLU A 1 508 ? -48.233 102.761 26.323 1.00 55.97  ? 508  GLU A N   1 
ATOM   4007 C CA  . GLU A 1 508 ? -49.006 102.807 25.087 1.00 56.79  ? 508  GLU A CA  1 
ATOM   4008 C C   . GLU A 1 508 ? -48.800 101.518 24.287 1.00 55.89  ? 508  GLU A C   1 
ATOM   4009 O O   . GLU A 1 508 ? -48.013 100.654 24.679 1.00 56.27  ? 508  GLU A O   1 
ATOM   4010 C CB  . GLU A 1 508 ? -48.582 104.004 24.231 1.00 59.35  ? 508  GLU A CB  1 
ATOM   4011 C CG  . GLU A 1 508 ? -48.917 105.365 24.812 1.00 63.69  ? 508  GLU A CG  1 
ATOM   4012 C CD  . GLU A 1 508 ? -48.746 106.482 23.791 1.00 67.65  ? 508  GLU A CD  1 
ATOM   4013 O OE1 . GLU A 1 508 ? -48.862 107.668 24.171 1.00 70.60  ? 508  GLU A OE1 1 
ATOM   4014 O OE2 . GLU A 1 508 ? -48.500 106.175 22.602 1.00 69.63  ? 508  GLU A OE2 1 
ATOM   4015 N N   . PRO A 1 509 ? -49.527 101.362 23.165 1.00 54.84  ? 509  PRO A N   1 
ATOM   4016 C CA  . PRO A 1 509 ? -49.394 100.165 22.329 1.00 54.03  ? 509  PRO A CA  1 
ATOM   4017 C C   . PRO A 1 509 ? -48.033 100.162 21.637 1.00 53.88  ? 509  PRO A C   1 
ATOM   4018 O O   . PRO A 1 509 ? -47.528 101.218 21.258 1.00 54.88  ? 509  PRO A O   1 
ATOM   4019 C CB  . PRO A 1 509 ? -50.535 100.320 21.331 1.00 53.16  ? 509  PRO A CB  1 
ATOM   4020 C CG  . PRO A 1 509 ? -51.553 101.098 22.096 1.00 52.20  ? 509  PRO A CG  1 
ATOM   4021 C CD  . PRO A 1 509 ? -50.712 102.138 22.762 1.00 54.00  ? 509  PRO A CD  1 
ATOM   4022 N N   . MET A 1 510 ? -47.442 98.986  21.463 1.00 52.60  ? 510  MET A N   1 
ATOM   4023 C CA  . MET A 1 510 ? -46.139 98.904  20.816 1.00 52.11  ? 510  MET A CA  1 
ATOM   4024 C C   . MET A 1 510 ? -46.088 99.631  19.472 1.00 51.82  ? 510  MET A C   1 
ATOM   4025 O O   . MET A 1 510 ? -47.088 99.713  18.759 1.00 52.28  ? 510  MET A O   1 
ATOM   4026 C CB  . MET A 1 510 ? -45.737 97.447  20.594 1.00 52.04  ? 510  MET A CB  1 
ATOM   4027 C CG  . MET A 1 510 ? -44.395 97.301  19.888 1.00 53.78  ? 510  MET A CG  1 
ATOM   4028 S SD  . MET A 1 510 ? -44.065 95.635  19.287 1.00 56.06  ? 510  MET A SD  1 
ATOM   4029 C CE  . MET A 1 510 ? -43.532 94.837  20.800 1.00 54.39  ? 510  MET A CE  1 
ATOM   4030 N N   . LYS A 1 511 ? -44.912 100.163 19.148 1.00 50.67  ? 511  LYS A N   1 
ATOM   4031 C CA  . LYS A 1 511 ? -44.667 100.860 17.887 1.00 49.63  ? 511  LYS A CA  1 
ATOM   4032 C C   . LYS A 1 511 ? -43.271 100.484 17.410 1.00 49.89  ? 511  LYS A C   1 
ATOM   4033 O O   . LYS A 1 511 ? -42.356 100.307 18.221 1.00 51.64  ? 511  LYS A O   1 
ATOM   4034 C CB  . LYS A 1 511 ? -44.729 102.378 18.057 1.00 48.28  ? 511  LYS A CB  1 
ATOM   4035 C CG  . LYS A 1 511 ? -46.121 102.961 18.117 1.00 49.99  ? 511  LYS A CG  1 
ATOM   4036 C CD  . LYS A 1 511 ? -46.072 104.451 17.822 1.00 51.01  ? 511  LYS A CD  1 
ATOM   4037 C CE  . LYS A 1 511 ? -47.455 105.075 17.820 1.00 50.54  ? 511  LYS A CE  1 
ATOM   4038 N NZ  . LYS A 1 511 ? -48.044 105.096 19.182 1.00 52.13  ? 511  LYS A NZ  1 
ATOM   4039 N N   . VAL A 1 512 ? -43.103 100.363 16.097 1.00 47.72  ? 512  VAL A N   1 
ATOM   4040 C CA  . VAL A 1 512 ? -41.807 100.015 15.537 1.00 44.09  ? 512  VAL A CA  1 
ATOM   4041 C C   . VAL A 1 512 ? -41.177 101.228 14.858 1.00 44.33  ? 512  VAL A C   1 
ATOM   4042 O O   . VAL A 1 512 ? -41.845 101.975 14.137 1.00 44.04  ? 512  VAL A O   1 
ATOM   4043 C CB  . VAL A 1 512 ? -41.936 98.860  14.522 1.00 41.19  ? 512  VAL A CB  1 
ATOM   4044 C CG1 . VAL A 1 512 ? -40.593 98.576  13.861 1.00 39.01  ? 512  VAL A CG1 1 
ATOM   4045 C CG2 . VAL A 1 512 ? -42.435 97.626  15.229 1.00 38.92  ? 512  VAL A CG2 1 
ATOM   4046 N N   . HIS A 1 513 ? -39.886 101.422 15.105 1.00 43.10  ? 513  HIS A N   1 
ATOM   4047 C CA  . HIS A 1 513 ? -39.158 102.538 14.524 1.00 41.72  ? 513  HIS A CA  1 
ATOM   4048 C C   . HIS A 1 513 ? -37.904 101.989 13.858 1.00 41.54  ? 513  HIS A C   1 
ATOM   4049 O O   . HIS A 1 513 ? -37.655 100.777 13.882 1.00 41.52  ? 513  HIS A O   1 
ATOM   4050 C CB  . HIS A 1 513 ? -38.758 103.540 15.613 1.00 41.94  ? 513  HIS A CB  1 
ATOM   4051 C CG  . HIS A 1 513 ? -39.894 103.990 16.481 1.00 41.55  ? 513  HIS A CG  1 
ATOM   4052 N ND1 . HIS A 1 513 ? -40.860 104.873 16.050 1.00 40.61  ? 513  HIS A ND1 1 
ATOM   4053 C CD2 . HIS A 1 513 ? -40.216 103.676 17.760 1.00 42.35  ? 513  HIS A CD2 1 
ATOM   4054 C CE1 . HIS A 1 513 ? -41.728 105.084 17.024 1.00 41.03  ? 513  HIS A CE1 1 
ATOM   4055 N NE2 . HIS A 1 513 ? -41.360 104.370 18.072 1.00 42.47  ? 513  HIS A NE2 1 
ATOM   4056 N N   . GLN A 1 514 ? -37.109 102.888 13.283 1.00 41.21  ? 514  GLN A N   1 
ATOM   4057 C CA  . GLN A 1 514 ? -35.879 102.501 12.607 1.00 41.33  ? 514  GLN A CA  1 
ATOM   4058 C C   . GLN A 1 514 ? -34.761 103.525 12.751 1.00 40.50  ? 514  GLN A C   1 
ATOM   4059 O O   . GLN A 1 514 ? -35.011 104.723 12.879 1.00 40.18  ? 514  GLN A O   1 
ATOM   4060 C CB  . GLN A 1 514 ? -36.157 102.273 11.124 1.00 42.60  ? 514  GLN A CB  1 
ATOM   4061 C CG  . GLN A 1 514 ? -37.019 101.066 10.848 1.00 46.71  ? 514  GLN A CG  1 
ATOM   4062 C CD  . GLN A 1 514 ? -37.459 100.992 9.405  1.00 48.96  ? 514  GLN A CD  1 
ATOM   4063 O OE1 . GLN A 1 514 ? -38.252 101.812 8.942  1.00 50.02  ? 514  GLN A OE1 1 
ATOM   4064 N NE2 . GLN A 1 514 ? -36.940 100.008 8.678  1.00 51.06  ? 514  GLN A NE2 1 
ATOM   4065 N N   . ARG A 1 515 ? -33.524 103.037 12.729 1.00 39.29  ? 515  ARG A N   1 
ATOM   4066 C CA  . ARG A 1 515 ? -32.348 103.891 12.828 1.00 38.01  ? 515  ARG A CA  1 
ATOM   4067 C C   . ARG A 1 515 ? -32.366 104.833 14.033 1.00 35.68  ? 515  ARG A C   1 
ATOM   4068 O O   . ARG A 1 515 ? -32.465 106.050 13.891 1.00 34.90  ? 515  ARG A O   1 
ATOM   4069 C CB  . ARG A 1 515 ? -32.201 104.678 11.523 1.00 40.30  ? 515  ARG A CB  1 
ATOM   4070 C CG  . ARG A 1 515 ? -32.037 103.764 10.319 1.00 45.18  ? 515  ARG A CG  1 
ATOM   4071 C CD  . ARG A 1 515 ? -31.944 104.505 9.005  1.00 49.17  ? 515  ARG A CD  1 
ATOM   4072 N NE  . ARG A 1 515 ? -31.456 103.624 7.943  1.00 56.08  ? 515  ARG A NE  1 
ATOM   4073 C CZ  . ARG A 1 515 ? -30.811 104.040 6.855  1.00 58.54  ? 515  ARG A CZ  1 
ATOM   4074 N NH1 . ARG A 1 515 ? -31.484 104.572 5.837  1.00 58.81  ? 515  ARG A NH1 1 
ATOM   4075 N NH2 . ARG A 1 515 ? -29.488 103.938 6.789  1.00 59.08  ? 515  ARG A NH2 1 
ATOM   4076 N N   . LEU A 1 516 ? -32.249 104.247 15.220 1.00 32.93  ? 516  LEU A N   1 
ATOM   4077 C CA  . LEU A 1 516 ? -32.251 104.991 16.472 1.00 31.14  ? 516  LEU A CA  1 
ATOM   4078 C C   . LEU A 1 516 ? -31.188 106.088 16.496 1.00 29.67  ? 516  LEU A C   1 
ATOM   4079 O O   . LEU A 1 516 ? -29.997 105.810 16.388 1.00 31.01  ? 516  LEU A O   1 
ATOM   4080 C CB  . LEU A 1 516 ? -32.053 104.011 17.630 1.00 30.11  ? 516  LEU A CB  1 
ATOM   4081 C CG  . LEU A 1 516 ? -31.848 104.508 19.059 1.00 31.06  ? 516  LEU A CG  1 
ATOM   4082 C CD1 . LEU A 1 516 ? -32.701 105.733 19.365 1.00 29.74  ? 516  LEU A CD1 1 
ATOM   4083 C CD2 . LEU A 1 516 ? -32.182 103.351 19.989 1.00 30.25  ? 516  LEU A CD2 1 
ATOM   4084 N N   . ARG A 1 517 ? -31.648 107.331 16.634 1.00 29.17  ? 517  ARG A N   1 
ATOM   4085 C CA  . ARG A 1 517 ? -30.804 108.527 16.657 1.00 27.84  ? 517  ARG A CA  1 
ATOM   4086 C C   . ARG A 1 517 ? -29.658 108.461 15.647 1.00 28.35  ? 517  ARG A C   1 
ATOM   4087 O O   . ARG A 1 517 ? -28.546 108.953 15.881 1.00 28.99  ? 517  ARG A O   1 
ATOM   4088 C CB  . ARG A 1 517 ? -30.285 108.769 18.076 1.00 27.87  ? 517  ARG A CB  1 
ATOM   4089 C CG  . ARG A 1 517 ? -31.409 109.076 19.055 1.00 28.32  ? 517  ARG A CG  1 
ATOM   4090 C CD  . ARG A 1 517 ? -30.905 109.664 20.354 1.00 31.60  ? 517  ARG A CD  1 
ATOM   4091 N NE  . ARG A 1 517 ? -30.348 111.009 20.206 1.00 32.98  ? 517  ARG A NE  1 
ATOM   4092 C CZ  . ARG A 1 517 ? -31.062 112.102 19.941 1.00 34.12  ? 517  ARG A CZ  1 
ATOM   4093 N NH1 . ARG A 1 517 ? -32.377 112.026 19.786 1.00 30.80  ? 517  ARG A NH1 1 
ATOM   4094 N NH2 . ARG A 1 517 ? -30.455 113.280 19.846 1.00 34.92  ? 517  ARG A NH2 1 
ATOM   4095 N N   . VAL A 1 518 ? -29.963 107.861 14.504 1.00 26.28  ? 518  VAL A N   1 
ATOM   4096 C CA  . VAL A 1 518 ? -29.006 107.682 13.433 1.00 25.83  ? 518  VAL A CA  1 
ATOM   4097 C C   . VAL A 1 518 ? -28.219 108.942 13.075 1.00 27.53  ? 518  VAL A C   1 
ATOM   4098 O O   . VAL A 1 518 ? -27.005 108.878 12.838 1.00 24.99  ? 518  VAL A O   1 
ATOM   4099 C CB  . VAL A 1 518 ? -29.720 107.175 12.171 1.00 24.61  ? 518  VAL A CB  1 
ATOM   4100 C CG1 . VAL A 1 518 ? -30.885 108.092 11.838 1.00 24.76  ? 518  VAL A CG1 1 
ATOM   4101 C CG2 . VAL A 1 518 ? -28.744 107.104 11.008 1.00 24.58  ? 518  VAL A CG2 1 
ATOM   4102 N N   . GLN A 1 519 ? -28.913 110.081 13.031 1.00 27.25  ? 519  GLN A N   1 
ATOM   4103 C CA  . GLN A 1 519 ? -28.277 111.341 12.665 1.00 25.76  ? 519  GLN A CA  1 
ATOM   4104 C C   . GLN A 1 519 ? -27.178 111.731 13.643 1.00 25.91  ? 519  GLN A C   1 
