data_1UB5
# 
_entry.id   1UB5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UB5         
RCSB  RCSB005640   
WWPDB D_1000005640 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1UB6 
_pdbx_database_related.details        'Antibody 19G2 with sera ligand' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        1UB5 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-30 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Beuscher, A.B.' 1 
'Wirsching, P.'  2 
'Lerner, R.A.'   3 
'Janda, K.'      4 
'Stevens, R.C.'  5 
# 
_citation.id                        primary 
_citation.title                     
'Structure and Dynamics of Blue Fluorescent Antibody 19G2 at Blue and Violet Fluorescent Temperatures' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Beuscher, A.B.' 1 
primary 'Wirsching, P.'  2 
primary 'Lerner, R.A.'   3 
primary 'Janda, K.'      4 
primary 'Stevens, R.C.'  5 
# 
_cell.entry_id           1UB5 
_cell.length_a           195.933 
_cell.length_b           61.058 
_cell.length_c           92.589 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.05 
_cell.angle_gamma        90.00 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
# 
_symmetry.entry_id                         1UB5 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'antibody 19G2, alpha chain'                22215.088 2   ? ? ? ? 
2 polymer     man 'antibody 19G2, beta chain'                 23434.055 2   ? ? ? ? 
3 non-polymer syn '4-(4-STYRYL-PHENYLCARBAMOYL)-BUTYRIC ACID' 309.359   2   ? ? ? ? 
4 water       nat water                                       18.015    557 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EVKLLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPDSVAGRFTISRDNVRNILYL
QMSSLRSEDTALYYCARGQGRPYWGQGTLVTVSSAKTTPPSVYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGS
SVHTFPALLQSGLYTMSSSVTVPSSTWPSTVTCSVAHPASSTTVDKKLE
;
;EVKLLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPDSVAGRFTISRDNVRNILYL
QMSSLRSEDTALYYCARGQGRPYWGQGTLVTVSSAKTTPPSVYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGS
SVHTFPALLQSGLYTMSSSVTVPSSTWPSTVTCSVAHPASSTTVDKKLE
;
H,A ? 
2 'polypeptide(L)' no no 
;DIVMTQAAFSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPNRFSSSGSGTDFTLRI
SRVEAEDVGVYYCAQNLELPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF
;
;DIVMTQAAFSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPNRFSSSGSGTDFTLRI
SRVEAEDVGVYYCAQNLELPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF
;
L,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   VAL n 
1 3   LYS n 
1 4   LEU n 
1 5   LEU n 
1 6   GLU n 
1 7   SER n 
1 8   GLY n 
1 9   GLY n 
1 10  GLY n 
1 11  LEU n 
1 12  VAL n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  GLY n 
1 17  SER n 
1 18  LEU n 
1 19  LYS n 
1 20  LEU n 
1 21  SER n 
1 22  CYS n 
1 23  THR n 
1 24  ALA n 
1 25  SER n 
1 26  GLY n 
1 27  ILE n 
1 28  THR n 
1 29  PHE n 
1 30  SER n 
1 31  ARG n 
1 32  TYR n 
1 33  ILE n 
1 34  MET n 
1 35  SER n 
1 36  TRP n 
1 37  VAL n 
1 38  ARG n 
1 39  GLN n 
1 40  ILE n 
1 41  PRO n 
1 42  GLU n 
1 43  LYS n 
1 44  ARG n 
1 45  LEU n 
1 46  GLU n 
1 47  TRP n 
1 48  VAL n 
1 49  ALA n 
1 50  SER n 
1 51  ILE n 
1 52  SER n 
1 53  SER n 
1 54  GLY n 
1 55  GLY n 
1 56  ILE n 
1 57  THR n 
1 58  TYR n 
1 59  TYR n 
1 60  PRO n 
1 61  ASP n 
1 62  SER n 
1 63  VAL n 
1 64  ALA n 
1 65  GLY n 
1 66  ARG n 
1 67  PHE n 
1 68  THR n 
1 69  ILE n 
1 70  SER n 
1 71  ARG n 
1 72  ASP n 
1 73  ASN n 
1 74  VAL n 
1 75  ARG n 
1 76  ASN n 
1 77  ILE n 
1 78  LEU n 
1 79  TYR n 
1 80  LEU n 
1 81  GLN n 
1 82  MET n 
1 83  SER n 
1 84  SER n 
1 85  LEU n 
1 86  ARG n 
1 87  SER n 
1 88  GLU n 
1 89  ASP n 
1 90  THR n 
1 91  ALA n 
1 92  LEU n 
1 93  TYR n 
1 94  TYR n 
1 95  CYS n 
1 96  ALA n 
1 97  ARG n 
1 98  GLY n 
1 99  GLN n 
1 100 GLY n 
1 101 ARG n 
1 102 PRO n 
1 103 TYR n 
1 104 TRP n 
1 105 GLY n 
1 106 GLN n 
1 107 GLY n 
1 108 THR n 
1 109 LEU n 
1 110 VAL n 
1 111 THR n 
1 112 VAL n 
1 113 SER n 
1 114 SER n 
1 115 ALA n 
1 116 LYS n 
1 117 THR n 
1 118 THR n 
1 119 PRO n 
1 120 PRO n 
1 121 SER n 
1 122 VAL n 
1 123 TYR n 
1 124 PRO n 
1 125 ALA n 
1 126 ALA n 
1 127 PRO n 
1 128 GLY n 
1 129 CYS n 
1 130 GLY n 
1 131 ASP n 
1 132 THR n 
1 133 THR n 
1 134 GLY n 
1 135 SER n 
1 136 SER n 
1 137 VAL n 
1 138 THR n 
1 139 LEU n 
1 140 GLY n 
1 141 CYS n 
1 142 LEU n 
1 143 VAL n 
1 144 LYS n 
1 145 GLY n 
1 146 TYR n 
1 147 PHE n 
1 148 PRO n 
1 149 GLU n 
1 150 PRO n 
1 151 VAL n 
1 152 THR n 
1 153 VAL n 
1 154 THR n 
1 155 TRP n 
1 156 ASN n 
1 157 SER n 
1 158 GLY n 
1 159 GLY n 
1 160 SER n 
1 161 SER n 
1 162 VAL n 
1 163 HIS n 
1 164 THR n 
1 165 PHE n 
1 166 PRO n 
1 167 ALA n 
1 168 LEU n 
1 169 LEU n 
1 170 GLN n 
1 171 SER n 
1 172 GLY n 
1 173 LEU n 
1 174 TYR n 
1 175 THR n 
1 176 MET n 
1 177 SER n 
1 178 SER n 
1 179 SER n 
1 180 VAL n 
1 181 THR n 
1 182 VAL n 
1 183 PRO n 
1 184 SER n 
1 185 SER n 
1 186 THR n 
1 187 TRP n 
1 188 PRO n 
1 189 SER n 
1 190 THR n 
1 191 VAL n 
1 192 THR n 
1 193 CYS n 
1 194 SER n 
1 195 VAL n 
1 196 ALA n 
1 197 HIS n 
1 198 PRO n 
1 199 ALA n 
1 200 SER n 
1 201 SER n 
1 202 THR n 
1 203 THR n 
1 204 VAL n 
1 205 ASP n 
1 206 LYS n 
1 207 LYS n 
1 208 LEU n 
1 209 GLU n 
2 1   ASP n 
2 2   ILE n 
2 3   VAL n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   ALA n 
2 8   ALA n 
2 9   PHE n 
2 10  SER n 
2 11  ASN n 
2 12  PRO n 
2 13  VAL n 
2 14  THR n 
2 15  LEU n 
2 16  GLY n 
2 17  THR n 
2 18  SER n 
2 19  ALA n 
2 20  SER n 
2 21  ILE n 
2 22  SER n 
2 23  CYS n 
2 24  ARG n 
2 25  SER n 
2 26  THR n 
2 27  LYS n 
2 28  SER n 
2 29  LEU n 
2 30  LEU n 
2 31  HIS n 
2 32  SER n 
2 33  ASN n 
2 34  GLY n 
2 35  ILE n 
2 36  THR n 
2 37  TYR n 
2 38  LEU n 
2 39  TYR n 
2 40  TRP n 
2 41  TYR n 
2 42  LEU n 
2 43  GLN n 
2 44  LYS n 
2 45  PRO n 
2 46  GLY n 
2 47  GLN n 
2 48  SER n 
2 49  PRO n 
2 50  GLN n 
2 51  LEU n 
2 52  LEU n 
2 53  ILE n 
2 54  TYR n 
2 55  GLN n 
2 56  MET n 
2 57  SER n 
2 58  ASN n 
2 59  LEU n 
2 60  ALA n 
2 61  SER n 
2 62  GLY n 
2 63  VAL n 
2 64  PRO n 
2 65  ASN n 
2 66  ARG n 
2 67  PHE n 
2 68  SER n 
2 69  SER n 
2 70  SER n 
2 71  GLY n 
2 72  SER n 
2 73  GLY n 
2 74  THR n 
2 75  ASP n 
2 76  PHE n 
2 77  THR n 
2 78  LEU n 
2 79  ARG n 
2 80  ILE n 
2 81  SER n 
2 82  ARG n 
2 83  VAL n 
2 84  GLU n 
2 85  ALA n 
2 86  GLU n 
2 87  ASP n 
2 88  VAL n 
2 89  GLY n 
2 90  VAL n 
2 91  TYR n 
2 92  TYR n 
2 93  CYS n 
2 94  ALA n 
2 95  GLN n 
2 96  ASN n 
2 97  LEU n 
2 98  GLU n 
2 99  LEU n 
2 100 PRO n 
2 101 PRO n 
2 102 THR n 
2 103 PHE n 
2 104 GLY n 
2 105 GLY n 
2 106 GLY n 
2 107 THR n 
2 108 LYS n 
2 109 LEU n 
2 110 GLU n 
2 111 ILE n 
2 112 LYS n 
2 113 ARG n 
2 114 ALA n 
2 115 ASP n 
2 116 ALA n 
2 117 ALA n 
2 118 PRO n 
2 119 THR n 
2 120 VAL n 
2 121 SER n 
2 122 ILE n 
2 123 PHE n 
2 124 PRO n 
2 125 PRO n 
2 126 SER n 
2 127 SER n 
2 128 GLU n 
2 129 GLN n 
2 130 LEU n 
2 131 THR n 
2 132 SER n 
2 133 GLY n 
2 134 GLY n 
2 135 ALA n 
2 136 SER n 
2 137 VAL n 
2 138 VAL n 
2 139 CYS n 
2 140 PHE n 
2 141 LEU n 
2 142 ASN n 
2 143 ASN n 
2 144 PHE n 
2 145 TYR n 
2 146 PRO n 
2 147 LYS n 
2 148 ASP n 
2 149 ILE n 
2 150 ASN n 
2 151 VAL n 
2 152 LYS n 
2 153 TRP n 
2 154 LYS n 
2 155 ILE n 
2 156 ASP n 
2 157 GLY n 
2 158 SER n 
2 159 GLU n 
2 160 ARG n 
2 161 GLN n 
2 162 ASN n 
2 163 GLY n 
2 164 VAL n 
2 165 LEU n 
2 166 ASN n 
2 167 SER n 
2 168 TRP n 
2 169 THR n 
2 170 ASP n 
2 171 GLN n 
2 172 ASP n 
2 173 SER n 
2 174 LYS n 
2 175 ASP n 
2 176 SER n 
2 177 THR n 
2 178 TYR n 
2 179 SER n 
2 180 MET n 
2 181 SER n 
2 182 SER n 
2 183 THR n 
2 184 LEU n 
2 185 THR n 
2 186 LEU n 
2 187 THR n 
2 188 LYS n 
2 189 ASP n 
2 190 GLU n 
2 191 TYR n 
2 192 GLU n 
2 193 ARG n 
2 194 HIS n 
2 195 ASN n 
2 196 GLY n 
2 197 TYR n 
2 198 THR n 
2 199 CYS n 
2 200 GLU n 
2 201 ALA n 
2 202 THR n 
2 203 HIS n 
2 204 LYS n 
2 205 THR n 
2 206 SER n 
2 207 THR n 
2 208 SER n 
2 209 PRO n 
2 210 ILE n 
2 211 VAL n 
2 212 LYS n 
2 213 SER n 
2 214 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? 
? ? ? ? ? ? 'hybridoma cell' ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? 
? ? ? ? ? ? 'hybridoma cell' ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP HV56_MOUSE P18527 1 1 ? ? 
2 PDB 1UB5       1UB5   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UB5 H 1 ? 97  ? P18527 1 ? 97  ? 1 99  
2 1 1UB5 A 1 ? 97  ? P18527 1 ? 97  ? 1 99  
3 2 1UB5 L 1 ? 214 ? 1UB5   1 ? 214 ? 1 214 
4 2 1UB5 B 1 ? 214 ? 1UB5   1 ? 214 ? 1 214 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                    ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                       ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                  ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                      ? 'C3 H7 N O3'     105.093 
SPB non-polymer         . '4-(4-STYRYL-PHENYLCARBAMOYL)-BUTYRIC ACID' 
'5-OXO-5-({4-[(E)-2-PHENYLVINYL]PHENYL}AMINO)PENTANOIC ACID; N-(TRANS-4-STILBENYL)-5-AMINO-5-OXO-PENTANOIC ACID' 'C19 H19 N O3'   
309.359 
THR 'L-peptide linking' y THREONINE                                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                      ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1UB5 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.62 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    'PEG2000, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
# 
_reflns.entry_id                     1UB5 
_reflns.d_resolution_high            1.89 
_reflns.d_resolution_low             19.89 
_reflns.limit_h_max                  92 
_reflns.limit_h_min                  -103 
_reflns.limit_k_max                  32 
_reflns.limit_k_min                  -103 
_reflns.limit_l_max                  48 
_reflns.limit_l_min                  0 
_reflns.number_all                   76903 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_F_max     211600.69 
_reflns.observed_criterion_F_min     0.320000 
_reflns.B_iso_Wilson_estimate        17.6 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_obs                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1UB5 
_refine.ls_number_reflns_all                     66117 
_refine.ls_number_reflns_obs                     63535 
_refine.ls_percent_reflns_obs                    96.1 
_refine.ls_d_res_high                            2.00 
_refine.ls_d_res_low                             19.89 
_refine.B_iso_min                                9.20 
_refine.B_iso_max                                105.27 
_refine.B_iso_mean                               44.80 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            -1.11 
_refine.aniso_B[2][2]                            -0.62 
_refine.aniso_B[3][3]                            1.73 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.04 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_param_bsol                 53.4994 
_refine.solvent_model_param_ksol                 0.359855 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.248 
_refine.ls_R_factor_R_free                       0.267 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_number_reflns_R_free                  3207 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.pdbx_ls_sigma_F                          -3 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.details                                  ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1UB5 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     2.00 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6414 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             557 
_refine_hist.number_atoms_total               7017 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        19.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.2  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.75  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
2.00 2.09  8255 7626 7220 92.4 0.291 0.29  0.014 406 4.9 8 . 'X-RAY DIFFRACTION' . 
2.09 2.20  8208 7691 7301 93.7 0.272 0.272 0.014 390 4.8 8 . 'X-RAY DIFFRACTION' . 
2.20 2.34  8236 7530 7169 91.4 0.306 0.306 0.016 361 4.4 8 . 'X-RAY DIFFRACTION' . 
2.34 2.52  8241 7966 7582 96.7 0.275 0.275 0.014 384 4.7 8 . 'X-RAY DIFFRACTION' . 
2.52 2.77  8250 8059 7652 97.7 0.258 0.257 0.013 407 4.9 8 . 'X-RAY DIFFRACTION' . 
2.77 3.17  8259 8149 7708 98.7 0.269 0.27  0.013 441 5.3 8 . 'X-RAY DIFFRACTION' . 
3.17 3.99  8303 8216 7800 99.0 0.245 0.246 0.012 416 5.0 8 . 'X-RAY DIFFRACTION' . 
3.99 19.89 8447 8298 7896 98.2 0.207 0.206 0.010 402 4.8 8 . 'X-RAY DIFFRACTION' . 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param  protein.top      'X-RAY DIFFRACTION' 
2 carbohydrate.param carbohydrate.top 'X-RAY DIFFRACTION' 
3 fra.param          fra.top          'X-RAY DIFFRACTION' 
4 water_rep.param    water.top        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1UB5 
_struct.title                     'Crystal structure of Antibody 19G2 with hapten at 100K' 
_struct.pdbx_descriptor           'Antibody 19G2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UB5 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'antibody fluorscence dynamics, sera ligand, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 28  ? TYR A 32  ? THR H 28  TYR H 34  5 ? 5 
HELX_P HELX_P2  2  ARG A 86  ? THR A 90  ? ARG H 88  THR H 92  5 ? 5 
HELX_P HELX_P3  3  PRO A 183 ? TRP A 187 ? PRO H 187 TRP H 191 5 ? 5 
HELX_P HELX_P4  4  PRO A 198 ? SER A 201 ? PRO H 203 SER H 206 5 ? 4 
HELX_P HELX_P5  5  GLU B 84  ? VAL B 88  ? GLU L 84  VAL L 88  5 ? 5 
HELX_P HELX_P6  6  SER B 126 ? THR B 131 ? SER L 126 THR L 131 1 ? 6 
HELX_P HELX_P7  7  LYS B 188 ? ARG B 193 ? LYS L 188 ARG L 193 1 ? 6 
HELX_P HELX_P8  8  THR C 28  ? TYR C 32  ? THR A 28  TYR A 34  5 ? 5 
HELX_P HELX_P9  9  ARG C 86  ? THR C 90  ? ARG A 88  THR A 92  5 ? 5 
HELX_P HELX_P10 10 PRO C 183 ? TRP C 187 ? PRO A 187 TRP A 191 5 ? 5 
HELX_P HELX_P11 11 PRO C 198 ? SER C 201 ? PRO A 203 SER A 206 5 ? 4 
HELX_P HELX_P12 12 GLU D 84  ? VAL D 88  ? GLU B 84  VAL B 88  5 ? 5 
HELX_P HELX_P13 13 SER D 126 ? THR D 131 ? SER B 126 THR B 131 1 ? 6 
HELX_P HELX_P14 14 LYS D 188 ? ARG D 193 ? LYS B 188 ARG B 193 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG ? ? ? 1_555 A CYS 95  SG ? ? H CYS 22  H CYS 97  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? A CYS 141 SG ? ? ? 1_555 A CYS 193 SG ? ? H CYS 143 H CYS 198 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf3 disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 93  SG ? ? L CYS 23  L CYS 93  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4 disulf ? ? B CYS 139 SG ? ? ? 1_555 B CYS 199 SG ? ? L CYS 139 L CYS 199 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf5 disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 95  SG ? ? A CYS 22  A CYS 97  1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf6 disulf ? ? C CYS 141 SG ? ? ? 1_555 C CYS 193 SG ? ? A CYS 143 A CYS 198 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf7 disulf ? ? D CYS 23  SG ? ? ? 1_555 D CYS 93  SG ? ? B CYS 23  B CYS 93  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf8 disulf ? ? D CYS 139 SG ? ? ? 1_555 D CYS 199 SG ? ? B CYS 139 B CYS 199 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 147 A . ? PHE 149 H PRO 148 A ? PRO 150 H 1 -0.07 
2 LEU 99  B . ? LEU 99  L PRO 100 B ? PRO 100 L 1 -0.28 
3 TYR 145 B . ? TYR 145 L PRO 146 B ? PRO 146 L 1 0.19  
4 PHE 147 C . ? PHE 149 A PRO 148 C ? PRO 150 A 1 -0.01 
5 LEU 99  D . ? LEU 99  B PRO 100 D ? PRO 100 B 1 -0.21 
6 TYR 145 D . ? TYR 145 B PRO 146 D ? PRO 146 B 1 0.03  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 6 ? 
D ? 4 ? 
E ? 4 ? 
F ? 3 ? 
G ? 4 ? 
H ? 2 ? 
I ? 5 ? 
J ? 5 ? 
K ? 4 ? 
L ? 4 ? 
M ? 4 ? 
N ? 5 ? 
O ? 6 ? 
P ? 4 ? 
Q ? 4 ? 
R ? 3 ? 
S ? 4 ? 
T ? 5 ? 
U ? 5 ? 
V ? 4 ? 
W ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
T 4 5 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
U 4 5 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 3   ? SER A 7   ? LYS H 3   SER H 7   
A 2 LEU A 18  ? SER A 25  ? LEU H 18  SER H 25  
A 3 ILE A 77  ? MET A 82  ? ILE H 79  MET H 84  
A 4 PHE A 67  ? ASP A 72  ? PHE H 69  ASP H 74  
B 1 THR A 57  ? TYR A 58  ? THR H 59  TYR H 60  
B 2 GLU A 46  ? ILE A 51  ? GLU H 48  ILE H 53  
B 3 MET A 34  ? GLN A 39  ? MET H 36  GLN H 41  
B 4 ALA A 91  ? ARG A 97  ? ALA H 93  ARG H 99  
B 5 TYR A 103 ? TRP A 104 ? TYR H 105 TRP H 106 
C 1 THR A 57  ? TYR A 58  ? THR H 59  TYR H 60  
C 2 GLU A 46  ? ILE A 51  ? GLU H 48  ILE H 53  
C 3 MET A 34  ? GLN A 39  ? MET H 36  GLN H 41  
C 4 ALA A 91  ? ARG A 97  ? ALA H 93  ARG H 99  
C 5 THR A 108 ? VAL A 112 ? THR H 110 VAL H 114 
C 6 GLY A 10  ? VAL A 12  ? GLY H 10  VAL H 12  
D 1 SER A 121 ? ALA A 125 ? SER H 123 ALA H 127 
D 2 VAL A 137 ? TYR A 146 ? VAL H 139 TYR H 148 
D 3 LEU A 173 ? VAL A 182 ? LEU H 177 VAL H 186 
D 4 HIS A 163 ? THR A 164 ? HIS H 167 THR H 168 
E 1 SER A 121 ? ALA A 125 ? SER H 123 ALA H 127 
E 2 VAL A 137 ? TYR A 146 ? VAL H 139 TYR H 148 
E 3 LEU A 173 ? VAL A 182 ? LEU H 177 VAL H 186 
E 4 LEU A 168 ? GLN A 170 ? LEU H 172 GLN H 174 
F 1 THR A 152 ? TRP A 155 ? THR H 154 TRP H 157 
F 2 THR A 192 ? HIS A 197 ? THR H 197 HIS H 202 
F 3 THR A 202 ? LYS A 207 ? THR H 207 LYS H 212 
G 1 MET B 4   ? THR B 5   ? MET L 4   THR L 5   
G 2 ALA B 19  ? SER B 25  ? ALA L 19  SER L 25  
G 3 ASP B 75  ? ILE B 80  ? ASP L 75  ILE L 80  
G 4 PHE B 67  ? GLY B 71  ? PHE L 67  GLY L 71  
H 1 VAL B 13  ? THR B 14  ? VAL L 13  THR L 14  
H 2 ILE B 111 ? LYS B 112 ? ILE L 111 LYS L 112 
I 1 ASN B 58  ? LEU B 59  ? ASN L 58  LEU L 59  
I 2 GLN B 50  ? TYR B 54  ? GLN L 50  TYR L 54  
I 3 LEU B 38  ? GLN B 43  ? LEU L 38  GLN L 43  
I 4 GLY B 89  ? GLN B 95  ? GLY L 89  GLN L 95  
I 5 THR B 102 ? PHE B 103 ? THR L 102 PHE L 103 
J 1 ASN B 58  ? LEU B 59  ? ASN L 58  LEU L 59  
J 2 GLN B 50  ? TYR B 54  ? GLN L 50  TYR L 54  
J 3 LEU B 38  ? GLN B 43  ? LEU L 38  GLN L 43  
J 4 GLY B 89  ? GLN B 95  ? GLY L 89  GLN L 95  
J 5 THR B 107 ? LEU B 109 ? THR L 107 LEU L 109 
K 1 THR B 119 ? PHE B 123 ? THR L 119 PHE L 123 
K 2 GLY B 134 ? PHE B 144 ? GLY L 134 PHE L 144 
K 3 TYR B 178 ? THR B 187 ? TYR L 178 THR L 187 
K 4 VAL B 164 ? TRP B 168 ? VAL L 164 TRP L 168 
L 1 SER B 158 ? GLU B 159 ? SER L 158 GLU L 159 
L 2 ASN B 150 ? ILE B 155 ? ASN L 150 ILE L 155 
L 3 TYR B 197 ? THR B 202 ? TYR L 197 THR L 202 
L 4 ILE B 210 ? PHE B 214 ? ILE L 210 PHE L 214 
M 1 LYS C 3   ? SER C 7   ? LYS A 3   SER A 7   
M 2 LEU C 18  ? SER C 25  ? LEU A 18  SER A 25  
M 3 ILE C 77  ? MET C 82  ? ILE A 79  MET A 84  
M 4 PHE C 67  ? ASP C 72  ? PHE A 69  ASP A 74  
N 1 THR C 57  ? TYR C 58  ? THR A 59  TYR A 60  
N 2 GLU C 46  ? ILE C 51  ? GLU A 48  ILE A 53  
N 3 MET C 34  ? GLN C 39  ? MET A 36  GLN A 41  
N 4 ALA C 91  ? ARG C 97  ? ALA A 93  ARG A 99  
N 5 TYR C 103 ? TRP C 104 ? TYR A 105 TRP A 106 
O 1 THR C 57  ? TYR C 58  ? THR A 59  TYR A 60  
O 2 GLU C 46  ? ILE C 51  ? GLU A 48  ILE A 53  
O 3 MET C 34  ? GLN C 39  ? MET A 36  GLN A 41  
O 4 ALA C 91  ? ARG C 97  ? ALA A 93  ARG A 99  
O 5 THR C 108 ? VAL C 112 ? THR A 110 VAL A 114 
O 6 GLY C 10  ? VAL C 12  ? GLY A 10  VAL A 12  
P 1 SER C 121 ? ALA C 125 ? SER A 123 ALA A 127 
P 2 VAL C 137 ? TYR C 146 ? VAL A 139 TYR A 148 
P 3 LEU C 173 ? VAL C 182 ? LEU A 177 VAL A 186 
P 4 HIS C 163 ? THR C 164 ? HIS A 167 THR A 168 
Q 1 SER C 121 ? ALA C 125 ? SER A 123 ALA A 127 
Q 2 VAL C 137 ? TYR C 146 ? VAL A 139 TYR A 148 
Q 3 LEU C 173 ? VAL C 182 ? LEU A 177 VAL A 186 
Q 4 LEU C 168 ? GLN C 170 ? LEU A 172 GLN A 174 
R 1 THR C 152 ? TRP C 155 ? THR A 154 TRP A 157 
R 2 THR C 192 ? HIS C 197 ? THR A 197 HIS A 202 
R 3 THR C 202 ? LYS C 207 ? THR A 207 LYS A 212 
S 1 MET D 4   ? THR D 5   ? MET B 4   THR B 5   
S 2 ALA D 19  ? SER D 25  ? ALA B 19  SER B 25  
S 3 ASP D 75  ? ILE D 80  ? ASP B 75  ILE B 80  
S 4 PHE D 67  ? GLY D 71  ? PHE B 67  GLY B 71  
T 1 ASN D 58  ? LEU D 59  ? ASN B 58  LEU B 59  
T 2 GLN D 50  ? TYR D 54  ? GLN B 50  TYR B 54  
T 3 LEU D 38  ? GLN D 43  ? LEU B 38  GLN B 43  
T 4 GLY D 89  ? GLN D 95  ? GLY B 89  GLN B 95  
T 5 THR D 102 ? PHE D 103 ? THR B 102 PHE B 103 
U 1 ASN D 58  ? LEU D 59  ? ASN B 58  LEU B 59  
U 2 GLN D 50  ? TYR D 54  ? GLN B 50  TYR B 54  
U 3 LEU D 38  ? GLN D 43  ? LEU B 38  GLN B 43  
U 4 GLY D 89  ? GLN D 95  ? GLY B 89  GLN B 95  
U 5 THR D 107 ? LEU D 109 ? THR B 107 LEU B 109 
V 1 THR D 119 ? PHE D 123 ? THR B 119 PHE B 123 
V 2 GLY D 134 ? PHE D 144 ? GLY B 134 PHE B 144 
V 3 TYR D 178 ? THR D 187 ? TYR B 178 THR B 187 
V 4 VAL D 164 ? TRP D 168 ? VAL B 164 TRP B 168 
W 1 SER D 158 ? GLU D 159 ? SER B 158 GLU B 159 
W 2 ASN D 150 ? ILE D 155 ? ASN B 150 ILE B 155 
W 3 TYR D 197 ? THR D 202 ? TYR B 197 THR B 202 
W 4 ILE D 210 ? PHE D 214 ? ILE B 210 PHE B 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 5   ? N LEU H 5   O THR A 23  ? O THR H 23  
A 2 3 N LEU A 18  ? N LEU H 18  O MET A 82  ? O MET H 84  
A 3 4 O TYR A 79  ? O TYR H 81  N SER A 70  ? N SER H 72  
B 1 2 O TYR A 58  ? O TYR H 60  N SER A 50  ? N SER H 52  
B 2 3 O GLU A 46  ? O GLU H 48  N ARG A 38  ? N ARG H 40  
B 3 4 N VAL A 37  ? N VAL H 39  O TYR A 94  ? O TYR H 96  
B 4 5 N ARG A 97  ? N ARG H 99  O TYR A 103 ? O TYR H 105 
C 1 2 O TYR A 58  ? O TYR H 60  N SER A 50  ? N SER H 52  
C 2 3 O GLU A 46  ? O GLU H 48  N ARG A 38  ? N ARG H 40  
C 3 4 N VAL A 37  ? N VAL H 39  O TYR A 94  ? O TYR H 96  
C 4 5 N TYR A 93  ? N TYR H 95  O THR A 108 ? O THR H 110 
C 5 6 O THR A 111 ? O THR H 113 N VAL A 12  ? N VAL H 12  
D 1 2 N TYR A 123 ? N TYR H 125 O LEU A 142 ? O LEU H 144 
D 2 3 N VAL A 143 ? N VAL H 145 O MET A 176 ? O MET H 180 
D 3 4 O SER A 179 ? O SER H 183 N HIS A 163 ? N HIS H 167 
E 1 2 N TYR A 123 ? N TYR H 125 O LEU A 142 ? O LEU H 144 
E 2 3 N VAL A 143 ? N VAL H 145 O MET A 176 ? O MET H 180 
E 3 4 O LEU A 173 ? O LEU H 177 N GLN A 170 ? N GLN H 174 
F 1 2 N THR A 154 ? N THR H 156 O SER A 194 ? O SER H 199 
F 2 3 N VAL A 195 ? N VAL H 200 O VAL A 204 ? O VAL H 209 
G 1 2 N THR B 5   ? N THR L 5   O ARG B 24  ? O ARG L 24  
G 2 3 N ILE B 21  ? N ILE L 21  O LEU B 78  ? O LEU L 78  
G 3 4 O ARG B 79  ? O ARG L 79  N SER B 68  ? N SER L 68  
H 1 2 N VAL B 13  ? N VAL L 13  O LYS B 112 ? O LYS L 112 
I 1 2 O ASN B 58  ? O ASN L 58  N TYR B 54  ? N TYR L 54  
I 2 3 O GLN B 50  ? O GLN L 50  N LEU B 42  ? N LEU L 42  
I 3 4 N TYR B 41  ? N TYR L 41  O TYR B 92  ? O TYR L 92  
I 4 5 N GLN B 95  ? N GLN L 95  O THR B 102 ? O THR L 102 
J 1 2 O ASN B 58  ? O ASN L 58  N TYR B 54  ? N TYR L 54  
J 2 3 O GLN B 50  ? O GLN L 50  N LEU B 42  ? N LEU L 42  
J 3 4 N TYR B 41  ? N TYR L 41  O TYR B 92  ? O TYR L 92  
J 4 5 N GLY B 89  ? N GLY L 89  O LEU B 109 ? O LEU L 109 
K 1 2 N PHE B 123 ? N PHE L 123 O VAL B 138 ? O VAL L 138 
K 2 3 N PHE B 144 ? N PHE L 144 O TYR B 178 ? O TYR L 178 
K 3 4 O THR B 183 ? O THR L 183 N LEU B 165 ? N LEU L 165 
L 1 2 O SER B 158 ? O SER L 158 N ILE B 155 ? N ILE L 155 
L 2 3 N LYS B 152 ? N LYS L 152 O GLU B 200 ? O GLU L 200 
L 3 4 N CYS B 199 ? N CYS L 199 O LYS B 212 ? O LYS L 212 
M 1 2 N LEU C 5   ? N LEU A 5   O THR C 23  ? O THR A 23  
M 2 3 N LEU C 18  ? N LEU A 18  O MET C 82  ? O MET A 84  
M 3 4 O TYR C 79  ? O TYR A 81  N SER C 70  ? N SER A 72  
N 1 2 O TYR C 58  ? O TYR A 60  N SER C 50  ? N SER A 52  
N 2 3 O GLU C 46  ? O GLU A 48  N ARG C 38  ? N ARG A 40  
N 3 4 N VAL C 37  ? N VAL A 39  O TYR C 94  ? O TYR A 96  
N 4 5 N ARG C 97  ? N ARG A 99  O TYR C 103 ? O TYR A 105 
O 1 2 O TYR C 58  ? O TYR A 60  N SER C 50  ? N SER A 52  
O 2 3 O GLU C 46  ? O GLU A 48  N ARG C 38  ? N ARG A 40  
O 3 4 N VAL C 37  ? N VAL A 39  O TYR C 94  ? O TYR A 96  
O 4 5 N ALA C 91  ? N ALA A 93  O VAL C 110 ? O VAL A 112 
O 5 6 O THR C 111 ? O THR A 113 N VAL C 12  ? N VAL A 12  
P 1 2 N TYR C 123 ? N TYR A 125 O LEU C 142 ? O LEU A 144 
P 2 3 N VAL C 143 ? N VAL A 145 O MET C 176 ? O MET A 180 
P 3 4 O SER C 179 ? O SER A 183 N HIS C 163 ? N HIS A 167 
Q 1 2 N TYR C 123 ? N TYR A 125 O LEU C 142 ? O LEU A 144 
Q 2 3 N VAL C 143 ? N VAL A 145 O MET C 176 ? O MET A 180 
Q 3 4 O LEU C 173 ? O LEU A 177 N GLN C 170 ? N GLN A 174 
R 1 2 N THR C 154 ? N THR A 156 O SER C 194 ? O SER A 199 
R 2 3 N VAL C 195 ? N VAL A 200 O VAL C 204 ? O VAL A 209 
S 1 2 N THR D 5   ? N THR B 5   O ARG D 24  ? O ARG B 24  
S 2 3 N ILE D 21  ? N ILE B 21  O LEU D 78  ? O LEU B 78  
S 3 4 O ARG D 79  ? O ARG B 79  N SER D 68  ? N SER B 68  
T 1 2 O ASN D 58  ? O ASN B 58  N TYR D 54  ? N TYR B 54  
T 2 3 O GLN D 50  ? O GLN B 50  N LEU D 42  ? N LEU B 42  
T 3 4 N TYR D 41  ? N TYR B 41  O TYR D 92  ? O TYR B 92  
T 4 5 N GLN D 95  ? N GLN B 95  O THR D 102 ? O THR B 102 
U 1 2 O ASN D 58  ? O ASN B 58  N TYR D 54  ? N TYR B 54  
U 2 3 O GLN D 50  ? O GLN B 50  N LEU D 42  ? N LEU B 42  
U 3 4 N TYR D 41  ? N TYR B 41  O TYR D 92  ? O TYR B 92  
U 4 5 N GLY D 89  ? N GLY B 89  O LEU D 109 ? O LEU B 109 
V 1 2 N PHE D 123 ? N PHE B 123 O VAL D 138 ? O VAL B 138 
V 2 3 N PHE D 144 ? N PHE B 144 O TYR D 178 ? O TYR B 178 
V 3 4 O THR D 183 ? O THR B 183 N LEU D 165 ? N LEU B 165 
W 1 2 O SER D 158 ? O SER B 158 N ILE D 155 ? N ILE B 155 
W 2 3 N LYS D 152 ? N LYS B 152 O GLU D 200 ? O GLU B 200 
W 3 4 N CYS D 199 ? N CYS B 199 O LYS D 212 ? O LYS B 212 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE SPB H 601' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE SPB B 701' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ILE A 33  ? ILE H 35  . ? 1_555 ? 
2  AC1 13 SER A 35  ? SER H 37  . ? 1_555 ? 
3  AC1 13 GLY A 98  ? GLY H 100 . ? 1_555 ? 
4  AC1 13 GLN A 99  ? GLN H 101 . ? 1_555 ? 
5  AC1 13 TRP A 104 ? TRP H 106 . ? 1_555 ? 
6  AC1 13 HOH G .   ? HOH H 602 . ? 1_555 ? 
7  AC1 13 HOH G .   ? HOH H 673 . ? 1_555 ? 
8  AC1 13 TYR B 39  ? TYR L 39  . ? 1_555 ? 
9  AC1 13 ASN B 96  ? ASN L 96  . ? 1_555 ? 
10 AC1 13 LEU B 97  ? LEU L 97  . ? 1_555 ? 
11 AC1 13 PRO B 101 ? PRO L 101 . ? 1_555 ? 
12 AC1 13 PHE B 103 ? PHE L 103 . ? 1_555 ? 
13 AC1 13 HOH H .   ? HOH L 221 . ? 1_555 ? 
14 AC2 15 ILE C 33  ? ILE A 35  . ? 1_555 ? 
15 AC2 15 SER C 35  ? SER A 37  . ? 1_555 ? 
16 AC2 15 ALA C 96  ? ALA A 98  . ? 1_555 ? 
17 AC2 15 GLY C 98  ? GLY A 100 . ? 1_555 ? 
18 AC2 15 GLN C 99  ? GLN A 101 . ? 1_555 ? 
19 AC2 15 TRP C 104 ? TRP A 106 . ? 1_555 ? 
20 AC2 15 HOH I .   ? HOH A 217 . ? 1_555 ? 
21 AC2 15 TYR D 39  ? TYR B 39  . ? 1_555 ? 
22 AC2 15 ASN D 96  ? ASN B 96  . ? 1_555 ? 
23 AC2 15 LEU D 97  ? LEU B 97  . ? 1_555 ? 
24 AC2 15 GLU D 98  ? GLU B 98  . ? 1_555 ? 
25 AC2 15 PRO D 101 ? PRO B 101 . ? 1_555 ? 
26 AC2 15 PHE D 103 ? PHE B 103 . ? 1_555 ? 
27 AC2 15 HOH J .   ? HOH B 702 . ? 1_555 ? 
28 AC2 15 HOH J .   ? HOH B 830 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1UB5 
_atom_sites.fract_transf_matrix[1][1]   0.005104 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002606 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016378 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012127 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 47.840 -4.111  -45.201 1.00 55.43  ? 1   GLU H N   1 
ATOM   2    C CA  . GLU A 1 1   ? 48.177 -3.192  -44.080 1.00 54.04  ? 1   GLU H CA  1 
ATOM   3    C C   . GLU A 1 1   ? 49.279 -3.787  -43.217 1.00 48.48  ? 1   GLU H C   1 
ATOM   4    O O   . GLU A 1 1   ? 49.616 -4.961  -43.342 1.00 48.78  ? 1   GLU H O   1 
ATOM   5    C CB  . GLU A 1 1   ? 46.945 -2.936  -43.204 1.00 61.01  ? 1   GLU H CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 46.261 -4.208  -42.707 1.00 70.33  ? 1   GLU H CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 45.330 -3.962  -41.528 1.00 74.76  ? 1   GLU H CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 44.532 -3.000  -41.576 1.00 77.65  ? 1   GLU H OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 45.391 -4.742  -40.552 1.00 75.87  ? 1   GLU H OE2 1 
ATOM   10   N N   . VAL A 1 2   ? 49.845 -2.963  -42.347 1.00 40.25  ? 2   VAL H N   1 
ATOM   11   C CA  . VAL A 1 2   ? 50.888 -3.417  -41.446 1.00 36.19  ? 2   VAL H CA  1 
ATOM   12   C C   . VAL A 1 2   ? 50.572 -2.877  -40.062 1.00 36.02  ? 2   VAL H C   1 
ATOM   13   O O   . VAL A 1 2   ? 50.501 -1.662  -39.863 1.00 31.84  ? 2   VAL H O   1 
ATOM   14   C CB  . VAL A 1 2   ? 52.277 -2.911  -41.875 1.00 37.17  ? 2   VAL H CB  1 
ATOM   15   C CG1 . VAL A 1 2   ? 53.337 -3.469  -40.945 1.00 35.65  ? 2   VAL H CG1 1 
ATOM   16   C CG2 . VAL A 1 2   ? 52.562 -3.323  -43.304 1.00 36.43  ? 2   VAL H CG2 1 
ATOM   17   N N   . LYS A 1 3   ? 50.356 -3.783  -39.114 1.00 33.99  ? 3   LYS H N   1 
ATOM   18   C CA  . LYS A 1 3   ? 50.062 -3.381  -37.747 1.00 36.25  ? 3   LYS H CA  1 
ATOM   19   C C   . LYS A 1 3   ? 50.263 -4.516  -36.748 1.00 35.38  ? 3   LYS H C   1 
ATOM   20   O O   . LYS A 1 3   ? 50.140 -5.696  -37.085 1.00 37.99  ? 3   LYS H O   1 
ATOM   21   C CB  . LYS A 1 3   ? 48.630 -2.859  -37.644 1.00 36.29  ? 3   LYS H CB  1 
ATOM   22   C CG  . LYS A 1 3   ? 47.579 -3.858  -38.069 1.00 46.21  ? 3   LYS H CG  1 
ATOM   23   C CD  . LYS A 1 3   ? 46.171 -3.270  -38.002 1.00 52.50  ? 3   LYS H CD  1 
ATOM   24   C CE  . LYS A 1 3   ? 45.688 -3.092  -36.571 1.00 57.05  ? 3   LYS H CE  1 
ATOM   25   N NZ  . LYS A 1 3   ? 46.516 -2.121  -35.807 1.00 64.36  ? 3   LYS H NZ  1 
ATOM   26   N N   . LEU A 1 4   ? 50.592 -4.142  -35.519 1.00 28.34  ? 4   LEU H N   1 
ATOM   27   C CA  . LEU A 1 4   ? 50.794 -5.104  -34.448 1.00 28.69  ? 4   LEU H CA  1 
ATOM   28   C C   . LEU A 1 4   ? 49.663 -4.882  -33.461 1.00 26.92  ? 4   LEU H C   1 
ATOM   29   O O   . LEU A 1 4   ? 49.239 -3.745  -33.246 1.00 26.53  ? 4   LEU H O   1 
ATOM   30   C CB  . LEU A 1 4   ? 52.140 -4.869  -33.760 1.00 30.49  ? 4   LEU H CB  1 
ATOM   31   C CG  . LEU A 1 4   ? 53.390 -5.024  -34.634 1.00 27.28  ? 4   LEU H CG  1 
ATOM   32   C CD1 . LEU A 1 4   ? 54.626 -4.651  -33.840 1.00 31.71  ? 4   LEU H CD1 1 
ATOM   33   C CD2 . LEU A 1 4   ? 53.494 -6.449  -35.120 1.00 35.26  ? 4   LEU H CD2 1 
ATOM   34   N N   . LEU A 1 5   ? 49.168 -5.963  -32.867 1.00 26.80  ? 5   LEU H N   1 
ATOM   35   C CA  . LEU A 1 5   ? 48.086 -5.852  -31.902 1.00 27.05  ? 5   LEU H CA  1 
ATOM   36   C C   . LEU A 1 5   ? 48.342 -6.669  -30.636 1.00 28.06  ? 5   LEU H C   1 
ATOM   37   O O   . LEU A 1 5   ? 48.353 -7.899  -30.678 1.00 24.73  ? 5   LEU H O   1 
ATOM   38   C CB  . LEU A 1 5   ? 46.769 -6.298  -32.545 1.00 34.36  ? 5   LEU H CB  1 
ATOM   39   C CG  . LEU A 1 5   ? 45.562 -6.384  -31.610 1.00 36.01  ? 5   LEU H CG  1 
ATOM   40   C CD1 . LEU A 1 5   ? 45.399 -5.072  -30.865 1.00 43.26  ? 5   LEU H CD1 1 
ATOM   41   C CD2 . LEU A 1 5   ? 44.309 -6.707  -32.413 1.00 47.21  ? 5   LEU H CD2 1 
ATOM   42   N N   . GLU A 1 6   ? 48.550 -5.983  -29.514 1.00 26.18  ? 6   GLU H N   1 
ATOM   43   C CA  . GLU A 1 6   ? 48.785 -6.665  -28.243 1.00 25.33  ? 6   GLU H CA  1 
ATOM   44   C C   . GLU A 1 6   ? 47.457 -6.948  -27.561 1.00 30.37  ? 6   GLU H C   1 
ATOM   45   O O   . GLU A 1 6   ? 46.474 -6.232  -27.771 1.00 31.40  ? 6   GLU H O   1 
ATOM   46   C CB  . GLU A 1 6   ? 49.640 -5.814  -27.306 1.00 23.08  ? 6   GLU H CB  1 
ATOM   47   C CG  . GLU A 1 6   ? 50.960 -5.374  -27.900 1.00 27.45  ? 6   GLU H CG  1 
ATOM   48   C CD  . GLU A 1 6   ? 50.862 -4.029  -28.591 1.00 29.33  ? 6   GLU H CD  1 
ATOM   49   O OE1 . GLU A 1 6   ? 49.730 -3.615  -28.926 1.00 29.94  ? 6   GLU H OE1 1 
ATOM   50   O OE2 . GLU A 1 6   ? 51.917 -3.392  -28.805 1.00 28.43  ? 6   GLU H OE2 1 
ATOM   51   N N   . SER A 1 7   ? 47.432 -7.992  -26.740 1.00 33.30  ? 7   SER H N   1 
ATOM   52   C CA  . SER A 1 7   ? 46.222 -8.359  -26.010 1.00 32.86  ? 7   SER H CA  1 
ATOM   53   C C   . SER A 1 7   ? 46.596 -9.185  -24.786 1.00 34.41  ? 7   SER H C   1 
ATOM   54   O O   . SER A 1 7   ? 47.738 -9.629  -24.664 1.00 29.87  ? 7   SER H O   1 
ATOM   55   C CB  . SER A 1 7   ? 45.285 -9.167  -26.912 1.00 34.30  ? 7   SER H CB  1 
ATOM   56   O OG  . SER A 1 7   ? 45.902 -10.373 -27.330 1.00 36.55  ? 7   SER H OG  1 
ATOM   57   N N   . GLY A 1 8   ? 45.639 -9.373  -23.875 1.00 35.25  ? 8   GLY H N   1 
ATOM   58   C CA  . GLY A 1 8   ? 45.895 -10.170 -22.686 1.00 34.93  ? 8   GLY H CA  1 
ATOM   59   C C   . GLY A 1 8   ? 46.080 -9.406  -21.391 1.00 37.25  ? 8   GLY H C   1 
ATOM   60   O O   . GLY A 1 8   ? 46.180 -10.012 -20.320 1.00 39.74  ? 8   GLY H O   1 
ATOM   61   N N   . GLY A 1 9   ? 46.125 -8.080  -21.471 1.00 34.04  ? 9   GLY H N   1 
ATOM   62   C CA  . GLY A 1 9   ? 46.311 -7.286  -20.270 1.00 34.24  ? 9   GLY H CA  1 
ATOM   63   C C   . GLY A 1 9   ? 45.092 -7.247  -19.370 1.00 35.73  ? 9   GLY H C   1 
ATOM   64   O O   . GLY A 1 9   ? 43.999 -7.650  -19.766 1.00 33.83  ? 9   GLY H O   1 
ATOM   65   N N   . GLY A 1 10  ? 45.277 -6.754  -18.151 1.00 38.29  ? 10  GLY H N   1 
ATOM   66   C CA  . GLY A 1 10  ? 44.170 -6.666  -17.216 1.00 35.97  ? 10  GLY H CA  1 
ATOM   67   C C   . GLY A 1 10  ? 44.652 -6.579  -15.783 1.00 40.15  ? 10  GLY H C   1 
ATOM   68   O O   . GLY A 1 10  ? 45.836 -6.345  -15.535 1.00 39.41  ? 10  GLY H O   1 
ATOM   69   N N   . LEU A 1 11  ? 43.736 -6.764  -14.834 1.00 38.87  ? 11  LEU H N   1 
ATOM   70   C CA  . LEU A 1 11  ? 44.093 -6.704  -13.423 1.00 40.99  ? 11  LEU H CA  1 
ATOM   71   C C   . LEU A 1 11  ? 44.646 -8.033  -12.935 1.00 40.91  ? 11  LEU H C   1 
ATOM   72   O O   . LEU A 1 11  ? 44.104 -9.093  -13.240 1.00 43.92  ? 11  LEU H O   1 
ATOM   73   C CB  . LEU A 1 11  ? 42.877 -6.311  -12.580 1.00 43.78  ? 11  LEU H CB  1 
ATOM   74   C CG  . LEU A 1 11  ? 42.573 -4.815  -12.493 1.00 40.45  ? 11  LEU H CG  1 
ATOM   75   C CD1 . LEU A 1 11  ? 42.364 -4.251  -13.886 1.00 46.16  ? 11  LEU H CD1 1 
ATOM   76   C CD2 . LEU A 1 11  ? 41.338 -4.601  -11.631 1.00 44.97  ? 11  LEU H CD2 1 
ATOM   77   N N   . VAL A 1 12  ? 45.735 -7.966  -12.180 1.00 41.56  ? 12  VAL H N   1 
ATOM   78   C CA  . VAL A 1 12  ? 46.371 -9.160  -11.638 1.00 42.07  ? 12  VAL H CA  1 
ATOM   79   C C   . VAL A 1 12  ? 46.835 -8.892  -10.215 1.00 41.66  ? 12  VAL H C   1 
ATOM   80   O O   . VAL A 1 12  ? 47.320 -7.801  -9.906  1.00 40.31  ? 12  VAL H O   1 
ATOM   81   C CB  . VAL A 1 12  ? 47.594 -9.576  -12.481 1.00 42.93  ? 12  VAL H CB  1 
ATOM   82   C CG1 . VAL A 1 12  ? 48.231 -10.826 -11.886 1.00 44.64  ? 12  VAL H CG1 1 
ATOM   83   C CG2 . VAL A 1 12  ? 47.170 -9.829  -13.916 1.00 45.49  ? 12  VAL H CG2 1 
ATOM   84   N N   . LYS A 1 13  ? 46.681 -9.887  -9.348  1.00 44.05  ? 13  LYS H N   1 
ATOM   85   C CA  . LYS A 1 13  ? 47.093 -9.746  -7.956  1.00 43.77  ? 13  LYS H CA  1 
ATOM   86   C C   . LYS A 1 13  ? 48.601 -9.875  -7.825  1.00 43.67  ? 13  LYS H C   1 
ATOM   87   O O   . LYS A 1 13  ? 49.239 -10.616 -8.574  1.00 44.55  ? 13  LYS H O   1 
ATOM   88   C CB  . LYS A 1 13  ? 46.423 -10.817 -7.092  1.00 49.87  ? 13  LYS H CB  1 
ATOM   89   C CG  . LYS A 1 13  ? 44.923 -10.649 -6.924  1.00 55.12  ? 13  LYS H CG  1 
ATOM   90   C CD  . LYS A 1 13  ? 44.599 -9.389  -6.136  1.00 62.90  ? 13  LYS H CD  1 
ATOM   91   C CE  . LYS A 1 13  ? 43.104 -9.259  -5.886  1.00 66.36  ? 13  LYS H CE  1 
ATOM   92   N NZ  . LYS A 1 13  ? 42.584 -10.396 -5.075  1.00 71.40  ? 13  LYS H NZ  1 
ATOM   93   N N   . PRO A 1 14  ? 49.197 -9.143  -6.872  1.00 44.42  ? 14  PRO H N   1 
ATOM   94   C CA  . PRO A 1 14  ? 50.644 -9.210  -6.671  1.00 42.91  ? 14  PRO H CA  1 
ATOM   95   C C   . PRO A 1 14  ? 51.056 -10.671 -6.523  1.00 44.58  ? 14  PRO H C   1 
ATOM   96   O O   . PRO A 1 14  ? 50.391 -11.437 -5.828  1.00 46.54  ? 14  PRO H O   1 
ATOM   97   C CB  . PRO A 1 14  ? 50.842 -8.416  -5.387  1.00 41.50  ? 14  PRO H CB  1 
ATOM   98   C CG  . PRO A 1 14  ? 49.789 -7.367  -5.497  1.00 42.18  ? 14  PRO H CG  1 
ATOM   99   C CD  . PRO A 1 14  ? 48.586 -8.159  -5.961  1.00 44.30  ? 14  PRO H CD  1 
ATOM   100  N N   . GLY A 1 15  ? 52.140 -11.055 -7.191  1.00 43.43  ? 15  GLY H N   1 
ATOM   101  C CA  . GLY A 1 15  ? 52.607 -12.427 -7.120  1.00 40.86  ? 15  GLY H CA  1 
ATOM   102  C C   . GLY A 1 15  ? 51.956 -13.346 -8.141  1.00 40.66  ? 15  GLY H C   1 
ATOM   103  O O   . GLY A 1 15  ? 52.368 -14.494 -8.298  1.00 42.31  ? 15  GLY H O   1 
ATOM   104  N N   . GLY A 1 16  ? 50.942 -12.846 -8.843  1.00 41.07  ? 16  GLY H N   1 
ATOM   105  C CA  . GLY A 1 16  ? 50.263 -13.660 -9.835  1.00 36.68  ? 16  GLY H CA  1 
ATOM   106  C C   . GLY A 1 16  ? 50.970 -13.684 -11.180 1.00 38.87  ? 16  GLY H C   1 
ATOM   107  O O   . GLY A 1 16  ? 52.049 -13.112 -11.334 1.00 38.58  ? 16  GLY H O   1 
ATOM   108  N N   . SER A 1 17  ? 50.362 -14.355 -12.154 1.00 37.69  ? 17  SER H N   1 
ATOM   109  C CA  . SER A 1 17  ? 50.936 -14.447 -13.487 1.00 41.85  ? 17  SER H CA  1 
ATOM   110  C C   . SER A 1 17  ? 49.930 -14.004 -14.545 1.00 41.64  ? 17  SER H C   1 
ATOM   111  O O   . SER A 1 17  ? 48.723 -13.951 -14.297 1.00 41.01  ? 17  SER H O   1 
ATOM   112  C CB  . SER A 1 17  ? 51.398 -15.880 -13.778 1.00 40.23  ? 17  SER H CB  1 
ATOM   113  O OG  . SER A 1 17  ? 50.301 -16.770 -13.860 1.00 48.79  ? 17  SER H OG  1 
ATOM   114  N N   . LEU A 1 18  ? 50.443 -13.693 -15.728 1.00 40.40  ? 18  LEU H N   1 
ATOM   115  C CA  . LEU A 1 18  ? 49.616 -13.233 -16.834 1.00 39.06  ? 18  LEU H CA  1 
ATOM   116  C C   . LEU A 1 18  ? 50.399 -13.446 -18.123 1.00 36.57  ? 18  LEU H C   1 
ATOM   117  O O   . LEU A 1 18  ? 51.622 -13.325 -18.143 1.00 38.38  ? 18  LEU H O   1 
ATOM   118  C CB  . LEU A 1 18  ? 49.307 -11.747 -16.650 1.00 40.63  ? 18  LEU H CB  1 
ATOM   119  C CG  . LEU A 1 18  ? 48.359 -11.068 -17.638 1.00 44.90  ? 18  LEU H CG  1 
ATOM   120  C CD1 . LEU A 1 18  ? 46.964 -11.686 -17.542 1.00 44.37  ? 18  LEU H CD1 1 
ATOM   121  C CD2 . LEU A 1 18  ? 48.306 -9.589  -17.321 1.00 39.24  ? 18  LEU H CD2 1 
ATOM   122  N N   . LYS A 1 19  ? 49.699 -13.766 -19.200 1.00 36.17  ? 19  LYS H N   1 
ATOM   123  C CA  . LYS A 1 19  ? 50.367 -13.997 -20.472 1.00 33.69  ? 19  LYS H CA  1 
ATOM   124  C C   . LYS A 1 19  ? 49.845 -13.038 -21.526 1.00 33.25  ? 19  LYS H C   1 
ATOM   125  O O   . LYS A 1 19  ? 48.653 -13.031 -21.832 1.00 38.27  ? 19  LYS H O   1 
ATOM   126  C CB  . LYS A 1 19  ? 50.134 -15.433 -20.929 1.00 35.15  ? 19  LYS H CB  1 
ATOM   127  C CG  . LYS A 1 19  ? 50.940 -15.849 -22.144 1.00 35.77  ? 19  LYS H CG  1 
ATOM   128  C CD  . LYS A 1 19  ? 50.571 -17.272 -22.549 1.00 43.20  ? 19  LYS H CD  1 
ATOM   129  C CE  . LYS A 1 19  ? 51.454 -17.783 -23.673 1.00 45.65  ? 19  LYS H CE  1 
ATOM   130  N NZ  . LYS A 1 19  ? 52.887 -17.781 -23.282 1.00 46.85  ? 19  LYS H NZ  1 
ATOM   131  N N   . LEU A 1 20  ? 50.738 -12.223 -22.077 1.00 34.44  ? 20  LEU H N   1 
ATOM   132  C CA  . LEU A 1 20  ? 50.350 -11.272 -23.114 1.00 27.58  ? 20  LEU H CA  1 
ATOM   133  C C   . LEU A 1 20  ? 50.645 -11.906 -24.457 1.00 30.14  ? 20  LEU H C   1 
ATOM   134  O O   . LEU A 1 20  ? 51.537 -12.741 -24.567 1.00 27.47  ? 20  LEU H O   1 
ATOM   135  C CB  . LEU A 1 20  ? 51.143 -9.973  -22.983 1.00 26.45  ? 20  LEU H CB  1 
ATOM   136  C CG  . LEU A 1 20  ? 51.172 -9.295  -21.612 1.00 26.26  ? 20  LEU H CG  1 
ATOM   137  C CD1 . LEU A 1 20  ? 51.884 -7.961  -21.730 1.00 22.99  ? 20  LEU H CD1 1 
ATOM   138  C CD2 . LEU A 1 20  ? 49.745 -9.094  -21.091 1.00 25.82  ? 20  LEU H CD2 1 
ATOM   139  N N   . SER A 1 21  ? 49.890 -11.515 -25.477 1.00 29.71  ? 21  SER H N   1 
ATOM   140  C CA  . SER A 1 21  ? 50.090 -12.045 -26.811 1.00 28.22  ? 21  SER H CA  1 
ATOM   141  C C   . SER A 1 21  ? 50.143 -10.909 -27.823 1.00 30.19  ? 21  SER H C   1 
ATOM   142  O O   . SER A 1 21  ? 49.677 -9.799  -27.561 1.00 30.88  ? 21  SER H O   1 
ATOM   143  C CB  . SER A 1 21  ? 48.965 -13.012 -27.173 1.00 30.84  ? 21  SER H CB  1 
ATOM   144  O OG  . SER A 1 21  ? 47.714 -12.354 -27.119 1.00 49.17  ? 21  SER H OG  1 
ATOM   145  N N   . CYS A 1 22  ? 50.725 -11.190 -28.981 1.00 29.34  ? 22  CYS H N   1 
ATOM   146  C CA  . CYS A 1 22  ? 50.850 -10.186 -30.026 1.00 27.71  ? 22  CYS H CA  1 
ATOM   147  C C   . CYS A 1 22  ? 50.721 -10.821 -31.393 1.00 28.31  ? 22  CYS H C   1 
ATOM   148  O O   . CYS A 1 22  ? 51.412 -11.787 -31.702 1.00 28.51  ? 22  CYS H O   1 
ATOM   149  C CB  . CYS A 1 22  ? 52.207 -9.510  -29.929 1.00 33.42  ? 22  CYS H CB  1 
ATOM   150  S SG  . CYS A 1 22  ? 52.516 -8.236  -31.194 1.00 36.08  ? 22  CYS H SG  1 
ATOM   151  N N   . THR A 1 23  ? 49.825 -10.282 -32.207 1.00 28.08  ? 23  THR H N   1 
ATOM   152  C CA  . THR A 1 23  ? 49.636 -10.784 -33.557 1.00 27.12  ? 23  THR H CA  1 
ATOM   153  C C   . THR A 1 23  ? 49.890 -9.610  -34.484 1.00 29.32  ? 23  THR H C   1 
ATOM   154  O O   . THR A 1 23  ? 49.979 -8.464  -34.036 1.00 29.71  ? 23  THR H O   1 
ATOM   155  C CB  . THR A 1 23  ? 48.202 -11.302 -33.781 1.00 28.51  ? 23  THR H CB  1 
ATOM   156  O OG1 . THR A 1 23  ? 47.270 -10.255 -33.496 1.00 34.13  ? 23  THR H OG1 1 
ATOM   157  C CG2 . THR A 1 23  ? 47.917 -12.493 -32.871 1.00 32.94  ? 23  THR H CG2 1 
ATOM   158  N N   . ALA A 1 24  ? 50.003 -9.880  -35.773 1.00 27.57  ? 24  ALA H N   1 
ATOM   159  C CA  . ALA A 1 24  ? 50.248 -8.799  -36.708 1.00 32.01  ? 24  ALA H CA  1 
ATOM   160  C C   . ALA A 1 24  ? 49.858 -9.153  -38.125 1.00 31.72  ? 24  ALA H C   1 
ATOM   161  O O   . ALA A 1 24  ? 49.693 -10.321 -38.468 1.00 32.36  ? 24  ALA H O   1 
ATOM   162  C CB  . ALA A 1 24  ? 51.712 -8.419  -36.676 1.00 37.80  ? 24  ALA H CB  1 
ATOM   163  N N   . SER A 1 25  ? 49.697 -8.124  -38.940 1.00 30.53  ? 25  SER H N   1 
ATOM   164  C CA  . SER A 1 25  ? 49.389 -8.312  -40.340 1.00 33.99  ? 25  SER H CA  1 
ATOM   165  C C   . SER A 1 25  ? 50.517 -7.588  -41.066 1.00 32.32  ? 25  SER H C   1 
ATOM   166  O O   . SER A 1 25  ? 50.851 -6.453  -40.723 1.00 34.88  ? 25  SER H O   1 
ATOM   167  C CB  . SER A 1 25  ? 48.028 -7.696  -40.690 1.00 35.05  ? 25  SER H CB  1 
ATOM   168  O OG  . SER A 1 25  ? 48.005 -6.306  -40.434 1.00 42.69  ? 25  SER H OG  1 
ATOM   169  N N   . GLY A 1 26  ? 51.140 -8.266  -42.024 1.00 29.86  ? 26  GLY H N   1 
ATOM   170  C CA  . GLY A 1 26  ? 52.211 -7.651  -42.790 1.00 25.78  ? 26  GLY H CA  1 
ATOM   171  C C   . GLY A 1 26  ? 53.612 -7.799  -42.234 1.00 24.82  ? 26  GLY H C   1 
ATOM   172  O O   . GLY A 1 26  ? 54.570 -7.375  -42.878 1.00 25.64  ? 26  GLY H O   1 
ATOM   173  N N   . ILE A 1 27  ? 53.739 -8.386  -41.043 1.00 19.65  ? 27  ILE H N   1 
ATOM   174  C CA  . ILE A 1 27  ? 55.044 -8.577  -40.414 1.00 21.38  ? 27  ILE H CA  1 
ATOM   175  C C   . ILE A 1 27  ? 55.207 -10.049 -40.046 1.00 23.62  ? 27  ILE H C   1 
ATOM   176  O O   . ILE A 1 27  ? 54.324 -10.636 -39.421 1.00 26.63  ? 27  ILE H O   1 
ATOM   177  C CB  . ILE A 1 27  ? 55.174 -7.707  -39.132 1.00 25.21  ? 27  ILE H CB  1 
ATOM   178  C CG1 . ILE A 1 27  ? 55.161 -6.223  -39.516 1.00 30.80  ? 27  ILE H CG1 1 
ATOM   179  C CG2 . ILE A 1 27  ? 56.458 -8.050  -38.381 1.00 26.78  ? 27  ILE H CG2 1 
ATOM   180  C CD1 . ILE A 1 27  ? 55.286 -5.276  -38.337 1.00 38.02  ? 27  ILE H CD1 1 
ATOM   181  N N   . THR A 1 28  ? 56.325 -10.646 -40.449 1.00 20.42  ? 28  THR H N   1 
ATOM   182  C CA  . THR A 1 28  ? 56.585 -12.058 -40.163 1.00 23.15  ? 28  THR H CA  1 
ATOM   183  C C   . THR A 1 28  ? 57.564 -12.123 -38.995 1.00 21.50  ? 28  THR H C   1 
ATOM   184  O O   . THR A 1 28  ? 58.772 -12.009 -39.181 1.00 22.92  ? 28  THR H O   1 
ATOM   185  C CB  . THR A 1 28  ? 57.188 -12.758 -41.398 1.00 28.25  ? 28  THR H CB  1 
ATOM   186  O OG1 . THR A 1 28  ? 56.362 -12.480 -42.541 1.00 27.98  ? 28  THR H OG1 1 
ATOM   187  C CG2 . THR A 1 28  ? 57.254 -14.283 -41.183 1.00 29.13  ? 28  THR H CG2 1 
ATOM   188  N N   . PHE A 1 29  ? 57.025 -12.293 -37.791 1.00 20.47  ? 29  PHE H N   1 
ATOM   189  C CA  . PHE A 1 29  ? 57.825 -12.330 -36.564 1.00 23.97  ? 29  PHE H CA  1 
ATOM   190  C C   . PHE A 1 29  ? 59.097 -13.173 -36.578 1.00 26.91  ? 29  PHE H C   1 
ATOM   191  O O   . PHE A 1 29  ? 60.108 -12.776 -35.988 1.00 23.41  ? 29  PHE H O   1 
ATOM   192  C CB  . PHE A 1 29  ? 56.960 -12.800 -35.386 1.00 25.17  ? 29  PHE H CB  1 
ATOM   193  C CG  . PHE A 1 29  ? 55.867 -11.842 -34.997 1.00 26.88  ? 29  PHE H CG  1 
ATOM   194  C CD1 . PHE A 1 29  ? 54.759 -12.295 -34.281 1.00 29.42  ? 29  PHE H CD1 1 
ATOM   195  C CD2 . PHE A 1 29  ? 55.951 -10.490 -35.316 1.00 24.70  ? 29  PHE H CD2 1 
ATOM   196  C CE1 . PHE A 1 29  ? 53.752 -11.418 -33.888 1.00 27.73  ? 29  PHE H CE1 1 
ATOM   197  C CE2 . PHE A 1 29  ? 54.951 -9.606  -34.928 1.00 26.73  ? 29  PHE H CE2 1 
ATOM   198  C CZ  . PHE A 1 29  ? 53.848 -10.066 -34.213 1.00 28.11  ? 29  PHE H CZ  1 
ATOM   199  N N   . SER A 1 30  ? 59.049 -14.329 -37.239 1.00 24.87  ? 30  SER H N   1 
ATOM   200  C CA  . SER A 1 30  ? 60.194 -15.237 -37.276 1.00 25.50  ? 30  SER H CA  1 
ATOM   201  C C   . SER A 1 30  ? 61.456 -14.635 -37.871 1.00 28.70  ? 30  SER H C   1 
ATOM   202  O O   . SER A 1 30  ? 62.559 -15.104 -37.600 1.00 28.29  ? 30  SER H O   1 
ATOM   203  C CB  . SER A 1 30  ? 59.839 -16.514 -38.052 1.00 26.39  ? 30  SER H CB  1 
ATOM   204  O OG  . SER A 1 30  ? 59.734 -16.257 -39.442 1.00 28.68  ? 30  SER H OG  1 
ATOM   205  N N   . ARG A 1 31  ? 61.295 -13.584 -38.666 1.00 29.65  ? 32  ARG H N   1 
ATOM   206  C CA  . ARG A 1 31  ? 62.422 -12.938 -39.325 1.00 27.54  ? 32  ARG H CA  1 
ATOM   207  C C   . ARG A 1 31  ? 63.137 -11.838 -38.546 1.00 29.55  ? 32  ARG H C   1 
ATOM   208  O O   . ARG A 1 31  ? 64.226 -11.419 -38.932 1.00 29.72  ? 32  ARG H O   1 
ATOM   209  C CB  . ARG A 1 31  ? 61.950 -12.341 -40.648 1.00 32.36  ? 32  ARG H CB  1 
ATOM   210  C CG  . ARG A 1 31  ? 61.501 -13.356 -41.684 1.00 39.74  ? 32  ARG H CG  1 
ATOM   211  C CD  . ARG A 1 31  ? 60.826 -12.653 -42.834 1.00 46.71  ? 32  ARG H CD  1 
ATOM   212  N NE  . ARG A 1 31  ? 61.571 -11.465 -43.246 1.00 58.21  ? 32  ARG H NE  1 
ATOM   213  C CZ  . ARG A 1 31  ? 61.210 -10.671 -44.250 1.00 60.50  ? 32  ARG H CZ  1 
ATOM   214  N NH1 . ARG A 1 31  ? 60.113 -10.941 -44.948 1.00 54.90  ? 32  ARG H NH1 1 
ATOM   215  N NH2 . ARG A 1 31  ? 61.942 -9.605  -44.553 1.00 62.52  ? 32  ARG H NH2 1 
ATOM   216  N N   . TYR A 1 32  ? 62.545 -11.369 -37.454 1.00 26.04  ? 34  TYR H N   1 
ATOM   217  C CA  . TYR A 1 32  ? 63.145 -10.262 -36.723 1.00 23.96  ? 34  TYR H CA  1 
ATOM   218  C C   . TYR A 1 32  ? 63.451 -10.463 -35.252 1.00 28.75  ? 34  TYR H C   1 
ATOM   219  O O   . TYR A 1 32  ? 63.104 -11.473 -34.651 1.00 25.21  ? 34  TYR H O   1 
ATOM   220  C CB  . TYR A 1 32  ? 62.228 -9.037  -36.820 1.00 26.48  ? 34  TYR H CB  1 
ATOM   221  C CG  . TYR A 1 32  ? 61.630 -8.793  -38.190 1.00 23.28  ? 34  TYR H CG  1 
ATOM   222  C CD1 . TYR A 1 32  ? 60.365 -9.278  -38.521 1.00 28.28  ? 34  TYR H CD1 1 
ATOM   223  C CD2 . TYR A 1 32  ? 62.326 -8.065  -39.149 1.00 27.41  ? 34  TYR H CD2 1 
ATOM   224  C CE1 . TYR A 1 32  ? 59.807 -9.034  -39.776 1.00 21.87  ? 34  TYR H CE1 1 
ATOM   225  C CE2 . TYR A 1 32  ? 61.779 -7.820  -40.409 1.00 23.17  ? 34  TYR H CE2 1 
ATOM   226  C CZ  . TYR A 1 32  ? 60.524 -8.302  -40.712 1.00 21.63  ? 34  TYR H CZ  1 
ATOM   227  O OH  . TYR A 1 32  ? 59.971 -8.023  -41.945 1.00 23.82  ? 34  TYR H OH  1 
ATOM   228  N N   . ILE A 1 33  ? 64.119 -9.461  -34.688 1.00 24.44  ? 35  ILE H N   1 
ATOM   229  C CA  . ILE A 1 33  ? 64.407 -9.433  -33.268 1.00 23.62  ? 35  ILE H CA  1 
ATOM   230  C C   . ILE A 1 33  ? 63.114 -8.779  -32.794 1.00 23.22  ? 35  ILE H C   1 
ATOM   231  O O   . ILE A 1 33  ? 62.890 -7.589  -33.035 1.00 22.76  ? 35  ILE H O   1 
ATOM   232  C CB  . ILE A 1 33  ? 65.590 -8.488  -32.930 1.00 24.09  ? 35  ILE H CB  1 
ATOM   233  C CG1 . ILE A 1 33  ? 66.895 -9.050  -33.503 1.00 25.87  ? 35  ILE H CG1 1 
ATOM   234  C CG2 . ILE A 1 33  ? 65.698 -8.308  -31.418 1.00 21.61  ? 35  ILE H CG2 1 
ATOM   235  C CD1 . ILE A 1 33  ? 68.063 -8.078  -33.443 1.00 32.64  ? 35  ILE H CD1 1 
ATOM   236  N N   . MET A 1 34  ? 62.237 -9.550  -32.164 1.00 19.72  ? 36  MET H N   1 
ATOM   237  C CA  . MET A 1 34  ? 60.983 -8.994  -31.686 1.00 18.32  ? 36  MET H CA  1 
ATOM   238  C C   . MET A 1 34  ? 61.129 -8.627  -30.221 1.00 24.27  ? 36  MET H C   1 
ATOM   239  O O   . MET A 1 34  ? 61.829 -9.314  -29.472 1.00 22.30  ? 36  MET H O   1 
ATOM   240  C CB  . MET A 1 34  ? 59.842 -9.990  -31.891 1.00 20.48  ? 36  MET H CB  1 
ATOM   241  C CG  . MET A 1 34  ? 59.514 -10.257 -33.363 1.00 27.41  ? 36  MET H CG  1 
ATOM   242  S SD  . MET A 1 34  ? 59.027 -8.751  -34.282 1.00 25.07  ? 36  MET H SD  1 
ATOM   243  C CE  . MET A 1 34  ? 57.592 -8.270  -33.333 1.00 21.63  ? 36  MET H CE  1 
ATOM   244  N N   . SER A 1 35  ? 60.478 -7.542  -29.809 1.00 22.69  ? 37  SER H N   1 
ATOM   245  C CA  . SER A 1 35  ? 60.596 -7.097  -28.424 1.00 19.65  ? 37  SER H CA  1 
ATOM   246  C C   . SER A 1 35  ? 59.295 -6.702  -27.762 1.00 23.14  ? 37  SER H C   1 
ATOM   247  O O   . SER A 1 35  ? 58.263 -6.520  -28.412 1.00 23.87  ? 37  SER H O   1 
ATOM   248  C CB  . SER A 1 35  ? 61.530 -5.885  -28.329 1.00 19.60  ? 37  SER H CB  1 
ATOM   249  O OG  . SER A 1 35  ? 62.730 -6.076  -29.048 1.00 20.83  ? 37  SER H OG  1 
ATOM   250  N N   . TRP A 1 36  ? 59.383 -6.565  -26.444 1.00 24.17  ? 38  TRP H N   1 
ATOM   251  C CA  . TRP A 1 36  ? 58.293 -6.105  -25.606 1.00 21.78  ? 38  TRP H CA  1 
ATOM   252  C C   . TRP A 1 36  ? 58.914 -4.939  -24.851 1.00 22.33  ? 38  TRP H C   1 
ATOM   253  O O   . TRP A 1 36  ? 60.056 -5.014  -24.409 1.00 22.84  ? 38  TRP H O   1 
ATOM   254  C CB  . TRP A 1 36  ? 57.837 -7.171  -24.604 1.00 24.18  ? 38  TRP H CB  1 
ATOM   255  C CG  . TRP A 1 36  ? 56.955 -8.227  -25.197 1.00 24.42  ? 38  TRP H CG  1 
ATOM   256  C CD1 . TRP A 1 36  ? 57.341 -9.443  -25.694 1.00 23.40  ? 38  TRP H CD1 1 