ATOM   4105 O O   . GLN A 1 519 ? -26.026 111.934 13.256 1.00 24.00  ? 519  GLN A O   1 
ATOM   4106 C CB  . GLN A 1 519 ? -29.310 112.466 12.596 1.00 24.48  ? 519  GLN A CB  1 
ATOM   4107 C CG  . GLN A 1 519 ? -28.808 113.692 11.863 1.00 21.85  ? 519  GLN A CG  1 
ATOM   4108 C CD  . GLN A 1 519 ? -28.736 113.466 10.361 1.00 23.23  ? 519  GLN A CD  1 
ATOM   4109 O OE1 . GLN A 1 519 ? -27.853 113.992 9.672  1.00 22.57  ? 519  GLN A OE1 1 
ATOM   4110 N NE2 . GLN A 1 519 ? -29.680 112.688 9.842  1.00 22.80  ? 519  GLN A NE2 1 
ATOM   4111 N N   . MET A 1 520 ? -27.535 111.839 14.914 1.00 25.24  ? 520  MET A N   1 
ATOM   4112 C CA  . MET A 1 520 ? -26.550 112.218 15.900 1.00 26.38  ? 520  MET A CA  1 
ATOM   4113 C C   . MET A 1 520 ? -25.447 111.180 16.020 1.00 26.58  ? 520  MET A C   1 
ATOM   4114 O O   . MET A 1 520 ? -24.304 111.523 16.291 1.00 26.94  ? 520  MET A O   1 
ATOM   4115 C CB  . MET A 1 520 ? -27.216 112.456 17.254 1.00 27.31  ? 520  MET A CB  1 
ATOM   4116 C CG  . MET A 1 520 ? -28.115 113.701 17.296 1.00 31.79  ? 520  MET A CG  1 
ATOM   4117 S SD  . MET A 1 520 ? -27.269 115.239 16.782 1.00 36.18  ? 520  MET A SD  1 
ATOM   4118 C CE  . MET A 1 520 ? -27.898 115.436 15.127 1.00 35.48  ? 520  MET A CE  1 
ATOM   4119 N N   . CYS A 1 521 ? -25.770 109.912 15.793 1.00 26.43  ? 521  CYS A N   1 
ATOM   4120 C CA  . CYS A 1 521 ? -24.749 108.884 15.910 1.00 27.46  ? 521  CYS A CA  1 
ATOM   4121 C C   . CYS A 1 521 ? -23.705 108.905 14.797 1.00 28.38  ? 521  CYS A C   1 
ATOM   4122 O O   . CYS A 1 521 ? -22.565 108.468 14.999 1.00 27.83  ? 521  CYS A O   1 
ATOM   4123 C CB  . CYS A 1 521 ? -25.397 107.509 16.026 1.00 27.72  ? 521  CYS A CB  1 
ATOM   4124 S SG  . CYS A 1 521 ? -26.221 107.307 17.635 1.00 29.59  ? 521  CYS A SG  1 
ATOM   4125 N N   . VAL A 1 522 ? -24.077 109.410 13.623 1.00 28.57  ? 522  VAL A N   1 
ATOM   4126 C CA  . VAL A 1 522 ? -23.110 109.512 12.540 1.00 28.17  ? 522  VAL A CA  1 
ATOM   4127 C C   . VAL A 1 522 ? -22.124 110.561 13.021 1.00 29.61  ? 522  VAL A C   1 
ATOM   4128 O O   . VAL A 1 522 ? -20.923 110.472 12.774 1.00 32.25  ? 522  VAL A O   1 
ATOM   4129 C CB  . VAL A 1 522 ? -23.735 110.011 11.234 1.00 28.16  ? 522  VAL A CB  1 
ATOM   4130 C CG1 . VAL A 1 522 ? -22.645 110.191 10.185 1.00 28.57  ? 522  VAL A CG1 1 
ATOM   4131 C CG2 . VAL A 1 522 ? -24.782 109.025 10.747 1.00 28.96  ? 522  VAL A CG2 1 
ATOM   4132 N N   . PHE A 1 523 ? -22.641 111.561 13.723 1.00 27.93  ? 523  PHE A N   1 
ATOM   4133 C CA  . PHE A 1 523 ? -21.780 112.597 14.242 1.00 26.71  ? 523  PHE A CA  1 
ATOM   4134 C C   . PHE A 1 523 ? -20.807 112.036 15.281 1.00 26.67  ? 523  PHE A C   1 
ATOM   4135 O O   . PHE A 1 523 ? -19.598 112.252 15.187 1.00 28.13  ? 523  PHE A O   1 
ATOM   4136 C CB  . PHE A 1 523 ? -22.595 113.722 14.887 1.00 23.86  ? 523  PHE A CB  1 
ATOM   4137 C CG  . PHE A 1 523 ? -21.746 114.720 15.601 1.00 20.19  ? 523  PHE A CG  1 
ATOM   4138 C CD1 . PHE A 1 523 ? -21.067 115.700 14.895 1.00 20.50  ? 523  PHE A CD1 1 
ATOM   4139 C CD2 . PHE A 1 523 ? -21.551 114.628 16.972 1.00 19.83  ? 523  PHE A CD2 1 
ATOM   4140 C CE1 . PHE A 1 523 ? -20.195 116.579 15.546 1.00 21.87  ? 523  PHE A CE1 1 
ATOM   4141 C CE2 . PHE A 1 523 ? -20.685 115.498 17.633 1.00 20.46  ? 523  PHE A CE2 1 
ATOM   4142 C CZ  . PHE A 1 523 ? -20.005 116.475 16.917 1.00 21.12  ? 523  PHE A CZ  1 
ATOM   4143 N N   . TRP A 1 524 ? -21.324 111.317 16.271 1.00 25.87  ? 524  TRP A N   1 
ATOM   4144 C CA  . TRP A 1 524 ? -20.456 110.786 17.318 1.00 27.96  ? 524  TRP A CA  1 
ATOM   4145 C C   . TRP A 1 524 ? -19.565 109.616 16.915 1.00 29.21  ? 524  TRP A C   1 
ATOM   4146 O O   . TRP A 1 524 ? -18.419 109.538 17.360 1.00 30.82  ? 524  TRP A O   1 
ATOM   4147 C CB  . TRP A 1 524 ? -21.269 110.385 18.561 1.00 26.15  ? 524  TRP A CB  1 
ATOM   4148 C CG  . TRP A 1 524 ? -21.937 111.538 19.268 1.00 25.42  ? 524  TRP A CG  1 
ATOM   4149 C CD1 . TRP A 1 524 ? -23.264 111.830 19.274 1.00 23.94  ? 524  TRP A CD1 1 
ATOM   4150 C CD2 . TRP A 1 524 ? -21.302 112.550 20.067 1.00 26.81  ? 524  TRP A CD2 1 
ATOM   4151 N NE1 . TRP A 1 524 ? -23.507 112.958 20.024 1.00 23.11  ? 524  TRP A NE1 1 
ATOM   4152 C CE2 . TRP A 1 524 ? -22.322 113.422 20.524 1.00 25.04  ? 524  TRP A CE2 1 
ATOM   4153 C CE3 . TRP A 1 524 ? -19.972 112.807 20.442 1.00 27.66  ? 524  TRP A CE3 1 
ATOM   4154 C CZ2 . TRP A 1 524 ? -22.057 114.534 21.340 1.00 24.59  ? 524  TRP A CZ2 1 
ATOM   4155 C CZ3 . TRP A 1 524 ? -19.705 113.923 21.258 1.00 27.04  ? 524  TRP A CZ3 1 
ATOM   4156 C CH2 . TRP A 1 524 ? -20.748 114.768 21.695 1.00 26.13  ? 524  TRP A CH2 1 
ATOM   4157 N N   . ASN A 1 525 ? -20.065 108.720 16.067 1.00 29.29  ? 525  ASN A N   1 
ATOM   4158 C CA  . ASN A 1 525 ? -19.286 107.550 15.680 1.00 28.55  ? 525  ASN A CA  1 
ATOM   4159 C C   . ASN A 1 525 ? -18.325 107.681 14.514 1.00 29.36  ? 525  ASN A C   1 
ATOM   4160 O O   . ASN A 1 525 ? -17.276 107.045 14.512 1.00 30.37  ? 525  ASN A O   1 
ATOM   4161 C CB  . ASN A 1 525 ? -20.215 106.368 15.433 1.00 27.23  ? 525  ASN A CB  1 
ATOM   4162 C CG  . ASN A 1 525 ? -21.023 106.014 16.658 1.00 27.94  ? 525  ASN A CG  1 
ATOM   4163 O OD1 . ASN A 1 525 ? -20.608 106.288 17.790 1.00 25.74  ? 525  ASN A OD1 1 
ATOM   4164 N ND2 . ASN A 1 525 ? -22.179 105.393 16.446 1.00 28.15  ? 525  ASN A ND2 1 
ATOM   4165 N N   . GLN A 1 526 ? -18.662 108.495 13.526 1.00 30.32  ? 526  GLN A N   1 
ATOM   4166 C CA  . GLN A 1 526 ? -17.783 108.660 12.375 1.00 31.45  ? 526  GLN A CA  1 
ATOM   4167 C C   . GLN A 1 526 ? -17.049 109.989 12.303 1.00 30.97  ? 526  GLN A C   1 
ATOM   4168 O O   . GLN A 1 526 ? -15.819 110.034 12.349 1.00 30.83  ? 526  GLN A O   1 
ATOM   4169 C CB  . GLN A 1 526 ? -18.567 108.494 11.083 1.00 33.80  ? 526  GLN A CB  1 
ATOM   4170 C CG  . GLN A 1 526 ? -19.003 107.098 10.795 1.00 41.21  ? 526  GLN A CG  1 
ATOM   4171 C CD  . GLN A 1 526 ? -19.910 107.049 9.593  1.00 48.28  ? 526  GLN A CD  1 
ATOM   4172 O OE1 . GLN A 1 526 ? -19.603 107.622 8.539  1.00 51.77  ? 526  GLN A OE1 1 
ATOM   4173 N NE2 . GLN A 1 526 ? -21.041 106.364 9.735  1.00 51.49  ? 526  GLN A NE2 1 
ATOM   4174 N N   . PHE A 1 527 ? -17.816 111.067 12.189 1.00 29.52  ? 527  PHE A N   1 
ATOM   4175 C CA  . PHE A 1 527 ? -17.257 112.402 12.043 1.00 29.06  ? 527  PHE A CA  1 
ATOM   4176 C C   . PHE A 1 527 ? -16.342 112.934 13.135 1.00 29.50  ? 527  PHE A C   1 
ATOM   4177 O O   . PHE A 1 527 ? -15.162 113.190 12.892 1.00 31.03  ? 527  PHE A O   1 
ATOM   4178 C CB  . PHE A 1 527 ? -18.376 113.408 11.820 1.00 27.89  ? 527  PHE A CB  1 
ATOM   4179 C CG  . PHE A 1 527 ? -17.886 114.767 11.456 1.00 25.06  ? 527  PHE A CG  1 
ATOM   4180 C CD1 . PHE A 1 527 ? -17.296 114.993 10.217 1.00 25.11  ? 527  PHE A CD1 1 
ATOM   4181 C CD2 . PHE A 1 527 ? -17.972 115.816 12.362 1.00 23.14  ? 527  PHE A CD2 1 
ATOM   4182 C CE1 . PHE A 1 527 ? -16.792 116.255 9.882  1.00 25.39  ? 527  PHE A CE1 1 
ATOM   4183 C CE2 . PHE A 1 527 ? -17.475 117.075 12.043 1.00 24.30  ? 527  PHE A CE2 1 
ATOM   4184 C CZ  . PHE A 1 527 ? -16.881 117.295 10.798 1.00 23.21  ? 527  PHE A CZ  1 
ATOM   4185 N N   . LEU A 1 528 ? -16.885 113.128 14.330 1.00 28.93  ? 528  LEU A N   1 
ATOM   4186 C CA  . LEU A 1 528 ? -16.091 113.667 15.426 1.00 28.16  ? 528  LEU A CA  1 
ATOM   4187 C C   . LEU A 1 528 ? -14.807 112.877 15.670 1.00 28.50  ? 528  LEU A C   1 
ATOM   4188 O O   . LEU A 1 528 ? -13.743 113.456 15.897 1.00 29.01  ? 528  LEU A O   1 
ATOM   4189 C CB  . LEU A 1 528 ? -16.921 113.725 16.712 1.00 25.69  ? 528  LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 528 ? -16.170 114.344 17.898 1.00 26.17  ? 528  LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 528 ? -15.792 115.769 17.553 1.00 22.19  ? 528  LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 528 ? -17.023 114.287 19.171 1.00 24.28  ? 528  LEU A CD2 1 
ATOM   4193 N N   . PRO A 1 529 ? -14.889 111.541 15.648 1.00 28.87  ? 529  PRO A N   1 
ATOM   4194 C CA  . PRO A 1 529 ? -13.660 110.785 15.878 1.00 29.61  ? 529  PRO A CA  1 
ATOM   4195 C C   . PRO A 1 529 ? -12.605 111.166 14.842 1.00 30.08  ? 529  PRO A C   1 
ATOM   4196 O O   . PRO A 1 529 ? -11.425 111.294 15.165 1.00 30.79  ? 529  PRO A O   1 
ATOM   4197 C CB  . PRO A 1 529 ? -14.124 109.341 15.744 1.00 28.67  ? 529  PRO A CB  1 
ATOM   4198 C CG  . PRO A 1 529 ? -15.522 109.405 16.266 1.00 27.43  ? 529  PRO A CG  1 
ATOM   4199 C CD  . PRO A 1 529 ? -16.051 110.637 15.586 1.00 29.88  ? 529  PRO A CD  1 
ATOM   4200 N N   . LYS A 1 530 ? -13.047 111.358 13.601 1.00 29.19  ? 530  LYS A N   1 
ATOM   4201 C CA  . LYS A 1 530 ? -12.157 111.728 12.508 1.00 30.21  ? 530  LYS A CA  1 
ATOM   4202 C C   . LYS A 1 530 ? -11.603 113.142 12.702 1.00 32.17  ? 530  LYS A C   1 
ATOM   4203 O O   . LYS A 1 530 ? -10.401 113.386 12.534 1.00 31.62  ? 530  LYS A O   1 
ATOM   4204 C CB  . LYS A 1 530 ? -12.904 111.639 11.175 1.00 28.03  ? 530  LYS A CB  1 
ATOM   4205 C CG  . LYS A 1 530 ? -12.087 112.110 9.992  1.00 30.39  ? 530  LYS A CG  1 
ATOM   4206 C CD  . LYS A 1 530 ? -12.702 111.691 8.665  1.00 32.08  ? 530  LYS A CD  1 
ATOM   4207 C CE  . LYS A 1 530 ? -11.775 112.026 7.494  1.00 31.98  ? 530  LYS A CE  1 
ATOM   4208 N NZ  . LYS A 1 530 ? -12.219 111.364 6.235  1.00 31.68  ? 530  LYS A NZ  1 
ATOM   4209 N N   . LEU A 1 531 ? -12.491 114.062 13.062 1.00 32.25  ? 531  LEU A N   1 
ATOM   4210 C CA  . LEU A 1 531 ? -12.122 115.444 13.288 1.00 33.33  ? 531  LEU A CA  1 
ATOM   4211 C C   . LEU A 1 531 ? -11.049 115.553 14.362 1.00 35.65  ? 531  LEU A C   1 
ATOM   4212 O O   . LEU A 1 531 ? -10.067 116.270 14.193 1.00 35.73  ? 531  LEU A O   1 
ATOM   4213 C CB  . LEU A 1 531 ? -13.357 116.238 13.696 1.00 32.02  ? 531  LEU A CB  1 
ATOM   4214 C CG  . LEU A 1 531 ? -13.160 117.732 13.946 1.00 32.22  ? 531  LEU A CG  1 
ATOM   4215 C CD1 . LEU A 1 531 ? -14.504 118.444 13.829 1.00 30.63  ? 531  LEU A CD1 1 
ATOM   4216 C CD2 . LEU A 1 531 ? -12.536 117.957 15.316 1.00 28.97  ? 531  LEU A CD2 1 
ATOM   4217 N N   . LEU A 1 532 ? -11.234 114.842 15.468 1.00 38.74  ? 532  LEU A N   1 
ATOM   4218 C CA  . LEU A 1 532 ? -10.269 114.878 16.558 1.00 41.54  ? 532  LEU A CA  1 
ATOM   4219 C C   . LEU A 1 532 ? -8.945  114.235 16.169 1.00 44.80  ? 532  LEU A C   1 
ATOM   4220 O O   . LEU A 1 532 ? -7.887  114.644 16.647 1.00 45.30  ? 532  LEU A O   1 
ATOM   4221 C CB  . LEU A 1 532 ? -10.846 114.188 17.788 1.00 39.26  ? 532  LEU A CB  1 
ATOM   4222 C CG  . LEU A 1 532 ? -12.017 114.961 18.402 1.00 39.81  ? 532  LEU A CG  1 
ATOM   4223 C CD1 . LEU A 1 532 ? -12.595 114.158 19.551 1.00 38.13  ? 532  LEU A CD1 1 
ATOM   4224 C CD2 . LEU A 1 532 ? -11.550 116.342 18.877 1.00 34.36  ? 532  LEU A CD2 1 
ATOM   4225 N N   . ASN A 1 533 ? -9.003  113.235 15.295 1.00 48.41  ? 533  ASN A N   1 
ATOM   4226 C CA  . ASN A 1 533 ? -7.797  112.554 14.839 1.00 52.12  ? 533  ASN A CA  1 
ATOM   4227 C C   . ASN A 1 533 ? -6.970  113.497 13.959 1.00 55.51  ? 533  ASN A C   1 
ATOM   4228 O O   . ASN A 1 533 ? -5.788  113.730 14.217 1.00 56.62  ? 533  ASN A O   1 
ATOM   4229 C CB  . ASN A 1 533 ? -8.180  111.293 14.060 1.00 52.77  ? 533  ASN A CB  1 
ATOM   4230 C CG  . ASN A 1 533 ? -6.981  110.587 13.453 1.00 53.77  ? 533  ASN A CG  1 
ATOM   4231 O OD1 . ASN A 1 533 ? -6.413  111.045 12.461 1.00 54.39  ? 533  ASN A OD1 1 
ATOM   4232 N ND2 . ASN A 1 533 ? -6.590  109.464 14.046 1.00 54.80  ? 533  ASN A ND2 1 
ATOM   4233 N N   . ALA A 1 534 ? -7.604  114.050 12.930 1.00 58.28  ? 534  ALA A N   1 
ATOM   4234 C CA  . ALA A 1 534 ? -6.939  114.965 12.011 1.00 60.65  ? 534  ALA A CA  1 
ATOM   4235 C C   . ALA A 1 534 ? -6.382  116.211 12.692 1.00 63.91  ? 534  ALA A C   1 
ATOM   4236 O O   . ALA A 1 534 ? -5.218  116.556 12.498 1.00 64.13  ? 534  ALA A O   1 
ATOM   4237 C CB  . ALA A 1 534 ? -7.901  115.372 10.908 1.00 60.35  ? 534  ALA A CB  1 
ATOM   4238 N N   . THR A 1 535 ? -7.214  116.884 13.486 1.00 68.58  ? 535  THR A N   1 
ATOM   4239 C CA  . THR A 1 535 ? -6.809  118.113 14.182 1.00 72.46  ? 535  THR A CA  1 
ATOM   4240 C C   . THR A 1 535 ? -6.285  117.918 15.607 1.00 75.90  ? 535  THR A C   1 
ATOM   4241 O O   . THR A 1 535 ? -6.963  118.242 16.587 1.00 77.05  ? 535  THR A O   1 
ATOM   4242 C CB  . THR A 1 535 ? -7.969  119.136 14.248 1.00 71.33  ? 535  THR A CB  1 
ATOM   4243 O OG1 . THR A 1 535 ? -9.040  118.605 15.037 1.00 69.40  ? 535  THR A OG1 1 
ATOM   4244 C CG2 . THR A 1 535 ? -8.477  119.449 12.852 1.00 71.51  ? 535  THR A CG2 1 
ATOM   4245 N N   . ALA A 1 536 ? -5.069  117.397 15.714 1.00 78.75  ? 536  ALA A N   1 
ATOM   4246 C CA  . ALA A 1 536 ? -4.433  117.171 17.006 1.00 80.75  ? 536  ALA A CA  1 
ATOM   4247 C C   . ALA A 1 536 ? -2.969  116.821 16.755 1.00 82.08  ? 536  ALA A C   1 
ATOM   4248 O O   . ALA A 1 536 ? -2.095  117.452 17.393 1.00 83.07  ? 536  ALA A O   1 
ATOM   4249 C CB  . ALA A 1 536 ? -5.139  116.041 17.762 1.00 79.80  ? 536  ALA A CB  1 
HETATM 4250 C C1  . NAG B 2 .   ? -48.370 103.878 49.104 1.00 73.54  ? 1    NAG B C1  1 
HETATM 4251 C C2  . NAG B 2 .   ? -48.842 104.819 50.222 1.00 76.54  ? 1    NAG B C2  1 
HETATM 4252 C C3  . NAG B 2 .   ? -47.714 105.735 50.751 1.00 79.49  ? 1    NAG B C3  1 
HETATM 4253 C C4  . NAG B 2 .   ? -46.368 105.005 50.886 1.00 78.76  ? 1    NAG B C4  1 
HETATM 4254 C C5  . NAG B 2 .   ? -46.070 104.169 49.656 1.00 76.79  ? 1    NAG B C5  1 
HETATM 4255 C C6  . NAG B 2 .   ? -44.785 103.383 49.797 1.00 75.76  ? 1    NAG B C6  1 
HETATM 4256 C C7  . NAG B 2 .   ? -50.869 106.082 50.551 1.00 79.88  ? 1    NAG B C7  1 
HETATM 4257 C C8  . NAG B 2 .   ? -50.901 107.580 50.824 1.00 78.72  ? 1    NAG B C8  1 
HETATM 4258 N N2  . NAG B 2 .   ? -49.930 105.636 49.722 1.00 78.12  ? 1    NAG B N2  1 
HETATM 4259 O O3  . NAG B 2 .   ? -48.069 106.308 52.044 1.00 83.23  ? 1    NAG B O3  1 
HETATM 4260 O O4  . NAG B 2 .   ? -45.323 105.951 51.078 1.00 79.27  ? 1    NAG B O4  1 
HETATM 4261 O O5  . NAG B 2 .   ? -47.138 103.235 49.444 1.00 75.69  ? 1    NAG B O5  1 
HETATM 4262 O O6  . NAG B 2 .   ? -43.652 104.230 49.653 1.00 75.49  ? 1    NAG B O6  1 
HETATM 4263 O O7  . NAG B 2 .   ? -51.688 105.340 51.096 1.00 81.34  ? 1    NAG B O7  1 
HETATM 4264 C C1  . FUL B 2 .   ? -48.869 105.563 52.944 1.00 86.00  ? 2    FUL B C1  1 
HETATM 4265 C C2  . FUL B 2 .   ? -49.357 106.454 54.120 1.00 86.97  ? 2    FUL B C2  1 
HETATM 4266 O O2  . FUL B 2 .   ? -50.771 106.353 54.279 1.00 85.66  ? 2    FUL B O2  1 
HETATM 4267 C C3  . FUL B 2 .   ? -48.668 106.113 55.449 1.00 88.00  ? 2    FUL B C3  1 
HETATM 4268 O O3  . FUL B 2 .   ? -48.689 107.244 56.308 1.00 88.58  ? 2    FUL B O3  1 
HETATM 4269 C C4  . FUL B 2 .   ? -47.222 105.673 55.217 1.00 87.84  ? 2    FUL B C4  1 
HETATM 4270 O O4  . FUL B 2 .   ? -46.473 106.712 54.601 1.00 88.42  ? 2    FUL B O4  1 
HETATM 4271 C C5  . FUL B 2 .   ? -47.181 104.397 54.363 1.00 87.74  ? 2    FUL B C5  1 
HETATM 4272 C C6  . FUL B 2 .   ? -45.869 104.188 53.631 1.00 87.12  ? 2    FUL B C6  1 
HETATM 4273 O O5  . FUL B 2 .   ? -48.265 104.326 53.382 1.00 87.15  ? 2    FUL B O5  1 
HETATM 4274 C C1  . NAG C 3 .   ? -28.027 82.360  59.835 1.00 87.81  ? 1    NAG C C1  1 
HETATM 4275 C C2  . NAG C 3 .   ? -28.526 83.800  60.067 1.00 90.59  ? 1    NAG C C2  1 
HETATM 4276 C C3  . NAG C 3 .   ? -29.032 84.002  61.510 1.00 91.82  ? 1    NAG C C3  1 
HETATM 4277 C C4  . NAG C 3 .   ? -30.009 82.881  61.895 1.00 91.08  ? 1    NAG C C4  1 
HETATM 4278 C C5  . NAG C 3 .   ? -29.348 81.523  61.631 1.00 89.94  ? 1    NAG C C5  1 
HETATM 4279 C C6  . NAG C 3 .   ? -30.202 80.327  61.994 1.00 89.20  ? 1    NAG C C6  1 
HETATM 4280 C C7  . NAG C 3 .   ? -26.181 84.414  59.909 1.00 95.01  ? 1    NAG C C7  1 
HETATM 4281 C C8  . NAG C 3 .   ? -25.606 84.334  61.319 1.00 94.92  ? 1    NAG C C8  1 
HETATM 4282 N N2  . NAG C 3 .   ? -27.464 84.752  59.782 1.00 92.96  ? 1    NAG C N2  1 
HETATM 4283 O O3  . NAG C 3 .   ? -29.701 85.281  61.622 1.00 93.37  ? 1    NAG C O3  1 
HETATM 4284 O O4  . NAG C 3 .   ? -30.363 82.996  63.267 1.00 92.37  ? 1    NAG C O4  1 
HETATM 4285 O O5  . NAG C 3 .   ? -29.025 81.409  60.234 1.00 88.35  ? 1    NAG C O5  1 
HETATM 4286 O O6  . NAG C 3 .   ? -29.401 79.166  62.167 1.00 87.54  ? 1    NAG C O6  1 
HETATM 4287 O O7  . NAG C 3 .   ? -25.454 84.184  58.937 1.00 96.19  ? 1    NAG C O7  1 
HETATM 4288 C C1  . FUC C 3 .   ? -29.012 86.328  62.269 1.00 94.71  ? 2    FUC C C1  1 
HETATM 4289 C C2  . FUC C 3 .   ? -27.807 86.784  61.426 1.00 94.83  ? 2    FUC C C2  1 
HETATM 4290 C C3  . FUC C 3 .   ? -27.016 87.892  62.127 1.00 95.13  ? 2    FUC C C3  1 
HETATM 4291 C C4  . FUC C 3 .   ? -26.662 87.478  63.549 1.00 95.35  ? 2    FUC C C4  1 
HETATM 4292 C C5  . FUC C 3 .   ? -27.929 87.054  64.302 1.00 95.94  ? 2    FUC C C5  1 
HETATM 4293 C C6  . FUC C 3 .   ? -27.629 86.554  65.704 1.00 95.87  ? 2    FUC C C6  1 
HETATM 4294 O O2  . FUC C 3 .   ? -28.258 87.259  60.167 1.00 95.43  ? 2    FUC C O2  1 
HETATM 4295 O O3  . FUC C 3 .   ? -25.821 88.150  61.404 1.00 95.36  ? 2    FUC C O3  1 
HETATM 4296 O O4  . FUC C 3 .   ? -25.733 86.406  63.509 1.00 95.15  ? 2    FUC C O4  1 
HETATM 4297 O O5  . FUC C 3 .   ? -28.599 85.986  63.592 1.00 95.49  ? 2    FUC C O5  1 
HETATM 4298 C C1  . NAG D 4 .   ? -45.574 107.326 48.035 1.00 104.65 ? 1    NAG D C1  1 
HETATM 4299 C C2  . NAG D 4 .   ? -44.823 108.464 47.322 1.00 105.40 ? 1    NAG D C2  1 
HETATM 4300 C C3  . NAG D 4 .   ? -44.424 108.022 45.908 1.00 104.43 ? 1    NAG D C3  1 