ATOM   257  C CD2 . TRP A 1 36  ? 55.539 -8.144  -25.392 1.00 23.47  ? 38  TRP H CD2 1 
ATOM   258  N NE1 . TRP A 1 36  ? 56.248 -10.121 -26.190 1.00 23.63  ? 38  TRP H NE1 1 
ATOM   259  C CE2 . TRP A 1 36  ? 55.131 -9.344  -26.017 1.00 24.35  ? 38  TRP H CE2 1 
ATOM   260  C CE3 . TRP A 1 36  ? 54.573 -7.169  -25.100 1.00 26.58  ? 38  TRP H CE3 1 
ATOM   261  C CZ2 . TRP A 1 36  ? 53.799 -9.594  -26.353 1.00 21.86  ? 38  TRP H CZ2 1 
ATOM   262  C CZ3 . TRP A 1 36  ? 53.249 -7.422  -25.434 1.00 20.50  ? 38  TRP H CZ3 1 
ATOM   263  C CH2 . TRP A 1 36  ? 52.876 -8.626  -26.054 1.00 19.53  ? 38  TRP H CH2 1 
ATOM   264  N N   . VAL A 1 37  ? 58.170 -3.849  -24.745 1.00 21.17  ? 39  VAL H N   1 
ATOM   265  C CA  . VAL A 1 37  ? 58.624 -2.661  -24.043 1.00 20.84  ? 39  VAL H CA  1 
ATOM   266  C C   . VAL A 1 37  ? 57.414 -2.220  -23.235 1.00 21.21  ? 39  VAL H C   1 
ATOM   267  O O   . VAL A 1 37  ? 56.291 -2.591  -23.569 1.00 25.35  ? 39  VAL H O   1 
ATOM   268  C CB  . VAL A 1 37  ? 59.046 -1.564  -25.046 1.00 24.50  ? 39  VAL H CB  1 
ATOM   269  C CG1 . VAL A 1 37  ? 59.400 -0.285  -24.309 1.00 30.66  ? 39  VAL H CG1 1 
ATOM   270  C CG2 . VAL A 1 37  ? 60.255 -2.049  -25.852 1.00 22.48  ? 39  VAL H CG2 1 
ATOM   271  N N   . ARG A 1 38  ? 57.624 -1.456  -22.168 1.00 20.38  ? 40  ARG H N   1 
ATOM   272  C CA  . ARG A 1 38  ? 56.493 -1.021  -21.359 1.00 23.96  ? 40  ARG H CA  1 
ATOM   273  C C   . ARG A 1 38  ? 56.614 0.445   -20.969 1.00 29.12  ? 40  ARG H C   1 
ATOM   274  O O   . ARG A 1 38  ? 57.717 0.979   -20.823 1.00 29.02  ? 40  ARG H O   1 
ATOM   275  C CB  . ARG A 1 38  ? 56.344 -1.906  -20.110 1.00 22.45  ? 40  ARG H CB  1 
ATOM   276  C CG  . ARG A 1 38  ? 57.477 -1.790  -19.111 1.00 26.15  ? 40  ARG H CG  1 
ATOM   277  C CD  . ARG A 1 38  ? 57.319 -2.811  -17.991 1.00 27.97  ? 40  ARG H CD  1 
ATOM   278  N NE  . ARG A 1 38  ? 58.382 -2.692  -16.998 1.00 33.14  ? 40  ARG H NE  1 
ATOM   279  C CZ  . ARG A 1 38  ? 58.548 -3.528  -15.975 1.00 36.71  ? 40  ARG H CZ  1 
ATOM   280  N NH1 . ARG A 1 38  ? 57.716 -4.550  -15.809 1.00 28.18  ? 40  ARG H NH1 1 
ATOM   281  N NH2 . ARG A 1 38  ? 59.550 -3.343  -15.121 1.00 31.78  ? 40  ARG H NH2 1 
ATOM   282  N N   . GLN A 1 39  ? 55.457 1.073   -20.801 1.00 30.43  ? 41  GLN H N   1 
ATOM   283  C CA  . GLN A 1 39  ? 55.346 2.488   -20.476 1.00 36.26  ? 41  GLN H CA  1 
ATOM   284  C C   . GLN A 1 39  ? 54.632 2.651   -19.141 1.00 43.67  ? 41  GLN H C   1 
ATOM   285  O O   . GLN A 1 39  ? 53.453 2.319   -19.022 1.00 39.34  ? 41  GLN H O   1 
ATOM   286  C CB  . GLN A 1 39  ? 54.555 3.167   -21.599 1.00 38.14  ? 41  GLN H CB  1 
ATOM   287  C CG  . GLN A 1 39  ? 54.269 4.649   -21.457 1.00 47.21  ? 41  GLN H CG  1 
ATOM   288  C CD  . GLN A 1 39  ? 53.915 5.281   -22.803 1.00 52.52  ? 41  GLN H CD  1 
ATOM   289  O OE1 . GLN A 1 39  ? 52.897 4.947   -23.421 1.00 48.00  ? 41  GLN H OE1 1 
ATOM   290  N NE2 . GLN A 1 39  ? 54.769 6.187   -23.269 1.00 51.55  ? 41  GLN H NE2 1 
ATOM   291  N N   . ILE A 1 40  ? 55.355 3.149   -18.141 1.00 50.55  ? 42  ILE H N   1 
ATOM   292  C CA  . ILE A 1 40  ? 54.794 3.360   -16.809 1.00 61.13  ? 42  ILE H CA  1 
ATOM   293  C C   . ILE A 1 40  ? 54.413 4.831   -16.644 1.00 66.69  ? 42  ILE H C   1 
ATOM   294  O O   . ILE A 1 40  ? 54.621 5.633   -17.556 1.00 68.19  ? 42  ILE H O   1 
ATOM   295  C CB  . ILE A 1 40  ? 55.808 2.966   -15.704 1.00 62.68  ? 42  ILE H CB  1 
ATOM   296  C CG1 . ILE A 1 40  ? 57.080 3.809   -15.830 1.00 65.94  ? 42  ILE H CG1 1 
ATOM   297  C CG2 . ILE A 1 40  ? 56.131 1.483   -15.799 1.00 62.32  ? 42  ILE H CG2 1 
ATOM   298  C CD1 . ILE A 1 40  ? 58.101 3.548   -14.738 1.00 69.12  ? 42  ILE H CD1 1 
ATOM   299  N N   . PRO A 1 41  ? 53.839 5.202   -15.484 1.00 71.88  ? 43  PRO H N   1 
ATOM   300  C CA  . PRO A 1 41  ? 53.434 6.588   -15.220 1.00 75.17  ? 43  PRO H CA  1 
ATOM   301  C C   . PRO A 1 41  ? 54.463 7.644   -15.618 1.00 77.47  ? 43  PRO H C   1 
ATOM   302  O O   . PRO A 1 41  ? 54.104 8.684   -16.173 1.00 77.83  ? 43  PRO H O   1 
ATOM   303  C CB  . PRO A 1 41  ? 53.161 6.577   -13.722 1.00 76.15  ? 43  PRO H CB  1 
ATOM   304  C CG  . PRO A 1 41  ? 52.549 5.228   -13.532 1.00 76.15  ? 43  PRO H CG  1 
ATOM   305  C CD  . PRO A 1 41  ? 53.458 4.330   -14.356 1.00 74.23  ? 43  PRO H CD  1 
ATOM   306  N N   . GLU A 1 42  ? 55.736 7.377   -15.334 1.00 79.84  ? 44  GLU H N   1 
ATOM   307  C CA  . GLU A 1 42  ? 56.810 8.310   -15.671 1.00 81.93  ? 44  GLU H CA  1 
ATOM   308  C C   . GLU A 1 42  ? 56.683 8.700   -17.140 1.00 81.52  ? 44  GLU H C   1 
ATOM   309  O O   . GLU A 1 42  ? 57.088 9.790   -17.547 1.00 82.51  ? 44  GLU H O   1 
ATOM   310  C CB  . GLU A 1 42  ? 58.177 7.662   -15.437 1.00 83.20  ? 44  GLU H CB  1 
ATOM   311  C CG  . GLU A 1 42  ? 58.609 6.717   -16.547 1.00 84.86  ? 44  GLU H CG  1 
ATOM   312  C CD  . GLU A 1 42  ? 59.962 6.097   -16.287 1.00 88.01  ? 44  GLU H CD  1 
ATOM   313  O OE1 . GLU A 1 42  ? 60.493 5.427   -17.197 1.00 89.16  ? 44  GLU H OE1 1 
ATOM   314  O OE2 . GLU A 1 42  ? 60.491 6.276   -15.169 1.00 90.26  ? 44  GLU H OE2 1 
ATOM   315  N N   . LYS A 1 43  ? 56.122 7.782   -17.923 1.00 80.47  ? 45  LYS H N   1 
ATOM   316  C CA  . LYS A 1 43  ? 55.897 7.964   -19.353 1.00 76.37  ? 45  LYS H CA  1 
ATOM   317  C C   . LYS A 1 43  ? 57.165 7.771   -20.187 1.00 72.29  ? 45  LYS H C   1 
ATOM   318  O O   . LYS A 1 43  ? 57.203 8.143   -21.361 1.00 72.58  ? 45  LYS H O   1 
ATOM   319  C CB  . LYS A 1 43  ? 55.291 9.347   -19.626 1.00 74.64  ? 45  LYS H CB  1 
ATOM   320  C CG  . LYS A 1 43  ? 54.285 9.369   -20.766 1.00 73.46  ? 45  LYS H CG  1 
ATOM   321  C CD  . LYS A 1 43  ? 53.081 8.487   -20.453 1.00 71.69  ? 45  LYS H CD  1 
ATOM   322  C CE  . LYS A 1 43  ? 52.070 8.496   -21.590 1.00 71.86  ? 45  LYS H CE  1 
ATOM   323  N NZ  . LYS A 1 43  ? 51.542 9.863   -21.868 1.00 70.97  ? 45  LYS H NZ  1 
ATOM   324  N N   . ARG A 1 44  ? 58.195 7.179   -19.585 1.00 66.76  ? 46  ARG H N   1 
ATOM   325  C CA  . ARG A 1 44  ? 59.456 6.922   -20.288 1.00 60.39  ? 46  ARG H CA  1 
ATOM   326  C C   . ARG A 1 44  ? 59.630 5.421   -20.535 1.00 51.68  ? 46  ARG H C   1 
ATOM   327  O O   . ARG A 1 44  ? 59.767 4.644   -19.594 1.00 48.95  ? 46  ARG H O   1 
ATOM   328  C CB  . ARG A 1 44  ? 60.641 7.453   -19.477 1.00 56.81  ? 46  ARG H CB  1 
ATOM   329  C CG  . ARG A 1 44  ? 61.962 7.280   -20.191 1.00 55.62  ? 46  ARG H CG  1 
ATOM   330  C CD  . ARG A 1 44  ? 63.114 7.971   -19.480 1.00 50.10  ? 46  ARG H CD  1 
ATOM   331  N NE  . ARG A 1 44  ? 64.335 7.844   -20.271 1.00 39.81  ? 46  ARG H NE  1 
ATOM   332  C CZ  . ARG A 1 44  ? 65.487 8.447   -20.001 1.00 31.99  ? 46  ARG H CZ  1 
ATOM   333  N NH1 . ARG A 1 44  ? 65.599 9.237   -18.942 1.00 33.61  ? 46  ARG H NH1 1 
ATOM   334  N NH2 . ARG A 1 44  ? 66.530 8.260   -20.799 1.00 28.93  ? 46  ARG H NH2 1 
ATOM   335  N N   . LEU A 1 45  ? 59.636 5.026   -21.805 1.00 46.32  ? 47  LEU H N   1 
ATOM   336  C CA  . LEU A 1 45  ? 59.758 3.617   -22.180 1.00 39.86  ? 47  LEU H CA  1 
ATOM   337  C C   . LEU A 1 45  ? 60.859 2.797   -21.519 1.00 36.02  ? 47  LEU H C   1 
ATOM   338  O O   . LEU A 1 45  ? 61.989 3.254   -21.343 1.00 29.51  ? 47  LEU H O   1 
ATOM   339  C CB  . LEU A 1 45  ? 59.890 3.478   -23.702 1.00 39.34  ? 47  LEU H CB  1 
ATOM   340  C CG  . LEU A 1 45  ? 58.594 3.540   -24.515 1.00 42.49  ? 47  LEU H CG  1 
ATOM   341  C CD1 . LEU A 1 45  ? 57.624 2.486   -23.998 1.00 40.83  ? 47  LEU H CD1 1 
ATOM   342  C CD2 . LEU A 1 45  ? 57.969 4.909   -24.399 1.00 49.66  ? 47  LEU H CD2 1 
ATOM   343  N N   . GLU A 1 46  ? 60.510 1.563   -21.170 1.00 30.99  ? 48  GLU H N   1 
ATOM   344  C CA  . GLU A 1 46  ? 61.444 0.634   -20.549 1.00 30.97  ? 48  GLU H CA  1 
ATOM   345  C C   . GLU A 1 46  ? 61.437 -0.674  -21.333 1.00 25.63  ? 48  GLU H C   1 
ATOM   346  O O   . GLU A 1 46  ? 60.382 -1.232  -21.604 1.00 30.56  ? 48  GLU H O   1 
ATOM   347  C CB  . GLU A 1 46  ? 61.039 0.358   -19.099 1.00 33.00  ? 48  GLU H CB  1 
ATOM   348  C CG  . GLU A 1 46  ? 61.941 -0.643  -18.389 1.00 43.47  ? 48  GLU H CG  1 
ATOM   349  C CD  . GLU A 1 46  ? 61.457 -0.998  -16.986 1.00 47.90  ? 48  GLU H CD  1 
ATOM   350  O OE1 . GLU A 1 46  ? 62.130 -1.814  -16.320 1.00 48.03  ? 48  GLU H OE1 1 
ATOM   351  O OE2 . GLU A 1 46  ? 60.410 -0.466  -16.552 1.00 47.93  ? 48  GLU H OE2 1 
ATOM   352  N N   . TRP A 1 47  ? 62.614 -1.149  -21.712 1.00 23.16  ? 49  TRP H N   1 
ATOM   353  C CA  . TRP A 1 47  ? 62.725 -2.403  -22.449 1.00 26.27  ? 49  TRP H CA  1 
ATOM   354  C C   . TRP A 1 47  ? 62.412 -3.554  -21.499 1.00 25.75  ? 49  TRP H C   1 
ATOM   355  O O   . TRP A 1 47  ? 62.900 -3.577  -20.374 1.00 24.64  ? 49  TRP H O   1 
ATOM   356  C CB  . TRP A 1 47  ? 64.139 -2.550  -23.000 1.00 25.95  ? 49  TRP H CB  1 
ATOM   357  C CG  . TRP A 1 47  ? 64.452 -3.896  -23.570 1.00 26.18  ? 49  TRP H CG  1 
ATOM   358  C CD1 . TRP A 1 47  ? 63.819 -4.518  -24.607 1.00 26.02  ? 49  TRP H CD1 1 
ATOM   359  C CD2 . TRP A 1 47  ? 65.524 -4.760  -23.176 1.00 24.51  ? 49  TRP H CD2 1 
ATOM   360  N NE1 . TRP A 1 47  ? 64.433 -5.712  -24.889 1.00 25.40  ? 49  TRP H NE1 1 
ATOM   361  C CE2 . TRP A 1 47  ? 65.483 -5.886  -24.025 1.00 27.28  ? 49  TRP H CE2 1 
ATOM   362  C CE3 . TRP A 1 47  ? 66.519 -4.688  -22.189 1.00 30.44  ? 49  TRP H CE3 1 
ATOM   363  C CZ2 . TRP A 1 47  ? 66.400 -6.936  -23.920 1.00 27.06  ? 49  TRP H CZ2 1 
ATOM   364  C CZ3 . TRP A 1 47  ? 67.433 -5.731  -22.082 1.00 28.05  ? 49  TRP H CZ3 1 
ATOM   365  C CH2 . TRP A 1 47  ? 67.366 -6.842  -22.946 1.00 31.56  ? 49  TRP H CH2 1 
ATOM   366  N N   . VAL A 1 48  ? 61.611 -4.507  -21.966 1.00 26.02  ? 50  VAL H N   1 
ATOM   367  C CA  . VAL A 1 48  ? 61.211 -5.653  -21.154 1.00 30.01  ? 50  VAL H CA  1 
ATOM   368  C C   . VAL A 1 48  ? 61.833 -6.977  -21.596 1.00 29.62  ? 50  VAL H C   1 
ATOM   369  O O   . VAL A 1 48  ? 62.261 -7.782  -20.761 1.00 28.80  ? 50  VAL H O   1 
ATOM   370  C CB  . VAL A 1 48  ? 59.669 -5.811  -21.164 1.00 29.15  ? 50  VAL H CB  1 
ATOM   371  C CG1 . VAL A 1 48  ? 59.262 -7.068  -20.421 1.00 33.96  ? 50  VAL H CG1 1 
ATOM   372  C CG2 . VAL A 1 48  ? 59.022 -4.595  -20.528 1.00 29.97  ? 50  VAL H CG2 1 
ATOM   373  N N   . ALA A 1 49  ? 61.876 -7.210  -22.904 1.00 26.51  ? 51  ALA H N   1 
ATOM   374  C CA  . ALA A 1 49  ? 62.427 -8.457  -23.425 1.00 26.63  ? 51  ALA H CA  1 
ATOM   375  C C   . ALA A 1 49  ? 62.537 -8.435  -24.940 1.00 25.67  ? 51  ALA H C   1 
ATOM   376  O O   . ALA A 1 49  ? 61.808 -7.707  -25.610 1.00 22.39  ? 51  ALA H O   1 
ATOM   377  C CB  . ALA A 1 49  ? 61.541 -9.626  -23.014 1.00 23.99  ? 51  ALA H CB  1 
ATOM   378  N N   . SER A 1 50  ? 63.448 -9.249  -25.465 1.00 25.38  ? 52  SER H N   1 
ATOM   379  C CA  . SER A 1 50  ? 63.647 -9.376  -26.904 1.00 22.59  ? 52  SER H CA  1 
ATOM   380  C C   . SER A 1 50  ? 63.996 -10.818 -27.239 1.00 26.77  ? 52  SER H C   1 
ATOM   381  O O   . SER A 1 50  ? 64.536 -11.551 -26.407 1.00 25.11  ? 52  SER H O   1 
ATOM   382  C CB  . SER A 1 50  ? 64.786 -8.467  -27.387 1.00 22.98  ? 52  SER H CB  1 
ATOM   383  O OG  . SER A 1 50  ? 64.465 -7.100  -27.207 1.00 20.79  ? 52  SER H OG  1 
ATOM   384  N N   . ILE A 1 51  ? 63.682 -11.218 -28.464 1.00 24.97  ? 53  ILE H N   1 
ATOM   385  C CA  . ILE A 1 51  ? 63.994 -12.551 -28.944 1.00 24.29  ? 53  ILE H CA  1 
ATOM   386  C C   . ILE A 1 51  ? 64.448 -12.409 -30.399 1.00 27.79  ? 53  ILE H C   1 
ATOM   387  O O   . ILE A 1 51  ? 63.741 -11.831 -31.234 1.00 21.63  ? 53  ILE H O   1 
ATOM   388  C CB  . ILE A 1 51  ? 62.774 -13.510 -28.824 1.00 24.44  ? 53  ILE H CB  1 
ATOM   389  C CG1 . ILE A 1 51  ? 63.192 -14.923 -29.236 1.00 22.37  ? 53  ILE H CG1 1 
ATOM   390  C CG2 . ILE A 1 51  ? 61.597 -13.015 -29.669 1.00 23.58  ? 53  ILE H CG2 1 
ATOM   391  C CD1 . ILE A 1 51  ? 62.114 -15.972 -28.990 1.00 27.32  ? 53  ILE H CD1 1 
ATOM   392  N N   . SER A 1 52  ? 65.644 -12.911 -30.693 1.00 25.65  ? 54  SER H N   1 
ATOM   393  C CA  . SER A 1 52  ? 66.208 -12.820 -32.039 1.00 25.23  ? 54  SER H CA  1 
ATOM   394  C C   . SER A 1 52  ? 65.529 -13.782 -32.997 1.00 23.79  ? 54  SER H C   1 
ATOM   395  O O   . SER A 1 52  ? 64.685 -14.580 -32.594 1.00 24.10  ? 54  SER H O   1 
ATOM   396  C CB  . SER A 1 52  ? 67.710 -13.128 -32.000 1.00 31.00  ? 54  SER H CB  1 
ATOM   397  O OG  . SER A 1 52  ? 67.941 -14.505 -31.726 1.00 27.56  ? 54  SER H OG  1 
ATOM   398  N N   . SER A 1 53  ? 65.895 -13.710 -34.273 1.00 26.24  ? 55  SER H N   1 
ATOM   399  C CA  . SER A 1 53  ? 65.317 -14.610 -35.257 1.00 32.30  ? 55  SER H CA  1 
ATOM   400  C C   . SER A 1 53  ? 65.805 -16.011 -34.915 1.00 30.35  ? 55  SER H C   1 
ATOM   401  O O   . SER A 1 53  ? 65.114 -17.001 -35.156 1.00 33.10  ? 55  SER H O   1 
ATOM   402  C CB  . SER A 1 53  ? 65.768 -14.232 -36.672 1.00 29.66  ? 55  SER H CB  1 
ATOM   403  O OG  . SER A 1 53  ? 67.179 -14.300 -36.784 1.00 41.33  ? 55  SER H OG  1 
ATOM   404  N N   . GLY A 1 54  ? 67.002 -16.075 -34.340 1.00 28.73  ? 56  GLY H N   1 
ATOM   405  C CA  . GLY A 1 54  ? 67.591 -17.349 -33.960 1.00 34.35  ? 56  GLY H CA  1 
ATOM   406  C C   . GLY A 1 54  ? 66.928 -17.942 -32.731 1.00 36.72  ? 56  GLY H C   1 
ATOM   407  O O   . GLY A 1 54  ? 67.187 -19.089 -32.357 1.00 39.11  ? 56  GLY H O   1 
ATOM   408  N N   . GLY A 1 55  ? 66.076 -17.153 -32.085 1.00 34.23  ? 57  GLY H N   1 
ATOM   409  C CA  . GLY A 1 55  ? 65.383 -17.642 -30.910 1.00 29.99  ? 57  GLY H CA  1 
ATOM   410  C C   . GLY A 1 55  ? 66.069 -17.336 -29.597 1.00 27.37  ? 57  GLY H C   1 
ATOM   411  O O   . GLY A 1 55  ? 65.576 -17.732 -28.542 1.00 26.31  ? 57  GLY H O   1 
ATOM   412  N N   . ILE A 1 56  ? 67.202 -16.643 -29.654 1.00 24.36  ? 58  ILE H N   1 
ATOM   413  C CA  . ILE A 1 56  ? 67.923 -16.271 -28.444 1.00 29.89  ? 58  ILE H CA  1 
ATOM   414  C C   . ILE A 1 56  ? 67.115 -15.208 -27.703 1.00 32.42  ? 58  ILE H C   1 
ATOM   415  O O   . ILE A 1 56  ? 66.646 -14.245 -28.314 1.00 34.42  ? 58  ILE H O   1 
ATOM   416  C CB  . ILE A 1 56  ? 69.308 -15.680 -28.777 1.00 29.88  ? 58  ILE H CB  1 
ATOM   417  C CG1 . ILE A 1 56  ? 70.087 -16.644 -29.672 1.00 33.96  ? 58  ILE H CG1 1 
ATOM   418  C CG2 . ILE A 1 56  ? 70.068 -15.389 -27.489 1.00 30.98  ? 58  ILE H CG2 1 
ATOM   419  C CD1 . ILE A 1 56  ? 70.262 -18.018 -29.081 1.00 31.91  ? 58  ILE H CD1 1 
ATOM   420  N N   . THR A 1 57  ? 66.954 -15.374 -26.394 1.00 30.01  ? 59  THR H N   1 
ATOM   421  C CA  . THR A 1 57  ? 66.201 -14.413 -25.602 1.00 24.02  ? 59  THR H CA  1 
ATOM   422  C C   . THR A 1 57  ? 67.102 -13.479 -24.797 1.00 30.16  ? 59  THR H C   1 
ATOM   423  O O   . THR A 1 57  ? 68.206 -13.855 -24.402 1.00 31.09  ? 59  THR H O   1 
ATOM   424  C CB  . THR A 1 57  ? 65.216 -15.134 -24.646 1.00 29.01  ? 59  THR H CB  1 
ATOM   425  O OG1 . THR A 1 57  ? 65.918 -16.112 -23.869 1.00 30.80  ? 59  THR H OG1 1 
ATOM   426  C CG2 . THR A 1 57  ? 64.127 -15.825 -25.440 1.00 25.51  ? 59  THR H CG2 1 
ATOM   427  N N   . TYR A 1 58  ? 66.624 -12.257 -24.566 1.00 25.82  ? 60  TYR H N   1 
ATOM   428  C CA  . TYR A 1 58  ? 67.371 -11.248 -23.815 1.00 27.53  ? 60  TYR H CA  1 
ATOM   429  C C   . TYR A 1 58  ? 66.421 -10.557 -22.863 1.00 29.06  ? 60  TYR H C   1 
ATOM   430  O O   . TYR A 1 58  ? 65.283 -10.261 -23.232 1.00 31.06  ? 60  TYR H O   1 
ATOM   431  C CB  . TYR A 1 58  ? 67.974 -10.198 -24.748 1.00 26.70  ? 60  TYR H CB  1 
ATOM   432  C CG  . TYR A 1 58  ? 68.792 -10.765 -25.865 1.00 30.36  ? 60  TYR H CG  1 
ATOM   433  C CD1 . TYR A 1 58  ? 68.181 -11.299 -26.994 1.00 32.91  ? 60  TYR H CD1 1 
ATOM   434  C CD2 . TYR A 1 58  ? 70.181 -10.784 -25.793 1.00 36.82  ? 60  TYR H CD2 1 
ATOM   435  C CE1 . TYR A 1 58  ? 68.933 -11.837 -28.028 1.00 38.43  ? 60  TYR H CE1 1 
ATOM   436  C CE2 . TYR A 1 58  ? 70.944 -11.321 -26.824 1.00 37.51  ? 60  TYR H CE2 1 
ATOM   437  C CZ  . TYR A 1 58  ? 70.314 -11.844 -27.937 1.00 39.69  ? 60  TYR H CZ  1 
ATOM   438  O OH  . TYR A 1 58  ? 71.062 -12.367 -28.966 1.00 42.74  ? 60  TYR H OH  1 
ATOM   439  N N   . TYR A 1 59  ? 66.893 -10.284 -21.649 1.00 29.80  ? 61  TYR H N   1 
ATOM   440  C CA  . TYR A 1 59  ? 66.075 -9.643  -20.622 1.00 28.03  ? 61  TYR H CA  1 
ATOM   441  C C   . TYR A 1 59  ? 66.888 -8.722  -19.725 1.00 27.34  ? 61  TYR H C   1 
ATOM   442  O O   . TYR A 1 59  ? 68.076 -8.943  -19.509 1.00 30.73  ? 61  TYR H O   1 
ATOM   443  C CB  . TYR A 1 59  ? 65.457 -10.690 -19.693 1.00 26.81  ? 61  TYR H CB  1 
ATOM   444  C CG  . TYR A 1 59  ? 64.674 -11.793 -20.354 1.00 26.29  ? 61  TYR H CG  1 
ATOM   445  C CD1 . TYR A 1 59  ? 63.319 -11.634 -20.648 1.00 27.35  ? 61  TYR H CD1 1 
ATOM   446  C CD2 . TYR A 1 59  ? 65.278 -13.015 -20.655 1.00 25.66  ? 61  TYR H CD2 1 
ATOM   447  C CE1 . TYR A 1 59  ? 62.583 -12.666 -21.223 1.00 28.28  ? 61  TYR H CE1 1 
ATOM   448  C CE2 . TYR A 1 59  ? 64.551 -14.056 -21.231 1.00 27.92  ? 61  TYR H CE2 1 
ATOM   449  C CZ  . TYR A 1 59  ? 63.207 -13.873 -21.511 1.00 24.64  ? 61  TYR H CZ  1 
ATOM   450  O OH  . TYR A 1 59  ? 62.483 -14.890 -22.074 1.00 32.63  ? 61  TYR H OH  1 
ATOM   451  N N   . PRO A 1 60  ? 66.258 -7.655  -19.211 1.00 30.28  ? 62  PRO H N   1 
ATOM   452  C CA  . PRO A 1 60  ? 66.983 -6.751  -18.316 1.00 30.45  ? 62  PRO H CA  1 
ATOM   453  C C   . PRO A 1 60  ? 66.832 -7.412  -16.942 1.00 33.02  ? 62  PRO H C   1 
ATOM   454  O O   . PRO A 1 60  ? 65.989 -8.294  -16.782 1.00 31.80  ? 62  PRO H O   1 
ATOM   455  C CB  . PRO A 1 60  ? 66.196 -5.450  -18.426 1.00 24.61  ? 62  PRO H CB  1 
ATOM   456  C CG  . PRO A 1 60  ? 64.799 -5.929  -18.680 1.00 26.11  ? 62  PRO H CG  1 
ATOM   457  C CD  . PRO A 1 60  ? 65.006 -7.036  -19.683 1.00 23.75  ? 62  PRO H CD  1 
ATOM   458  N N   . ASP A 1 61  ? 67.634 -7.003  -15.965 1.00 39.44  ? 63  ASP H N   1 
ATOM   459  C CA  . ASP A 1 61  ? 67.567 -7.587  -14.623 1.00 40.91  ? 63  ASP H CA  1 
ATOM   460  C C   . ASP A 1 61  ? 66.202 -7.450  -13.967 1.00 42.56  ? 63  ASP H C   1 
ATOM   461  O O   . ASP A 1 61  ? 65.761 -8.328  -13.226 1.00 43.86  ? 63  ASP H O   1 
ATOM   462  C CB  . ASP A 1 61  ? 68.613 -6.937  -13.717 1.00 45.66  ? 63  ASP H CB  1 
ATOM   463  C CG  . ASP A 1 61  ? 70.020 -7.308  -14.102 1.00 49.83  ? 63  ASP H CG  1 
ATOM   464  O OD1 . ASP A 1 61  ? 70.957 -6.652  -13.604 1.00 55.67  ? 63  ASP H OD1 1 
ATOM   465  O OD2 . ASP A 1 61  ? 70.186 -8.260  -14.895 1.00 52.83  ? 63  ASP H OD2 1 
ATOM   466  N N   . SER A 1 62  ? 65.547 -6.330  -14.236 1.00 42.90  ? 64  SER H N   1 
ATOM   467  C CA  . SER A 1 62  ? 64.234 -6.037  -13.678 1.00 41.30  ? 64  SER H CA  1 
ATOM   468  C C   . SER A 1 62  ? 63.207 -7.158  -13.810 1.00 40.16  ? 64  SER H C   1 
ATOM   469  O O   . SER A 1 62  ? 62.330 -7.299  -12.959 1.00 43.02  ? 64  SER H O   1 
ATOM   470  C CB  . SER A 1 62  ? 63.677 -4.782  -14.341 1.00 43.73  ? 64  SER H CB  1 
ATOM   471  O OG  . SER A 1 62  ? 63.612 -4.962  -15.745 1.00 42.95  ? 64  SER H OG  1 
ATOM   472  N N   . VAL A 1 63  ? 63.306 -7.953  -14.871 1.00 37.52  ? 65  VAL H N   1 
ATOM   473  C CA  . VAL A 1 63  ? 62.335 -9.019  -15.089 1.00 37.08  ? 65  VAL H CA  1 
ATOM   474  C C   . VAL A 1 63  ? 62.964 -10.384 -15.315 1.00 34.69  ? 65  VAL H C   1 
ATOM   475  O O   . VAL A 1 63  ? 62.253 -11.386 -15.433 1.00 32.98  ? 65  VAL H O   1 
ATOM   476  C CB  . VAL A 1 63  ? 61.422 -8.696  -16.306 1.00 37.21  ? 65  VAL H CB  1 
ATOM   477  C CG1 . VAL A 1 63  ? 60.805 -7.314  -16.143 1.00 31.26  ? 65  VAL H CG1 1 
ATOM   478  C CG2 . VAL A 1 63  ? 62.218 -8.786  -17.601 1.00 31.46  ? 65  VAL H CG2 1 
ATOM   479  N N   . ALA A 1 64  ? 64.291 -10.418 -15.390 1.00 35.99  ? 66  ALA H N   1 
ATOM   480  C CA  . ALA A 1 64  ? 65.013 -11.662 -15.608 1.00 37.94  ? 66  ALA H CA  1 
ATOM   481  C C   . ALA A 1 64  ? 64.556 -12.701 -14.594 1.00 40.65  ? 66  ALA H C   1 
ATOM   482  O O   . ALA A 1 64  ? 64.509 -12.428 -13.396 1.00 43.75  ? 66  ALA H O   1 
ATOM   483  C CB  . ALA A 1 64  ? 66.517 -11.426 -15.479 1.00 40.52  ? 66  ALA H CB  1 
ATOM   484  N N   . GLY A 1 65  ? 64.204 -13.885 -15.085 1.00 42.06  ? 67  GLY H N   1 
ATOM   485  C CA  . GLY A 1 65  ? 63.757 -14.948 -14.205 1.00 41.99  ? 67  GLY H CA  1 
ATOM   486  C C   . GLY A 1 65  ? 62.257 -15.010 -13.983 1.00 39.77  ? 67  GLY H C   1 
ATOM   487  O O   . GLY A 1 65  ? 61.725 -16.071 -13.648 1.00 41.49  ? 67  GLY H O   1 
ATOM   488  N N   . ARG A 1 66  ? 61.566 -13.887 -14.162 1.00 36.87  ? 68  ARG H N   1 
ATOM   489  C CA  . ARG A 1 66  ? 60.116 -13.854 -13.967 1.00 35.95  ? 68  ARG H CA  1 
ATOM   490  C C   . ARG A 1 66  ? 59.347 -13.775 -15.280 1.00 37.42  ? 68  ARG H C   1 
ATOM   491  O O   . ARG A 1 66  ? 58.234 -14.294 -15.383 1.00 39.42  ? 68  ARG H O   1 
ATOM   492  C CB  . ARG A 1 66  ? 59.719 -12.668 -13.086 1.00 34.86  ? 68  ARG H CB  1 
ATOM   493  C CG  . ARG A 1 66  ? 60.295 -12.709 -11.682 1.00 39.54  ? 68  ARG H CG  1 
ATOM   494  C CD  . ARG A 1 66  ? 59.826 -11.513 -10.869 1.00 38.93  ? 68  ARG H CD  1 
ATOM   495  N NE  . ARG A 1 66  ? 60.231 -10.245 -11.469 1.00 42.04  ? 68  ARG H NE  1 
ATOM   496  C CZ  . ARG A 1 66  ? 59.383 -9.291  -11.842 1.00 44.69  ? 68  ARG H CZ  1 
ATOM   497  N NH1 . ARG A 1 66  ? 58.077 -9.459  -11.677 1.00 43.70  ? 68  ARG H NH1 1 
ATOM   498  N NH2 . ARG A 1 66  ? 59.839 -8.168  -12.382 1.00 46.00  ? 68  ARG H NH2 1 
ATOM   499  N N   . PHE A 1 67  ? 59.936 -13.121 -16.279 1.00 35.29  ? 69  PHE H N   1 
ATOM   500  C CA  . PHE A 1 67  ? 59.290 -12.976 -17.584 1.00 33.91  ? 69  PHE H CA  1 
ATOM   501  C C   . PHE A 1 67  ? 59.931 -13.848 -18.642 1.00 26.44  ? 69  PHE H C   1 
ATOM   502  O O   . PHE A 1 67  ? 61.142 -14.033 -18.655 1.00 32.29  ? 69  PHE H O   1 
ATOM   503  C CB  . PHE A 1 67  ? 59.356 -11.525 -18.068 1.00 34.64  ? 69  PHE H CB  1 
ATOM   504  C CG  . PHE A 1 67  ? 58.492 -10.574 -17.292 1.00 37.42  ? 69  PHE H CG  1 
ATOM   505  C CD1 . PHE A 1 67  ? 58.287 -9.281  -17.761 1.00 39.62  ? 69  PHE H CD1 1 
ATOM   506  C CD2 . PHE A 1 67  ? 57.890 -10.956 -16.097 1.00 37.58  ? 69  PHE H CD2 1 
ATOM   507  C CE1 . PHE A 1 67  ? 57.500 -8.382  -17.055 1.00 37.14  ? 69  PHE H CE1 1 
ATOM   508  C CE2 . PHE A 1 67  ? 57.099 -10.061 -15.382 1.00 37.80  ? 69  PHE H CE2 1 
ATOM   509  C CZ  . PHE A 1 67  ? 56.905 -8.774  -15.862 1.00 39.40  ? 69  PHE H CZ  1 
ATOM   510  N N   . THR A 1 68  ? 59.109 -14.370 -19.540 1.00 29.40  ? 70  THR H N   1 
ATOM   511  C CA  . THR A 1 68  ? 59.594 -15.212 -20.620 1.00 29.96  ? 70  THR H CA  1 
ATOM   512  C C   . THR A 1 68  ? 58.981 -14.763 -21.934 1.00 30.75  ? 70  THR H C   1 
ATOM   513  O O   . THR A 1 68  ? 57.755 -14.732 -22.075 1.00 34.40  ? 70  THR H O   1 
ATOM   514  C CB  . THR A 1 68  ? 59.212 -16.694 -20.409 1.00 31.58  ? 70  THR H CB  1 
ATOM   515  O OG1 . THR A 1 68  ? 59.724 -17.147 -19.149 1.00 30.59  ? 70  THR H OG1 1 
ATOM   516  C CG2 . THR A 1 68  ? 59.794 -17.553 -21.531 1.00 28.90  ? 70  THR H CG2 1 
ATOM   517  N N   . ILE A 1 69  ? 59.830 -14.409 -22.892 1.00 26.31  ? 71  ILE H N   1 
ATOM   518  C CA  . ILE A 1 69  ? 59.340 -14.001 -24.196 1.00 25.18  ? 71  ILE H CA  1 
ATOM   519  C C   . ILE A 1 69  ? 59.469 -15.224 -25.086 1.00 27.65  ? 71  ILE H C   1 
ATOM   520  O O   . ILE A 1 69  ? 60.469 -15.938 -25.021 1.00 28.79  ? 71  ILE H O   1 
ATOM   521  C CB  . ILE A 1 69  ? 60.175 -12.827 -24.780 1.00 28.03  ? 71  ILE H CB  1 
ATOM   522  C CG1 . ILE A 1 69  ? 59.578 -12.370 -26.122 1.00 26.33  ? 71  ILE H CG1 1 
ATOM   523  C CG2 . ILE A 1 69  ? 61.626 -13.253 -24.962 1.00 18.29  ? 71  ILE H CG2 1 
ATOM   524  C CD1 . ILE A 1 69  ? 60.233 -11.095 -26.696 1.00 18.09  ? 71  ILE H CD1 1 
ATOM   525  N N   . SER A 1 70  ? 58.446 -15.485 -25.891 1.00 25.30  ? 72  SER H N   1 
ATOM   526  C CA  . SER A 1 70  ? 58.471 -16.626 -26.803 1.00 27.60  ? 72  SER H CA  1 
ATOM   527  C C   . SER A 1 70  ? 57.723 -16.281 -28.086 1.00 30.37  ? 72  SER H C   1 
ATOM   528  O O   . SER A 1 70  ? 56.949 -15.321 -28.128 1.00 30.53  ? 72  SER H O   1 
ATOM   529  C CB  . SER A 1 70  ? 57.838 -17.860 -26.145 1.00 29.69  ? 72  SER H CB  1 