HETATM 4301 C C4  . NAG D 4 .   ? -44.081 106.540 45.975 1.00 103.84 ? 1    NAG D C4  1 
HETATM 4302 C C5  . NAG D 4 .   ? -45.373 105.760 46.199 1.00 104.18 ? 1    NAG D C5  1 
HETATM 4303 C C6  . NAG D 4 .   ? -45.159 104.392 46.818 1.00 105.74 ? 1    NAG D C6  1 
HETATM 4304 C C7  . NAG D 4 .   ? -45.167 110.826 47.726 1.00 107.93 ? 1    NAG D C7  1 
HETATM 4305 C C8  . NAG D 4 .   ? -45.753 112.086 47.107 1.00 107.62 ? 1    NAG D C8  1 
HETATM 4306 N N2  . NAG D 4 .   ? -45.645 109.661 47.285 1.00 107.43 ? 1    NAG D N2  1 
HETATM 4307 O O3  . NAG D 4 .   ? -43.306 108.772 45.464 1.00 105.16 ? 1    NAG D O3  1 
HETATM 4308 O O4  . NAG D 4 .   ? -43.425 106.097 44.775 1.00 103.32 ? 1    NAG D O4  1 
HETATM 4309 O O5  . NAG D 4 .   ? -46.263 106.494 47.078 1.00 103.81 ? 1    NAG D O5  1 
HETATM 4310 O O6  . NAG D 4 .   ? -43.910 103.831 46.450 1.00 107.02 ? 1    NAG D O6  1 
HETATM 4311 O O7  . NAG D 4 .   ? -44.291 110.916 48.592 1.00 108.06 ? 1    NAG D O7  1 
HETATM 4312 C C1  . MAN D 4 .   ? -42.246 105.404 44.973 1.00 101.71 ? 2    MAN D C1  1 
HETATM 4313 C C2  . MAN D 4 .   ? -41.077 106.376 45.025 1.00 101.95 ? 2    MAN D C2  1 
HETATM 4314 C C3  . MAN D 4 .   ? -39.806 105.615 45.391 1.00 101.13 ? 2    MAN D C3  1 
HETATM 4315 C C4  . MAN D 4 .   ? -39.761 104.267 44.679 1.00 99.76  ? 2    MAN D C4  1 
HETATM 4316 C C5  . MAN D 4 .   ? -40.720 104.233 43.490 1.00 99.17  ? 2    MAN D C5  1 
HETATM 4317 C C6  . MAN D 4 .   ? -40.683 102.885 42.814 1.00 98.38  ? 2    MAN D C6  1 
HETATM 4318 O O2  . MAN D 4 .   ? -41.339 107.374 46.002 1.00 104.09 ? 2    MAN D O2  1 
HETATM 4319 O O3  . MAN D 4 .   ? -39.770 105.403 46.797 1.00 102.09 ? 2    MAN D O3  1 
HETATM 4320 O O4  . MAN D 4 .   ? -38.443 104.038 44.209 1.00 99.51  ? 2    MAN D O4  1 
HETATM 4321 O O5  . MAN D 4 .   ? -42.092 104.449 43.908 1.00 100.39 ? 2    MAN D O5  1 
HETATM 4322 O O6  . MAN D 4 .   ? -39.490 102.185 43.137 1.00 97.05  ? 2    MAN D O6  1 
HETATM 4323 C C1  . NAG E 5 .   ? -30.133 77.253  10.129 1.00 114.74 ? 994  NAG A C1  1 
HETATM 4324 C C2  . NAG E 5 .   ? -30.761 77.558  8.761  1.00 114.45 ? 994  NAG A C2  1 
HETATM 4325 C C3  . NAG E 5 .   ? -31.928 76.598  8.467  1.00 114.50 ? 994  NAG A C3  1 
HETATM 4326 C C4  . NAG E 5 .   ? -31.771 75.312  9.281  1.00 114.36 ? 994  NAG A C4  1 
HETATM 4327 C C5  . NAG E 5 .   ? -31.828 75.635  10.784 1.00 114.25 ? 994  NAG A C5  1 
HETATM 4328 C C6  . NAG E 5 .   ? -31.220 74.553  11.662 1.00 114.01 ? 994  NAG A C6  1 
HETATM 4329 C C7  . NAG E 5 .   ? -32.243 79.303  7.972  1.00 113.80 ? 994  NAG A C7  1 
HETATM 4330 C C8  . NAG E 5 .   ? -33.510 79.738  8.692  1.00 113.29 ? 994  NAG A C8  1 
HETATM 4331 N N2  . NAG E 5 .   ? -31.210 78.940  8.726  1.00 113.90 ? 994  NAG A N2  1 
HETATM 4332 O O3  . NAG E 5 .   ? -31.956 76.285  7.081  1.00 114.53 ? 994  NAG A O3  1 
HETATM 4333 O O4  . NAG E 5 .   ? -32.801 74.393  8.940  1.00 113.62 ? 994  NAG A O4  1 
HETATM 4334 O O5  . NAG E 5 .   ? -31.144 76.883  11.089 1.00 114.56 ? 994  NAG A O5  1 
HETATM 4335 O O6  . NAG E 5 .   ? -29.869 74.840  11.989 1.00 113.10 ? 994  NAG A O6  1 
HETATM 4336 O O7  . NAG E 5 .   ? -32.208 79.296  6.741  1.00 113.65 ? 994  NAG A O7  1 
HETATM 4337 C C1  . NAG F 5 .   ? -29.009 81.728  14.137 1.00 62.92  ? 998  NAG A C1  1 
HETATM 4338 C C2  . NAG F 5 .   ? -29.627 82.488  12.958 1.00 64.20  ? 998  NAG A C2  1 
HETATM 4339 C C3  . NAG F 5 .   ? -30.642 81.614  12.203 1.00 66.00  ? 998  NAG A C3  1 
HETATM 4340 C C4  . NAG F 5 .   ? -30.076 80.221  11.900 1.00 65.42  ? 998  NAG A C4  1 
HETATM 4341 C C5  . NAG F 5 .   ? -29.476 79.602  13.162 1.00 64.71  ? 998  NAG A C5  1 
HETATM 4342 C C6  . NAG F 5 .   ? -28.825 78.261  12.906 1.00 64.64  ? 998  NAG A C6  1 
HETATM 4343 C C7  . NAG F 5 .   ? -30.181 84.821  12.807 1.00 65.56  ? 998  NAG A C7  1 
HETATM 4344 C C8  . NAG F 5 .   ? -31.470 85.445  12.290 1.00 64.75  ? 998  NAG A C8  1 
HETATM 4345 N N2  . NAG F 5 .   ? -30.289 83.673  13.461 1.00 63.98  ? 998  NAG A N2  1 
HETATM 4346 O O3  . NAG F 5 .   ? -30.998 82.248  10.980 1.00 67.07  ? 998  NAG A O3  1 
HETATM 4347 O O4  . NAG F 5 .   ? -31.121 79.392  11.418 1.00 67.06  ? 998  NAG A O4  1 
HETATM 4348 O O5  . NAG F 5 .   ? -28.463 80.476  13.700 1.00 63.30  ? 998  NAG A O5  1 
HETATM 4349 O O6  . NAG F 5 .   ? -27.435 78.300  13.192 1.00 65.88  ? 998  NAG A O6  1 
HETATM 4350 O O7  . NAG F 5 .   ? -29.098 85.378  12.608 1.00 67.23  ? 998  NAG A O7  1 
HETATM 4351 N N1  . CP0 G 6 .   ? -17.188 113.198 39.692 1.00 78.48  ? 1000 CP0 A N1  1 
HETATM 4352 N N4  . CP0 G 6 .   ? -14.792 114.665 41.913 1.00 84.40  ? 1000 CP0 A N4  1 
HETATM 4353 O O1  . CP0 G 6 .   ? -22.393 109.692 38.469 1.00 64.49  ? 1000 CP0 A O1  1 
HETATM 4354 O O2  . CP0 G 6 .   ? -22.340 110.742 40.483 1.00 68.38  ? 1000 CP0 A O2  1 
HETATM 4355 O O18 . CP0 G 6 .   ? -13.147 115.667 43.335 1.00 87.81  ? 1000 CP0 A O18 1 
HETATM 4356 O O19 . CP0 G 6 .   ? -10.634 116.617 39.758 1.00 90.42  ? 1000 CP0 A O19 1 
HETATM 4357 O O22 . CP0 G 6 .   ? -10.253 116.594 37.536 1.00 89.58  ? 1000 CP0 A O22 1 
HETATM 4358 O O23 . CP0 G 6 .   ? -12.075 114.316 37.606 1.00 91.14  ? 1000 CP0 A O23 1 
HETATM 4359 C C13 . CP0 G 6 .   ? -18.457 112.588 39.982 1.00 76.89  ? 1000 CP0 A C13 1 
HETATM 4360 C C10 . CP0 G 6 .   ? -21.051 111.355 40.403 1.00 71.71  ? 1000 CP0 A C10 1 
HETATM 4361 C C14 . CP0 G 6 .   ? -14.525 114.556 39.477 1.00 86.01  ? 1000 CP0 A C14 1 
HETATM 4362 C C6  . CP0 G 6 .   ? -16.858 113.631 42.147 1.00 80.45  ? 1000 CP0 A C6  1 
HETATM 4363 C C8  . CP0 G 6 .   ? -19.014 112.467 41.401 1.00 75.99  ? 1000 CP0 A C8  1 
HETATM 4364 C C7  . CP0 G 6 .   ? -18.154 113.019 42.488 1.00 78.62  ? 1000 CP0 A C7  1 
HETATM 4365 C C37 . CP0 G 6 .   ? -22.999 109.990 39.426 1.00 63.63  ? 1000 CP0 A C37 1 
HETATM 4366 C C3  . CP0 G 6 .   ? -15.268 114.287 40.596 1.00 83.65  ? 1000 CP0 A C3  1 
HETATM 4367 C C9  . CP0 G 6 .   ? -20.351 111.821 41.540 1.00 73.32  ? 1000 CP0 A C9  1 
HETATM 4368 C C12 . CP0 G 6 .   ? -19.175 112.097 38.746 1.00 75.29  ? 1000 CP0 A C12 1 
HETATM 4369 C C11 . CP0 G 6 .   ? -20.419 111.513 39.013 1.00 73.72  ? 1000 CP0 A C11 1 
HETATM 4370 C C2  . CP0 G 6 .   ? -16.511 113.655 40.739 1.00 81.11  ? 1000 CP0 A C2  1 
HETATM 4371 C C16 . CP0 G 6 .   ? -12.715 115.646 40.875 1.00 88.41  ? 1000 CP0 A C16 1 
HETATM 4372 C C15 . CP0 G 6 .   ? -13.222 115.250 39.606 1.00 88.33  ? 1000 CP0 A C15 1 
HETATM 4373 C C23 . CP0 G 6 .   ? -13.483 115.372 42.155 1.00 87.08  ? 1000 CP0 A C23 1 
HETATM 4374 C C17 . CP0 G 6 .   ? -11.347 116.371 41.037 1.00 89.39  ? 1000 CP0 A C17 1 
HETATM 4375 C C5  . CP0 G 6 .   ? -15.762 114.281 42.983 1.00 82.41  ? 1000 CP0 A C5  1 
HETATM 4376 C C21 . CP0 G 6 .   ? -11.006 116.296 38.464 1.00 89.86  ? 1000 CP0 A C21 1 
HETATM 4377 C C28 . CP0 G 6 .   ? -13.348 116.190 37.233 1.00 89.71  ? 1000 CP0 A C28 1 
HETATM 4378 C C20 . CP0 G 6 .   ? -12.408 115.556 38.269 1.00 89.49  ? 1000 CP0 A C20 1 
HETATM 4379 C C31 . CP0 G 6 .   ? -18.666 112.934 43.955 1.00 80.99  ? 1000 CP0 A C31 1 
HETATM 4380 C C32 . CP0 G 6 .   ? -19.449 114.185 44.546 1.00 82.29  ? 1000 CP0 A C32 1 
HETATM 4381 C C33 . CP0 G 6 .   ? -13.885 117.495 37.552 1.00 88.43  ? 1000 CP0 A C33 1 
HETATM 4382 N N2  . CP0 G 6 .   ? -24.308 109.675 39.658 1.00 59.18  ? 1000 CP0 A N2  1 
HETATM 4383 N N3  . CP0 G 6 .   ? -25.918 105.827 38.985 1.00 49.37  ? 1000 CP0 A N3  1 
HETATM 4384 C C25 . CP0 G 6 .   ? -24.443 107.394 40.298 1.00 56.65  ? 1000 CP0 A C25 1 
HETATM 4385 C C22 . CP0 G 6 .   ? -25.712 109.806 39.126 1.00 56.45  ? 1000 CP0 A C22 1 
HETATM 4386 C C24 . CP0 G 6 .   ? -25.768 107.253 39.576 1.00 53.09  ? 1000 CP0 A C24 1 
HETATM 4387 C C26 . CP0 G 6 .   ? -24.246 108.832 40.841 1.00 57.18  ? 1000 CP0 A C26 1 
HETATM 4388 C C29 . CP0 G 6 .   ? -27.082 105.730 37.909 1.00 48.33  ? 1000 CP0 A C29 1 
HETATM 4389 C C34 . CP0 G 6 .   ? -26.859 104.457 37.148 1.00 45.68  ? 1000 CP0 A C34 1 
HETATM 4390 C C35 . CP0 G 6 .   ? -26.205 104.809 40.048 1.00 47.72  ? 1000 CP0 A C35 1 
HETATM 4391 C C27 . CP0 G 6 .   ? -26.335 103.352 39.528 1.00 45.99  ? 1000 CP0 A C27 1 
HETATM 4392 C C30 . CP0 G 6 .   ? -27.049 103.230 38.094 1.00 44.73  ? 1000 CP0 A C30 1 
HETATM 4393 C C36 . CP0 G 6 .   ? -25.918 108.365 38.445 1.00 55.26  ? 1000 CP0 A C36 1 
HETATM 4394 I I   . IOD H 7 .   ? 5.141   101.052 53.692 0.60 66.17  ? 1001 IOD A I   1 
HETATM 4395 O O   . HOH I 8 .   ? -30.106 110.442 32.917 1.00 20.62  ? 1002 HOH A O   1 
HETATM 4396 O O   . HOH I 8 .   ? -36.986 90.763  40.635 1.00 16.47  ? 1003 HOH A O   1 
HETATM 4397 O O   . HOH I 8 .   ? -22.044 104.385 46.043 1.00 32.24  ? 1004 HOH A O   1 
HETATM 4398 O O   . HOH I 8 .   ? -27.053 110.994 48.675 1.00 26.52  ? 1005 HOH A O   1 
HETATM 4399 O O   . HOH I 8 .   ? -25.070 133.308 28.702 1.00 27.65  ? 1006 HOH A O   1 
HETATM 4400 O O   . HOH I 8 .   ? -5.243  94.461  39.287 1.00 17.18  ? 1007 HOH A O   1 
HETATM 4401 O O   . HOH I 8 .   ? -14.801 100.892 26.228 1.00 17.48  ? 1008 HOH A O   1 
HETATM 4402 O O   . HOH I 8 .   ? -29.907 91.082  43.330 1.00 28.09  ? 1009 HOH A O   1 
HETATM 4403 O O   . HOH I 8 .   ? -22.098 107.318 42.829 1.00 27.43  ? 1010 HOH A O   1 
HETATM 4404 O O   . HOH I 8 .   ? -7.800  100.876 35.355 1.00 20.38  ? 1011 HOH A O   1 
HETATM 4405 O O   . HOH I 8 .   ? -20.241 99.456  38.672 1.00 25.03  ? 1012 HOH A O   1 
HETATM 4406 O O   . HOH I 8 .   ? -19.271 129.606 29.289 1.00 21.38  ? 1013 HOH A O   1 
HETATM 4407 O O   . HOH I 8 .   ? -38.083 107.281 42.273 1.00 29.62  ? 1014 HOH A O   1 
HETATM 4408 O O   . HOH I 8 .   ? -27.708 89.397  13.381 1.00 26.99  ? 1015 HOH A O   1 
HETATM 4409 O O   . HOH I 8 .   ? -14.644 97.241  45.228 1.00 25.86  ? 1016 HOH A O   1 
HETATM 4410 O O   . HOH I 8 .   ? -4.840  113.051 37.539 1.00 27.93  ? 1017 HOH A O   1 
HETATM 4411 O O   . HOH I 8 .   ? -13.949 101.788 45.475 1.00 24.34  ? 1018 HOH A O   1 
HETATM 4412 O O   . HOH I 8 .   ? -35.537 95.156  17.837 1.00 23.65  ? 1019 HOH A O   1 
HETATM 4413 O O   . HOH I 8 .   ? -23.512 103.536 13.984 1.00 24.06  ? 1020 HOH A O   1 
HETATM 4414 O O   . HOH I 8 .   ? -26.335 107.719 44.023 1.00 30.13  ? 1021 HOH A O   1 
HETATM 4415 O O   . HOH I 8 .   ? -23.033 105.381 37.777 1.00 34.80  ? 1022 HOH A O   1 
HETATM 4416 O O   . HOH I 8 .   ? -32.329 100.303 45.706 1.00 13.82  ? 1023 HOH A O   1 
HETATM 4417 O O   . HOH I 8 .   ? -17.427 103.655 20.066 1.00 31.36  ? 1024 HOH A O   1 
HETATM 4418 O O   . HOH I 8 .   ? -30.373 112.001 16.037 1.00 30.31  ? 1025 HOH A O   1 
HETATM 4419 O O   . HOH I 8 .   ? -11.556 112.913 32.615 1.00 27.68  ? 1026 HOH A O   1 
HETATM 4420 O O   . HOH I 8 .   ? 1.534   96.262  53.602 1.00 58.68  ? 1027 HOH A O   1 
HETATM 4421 O O   . HOH I 8 .   ? -39.729 105.136 40.714 1.00 29.77  ? 1028 HOH A O   1 
HETATM 4422 O O   . HOH I 8 .   ? -25.867 99.223  41.225 1.00 29.57  ? 1029 HOH A O   1 
HETATM 4423 O O   . HOH I 8 .   ? -8.465  97.537  34.998 1.00 23.43  ? 1030 HOH A O   1 
HETATM 4424 O O   . HOH I 8 .   ? -24.225 73.518  38.104 1.00 45.84  ? 1031 HOH A O   1 
HETATM 4425 O O   . HOH I 8 .   ? 4.378   91.526  39.403 1.00 37.40  ? 1032 HOH A O   1 
HETATM 4426 O O   . HOH I 8 .   ? -43.424 111.241 37.093 1.00 23.90  ? 1033 HOH A O   1 
HETATM 4427 O O   . HOH I 8 .   ? -15.271 88.071  49.789 1.00 37.48  ? 1034 HOH A O   1 
HETATM 4428 O O   . HOH I 8 .   ? -25.965 122.392 12.847 1.00 39.15  ? 1035 HOH A O   1 
HETATM 4429 O O   . HOH I 8 .   ? -41.489 114.493 41.205 1.00 44.58  ? 1036 HOH A O   1 
HETATM 4430 O O   . HOH I 8 .   ? -12.962 94.204  47.563 1.00 46.24  ? 1037 HOH A O   1 
HETATM 4431 O O   . HOH I 8 .   ? -30.351 111.302 23.841 1.00 27.50  ? 1038 HOH A O   1 
HETATM 4432 O O   . HOH I 8 .   ? -29.014 101.281 49.057 1.00 23.13  ? 1039 HOH A O   1 
HETATM 4433 O O   . HOH I 8 .   ? -4.025  93.513  21.134 1.00 30.49  ? 1040 HOH A O   1 
HETATM 4434 O O   . HOH I 8 .   ? -35.313 101.687 38.555 1.00 20.89  ? 1041 HOH A O   1 
HETATM 4435 O O   . HOH I 8 .   ? -20.780 112.697 48.215 1.00 25.28  ? 1042 HOH A O   1 
HETATM 4436 O O   . HOH I 8 .   ? -25.175 119.044 43.679 1.00 31.89  ? 1043 HOH A O   1 
HETATM 4437 O O   . HOH I 8 .   ? -11.325 102.512 55.130 1.00 46.11  ? 1044 HOH A O   1 
HETATM 4438 O O   . HOH I 8 .   ? -25.490 101.801 42.559 1.00 34.26  ? 1045 HOH A O   1 
HETATM 4439 O O   . HOH I 8 .   ? -30.174 90.359  13.650 1.00 39.43  ? 1046 HOH A O   1 
HETATM 4440 O O   . HOH I 8 .   ? -14.730 103.355 38.309 1.00 37.31  ? 1047 HOH A O   1 
HETATM 4441 O O   . HOH I 8 .   ? -15.455 104.111 44.382 1.00 20.87  ? 1048 HOH A O   1 
HETATM 4442 O O   . HOH I 8 .   ? -32.263 101.096 29.506 1.00 18.67  ? 1049 HOH A O   1 
HETATM 4443 O O   . HOH I 8 .   ? -9.793  94.123  47.712 1.00 29.34  ? 1050 HOH A O   1 
HETATM 4444 O O   . HOH I 8 .   ? 1.100   109.477 37.323 1.00 30.59  ? 1051 HOH A O   1 
HETATM 4445 O O   . HOH I 8 .   ? -31.763 110.790 13.450 1.00 42.24  ? 1052 HOH A O   1 
HETATM 4446 O O   . HOH I 8 .   ? -9.303  81.880  27.613 1.00 28.00  ? 1053 HOH A O   1 
HETATM 4447 O O   . HOH I 8 .   ? -17.413 104.581 17.662 1.00 31.61  ? 1054 HOH A O   1 
HETATM 4448 O O   . HOH I 8 .   ? -4.400  106.594 12.706 1.00 28.99  ? 1055 HOH A O   1 
HETATM 4449 O O   . HOH I 8 .   ? -31.475 99.782  48.256 1.00 21.54  ? 1056 HOH A O   1 
HETATM 4450 O O   . HOH I 8 .   ? -6.530  86.905  33.441 1.00 37.29  ? 1057 HOH A O   1 
HETATM 4451 O O   . HOH I 8 .   ? -4.726  85.275  43.196 1.00 41.49  ? 1058 HOH A O   1 
HETATM 4452 O O   . HOH I 8 .   ? -11.117 100.027 20.253 1.00 33.33  ? 1059 HOH A O   1 
HETATM 4453 O O   . HOH I 8 .   ? -11.732 107.362 31.543 1.00 29.60  ? 1060 HOH A O   1 
HETATM 4454 O O   . HOH I 8 .   ? -14.450 126.363 23.347 1.00 40.49  ? 1061 HOH A O   1 
HETATM 4455 O O   . HOH I 8 .   ? -19.551 108.438 21.736 1.00 41.49  ? 1062 HOH A O   1 
HETATM 4456 O O   . HOH I 8 .   ? -29.836 111.393 26.271 1.00 21.35  ? 1063 HOH A O   1 
HETATM 4457 O O   . HOH I 8 .   ? -34.869 100.626 45.427 1.00 44.13  ? 1064 HOH A O   1 
HETATM 4458 O O   . HOH I 8 .   ? -40.031 117.047 41.991 1.00 28.15  ? 1065 HOH A O   1 
HETATM 4459 O O   . HOH I 8 .   ? -8.553  118.448 26.248 1.00 31.89  ? 1066 HOH A O   1 
HETATM 4460 O O   . HOH I 8 .   ? -27.552 98.882  37.293 1.00 15.44  ? 1067 HOH A O   1 
HETATM 4461 O O   . HOH I 8 .   ? -31.079 126.349 22.209 1.00 34.39  ? 1068 HOH A O   1 
HETATM 4462 O O   . HOH I 8 .   ? -8.749  109.110 29.565 1.00 40.74  ? 1069 HOH A O   1 
HETATM 4463 O O   . HOH I 8 .   ? -19.753 106.350 20.279 1.00 20.96  ? 1070 HOH A O   1 
HETATM 4464 O O   . HOH I 8 .   ? -31.385 123.110 44.967 1.00 39.58  ? 1071 HOH A O   1 
HETATM 4465 O O   . HOH I 8 .   ? -20.631 128.481 33.383 1.00 38.09  ? 1072 HOH A O   1 
HETATM 4466 O O   . HOH I 8 .   ? -22.937 107.230 7.177  1.00 27.60  ? 1073 HOH A O   1 
HETATM 4467 O O   . HOH I 8 .   ? -49.289 104.757 34.239 1.00 25.68  ? 1074 HOH A O   1 
HETATM 4468 O O   . HOH I 8 .   ? -41.364 74.834  29.191 1.00 35.00  ? 1075 HOH A O   1 
HETATM 4469 O O   . HOH I 8 .   ? -15.443 79.589  43.468 1.00 28.71  ? 1076 HOH A O   1 
HETATM 4470 O O   . HOH I 8 .   ? -31.870 101.351 14.858 1.00 35.06  ? 1077 HOH A O   1 
HETATM 4471 O O   . HOH I 8 .   ? -1.672  106.388 55.854 1.00 39.95  ? 1078 HOH A O   1 
HETATM 4472 O O   . HOH I 8 .   ? -10.560 77.694  23.731 1.00 50.21  ? 1079 HOH A O   1 
HETATM 4473 O O   . HOH I 8 .   ? -3.215  95.760  23.685 1.00 31.63  ? 1080 HOH A O   1 
HETATM 4474 O O   . HOH I 8 .   ? -1.112  95.595  25.157 1.00 40.63  ? 1081 HOH A O   1 
HETATM 4475 O O   . HOH I 8 .   ? -7.545  99.759  22.104 1.00 17.05  ? 1082 HOH A O   1 
HETATM 4476 O O   . HOH I 8 .   ? -5.825  100.711 23.953 1.00 36.11  ? 1083 HOH A O   1 
HETATM 4477 O O   . HOH I 8 .   ? -12.323 107.795 24.832 1.00 39.36  ? 1084 HOH A O   1 
HETATM 4478 O O   . HOH I 8 .   ? -8.415  110.327 24.748 1.00 44.51  ? 1085 HOH A O   1 
HETATM 4479 O O   . HOH I 8 .   ? -43.302 111.307 39.812 1.00 45.77  ? 1086 HOH A O   1 
HETATM 4480 O O   . HOH I 8 .   ? -28.809 68.444  40.015 1.00 44.60  ? 1087 HOH A O   1 
HETATM 4481 O O   . HOH I 8 .   ? -5.647  96.833  55.442 1.00 43.33  ? 1088 HOH A O   1 
HETATM 4482 O O   . HOH I 8 .   ? -37.528 129.263 27.377 1.00 43.11  ? 1089 HOH A O   1 
HETATM 4483 O O   . HOH I 8 .   ? -26.927 103.436 9.184  1.00 24.23  ? 1090 HOH A O   1 
HETATM 4484 O O   . HOH I 8 .   ? -15.321 76.835  45.286 1.00 40.38  ? 1091 HOH A O   1 
HETATM 4485 O O   . HOH I 8 .   ? -39.132 72.214  36.833 1.00 51.77  ? 1092 HOH A O   1 
HETATM 4486 O O   . HOH I 8 .   ? -19.084 112.432 50.580 1.00 35.66  ? 1093 HOH A O   1 
HETATM 4487 O O   . HOH I 8 .   ? -34.534 72.602  8.111  1.00 35.63  ? 1094 HOH A O   1 
HETATM 4488 O O   . HOH I 8 .   ? -29.825 80.301  66.741 1.00 48.78  ? 1095 HOH A O   1 
HETATM 4489 O O   . HOH I 8 .   ? -30.471 77.270  65.232 1.00 42.15  ? 1096 HOH A O   1 
HETATM 4490 O O   . HOH I 8 .   ? -21.504 67.757  45.440 1.00 27.49  ? 1097 HOH A O   1 
HETATM 4491 O O   . HOH I 8 .   ? -45.146 91.689  47.729 1.00 29.39  ? 1098 HOH A O   1 
HETATM 4492 O O   . HOH I 8 .   ? -16.045 85.612  49.337 1.00 46.11  ? 1099 HOH A O   1 
HETATM 4493 O O   . HOH I 8 .   ? -7.303  85.884  51.700 1.00 37.76  ? 1100 HOH A O   1 
HETATM 4494 O O   . HOH I 8 .   ? -1.573  87.273  51.176 1.00 51.27  ? 1101 HOH A O   1 
HETATM 4495 O O   . HOH I 8 .   ? -19.200 77.833  58.428 1.00 30.61  ? 1102 HOH A O   1 
HETATM 4496 O O   . HOH I 8 .   ? -2.201  112.010 25.761 1.00 48.39  ? 1103 HOH A O   1 