ATOM   530  O OG  . SER A 1 70  ? 56.467 -17.643 -25.855 1.00 32.17  ? 72  SER H OG  1 
ATOM   531  N N   . ARG A 1 71  ? 57.948 -17.076 -29.128 1.00 30.38  ? 73  ARG H N   1 
ATOM   532  C CA  . ARG A 1 71  ? 57.316 -16.839 -30.416 1.00 29.92  ? 73  ARG H CA  1 
ATOM   533  C C   . ARG A 1 71  ? 56.812 -18.118 -31.067 1.00 31.19  ? 73  ARG H C   1 
ATOM   534  O O   . ARG A 1 71  ? 57.465 -19.153 -31.004 1.00 31.63  ? 73  ARG H O   1 
ATOM   535  C CB  . ARG A 1 71  ? 58.324 -16.149 -31.349 1.00 30.29  ? 73  ARG H CB  1 
ATOM   536  C CG  . ARG A 1 71  ? 57.895 -16.013 -32.813 1.00 31.37  ? 73  ARG H CG  1 
ATOM   537  C CD  . ARG A 1 71  ? 58.956 -15.231 -33.594 1.00 31.59  ? 73  ARG H CD  1 
ATOM   538  N NE  . ARG A 1 71  ? 60.282 -15.819 -33.418 1.00 36.01  ? 73  ARG H NE  1 
ATOM   539  C CZ  . ARG A 1 71  ? 61.422 -15.132 -33.411 1.00 36.77  ? 73  ARG H CZ  1 
ATOM   540  N NH1 . ARG A 1 71  ? 61.425 -13.809 -33.576 1.00 26.26  ? 73  ARG H NH1 1 
ATOM   541  N NH2 . ARG A 1 71  ? 62.565 -15.773 -33.217 1.00 31.84  ? 73  ARG H NH2 1 
ATOM   542  N N   . ASP A 1 72  ? 55.633 -18.046 -31.674 1.00 30.98  ? 74  ASP H N   1 
ATOM   543  C CA  . ASP A 1 72  ? 55.085 -19.193 -32.386 1.00 33.46  ? 74  ASP H CA  1 
ATOM   544  C C   . ASP A 1 72  ? 55.287 -18.834 -33.855 1.00 35.26  ? 74  ASP H C   1 
ATOM   545  O O   . ASP A 1 72  ? 54.491 -18.096 -34.441 1.00 34.63  ? 74  ASP H O   1 
ATOM   546  C CB  . ASP A 1 72  ? 53.598 -19.380 -32.075 1.00 31.26  ? 74  ASP H CB  1 
ATOM   547  C CG  . ASP A 1 72  ? 52.981 -20.542 -32.844 1.00 36.64  ? 74  ASP H CG  1 
ATOM   548  O OD1 . ASP A 1 72  ? 51.871 -20.984 -32.473 1.00 37.71  ? 74  ASP H OD1 1 
ATOM   549  O OD2 . ASP A 1 72  ? 53.601 -21.009 -33.825 1.00 40.25  ? 74  ASP H OD2 1 
ATOM   550  N N   . ASN A 1 73  ? 56.361 -19.349 -34.441 1.00 33.93  ? 75  ASN H N   1 
ATOM   551  C CA  . ASN A 1 73  ? 56.690 -19.043 -35.826 1.00 37.85  ? 75  ASN H CA  1 
ATOM   552  C C   . ASN A 1 73  ? 55.646 -19.426 -36.856 1.00 38.32  ? 75  ASN H C   1 
ATOM   553  O O   . ASN A 1 73  ? 55.518 -18.761 -37.881 1.00 37.60  ? 75  ASN H O   1 
ATOM   554  C CB  . ASN A 1 73  ? 58.027 -19.677 -36.206 1.00 38.85  ? 75  ASN H CB  1 
ATOM   555  C CG  . ASN A 1 73  ? 59.193 -19.018 -35.511 1.00 44.21  ? 75  ASN H CG  1 
ATOM   556  O OD1 . ASN A 1 73  ? 59.142 -17.833 -35.180 1.00 48.28  ? 75  ASN H OD1 1 
ATOM   557  N ND2 . ASN A 1 73  ? 60.261 -19.776 -35.297 1.00 48.18  ? 75  ASN H ND2 1 
ATOM   558  N N   . VAL A 1 74  ? 54.903 -20.493 -36.585 1.00 37.63  ? 76  VAL H N   1 
ATOM   559  C CA  . VAL A 1 74  ? 53.883 -20.955 -37.512 1.00 38.44  ? 76  VAL H CA  1 
ATOM   560  C C   . VAL A 1 74  ? 52.666 -20.042 -37.541 1.00 38.87  ? 76  VAL H C   1 
ATOM   561  O O   . VAL A 1 74  ? 52.284 -19.545 -38.598 1.00 36.74  ? 76  VAL H O   1 
ATOM   562  C CB  . VAL A 1 74  ? 53.414 -22.381 -37.165 1.00 41.74  ? 76  VAL H CB  1 
ATOM   563  C CG1 . VAL A 1 74  ? 52.373 -22.844 -38.176 1.00 38.31  ? 76  VAL H CG1 1 
ATOM   564  C CG2 . VAL A 1 74  ? 54.604 -23.329 -37.157 1.00 41.73  ? 76  VAL H CG2 1 
ATOM   565  N N   . ARG A 1 75  ? 52.055 -19.827 -36.381 1.00 38.91  ? 77  ARG H N   1 
ATOM   566  C CA  . ARG A 1 75  ? 50.877 -18.976 -36.301 1.00 40.67  ? 77  ARG H CA  1 
ATOM   567  C C   . ARG A 1 75  ? 51.201 -17.480 -36.284 1.00 36.96  ? 77  ARG H C   1 
ATOM   568  O O   . ARG A 1 75  ? 50.299 -16.647 -36.353 1.00 34.35  ? 77  ARG H O   1 
ATOM   569  C CB  . ARG A 1 75  ? 50.045 -19.348 -35.069 1.00 47.52  ? 77  ARG H CB  1 
ATOM   570  C CG  . ARG A 1 75  ? 49.146 -20.561 -35.279 1.00 52.14  ? 77  ARG H CG  1 
ATOM   571  C CD  . ARG A 1 75  ? 48.265 -20.827 -34.067 1.00 57.78  ? 77  ARG H CD  1 
ATOM   572  N NE  . ARG A 1 75  ? 48.964 -21.583 -33.031 1.00 64.65  ? 77  ARG H NE  1 
ATOM   573  C CZ  . ARG A 1 75  ? 49.314 -22.862 -33.147 1.00 66.27  ? 77  ARG H CZ  1 
ATOM   574  N NH1 . ARG A 1 75  ? 49.029 -23.532 -34.255 1.00 68.54  ? 77  ARG H NH1 1 
ATOM   575  N NH2 . ARG A 1 75  ? 49.951 -23.472 -32.157 1.00 65.49  ? 77  ARG H NH2 1 
ATOM   576  N N   . ASN A 1 76  ? 52.489 -17.153 -36.202 1.00 36.17  ? 78  ASN H N   1 
ATOM   577  C CA  . ASN A 1 76  ? 52.953 -15.766 -36.180 1.00 33.71  ? 78  ASN H CA  1 
ATOM   578  C C   . ASN A 1 76  ? 52.369 -15.025 -34.979 1.00 32.78  ? 78  ASN H C   1 
ATOM   579  O O   . ASN A 1 76  ? 51.590 -14.081 -35.129 1.00 31.48  ? 78  ASN H O   1 
ATOM   580  C CB  . ASN A 1 76  ? 52.565 -15.057 -37.486 1.00 29.84  ? 78  ASN H CB  1 
ATOM   581  C CG  . ASN A 1 76  ? 53.446 -13.849 -37.784 1.00 29.87  ? 78  ASN H CG  1 
ATOM   582  O OD1 . ASN A 1 76  ? 54.668 -13.941 -37.748 1.00 27.94  ? 78  ASN H OD1 1 
ATOM   583  N ND2 . ASN A 1 76  ? 52.824 -12.720 -38.098 1.00 26.79  ? 78  ASN H ND2 1 
ATOM   584  N N   . ILE A 1 77  ? 52.750 -15.475 -33.786 1.00 30.15  ? 79  ILE H N   1 
ATOM   585  C CA  . ILE A 1 77  ? 52.285 -14.877 -32.541 1.00 28.95  ? 79  ILE H CA  1 
ATOM   586  C C   . ILE A 1 77  ? 53.463 -14.687 -31.586 1.00 28.40  ? 79  ILE H C   1 
ATOM   587  O O   . ILE A 1 77  ? 54.298 -15.579 -31.424 1.00 29.01  ? 79  ILE H O   1 
ATOM   588  C CB  . ILE A 1 77  ? 51.235 -15.779 -31.834 1.00 31.42  ? 79  ILE H CB  1 
ATOM   589  C CG1 . ILE A 1 77  ? 50.099 -16.125 -32.795 1.00 33.65  ? 79  ILE H CG1 1 
ATOM   590  C CG2 . ILE A 1 77  ? 50.670 -15.065 -30.615 1.00 25.88  ? 79  ILE H CG2 1 
ATOM   591  C CD1 . ILE A 1 77  ? 49.095 -17.108 -32.226 1.00 38.31  ? 79  ILE H CD1 1 
ATOM   592  N N   . LEU A 1 78  ? 53.519 -13.523 -30.954 1.00 26.81  ? 80  LEU H N   1 
ATOM   593  C CA  . LEU A 1 78  ? 54.575 -13.201 -30.003 1.00 24.50  ? 80  LEU H CA  1 
ATOM   594  C C   . LEU A 1 78  ? 53.946 -13.256 -28.613 1.00 28.88  ? 80  LEU H C   1 
ATOM   595  O O   . LEU A 1 78  ? 52.833 -12.763 -28.424 1.00 28.07  ? 80  LEU H O   1 
ATOM   596  C CB  . LEU A 1 78  ? 55.097 -11.784 -30.253 1.00 24.88  ? 80  LEU H CB  1 
ATOM   597  C CG  . LEU A 1 78  ? 56.570 -11.465 -30.002 1.00 29.64  ? 80  LEU H CG  1 
ATOM   598  C CD1 . LEU A 1 78  ? 56.675 -10.054 -29.457 1.00 27.46  ? 80  LEU H CD1 1 
ATOM   599  C CD2 . LEU A 1 78  ? 57.181 -12.453 -29.045 1.00 31.99  ? 80  LEU H CD2 1 
ATOM   600  N N   . TYR A 1 79  ? 54.656 -13.829 -27.641 1.00 25.31  ? 81  TYR H N   1 
ATOM   601  C CA  . TYR A 1 79  ? 54.124 -13.934 -26.286 1.00 27.10  ? 81  TYR H CA  1 
ATOM   602  C C   . TYR A 1 79  ? 55.058 -13.366 -25.239 1.00 25.87  ? 81  TYR H C   1 
ATOM   603  O O   . TYR A 1 79  ? 56.270 -13.290 -25.435 1.00 30.10  ? 81  TYR H O   1 
ATOM   604  C CB  . TYR A 1 79  ? 53.861 -15.396 -25.899 1.00 23.06  ? 81  TYR H CB  1 
ATOM   605  C CG  . TYR A 1 79  ? 52.877 -16.143 -26.762 1.00 30.25  ? 81  TYR H CG  1 
ATOM   606  C CD1 . TYR A 1 79  ? 53.315 -17.105 -27.673 1.00 29.86  ? 81  TYR H CD1 1 
ATOM   607  C CD2 . TYR A 1 79  ? 51.504 -15.918 -26.644 1.00 26.66  ? 81  TYR H CD2 1 
ATOM   608  C CE1 . TYR A 1 79  ? 52.411 -17.829 -28.444 1.00 30.81  ? 81  TYR H CE1 1 
ATOM   609  C CE2 . TYR A 1 79  ? 50.592 -16.639 -27.411 1.00 31.29  ? 81  TYR H CE2 1 
ATOM   610  C CZ  . TYR A 1 79  ? 51.056 -17.593 -28.308 1.00 31.99  ? 81  TYR H CZ  1 
ATOM   611  O OH  . TYR A 1 79  ? 50.162 -18.319 -29.063 1.00 37.77  ? 81  TYR H OH  1 
ATOM   612  N N   . LEU A 1 80  ? 54.466 -12.978 -24.119 1.00 27.64  ? 82  LEU H N   1 
ATOM   613  C CA  . LEU A 1 80  ? 55.206 -12.471 -22.979 1.00 30.61  ? 82  LEU H CA  1 
ATOM   614  C C   . LEU A 1 80  ? 54.509 -13.101 -21.772 1.00 31.15  ? 82  LEU H C   1 
ATOM   615  O O   . LEU A 1 80  ? 53.428 -12.664 -21.366 1.00 27.28  ? 82  LEU H O   1 
ATOM   616  C CB  . LEU A 1 80  ? 55.128 -10.941 -22.895 1.00 28.59  ? 82  LEU H CB  1 
ATOM   617  C CG  . LEU A 1 80  ? 56.256 -10.155 -22.203 1.00 32.54  ? 82  LEU H CG  1 
ATOM   618  C CD1 . LEU A 1 80  ? 55.691 -9.344  -21.055 1.00 29.34  ? 82  LEU H CD1 1 
ATOM   619  C CD2 . LEU A 1 80  ? 57.362 -11.085 -21.725 1.00 33.91  ? 82  LEU H CD2 1 
ATOM   620  N N   . GLN A 1 81  ? 55.112 -14.157 -21.237 1.00 31.46  ? 83  GLN H N   1 
ATOM   621  C CA  . GLN A 1 81  ? 54.570 -14.843 -20.070 1.00 31.06  ? 83  GLN H CA  1 
ATOM   622  C C   . GLN A 1 81  ? 55.170 -14.172 -18.849 1.00 31.74  ? 83  GLN H C   1 
ATOM   623  O O   . GLN A 1 81  ? 56.388 -14.167 -18.674 1.00 31.14  ? 83  GLN H O   1 
ATOM   624  C CB  . GLN A 1 81  ? 54.963 -16.326 -20.094 1.00 36.84  ? 83  GLN H CB  1 
ATOM   625  C CG  . GLN A 1 81  ? 54.561 -17.116 -18.844 1.00 38.97  ? 83  GLN H CG  1 
ATOM   626  C CD  . GLN A 1 81  ? 53.065 -17.074 -18.582 1.00 36.98  ? 83  GLN H CD  1 
ATOM   627  O OE1 . GLN A 1 81  ? 52.601 -16.406 -17.654 1.00 40.31  ? 83  GLN H OE1 1 
ATOM   628  N NE2 . GLN A 1 81  ? 52.300 -17.775 -19.411 1.00 38.21  ? 83  GLN H NE2 1 
ATOM   629  N N   . MET A 1 82  ? 54.321 -13.593 -18.009 1.00 32.10  ? 84  MET H N   1 
ATOM   630  C CA  . MET A 1 82  ? 54.797 -12.923 -16.812 1.00 34.52  ? 84  MET H CA  1 
ATOM   631  C C   . MET A 1 82  ? 54.463 -13.758 -15.575 1.00 36.50  ? 84  MET H C   1 
ATOM   632  O O   . MET A 1 82  ? 53.437 -14.431 -15.535 1.00 39.14  ? 84  MET H O   1 
ATOM   633  C CB  . MET A 1 82  ? 54.158 -11.537 -16.705 1.00 34.14  ? 84  MET H CB  1 
ATOM   634  C CG  . MET A 1 82  ? 54.375 -10.662 -17.942 1.00 37.72  ? 84  MET H CG  1 
ATOM   635  S SD  . MET A 1 82  ? 53.629 -9.016  -17.812 1.00 41.60  ? 84  MET H SD  1 
ATOM   636  C CE  . MET A 1 82  ? 51.978 -9.395  -18.204 1.00 37.42  ? 84  MET H CE  1 
ATOM   637  N N   . SER A 1 83  ? 55.341 -13.720 -14.578 1.00 39.56  ? 85  SER H N   1 
ATOM   638  C CA  . SER A 1 83  ? 55.138 -14.469 -13.341 1.00 39.28  ? 85  SER H CA  1 
ATOM   639  C C   . SER A 1 83  ? 55.645 -13.659 -12.161 1.00 38.70  ? 85  SER H C   1 
ATOM   640  O O   . SER A 1 83  ? 56.405 -12.704 -12.337 1.00 38.07  ? 85  SER H O   1 
ATOM   641  C CB  . SER A 1 83  ? 55.885 -15.806 -13.395 1.00 42.00  ? 85  SER H CB  1 
ATOM   642  O OG  . SER A 1 83  ? 55.408 -16.621 -14.454 1.00 47.90  ? 85  SER H OG  1 
ATOM   643  N N   . SER A 1 84  ? 55.229 -14.049 -10.959 1.00 37.95  ? 86  SER H N   1 
ATOM   644  C CA  . SER A 1 84  ? 55.646 -13.359 -9.744  1.00 38.17  ? 86  SER H CA  1 
ATOM   645  C C   . SER A 1 84  ? 55.522 -11.857 -9.951  1.00 37.05  ? 86  SER H C   1 
ATOM   646  O O   . SER A 1 84  ? 56.425 -11.088 -9.612  1.00 36.10  ? 86  SER H O   1 
ATOM   647  C CB  . SER A 1 84  ? 57.097 -13.716 -9.405  1.00 39.22  ? 86  SER H CB  1 
ATOM   648  O OG  . SER A 1 84  ? 57.251 -15.114 -9.236  1.00 45.01  ? 86  SER H OG  1 
ATOM   649  N N   . LEU A 1 85  ? 54.392 -11.447 -10.513 1.00 39.54  ? 87  LEU H N   1 
ATOM   650  C CA  . LEU A 1 85  ? 54.148 -10.040 -10.794 1.00 39.82  ? 87  LEU H CA  1 
ATOM   651  C C   . LEU A 1 85  ? 54.256 -9.150  -9.570  1.00 41.64  ? 87  LEU H C   1 
ATOM   652  O O   . LEU A 1 85  ? 53.831 -9.516  -8.474  1.00 45.92  ? 87  LEU H O   1 
ATOM   653  C CB  . LEU A 1 85  ? 52.777 -9.867  -11.452 1.00 38.42  ? 87  LEU H CB  1 
ATOM   654  C CG  . LEU A 1 85  ? 52.752 -10.175 -12.954 1.00 37.05  ? 87  LEU H CG  1 
ATOM   655  C CD1 . LEU A 1 85  ? 51.338 -10.102 -13.470 1.00 39.88  ? 87  LEU H CD1 1 
ATOM   656  C CD2 . LEU A 1 85  ? 53.634 -9.178  -13.691 1.00 33.95  ? 87  LEU H CD2 1 
ATOM   657  N N   . ARG A 1 86  ? 54.841 -7.976  -9.776  1.00 41.95  ? 88  ARG H N   1 
ATOM   658  C CA  . ARG A 1 86  ? 55.032 -6.996  -8.723  1.00 43.36  ? 88  ARG H CA  1 
ATOM   659  C C   . ARG A 1 86  ? 54.319 -5.701  -9.091  1.00 46.70  ? 88  ARG H C   1 
ATOM   660  O O   . ARG A 1 86  ? 54.059 -5.435  -10.265 1.00 46.41  ? 88  ARG H O   1 
ATOM   661  C CB  . ARG A 1 86  ? 56.529 -6.732  -8.516  1.00 46.13  ? 88  ARG H CB  1 
ATOM   662  C CG  . ARG A 1 86  ? 57.205 -7.709  -7.560  1.00 48.86  ? 88  ARG H CG  1 
ATOM   663  C CD  . ARG A 1 86  ? 58.290 -8.572  -8.213  1.00 47.91  ? 88  ARG H CD  1 
ATOM   664  N NE  . ARG A 1 86  ? 59.435 -7.794  -8.678  1.00 48.07  ? 88  ARG H NE  1 
ATOM   665  C CZ  . ARG A 1 86  ? 60.678 -8.262  -8.765  1.00 47.52  ? 88  ARG H CZ  1 
ATOM   666  N NH1 . ARG A 1 86  ? 60.952 -9.510  -8.412  1.00 46.87  ? 88  ARG H NH1 1 
ATOM   667  N NH2 . ARG A 1 86  ? 61.650 -7.485  -9.223  1.00 46.60  ? 88  ARG H NH2 1 
ATOM   668  N N   . SER A 1 87  ? 53.999 -4.897  -8.084  1.00 46.15  ? 89  SER H N   1 
ATOM   669  C CA  . SER A 1 87  ? 53.317 -3.632  -8.316  1.00 44.22  ? 89  SER H CA  1 
ATOM   670  C C   . SER A 1 87  ? 54.111 -2.785  -9.311  1.00 41.69  ? 89  SER H C   1 
ATOM   671  O O   . SER A 1 87  ? 53.537 -2.029  -10.100 1.00 38.75  ? 89  SER H O   1 
ATOM   672  C CB  . SER A 1 87  ? 53.163 -2.875  -6.997  1.00 44.37  ? 89  SER H CB  1 
ATOM   673  O OG  . SER A 1 87  ? 54.431 -2.626  -6.418  1.00 51.54  ? 89  SER H OG  1 
ATOM   674  N N   . GLU A 1 88  ? 55.432 -2.925  -9.271  1.00 39.96  ? 90  GLU H N   1 
ATOM   675  C CA  . GLU A 1 88  ? 56.321 -2.181  -10.154 1.00 43.44  ? 90  GLU H CA  1 
ATOM   676  C C   . GLU A 1 88  ? 56.183 -2.586  -11.623 1.00 43.08  ? 90  GLU H C   1 
ATOM   677  O O   . GLU A 1 88  ? 56.726 -1.921  -12.502 1.00 43.98  ? 90  GLU H O   1 
ATOM   678  C CB  . GLU A 1 88  ? 57.780 -2.360  -9.712  1.00 49.00  ? 90  GLU H CB  1 
ATOM   679  C CG  . GLU A 1 88  ? 58.279 -3.805  -9.748  1.00 58.38  ? 90  GLU H CG  1 
ATOM   680  C CD  . GLU A 1 88  ? 59.698 -3.961  -9.210  1.00 62.90  ? 90  GLU H CD  1 
ATOM   681  O OE1 . GLU A 1 88  ? 59.941 -3.571  -8.048  1.00 67.21  ? 90  GLU H OE1 1 
ATOM   682  O OE2 . GLU A 1 88  ? 60.569 -4.479  -9.946  1.00 62.59  ? 90  GLU H OE2 1 
ATOM   683  N N   . ASP A 1 89  ? 55.466 -3.674  -11.889 1.00 40.94  ? 91  ASP H N   1 
ATOM   684  C CA  . ASP A 1 89  ? 55.278 -4.141  -13.261 1.00 38.38  ? 91  ASP H CA  1 
ATOM   685  C C   . ASP A 1 89  ? 54.071 -3.490  -13.929 1.00 38.16  ? 91  ASP H C   1 
ATOM   686  O O   . ASP A 1 89  ? 53.856 -3.650  -15.131 1.00 34.93  ? 91  ASP H O   1 
ATOM   687  C CB  . ASP A 1 89  ? 55.108 -5.661  -13.301 1.00 33.51  ? 91  ASP H CB  1 
ATOM   688  C CG  . ASP A 1 89  ? 56.362 -6.402  -12.882 1.00 39.38  ? 91  ASP H CG  1 
ATOM   689  O OD1 . ASP A 1 89  ? 57.464 -6.020  -13.341 1.00 32.31  ? 91  ASP H OD1 1 
ATOM   690  O OD2 . ASP A 1 89  ? 56.243 -7.374  -12.101 1.00 36.45  ? 91  ASP H OD2 1 
ATOM   691  N N   . THR A 1 90  ? 53.272 -2.776  -13.145 1.00 36.35  ? 92  THR H N   1 
ATOM   692  C CA  . THR A 1 90  ? 52.097 -2.105  -13.681 1.00 35.99  ? 92  THR H CA  1 
ATOM   693  C C   . THR A 1 90  ? 52.545 -1.145  -14.779 1.00 35.65  ? 92  THR H C   1 
ATOM   694  O O   . THR A 1 90  ? 53.424 -0.305  -14.565 1.00 34.68  ? 92  THR H O   1 
ATOM   695  C CB  . THR A 1 90  ? 51.346 -1.336  -12.571 1.00 36.87  ? 92  THR H CB  1 
ATOM   696  O OG1 . THR A 1 90  ? 50.801 -2.277  -11.631 1.00 39.83  ? 92  THR H OG1 1 
ATOM   697  C CG2 . THR A 1 90  ? 50.217 -0.502  -13.160 1.00 35.92  ? 92  THR H CG2 1 
ATOM   698  N N   . ALA A 1 91  ? 51.951 -1.288  -15.961 1.00 33.07  ? 93  ALA H N   1 
ATOM   699  C CA  . ALA A 1 91  ? 52.303 -0.446  -17.099 1.00 32.21  ? 93  ALA H CA  1 
ATOM   700  C C   . ALA A 1 91  ? 51.531 -0.847  -18.344 1.00 30.73  ? 93  ALA H C   1 
ATOM   701  O O   . ALA A 1 91  ? 50.746 -1.799  -18.335 1.00 29.65  ? 93  ALA H O   1 
ATOM   702  C CB  . ALA A 1 91  ? 53.806 -0.551  -17.385 1.00 27.95  ? 93  ALA H CB  1 
ATOM   703  N N   . LEU A 1 92  ? 51.763 -0.097  -19.414 1.00 31.31  ? 94  LEU H N   1 
ATOM   704  C CA  . LEU A 1 92  ? 51.152 -0.369  -20.705 1.00 31.84  ? 94  LEU H CA  1 
ATOM   705  C C   . LEU A 1 92  ? 52.254 -1.115  -21.459 1.00 28.11  ? 94  LEU H C   1 
ATOM   706  O O   . LEU A 1 92  ? 53.352 -0.587  -21.640 1.00 29.72  ? 94  LEU H O   1 
ATOM   707  C CB  . LEU A 1 92  ? 50.809 0.948   -21.410 1.00 33.62  ? 94  LEU H CB  1 
ATOM   708  C CG  . LEU A 1 92  ? 50.013 0.858   -22.713 1.00 37.94  ? 94  LEU H CG  1 
ATOM   709  C CD1 . LEU A 1 92  ? 48.646 0.245   -22.441 1.00 30.38  ? 94  LEU H CD1 1 
ATOM   710  C CD2 . LEU A 1 92  ? 49.863 2.253   -23.314 1.00 38.24  ? 94  LEU H CD2 1 
ATOM   711  N N   . TYR A 1 93  ? 51.972 -2.344  -21.877 1.00 27.22  ? 95  TYR H N   1 
ATOM   712  C CA  . TYR A 1 93  ? 52.964 -3.152  -22.574 1.00 26.21  ? 95  TYR H CA  1 
ATOM   713  C C   . TYR A 1 93  ? 52.809 -3.140  -24.084 1.00 26.25  ? 95  TYR H C   1 
ATOM   714  O O   . TYR A 1 93  ? 51.725 -3.366  -24.609 1.00 26.07  ? 95  TYR H O   1 
ATOM   715  C CB  . TYR A 1 93  ? 52.917 -4.600  -22.069 1.00 22.88  ? 95  TYR H CB  1 
ATOM   716  C CG  . TYR A 1 93  ? 53.487 -4.772  -20.672 1.00 23.06  ? 95  TYR H CG  1 
ATOM   717  C CD1 . TYR A 1 93  ? 52.827 -4.258  -19.559 1.00 27.34  ? 95  TYR H CD1 1 
ATOM   718  C CD2 . TYR A 1 93  ? 54.709 -5.418  -20.473 1.00 26.69  ? 95  TYR H CD2 1 
ATOM   719  C CE1 . TYR A 1 93  ? 53.373 -4.379  -18.269 1.00 28.92  ? 95  TYR H CE1 1 
ATOM   720  C CE2 . TYR A 1 93  ? 55.266 -5.542  -19.195 1.00 29.19  ? 95  TYR H CE2 1 
ATOM   721  C CZ  . TYR A 1 93  ? 54.596 -5.019  -18.099 1.00 30.80  ? 95  TYR H CZ  1 
ATOM   722  O OH  . TYR A 1 93  ? 55.164 -5.108  -16.842 1.00 32.79  ? 95  TYR H OH  1 
ATOM   723  N N   . TYR A 1 94  ? 53.917 -2.891  -24.770 1.00 26.19  ? 96  TYR H N   1 
ATOM   724  C CA  . TYR A 1 94  ? 53.940 -2.842  -26.221 1.00 23.46  ? 96  TYR H CA  1 
ATOM   725  C C   . TYR A 1 94  ? 54.752 -3.970  -26.830 1.00 25.31  ? 96  TYR H C   1 
ATOM   726  O O   . TYR A 1 94  ? 55.776 -4.397  -26.297 1.00 24.54  ? 96  TYR H O   1 
ATOM   727  C CB  . TYR A 1 94  ? 54.552 -1.529  -26.706 1.00 24.89  ? 96  TYR H CB  1 
ATOM   728  C CG  . TYR A 1 94  ? 53.751 -0.289  -26.410 1.00 24.09  ? 96  TYR H CG  1 
ATOM   729  C CD1 . TYR A 1 94  ? 52.790 0.180   -27.309 1.00 23.82  ? 96  TYR H CD1 1 
ATOM   730  C CD2 . TYR A 1 94  ? 53.995 0.456   -25.256 1.00 22.13  ? 96  TYR H CD2 1 
ATOM   731  C CE1 . TYR A 1 94  ? 52.100 1.364   -27.065 1.00 20.15  ? 96  TYR H CE1 1 
ATOM   732  C CE2 . TYR A 1 94  ? 53.315 1.635   -25.004 1.00 23.42  ? 96  TYR H CE2 1 
ATOM   733  C CZ  . TYR A 1 94  ? 52.369 2.088   -25.913 1.00 24.40  ? 96  TYR H CZ  1 
ATOM   734  O OH  . TYR A 1 94  ? 51.722 3.278   -25.669 1.00 27.20  ? 96  TYR H OH  1 
ATOM   735  N N   . CYS A 1 95  ? 54.272 -4.427  -27.973 1.00 22.64  ? 97  CYS H N   1 
ATOM   736  C CA  . CYS A 1 95  ? 54.914 -5.457  -28.767 1.00 23.97  ? 97  CYS H CA  1 
ATOM   737  C C   . CYS A 1 95  ? 55.611 -4.631  -29.853 1.00 23.22  ? 97  CYS H C   1 
ATOM   738  O O   . CYS A 1 95  ? 55.010 -3.690  -30.362 1.00 23.85  ? 97  CYS H O   1 
ATOM   739  C CB  . CYS A 1 95  ? 53.825 -6.309  -29.378 1.00 30.72  ? 97  CYS H CB  1 
ATOM   740  S SG  . CYS A 1 95  ? 54.330 -7.528  -30.608 1.00 40.90  ? 97  CYS H SG  1 
ATOM   741  N N   . ALA A 1 96  ? 56.843 -4.974  -30.228 1.00 19.29  ? 98  ALA H N   1 
ATOM   742  C CA  . ALA A 1 96  ? 57.537 -4.169  -31.230 1.00 22.75  ? 98  ALA H CA  1 
ATOM   743  C C   . ALA A 1 96  ? 58.550 -4.857  -32.134 1.00 21.12  ? 98  ALA H C   1 
ATOM   744  O O   . ALA A 1 96  ? 59.303 -5.740  -31.710 1.00 21.71  ? 98  ALA H O   1 
ATOM   745  C CB  . ALA A 1 96  ? 58.210 -2.972  -30.533 1.00 19.64  ? 98  ALA H CB  1 
ATOM   746  N N   . ARG A 1 97  ? 58.548 -4.433  -33.394 1.00 19.08  ? 99  ARG H N   1 
ATOM   747  C CA  . ARG A 1 97  ? 59.484 -4.912  -34.419 1.00 17.09  ? 99  ARG H CA  1 
ATOM   748  C C   . ARG A 1 97  ? 60.405 -3.707  -34.514 1.00 18.16  ? 99  ARG H C   1 
ATOM   749  O O   . ARG A 1 97  ? 60.180 -2.811  -35.327 1.00 17.59  ? 99  ARG H O   1 
ATOM   750  C CB  . ARG A 1 97  ? 58.753 -5.133  -35.753 1.00 18.21  ? 99  ARG H CB  1 
ATOM   751  C CG  . ARG A 1 97  ? 59.569 -5.849  -36.851 1.00 17.61  ? 99  ARG H CG  1 
ATOM   752  C CD  . ARG A 1 97  ? 60.719 -4.986  -37.388 1.00 19.82  ? 99  ARG H CD  1 
ATOM   753  N NE  . ARG A 1 97  ? 60.280 -3.822  -38.167 1.00 19.42  ? 99  ARG H NE  1 
ATOM   754  C CZ  . ARG A 1 97  ? 59.823 -3.875  -39.419 1.00 28.56  ? 99  ARG H CZ  1 
ATOM   755  N NH1 . ARG A 1 97  ? 59.726 -5.042  -40.055 1.00 27.38  ? 99  ARG H NH1 1 
ATOM   756  N NH2 . ARG A 1 97  ? 59.501 -2.754  -40.055 1.00 23.37  ? 99  ARG H NH2 1 
ATOM   757  N N   . GLY A 1 98  ? 61.433 -3.680  -33.661 1.00 19.06  ? 100 GLY H N   1 
ATOM   758  C CA  . GLY A 1 98  ? 62.339 -2.543  -33.606 1.00 17.13  ? 100 GLY H CA  1 
ATOM   759  C C   . GLY A 1 98  ? 63.359 -2.251  -34.695 1.00 20.86  ? 100 GLY H C   1 
ATOM   760  O O   . GLY A 1 98  ? 63.806 -1.110  -34.806 1.00 21.92  ? 100 GLY H O   1 
ATOM   761  N N   . GLN A 1 99  ? 63.730 -3.248  -35.490 1.00 14.47  ? 101 GLN H N   1 
ATOM   762  C CA  . GLN A 1 99  ? 64.730 -3.067  -36.542 1.00 20.08  ? 101 GLN H CA  1 
ATOM   763  C C   . GLN A 1 99  ? 64.250 -2.207  -37.704 1.00 17.83  ? 101 GLN H C   1 
ATOM   764  O O   . GLN A 1 99  ? 63.079 -2.218  -38.036 1.00 18.16  ? 101 GLN H O   1 
ATOM   765  C CB  . GLN A 1 99  ? 65.167 -4.427  -37.092 1.00 22.98  ? 101 GLN H CB  1 
ATOM   766  C CG  . GLN A 1 99  ? 65.898 -5.303  -36.080 1.00 28.71  ? 101 GLN H CG  1 
ATOM   767  C CD  . GLN A 1 99  ? 65.937 -6.757  -36.511 1.00 26.92  ? 101 GLN H CD  1 
ATOM   768  O OE1 . GLN A 1 99  ? 64.899 -7.401  -36.631 1.00 20.98  ? 101 GLN H OE1 1 
ATOM   769  N NE2 . GLN A 1 99  ? 67.133 -7.278  -36.748 1.00 29.02  ? 101 GLN H NE2 1 
ATOM   770  N N   . GLY A 1 100 ? 65.181 -1.469  -38.307 1.00 20.81  ? 102 GLY H N   1 
ATOM   771  C CA  . GLY A 1 100 ? 64.869 -0.615  -39.443 1.00 16.36  ? 102 GLY H CA  1 
ATOM   772  C C   . GLY A 1 100 ? 63.859 0.453   -39.107 1.00 15.24  ? 102 GLY H C   1 
ATOM   773  O O   . GLY A 1 100 ? 64.170 1.417   -38.401 1.00 16.41  ? 102 GLY H O   1 
ATOM   774  N N   . ARG A 1 101 ? 62.654 0.299   -39.644 1.00 18.29  ? 103 ARG H N   1 
ATOM   775  C CA  . ARG A 1 101 ? 61.566 1.231   -39.380 1.00 15.80  ? 103 ARG H CA  1 
ATOM   776  C C   . ARG A 1 101 ? 60.783 0.555   -38.270 1.00 14.88  ? 103 ARG H C   1 
ATOM   777  O O   . ARG A 1 101 ? 60.097 -0.447  -38.501 1.00 16.16  ? 103 ARG H O   1 
ATOM   778  C CB  . ARG A 1 101 ? 60.682 1.409   -40.625 1.00 19.63  ? 103 ARG H CB  1 
ATOM   779  C CG  . ARG A 1 101 ? 59.511 2.392   -40.448 1.00 21.31  ? 103 ARG H CG  1 
ATOM   780  C CD  . ARG A 1 101 ? 58.206 1.649   -40.221 1.00 33.52  ? 103 ARG H CD  1 
ATOM   781  N NE  . ARG A 1 101 ? 57.073 2.484   -39.798 1.00 36.56  ? 103 ARG H NE  1 
ATOM   782  C CZ  . ARG A 1 101 ? 56.495 3.442   -40.523 1.00 40.11  ? 103 ARG H CZ  1 
ATOM   783  N NH1 . ARG A 1 101 ? 56.936 3.737   -41.749 1.00 42.24  ? 103 ARG H NH1 1 
ATOM   784  N NH2 . ARG A 1 101 ? 55.440 4.089   -40.027 1.00 21.29  ? 103 ARG H NH2 1 
ATOM   785  N N   . PRO A 1 102 ? 60.881 1.085   -37.039 1.00 20.33  ? 104 PRO H N   1 
ATOM   786  C CA  . PRO A 1 102 ? 60.171 0.498   -35.900 1.00 18.67  ? 104 PRO H CA  1 
ATOM   787  C C   . PRO A 1 102 ? 58.655 0.487   -36.035 1.00 19.78  ? 104 PRO H C   1 
ATOM   788  O O   . PRO A 1 102 ? 58.062 1.457   -36.501 1.00 19.35  ? 104 PRO H O   1 
ATOM   789  C CB  . PRO A 1 102 ? 60.612 1.375   -34.713 1.00 21.56  ? 104 PRO H CB  1 
ATOM   790  C CG  . PRO A 1 102 ? 61.898 2.003   -35.172 1.00 22.41  ? 104 PRO H CG  1 
ATOM   791  C CD  . PRO A 1 102 ? 61.620 2.293   -36.629 1.00 14.96  ? 104 PRO H CD  1 
ATOM   792  N N   . TYR A 1 103 ? 58.046 -0.626  -35.624 1.00 16.70  ? 105 TYR H N   1 
ATOM   793  C CA  . TYR A 1 103 ? 56.598 -0.792  -35.597 1.00 21.22  ? 105 TYR H CA  1 
ATOM   794  C C   . TYR A 1 103 ? 56.238 -1.261  -34.184 1.00 21.47  ? 105 TYR H C   1 
ATOM   795  O O   . TYR A 1 103 ? 56.958 -2.069  -33.599 1.00 21.41  ? 105 TYR H O   1 
ATOM   796  C CB  . TYR A 1 103 ? 56.140 -1.869  -36.584 1.00 23.57  ? 105 TYR H CB  1 
ATOM   797  C CG  . TYR A 1 103 ? 55.932 -1.403  -38.001 1.00 24.74  ? 105 TYR H CG  1 
ATOM   798  C CD1 . TYR A 1 103 ? 54.842 -0.599  -38.340 1.00 32.96  ? 105 TYR H CD1 1 
ATOM   799  C CD2 . TYR A 1 103 ? 56.790 -1.815  -39.019 1.00 32.11  ? 105 TYR H CD2 1 
ATOM   800  C CE1 . TYR A 1 103 ? 54.608 -0.223  -39.667 1.00 30.70  ? 105 TYR H CE1 1 
ATOM   801  C CE2 . TYR A 1 103 ? 56.567 -1.444  -40.348 1.00 33.86  ? 105 TYR H CE2 1 
ATOM   802  C CZ  . TYR A 1 103 ? 55.474 -0.651  -40.663 1.00 34.17  ? 105 TYR H CZ  1 