HETATM 4497 O O   . HOH I 8 .   ? -24.141 106.242 43.826 1.00 29.96  ? 1104 HOH A O   1 
HETATM 4498 O O   . HOH I 8 .   ? -27.654 101.736 55.719 1.00 47.15  ? 1105 HOH A O   1 
HETATM 4499 O O   . HOH I 8 .   ? -22.598 100.799 54.440 1.00 26.08  ? 1106 HOH A O   1 
HETATM 4500 O O   . HOH I 8 .   ? -46.276 80.101  38.931 1.00 30.63  ? 1107 HOH A O   1 
HETATM 4501 O O   . HOH I 8 .   ? -48.108 80.856  40.720 1.00 44.55  ? 1108 HOH A O   1 
HETATM 4502 O O   . HOH I 8 .   ? -48.694 84.210  39.129 1.00 33.76  ? 1109 HOH A O   1 
HETATM 4503 O O   . HOH I 8 .   ? -44.869 85.822  31.853 1.00 20.48  ? 1110 HOH A O   1 
HETATM 4504 O O   . HOH I 8 .   ? -43.867 83.616  26.890 1.00 16.42  ? 1111 HOH A O   1 
HETATM 4505 O O   . HOH I 8 .   ? -1.089  99.420  33.250 1.00 36.45  ? 1112 HOH A O   1 
HETATM 4506 O O   . HOH I 8 .   ? -13.876 103.575 23.424 1.00 27.49  ? 1113 HOH A O   1 
HETATM 4507 O O   . HOH I 8 .   ? -10.028 99.297  22.562 1.00 31.45  ? 1114 HOH A O   1 
HETATM 4508 O O   . HOH I 8 .   ? -6.235  110.661 28.241 1.00 34.05  ? 1115 HOH A O   1 
HETATM 4509 O O   . HOH I 8 .   ? -11.577 110.351 26.904 1.00 43.18  ? 1116 HOH A O   1 
HETATM 4510 O O   . HOH I 8 .   ? -7.236  105.672 27.143 1.00 35.81  ? 1117 HOH A O   1 
HETATM 4511 O O   . HOH I 8 .   ? -1.845  116.597 46.544 1.00 32.82  ? 1118 HOH A O   1 
HETATM 4512 O O   . HOH I 8 .   ? -20.455 112.631 35.805 1.00 27.58  ? 1119 HOH A O   1 
HETATM 4513 O O   . HOH I 8 .   ? -32.603 109.869 23.212 1.00 38.29  ? 1120 HOH A O   1 
HETATM 4514 O O   . HOH I 8 .   ? -34.217 114.968 26.933 1.00 21.16  ? 1121 HOH A O   1 
HETATM 4515 O O   . HOH I 8 .   ? -41.743 129.062 33.083 1.00 31.80  ? 1122 HOH A O   1 
HETATM 4516 O O   . HOH I 8 .   ? -30.811 121.214 17.054 1.00 46.86  ? 1123 HOH A O   1 
HETATM 4517 O O   . HOH I 8 .   ? -38.972 131.049 18.718 1.00 35.03  ? 1124 HOH A O   1 
HETATM 4518 O O   . HOH I 8 .   ? -30.825 117.482 20.544 1.00 27.80  ? 1125 HOH A O   1 
HETATM 4519 O O   . HOH I 8 .   ? -28.896 101.639 13.392 1.00 30.25  ? 1126 HOH A O   1 
HETATM 4520 O O   . HOH I 8 .   ? -19.566 87.043  7.808  1.00 39.44  ? 1127 HOH A O   1 
HETATM 4521 O O   . HOH I 8 .   ? -36.400 106.708 19.401 1.00 38.01  ? 1128 HOH A O   1 
HETATM 4522 O O   . HOH I 8 .   ? -44.114 108.307 29.307 1.00 40.61  ? 1129 HOH A O   1 
HETATM 4523 O O   . HOH I 8 .   ? -36.599 116.434 28.590 1.00 31.65  ? 1130 HOH A O   1 
HETATM 4524 O O   . HOH I 8 .   ? -53.343 104.115 49.385 1.00 46.80  ? 1131 HOH A O   1 
HETATM 4525 O O   . HOH I 8 .   ? -52.066 94.479  35.253 1.00 42.11  ? 1132 HOH A O   1 
HETATM 4526 O O   . HOH I 8 .   ? -39.725 83.063  22.081 1.00 48.98  ? 1133 HOH A O   1 
HETATM 4527 O O   . HOH I 8 .   ? -45.927 92.430  22.261 1.00 39.35  ? 1134 HOH A O   1 
HETATM 4528 O O   . HOH I 8 .   ? -46.029 105.355 28.143 1.00 48.48  ? 1135 HOH A O   1 
HETATM 4529 O O   . HOH I 8 .   ? -49.042 96.576  20.016 1.00 36.41  ? 1136 HOH A O   1 
HETATM 4530 O O   . HOH I 8 .   ? -23.999 103.956 41.920 1.00 21.24  ? 1137 HOH A O   1 
HETATM 4531 O O   . HOH I 8 .   ? -26.574 100.205 6.318  1.00 31.62  ? 1138 HOH A O   1 
HETATM 4532 O O   . HOH I 8 .   ? -37.037 104.022 42.261 1.00 33.65  ? 1139 HOH A O   1 
HETATM 4533 O O   . HOH I 8 .   ? -36.732 111.608 49.989 1.00 45.48  ? 1140 HOH A O   1 
HETATM 4534 O O   . HOH I 8 .   ? -36.346 106.428 44.691 1.00 28.62  ? 1141 HOH A O   1 
HETATM 4535 O O   . HOH I 8 .   ? -14.135 106.985 39.853 1.00 30.19  ? 1142 HOH A O   1 
HETATM 4536 O O   . HOH I 8 .   ? -31.825 71.542  7.796  1.00 66.58  ? 1143 HOH A O   1 
HETATM 4537 O O   . HOH I 8 .   ? -18.725 99.025  7.369  1.00 50.42  ? 1144 HOH A O   1 
HETATM 4538 O O   . HOH I 8 .   ? -39.093 107.836 19.514 1.00 23.89  ? 1145 HOH A O   1 
HETATM 4539 O O   . HOH I 8 .   ? -41.340 109.227 19.772 1.00 26.03  ? 1146 HOH A O   1 
HETATM 4540 O O   . HOH I 8 .   ? -49.086 103.068 20.447 1.00 37.81  ? 1147 HOH A O   1 
HETATM 4541 O O   . HOH I 8 .   ? -32.316 120.872 21.992 1.00 34.40  ? 1148 HOH A O   1 
HETATM 4542 O O   . HOH I 8 .   ? -30.770 70.306  30.217 1.00 36.93  ? 1149 HOH A O   1 
HETATM 4543 O O   . HOH I 8 .   ? -35.573 85.874  55.375 1.00 42.43  ? 1150 HOH A O   1 
HETATM 4544 O O   . HOH I 8 .   ? -29.290 96.039  57.475 1.00 33.91  ? 1151 HOH A O   1 
HETATM 4545 O O   . HOH I 8 .   ? -24.953 100.844 56.359 1.00 45.96  ? 1152 HOH A O   1 
HETATM 4546 O O   . HOH I 8 .   ? -45.617 80.993  15.378 1.00 35.52  ? 1153 HOH A O   1 
HETATM 4547 O O   . HOH I 8 .   ? -49.835 86.679  38.683 1.00 40.95  ? 1154 HOH A O   1 
HETATM 4548 O O   . HOH I 8 .   ? -4.134  111.812 29.701 1.00 35.30  ? 1155 HOH A O   1 
HETATM 4549 O O   . HOH I 8 .   ? -1.489  108.239 29.248 1.00 33.23  ? 1156 HOH A O   1 
HETATM 4550 O O   . HOH I 8 .   ? -1.071  115.899 49.262 1.00 33.96  ? 1157 HOH A O   1 
HETATM 4551 O O   . HOH I 8 .   ? -40.146 131.888 31.768 1.00 52.43  ? 1158 HOH A O   1 
HETATM 4552 O O   . HOH I 8 .   ? -48.920 101.930 53.926 1.00 48.60  ? 1159 HOH A O   1 
HETATM 4553 O O   . HOH I 8 .   ? -47.254 106.016 59.544 1.00 57.73  ? 1160 HOH A O   1 
HETATM 4554 O O   . HOH I 8 .   ? -26.568 83.759  12.485 1.00 26.63  ? 1161 HOH A O   1 
HETATM 4555 O O   . HOH I 8 .   ? -31.431 73.063  5.647  1.00 60.05  ? 1162 HOH A O   1 
HETATM 4556 O O   . HOH I 8 .   ? -31.880 75.859  4.417  1.00 46.66  ? 1163 HOH A O   1 
HETATM 4557 O O   . HOH I 8 .   ? 3.851   96.573  55.295 1.00 38.04  ? 1164 HOH A O   1 
HETATM 4558 O O   . HOH I 8 .   ? -18.717 93.625  12.580 1.00 31.53  ? 1165 HOH A O   1 
HETATM 4559 O O   . HOH I 8 .   ? -39.558 109.412 22.960 1.00 28.52  ? 1166 HOH A O   1 
HETATM 4560 O O   . HOH I 8 .   ? -42.005 111.302 23.876 1.00 27.76  ? 1167 HOH A O   1 
HETATM 4561 O O   . HOH I 8 .   ? -36.910 117.107 24.748 1.00 41.56  ? 1168 HOH A O   1 
HETATM 4562 O O   . HOH I 8 .   ? -27.445 98.592  57.106 1.00 51.41  ? 1169 HOH A O   1 
HETATM 4563 O O   . HOH I 8 .   ? -22.225 103.295 54.173 1.00 30.67  ? 1170 HOH A O   1 
HETATM 4564 O O   . HOH I 8 .   ? -52.229 82.961  38.372 1.00 46.38  ? 1171 HOH A O   1 
HETATM 4565 O O   . HOH I 8 .   ? -21.656 66.666  42.850 1.00 30.93  ? 1172 HOH A O   1 
HETATM 4566 O O   . HOH I 8 .   ? 0.717   86.688  49.898 1.00 54.62  ? 1173 HOH A O   1 
HETATM 4567 O O   . HOH I 8 .   ? -10.739 124.690 23.902 1.00 47.84  ? 1174 HOH A O   1 
HETATM 4568 O O   . HOH I 8 .   ? -7.503  123.465 27.178 1.00 36.95  ? 1175 HOH A O   1 
HETATM 4569 O O   . HOH I 8 .   ? -35.506 130.842 28.712 1.00 28.53  ? 1176 HOH A O   1 
HETATM 4570 O O   . HOH I 8 .   ? -19.711 102.384 9.301  1.00 62.88  ? 1177 HOH A O   1 
HETATM 4571 O O   . HOH I 8 .   ? -8.801  93.591  45.232 1.00 39.78  ? 1178 HOH A O   1 
HETATM 4572 O O   . HOH I 8 .   ? -36.498 89.075  57.078 1.00 34.86  ? 1179 HOH A O   1 
HETATM 4573 O O   . HOH I 8 .   ? -19.245 71.942  53.867 1.00 34.73  ? 1180 HOH A O   1 
HETATM 4574 O O   . HOH I 8 .   ? -32.531 84.419  63.070 1.00 55.24  ? 1181 HOH A O   1 
HETATM 4575 O O   . HOH I 8 .   ? -51.000 108.430 59.211 1.00 49.62  ? 1182 HOH A O   1 
HETATM 4576 O O   . HOH I 8 .   ? -25.487 131.606 33.388 1.00 31.60  ? 1183 HOH A O   1 
HETATM 4577 O O   . HOH I 8 .   ? -51.580 85.304  36.655 1.00 43.90  ? 1184 HOH A O   1 
HETATM 4578 O O   . HOH I 8 .   ? -12.784 129.621 24.926 1.00 53.49  ? 1185 HOH A O   1 
HETATM 4579 O O   . HOH I 8 .   ? -6.527  117.743 25.030 1.00 39.23  ? 1186 HOH A O   1 
HETATM 4580 O O   . HOH I 8 .   ? -6.106  111.145 22.203 1.00 42.28  ? 1187 HOH A O   1 
HETATM 4581 O O   . HOH I 8 .   ? -10.290 110.284 17.695 1.00 35.04  ? 1188 HOH A O   1 
HETATM 4582 O O   . HOH I 8 .   ? -11.890 79.102  25.957 1.00 44.48  ? 1189 HOH A O   1 
HETATM 4583 O O   . HOH I 8 .   ? -8.538  86.590  30.960 1.00 55.43  ? 1190 HOH A O   1 
HETATM 4584 O O   . HOH I 8 .   ? -5.439  93.828  55.450 1.00 37.25  ? 1191 HOH A O   1 
HETATM 4585 O O   . HOH I 8 .   ? -10.750 99.990  57.790 1.00 36.27  ? 1192 HOH A O   1 
HETATM 4586 O O   . HOH I 8 .   ? -5.897  96.299  18.284 1.00 42.21  ? 1193 HOH A O   1 
HETATM 4587 O O   . HOH I 8 .   ? -36.117 114.296 25.736 1.00 50.96  ? 1194 HOH A O   1 
HETATM 4588 O O   . HOH I 8 .   ? -28.916 137.444 26.586 1.00 46.20  ? 1195 HOH A O   1 
HETATM 4589 O O   . HOH I 8 .   ? -16.204 72.355  40.749 1.00 39.75  ? 1196 HOH A O   1 
HETATM 4590 O O   . HOH I 8 .   ? -37.373 69.798  36.526 1.00 36.77  ? 1197 HOH A O   1 
HETATM 4591 O O   . HOH I 8 .   ? -30.332 81.452  29.452 1.00 35.81  ? 1198 HOH A O   1 
HETATM 4592 O O   . HOH I 8 .   ? -32.214 139.131 26.740 1.00 44.60  ? 1199 HOH A O   1 
HETATM 4593 O O   . HOH I 8 .   ? -21.041 99.966  57.975 1.00 59.77  ? 1200 HOH A O   1 
HETATM 4594 O O   . HOH I 8 .   ? -33.325 115.957 25.126 1.00 40.80  ? 1201 HOH A O   1 
HETATM 4595 O O   . HOH I 8 .   ? -19.506 112.869 29.217 1.00 34.95  ? 1202 HOH A O   1 
HETATM 4596 O O   . HOH I 8 .   ? -4.778  95.273  51.775 1.00 39.91  ? 1203 HOH A O   1 
HETATM 4597 O O   . HOH I 8 .   ? -9.794  80.659  25.343 1.00 33.46  ? 1204 HOH A O   1 
HETATM 4598 O O   . HOH I 8 .   ? -10.224 84.036  19.893 1.00 34.60  ? 1205 HOH A O   1 
HETATM 4599 O O   . HOH I 8 .   ? -10.190 121.975 25.154 1.00 35.14  ? 1206 HOH A O   1 
HETATM 4600 O O   . HOH I 8 .   ? -46.271 82.771  39.236 1.00 42.37  ? 1207 HOH A O   1 
HETATM 4601 O O   . HOH I 8 .   ? -40.476 82.457  31.495 1.00 45.82  ? 1208 HOH A O   1 
HETATM 4602 O O   . HOH I 8 .   ? -44.562 88.564  33.737 1.00 56.27  ? 1209 HOH A O   1 
HETATM 4603 O O   . HOH I 8 .   ? -24.228 123.147 32.051 1.00 37.38  ? 1210 HOH A O   1 
HETATM 4604 O O   . HOH I 8 .   ? -29.766 126.874 35.320 1.00 34.31  ? 1211 HOH A O   1 
HETATM 4605 O O   . HOH I 8 .   ? -41.370 129.888 30.354 1.00 53.25  ? 1212 HOH A O   1 
HETATM 4606 O O   . HOH I 8 .   ? -51.293 104.047 54.980 1.00 38.44  ? 1213 HOH A O   1 
HETATM 4607 O O   . HOH I 8 .   ? -26.754 80.067  61.537 1.00 41.95  ? 1214 HOH A O   1 
HETATM 4608 O O   . HOH I 8 .   ? -28.489 77.734  58.541 1.00 51.40  ? 1215 HOH A O   1 
HETATM 4609 O O   . HOH I 8 .   ? -34.952 90.114  58.769 1.00 45.61  ? 1216 HOH A O   1 
HETATM 4610 O O   . HOH I 8 .   ? -48.573 103.822 15.252 1.00 45.74  ? 1217 HOH A O   1 
HETATM 4611 O O   . HOH I 8 .   ? -3.933  108.214 14.443 1.00 55.81  ? 1218 HOH A O   1 
HETATM 4612 O O   . HOH I 8 .   ? -43.241 90.086  27.239 1.00 65.96  ? 1219 HOH A O   1 
HETATM 4613 O O   . HOH I 8 .   ? -52.477 93.526  37.643 1.00 52.25  ? 1220 HOH A O   1 
HETATM 4614 O O   . HOH I 8 .   ? -56.032 91.484  37.681 1.00 39.10  ? 1221 HOH A O   1 
HETATM 4615 O O   . HOH I 8 .   ? -57.885 92.649  36.098 1.00 48.35  ? 1222 HOH A O   1 
HETATM 4616 O O   . HOH I 8 .   ? -37.125 133.145 18.976 1.00 36.36  ? 1223 HOH A O   1 
HETATM 4617 O O   . HOH I 8 .   ? -33.061 132.625 21.454 1.00 47.23  ? 1224 HOH A O   1 
HETATM 4618 O O   . HOH I 8 .   ? -11.674 106.054 29.318 1.00 21.08  ? 1225 HOH A O   1 
HETATM 4619 O O   . HOH I 8 .   ? -16.534 105.718 21.904 1.00 50.51  ? 1226 HOH A O   1 
HETATM 4620 O O   . HOH I 8 .   ? -22.588 83.487  57.282 1.00 49.21  ? 1227 HOH A O   1 
HETATM 4621 O O   . HOH I 8 .   ? -9.587  83.672  34.657 1.00 41.83  ? 1228 HOH A O   1 
HETATM 4622 O O   . HOH I 8 .   ? -39.221 104.819 35.409 1.00 31.64  ? 1229 HOH A O   1 
HETATM 4623 O O   . HOH I 8 .   ? -13.487 80.697  34.774 1.00 38.28  ? 1230 HOH A O   1 
HETATM 4624 O O   . HOH I 8 .   ? -46.684 111.056 27.462 1.00 48.70  ? 1231 HOH A O   1 
HETATM 4625 O O   . HOH I 8 .   ? -43.109 114.574 38.334 1.00 57.89  ? 1232 HOH A O   1 
HETATM 4626 O O   . HOH I 8 .   ? -1.912  94.625  54.507 1.00 37.41  ? 1233 HOH A O   1 
HETATM 4627 O O   . HOH I 8 .   ? -27.953 118.863 48.389 1.00 47.12  ? 1234 HOH A O   1 
HETATM 4628 O O   . HOH I 8 .   ? -23.866 100.627 45.771 1.00 35.15  ? 1235 HOH A O   1 
HETATM 4629 O O   . HOH I 8 .   ? -22.630 78.230  31.568 1.00 48.27  ? 1236 HOH A O   1 
HETATM 4630 O O   . HOH I 8 .   ? -35.069 127.750 35.418 1.00 32.37  ? 1237 HOH A O   1 
HETATM 4631 O O   . HOH I 8 .   ? -23.684 78.108  28.530 1.00 36.99  ? 1238 HOH A O   1 
HETATM 4632 O O   . HOH I 8 .   ? -29.315 77.028  24.188 1.00 43.40  ? 1239 HOH A O   1 
HETATM 4633 O O   . HOH I 8 .   ? -39.505 127.445 24.472 1.00 40.46  ? 1240 HOH A O   1 
HETATM 4634 O O   . HOH I 8 .   ? -22.538 129.542 21.325 1.00 40.70  ? 1241 HOH A O   1 
HETATM 4635 O O   . HOH I 8 .   ? -18.043 127.250 15.049 1.00 31.83  ? 1242 HOH A O   1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'NAG B 1 HAS WRONG CHIRALITY AT ATOM C1' 
2 'FUC C 2 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Israel Structural Proteomics Center' 
_pdbx_SG_project.initial_of_center     ISPC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 NAG 1   994  994  NAG NAG A . 
F 5 NAG 1   998  998  NAG NAG A . 
G 6 CP0 1   1000 998  CP0 CP0 A . 
H 7 IOD 1   1001 1001 IOD IOD A . 
I 8 HOH 1   1002 1    HOH HOH A . 
I 8 HOH 2   1003 2    HOH HOH A . 
I 8 HOH 3   1004 3    HOH HOH A . 
I 8 HOH 4   1005 4    HOH HOH A . 
I 8 HOH 5   1006 5    HOH HOH A . 
I 8 HOH 6   1007 6    HOH HOH A . 
I 8 HOH 7   1008 7    HOH HOH A . 
I 8 HOH 8   1009 8    HOH HOH A . 
I 8 HOH 9   1010 9    HOH HOH A . 
I 8 HOH 10  1011 10   HOH HOH A . 
I 8 HOH 11  1012 11   HOH HOH A . 
I 8 HOH 12  1013 12   HOH HOH A . 
I 8 HOH 13  1014 13   HOH HOH A . 
I 8 HOH 14  1015 14   HOH HOH A . 
I 8 HOH 15  1016 15   HOH HOH A . 
I 8 HOH 16  1017 16   HOH HOH A . 
I 8 HOH 17  1018 17   HOH HOH A . 
I 8 HOH 18  1019 18   HOH HOH A . 
I 8 HOH 19  1020 19   HOH HOH A . 
I 8 HOH 20  1021 20   HOH HOH A . 
I 8 HOH 21  1022 21   HOH HOH A . 
I 8 HOH 22  1023 22   HOH HOH A . 
I 8 HOH 23  1024 23   HOH HOH A . 
I 8 HOH 24  1025 24   HOH HOH A . 
I 8 HOH 25  1026 25   HOH HOH A . 
I 8 HOH 26  1027 26   HOH HOH A . 
I 8 HOH 27  1028 27   HOH HOH A . 
I 8 HOH 28  1029 28   HOH HOH A . 
I 8 HOH 29  1030 29   HOH HOH A . 
I 8 HOH 30  1031 30   HOH HOH A . 
I 8 HOH 31  1032 31   HOH HOH A . 
I 8 HOH 32  1033 32   HOH HOH A . 
I 8 HOH 33  1034 33   HOH HOH A . 
I 8 HOH 34  1035 34   HOH HOH A . 
I 8 HOH 35  1036 35   HOH HOH A . 
I 8 HOH 36  1037 36   HOH HOH A . 
I 8 HOH 37  1038 37   HOH HOH A . 
I 8 HOH 38  1039 38   HOH HOH A . 
I 8 HOH 39  1040 39   HOH HOH A . 
I 8 HOH 40  1041 40   HOH HOH A . 
I 8 HOH 41  1042 41   HOH HOH A . 
I 8 HOH 42  1043 42   HOH HOH A . 
I 8 HOH 43  1044 43   HOH HOH A . 
I 8 HOH 44  1045 44   HOH HOH A . 
I 8 HOH 45  1046 45   HOH HOH A . 
I 8 HOH 46  1047 46   HOH HOH A . 
I 8 HOH 47  1048 47   HOH HOH A . 
I 8 HOH 48  1049 48   HOH HOH A . 
I 8 HOH 49  1050 49   HOH HOH A . 
I 8 HOH 50  1051 50   HOH HOH A . 
I 8 HOH 51  1052 51   HOH HOH A . 
I 8 HOH 52  1053 52   HOH HOH A . 
I 8 HOH 53  1054 53   HOH HOH A . 
I 8 HOH 54  1055 54   HOH HOH A . 
I 8 HOH 55  1056 55   HOH HOH A . 
I 8 HOH 56  1057 56   HOH HOH A . 
I 8 HOH 57  1058 57   HOH HOH A . 
I 8 HOH 58  1059 58   HOH HOH A . 
I 8 HOH 59  1060 59   HOH HOH A . 
I 8 HOH 60  1061 60   HOH HOH A . 
I 8 HOH 61  1062 61   HOH HOH A . 
I 8 HOH 62  1063 62   HOH HOH A . 
I 8 HOH 63  1064 63   HOH HOH A . 
I 8 HOH 64  1065 64   HOH HOH A . 
I 8 HOH 65  1066 65   HOH HOH A . 
I 8 HOH 66  1067 66   HOH HOH A . 
I 8 HOH 67  1068 67   HOH HOH A . 
I 8 HOH 68  1069 68   HOH HOH A . 
I 8 HOH 69  1070 69   HOH HOH A . 
I 8 HOH 70  1071 70   HOH HOH A . 
I 8 HOH 71  1072 71   HOH HOH A . 
I 8 HOH 72  1073 72   HOH HOH A . 
I 8 HOH 73  1074 73   HOH HOH A . 
I 8 HOH 74  1075 74   HOH HOH A . 
I 8 HOH 75  1076 75   HOH HOH A . 
I 8 HOH 76  1077 76   HOH HOH A . 
I 8 HOH 77  1078 77   HOH HOH A . 
I 8 HOH 78  1079 78   HOH HOH A . 
I 8 HOH 79  1080 79   HOH HOH A . 
I 8 HOH 80  1081 80   HOH HOH A . 
I 8 HOH 81  1082 81   HOH HOH A . 
I 8 HOH 82  1083 82   HOH HOH A . 
I 8 HOH 83  1084 83   HOH HOH A . 
I 8 HOH 84  1085 84   HOH HOH A . 
I 8 HOH 85  1086 85   HOH HOH A . 
I 8 HOH 86  1087 86   HOH HOH A . 
I 8 HOH 87  1088 87   HOH HOH A . 
I 8 HOH 88  1089 88   HOH HOH A . 
I 8 HOH 89  1090 89   HOH HOH A . 
I 8 HOH 90  1091 90   HOH HOH A . 
I 8 HOH 91  1092 91   HOH HOH A . 
I 8 HOH 92  1093 92   HOH HOH A . 
I 8 HOH 93  1094 93   HOH HOH A . 
I 8 HOH 94  1095 94   HOH HOH A . 
I 8 HOH 95  1096 95   HOH HOH A . 
I 8 HOH 96  1097 96   HOH HOH A . 
I 8 HOH 97  1098 97   HOH HOH A . 
I 8 HOH 98  1099 98   HOH HOH A . 
I 8 HOH 99  1100 99   HOH HOH A . 
I 8 HOH 100 1101 100  HOH HOH A . 
I 8 HOH 101 1102 101  HOH HOH A . 
I 8 HOH 102 1103 102  HOH HOH A . 
I 8 HOH 103 1104 103  HOH HOH A . 
I 8 HOH 104 1105 104  HOH HOH A . 
I 8 HOH 105 1106 105  HOH HOH A . 
I 8 HOH 106 1107 106  HOH HOH A . 
I 8 HOH 107 1108 107  HOH HOH A . 
I 8 HOH 108 1109 108  HOH HOH A . 
I 8 HOH 109 1110 109  HOH HOH A . 
I 8 HOH 110 1111 110  HOH HOH A . 
I 8 HOH 111 1112 111  HOH HOH A . 
I 8 HOH 112 1113 112  HOH HOH A . 
I 8 HOH 113 1114 113  HOH HOH A . 
I 8 HOH 114 1115 114  HOH HOH A . 
I 8 HOH 115 1116 115  HOH HOH A . 
I 8 HOH 116 1117 116  HOH HOH A . 
I 8 HOH 117 1118 117  HOH HOH A . 
I 8 HOH 118 1119 118  HOH HOH A . 
I 8 HOH 119 1120 119  HOH HOH A . 
I 8 HOH 120 1121 120  HOH HOH A . 
I 8 HOH 121 1122 121  HOH HOH A . 
I 8 HOH 122 1123 122  HOH HOH A . 
I 8 HOH 123 1124 123  HOH HOH A . 
I 8 HOH 124 1125 124  HOH HOH A . 
I 8 HOH 125 1126 125  HOH HOH A . 
I 8 HOH 126 1127 126  HOH HOH A . 
I 8 HOH 127 1128 127  HOH HOH A . 
I 8 HOH 128 1129 128  HOH HOH A . 
I 8 HOH 129 1130 129  HOH HOH A . 
I 8 HOH 130 1131 130  HOH HOH A . 
I 8 HOH 131 1132 131  HOH HOH A . 
I 8 HOH 132 1133 132  HOH HOH A . 
I 8 HOH 133 1134 133  HOH HOH A . 
I 8 HOH 134 1135 134  HOH HOH A . 
I 8 HOH 135 1136 135  HOH HOH A . 