ATOM   803  O OH  . TYR A 1 103 ? 55.248 -0.308  -41.978 1.00 38.59  ? 105 TYR H OH  1 
ATOM   804  N N   . TRP A 1 104 ? 55.139 -0.748  -33.640 1.00 18.78  ? 106 TRP H N   1 
ATOM   805  C CA  . TRP A 1 104 ? 54.662 -1.159  -32.318 1.00 23.65  ? 106 TRP H CA  1 
ATOM   806  C C   . TRP A 1 104 ? 53.146 -1.055  -32.307 1.00 25.47  ? 106 TRP H C   1 
ATOM   807  O O   . TRP A 1 104 ? 52.568 -0.362  -33.146 1.00 26.14  ? 106 TRP H O   1 
ATOM   808  C CB  . TRP A 1 104 ? 55.274 -0.301  -31.206 1.00 21.30  ? 106 TRP H CB  1 
ATOM   809  C CG  . TRP A 1 104 ? 55.058 1.169   -31.358 1.00 22.70  ? 106 TRP H CG  1 
ATOM   810  C CD1 . TRP A 1 104 ? 53.911 1.873   -31.098 1.00 19.28  ? 106 TRP H CD1 1 
ATOM   811  C CD2 . TRP A 1 104 ? 56.026 2.121   -31.797 1.00 20.62  ? 106 TRP H CD2 1 
ATOM   812  N NE1 . TRP A 1 104 ? 54.113 3.210   -31.348 1.00 23.47  ? 106 TRP H NE1 1 
ATOM   813  C CE2 . TRP A 1 104 ? 55.403 3.391   -31.779 1.00 21.58  ? 106 TRP H CE2 1 
ATOM   814  C CE3 . TRP A 1 104 ? 57.364 2.026   -32.208 1.00 16.24  ? 106 TRP H CE3 1 
ATOM   815  C CZ2 . TRP A 1 104 ? 56.075 4.561   -32.156 1.00 19.49  ? 106 TRP H CZ2 1 
ATOM   816  C CZ3 . TRP A 1 104 ? 58.035 3.193   -32.584 1.00 22.22  ? 106 TRP H CZ3 1 
ATOM   817  C CH2 . TRP A 1 104 ? 57.385 4.445   -32.553 1.00 19.69  ? 106 TRP H CH2 1 
ATOM   818  N N   . GLY A 1 105 ? 52.503 -1.749  -31.371 1.00 26.99  ? 107 GLY H N   1 
ATOM   819  C CA  . GLY A 1 105 ? 51.052 -1.726  -31.310 1.00 29.78  ? 107 GLY H CA  1 
ATOM   820  C C   . GLY A 1 105 ? 50.477 -0.605  -30.472 1.00 29.30  ? 107 GLY H C   1 
ATOM   821  O O   . GLY A 1 105 ? 51.183 0.341   -30.113 1.00 29.40  ? 107 GLY H O   1 
ATOM   822  N N   . GLN A 1 106 ? 49.187 -0.705  -30.168 1.00 28.99  ? 108 GLN H N   1 
ATOM   823  C CA  . GLN A 1 106 ? 48.517 0.302   -29.350 1.00 30.59  ? 108 GLN H CA  1 
ATOM   824  C C   . GLN A 1 106 ? 48.781 0.021   -27.880 1.00 29.96  ? 108 GLN H C   1 
ATOM   825  O O   . GLN A 1 106 ? 48.493 0.849   -27.022 1.00 28.33  ? 108 GLN H O   1 
ATOM   826  C CB  . GLN A 1 106 ? 47.010 0.297   -29.609 1.00 32.60  ? 108 GLN H CB  1 
ATOM   827  C CG  . GLN A 1 106 ? 46.608 0.838   -30.976 1.00 44.99  ? 108 GLN H CG  1 
ATOM   828  C CD  . GLN A 1 106 ? 46.957 2.308   -31.151 1.00 47.09  ? 108 GLN H CD  1 
ATOM   829  O OE1 . GLN A 1 106 ? 46.474 3.164   -30.410 1.00 49.88  ? 108 GLN H OE1 1 
ATOM   830  N NE2 . GLN A 1 106 ? 47.802 2.606   -32.134 1.00 47.62  ? 108 GLN H NE2 1 
ATOM   831  N N   . GLY A 1 107 ? 49.322 -1.160  -27.596 1.00 29.28  ? 109 GLY H N   1 
ATOM   832  C CA  . GLY A 1 107 ? 49.636 -1.518  -26.221 1.00 31.53  ? 109 GLY H CA  1 
ATOM   833  C C   . GLY A 1 107 ? 48.490 -2.148  -25.449 1.00 31.86  ? 109 GLY H C   1 
ATOM   834  O O   . GLY A 1 107 ? 47.322 -1.958  -25.788 1.00 30.66  ? 109 GLY H O   1 
ATOM   835  N N   . THR A 1 108 ? 48.830 -2.911  -24.412 1.00 28.57  ? 110 THR H N   1 
ATOM   836  C CA  . THR A 1 108 ? 47.833 -3.561  -23.571 1.00 28.38  ? 110 THR H CA  1 
ATOM   837  C C   . THR A 1 108 ? 48.188 -3.249  -22.114 1.00 29.18  ? 110 THR H C   1 
ATOM   838  O O   . THR A 1 108 ? 49.349 -3.355  -21.713 1.00 26.49  ? 110 THR H O   1 
ATOM   839  C CB  . THR A 1 108 ? 47.801 -5.099  -23.817 1.00 31.17  ? 110 THR H CB  1 
ATOM   840  O OG1 . THR A 1 108 ? 46.681 -5.666  -23.130 1.00 35.83  ? 110 THR H OG1 1 
ATOM   841  C CG2 . THR A 1 108 ? 49.070 -5.765  -23.323 1.00 28.06  ? 110 THR H CG2 1 
ATOM   842  N N   . LEU A 1 109 ? 47.184 -2.857  -21.332 1.00 27.07  ? 111 LEU H N   1 
ATOM   843  C CA  . LEU A 1 109 ? 47.381 -2.477  -19.939 1.00 30.93  ? 111 LEU H CA  1 
ATOM   844  C C   . LEU A 1 109 ? 47.405 -3.632  -18.947 1.00 31.10  ? 111 LEU H C   1 
ATOM   845  O O   . LEU A 1 109 ? 46.517 -4.477  -18.937 1.00 32.28  ? 111 LEU H O   1 
ATOM   846  C CB  . LEU A 1 109 ? 46.301 -1.474  -19.516 1.00 29.58  ? 111 LEU H CB  1 
ATOM   847  C CG  . LEU A 1 109 ? 46.443 -0.834  -18.127 1.00 35.08  ? 111 LEU H CG  1 
ATOM   848  C CD1 . LEU A 1 109 ? 47.747 -0.046  -18.044 1.00 33.18  ? 111 LEU H CD1 1 
ATOM   849  C CD2 . LEU A 1 109 ? 45.255 0.082   -17.863 1.00 35.24  ? 111 LEU H CD2 1 
ATOM   850  N N   . VAL A 1 110 ? 48.439 -3.657  -18.114 1.00 35.05  ? 112 VAL H N   1 
ATOM   851  C CA  . VAL A 1 110 ? 48.581 -4.680  -17.087 1.00 35.17  ? 112 VAL H CA  1 
ATOM   852  C C   . VAL A 1 110 ? 48.627 -3.961  -15.746 1.00 36.28  ? 112 VAL H C   1 
ATOM   853  O O   . VAL A 1 110 ? 49.509 -3.138  -15.503 1.00 36.92  ? 112 VAL H O   1 
ATOM   854  C CB  . VAL A 1 110 ? 49.875 -5.500  -17.270 1.00 35.91  ? 112 VAL H CB  1 
ATOM   855  C CG1 . VAL A 1 110 ? 50.032 -6.487  -16.122 1.00 35.43  ? 112 VAL H CG1 1 
ATOM   856  C CG2 . VAL A 1 110 ? 49.828 -6.253  -18.595 1.00 37.87  ? 112 VAL H CG2 1 
ATOM   857  N N   . THR A 1 111 ? 47.661 -4.262  -14.885 1.00 36.31  ? 113 THR H N   1 
ATOM   858  C CA  . THR A 1 111 ? 47.588 -3.630  -13.575 1.00 38.61  ? 113 THR H CA  1 
ATOM   859  C C   . THR A 1 111 ? 47.738 -4.684  -12.490 1.00 38.02  ? 113 THR H C   1 
ATOM   860  O O   . THR A 1 111 ? 46.936 -5.611  -12.405 1.00 38.84  ? 113 THR H O   1 
ATOM   861  C CB  . THR A 1 111 ? 46.239 -2.912  -13.388 1.00 40.03  ? 113 THR H CB  1 
ATOM   862  O OG1 . THR A 1 111 ? 46.032 -2.000  -14.473 1.00 42.20  ? 113 THR H OG1 1 
ATOM   863  C CG2 . THR A 1 111 ? 46.221 -2.138  -12.081 1.00 40.69  ? 113 THR H CG2 1 
ATOM   864  N N   . VAL A 1 112 ? 48.770 -4.537  -11.669 1.00 39.80  ? 114 VAL H N   1 
ATOM   865  C CA  . VAL A 1 112 ? 49.041 -5.479  -10.588 1.00 41.35  ? 114 VAL H CA  1 
ATOM   866  C C   . VAL A 1 112 ? 48.665 -4.853  -9.251  1.00 41.85  ? 114 VAL H C   1 
ATOM   867  O O   . VAL A 1 112 ? 49.305 -3.906  -8.798  1.00 38.94  ? 114 VAL H O   1 
ATOM   868  C CB  . VAL A 1 112 ? 50.537 -5.869  -10.553 1.00 41.82  ? 114 VAL H CB  1 
ATOM   869  C CG1 . VAL A 1 112 ? 50.780 -6.920  -9.479  1.00 34.81  ? 114 VAL H CG1 1 
ATOM   870  C CG2 . VAL A 1 112 ? 50.973 -6.385  -11.920 1.00 37.88  ? 114 VAL H CG2 1 
ATOM   871  N N   . SER A 1 113 ? 47.620 -5.383  -8.626  1.00 46.45  ? 115 SER H N   1 
ATOM   872  C CA  . SER A 1 113 ? 47.163 -4.867  -7.343  1.00 51.63  ? 115 SER H CA  1 
ATOM   873  C C   . SER A 1 113 ? 46.126 -5.787  -6.716  1.00 52.44  ? 115 SER H C   1 
ATOM   874  O O   . SER A 1 113 ? 45.645 -6.726  -7.350  1.00 50.98  ? 115 SER H O   1 
ATOM   875  C CB  . SER A 1 113 ? 46.552 -3.480  -7.525  1.00 53.61  ? 115 SER H CB  1 
ATOM   876  O OG  . SER A 1 113 ? 45.424 -3.538  -8.379  1.00 57.18  ? 115 SER H OG  1 
ATOM   877  N N   . SER A 1 114 ? 45.788 -5.512  -5.462  1.00 56.29  ? 116 SER H N   1 
ATOM   878  C CA  . SER A 1 114 ? 44.793 -6.307  -4.758  1.00 58.16  ? 116 SER H CA  1 
ATOM   879  C C   . SER A 1 114 ? 43.455 -5.586  -4.846  1.00 58.06  ? 116 SER H C   1 
ATOM   880  O O   . SER A 1 114 ? 42.398 -6.193  -4.679  1.00 58.81  ? 116 SER H O   1 
ATOM   881  C CB  . SER A 1 114 ? 45.195 -6.489  -3.293  1.00 60.87  ? 116 SER H CB  1 
ATOM   882  O OG  . SER A 1 114 ? 45.307 -5.240  -2.632  1.00 64.69  ? 116 SER H OG  1 
ATOM   883  N N   . ALA A 1 115 ? 43.521 -4.285  -5.124  1.00 59.59  ? 117 ALA H N   1 
ATOM   884  C CA  . ALA A 1 115 ? 42.338 -3.436  -5.245  1.00 61.61  ? 117 ALA H CA  1 
ATOM   885  C C   . ALA A 1 115 ? 41.262 -4.060  -6.128  1.00 61.61  ? 117 ALA H C   1 
ATOM   886  O O   . ALA A 1 115 ? 41.531 -4.972  -6.910  1.00 62.74  ? 117 ALA H O   1 
ATOM   887  C CB  . ALA A 1 115 ? 42.734 -2.065  -5.790  1.00 61.30  ? 117 ALA H CB  1 
ATOM   888  N N   . LYS A 1 116 ? 40.042 -3.549  -6.004  1.00 63.98  ? 118 LYS H N   1 
ATOM   889  C CA  . LYS A 1 116 ? 38.909 -4.061  -6.766  1.00 65.94  ? 118 LYS H CA  1 
ATOM   890  C C   . LYS A 1 116 ? 38.523 -3.141  -7.919  1.00 64.26  ? 118 LYS H C   1 
ATOM   891  O O   . LYS A 1 116 ? 38.667 -1.924  -7.827  1.00 64.62  ? 118 LYS H O   1 
ATOM   892  C CB  . LYS A 1 116 ? 37.711 -4.235  -5.832  1.00 69.44  ? 118 LYS H CB  1 
ATOM   893  C CG  . LYS A 1 116 ? 38.054 -4.934  -4.528  1.00 72.62  ? 118 LYS H CG  1 
ATOM   894  C CD  . LYS A 1 116 ? 36.906 -4.862  -3.538  1.00 76.29  ? 118 LYS H CD  1 
ATOM   895  C CE  . LYS A 1 116 ? 37.293 -5.486  -2.208  1.00 78.29  ? 118 LYS H CE  1 
ATOM   896  N NZ  . LYS A 1 116 ? 36.184 -5.410  -1.221  1.00 81.16  ? 118 LYS H NZ  1 
ATOM   897  N N   . THR A 1 117 ? 38.028 -3.729  -9.002  1.00 63.05  ? 119 THR H N   1 
ATOM   898  C CA  . THR A 1 117 ? 37.606 -2.958  -10.164 1.00 63.64  ? 119 THR H CA  1 
ATOM   899  C C   . THR A 1 117 ? 36.234 -2.340  -9.888  1.00 62.37  ? 119 THR H C   1 
ATOM   900  O O   . THR A 1 117 ? 35.216 -3.027  -9.944  1.00 63.50  ? 119 THR H O   1 
ATOM   901  C CB  . THR A 1 117 ? 37.545 -3.857  -11.420 1.00 66.61  ? 119 THR H CB  1 
ATOM   902  O OG1 . THR A 1 117 ? 36.886 -3.161  -12.484 1.00 71.65  ? 119 THR H OG1 1 
ATOM   903  C CG2 . THR A 1 117 ? 36.813 -5.153  -11.115 1.00 70.64  ? 119 THR H CG2 1 
ATOM   904  N N   . THR A 1 118 ? 36.222 -1.040  -9.589  1.00 59.09  ? 120 THR H N   1 
ATOM   905  C CA  . THR A 1 118 ? 34.994 -0.307  -9.265  1.00 57.24  ? 120 THR H CA  1 
ATOM   906  C C   . THR A 1 118 ? 34.482 0.597   -10.393 1.00 55.83  ? 120 THR H C   1 
ATOM   907  O O   . THR A 1 118 ? 35.256 1.322   -11.022 1.00 55.78  ? 120 THR H O   1 
ATOM   908  C CB  . THR A 1 118 ? 35.209 0.572   -8.011  1.00 56.66  ? 120 THR H CB  1 
ATOM   909  O OG1 . THR A 1 118 ? 35.745 -0.229  -6.949  1.00 57.81  ? 120 THR H OG1 1 
ATOM   910  C CG2 . THR A 1 118 ? 33.896 1.189   -7.556  1.00 55.54  ? 120 THR H CG2 1 
ATOM   911  N N   . PRO A 1 119 ? 33.162 0.565   -10.660 1.00 53.90  ? 121 PRO H N   1 
ATOM   912  C CA  . PRO A 1 119 ? 32.564 1.391   -11.714 1.00 51.83  ? 121 PRO H CA  1 
ATOM   913  C C   . PRO A 1 119 ? 32.560 2.861   -11.299 1.00 48.67  ? 121 PRO H C   1 
ATOM   914  O O   . PRO A 1 119 ? 32.567 3.180   -10.107 1.00 43.70  ? 121 PRO H O   1 
ATOM   915  C CB  . PRO A 1 119 ? 31.157 0.816   -11.843 1.00 53.01  ? 121 PRO H CB  1 
ATOM   916  C CG  . PRO A 1 119 ? 30.848 0.410   -10.437 1.00 54.80  ? 121 PRO H CG  1 
ATOM   917  C CD  . PRO A 1 119 ? 32.135 -0.263  -10.001 1.00 55.09  ? 121 PRO H CD  1 
ATOM   918  N N   . PRO A 1 120 ? 32.547 3.775   -12.280 1.00 48.42  ? 122 PRO H N   1 
ATOM   919  C CA  . PRO A 1 120 ? 32.548 5.213   -12.006 1.00 47.63  ? 122 PRO H CA  1 
ATOM   920  C C   . PRO A 1 120 ? 31.182 5.821   -11.707 1.00 47.84  ? 122 PRO H C   1 
ATOM   921  O O   . PRO A 1 120 ? 30.160 5.383   -12.239 1.00 45.17  ? 122 PRO H O   1 
ATOM   922  C CB  . PRO A 1 120 ? 33.138 5.790   -13.282 1.00 48.25  ? 122 PRO H CB  1 
ATOM   923  C CG  . PRO A 1 120 ? 32.510 4.915   -14.322 1.00 49.21  ? 122 PRO H CG  1 
ATOM   924  C CD  . PRO A 1 120 ? 32.673 3.523   -13.728 1.00 48.25  ? 122 PRO H CD  1 
ATOM   925  N N   . SER A 1 121 ? 31.183 6.833   -10.846 1.00 46.73  ? 123 SER H N   1 
ATOM   926  C CA  . SER A 1 121 ? 29.969 7.562   -10.505 1.00 45.80  ? 123 SER H CA  1 
ATOM   927  C C   . SER A 1 121 ? 30.078 8.844   -11.316 1.00 44.57  ? 123 SER H C   1 
ATOM   928  O O   . SER A 1 121 ? 31.075 9.562   -11.219 1.00 46.03  ? 123 SER H O   1 
ATOM   929  C CB  . SER A 1 121 ? 29.925 7.894   -9.014  1.00 45.16  ? 123 SER H CB  1 
ATOM   930  O OG  . SER A 1 121 ? 29.793 6.722   -8.233  1.00 49.73  ? 123 SER H OG  1 
ATOM   931  N N   . VAL A 1 122 ? 29.067 9.122   -12.129 1.00 43.87  ? 124 VAL H N   1 
ATOM   932  C CA  . VAL A 1 122 ? 29.079 10.312  -12.967 1.00 41.86  ? 124 VAL H CA  1 
ATOM   933  C C   . VAL A 1 122 ? 28.062 11.340  -12.481 1.00 42.31  ? 124 VAL H C   1 
ATOM   934  O O   . VAL A 1 122 ? 26.868 11.054  -12.384 1.00 40.46  ? 124 VAL H O   1 
ATOM   935  C CB  . VAL A 1 122 ? 28.778 9.946   -14.438 1.00 37.48  ? 124 VAL H CB  1 
ATOM   936  C CG1 . VAL A 1 122 ? 28.912 11.172  -15.321 1.00 37.46  ? 124 VAL H CG1 1 
ATOM   937  C CG2 . VAL A 1 122 ? 29.726 8.845   -14.901 1.00 39.92  ? 124 VAL H CG2 1 
ATOM   938  N N   . TYR A 1 123 ? 28.549 12.537  -12.172 1.00 39.36  ? 125 TYR H N   1 
ATOM   939  C CA  . TYR A 1 123 ? 27.694 13.613  -11.696 1.00 39.28  ? 125 TYR H CA  1 
ATOM   940  C C   . TYR A 1 123 ? 27.709 14.771  -12.686 1.00 43.02  ? 125 TYR H C   1 
ATOM   941  O O   . TYR A 1 123 ? 28.774 15.218  -13.120 1.00 40.48  ? 125 TYR H O   1 
ATOM   942  C CB  . TYR A 1 123 ? 28.173 14.097  -10.331 1.00 39.21  ? 125 TYR H CB  1 
ATOM   943  C CG  . TYR A 1 123 ? 28.206 13.010  -9.281  1.00 39.51  ? 125 TYR H CG  1 
ATOM   944  C CD1 . TYR A 1 123 ? 27.042 12.334  -8.914  1.00 38.83  ? 125 TYR H CD1 1 
ATOM   945  C CD2 . TYR A 1 123 ? 29.397 12.656  -8.658  1.00 40.49  ? 125 TYR H CD2 1 
ATOM   946  C CE1 . TYR A 1 123 ? 27.064 11.330  -7.948  1.00 43.00  ? 125 TYR H CE1 1 
ATOM   947  C CE2 . TYR A 1 123 ? 29.433 11.650  -7.691  1.00 46.18  ? 125 TYR H CE2 1 
ATOM   948  C CZ  . TYR A 1 123 ? 28.262 10.994  -7.342  1.00 43.06  ? 125 TYR H CZ  1 
ATOM   949  O OH  . TYR A 1 123 ? 28.291 10.006  -6.386  1.00 45.59  ? 125 TYR H OH  1 
ATOM   950  N N   . PRO A 1 124 ? 26.523 15.269  -13.065 1.00 43.06  ? 126 PRO H N   1 
ATOM   951  C CA  . PRO A 1 124 ? 26.454 16.379  -14.013 1.00 45.75  ? 126 PRO H CA  1 
ATOM   952  C C   . PRO A 1 124 ? 26.908 17.689  -13.383 1.00 46.65  ? 126 PRO H C   1 
ATOM   953  O O   . PRO A 1 124 ? 26.725 17.908  -12.188 1.00 42.55  ? 126 PRO H O   1 
ATOM   954  C CB  . PRO A 1 124 ? 24.980 16.396  -14.407 1.00 47.33  ? 126 PRO H CB  1 
ATOM   955  C CG  . PRO A 1 124 ? 24.306 15.993  -13.142 1.00 48.65  ? 126 PRO H CG  1 
ATOM   956  C CD  . PRO A 1 124 ? 25.172 14.839  -12.660 1.00 47.32  ? 126 PRO H CD  1 
ATOM   957  N N   . ALA A 1 125 ? 27.514 18.546  -14.197 1.00 48.80  ? 127 ALA H N   1 
ATOM   958  C CA  . ALA A 1 125 ? 27.991 19.844  -13.739 1.00 51.65  ? 127 ALA H CA  1 
ATOM   959  C C   . ALA A 1 125 ? 27.418 20.918  -14.658 1.00 54.40  ? 127 ALA H C   1 
ATOM   960  O O   . ALA A 1 125 ? 27.997 21.237  -15.698 1.00 50.36  ? 127 ALA H O   1 
ATOM   961  C CB  . ALA A 1 125 ? 29.517 19.881  -13.763 1.00 50.40  ? 127 ALA H CB  1 
ATOM   962  N N   . ALA A 1 126 ? 26.268 21.462  -14.269 1.00 60.29  ? 128 ALA H N   1 
ATOM   963  C CA  . ALA A 1 126 ? 25.596 22.496  -15.049 1.00 66.08  ? 128 ALA H CA  1 
ATOM   964  C C   . ALA A 1 126 ? 25.289 23.712  -14.178 1.00 69.03  ? 128 ALA H C   1 
ATOM   965  O O   . ALA A 1 126 ? 25.365 23.641  -12.951 1.00 68.33  ? 128 ALA H O   1 
ATOM   966  C CB  . ALA A 1 126 ? 24.306 21.940  -15.644 1.00 65.01  ? 128 ALA H CB  1 
ATOM   967  N N   . PRO A 1 127 ? 24.943 24.849  -14.806 1.00 72.65  ? 129 PRO H N   1 
ATOM   968  C CA  . PRO A 1 127 ? 24.624 26.080  -14.075 1.00 76.06  ? 129 PRO H CA  1 
ATOM   969  C C   . PRO A 1 127 ? 23.278 26.013  -13.341 1.00 78.78  ? 129 PRO H C   1 
ATOM   970  O O   . PRO A 1 127 ? 22.296 25.495  -13.877 1.00 78.05  ? 129 PRO H O   1 
ATOM   971  C CB  . PRO A 1 127 ? 24.640 27.139  -15.175 1.00 75.51  ? 129 PRO H CB  1 
ATOM   972  C CG  . PRO A 1 127 ? 24.141 26.377  -16.364 1.00 75.25  ? 129 PRO H CG  1 
ATOM   973  C CD  . PRO A 1 127 ? 24.914 25.083  -16.262 1.00 72.57  ? 129 PRO H CD  1 
ATOM   974  N N   . GLY A 1 128 ? 23.244 26.543  -12.119 1.00 81.94  ? 130 GLY H N   1 
ATOM   975  C CA  . GLY A 1 128 ? 22.023 26.529  -11.328 1.00 84.25  ? 130 GLY H CA  1 
ATOM   976  C C   . GLY A 1 128 ? 21.449 27.899  -10.998 1.00 85.89  ? 130 GLY H C   1 
ATOM   977  O O   . GLY A 1 128 ? 20.994 28.617  -11.889 1.00 85.44  ? 130 GLY H O   1 
ATOM   978  N N   . CYS A 1 129 ? 21.463 28.258  -9.716  1.00 88.41  ? 131 CYS H N   1 
ATOM   979  C CA  . CYS A 1 129 ? 20.938 29.547  -9.263  1.00 90.91  ? 131 CYS H CA  1 
ATOM   980  C C   . CYS A 1 129 ? 21.887 30.708  -9.542  1.00 92.15  ? 131 CYS H C   1 
ATOM   981  O O   . CYS A 1 129 ? 23.028 30.714  -9.079  1.00 92.96  ? 131 CYS H O   1 
ATOM   982  C CB  . CYS A 1 129 ? 20.634 29.507  -7.761  1.00 91.54  ? 131 CYS H CB  1 
ATOM   983  S SG  . CYS A 1 129 ? 19.153 28.574  -7.295  1.00 95.77  ? 131 CYS H SG  1 
ATOM   984  N N   . GLY A 1 130 ? 21.403 31.691  -10.296 1.00 93.43  ? 132 GLY H N   1 
ATOM   985  C CA  . GLY A 1 130 ? 22.210 32.855  -10.620 1.00 94.45  ? 132 GLY H CA  1 
ATOM   986  C C   . GLY A 1 130 ? 23.520 32.535  -11.318 1.00 94.86  ? 132 GLY H C   1 
ATOM   987  O O   . GLY A 1 130 ? 24.575 32.479  -10.683 1.00 94.41  ? 132 GLY H O   1 
ATOM   988  N N   . ASP A 1 131 ? 23.454 32.329  -12.629 1.00 94.47  ? 133 ASP H N   1 
ATOM   989  C CA  . ASP A 1 131 ? 24.643 32.018  -13.411 1.00 94.14  ? 133 ASP H CA  1 
ATOM   990  C C   . ASP A 1 131 ? 24.783 32.923  -14.627 1.00 93.38  ? 133 ASP H C   1 
ATOM   991  O O   . ASP A 1 131 ? 23.927 33.769  -14.891 1.00 93.09  ? 133 ASP H O   1 
ATOM   992  C CB  . ASP A 1 131 ? 24.614 30.558  -13.867 1.00 95.34  ? 133 ASP H CB  1 
ATOM   993  C CG  . ASP A 1 131 ? 24.885 29.590  -12.735 1.00 96.29  ? 133 ASP H CG  1 
ATOM   994  O OD1 . ASP A 1 131 ? 24.117 29.594  -11.751 1.00 97.73  ? 133 ASP H OD1 1 
ATOM   995  O OD2 . ASP A 1 131 ? 25.868 28.825  -12.831 1.00 96.69  ? 133 ASP H OD2 1 
ATOM   996  N N   . THR A 1 132 ? 25.875 32.731  -15.360 1.00 92.03  ? 134 THR H N   1 
ATOM   997  C CA  . THR A 1 132 ? 26.156 33.509  -16.559 1.00 90.73  ? 134 THR H CA  1 
ATOM   998  C C   . THR A 1 132 ? 25.374 32.916  -17.731 1.00 90.11  ? 134 THR H C   1 
ATOM   999  O O   . THR A 1 132 ? 25.939 32.601  -18.779 1.00 90.12  ? 134 THR H O   1 
ATOM   1000 C CB  . THR A 1 132 ? 27.670 33.487  -16.882 1.00 90.85  ? 134 THR H CB  1 
ATOM   1001 O OG1 . THR A 1 132 ? 28.412 33.908  -15.729 1.00 90.96  ? 134 THR H OG1 1 
ATOM   1002 C CG2 . THR A 1 132 ? 27.988 34.422  -18.036 1.00 91.61  ? 134 THR H CG2 1 
ATOM   1003 N N   . THR A 1 133 ? 24.068 32.760  -17.536 1.00 89.24  ? 135 THR H N   1 
ATOM   1004 C CA  . THR A 1 133 ? 23.195 32.205  -18.562 1.00 90.12  ? 135 THR H CA  1 
ATOM   1005 C C   . THR A 1 133 ? 23.235 33.060  -19.827 1.00 90.44  ? 135 THR H C   1 
ATOM   1006 O O   . THR A 1 133 ? 22.412 33.960  -20.008 1.00 90.91  ? 135 THR H O   1 
ATOM   1007 C CB  . THR A 1 133 ? 21.736 32.123  -18.061 1.00 90.77  ? 135 THR H CB  1 
ATOM   1008 O OG1 . THR A 1 133 ? 21.685 31.347  -16.857 1.00 89.87  ? 135 THR H OG1 1 
ATOM   1009 C CG2 . THR A 1 133 ? 20.845 31.475  -19.114 1.00 90.50  ? 135 THR H CG2 1 
ATOM   1010 N N   . GLY A 1 134 ? 24.198 32.774  -20.698 1.00 90.30  ? 136 GLY H N   1 
ATOM   1011 C CA  . GLY A 1 134 ? 24.327 33.528  -21.932 1.00 88.70  ? 136 GLY H CA  1 
ATOM   1012 C C   . GLY A 1 134 ? 25.286 32.890  -22.918 1.00 87.50  ? 136 GLY H C   1 
ATOM   1013 O O   . GLY A 1 134 ? 25.657 31.726  -22.767 1.00 87.50  ? 136 GLY H O   1 
ATOM   1014 N N   . SER A 1 135 ? 25.686 33.655  -23.930 1.00 85.92  ? 137 SER H N   1 
ATOM   1015 C CA  . SER A 1 135 ? 26.606 33.167  -24.953 1.00 83.62  ? 137 SER H CA  1 
ATOM   1016 C C   . SER A 1 135 ? 27.766 32.407  -24.326 1.00 80.99  ? 137 SER H C   1 
ATOM   1017 O O   . SER A 1 135 ? 28.410 32.898  -23.398 1.00 82.11  ? 137 SER H O   1 
ATOM   1018 C CB  . SER A 1 135 ? 27.149 34.336  -25.780 1.00 84.15  ? 137 SER H CB  1 
ATOM   1019 O OG  . SER A 1 135 ? 28.044 33.880  -26.783 1.00 85.50  ? 137 SER H OG  1 
ATOM   1020 N N   . SER A 1 136 ? 28.023 31.207  -24.837 1.00 77.65  ? 138 SER H N   1 
ATOM   1021 C CA  . SER A 1 136 ? 29.105 30.368  -24.334 1.00 74.72  ? 138 SER H CA  1 
ATOM   1022 C C   . SER A 1 136 ? 28.884 29.964  -22.880 1.00 71.53  ? 138 SER H C   1 
ATOM   1023 O O   . SER A 1 136 ? 29.051 30.771  -21.963 1.00 68.98  ? 138 SER H O   1 
ATOM   1024 C CB  . SER A 1 136 ? 30.447 31.094  -24.466 1.00 76.41  ? 138 SER H CB  1 
ATOM   1025 O OG  . SER A 1 136 ? 30.729 31.408  -25.820 1.00 80.68  ? 138 SER H OG  1 
ATOM   1026 N N   . VAL A 1 137 ? 28.504 28.708  -22.677 1.00 67.06  ? 139 VAL H N   1 
ATOM   1027 C CA  . VAL A 1 137 ? 28.266 28.187  -21.339 1.00 64.92  ? 139 VAL H CA  1 
ATOM   1028 C C   . VAL A 1 137 ? 29.184 26.998  -21.078 1.00 60.98  ? 139 VAL H C   1 
ATOM   1029 O O   . VAL A 1 137 ? 29.413 26.174  -21.963 1.00 58.63  ? 139 VAL H O   1 
ATOM   1030 C CB  . VAL A 1 137 ? 26.796 27.746  -21.168 1.00 64.92  ? 139 VAL H CB  1 
ATOM   1031 C CG1 . VAL A 1 137 ? 26.436 26.720  -22.226 1.00 65.50  ? 139 VAL H CG1 1 
ATOM   1032 C CG2 . VAL A 1 137 ? 26.583 27.173  -19.773 1.00 67.64  ? 139 VAL H CG2 1 
ATOM   1033 N N   . THR A 1 138 ? 29.715 26.916  -19.864 1.00 58.80  ? 140 THR H N   1 
ATOM   1034 C CA  . THR A 1 138 ? 30.610 25.826  -19.504 1.00 57.64  ? 140 THR H CA  1 
ATOM   1035 C C   . THR A 1 138 ? 29.867 24.713  -18.778 1.00 56.71  ? 140 THR H C   1 
ATOM   1036 O O   . THR A 1 138 ? 29.395 24.895  -17.657 1.00 56.24  ? 140 THR H O   1 
ATOM   1037 C CB  . THR A 1 138 ? 31.754 26.314  -18.594 1.00 59.43  ? 140 THR H CB  1 
ATOM   1038 O OG1 . THR A 1 138 ? 32.461 27.379  -19.241 1.00 59.24  ? 140 THR H OG1 1 
ATOM   1039 C CG2 . THR A 1 138 ? 32.725 25.175  -18.306 1.00 56.59  ? 140 THR H CG2 1 
ATOM   1040 N N   . LEU A 1 139 ? 29.767 23.561  -19.429 1.00 54.69  ? 141 LEU H N   1 
ATOM   1041 C CA  . LEU A 1 139 ? 29.104 22.399  -18.851 1.00 54.13  ? 141 LEU H CA  1 
ATOM   1042 C C   . LEU A 1 139 ? 30.168 21.362  -18.511 1.00 52.93  ? 141 LEU H C   1 
ATOM   1043 O O   . LEU A 1 139 ? 31.315 21.484  -18.942 1.00 50.19  ? 141 LEU H O   1 
ATOM   1044 C CB  . LEU A 1 139 ? 28.110 21.810  -19.850 1.00 56.02  ? 141 LEU H CB  1 
ATOM   1045 C CG  . LEU A 1 139 ? 26.931 22.696  -20.259 1.00 58.49  ? 141 LEU H CG  1 
ATOM   1046 C CD1 . LEU A 1 139 ? 26.129 22.002  -21.344 1.00 59.99  ? 141 LEU H CD1 1 
ATOM   1047 C CD2 . LEU A 1 139 ? 26.061 22.991  -19.047 1.00 58.62  ? 141 LEU H CD2 1 
ATOM   1048 N N   . GLY A 1 140 ? 29.801 20.344  -17.739 1.00 49.98  ? 142 GLY H N   1 
ATOM   1049 C CA  . GLY A 1 140 ? 30.783 19.334  -17.392 1.00 48.86  ? 142 GLY H CA  1 
ATOM   1050 C C   . GLY A 1 140 ? 30.249 18.122  -16.661 1.00 47.39  ? 142 GLY H C   1 
ATOM   1051 O O   . GLY A 1 140 ? 29.112 18.105  -16.199 1.00 48.76  ? 142 GLY H O   1 
ATOM   1052 N N   . CYS A 1 141 ? 31.085 17.097  -16.566 1.00 45.85  ? 143 CYS H N   1 
ATOM   1053 C CA  . CYS A 1 141 ? 30.725 15.867  -15.879 1.00 45.02  ? 143 CYS H CA  1 
ATOM   1054 C C   . CYS A 1 141 ? 31.858 15.446  -14.951 1.00 43.62  ? 143 CYS H C   1 
ATOM   1055 O O   . CYS A 1 141 ? 33.016 15.354  -15.365 1.00 40.57  ? 143 CYS H O   1 
ATOM   1056 C CB  . CYS A 1 141 ? 30.410 14.759  -16.900 1.00 45.78  ? 143 CYS H CB  1 
ATOM   1057 S SG  . CYS A 1 141 ? 28.791 14.996  -17.705 1.00 48.63  ? 143 CYS H SG  1 
ATOM   1058 N N   . LEU A 1 142 ? 31.515 15.220  -13.686 1.00 40.61  ? 144 LEU H N   1 
ATOM   1059 C CA  . LEU A 1 142 ? 32.480 14.803  -12.679 1.00 37.08  ? 144 LEU H CA  1 
ATOM   1060 C C   . LEU A 1 142 ? 32.427 13.289  -12.535 1.00 39.16  ? 144 LEU H C   1 
ATOM   1061 O O   . LEU A 1 142 ? 31.368 12.723  -12.272 1.00 34.06  ? 144 LEU H O   1 
ATOM   1062 C CB  . LEU A 1 142 ? 32.161 15.457  -11.329 1.00 37.64  ? 144 LEU H CB  1 
ATOM   1063 C CG  . LEU A 1 142 ? 32.909 14.905  -10.109 1.00 38.06  ? 144 LEU H CG  1 
ATOM   1064 C CD1 . LEU A 1 142 ? 34.390 15.201  -10.241 1.00 40.95  ? 144 LEU H CD1 1 
ATOM   1065 C CD2 . LEU A 1 142 ? 32.353 15.518  -8.830  1.00 39.70  ? 144 LEU H CD2 1 
ATOM   1066 N N   . VAL A 1 143 ? 33.575 12.638  -12.704 1.00 38.32  ? 145 VAL H N   1 
ATOM   1067 C CA  . VAL A 1 143 ? 33.656 11.187  -12.599 1.00 38.43  ? 145 VAL H CA  1 
ATOM   1068 C C   . VAL A 1 143 ? 34.558 10.802  -11.430 1.00 39.75  ? 145 VAL H C   1 
ATOM   1069 O O   . VAL A 1 143 ? 35.724 11.188  -11.384 1.00 39.91  ? 145 VAL H O   1 
ATOM   1070 C CB  . VAL A 1 143 ? 34.216 10.581  -13.904 1.00 40.77  ? 145 VAL H CB  1 
ATOM   1071 C CG1 . VAL A 1 143 ? 34.174 9.059   -13.844 1.00 42.96  ? 145 VAL H CG1 1 
ATOM   1072 C CG2 . VAL A 1 143 ? 33.414 11.093  -15.091 1.00 38.26  ? 145 VAL H CG2 1 
ATOM   1073 N N   . LYS A 1 144 ? 34.019 10.048  -10.477 1.00 40.31  ? 146 LYS H N   1 
ATOM   1074 C CA  . LYS A 1 144 ? 34.810 9.642   -9.322  1.00 41.69  ? 146 LYS H CA  1 
ATOM   1075 C C   . LYS A 1 144 ? 34.486 8.237   -8.833  1.00 41.76  ? 146 LYS H C   1 
ATOM   1076 O O   . LYS A 1 144 ? 33.496 7.629   -9.249  1.00 41.91  ? 146 LYS H O   1 
ATOM   1077 C CB  . LYS A 1 144 ? 34.608 10.634  -8.171  1.00 46.11  ? 146 LYS H CB  1 
ATOM   1078 C CG  . LYS A 1 144 ? 33.228 10.579  -7.537  1.00 49.38  ? 146 LYS H CG  1 
ATOM   1079 C CD  . LYS A 1 144 ? 33.014 11.671  -6.483  1.00 55.83  ? 146 LYS H CD  1 
ATOM   1080 C CE  . LYS A 1 144 ? 33.925 11.521  -5.267  1.00 55.43  ? 146 LYS H CE  1 
ATOM   1081 N NZ  . LYS A 1 144 ? 35.333 11.895  -5.556  1.00 61.76  ? 146 LYS H NZ  1 
ATOM   1082 N N   . GLY A 1 145 ? 35.345 7.730   -7.953  1.00 40.72  ? 147 GLY H N   1 
ATOM   1083 C CA  . GLY A 1 145 ? 35.153 6.414   -7.371  1.00 43.03  ? 147 GLY H CA  1 
ATOM   1084 C C   . GLY A 1 145 ? 35.387 5.212   -8.260  1.00 43.99  ? 147 GLY H C   1 
ATOM   1085 O O   . GLY A 1 145 ? 34.853 4.141   -7.982  1.00 48.59  ? 147 GLY H O   1 
ATOM   1086 N N   . TYR A 1 146 ? 36.179 5.361   -9.318  1.00 45.80  ? 148 TYR H N   1 
ATOM   1087 C CA  . TYR A 1 146 ? 36.432 4.230   -10.203 1.00 48.83  ? 148 TYR H CA  1 
ATOM   1088 C C   . TYR A 1 146 ? 37.848 3.671   -10.104 1.00 51.08  ? 148 TYR H C   1 
ATOM   1089 O O   . TYR A 1 146 ? 38.739 4.286   -9.515  1.00 51.68  ? 148 TYR H O   1 
ATOM   1090 C CB  . TYR A 1 146 ? 36.122 4.594   -11.662 1.00 48.76  ? 148 TYR H CB  1 
ATOM   1091 C CG  . TYR A 1 146 ? 37.007 5.662   -12.266 1.00 51.61  ? 148 TYR H CG  1 
ATOM   1092 C CD1 . TYR A 1 146 ? 36.817 7.011   -11.967 1.00 51.38  ? 148 TYR H CD1 1 
ATOM   1093 C CD2 . TYR A 1 146 ? 38.028 5.323   -13.153 1.00 48.66  ? 148 TYR H CD2 1 
ATOM   1094 C CE1 . TYR A 1 146 ? 37.621 7.996   -12.543 1.00 49.44  ? 148 TYR H CE1 1 
ATOM   1095 C CE2 . TYR A 1 146 ? 38.833 6.296   -13.729 1.00 49.81  ? 148 TYR H CE2 1 
ATOM   1096 C CZ  . TYR A 1 146 ? 38.624 7.628   -13.422 1.00 49.50  ? 148 TYR H CZ  1 
ATOM   1097 O OH  . TYR A 1 146 ? 39.412 8.589   -14.009 1.00 52.61  ? 148 TYR H OH  1 
ATOM   1098 N N   . PHE A 1 147 ? 38.034 2.490   -10.689 1.00 52.96  ? 149 PHE H N   1 
ATOM   1099 C CA  . PHE A 1 147 ? 39.317 1.794   -10.692 1.00 55.61  ? 149 PHE H CA  1 
ATOM   1100 C C   . PHE A 1 147 ? 39.169 0.546   -11.561 1.00 57.07  ? 149 PHE H C   1 
ATOM   1101 O O   . PHE A 1 147 ? 38.186 -0.183  -11.438 1.00 59.06  ? 149 PHE H O   1 
ATOM   1102 C CB  . PHE A 1 147 ? 39.695 1.378   -9.267  1.00 54.45  ? 149 PHE H CB  1 
ATOM   1103 C CG  . PHE A 1 147 ? 41.058 0.751   -9.160  1.00 54.25  ? 149 PHE H CG  1 
ATOM   1104 C CD1 . PHE A 1 147 ? 42.195 1.543   -9.052  1.00 54.35  ? 149 PHE H CD1 1 
ATOM   1105 C CD2 . PHE A 1 147 ? 41.205 -0.631  -9.187  1.00 55.02  ? 149 PHE H CD2 1 
ATOM   1106 C CE1 . PHE A 1 147 ? 43.463 0.967   -8.974  1.00 53.92  ? 149 PHE H CE1 1 
ATOM   1107 C CE2 . PHE A 1 147 ? 42.467 -1.218  -9.111  1.00 56.16  ? 149 PHE H CE2 1 
ATOM   1108 C CZ  . PHE A 1 147 ? 43.598 -0.415  -9.004  1.00 53.47  ? 149 PHE H CZ  1 
ATOM   1109 N N   . PRO A 1 148 ? 40.137 0.282   -12.455 1.00 59.47  ? 150 PRO H N   1 
ATOM   1110 C CA  . PRO A 1 148 ? 41.363 1.037   -12.739 1.00 59.95  ? 150 PRO H CA  1 
ATOM   1111 C C   . PRO A 1 148 ? 41.096 2.419   -13.325 1.00 61.02  ? 150 PRO H C   1 
ATOM   1112 O O   . PRO A 1 148 ? 39.947 2.835   -13.478 1.00 60.32  ? 150 PRO H O   1 
ATOM   1113 C CB  . PRO A 1 148 ? 42.102 0.139   -13.729 1.00 59.93  ? 150 PRO H CB  1 
ATOM   1114 C CG  . PRO A 1 148 ? 41.624 -1.219  -13.375 1.00 60.91  ? 150 PRO H CG  1 
ATOM   1115 C CD  . PRO A 1 148 ? 40.153 -0.999  -13.179 1.00 58.39  ? 150 PRO H CD  1 
ATOM   1116 N N   . GLU A 1 149 ? 42.177 3.107   -13.675 1.00 61.01  ? 151 GLU H N   1 
ATOM   1117 C CA  . GLU A 1 149 ? 42.119 4.457   -14.225 1.00 62.62  ? 151 GLU H CA  1 
ATOM   1118 C C   . GLU A 1 149 ? 41.525 4.620   -15.627 1.00 62.66  ? 151 GLU H C   1 
ATOM   1119 O O   . GLU A 1 149 ? 40.800 5.582   -15.885 1.00 65.94  ? 151 GLU H O   1 
ATOM   1120 C CB  . GLU A 1 149 ? 43.520 5.070   -14.213 1.00 63.29  ? 151 GLU H CB  1 
ATOM   1121 C CG  . GLU A 1 149 ? 43.550 6.536   -14.603 1.00 67.06  ? 151 GLU H CG  1 
ATOM   1122 C CD  . GLU A 1 149 ? 44.958 7.075   -14.721 1.00 71.11  ? 151 GLU H CD  1 
ATOM   1123 O OE1 . GLU A 1 149 ? 45.742 6.908   -13.762 1.00 74.03  ? 151 GLU H OE1 1 
ATOM   1124 O OE2 . GLU A 1 149 ? 45.280 7.670   -15.770 1.00 75.17  ? 151 GLU H OE2 1 
ATOM   1125 N N   . PRO A 1 150 ? 41.820 3.692   -16.552 1.00 59.97  ? 152 PRO H N   1 
ATOM   1126 C CA  . PRO A 1 150 ? 41.277 3.820   -17.909 1.00 58.64  ? 152 PRO H CA  1 
ATOM   1127 C C   . PRO A 1 150 ? 39.781 4.128   -18.009 1.00 60.18  ? 152 PRO H C   1 
ATOM   1128 O O   . PRO A 1 150 ? 38.938 3.273   -17.740 1.00 64.10  ? 152 PRO H O   1 
ATOM   1129 C CB  . PRO A 1 150 ? 41.646 2.484   -18.557 1.00 57.10  ? 152 PRO H CB  1 
ATOM   1130 C CG  . PRO A 1 150 ? 41.736 1.542   -17.394 1.00 59.72  ? 152 PRO H CG  1 
ATOM   1131 C CD  . PRO A 1 150 ? 42.452 2.375   -16.367 1.00 59.19  ? 152 PRO H CD  1 
ATOM   1132 N N   . VAL A 1 151 ? 39.465 5.359   -18.402 1.00 57.96  ? 153 VAL H N   1 
ATOM   1133 C CA  . VAL A 1 151 ? 38.083 5.803   -18.559 1.00 56.29  ? 153 VAL H CA  1 
ATOM   1134 C C   . VAL A 1 151 ? 38.035 6.858   -19.662 1.00 53.77  ? 153 VAL H C   1 
ATOM   1135 O O   . VAL A 1 151 ? 38.926 7.699   -19.758 1.00 53.32  ? 153 VAL H O   1 
ATOM   1136 C CB  . VAL A 1 151 ? 37.534 6.407   -17.242 1.00 58.58  ? 153 VAL H CB  1 
ATOM   1137 C CG1 . VAL A 1 151 ? 38.278 7.691   -16.899 1.00 60.13  ? 153 VAL H CG1 1 
ATOM   1138 C CG2 . VAL A 1 151 ? 36.049 6.670   -17.374 1.00 57.58  ? 153 VAL H CG2 1 
ATOM   1139 N N   . THR A 1 152 ? 37.000 6.816   -20.496 1.00 52.58  ? 154 THR H N   1 
ATOM   1140 C CA  . THR A 1 152 ? 36.888 7.773   -21.593 1.00 53.72  ? 154 THR H CA  1 
ATOM   1141 C C   . THR A 1 152 ? 35.591 8.572   -21.602 1.00 52.48  ? 154 THR H C   1 
ATOM   1142 O O   . THR A 1 152 ? 34.501 8.006   -21.567 1.00 55.51  ? 154 THR H O   1 
ATOM   1143 C CB  . THR A 1 152 ? 37.016 7.063   -22.954 1.00 55.83  ? 154 THR H CB  1 
ATOM   1144 O OG1 . THR A 1 152 ? 38.246 6.326   -22.995 1.00 58.23  ? 154 THR H OG1 1 
ATOM   1145 C CG2 . THR A 1 152 ? 36.998 8.083   -24.089 1.00 54.39  ? 154 THR H CG2 1 
ATOM   1146 N N   . VAL A 1 153 ? 35.717 9.893   -21.665 1.00 51.75  ? 155 VAL H N   1 
ATOM   1147 C CA  . VAL A 1 153 ? 34.555 10.773  -21.693 1.00 49.75  ? 155 VAL H CA  1 
ATOM   1148 C C   . VAL A 1 153 ? 34.375 11.346  -23.093 1.00 50.12  ? 155 VAL H C   1 
ATOM   1149 O O   . VAL A 1 153 ? 35.282 11.973  -23.640 1.00 50.38  ? 155 VAL H O   1 
ATOM   1150 C CB  . VAL A 1 153 ? 34.707 11.945  -20.699 1.00 46.61  ? 155 VAL H CB  1 
ATOM   1151 C CG1 . VAL A 1 153 ? 33.469 12.823  -20.738 1.00 46.36  ? 155 VAL H CG1 1 
ATOM   1152 C CG2 . VAL A 1 153 ? 34.934 11.411  -19.297 1.00 45.60  ? 155 VAL H CG2 1 
ATOM   1153 N N   . THR A 1 154 ? 33.200 11.126  -23.670 1.00 51.20  ? 156 THR H N   1 
ATOM   1154 C CA  . THR A 1 154 ? 32.903 11.624  -25.006 1.00 55.57  ? 156 THR H CA  1 
ATOM   1155 C C   . THR A 1 154 ? 31.616 12.437  -25.007 1.00 56.87  ? 156 THR H C   1 
ATOM   1156 O O   . THR A 1 154 ? 30.619 12.036  -24.405 1.00 58.59  ? 156 THR H O   1 
ATOM   1157 C CB  . THR A 1 154 ? 32.759 10.461  -26.007 1.00 57.45  ? 156 THR H CB  1 
ATOM   1158 O OG1 . THR A 1 154 ? 31.860 9.482   -25.473 1.00 61.03  ? 156 THR H OG1 1 
ATOM   1159 C CG2 . THR A 1 154 ? 34.109 9.810   -26.268 1.00 58.73  ? 156 THR H CG2 1 
ATOM   1160 N N   . TRP A 1 155 ? 31.641 13.583  -25.678 1.00 58.51  ? 157 TRP H N   1 
ATOM   1161 C CA  . TRP A 1 155 ? 30.468 14.446  -25.757 1.00 59.88  ? 157 TRP H CA  1 
ATOM   1162 C C   . TRP A 1 155 ? 29.832 14.402  -27.140 1.00 62.84  ? 157 TRP H C   1 
ATOM   1163 O O   . TRP A 1 155 ? 30.328 15.031  -28.076 1.00 64.12  ? 157 TRP H O   1 
ATOM   1164 C CB  . TRP A 1 155 ? 30.845 15.888  -25.432 1.00 55.80  ? 157 TRP H CB  1 
ATOM   1165 C CG  . TRP A 1 155 ? 31.343 16.079  -24.047 1.00 54.12  ? 157 TRP H CG  1 
ATOM   1166 C CD1 . TRP A 1 155 ? 32.593 15.802  -23.577 1.00 54.07  ? 157 TRP H CD1 1 
ATOM   1167 C CD2 . TRP A 1 155 ? 30.594 16.576  -22.934 1.00 49.51  ? 157 TRP H CD2 1 
ATOM   1168 N NE1 . TRP A 1 155 ? 32.671 16.098  -22.237 1.00 52.30  ? 157 TRP H NE1 1 
ATOM   1169 C CE2 . TRP A 1 155 ? 31.456 16.575  -21.817 1.00 49.36  ? 157 TRP H CE2 1 
ATOM   1170 C CE3 . TRP A 1 155 ? 29.276 17.022  -22.772 1.00 50.11  ? 157 TRP H CE3 1 
ATOM   1171 C CZ2 . TRP A 1 155 ? 31.043 17.002  -20.551 1.00 47.26  ? 157 TRP H CZ2 1 
ATOM   1172 C CZ3 . TRP A 1 155 ? 28.864 17.447  -21.511 1.00 48.97  ? 157 TRP H CZ3 1 
ATOM   1173 C CH2 . TRP A 1 155 ? 29.747 17.433  -20.418 1.00 46.15  ? 157 TRP H CH2 1 
ATOM   1174 N N   . ASN A 1 156 ? 28.732 13.664  -27.263 1.00 67.18  ? 158 ASN H N   1 
ATOM   1175 C CA  . ASN A 1 156 ? 28.021 13.536  -28.534 1.00 69.85  ? 158 ASN H CA  1 
ATOM   1176 C C   . ASN A 1 156 ? 28.983 13.232  -29.682 1.00 72.12  ? 158 ASN H C   1 
ATOM   1177 O O   . ASN A 1 156 ? 28.626 13.374  -30.853 1.00 72.37  ? 158 ASN H O   1 
ATOM   1178 C CB  . ASN A 1 156 ? 27.259 14.828  -28.843 1.00 69.83  ? 158 ASN H CB  1 
ATOM   1179 C CG  . ASN A 1 156 ? 26.311 15.227  -27.730 1.00 71.05  ? 158 ASN H CG  1 
ATOM   1180 O OD1 . ASN A 1 156 ? 25.410 14.473  -27.364 1.00 73.95  ? 158 ASN H OD1 1 
ATOM   1181 N ND2 . ASN A 1 156 ? 26.508 16.421  -27.185 1.00 70.00  ? 158 ASN H ND2 1 
ATOM   1182 N N   . SER A 1 157 ? 30.201 12.818  -29.336 1.00 75.44  ? 159 SER H N   1 
ATOM   1183 C CA  . SER A 1 157 ? 31.240 12.498  -30.314 1.00 77.66  ? 159 SER H CA  1 
ATOM   1184 C C   . SER A 1 157 ? 31.790 13.759  -30.981 1.00 78.72  ? 159 SER H C   1 
ATOM   1185 O O   . SER A 1 157 ? 32.984 13.850  -31.269 1.00 77.52  ? 159 SER H O   1 
ATOM   1186 C CB  . SER A 1 157 ? 30.696 11.543  -31.382 1.00 77.65  ? 159 SER H CB  1 
ATOM   1187 O OG  . SER A 1 157 ? 30.229 10.338  -30.799 1.00 80.62  ? 159 SER H OG  1 
ATOM   1188 N N   . GLY A 1 158 ? 30.912 14.730  -31.219 1.00 80.66  ? 160 GLY H N   1 
ATOM   1189 C CA  . GLY A 1 158 ? 31.326 15.971  -31.849 1.00 81.88  ? 160 GLY H CA  1 
ATOM   1190 C C   . GLY A 1 158 ? 31.729 17.039  -30.849 1.00 83.16  ? 160 GLY H C   1 
ATOM   1191 O O   . GLY A 1 158 ? 31.094 18.091  -30.762 1.00 83.23  ? 160 GLY H O   1 
ATOM   1192 N N   . GLY A 1 159 ? 32.788 16.765  -30.093 1.00 84.60  ? 161 GLY H N   1 
ATOM   1193 C CA  . GLY A 1 159 ? 33.266 17.717  -29.106 1.00 83.71  ? 161 GLY H CA  1 
ATOM   1194 C C   . GLY A 1 159 ? 34.622 18.276  -29.487 1.00 82.93  ? 161 GLY H C   1 
ATOM   1195 O O   . GLY A 1 159 ? 35.594 17.531  -29.622 1.00 82.84  ? 161 GLY H O   1 
ATOM   1196 N N   . SER A 1 160 ? 34.690 19.592  -29.661 1.00 82.50  ? 164 SER H N   1 
ATOM   1197 C CA  . SER A 1 160 ? 35.936 20.249  -30.036 1.00 81.09  ? 164 SER H CA  1 
ATOM   1198 C C   . SER A 1 160 ? 36.396 21.225  -28.957 1.00 78.48  ? 164 SER H C   1 
ATOM   1199 O O   . SER A 1 160 ? 37.561 21.624  -28.922 1.00 78.92  ? 164 SER H O   1 
ATOM   1200 C CB  . SER A 1 160 ? 35.755 20.992  -31.363 1.00 82.04  ? 164 SER H CB  1 
ATOM   1201 O OG  . SER A 1 160 ? 36.962 21.611  -31.770 1.00 84.24  ? 164 SER H OG  1 
ATOM   1202 N N   . SER A 1 161 ? 35.475 21.606  -28.080 1.00 74.48  ? 165 SER H N   1 
ATOM   1203 C CA  . SER A 1 161 ? 35.786 22.533  -26.998 1.00 71.42  ? 165 SER H CA  1 
ATOM   1204 C C   . SER A 1 161 ? 35.815 21.787  -25.668 1.00 68.66  ? 165 SER H C   1 
ATOM   1205 O O   . SER A 1 161 ? 35.495 22.349  -24.620 1.00 67.16  ? 165 SER H O   1 
ATOM   1206 C CB  . SER A 1 161 ? 34.736 23.647  -26.946 1.00 71.73  ? 165 SER H CB  1 
ATOM   1207 O OG  . SER A 1 161 ? 35.025 24.578  -25.916 1.00 73.07  ? 165 SER H OG  1 
ATOM   1208 N N   . VAL A 1 162 ? 36.210 20.518  -25.718 1.00 65.09  ? 166 VAL H N   1 
ATOM   1209 C CA  . VAL A 1 162 ? 36.264 19.689  -24.520 1.00 61.19  ? 166 VAL H CA  1 
ATOM   1210 C C   . VAL A 1 162 ? 37.608 19.768  -23.803 1.00 56.97  ? 166 VAL H C   1 
ATOM   1211 O O   . VAL A 1 162 ? 38.652 19.929  -24.432 1.00 54.42  ? 166 VAL H O   1 
ATOM   1212 C CB  . VAL A 1 162 ? 35.978 18.207  -24.855 1.00 60.35  ? 166 VAL H CB  1 
ATOM   1213 C CG1 . VAL A 1 162 ? 34.728 18.102  -25.713 1.00 63.71  ? 166 VAL H CG1 1 
ATOM   1214 C CG2 . VAL A 1 162 ? 37.169 17.590  -25.566 1.00 64.74  ? 166 VAL H CG2 1 
ATOM   1215 N N   . HIS A 1 163 ? 37.563 19.655  -22.479 1.00 53.65  ? 167 HIS H N   1 
ATOM   1216 C CA  . HIS A 1 163 ? 38.759 19.687  -21.648 1.00 50.56  ? 167 HIS H CA  1 
ATOM   1217 C C   . HIS A 1 163 ? 38.670 18.576  -20.611 1.00 51.08  ? 167 HIS H C   1 
ATOM   1218 O O   . HIS A 1 163 ? 38.042 18.745  -19.565 1.00 53.07  ? 167 HIS H O   1 
ATOM   1219 C CB  . HIS A 1 163 ? 38.892 21.028  -20.918 1.00 50.30  ? 167 HIS H CB  1 
ATOM   1220 C CG  . HIS A 1 163 ? 39.278 22.171  -21.803 1.00 51.10  ? 167 HIS H CG  1 
ATOM   1221 N ND1 . HIS A 1 163 ? 40.424 22.167  -22.566 1.00 52.44  ? 167 HIS H ND1 1 
ATOM   1222 C CD2 . HIS A 1 163 ? 38.683 23.367  -22.023 1.00 51.12  ? 167 HIS H CD2 1 
ATOM   1223 C CE1 . HIS A 1 163 ? 40.520 23.311  -23.219 1.00 51.53  ? 167 HIS H CE1 1 
ATOM   1224 N NE2 . HIS A 1 163 ? 39.476 24.057  -22.907 1.00 51.71  ? 167 HIS H NE2 1 
ATOM   1225 N N   . THR A 1 164 ? 39.285 17.437  -20.902 1.00 49.36  ? 168 THR H N   1 
ATOM   1226 C CA  . THR A 1 164 ? 39.271 16.329  -19.960 1.00 50.16  ? 168 THR H CA  1 
ATOM   1227 C C   . THR A 1 164 ? 40.569 16.374  -19.169 1.00 46.78  ? 168 THR H C   1 
ATOM   1228 O O   . THR A 1 164 ? 41.655 16.208  -19.721 1.00 47.37  ? 168 THR H O   1 
ATOM   1229 C CB  . THR A 1 164 ? 39.130 14.974  -20.681 1.00 52.86  ? 168 THR H CB  1 
ATOM   1230 O OG1 . THR A 1 164 ? 37.854 14.915  -21.335 1.00 53.21  ? 168 THR H OG1 1 
ATOM   1231 C CG2 . THR A 1 164 ? 39.229 13.827  -19.685 1.00 54.41  ? 168 THR H CG2 1 
ATOM   1232 N N   . PHE A 1 165 ? 40.441 16.613  -17.869 1.00 42.08  ? 169 PHE H N   1 
ATOM   1233 C CA  . PHE A 1 165 ? 41.584 16.725  -16.972 1.00 39.87  ? 169 PHE H CA  1 
ATOM   1234 C C   . PHE A 1 165 ? 42.115 15.385  -16.469 1.00 38.33  ? 169 PHE H C   1 
ATOM   1235 O O   . PHE A 1 165 ? 41.362 14.427  -16.292 1.00 39.11  ? 169 PHE H O   1 
ATOM   1236 C CB  . PHE A 1 165 ? 41.198 17.629  -15.799 1.00 39.73  ? 169 PHE H CB  1 
ATOM   1237 C CG  . PHE A 1 165 ? 40.662 18.962  -16.234 1.00 37.29  ? 169 PHE H CG  1 
ATOM   1238 C CD1 . PHE A 1 165 ? 41.523 20.010  -16.533 1.00 40.20  ? 169 PHE H CD1 1 
ATOM   1239 C CD2 . PHE A 1 165 ? 39.297 19.144  -16.424 1.00 39.25  ? 169 PHE H CD2 1 
ATOM   1240 C CE1 . PHE A 1 165 ? 41.034 21.222  -17.021 1.00 39.39  ? 169 PHE H CE1 1 
ATOM   1241 C CE2 . PHE A 1 165 ? 38.795 20.350  -16.911 1.00 38.71  ? 169 PHE H CE2 1 
ATOM   1242 C CZ  . PHE A 1 165 ? 39.666 21.391  -17.211 1.00 40.06  ? 169 PHE H CZ  1 
ATOM   1243 N N   . PRO A 1 166 ? 43.434 15.301  -16.246 1.00 35.17  ? 170 PRO H N   1 
ATOM   1244 C CA  . PRO A 1 166 ? 44.076 14.077  -15.762 1.00 36.96  ? 170 PRO H CA  1 
ATOM   1245 C C   . PRO A 1 166 ? 43.385 13.542  -14.515 1.00 38.19  ? 170 PRO H C   1 
ATOM   1246 O O   . PRO A 1 166 ? 43.064 14.302  -13.604 1.00 36.40  ? 170 PRO H O   1 
ATOM   1247 C CB  . PRO A 1 166 ? 45.505 14.532  -15.475 1.00 33.67  ? 170 PRO H CB  1 
ATOM   1248 C CG  . PRO A 1 166 ? 45.724 15.593  -16.506 1.00 37.06  ? 170 PRO H CG  1 
ATOM   1249 C CD  . PRO A 1 166 ? 44.428 16.368  -16.451 1.00 35.77  ? 170 PRO H CD  1 
ATOM   1250 N N   . ALA A 1 167 ? 43.156 12.236  -14.474 1.00 39.20  ? 171 ALA H N   1 
ATOM   1251 C CA  . ALA A 1 167 ? 42.510 11.628  -13.322 1.00 42.53  ? 171 ALA H CA  1 
ATOM   1252 C C   . ALA A 1 167 ? 43.461 11.679  -12.135 1.00 45.15  ? 171 ALA H C   1 
ATOM   1253 O O   . ALA A 1 167 ? 44.678 11.624  -12.304 1.00 46.27  ? 171 ALA H O   1 
ATOM   1254 C CB  . ALA A 1 167 ? 42.137 10.187  -13.629 1.00 44.22  ? 171 ALA H CB  1 
ATOM   1255 N N   . LEU A 1 168 ? 42.902 11.800  -10.936 1.00 47.87  ? 172 LEU H N   1 
ATOM   1256 C CA  . LEU A 1 168 ? 43.704 11.842  -9.722  1.00 50.70  ? 172 LEU H CA  1 
ATOM   1257 C C   . LEU A 1 168 ? 43.269 10.730  -8.779  1.00 54.31  ? 172 LEU H C   1 
ATOM   1258 O O   . LEU A 1 168 ? 42.076 10.500  -8.584  1.00 53.68  ? 172 LEU H O   1 
ATOM   1259 C CB  . LEU A 1 168 ? 43.557 13.195  -9.025  1.00 50.75  ? 172 LEU H CB  1 
ATOM   1260 C CG  . LEU A 1 168 ? 44.127 14.410  -9.758  1.00 52.66  ? 172 LEU H CG  1 
ATOM   1261 C CD1 . LEU A 1 168 ? 43.865 15.658  -8.934  1.00 54.28  ? 172 LEU H CD1 1 
ATOM   1262 C CD2 . LEU A 1 168 ? 45.621 14.225  -9.989  1.00 50.61  ? 172 LEU H CD2 1 
ATOM   1263 N N   . LEU A 1 169 ? 44.243 10.037  -8.201  1.00 57.24  ? 173 LEU H N   1 
ATOM   1264 C CA  . LEU A 1 169 ? 43.953 8.947   -7.282  1.00 61.67  ? 173 LEU H CA  1 
ATOM   1265 C C   . LEU A 1 169 ? 43.554 9.532   -5.933  1.00 65.13  ? 173 LEU H C   1 
ATOM   1266 O O   . LEU A 1 169 ? 44.217 10.430  -5.412  1.00 64.86  ? 173 LEU H O   1 
ATOM   1267 C CB  . LEU A 1 169 ? 45.180 8.047   -7.135  1.00 60.94  ? 173 LEU H CB  1 
ATOM   1268 C CG  . LEU A 1 169 ? 44.971 6.689   -6.466  1.00 62.35  ? 173 LEU H CG  1 
ATOM   1269 C CD1 . LEU A 1 169 ? 43.849 5.929   -7.162  1.00 60.55  ? 173 LEU H CD1 1 
ATOM   1270 C CD2 . LEU A 1 169 ? 46.270 5.901   -6.527  1.00 62.13  ? 173 LEU H CD2 1 
ATOM   1271 N N   . GLN A 1 170 ? 42.460 9.022   -5.378  1.00 69.05  ? 174 GLN H N   1 
ATOM   1272 C CA  . GLN A 1 170 ? 41.952 9.507   -4.105  1.00 72.02  ? 174 GLN H CA  1 
ATOM   1273 C C   . GLN A 1 170 ? 41.476 8.348   -3.234  1.00 72.83  ? 174 GLN H C   1 
ATOM   1274 O O   . GLN A 1 170 ? 40.436 7.742   -3.501  1.00 73.21  ? 174 GLN H O   1 
ATOM   1275 C CB  . GLN A 1 170 ? 40.804 10.487  -4.363  1.00 75.93  ? 174 GLN H CB  1 
ATOM   1276 C CG  . GLN A 1 170 ? 40.266 11.195  -3.134  1.00 82.18  ? 174 GLN H CG  1 
ATOM   1277 C CD  . GLN A 1 170 ? 39.261 12.278  -3.489  1.00 85.71  ? 174 GLN H CD  1 
ATOM   1278 O OE1 . GLN A 1 170 ? 38.248 12.013  -4.138  1.00 88.00  ? 174 GLN H OE1 1 
ATOM   1279 N NE2 . GLN A 1 170 ? 39.537 13.506  -3.064  1.00 86.98  ? 174 GLN H NE2 1 
ATOM   1280 N N   . SER A 1 171 ? 42.251 8.043   -2.196  1.00 71.57  ? 175 SER H N   1 
ATOM   1281 C CA  . SER A 1 171 ? 41.930 6.962   -1.271  1.00 70.15  ? 175 SER H CA  1 
ATOM   1282 C C   . SER A 1 171 ? 41.807 5.611   -1.967  1.00 67.34  ? 175 SER H C   1 
ATOM   1283 O O   . SER A 1 171 ? 41.077 4.736   -1.506  1.00 68.30  ? 175 SER H O   1 
ATOM   1284 C CB  . SER A 1 171 ? 40.628 7.270   -0.527  1.00 72.02  ? 175 SER H CB  1 
ATOM   1285 O OG  . SER A 1 171 ? 40.756 8.436   0.266   1.00 76.49  ? 175 SER H OG  1 
ATOM   1286 N N   . GLY A 1 172 ? 42.517 5.445   -3.079  1.00 63.95  ? 176 GLY H N   1 
ATOM   1287 C CA  . GLY A 1 172 ? 42.466 4.185   -3.798  1.00 58.95  ? 176 GLY H CA  1 
ATOM   1288 C C   . GLY A 1 172 ? 41.556 4.180   -5.013  1.00 56.99  ? 176 GLY H C   1 
ATOM   1289 O O   . GLY A 1 172 ? 41.502 3.194   -5.748  1.00 55.29  ? 176 GLY H O   1 
ATOM   1290 N N   . LEU A 1 173 ? 40.836 5.276   -5.225  1.00 53.25  ? 177 LEU H N   1 
ATOM   1291 C CA  . LEU A 1 173 ? 39.935 5.388   -6.364  1.00 52.35  ? 177 LEU H CA  1 
ATOM   1292 C C   . LEU A 1 173 ? 40.284 6.628   -7.181  1.00 50.92  ? 177 LEU H C   1 
ATOM   1293 O O   . LEU A 1 173 ? 40.713 7.642   -6.635  1.00 50.99  ? 177 LEU H O   1 
ATOM   1294 C CB  . LEU A 1 173 ? 38.484 5.471   -5.883  1.00 48.81  ? 177 LEU H CB  1 
ATOM   1295 C CG  . LEU A 1 173 ? 38.002 4.305   -5.018  1.00 46.80  ? 177 LEU H CG  1 
ATOM   1296 C CD1 . LEU A 1 173 ? 36.571 4.562   -4.571  1.00 45.18  ? 177 LEU H CD1 1 
ATOM   1297 C CD2 . LEU A 1 173 ? 38.098 3.006   -5.805  1.00 42.48  ? 177 LEU H CD2 1 
ATOM   1298 N N   . TYR A 1 174 ? 40.095 6.544   -8.492  1.00 50.59  ? 178 TYR H N   1 
ATOM   1299 C CA  . TYR A 1 174 ? 40.404 7.660   -9.372  1.00 49.72  ? 178 TYR H CA  1 
ATOM   1300 C C   . TYR A 1 174 ? 39.231 8.610   -9.547  1.00 49.38  ? 178 TYR H C   1 
ATOM   1301 O O   . TYR A 1 174 ? 38.071 8.212   -9.453  1.00 49.75  ? 178 TYR H O   1 
ATOM   1302 C CB  . TYR A 1 174 ? 40.859 7.136   -10.734 1.00 51.11  ? 178 TYR H CB  1 
ATOM   1303 C CG  . TYR A 1 174 ? 42.227 6.500   -10.700 1.00 56.66  ? 178 TYR H CG  1 
ATOM   1304 C CD1 . TYR A 1 174 ? 43.370 7.277   -10.512 1.00 58.19  ? 178 TYR H CD1 1 
ATOM   1305 C CD2 . TYR A 1 174 ? 42.382 5.121   -10.837 1.00 57.61  ? 178 TYR H CD2 1 
ATOM   1306 C CE1 . TYR A 1 174 ? 44.636 6.699   -10.462 1.00 60.36  ? 178 TYR H CE1 1 
ATOM   1307 C CE2 . TYR A 1 174 ? 43.646 4.529   -10.788 1.00 61.05  ? 178 TYR H CE2 1 
ATOM   1308 C CZ  . TYR A 1 174 ? 44.768 5.325   -10.600 1.00 62.13  ? 178 TYR H CZ  1 
ATOM   1309 O OH  . TYR A 1 174 ? 46.020 4.752   -10.550 1.00 62.49  ? 178 TYR H OH  1 
ATOM   1310 N N   . THR A 1 175 ? 39.549 9.873   -9.801  1.00 47.36  ? 179 THR H N   1 
ATOM   1311 C CA  . THR A 1 175 ? 38.540 10.902  -10.000 1.00 44.56  ? 179 THR H CA  1 
ATOM   1312 C C   . THR A 1 175 ? 39.021 11.882  -11.056 1.00 42.85  ? 179 THR H C   1 
ATOM   1313 O O   . THR A 1 175 ? 40.188 12.279  -11.067 1.00 42.37  ? 179 THR H O   1 
ATOM   1314 C CB  . THR A 1 175 ? 38.274 11.697  -8.709  1.00 47.28  ? 179 THR H CB  1 
ATOM   1315 O OG1 . THR A 1 175 ? 37.865 10.804  -7.668  1.00 54.74  ? 179 THR H OG1 1 
ATOM   1316 C CG2 . THR A 1 175 ? 37.180 12.729  -8.940  1.00 48.90  ? 179 THR H CG2 1 
ATOM   1317 N N   . MET A 1 176 ? 38.118 12.265  -11.947 1.00 40.69  ? 180 MET H N   1 
ATOM   1318 C CA  . MET A 1 176 ? 38.447 13.214  -12.995 1.00 42.28  ? 180 MET H CA  1 
ATOM   1319 C C   . MET A 1 176 ? 37.177 13.888  -13.477 1.00 41.27  ? 180 MET H C   1 
ATOM   1320 O O   . MET A 1 176 ? 36.079 13.356  -13.325 1.00 37.83  ? 180 MET H O   1 
ATOM   1321 C CB  . MET A 1 176 ? 39.116 12.510  -14.174 1.00 48.07  ? 180 MET H CB  1 
ATOM   1322 C CG  . MET A 1 176 ? 38.209 11.542  -14.906 1.00 52.47  ? 180 MET H CG  1 
ATOM   1323 S SD  . MET A 1 176 ? 38.528 11.570  -16.673 1.00 67.75  ? 180 MET H SD  1 
ATOM   1324 C CE  . MET A 1 176 ? 40.100 10.721  -16.745 1.00 63.55  ? 180 MET H CE  1 
ATOM   1325 N N   . SER A 1 177 ? 37.336 15.065  -14.061 1.00 40.32  ? 181 SER H N   1 
ATOM   1326 C CA  . SER A 1 177 ? 36.207 15.816  -14.582 1.00 41.04  ? 181 SER H CA  1 
ATOM   1327 C C   . SER A 1 177 ? 36.496 16.198  -16.028 1.00 39.26  ? 181 SER H C   1 
ATOM   1328 O O   . SER A 1 177 ? 37.643 16.166  -16.472 1.00 37.68  ? 181 SER H O   1 
ATOM   1329 C CB  . SER A 1 177 ? 35.976 17.076  -13.743 1.00 44.64  ? 181 SER H CB  1 
ATOM   1330 O OG  . SER A 1 177 ? 37.163 17.850  -13.662 1.00 50.96  ? 181 SER H OG  1 
ATOM   1331 N N   . SER A 1 178 ? 35.448 16.552  -16.758 1.00 38.52  ? 182 SER H N   1 
ATOM   1332 C CA  . SER A 1 178 ? 35.576 16.949  -18.149 1.00 39.33  ? 182 SER H CA  1 
ATOM   1333 C C   . SER A 1 178 ? 34.624 18.104  -18.395 1.00 42.32  ? 182 SER H C   1 
ATOM   1334 O O   . SER A 1 178 ? 33.444 18.021  -18.059 1.00 42.98  ? 182 SER H O   1 
ATOM   1335 C CB  . SER A 1 178 ? 35.223 15.777  -19.066 1.00 40.34  ? 182 SER H CB  1 
ATOM   1336 O OG  . SER A 1 178 ? 35.289 16.155  -20.429 1.00 39.90  ? 182 SER H OG  1 
ATOM   1337 N N   . SER A 1 179 ? 35.135 19.184  -18.973 1.00 45.51  ? 183 SER H N   1 
ATOM   1338 C CA  . SER A 1 179 ? 34.305 20.345  -19.250 1.00 47.37  ? 183 SER H CA  1 
ATOM   1339 C C   . SER A 1 179 ? 34.130 20.540  -20.746 1.00 50.01  ? 183 SER H C   1 
ATOM   1340 O O   . SER A 1 179 ? 34.993 20.160  -21.539 1.00 49.35  ? 183 SER H O   1 
ATOM   1341 C CB  . SER A 1 179 ? 34.923 21.605  -18.643 1.00 48.35  ? 183 SER H CB  1 
ATOM   1342 O OG  . SER A 1 179 ? 36.137 21.941  -19.288 1.00 48.28  ? 183 SER H OG  1 
ATOM   1343 N N   . VAL A 1 180 ? 33.001 21.129  -21.122 1.00 52.25  ? 184 VAL H N   1 
ATOM   1344 C CA  . VAL A 1 180 ? 32.693 21.396  -22.519 1.00 55.58  ? 184 VAL H CA  1 
ATOM   1345 C C   . VAL A 1 180 ? 32.114 22.803  -22.622 1.00 58.54  ? 184 VAL H C   1 
ATOM   1346 O O   . VAL A 1 180 ? 31.526 23.314  -21.667 1.00 56.50  ? 184 VAL H O   1 
ATOM   1347 C CB  . VAL A 1 180 ? 31.668 20.380  -23.080 1.00 56.00  ? 184 VAL H CB  1 
ATOM   1348 C CG1 . VAL A 1 180 ? 30.346 20.512  -22.348 1.00 54.87  ? 184 VAL H CG1 1 
ATOM   1349 C CG2 . VAL A 1 180 ? 31.479 20.601  -24.572 1.00 55.98  ? 184 VAL H CG2 1 