I 8 HOH 136 1137 136  HOH HOH A . 
I 8 HOH 137 1138 137  HOH HOH A . 
I 8 HOH 138 1139 138  HOH HOH A . 
I 8 HOH 139 1140 139  HOH HOH A . 
I 8 HOH 140 1141 140  HOH HOH A . 
I 8 HOH 141 1142 141  HOH HOH A . 
I 8 HOH 142 1143 142  HOH HOH A . 
I 8 HOH 143 1144 143  HOH HOH A . 
I 8 HOH 144 1145 144  HOH HOH A . 
I 8 HOH 145 1146 145  HOH HOH A . 
I 8 HOH 146 1147 146  HOH HOH A . 
I 8 HOH 147 1148 147  HOH HOH A . 
I 8 HOH 148 1149 148  HOH HOH A . 
I 8 HOH 149 1150 149  HOH HOH A . 
I 8 HOH 150 1151 150  HOH HOH A . 
I 8 HOH 151 1152 151  HOH HOH A . 
I 8 HOH 152 1153 152  HOH HOH A . 
I 8 HOH 153 1154 153  HOH HOH A . 
I 8 HOH 154 1155 154  HOH HOH A . 
I 8 HOH 155 1156 155  HOH HOH A . 
I 8 HOH 156 1157 156  HOH HOH A . 
I 8 HOH 157 1158 157  HOH HOH A . 
I 8 HOH 158 1159 158  HOH HOH A . 
I 8 HOH 159 1160 159  HOH HOH A . 
I 8 HOH 160 1161 160  HOH HOH A . 
I 8 HOH 161 1162 161  HOH HOH A . 
I 8 HOH 162 1163 162  HOH HOH A . 
I 8 HOH 163 1164 163  HOH HOH A . 
I 8 HOH 164 1165 164  HOH HOH A . 
I 8 HOH 165 1166 165  HOH HOH A . 
I 8 HOH 166 1167 166  HOH HOH A . 
I 8 HOH 167 1168 167  HOH HOH A . 
I 8 HOH 168 1169 168  HOH HOH A . 
I 8 HOH 169 1170 169  HOH HOH A . 
I 8 HOH 170 1171 170  HOH HOH A . 
I 8 HOH 171 1172 171  HOH HOH A . 
I 8 HOH 172 1173 172  HOH HOH A . 
I 8 HOH 173 1174 173  HOH HOH A . 
I 8 HOH 174 1175 174  HOH HOH A . 
I 8 HOH 175 1176 175  HOH HOH A . 
I 8 HOH 176 1177 176  HOH HOH A . 
I 8 HOH 177 1178 177  HOH HOH A . 
I 8 HOH 178 1179 178  HOH HOH A . 
I 8 HOH 179 1180 179  HOH HOH A . 
I 8 HOH 180 1181 180  HOH HOH A . 
I 8 HOH 181 1182 181  HOH HOH A . 
I 8 HOH 182 1183 182  HOH HOH A . 
I 8 HOH 183 1184 183  HOH HOH A . 
I 8 HOH 184 1185 184  HOH HOH A . 
I 8 HOH 185 1186 185  HOH HOH A . 
I 8 HOH 186 1187 186  HOH HOH A . 
I 8 HOH 187 1188 187  HOH HOH A . 
I 8 HOH 188 1189 188  HOH HOH A . 
I 8 HOH 189 1190 189  HOH HOH A . 
I 8 HOH 190 1191 190  HOH HOH A . 
I 8 HOH 191 1192 191  HOH HOH A . 
I 8 HOH 192 1193 192  HOH HOH A . 
I 8 HOH 193 1194 193  HOH HOH A . 
I 8 HOH 194 1195 194  HOH HOH A . 
I 8 HOH 195 1196 195  HOH HOH A . 
I 8 HOH 196 1197 196  HOH HOH A . 
I 8 HOH 197 1198 197  HOH HOH A . 
I 8 HOH 198 1199 198  HOH HOH A . 
I 8 HOH 199 1200 199  HOH HOH A . 
I 8 HOH 200 1201 200  HOH HOH A . 
I 8 HOH 201 1202 201  HOH HOH A . 
I 8 HOH 202 1203 202  HOH HOH A . 
I 8 HOH 203 1204 203  HOH HOH A . 
I 8 HOH 204 1205 204  HOH HOH A . 
I 8 HOH 205 1206 205  HOH HOH A . 
I 8 HOH 206 1207 206  HOH HOH A . 
I 8 HOH 207 1208 207  HOH HOH A . 
I 8 HOH 208 1209 208  HOH HOH A . 
I 8 HOH 209 1210 209  HOH HOH A . 
I 8 HOH 210 1211 210  HOH HOH A . 
I 8 HOH 211 1212 211  HOH HOH A . 
I 8 HOH 212 1213 212  HOH HOH A . 
I 8 HOH 213 1214 213  HOH HOH A . 
I 8 HOH 214 1215 214  HOH HOH A . 
I 8 HOH 215 1216 215  HOH HOH A . 
I 8 HOH 216 1217 216  HOH HOH A . 
I 8 HOH 217 1218 217  HOH HOH A . 
I 8 HOH 218 1219 218  HOH HOH A . 
I 8 HOH 219 1220 219  HOH HOH A . 
I 8 HOH 220 1221 220  HOH HOH A . 
I 8 HOH 221 1222 221  HOH HOH A . 
I 8 HOH 222 1223 222  HOH HOH A . 
I 8 HOH 223 1224 223  HOH HOH A . 
I 8 HOH 224 1225 224  HOH HOH A . 
I 8 HOH 225 1226 225  HOH HOH A . 
I 8 HOH 226 1227 226  HOH HOH A . 
I 8 HOH 227 1228 227  HOH HOH A . 
I 8 HOH 228 1229 228  HOH HOH A . 
I 8 HOH 229 1230 229  HOH HOH A . 
I 8 HOH 230 1231 230  HOH HOH A . 
I 8 HOH 231 1232 231  HOH HOH A . 
I 8 HOH 232 1233 232  HOH HOH A . 
I 8 HOH 233 1234 233  HOH HOH A . 
I 8 HOH 234 1235 234  HOH HOH A . 
I 8 HOH 235 1236 235  HOH HOH A . 
I 8 HOH 236 1237 236  HOH HOH A . 
I 8 HOH 237 1238 237  HOH HOH A . 
I 8 HOH 238 1239 238  HOH HOH A . 
I 8 HOH 239 1240 239  HOH HOH A . 
I 8 HOH 240 1241 240  HOH HOH A . 
I 8 HOH 241 1242 241  HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 457 A ASN 457 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-19 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Atomic model'              
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Non-polymer description'   
9 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_distant_solvent_atoms    
8  4 'Structure model' pdbx_entity_branch            
9  4 'Structure model' pdbx_entity_branch_descriptor 
10 4 'Structure model' pdbx_entity_branch_link       
11 4 'Structure model' pdbx_entity_branch_list       
12 4 'Structure model' pdbx_entity_nonpoly           
13 4 'Structure model' pdbx_nonpoly_scheme           
14 4 'Structure model' pdbx_struct_assembly_gen      
15 4 'Structure model' pdbx_unobs_or_zero_occ_atoms  
16 4 'Structure model' pdbx_validate_chiral          
17 4 'Structure model' struct_asym                   
18 4 'Structure model' struct_conn                   
19 4 'Structure model' struct_site                   
20 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.type_symbol'                 
14 4 'Structure model' '_chem_comp.formula'                     
15 4 'Structure model' '_chem_comp.formula_weight'              
16 4 'Structure model' '_chem_comp.id'                          
17 4 'Structure model' '_chem_comp.mon_nstd_flag'               
18 4 'Structure model' '_chem_comp.name'                        
19 4 'Structure model' '_chem_comp.pdbx_synonyms'               
20 4 'Structure model' '_chem_comp.type'                        
21 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS 'data scaling'   . ? 1 
XDS 'data reduction' . ? 2 
CNS refinement       . ? 3 
CNS phasing          . ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    CG2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    THR 
_pdbx_validate_symm_contact.auth_seq_id_1     535 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    CG2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    THR 
_pdbx_validate_symm_contact.auth_seq_id_2     535 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_675 
_pdbx_validate_symm_contact.dist              2.08 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_1             403 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_2             403 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.222 
_pdbx_validate_rmsd_bond.bond_target_value         1.474 
_pdbx_validate_rmsd_bond.bond_deviation            -0.252 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.014 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A PRO 232 ? ? N  A PRO 232 ? ? CD A PRO 232 ? ? 94.74  111.70 -16.96 1.40 N 
2 1 CA A PRO 283 ? ? N  A PRO 283 ? ? CD A PRO 283 ? ? 85.61  111.70 -26.09 1.40 N 
3 1 CB A PRO 283 ? ? CA A PRO 283 ? ? C  A PRO 283 ? ? 98.85  111.70 -12.85 2.10 N 
4 1 N  A PRO 283 ? ? CA A PRO 283 ? ? CB A PRO 283 ? ? 110.86 103.30 7.56   1.20 N 
5 1 N  A PRO 283 ? ? CD A PRO 283 ? ? CG A PRO 283 ? ? 112.39 103.20 9.19   1.50 N 
6 1 C  A ALA 336 ? ? N  A PRO 337 ? ? CD A PRO 337 ? ? 113.28 128.40 -15.12 2.10 Y 
7 1 CA A PRO 337 ? ? N  A PRO 337 ? ? CD A PRO 337 ? ? 89.02  111.70 -22.68 1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 11  ? ? -67.99  8.81    
2  1 SER A 25  ? ? -177.97 -174.76 
3  1 PRO A 39  ? ? -64.67  42.02   
4  1 PHE A 45  ? ? 89.31   -22.17  
5  1 ALA A 60  ? ? -119.15 58.67   
6  1 MET A 83  ? ? -69.32  0.04    
7  1 SER A 91  ? ? -172.64 141.95  
8  1 ASP A 93  ? ? -66.37  86.82   
9  1 CYS A 94  ? ? -140.34 12.06   
10 1 GLU A 140 ? ? 44.83   70.49   
11 1 PHE A 155 ? ? -142.10 15.29   
12 1 LEU A 158 ? ? -114.29 74.16   
13 1 ASN A 167 ? ? 56.58   10.12   
14 1 THR A 193 ? ? -148.32 58.88   
15 1 SER A 200 ? ? 54.08   -120.75 
16 1 ARG A 220 ? ? -92.67  -64.30  
17 1 ASN A 257 ? ? -31.27  -33.92  
18 1 ILE A 296 ? ? -66.22  94.13   
19 1 GLU A 299 ? ? -112.83 -74.90  
20 1 THR A 317 ? ? -148.77 -157.64 
21 1 ASP A 326 ? ? -116.81 66.68   
22 1 SER A 345 ? ? 38.23   53.24   
23 1 ASP A 380 ? ? -171.00 69.22   
24 1 VAL A 400 ? ? -128.61 -64.59  
25 1 ASN A 457 ? ? 34.87   57.32   
26 1 PRO A 485 ? ? -37.39  -34.54  
27 1 HIS A 486 ? ? -167.50 36.15   
28 1 ARG A 517 ? ? 39.70   36.21   
29 1 GLN A 526 ? ? -107.45 -62.60  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     515 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.290 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1 ? B NAG 1 ? 'WRONG HAND' . 
2 1 C1 ? C FUC 2 ? 'WRONG HAND' . 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 1103 ? 6.65 . 
2 1 O ? A HOH 1171 ? 6.71 . 
3 1 O ? A HOH 1179 ? 6.76 . 
4 1 O ? A HOH 1187 ? 6.09 . 
5 1 O ? A HOH 1216 ? 7.16 . 
6 1 O ? A HOH 1221 ? 6.16 . 
7 1 O ? A HOH 1222 ? 7.79 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 D NAG 1   ? O1 ? D NAG 1 O1 
2 1 N 1 A NAG 994 ? O1 ? E NAG 1 O1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A CYS 537 ? A CYS 537 
5  1 Y 1 A ASP 538 ? A ASP 538 
6  1 Y 1 A GLY 539 ? A GLY 539 
7  1 Y 1 A GLU 540 ? A GLU 540 
8  1 Y 1 A LEU 541 ? A LEU 541 
9  1 Y 1 A SER 542 ? A SER 542 
10 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 B NAG 999 n 
B 2 FUL 2 B FUL 2 B FUC 993 n 
C 3 NAG 1 C NAG 1 D NAG 997 n 
C 3 FUC 2 C FUC 2 D FUC 996 n 
D 4 NAG 1 D NAG 1 E NAG 995 n 
D 4 MAN 2 D MAN 2 E MAN 992 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
FUL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpb                         
FUL 'COMMON NAME'                         GMML     1.0 b-L-fucopyranose               
FUL 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-L-Fucp                       
FUL 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
4 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 LFucpb1-3DGlcpNAcb1-                                                 'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1b_1-5]/1-2/a3-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][a-D-GlcpNAc]{[(3+1)][b-L-Fucp]{}}}'                      LINUCS                      PDB-CARE   ?     
4 3 LFucpa1-3DGlcpNAcb1-                                                 'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2/a3-b1' WURCS                       PDB2Glycan 1.1.0 
6 3 '[]{[(4+1)][b-D-GlcpNAc]{[(3+1)][b-L-Fucp]{}}}'                      LINUCS                      PDB-CARE   ?     
7 4 DManpa1-4DGlcpNAcb1-ROH                                              'Glycam Condensed Sequence' GMML       1.0   
8 4 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1a_1-5]/1-2/a4-b1' WURCS                       PDB2Glycan 1.1.0 
9 4 '[][D-1-deoxy-GlcpNAc]{[(4+1)][a-D-Manp]{}}'                         LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 FUL C1 O1 1 NAG O3 HO3 sing ? 
2 3 2 FUC C1 O1 1 NAG O3 HO3 sing ? 
3 4 2 MAN C1 O1 1 NAG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 FUL 2 n 
3 NAG 1 n 
3 FUC 2 n 
4 NAG 1 n 
4 MAN 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
6 
;(4S)-4,11-DIETHYL-4-HYDROXY-3,14-DIOXO-3,4,12,14-TETRAHYDRO-1H-PYRANO[3',4':6,7]INDOLIZINO[1,2-B]QUINOLIN-9-YL 1,4'-BIPIPERIDINE-1'-CARBOXYLATE
;
CP0 
7 'IODIDE ION' IOD 
8 water HOH 
#