ATOM   1350 N N   . THR A 1 181 ? 32.291 23.429  -23.780 1.00 61.85  ? 185 THR H N   1 
ATOM   1351 C CA  . THR A 1 181 ? 31.793 24.780  -23.987 1.00 64.47  ? 185 THR H CA  1 
ATOM   1352 C C   . THR A 1 181 ? 30.975 24.889  -25.265 1.00 65.78  ? 185 THR H C   1 
ATOM   1353 O O   . THR A 1 181 ? 31.371 24.380  -26.313 1.00 64.10  ? 185 THR H O   1 
ATOM   1354 C CB  . THR A 1 181 ? 32.955 25.788  -24.047 1.00 64.74  ? 185 THR H CB  1 
ATOM   1355 O OG1 . THR A 1 181 ? 33.658 25.777  -22.799 1.00 66.64  ? 185 THR H OG1 1 
ATOM   1356 C CG2 . THR A 1 181 ? 32.435 27.191  -24.319 1.00 66.08  ? 185 THR H CG2 1 
ATOM   1357 N N   . VAL A 1 182 ? 29.829 25.554  -25.161 1.00 68.76  ? 186 VAL H N   1 
ATOM   1358 C CA  . VAL A 1 182 ? 28.933 25.753  -26.294 1.00 72.23  ? 186 VAL H CA  1 
ATOM   1359 C C   . VAL A 1 182 ? 28.144 27.049  -26.120 1.00 74.37  ? 186 VAL H C   1 
ATOM   1360 O O   . VAL A 1 182 ? 27.881 27.482  -24.994 1.00 74.97  ? 186 VAL H O   1 
ATOM   1361 C CB  . VAL A 1 182 ? 27.923 24.590  -26.433 1.00 72.87  ? 186 VAL H CB  1 
ATOM   1362 C CG1 . VAL A 1 182 ? 28.652 23.294  -26.741 1.00 72.64  ? 186 VAL H CG1 1 
ATOM   1363 C CG2 . VAL A 1 182 ? 27.110 24.453  -25.155 1.00 73.37  ? 186 VAL H CG2 1 
ATOM   1364 N N   . PRO A 1 183 ? 27.757 27.688  -27.236 1.00 75.21  ? 187 PRO H N   1 
ATOM   1365 C CA  . PRO A 1 183 ? 26.993 28.939  -27.201 1.00 76.36  ? 187 PRO H CA  1 
ATOM   1366 C C   . PRO A 1 183 ? 25.580 28.719  -26.666 1.00 76.12  ? 187 PRO H C   1 
ATOM   1367 O O   . PRO A 1 183 ? 24.924 27.738  -27.016 1.00 75.77  ? 187 PRO H O   1 
ATOM   1368 C CB  . PRO A 1 183 ? 27.003 29.384  -28.659 1.00 76.96  ? 187 PRO H CB  1 
ATOM   1369 C CG  . PRO A 1 183 ? 26.997 28.081  -29.394 1.00 76.33  ? 187 PRO H CG  1 
ATOM   1370 C CD  . PRO A 1 183 ? 28.010 27.269  -28.627 1.00 75.41  ? 187 PRO H CD  1 
ATOM   1371 N N   . SER A 1 184 ? 25.117 29.635  -25.821 1.00 76.20  ? 188 SER H N   1 
ATOM   1372 C CA  . SER A 1 184 ? 23.786 29.528  -25.231 1.00 77.40  ? 188 SER H CA  1 
ATOM   1373 C C   . SER A 1 184 ? 22.692 29.359  -26.280 1.00 77.59  ? 188 SER H C   1 
ATOM   1374 O O   . SER A 1 184 ? 21.648 28.762  -26.010 1.00 77.39  ? 188 SER H O   1 
ATOM   1375 C CB  . SER A 1 184 ? 23.487 30.762  -24.379 1.00 76.66  ? 188 SER H CB  1 
ATOM   1376 O OG  . SER A 1 184 ? 22.269 30.608  -23.674 1.00 78.00  ? 188 SER H OG  1 
ATOM   1377 N N   . SER A 1 185 ? 22.935 29.880  -27.478 1.00 78.36  ? 189 SER H N   1 
ATOM   1378 C CA  . SER A 1 185 ? 21.964 29.786  -28.562 1.00 79.91  ? 189 SER H CA  1 
ATOM   1379 C C   . SER A 1 185 ? 21.765 28.352  -29.038 1.00 80.14  ? 189 SER H C   1 
ATOM   1380 O O   . SER A 1 185 ? 21.051 28.110  -30.011 1.00 80.39  ? 189 SER H O   1 
ATOM   1381 C CB  . SER A 1 185 ? 22.400 30.655  -29.745 1.00 80.82  ? 189 SER H CB  1 
ATOM   1382 O OG  . SER A 1 185 ? 22.475 32.021  -29.378 1.00 85.85  ? 189 SER H OG  1 
ATOM   1383 N N   . THR A 1 186 ? 22.396 27.403  -28.356 1.00 80.57  ? 190 THR H N   1 
ATOM   1384 C CA  . THR A 1 186 ? 22.270 26.001  -28.730 1.00 81.29  ? 190 THR H CA  1 
ATOM   1385 C C   . THR A 1 186 ? 22.279 25.087  -27.510 1.00 82.00  ? 190 THR H C   1 
ATOM   1386 O O   . THR A 1 186 ? 22.307 23.864  -27.645 1.00 80.83  ? 190 THR H O   1 
ATOM   1387 C CB  . THR A 1 186 ? 23.407 25.570  -29.684 1.00 80.89  ? 190 THR H CB  1 
ATOM   1388 O OG1 . THR A 1 186 ? 23.176 24.229  -30.131 1.00 83.70  ? 190 THR H OG1 1 
ATOM   1389 C CG2 . THR A 1 186 ? 24.753 25.632  -28.976 1.00 80.92  ? 190 THR H CG2 1 
ATOM   1390 N N   . TRP A 1 187 ? 22.251 25.679  -26.320 1.00 84.30  ? 191 TRP H N   1 
ATOM   1391 C CA  . TRP A 1 187 ? 22.254 24.893  -25.092 1.00 87.83  ? 191 TRP H CA  1 
ATOM   1392 C C   . TRP A 1 187 ? 21.043 23.959  -25.050 1.00 88.34  ? 191 TRP H C   1 
ATOM   1393 O O   . TRP A 1 187 ? 21.174 22.777  -24.724 1.00 88.81  ? 191 TRP H O   1 
ATOM   1394 C CB  . TRP A 1 187 ? 22.264 25.812  -23.865 1.00 91.41  ? 191 TRP H CB  1 
ATOM   1395 C CG  . TRP A 1 187 ? 22.528 25.084  -22.575 1.00 96.70  ? 191 TRP H CG  1 
ATOM   1396 C CD1 . TRP A 1 187 ? 23.335 23.995  -22.401 1.00 96.57  ? 191 TRP H CD1 1 
ATOM   1397 C CD2 . TRP A 1 187 ? 22.029 25.423  -21.273 1.00 100.02 ? 191 TRP H CD2 1 
ATOM   1398 N NE1 . TRP A 1 187 ? 23.371 23.635  -21.076 1.00 97.83  ? 191 TRP H NE1 1 
ATOM   1399 C CE2 . TRP A 1 187 ? 22.580 24.494  -20.360 1.00 99.40  ? 191 TRP H CE2 1 
ATOM   1400 C CE3 . TRP A 1 187 ? 21.173 26.422  -20.789 1.00 103.14 ? 191 TRP H CE3 1 
ATOM   1401 C CZ2 . TRP A 1 187 ? 22.302 24.534  -18.989 1.00 102.27 ? 191 TRP H CZ2 1 
ATOM   1402 C CZ3 . TRP A 1 187 ? 20.896 26.462  -19.421 1.00 104.99 ? 191 TRP H CZ3 1 
ATOM   1403 C CH2 . TRP A 1 187 ? 21.461 25.522  -18.539 1.00 105.27 ? 191 TRP H CH2 1 
ATOM   1404 N N   . PRO A 1 188 ? 19.845 24.477  -25.376 1.00 87.31  ? 192 PRO H N   1 
ATOM   1405 C CA  . PRO A 1 188 ? 18.645 23.635  -25.362 1.00 84.78  ? 192 PRO H CA  1 
ATOM   1406 C C   . PRO A 1 188 ? 18.552 22.785  -26.628 1.00 82.45  ? 192 PRO H C   1 
ATOM   1407 O O   . PRO A 1 188 ? 17.580 22.873  -27.377 1.00 82.16  ? 192 PRO H O   1 
ATOM   1408 C CB  . PRO A 1 188 ? 17.519 24.654  -25.269 1.00 85.79  ? 192 PRO H CB  1 
ATOM   1409 C CG  . PRO A 1 188 ? 18.048 25.780  -26.095 1.00 87.58  ? 192 PRO H CG  1 
ATOM   1410 C CD  . PRO A 1 188 ? 19.484 25.887  -25.619 1.00 87.53  ? 192 PRO H CD  1 
ATOM   1411 N N   . SER A 1 189 ? 19.578 21.972  -26.864 1.00 81.10  ? 193 SER H N   1 
ATOM   1412 C CA  . SER A 1 189 ? 19.624 21.099  -28.032 1.00 79.74  ? 193 SER H CA  1 
ATOM   1413 C C   . SER A 1 189 ? 20.156 19.722  -27.643 1.00 78.03  ? 193 SER H C   1 
ATOM   1414 O O   . SER A 1 189 ? 20.481 18.905  -28.506 1.00 78.77  ? 193 SER H O   1 
ATOM   1415 C CB  . SER A 1 189 ? 20.515 21.710  -29.118 1.00 80.55  ? 193 SER H CB  1 
ATOM   1416 O OG  . SER A 1 189 ? 19.999 22.953  -29.565 1.00 81.97  ? 193 SER H OG  1 
ATOM   1417 N N   . THR A 1 190 ? 20.243 19.486  -26.337 1.00 75.38  ? 195 THR H N   1 
ATOM   1418 C CA  . THR A 1 190 ? 20.721 18.222  -25.780 1.00 74.25  ? 195 THR H CA  1 
ATOM   1419 C C   . THR A 1 190 ? 22.243 18.074  -25.777 1.00 72.86  ? 195 THR H C   1 
ATOM   1420 O O   . THR A 1 190 ? 22.864 17.840  -26.816 1.00 71.45  ? 195 THR H O   1 
ATOM   1421 C CB  . THR A 1 190 ? 20.121 17.005  -26.524 1.00 73.75  ? 195 THR H CB  1 
ATOM   1422 O OG1 . THR A 1 190 ? 18.691 17.084  -26.501 1.00 75.86  ? 195 THR H OG1 1 
ATOM   1423 C CG2 . THR A 1 190 ? 20.557 15.707  -25.857 1.00 73.28  ? 195 THR H CG2 1 
ATOM   1424 N N   . VAL A 1 191 ? 22.833 18.213  -24.594 1.00 69.73  ? 196 VAL H N   1 
ATOM   1425 C CA  . VAL A 1 191 ? 24.273 18.069  -24.416 1.00 66.87  ? 196 VAL H CA  1 
ATOM   1426 C C   . VAL A 1 191 ? 24.473 16.862  -23.506 1.00 63.63  ? 196 VAL H C   1 
ATOM   1427 O O   . VAL A 1 191 ? 24.084 16.887  -22.337 1.00 64.98  ? 196 VAL H O   1 
ATOM   1428 C CB  . VAL A 1 191 ? 24.888 19.311  -23.742 1.00 67.06  ? 196 VAL H CB  1 
ATOM   1429 C CG1 . VAL A 1 191 ? 26.397 19.149  -23.634 1.00 65.27  ? 196 VAL H CG1 1 
ATOM   1430 C CG2 . VAL A 1 191 ? 24.536 20.561  -24.530 1.00 66.41  ? 196 VAL H CG2 1 
ATOM   1431 N N   . THR A 1 192 ? 25.080 15.808  -24.038 1.00 59.15  ? 197 THR H N   1 
ATOM   1432 C CA  . THR A 1 192 ? 25.288 14.595  -23.258 1.00 56.88  ? 197 THR H CA  1 
ATOM   1433 C C   . THR A 1 192 ? 26.742 14.146  -23.159 1.00 55.38  ? 197 THR H C   1 
ATOM   1434 O O   . THR A 1 192 ? 27.473 14.148  -24.152 1.00 56.33  ? 197 THR H O   1 
ATOM   1435 C CB  . THR A 1 192 ? 24.469 13.429  -23.849 1.00 55.42  ? 197 THR H CB  1 
ATOM   1436 O OG1 . THR A 1 192 ? 23.090 13.808  -23.931 1.00 53.17  ? 197 THR H OG1 1 
ATOM   1437 C CG2 . THR A 1 192 ? 24.600 12.187  -22.981 1.00 52.64  ? 197 THR H CG2 1 
ATOM   1438 N N   . CYS A 1 193 ? 27.162 13.768  -21.954 1.00 51.76  ? 198 CYS H N   1 
ATOM   1439 C CA  . CYS A 1 193 ? 28.519 13.272  -21.754 1.00 48.29  ? 198 CYS H CA  1 
ATOM   1440 C C   . CYS A 1 193 ? 28.402 11.765  -21.584 1.00 46.26  ? 198 CYS H C   1 
ATOM   1441 O O   . CYS A 1 193 ? 27.591 11.280  -20.794 1.00 42.47  ? 198 CYS H O   1 
ATOM   1442 C CB  . CYS A 1 193 ? 29.176 13.888  -20.509 1.00 46.53  ? 198 CYS H CB  1 
ATOM   1443 S SG  . CYS A 1 193 ? 28.509 13.368  -18.889 1.00 49.82  ? 198 CYS H SG  1 
ATOM   1444 N N   . SER A 1 194 ? 29.191 11.025  -22.351 1.00 46.14  ? 199 SER H N   1 
ATOM   1445 C CA  . SER A 1 194 ? 29.171 9.575   -22.273 1.00 46.69  ? 199 SER H CA  1 
ATOM   1446 C C   . SER A 1 194 ? 30.470 9.101   -21.641 1.00 44.63  ? 199 SER H C   1 
ATOM   1447 O O   . SER A 1 194 ? 31.547 9.262   -22.215 1.00 48.26  ? 199 SER H O   1 
ATOM   1448 C CB  . SER A 1 194 ? 29.009 8.973   -23.671 1.00 47.02  ? 199 SER H CB  1 
ATOM   1449 O OG  . SER A 1 194 ? 28.948 7.561   -23.602 1.00 53.89  ? 199 SER H OG  1 
ATOM   1450 N N   . VAL A 1 195 ? 30.361 8.529   -20.448 1.00 45.25  ? 200 VAL H N   1 
ATOM   1451 C CA  . VAL A 1 195 ? 31.522 8.029   -19.726 1.00 43.97  ? 200 VAL H CA  1 
ATOM   1452 C C   . VAL A 1 195 ? 31.646 6.521   -19.902 1.00 45.16  ? 200 VAL H C   1 
ATOM   1453 O O   . VAL A 1 195 ? 30.750 5.769   -19.517 1.00 45.26  ? 200 VAL H O   1 
ATOM   1454 C CB  . VAL A 1 195 ? 31.414 8.347   -18.219 1.00 43.41  ? 200 VAL H CB  1 
ATOM   1455 C CG1 . VAL A 1 195 ? 32.698 7.946   -17.505 1.00 41.57  ? 200 VAL H CG1 1 
ATOM   1456 C CG2 . VAL A 1 195 ? 31.135 9.829   -18.020 1.00 42.68  ? 200 VAL H CG2 1 
ATOM   1457 N N   . ALA A 1 196 ? 32.757 6.086   -20.491 1.00 45.98  ? 201 ALA H N   1 
ATOM   1458 C CA  . ALA A 1 196 ? 33.007 4.664   -20.717 1.00 47.81  ? 201 ALA H CA  1 
ATOM   1459 C C   . ALA A 1 196 ? 34.148 4.158   -19.836 1.00 47.33  ? 201 ALA H C   1 
ATOM   1460 O O   . ALA A 1 196 ? 35.206 4.781   -19.747 1.00 45.56  ? 201 ALA H O   1 
ATOM   1461 C CB  . ALA A 1 196 ? 33.332 4.419   -22.186 1.00 47.22  ? 201 ALA H CB  1 
ATOM   1462 N N   . HIS A 1 197 ? 33.916 3.024   -19.183 1.00 48.59  ? 202 HIS H N   1 
ATOM   1463 C CA  . HIS A 1 197 ? 34.905 2.413   -18.303 1.00 50.81  ? 202 HIS H CA  1 
ATOM   1464 C C   . HIS A 1 197 ? 34.955 0.913   -18.601 1.00 55.77  ? 202 HIS H C   1 
ATOM   1465 O O   . HIS A 1 197 ? 34.390 0.103   -17.862 1.00 56.01  ? 202 HIS H O   1 
ATOM   1466 C CB  . HIS A 1 197 ? 34.511 2.628   -16.841 1.00 49.26  ? 202 HIS H CB  1 
ATOM   1467 C CG  . HIS A 1 197 ? 35.542 2.163   -15.860 1.00 48.67  ? 202 HIS H CG  1 
ATOM   1468 N ND1 . HIS A 1 197 ? 35.213 1.652   -14.624 1.00 49.12  ? 202 HIS H ND1 1 
ATOM   1469 C CD2 . HIS A 1 197 ? 36.894 2.167   -15.918 1.00 48.39  ? 202 HIS H CD2 1 
ATOM   1470 C CE1 . HIS A 1 197 ? 36.318 1.361   -13.961 1.00 52.61  ? 202 HIS H CE1 1 
ATOM   1471 N NE2 . HIS A 1 197 ? 37.353 1.665   -14.724 1.00 51.66  ? 202 HIS H NE2 1 
ATOM   1472 N N   . PRO A 1 198 ? 35.639 0.525   -19.689 1.00 58.42  ? 203 PRO H N   1 
ATOM   1473 C CA  . PRO A 1 198 ? 35.753 -0.886  -20.073 1.00 60.00  ? 203 PRO H CA  1 
ATOM   1474 C C   . PRO A 1 198 ? 36.175 -1.816  -18.937 1.00 60.31  ? 203 PRO H C   1 
ATOM   1475 O O   . PRO A 1 198 ? 35.804 -2.989  -18.919 1.00 61.25  ? 203 PRO H O   1 
ATOM   1476 C CB  . PRO A 1 198 ? 36.767 -0.853  -21.218 1.00 60.38  ? 203 PRO H CB  1 
ATOM   1477 C CG  . PRO A 1 198 ? 37.580 0.379   -20.929 1.00 61.38  ? 203 PRO H CG  1 
ATOM   1478 C CD  . PRO A 1 198 ? 36.517 1.362   -20.524 1.00 58.82  ? 203 PRO H CD  1 
ATOM   1479 N N   . ALA A 1 199 ? 36.938 -1.287  -17.985 1.00 60.22  ? 204 ALA H N   1 
ATOM   1480 C CA  . ALA A 1 199 ? 37.405 -2.078  -16.851 1.00 59.41  ? 204 ALA H CA  1 
ATOM   1481 C C   . ALA A 1 199 ? 36.248 -2.722  -16.095 1.00 59.37  ? 204 ALA H C   1 
ATOM   1482 O O   . ALA A 1 199 ? 36.373 -3.838  -15.587 1.00 59.95  ? 204 ALA H O   1 
ATOM   1483 C CB  . ALA A 1 199 ? 38.220 -1.206  -15.910 1.00 60.82  ? 204 ALA H CB  1 
ATOM   1484 N N   . SER A 1 200 ? 35.123 -2.016  -16.019 1.00 58.68  ? 205 SER H N   1 
ATOM   1485 C CA  . SER A 1 200 ? 33.947 -2.529  -15.324 1.00 55.74  ? 205 SER H CA  1 
ATOM   1486 C C   . SER A 1 200 ? 32.811 -2.792  -16.305 1.00 55.61  ? 205 SER H C   1 
ATOM   1487 O O   . SER A 1 200 ? 31.675 -3.037  -15.900 1.00 56.62  ? 205 SER H O   1 
ATOM   1488 C CB  . SER A 1 200 ? 33.485 -1.533  -14.258 1.00 56.91  ? 205 SER H CB  1 
ATOM   1489 O OG  . SER A 1 200 ? 33.147 -0.289  -14.846 1.00 53.51  ? 205 SER H OG  1 
ATOM   1490 N N   . SER A 1 201 ? 33.128 -2.739  -17.597 1.00 54.97  ? 206 SER H N   1 
ATOM   1491 C CA  . SER A 1 201 ? 32.140 -2.970  -18.647 1.00 54.71  ? 206 SER H CA  1 
ATOM   1492 C C   . SER A 1 201 ? 30.945 -2.039  -18.454 1.00 55.44  ? 206 SER H C   1 
ATOM   1493 O O   . SER A 1 201 ? 29.802 -2.402  -18.741 1.00 52.06  ? 206 SER H O   1 
ATOM   1494 C CB  . SER A 1 201 ? 31.677 -4.430  -18.619 1.00 56.05  ? 206 SER H CB  1 
ATOM   1495 O OG  . SER A 1 201 ? 32.780 -5.320  -18.713 1.00 57.78  ? 206 SER H OG  1 
ATOM   1496 N N   . THR A 1 202 ? 31.225 -0.830  -17.978 1.00 52.99  ? 207 THR H N   1 
ATOM   1497 C CA  . THR A 1 202 ? 30.184 0.154   -17.723 1.00 48.48  ? 207 THR H CA  1 
ATOM   1498 C C   . THR A 1 202 ? 30.298 1.395   -18.598 1.00 49.29  ? 207 THR H C   1 
ATOM   1499 O O   . THR A 1 202 ? 31.395 1.870   -18.892 1.00 49.11  ? 207 THR H O   1 
ATOM   1500 C CB  . THR A 1 202 ? 30.216 0.613   -16.256 1.00 47.51  ? 207 THR H CB  1 
ATOM   1501 O OG1 . THR A 1 202 ? 30.100 -0.526  -15.397 1.00 44.34  ? 207 THR H OG1 1 
ATOM   1502 C CG2 . THR A 1 202 ? 29.077 1.574   -15.974 1.00 45.04  ? 207 THR H CG2 1 
ATOM   1503 N N   . THR A 1 203 ? 29.147 1.910   -19.012 1.00 47.03  ? 208 THR H N   1 
ATOM   1504 C CA  . THR A 1 203 ? 29.075 3.117   -19.820 1.00 45.46  ? 208 THR H CA  1 
ATOM   1505 C C   . THR A 1 203 ? 27.919 3.919   -19.243 1.00 46.64  ? 208 THR H C   1 
ATOM   1506 O O   . THR A 1 203 ? 26.783 3.445   -19.202 1.00 48.53  ? 208 THR H O   1 
ATOM   1507 C CB  . THR A 1 203 ? 28.790 2.805   -21.301 1.00 49.20  ? 208 THR H CB  1 
ATOM   1508 O OG1 . THR A 1 203 ? 29.809 1.939   -21.812 1.00 50.94  ? 208 THR H OG1 1 
ATOM   1509 C CG2 . THR A 1 203 ? 28.779 4.088   -22.122 1.00 49.54  ? 208 THR H CG2 1 
ATOM   1510 N N   . VAL A 1 204 ? 28.213 5.124   -18.771 1.00 44.79  ? 209 VAL H N   1 
ATOM   1511 C CA  . VAL A 1 204 ? 27.184 5.969   -18.190 1.00 43.77  ? 209 VAL H CA  1 
ATOM   1512 C C   . VAL A 1 204 ? 26.999 7.228   -19.015 1.00 45.77  ? 209 VAL H C   1 
ATOM   1513 O O   . VAL A 1 204 ? 27.963 7.932   -19.319 1.00 43.73  ? 209 VAL H O   1 
ATOM   1514 C CB  . VAL A 1 204 ? 27.541 6.360   -16.745 1.00 40.52  ? 209 VAL H CB  1 
ATOM   1515 C CG1 . VAL A 1 204 ? 26.458 7.255   -16.163 1.00 41.26  ? 209 VAL H CG1 1 
ATOM   1516 C CG2 . VAL A 1 204 ? 27.704 5.110   -15.904 1.00 40.18  ? 209 VAL H CG2 1 
ATOM   1517 N N   . ASP A 1 205 ? 25.752 7.499   -19.382 1.00 48.45  ? 210 ASP H N   1 
ATOM   1518 C CA  . ASP A 1 205 ? 25.423 8.676   -20.172 1.00 53.24  ? 210 ASP H CA  1 
ATOM   1519 C C   . ASP A 1 205 ? 24.592 9.626   -19.324 1.00 53.33  ? 210 ASP H C   1 
ATOM   1520 O O   . ASP A 1 205 ? 23.543 9.253   -18.803 1.00 48.78  ? 210 ASP H O   1 
ATOM   1521 C CB  . ASP A 1 205 ? 24.641 8.274   -21.423 1.00 56.94  ? 210 ASP H CB  1 
ATOM   1522 C CG  . ASP A 1 205 ? 25.350 7.207   -22.226 1.00 62.93  ? 210 ASP H CG  1 
ATOM   1523 O OD1 . ASP A 1 205 ? 26.520 7.429   -22.600 1.00 64.23  ? 210 ASP H OD1 1 
ATOM   1524 O OD2 . ASP A 1 205 ? 24.738 6.147   -22.481 1.00 67.04  ? 210 ASP H OD2 1 
ATOM   1525 N N   . LYS A 1 206 ? 25.072 10.855  -19.189 1.00 54.35  ? 211 LYS H N   1 
ATOM   1526 C CA  . LYS A 1 206 ? 24.381 11.858  -18.395 1.00 57.07  ? 211 LYS H CA  1 
ATOM   1527 C C   . LYS A 1 206 ? 24.011 13.055  -19.270 1.00 59.09  ? 211 LYS H C   1 
ATOM   1528 O O   . LYS A 1 206 ? 24.886 13.738  -19.803 1.00 61.24  ? 211 LYS H O   1 
ATOM   1529 C CB  . LYS A 1 206 ? 25.283 12.309  -17.243 1.00 57.09  ? 211 LYS H CB  1 
ATOM   1530 C CG  . LYS A 1 206 ? 24.581 13.129  -16.180 1.00 61.90  ? 211 LYS H CG  1 
ATOM   1531 C CD  . LYS A 1 206 ? 23.670 12.264  -15.321 1.00 63.04  ? 211 LYS H CD  1 
ATOM   1532 C CE  . LYS A 1 206 ? 24.474 11.265  -14.506 1.00 62.02  ? 211 LYS H CE  1 
ATOM   1533 N NZ  . LYS A 1 206 ? 23.609 10.445  -13.618 1.00 62.02  ? 211 LYS H NZ  1 
ATOM   1534 N N   . LYS A 1 207 ? 22.714 13.299  -19.428 1.00 59.88  ? 212 LYS H N   1 
ATOM   1535 C CA  . LYS A 1 207 ? 22.251 14.428  -20.227 1.00 59.40  ? 212 LYS H CA  1 
ATOM   1536 C C   . LYS A 1 207 ? 22.090 15.636  -19.315 1.00 56.37  ? 212 LYS H C   1 
ATOM   1537 O O   . LYS A 1 207 ? 21.261 15.636  -18.412 1.00 51.51  ? 212 LYS H O   1 
ATOM   1538 C CB  . LYS A 1 207 ? 20.915 14.104  -20.897 1.00 63.32  ? 212 LYS H CB  1 
ATOM   1539 C CG  . LYS A 1 207 ? 20.415 15.203  -21.824 1.00 70.19  ? 212 LYS H CG  1 
ATOM   1540 C CD  . LYS A 1 207 ? 19.130 14.804  -22.534 1.00 74.96  ? 212 LYS H CD  1 
ATOM   1541 C CE  . LYS A 1 207 ? 17.987 14.608  -21.552 1.00 79.84  ? 212 LYS H CE  1 
ATOM   1542 N NZ  . LYS A 1 207 ? 17.669 15.860  -20.808 1.00 82.04  ? 212 LYS H NZ  1 
ATOM   1543 N N   . LEU A 1 208 ? 22.894 16.662  -19.552 1.00 58.96  ? 213 LEU H N   1 
ATOM   1544 C CA  . LEU A 1 208 ? 22.843 17.867  -18.737 1.00 61.92  ? 213 LEU H CA  1 
ATOM   1545 C C   . LEU A 1 208 ? 21.478 18.539  -18.826 1.00 65.04  ? 213 LEU H C   1 
ATOM   1546 O O   . LEU A 1 208 ? 21.085 19.036  -19.884 1.00 63.37  ? 213 LEU H O   1 
ATOM   1547 C CB  . LEU A 1 208 ? 23.945 18.823  -19.179 1.00 61.77  ? 213 LEU H CB  1 
ATOM   1548 C CG  . LEU A 1 208 ? 25.332 18.192  -19.058 1.00 62.25  ? 213 LEU H CG  1 
ATOM   1549 C CD1 . LEU A 1 208 ? 26.357 19.093  -19.699 1.00 66.34  ? 213 LEU H CD1 1 
ATOM   1550 C CD2 . LEU A 1 208 ? 25.665 17.949  -17.594 1.00 62.12  ? 213 LEU H CD2 1 
ATOM   1551 N N   . GLU A 1 209 ? 20.764 18.547  -17.703 1.00 66.92  ? 214 GLU H N   1 
ATOM   1552 C CA  . GLU A 1 209 ? 19.430 19.131  -17.621 1.00 69.42  ? 214 GLU H CA  1 
ATOM   1553 C C   . GLU A 1 209 ? 18.514 18.600  -18.723 1.00 71.65  ? 214 GLU H C   1 
ATOM   1554 O O   . GLU A 1 209 ? 18.030 19.418  -19.534 1.00 72.64  ? 214 GLU H O   1 
ATOM   1555 C CB  . GLU A 1 209 ? 19.499 20.661  -17.700 1.00 69.04  ? 214 GLU H CB  1 
ATOM   1556 C CG  . GLU A 1 209 ? 20.002 21.334  -16.434 1.00 67.65  ? 214 GLU H CG  1 
ATOM   1557 C CD  . GLU A 1 209 ? 19.511 22.767  -16.310 1.00 69.03  ? 214 GLU H CD  1 
ATOM   1558 O OE1 . GLU A 1 209 ? 19.838 23.429  -15.302 1.00 69.24  ? 214 GLU H OE1 1 
ATOM   1559 O OE2 . GLU A 1 209 ? 18.793 23.230  -17.223 1.00 66.04  ? 214 GLU H OE2 1 
ATOM   1560 O OXT . GLU A 1 209 ? 18.290 17.370  -18.760 1.00 70.41  ? 214 GLU H OXT 1 
ATOM   1561 N N   . ASP B 2 1   ? 75.396 -0.041  -22.483 1.00 31.20  ? 1   ASP L N   1 
ATOM   1562 C CA  . ASP B 2 1   ? 74.182 0.593   -23.085 1.00 32.20  ? 1   ASP L CA  1 
ATOM   1563 C C   . ASP B 2 1   ? 74.494 1.923   -23.751 1.00 35.17  ? 1   ASP L C   1 
ATOM   1564 O O   . ASP B 2 1   ? 75.341 2.690   -23.291 1.00 34.98  ? 1   ASP L O   1 
ATOM   1565 C CB  . ASP B 2 1   ? 73.108 0.838   -22.024 1.00 29.82  ? 1   ASP L CB  1 
ATOM   1566 C CG  . ASP B 2 1   ? 72.591 -0.438  -21.407 1.00 31.93  ? 1   ASP L CG  1 
ATOM   1567 O OD1 . ASP B 2 1   ? 71.681 -0.345  -20.563 1.00 30.15  ? 1   ASP L OD1 1 
ATOM   1568 O OD2 . ASP B 2 1   ? 73.093 -1.528  -21.756 1.00 38.47  ? 1   ASP L OD2 1 
ATOM   1569 N N   . ILE B 2 2   ? 73.798 2.191   -24.845 1.00 32.82  ? 2   ILE L N   1 
ATOM   1570 C CA  . ILE B 2 2   ? 73.976 3.442   -25.551 1.00 28.48  ? 2   ILE L CA  1 
ATOM   1571 C C   . ILE B 2 2   ? 72.978 4.419   -24.932 1.00 28.12  ? 2   ILE L C   1 
ATOM   1572 O O   . ILE B 2 2   ? 71.767 4.264   -25.087 1.00 30.56  ? 2   ILE L O   1 
ATOM   1573 C CB  . ILE B 2 2   ? 73.719 3.248   -27.058 1.00 32.49  ? 2   ILE L CB  1 
ATOM   1574 C CG1 . ILE B 2 2   ? 73.685 4.603   -27.754 1.00 33.91  ? 2   ILE L CG1 1 
ATOM   1575 C CG2 . ILE B 2 2   ? 72.443 2.491   -27.271 1.00 42.05  ? 2   ILE L CG2 1 
ATOM   1576 C CD1 . ILE B 2 2   ? 74.955 5.362   -27.579 1.00 42.17  ? 2   ILE L CD1 1 
ATOM   1577 N N   . VAL B 2 3   ? 73.488 5.411   -24.208 1.00 23.06  ? 3   VAL L N   1 
ATOM   1578 C CA  . VAL B 2 3   ? 72.629 6.381   -23.545 1.00 25.14  ? 3   VAL L CA  1 
ATOM   1579 C C   . VAL B 2 3   ? 72.257 7.533   -24.467 1.00 24.64  ? 3   VAL L C   1 
ATOM   1580 O O   . VAL B 2 3   ? 73.117 8.143   -25.106 1.00 22.87  ? 3   VAL L O   1 
ATOM   1581 C CB  . VAL B 2 3   ? 73.295 6.957   -22.275 1.00 25.78  ? 3   VAL L CB  1 
ATOM   1582 C CG1 . VAL B 2 3   ? 72.361 7.955   -21.605 1.00 25.84  ? 3   VAL L CG1 1 
ATOM   1583 C CG2 . VAL B 2 3   ? 73.639 5.825   -21.312 1.00 29.50  ? 3   VAL L CG2 1 
ATOM   1584 N N   . MET B 2 4   ? 70.964 7.823   -24.516 1.00 23.84  ? 4   MET L N   1 
ATOM   1585 C CA  . MET B 2 4   ? 70.432 8.886   -25.354 1.00 25.82  ? 4   MET L CA  1 
ATOM   1586 C C   . MET B 2 4   ? 70.066 10.064  -24.460 1.00 20.99  ? 4   MET L C   1 
ATOM   1587 O O   . MET B 2 4   ? 69.261 9.924   -23.542 1.00 22.61  ? 4   MET L O   1 
ATOM   1588 C CB  . MET B 2 4   ? 69.193 8.382   -26.100 1.00 24.75  ? 4   MET L CB  1 
ATOM   1589 C CG  . MET B 2 4   ? 69.422 7.120   -26.927 1.00 18.79  ? 4   MET L CG  1 
ATOM   1590 S SD  . MET B 2 4   ? 70.562 7.360   -28.297 1.00 22.03  ? 4   MET L SD  1 
ATOM   1591 C CE  . MET B 2 4   ? 69.538 8.495   -29.364 1.00 19.14  ? 4   MET L CE  1 
ATOM   1592 N N   . THR B 2 5   ? 70.650 11.222  -24.743 1.00 15.30  ? 5   THR L N   1 
ATOM   1593 C CA  . THR B 2 5   ? 70.407 12.416  -23.948 1.00 20.47  ? 5   THR L CA  1 
ATOM   1594 C C   . THR B 2 5   ? 69.747 13.585  -24.678 1.00 18.74  ? 5   THR L C   1 
ATOM   1595 O O   . THR B 2 5   ? 70.230 14.012  -25.732 1.00 20.82  ? 5   THR L O   1 
ATOM   1596 C CB  . THR B 2 5   ? 71.740 12.915  -23.339 1.00 23.73  ? 5   THR L CB  1 
ATOM   1597 O OG1 . THR B 2 5   ? 72.331 11.856  -22.572 1.00 28.36  ? 5   THR L OG1 1 
ATOM   1598 C CG2 . THR B 2 5   ? 71.514 14.129  -22.441 1.00 25.71  ? 5   THR L CG2 1 
ATOM   1599 N N   . GLN B 2 6   ? 68.651 14.088  -24.103 1.00 19.37  ? 6   GLN L N   1 
ATOM   1600 C CA  . GLN B 2 6   ? 67.911 15.245  -24.625 1.00 23.72  ? 6   GLN L CA  1 
ATOM   1601 C C   . GLN B 2 6   ? 67.527 16.107  -23.432 1.00 25.50  ? 6   GLN L C   1 
ATOM   1602 O O   . GLN B 2 6   ? 67.362 15.593  -22.329 1.00 27.68  ? 6   GLN L O   1 
ATOM   1603 C CB  . GLN B 2 6   ? 66.575 14.878  -25.273 1.00 20.29  ? 6   GLN L CB  1 
ATOM   1604 C CG  . GLN B 2 6   ? 66.449 13.570  -25.990 1.00 28.46  ? 6   GLN L CG  1 
ATOM   1605 C CD  . GLN B 2 6   ? 65.003 13.349  -26.427 1.00 24.27  ? 6   GLN L CD  1 
ATOM   1606 O OE1 . GLN B 2 6   ? 64.412 14.202  -27.107 1.00 24.18  ? 6   GLN L OE1 1 
ATOM   1607 N NE2 . GLN B 2 6   ? 64.424 12.218  -26.033 1.00 11.07  ? 6   GLN L NE2 1 
ATOM   1608 N N   . ALA B 2 7   ? 67.331 17.402  -23.669 1.00 27.59  ? 7   ALA L N   1 
ATOM   1609 C CA  . ALA B 2 7   ? 66.915 18.325  -22.616 1.00 31.57  ? 7   ALA L CA  1 
ATOM   1610 C C   . ALA B 2 7   ? 65.419 18.104  -22.382 1.00 32.02  ? 7   ALA L C   1 
ATOM   1611 O O   . ALA B 2 7   ? 64.689 17.779  -23.317 1.00 27.96  ? 7   ALA L O   1 
ATOM   1612 C CB  . ALA B 2 7   ? 67.172 19.768  -23.058 1.00 31.66  ? 7   ALA L CB  1 
ATOM   1613 N N   . ALA B 2 8   ? 64.955 18.287  -21.147 1.00 25.51  ? 8   ALA L N   1 
ATOM   1614 C CA  . ALA B 2 8   ? 63.542 18.085  -20.844 1.00 24.31  ? 8   ALA L CA  1 
ATOM   1615 C C   . ALA B 2 8   ? 62.640 19.109  -21.539 1.00 24.74  ? 8   ALA L C   1 
ATOM   1616 O O   . ALA B 2 8   ? 61.483 18.830  -21.840 1.00 21.29  ? 8   ALA L O   1 
ATOM   1617 C CB  . ALA B 2 8   ? 63.315 18.130  -19.330 1.00 30.28  ? 8   ALA L CB  1 
ATOM   1618 N N   . PHE B 2 9   ? 63.163 20.301  -21.785 1.00 27.35  ? 9   PHE L N   1 
ATOM   1619 C CA  . PHE B 2 9   ? 62.370 21.326  -22.445 1.00 30.33  ? 9   PHE L CA  1 
ATOM   1620 C C   . PHE B 2 9   ? 63.196 22.067  -23.488 1.00 31.01  ? 9   PHE L C   1 
ATOM   1621 O O   . PHE B 2 9   ? 64.415 21.923  -23.562 1.00 29.28  ? 9   PHE L O   1 
ATOM   1622 C CB  . PHE B 2 9   ? 61.830 22.354  -21.438 1.00 34.47  ? 9   PHE L CB  1 
ATOM   1623 C CG  . PHE B 2 9   ? 61.065 21.756  -20.293 1.00 35.14  ? 9   PHE L CG  1 
ATOM   1624 C CD1 . PHE B 2 9   ? 61.730 21.310  -19.153 1.00 43.27  ? 9   PHE L CD1 1 
ATOM   1625 C CD2 . PHE B 2 9   ? 59.678 21.647  -20.346 1.00 40.01  ? 9   PHE L CD2 1 
ATOM   1626 C CE1 . PHE B 2 9   ? 61.022 20.765  -18.077 1.00 42.77  ? 9   PHE L CE1 1 
ATOM   1627 C CE2 . PHE B 2 9   ? 58.959 21.103  -19.278 1.00 41.69  ? 9   PHE L CE2 1 
ATOM   1628 C CZ  . PHE B 2 9   ? 59.632 20.663  -18.144 1.00 42.94  ? 9   PHE L CZ  1 
ATOM   1629 N N   . SER B 2 10  ? 62.505 22.849  -24.302 1.00 34.37  ? 10  SER L N   1 
ATOM   1630 C CA  . SER B 2 10  ? 63.135 23.664  -25.332 1.00 35.90  ? 10  SER L CA  1 
ATOM   1631 C C   . SER B 2 10  ? 62.450 25.010  -25.145 1.00 29.67  ? 10  SER L C   1 
ATOM   1632 O O   . SER B 2 10  ? 61.382 25.076  -24.549 1.00 27.83  ? 10  SER L O   1 
ATOM   1633 C CB  . SER B 2 10  ? 62.836 23.103  -26.727 1.00 37.09  ? 10  SER L CB  1 
ATOM   1634 O OG  . SER B 2 10  ? 61.455 23.208  -27.034 1.00 40.76  ? 10  SER L OG  1 
ATOM   1635 N N   . ASN B 2 11  ? 63.038 26.083  -25.648 1.00 34.47  ? 11  ASN L N   1 
ATOM   1636 C CA  . ASN B 2 11  ? 62.402 27.385  -25.467 1.00 38.06  ? 11  ASN L CA  1 
ATOM   1637 C C   . ASN B 2 11  ? 61.082 27.453  -26.216 1.00 35.89  ? 11  ASN L C   1 
ATOM   1638 O O   . ASN B 2 11  ? 60.905 26.785  -27.236 1.00 28.73  ? 11  ASN L O   1 
ATOM   1639 C CB  . ASN B 2 11  ? 63.325 28.497  -25.947 1.00 41.00  ? 11  ASN L CB  1 
ATOM   1640 C CG  . ASN B 2 11  ? 64.640 28.512  -25.203 1.00 43.35  ? 11  ASN L CG  1 
ATOM   1641 O OD1 . ASN B 2 11  ? 64.673 28.595  -23.966 1.00 41.08  ? 11  ASN L OD1 1 
ATOM   1642 N ND2 . ASN B 2 11  ? 65.734 28.427  -25.948 1.00 29.25  ? 11  ASN L ND2 1 
ATOM   1643 N N   . PRO B 2 12  ? 60.127 28.248  -25.708 1.00 37.73  ? 12  PRO L N   1 
ATOM   1644 C CA  . PRO B 2 12  ? 58.840 28.352  -26.394 1.00 35.09  ? 12  PRO L CA  1 
ATOM   1645 C C   . PRO B 2 12  ? 59.060 28.831  -27.818 1.00 33.37  ? 12  PRO L C   1 
ATOM   1646 O O   . PRO B 2 12  ? 59.911 29.681  -28.076 1.00 32.40  ? 12  PRO L O   1 
ATOM   1647 C CB  . PRO B 2 12  ? 58.063 29.354  -25.534 1.00 40.30  ? 12  PRO L CB  1 
ATOM   1648 C CG  . PRO B 2 12  ? 59.139 30.175  -24.898 1.00 45.33  ? 12  PRO L CG  1 
ATOM   1649 C CD  . PRO B 2 12  ? 60.168 29.135  -24.533 1.00 41.11  ? 12  PRO L CD  1 
ATOM   1650 N N   . VAL B 2 13  ? 58.299 28.274  -28.748 1.00 28.35  ? 13  VAL L N   1 
ATOM   1651 C CA  . VAL B 2 13  ? 58.454 28.650  -30.135 1.00 26.07  ? 13  VAL L CA  1 
ATOM   1652 C C   . VAL B 2 13  ? 57.208 29.327  -30.660 1.00 25.73  ? 13  VAL L C   1 
ATOM   1653 O O   . VAL B 2 13  ? 56.090 28.935  -30.347 1.00 22.35  ? 13  VAL L O   1 
ATOM   1654 C CB  . VAL B 2 13  ? 58.779 27.418  -31.012 1.00 31.16  ? 13  VAL L CB  1 
ATOM   1655 C CG1 . VAL B 2 13  ? 60.049 26.746  -30.505 1.00 30.92  ? 13  VAL L CG1 1 
ATOM   1656 C CG2 . VAL B 2 13  ? 57.628 26.441  -30.987 1.00 27.67  ? 13  VAL L CG2 1 
ATOM   1657 N N   . THR B 2 14  ? 57.416 30.359  -31.461 1.00 25.07  ? 14  THR L N   1 
ATOM   1658 C CA  . THR B 2 14  ? 56.318 31.102  -32.045 1.00 27.96  ? 14  THR L CA  1 
ATOM   1659 C C   . THR B 2 14  ? 55.691 30.299  -33.190 1.00 21.75  ? 14  THR L C   1 
ATOM   1660 O O   . THR B 2 14  ? 56.384 29.696  -34.001 1.00 20.62  ? 14  THR L O   1 
ATOM   1661 C CB  . THR B 2 14  ? 56.820 32.456  -32.597 1.00 31.15  ? 14  THR L CB  1 
ATOM   1662 O OG1 . THR B 2 14  ? 57.417 33.210  -31.533 1.00 39.15  ? 14  THR L OG1 1 
ATOM   1663 C CG2 . THR B 2 14  ? 55.672 33.247  -33.203 1.00 32.10  ? 14  THR L CG2 1 
ATOM   1664 N N   . LEU B 2 15  ? 54.370 30.287  -33.247 1.00 23.01  ? 15  LEU L N   1 
ATOM   1665 C CA  . LEU B 2 15  ? 53.685 29.582  -34.318 1.00 28.98  ? 15  LEU L CA  1 
ATOM   1666 C C   . LEU B 2 15  ? 54.209 30.094  -35.651 1.00 29.40  ? 15  LEU L C   1 
ATOM   1667 O O   . LEU B 2 15  ? 54.429 31.293  -35.813 1.00 29.19  ? 15  LEU L O   1 
ATOM   1668 C CB  . LEU B 2 15  ? 52.183 29.829  -34.235 1.00 32.61  ? 15  LEU L CB  1 
ATOM   1669 C CG  . LEU B 2 15  ? 51.503 29.167  -33.043 1.00 40.79  ? 15  LEU L CG  1 
ATOM   1670 C CD1 . LEU B 2 15  ? 50.042 29.574  -32.983 1.00 42.95  ? 15  LEU L CD1 1 
ATOM   1671 C CD2 . LEU B 2 15  ? 51.637 27.657  -33.173 1.00 36.14  ? 15  LEU L CD2 1 
ATOM   1672 N N   . GLY B 2 16  ? 54.421 29.183  -36.594 1.00 28.67  ? 16  GLY L N   1 
ATOM   1673 C CA  . GLY B 2 16  ? 54.925 29.582  -37.897 1.00 26.99  ? 16  GLY L CA  1 
ATOM   1674 C C   . GLY B 2 16  ? 56.434 29.649  -38.020 1.00 25.56  ? 16  GLY L C   1 
ATOM   1675 O O   . GLY B 2 16  ? 56.944 29.864  -39.120 1.00 24.98  ? 16  GLY L O   1 
ATOM   1676 N N   . THR B 2 17  ? 57.154 29.495  -36.908 1.00 20.61  ? 17  THR L N   1 
ATOM   1677 C CA  . THR B 2 17  ? 58.615 29.534  -36.952 1.00 19.76  ? 17  THR L CA  1 
ATOM   1678 C C   . THR B 2 17  ? 59.166 28.131  -36.708 1.00 20.94  ? 17  THR L C   1 
ATOM   1679 O O   . THR B 2 17  ? 58.398 27.203  -36.429 1.00 22.31  ? 17  THR L O   1 
ATOM   1680 C CB  . THR B 2 17  ? 59.199 30.507  -35.897 1.00 23.89  ? 17  THR L CB  1 
ATOM   1681 O OG1 . THR B 2 17  ? 58.867 30.048  -34.586 1.00 22.59  ? 17  THR L OG1 1 
ATOM   1682 C CG2 . THR B 2 17  ? 58.630 31.900  -36.090 1.00 26.56  ? 17  THR L CG2 1 
ATOM   1683 N N   . SER B 2 18  ? 60.483 27.975  -36.819 1.00 21.42  ? 18  SER L N   1 
ATOM   1684 C CA  . SER B 2 18  ? 61.120 26.673  -36.648 1.00 25.49  ? 18  SER L CA  1 
ATOM   1685 C C   . SER B 2 18  ? 61.496 26.322  -35.213 1.00 27.73  ? 18  SER L C   1 
ATOM   1686 O O   . SER B 2 18  ? 61.861 27.187  -34.419 1.00 22.36  ? 18  SER L O   1 
ATOM   1687 C CB  . SER B 2 18  ? 62.392 26.579  -37.509 1.00 28.70  ? 18  SER L CB  1 
ATOM   1688 O OG  . SER B 2 18  ? 62.090 26.480  -38.889 1.00 33.01  ? 18  SER L OG  1 
ATOM   1689 N N   . ALA B 2 19  ? 61.411 25.038  -34.893 1.00 24.64  ? 19  ALA L N   1 
ATOM   1690 C CA  . ALA B 2 19  ? 61.791 24.554  -33.572 1.00 22.78  ? 19  ALA L CA  1 
ATOM   1691 C C   . ALA B 2 19  ? 62.924 23.563  -33.814 1.00 22.89  ? 19  ALA L C   1 
ATOM   1692 O O   . ALA B 2 19  ? 62.949 22.896  -34.848 1.00 20.83  ? 19  ALA L O   1 
ATOM   1693 C CB  . ALA B 2 19  ? 60.606 23.853  -32.896 1.00 19.03  ? 19  ALA L CB  1 
ATOM   1694 N N   . SER B 2 20  ? 63.870 23.483  -32.881 1.00 17.31  ? 20  SER L N   1 
ATOM   1695 C CA  . SER B 2 20  ? 64.989 22.552  -32.995 1.00 20.05  ? 20  SER L CA  1 
ATOM   1696 C C   . SER B 2 20  ? 65.086 21.753  -31.701 1.00 25.79  ? 20  SER L C   1 
ATOM   1697 O O   . SER B 2 20  ? 65.096 22.334  -30.614 1.00 24.68  ? 20  SER L O   1 
ATOM   1698 C CB  . SER B 2 20  ? 66.310 23.299  -33.201 1.00 27.63  ? 20  SER L CB  1 
ATOM   1699 O OG  . SER B 2 20  ? 66.273 24.118  -34.352 1.00 41.20  ? 20  SER L OG  1 
ATOM   1700 N N   . ILE B 2 21  ? 65.147 20.432  -31.817 1.00 22.73  ? 21  ILE L N   1 
ATOM   1701 C CA  . ILE B 2 21  ? 65.271 19.569  -30.645 1.00 22.73  ? 21  ILE L CA  1 
ATOM   1702 C C   . ILE B 2 21  ? 66.546 18.755  -30.796 1.00 22.66  ? 21  ILE L C   1 
ATOM   1703 O O   . ILE B 2 21  ? 66.724 18.028  -31.778 1.00 20.13  ? 21  ILE L O   1 
ATOM   1704 C CB  . ILE B 2 21  ? 64.058 18.632  -30.498 1.00 19.94  ? 21  ILE L CB  1 
ATOM   1705 C CG1 . ILE B 2 21  ? 62.790 19.484  -30.320 1.00 23.98  ? 21  ILE L CG1 1 
ATOM   1706 C CG2 . ILE B 2 21  ? 64.244 17.698  -29.286 1.00 21.04  ? 21  ILE L CG2 1 
ATOM   1707 C CD1 . ILE B 2 21  ? 61.520 18.689  -30.226 1.00 26.06  ? 21  ILE L CD1 1 
ATOM   1708 N N   . SER B 2 22  ? 67.439 18.885  -29.820 1.00 18.46  ? 22  SER L N   1 
ATOM   1709 C CA  . SER B 2 22  ? 68.707 18.177  -29.870 1.00 19.19  ? 22  SER L CA  1 
ATOM   1710 C C   . SER B 2 22  ? 68.694 16.851  -29.129 1.00 17.82  ? 22  SER L C   1 
ATOM   1711 O O   . SER B 2 22  ? 67.846 16.592  -28.278 1.00 21.90  ? 22  SER L O   1 
ATOM   1712 C CB  . SER B 2 22  ? 69.819 19.048  -29.283 1.00 29.22  ? 22  SER L CB  1 
ATOM   1713 O OG  . SER B 2 22  ? 69.763 19.037  -27.865 1.00 38.26  ? 22  SER L OG  1 
ATOM   1714 N N   . CYS B 2 23  ? 69.662 16.016  -29.468 1.00 17.58  ? 23  CYS L N   1 
ATOM   1715 C CA  . CYS B 2 23  ? 69.802 14.719  -28.844 1.00 20.73  ? 23  CYS L CA  1 
ATOM   1716 C C   . CYS B 2 23  ? 71.208 14.256  -29.135 1.00 19.94  ? 23  CYS L C   1 
ATOM   1717 O O   . CYS B 2 23  ? 71.783 14.585  -30.182 1.00 18.24  ? 23  CYS L O   1 
ATOM   1718 C CB  . CYS B 2 23  ? 68.799 13.732  -29.433 1.00 24.23  ? 23  CYS L CB  1 
ATOM   1719 S SG  . CYS B 2 23  ? 69.013 11.991  -28.926 1.00 25.36  ? 23  CYS L SG  1 
ATOM   1720 N N   . ARG B 2 24  ? 71.778 13.514  -28.200 1.00 16.55  ? 24  ARG L N   1 
ATOM   1721 C CA  . ARG B 2 24  ? 73.109 12.981  -28.391 1.00 22.19  ? 24  ARG L CA  1 
ATOM   1722 C C   . ARG B 2 24  ? 73.164 11.561  -27.849 1.00 21.48  ? 24  ARG L C   1 
ATOM   1723 O O   . ARG B 2 24  ? 72.406 11.187  -26.954 1.00 21.82  ? 24  ARG L O   1 
ATOM   1724 C CB  . ARG B 2 24  ? 74.174 13.868  -27.724 1.00 23.24  ? 24  ARG L CB  1 
ATOM   1725 C CG  . ARG B 2 24  ? 74.143 13.952  -26.215 1.00 26.80  ? 24  ARG L CG  1 
ATOM   1726 C CD  . ARG B 2 24  ? 75.459 14.569  -25.705 1.00 29.78  ? 24  ARG L CD  1 
ATOM   1727 N NE  . ARG B 2 24  ? 75.476 14.746  -24.252 1.00 30.57  ? 24  ARG L NE  1 
ATOM   1728 C CZ  . ARG B 2 24  ? 74.845 15.720  -23.605 1.00 36.99  ? 24  ARG L CZ  1 
ATOM   1729 N NH1 . ARG B 2 24  ? 74.142 16.624  -24.275 1.00 32.79  ? 24  ARG L NH1 1 
ATOM   1730 N NH2 . ARG B 2 24  ? 74.904 15.782  -22.281 1.00 36.66  ? 24  ARG L NH2 1 
ATOM   1731 N N   . SER B 2 25  ? 74.070 10.783  -28.421 1.00 19.17  ? 25  SER L N   1 
ATOM   1732 C CA  . SER B 2 25  ? 74.260 9.390   -28.058 1.00 25.00  ? 25  SER L CA  1 
ATOM   1733 C C   . SER B 2 25  ? 75.690 9.194   -27.532 1.00 26.09  ? 25  SER L C   1 
ATOM   1734 O O   . SER B 2 25  ? 76.594 9.936   -27.904 1.00 27.01  ? 25  SER L O   1 
ATOM   1735 C CB  . SER B 2 25  ? 74.035 8.554   -29.315 1.00 29.38  ? 25  SER L CB  1 
ATOM   1736 O OG  . SER B 2 25  ? 73.780 7.199   -29.024 1.00 42.47  ? 25  SER L OG  1 
ATOM   1737 N N   . THR B 2 26  ? 75.899 8.198   -26.674 1.00 29.01  ? 26  THR L N   1 
ATOM   1738 C CA  . THR B 2 26  ? 77.240 7.934   -26.138 1.00 27.86  ? 26  THR L CA  1 
ATOM   1739 C C   . THR B 2 26  ? 78.066 7.133   -27.137 1.00 31.15  ? 26  THR L C   1 
ATOM   1740 O O   . THR B 2 26  ? 79.269 6.966   -26.968 1.00 35.60  ? 26  THR L O   1 
ATOM   1741 C CB  . THR B 2 26  ? 77.181 7.139   -24.805 1.00 28.79  ? 26  THR L CB  1 
ATOM   1742 O OG1 . THR B 2 26  ? 76.322 5.999   -24.958 1.00 27.93  ? 26  THR L OG1 1 
ATOM   1743 C CG2 . THR B 2 26  ? 76.666 8.012   -23.684 1.00 22.29  ? 26  THR L CG2 1 
ATOM   1744 N N   . LYS B 2 27  ? 77.410 6.645   -28.187 1.00 33.15  ? 27  LYS L N   1 
ATOM   1745 C CA  . LYS B 2 27  ? 78.068 5.851   -29.215 1.00 29.12  ? 27  LYS L CA  1 
ATOM   1746 C C   . LYS B 2 27  ? 77.504 6.193   -30.592 1.00 30.22  ? 27  LYS L C   1 
ATOM   1747 O O   . LYS B 2 27  ? 76.309 6.444   -30.735 1.00 29.90  ? 27  LYS L O   1 
ATOM   1748 C CB  . LYS B 2 27  ? 77.857 4.360   -28.935 1.00 32.34  ? 27  LYS L CB  1 
ATOM   1749 C CG  . LYS B 2 27  ? 78.475 3.434   -29.975 1.00 31.24  ? 27  LYS L CG  1 
ATOM   1750 C CD  . LYS B 2 27  ? 78.189 1.972   -29.663 1.00 35.02  ? 27  LYS L CD  1 
ATOM   1751 C CE  . LYS B 2 27  ? 78.812 1.060   -30.706 1.00 37.15  ? 27  LYS L CE  1 
ATOM   1752 N NZ  . LYS B 2 27  ? 78.634 -0.381  -30.378 1.00 42.93  ? 27  LYS L NZ  1 
ATOM   1753 N N   . SER B 2 28  ? 78.354 6.196   -31.611 1.00 28.67  ? 28  SER L N   1 
ATOM   1754 C CA  . SER B 2 28  ? 77.880 6.515   -32.951 1.00 31.49  ? 28  SER L CA  1 
ATOM   1755 C C   . SER B 2 28  ? 76.796 5.535   -33.370 1.00 33.11  ? 28  SER L C   1 
ATOM   1756 O O   . SER B 2 28  ? 76.903 4.331   -33.124 1.00 25.93  ? 28  SER L O   1 
ATOM   1757 C CB  . SER B 2 28  ? 79.014 6.457   -33.967 1.00 33.67  ? 28  SER L CB  1 
ATOM   1758 O OG  . SER B 2 28  ? 78.498 6.641   -35.277 1.00 25.65  ? 28  SER L OG  1 
ATOM   1759 N N   . LEU B 2 29  ? 75.757 6.054   -34.011 1.00 28.01  ? 29  LEU L N   1 
ATOM   1760 C CA  . LEU B 2 29  ? 74.651 5.230   -34.473 1.00 25.12  ? 29  LEU L CA  1 
ATOM   1761 C C   . LEU B 2 29  ? 74.840 4.885   -35.951 1.00 29.13  ? 29  LEU L C   1 
ATOM   1762 O O   . LEU B 2 29  ? 73.988 4.233   -36.569 1.00 27.03  ? 29  LEU L O   1 
ATOM   1763 C CB  . LEU B 2 29  ? 73.330 5.976   -34.242 1.00 28.42  ? 29  LEU L CB  1 
ATOM   1764 C CG  . LEU B 2 29  ? 72.561 5.735   -32.926 1.00 30.88  ? 29  LEU L CG  1 
ATOM   1765 C CD1 . LEU B 2 29  ? 73.500 5.401   -31.780 1.00 27.81  ? 29  LEU L CD1 1 
ATOM   1766 C CD2 . LEU B 2 29  ? 71.704 6.947   -32.608 1.00 26.30  ? 29  LEU L CD2 1 
ATOM   1767 N N   . LEU B 2 30  ? 75.961 5.332   -36.514 1.00 28.58  ? 30  LEU L N   1 
ATOM   1768 C CA  . LEU B 2 30  ? 76.280 5.077   -37.914 1.00 30.58  ? 30  LEU L CA  1 
ATOM   1769 C C   . LEU B 2 30  ? 76.739 3.639   -38.048 1.00 30.24  ? 30  LEU L C   1 
ATOM   1770 O O   . LEU B 2 30  ? 77.763 3.255   -37.488 1.00 32.18  ? 30  LEU L O   1 
ATOM   1771 C CB  . LEU B 2 30  ? 77.391 6.017   -38.411 1.00 29.85  ? 30  LEU L CB  1 
ATOM   1772 C CG  . LEU B 2 30  ? 78.021 5.624   -39.756 1.00 33.52  ? 30  LEU L CG  1 
ATOM   1773 C CD1 . LEU B 2 30  ? 76.945 5.565   -40.835 1.00 32.61  ? 30  LEU L CD1 1 
ATOM   1774 C CD2 . LEU B 2 30  ? 79.101 6.631   -40.141 1.00 30.25  ? 30  LEU L CD2 1 
ATOM   1775 N N   . HIS B 2 31  ? 75.977 2.850   -38.796 1.00 26.65  ? 31  HIS L N   1 
ATOM   1776 C CA  . HIS B 2 31  ? 76.297 1.442   -38.999 1.00 28.96  ? 31  HIS L CA  1 
ATOM   1777 C C   . HIS B 2 31  ? 77.240 1.255   -40.182 1.00 29.34  ? 31  HIS L C   1 
ATOM   1778 O O   . HIS B 2 31  ? 77.405 2.152   -41.011 1.00 29.93  ? 31  HIS L O   1 
ATOM   1779 C CB  . HIS B 2 31  ? 75.005 0.650   -39.223 1.00 31.07  ? 31  HIS L CB  1 
ATOM   1780 C CG  . HIS B 2 31  ? 75.203 -0.832  -39.309 1.00 33.67  ? 31  HIS L CG  1 
ATOM   1781 N ND1 . HIS B 2 31  ? 75.784 -1.447  -40.399 1.00 43.69  ? 31  HIS L ND1 1 
ATOM   1782 C CD2 . HIS B 2 31  ? 74.887 -1.822  -38.443 1.00 35.51  ? 31  HIS L CD2 1 
ATOM   1783 C CE1 . HIS B 2 31  ? 75.815 -2.753  -40.199 1.00 37.35  ? 31  HIS L CE1 1 
ATOM   1784 N NE2 . HIS B 2 31  ? 75.276 -3.006  -39.020 1.00 35.08  ? 31  HIS L NE2 1 
ATOM   1785 N N   . SER B 2 32  ? 77.861 0.084   -40.249 1.00 27.51  ? 32  SER L N   1 
ATOM   1786 C CA  . SER B 2 32  ? 78.794 -0.234  -41.328 1.00 29.28  ? 32  SER L CA  1 
ATOM   1787 C C   . SER B 2 32  ? 78.114 -0.199  -42.701 1.00 28.24  ? 32  SER L C   1 
ATOM   1788 O O   . SER B 2 32  ? 78.763 0.021   -43.722 1.00 29.76  ? 32  SER L O   1 
ATOM   1789 C CB  . SER B 2 32  ? 79.400 -1.612  -41.095 1.00 31.02  ? 32  SER L CB  1 
ATOM   1790 O OG  . SER B 2 32  ? 80.386 -1.878  -42.073 1.00 47.64  ? 32  SER L OG  1 
ATOM   1791 N N   . ASN B 2 33  ? 76.803 -0.417  -42.731 1.00 29.87  ? 33  ASN L N   1 
ATOM   1792 C CA  . ASN B 2 33  ? 76.082 -0.389  -43.999 1.00 28.82  ? 33  ASN L CA  1 
ATOM   1793 C C   . ASN B 2 33  ? 75.762 1.027   -44.478 1.00 27.76  ? 33  ASN L C   1 
ATOM   1794 O O   . ASN B 2 33  ? 75.086 1.202   -45.490 1.00 26.20  ? 33  ASN L O   1 
ATOM   1795 C CB  . ASN B 2 33  ? 74.784 -1.193  -43.908 1.00 32.36  ? 33  ASN L CB  1 
ATOM   1796 C CG  . ASN B 2 33  ? 73.834 -0.669  -42.834 1.00 33.63  ? 33  ASN L CG  1 
ATOM   1797 O OD1 . ASN B 2 33  ? 73.979 0.454   -42.346 1.00 29.99  ? 33  ASN L OD1 1 
ATOM   1798 N ND2 . ASN B 2 33  ? 72.848 -1.483  -42.473 1.00 26.26  ? 33  ASN L ND2 1 
ATOM   1799 N N   . GLY B 2 34  ? 76.237 2.031   -43.748 1.00 23.08  ? 34  GLY L N   1 
ATOM   1800 C CA  . GLY B 2 34  ? 75.987 3.407   -44.151 1.00 25.67  ? 34  GLY L CA  1 
ATOM   1801 C C   . GLY B 2 34  ? 74.702 4.014   -43.613 1.00 23.56  ? 34  GLY L C   1 
ATOM   1802 O O   . GLY B 2 34  ? 74.410 5.185   -43.852 1.00 25.62  ? 34  GLY L O   1 
ATOM   1803 N N   . ILE B 2 35  ? 73.921 3.218   -42.895 1.00 22.88  ? 35  ILE L N   1 
ATOM   1804 C CA  . ILE B 2 35  ? 72.673 3.712   -42.321 1.00 25.20  ? 35  ILE L CA  1 
ATOM   1805 C C   . ILE B 2 35  ? 72.906 4.089   -40.862 1.00 19.17  ? 35  ILE L C   1 
ATOM   1806 O O   . ILE B 2 35  ? 73.661 3.417   -40.165 1.00 21.38  ? 35  ILE L O   1 
ATOM   1807 C CB  . ILE B 2 35  ? 71.579 2.634   -42.414 1.00 24.36  ? 35  ILE L CB  1 
ATOM   1808 C CG1 . ILE B 2 35  ? 71.299 2.328   -43.888 1.00 29.35  ? 35  ILE L CG1 1 
ATOM   1809 C CG2 . ILE B 2 35  ? 70.313 3.092   -41.703 1.00 19.74  ? 35  ILE L CG2 1 
ATOM   1810 C CD1 . ILE B 2 35  ? 70.270 1.227   -44.108 1.00 30.21  ? 35  ILE L CD1 1 
ATOM   1811 N N   . THR B 2 36  ? 72.283 5.180   -40.417 1.00 22.76  ? 36  THR L N   1 
ATOM   1812 C CA  . THR B 2 36  ? 72.407 5.648   -39.031 1.00 18.46  ? 36  THR L CA  1 
ATOM   1813 C C   . THR B 2 36  ? 71.104 5.298   -38.325 1.00 21.26  ? 36  THR L C   1 
ATOM   1814 O O   . THR B 2 36  ? 70.036 5.831   -38.644 1.00 20.71  ? 36  THR L O   1 
ATOM   1815 C CB  . THR B 2 36  ? 72.662 7.163   -38.984 1.00 23.05  ? 36  THR L CB  1 
ATOM   1816 O OG1 . THR B 2 36  ? 73.919 7.431   -39.613 1.00 20.61  ? 36  THR L OG1 1 
ATOM   1817 C CG2 . THR B 2 36  ? 72.713 7.667   -37.532 1.00 21.04  ? 36  THR L CG2 1 
ATOM   1818 N N   . TYR B 2 37  ? 71.201 4.393   -37.361 1.00 19.53  ? 37  TYR L N   1 
ATOM   1819 C CA  . TYR B 2 37  ? 70.027 3.902   -36.671 1.00 17.45  ? 37  TYR L CA  1 
ATOM   1820 C C   . TYR B 2 37  ? 69.485 4.733   -35.518 1.00 22.71  ? 37  TYR L C   1 
ATOM   1821 O O   . TYR B 2 37  ? 69.502 4.334   -34.349 1.00 17.00  ? 37  TYR L O   1 
ATOM   1822 C CB  . TYR B 2 37  ? 70.267 2.445   -36.268 1.00 20.10  ? 37  TYR L CB  1 
ATOM   1823 C CG  . TYR B 2 37  ? 70.307 1.555   -37.488 1.00 22.63  ? 37  TYR L CG  1 
ATOM   1824 C CD1 . TYR B 2 37  ? 71.503 1.316   -38.169 1.00 22.87  ? 37  TYR L CD1 1 
ATOM   1825 C CD2 . TYR B 2 37  ? 69.131 1.030   -38.023 1.00 22.27  ? 37  TYR L CD2 1 
ATOM   1826 C CE1 . TYR B 2 37  ? 71.525 0.582   -39.352 1.00 26.08  ? 37  TYR L CE1 1 
ATOM   1827 C CE2 . TYR B 2 37  ? 69.140 0.294   -39.210 1.00 25.50  ? 37  TYR L CE2 1 
ATOM   1828 C CZ  . TYR B 2 37  ? 70.338 0.076   -39.868 1.00 29.36  ? 37  TYR L CZ  1 
ATOM   1829 O OH  . TYR B 2 37  ? 70.344 -0.636  -41.046 1.00 26.23  ? 37  TYR L OH  1 
ATOM   1830 N N   . LEU B 2 38  ? 68.978 5.902   -35.897 1.00 19.53  ? 38  LEU L N   1 
ATOM   1831 C CA  . LEU B 2 38  ? 68.381 6.855   -34.982 1.00 16.87  ? 38  LEU L CA  1 
ATOM   1832 C C   . LEU B 2 38  ? 66.936 7.041   -35.405 1.00 18.37  ? 38  LEU L C   1 
ATOM   1833 O O   . LEU B 2 38  ? 66.661 7.186   -36.596 1.00 20.57  ? 38  LEU L O   1 
ATOM   1834 C CB  . LEU B 2 38  ? 69.071 8.211   -35.105 1.00 19.11  ? 38  LEU L CB  1 
ATOM   1835 C CG  . LEU B 2 38  ? 68.293 9.348   -34.434 1.00 20.91  ? 38  LEU L CG  1 
ATOM   1836 C CD1 . LEU B 2 38  ? 68.579 9.304   -32.930 1.00 24.96  ? 38  LEU L CD1 1 
ATOM   1837 C CD2 . LEU B 2 38  ? 68.704 10.692  -35.013 1.00 26.92  ? 38  LEU L CD2 1 
ATOM   1838 N N   . TYR B 2 39  ? 66.006 7.030   -34.460 1.00 14.49  ? 39  TYR L N   1 
ATOM   1839 C CA  . TYR B 2 39  ? 64.620 7.290   -34.827 1.00 14.53  ? 39  TYR L CA  1 
ATOM   1840 C C   . TYR B 2 39  ? 64.034 8.273   -33.825 1.00 20.49  ? 39  TYR L C   1 
ATOM   1841 O O   . TYR B 2 39  ? 64.553 8.425   -32.723 1.00 13.77  ? 39  TYR L O   1 
ATOM   1842 C CB  . TYR B 2 39  ? 63.788 5.991   -34.933 1.00 16.64  ? 39  TYR L CB  1 
ATOM   1843 C CG  . TYR B 2 39  ? 63.550 5.212   -33.657 1.00 16.71  ? 39  TYR L CG  1 
ATOM   1844 C CD1 . TYR B 2 39  ? 62.366 5.355   -32.956 1.00 14.71  ? 39  TYR L CD1 1 
ATOM   1845 C CD2 . TYR B 2 39  ? 64.507 4.312   -33.167 1.00 16.07  ? 39  TYR L CD2 1 
ATOM   1846 C CE1 . TYR B 2 39  ? 62.123 4.629   -31.789 1.00 17.25  ? 39  TYR L CE1 1 
ATOM   1847 C CE2 . TYR B 2 39  ? 64.276 3.581   -31.998 1.00 19.09  ? 39  TYR L CE2 1 
ATOM   1848 C CZ  . TYR B 2 39  ? 63.086 3.746   -31.316 1.00 22.48  ? 39  TYR L CZ  1 
ATOM   1849 O OH  . TYR B 2 39  ? 62.847 3.064   -30.142 1.00 15.71  ? 39  TYR L OH  1 
ATOM   1850 N N   . TRP B 2 40  ? 62.990 8.979   -34.244 1.00 14.58  ? 40  TRP L N   1 
ATOM   1851 C CA  . TRP B 2 40  ? 62.324 9.964   -33.423 1.00 9.20   ? 40  TRP L CA  1 
ATOM   1852 C C   . TRP B 2 40  ? 60.854 9.617   -33.398 1.00 15.58  ? 40  TRP L C   1 
ATOM   1853 O O   . TRP B 2 40  ? 60.283 9.211   -34.424 1.00 14.62  ? 40  TRP L O   1 
ATOM   1854 C CB  . TRP B 2 40  ? 62.446 11.378  -34.029 1.00 12.05  ? 40  TRP L CB  1 
ATOM   1855 C CG  . TRP B 2 40  ? 63.807 11.991  -34.063 1.00 11.79  ? 40  TRP L CG  1 
ATOM   1856 C CD1 . TRP B 2 40  ? 64.743 11.884  -35.059 1.00 18.81  ? 40  TRP L CD1 1 
ATOM   1857 C CD2 . TRP B 2 40  ? 64.369 12.862  -33.079 1.00 13.69  ? 40  TRP L CD2 1 
ATOM   1858 N NE1 . TRP B 2 40  ? 65.847 12.646  -34.756 1.00 14.83  ? 40  TRP L NE1 1 
ATOM   1859 C CE2 . TRP B 2 40  ? 65.644 13.256  -33.546 1.00 16.89  ? 40  TRP L CE2 1 
ATOM   1860 C CE3 . TRP B 2 40  ? 63.917 13.356  -31.846 1.00 20.52  ? 40  TRP L CE3 1 
ATOM   1861 C CZ2 . TRP B 2 40  ? 66.477 14.125  -32.823 1.00 21.20  ? 40  TRP L CZ2 1 
ATOM   1862 C CZ3 . TRP B 2 40  ? 64.753 14.230  -31.122 1.00 18.29  ? 40  TRP L CZ3 1 
ATOM   1863 C CH2 . TRP B 2 40  ? 66.015 14.601  -31.621 1.00 18.84  ? 40  TRP L CH2 1 
ATOM   1864 N N   . TYR B 2 41  ? 60.238 9.771   -32.231 1.00 13.36  ? 41  TYR L N   1 
ATOM   1865 C CA  . TYR B 2 41  ? 58.808 9.544   -32.112 1.00 12.53  ? 41  TYR L CA  1 
ATOM   1866 C C   . TYR B 2 41  ? 58.187 10.614  -31.230 1.00 16.53  ? 41  TYR L C   1 
ATOM   1867 O O   . TYR B 2 41  ? 58.879 11.283  -30.456 1.00 18.60  ? 41  TYR L O   1 
ATOM   1868 C CB  . TYR B 2 41  ? 58.493 8.131   -31.613 1.00 16.40  ? 41  TYR L CB  1 
ATOM   1869 C CG  . TYR B 2 41  ? 58.993 7.791   -30.236 1.00 16.38  ? 41  TYR L CG  1 
ATOM   1870 C CD1 . TYR B 2 41  ? 58.221 8.051   -29.106 1.00 21.31  ? 41  TYR L CD1 1 
ATOM   1871 C CD2 . TYR B 2 41  ? 60.223 7.175   -30.069 1.00 21.22  ? 41  TYR L CD2 1 
ATOM   1872 C CE1 . TYR B 2 41  ? 58.676 7.685   -27.827 1.00 28.07  ? 41  TYR L CE1 1 
ATOM   1873 C CE2 . TYR B 2 41  ? 60.686 6.818   -28.817 1.00 22.68  ? 41  TYR L CE2 1 
ATOM   1874 C CZ  . TYR B 2 41  ? 59.913 7.069   -27.703 1.00 27.00  ? 41  TYR L CZ  1 
ATOM   1875 O OH  . TYR B 2 41  ? 60.396 6.685   -26.477 1.00 26.70  ? 41  TYR L OH  1 
ATOM   1876 N N   . LEU B 2 42  ? 56.880 10.793  -31.366 1.00 15.54  ? 42  LEU L N   1 
ATOM   1877 C CA  . LEU B 2 42  ? 56.162 11.822  -30.637 1.00 19.68  ? 42  LEU L CA  1 
ATOM   1878 C C   . LEU B 2 42  ? 55.059 11.271  -29.751 1.00 21.20  ? 42  LEU L C   1 
ATOM   1879 O O   . LEU B 2 42  ? 54.325 10.363  -30.139 1.00 22.04  ? 42  LEU L O   1 
ATOM   1880 C CB  . LEU B 2 42  ? 55.570 12.826  -31.633 1.00 20.13  ? 42  LEU L CB  1 
ATOM   1881 C CG  . LEU B 2 42  ? 54.490 13.808  -31.157 1.00 24.70  ? 42  LEU L CG  1 
ATOM   1882 C CD1 . LEU B 2 42  ? 55.062 14.744  -30.095 1.00 20.79  ? 42  LEU L CD1 1 
ATOM   1883 C CD2 . LEU B 2 42  ? 53.973 14.610  -32.361 1.00 20.54  ? 42  LEU L CD2 1 
ATOM   1884 N N   . GLN B 2 43  ? 54.951 11.831  -28.553 1.00 19.94  ? 43  GLN L N   1 
ATOM   1885 C CA  . GLN B 2 43  ? 53.921 11.413  -27.621 1.00 24.09  ? 43  GLN L CA  1 
ATOM   1886 C C   . GLN B 2 43  ? 53.086 12.621  -27.239 1.00 26.97  ? 43  GLN L C   1 
ATOM   1887 O O   . GLN B 2 43  ? 53.599 13.572  -26.650 1.00 26.36  ? 43  GLN L O   1 
ATOM   1888 C CB  . GLN B 2 43  ? 54.554 10.805  -26.370 1.00 30.23  ? 43  GLN L CB  1 
ATOM   1889 C CG  . GLN B 2 43  ? 53.541 10.406  -25.309 1.00 46.39  ? 43  GLN L CG  1 
ATOM   1890 C CD  . GLN B 2 43  ? 53.405 8.907   -25.171 1.00 48.43  ? 43  GLN L CD  1 
ATOM   1891 O OE1 . GLN B 2 43  ? 54.379 8.213   -24.875 1.00 52.27  ? 43  GLN L OE1 1 
ATOM   1892 N NE2 . GLN B 2 43  ? 52.196 8.396   -25.382 1.00 49.70  ? 43  GLN L NE2 1 
ATOM   1893 N N   . LYS B 2 44  ? 51.810 12.593  -27.611 1.00 34.17  ? 44  LYS L N   1 
ATOM   1894 C CA  . LYS B 2 44  ? 50.878 13.672  -27.293 1.00 38.84  ? 44  LYS L CA  1 
ATOM   1895 C C   . LYS B 2 44  ? 49.973 13.163  -26.177 1.00 42.86  ? 44  LYS L C   1 
ATOM   1896 O O   . LYS B 2 44  ? 49.702 11.965  -26.089 1.00 39.00  ? 44  LYS L O   1 
ATOM   1897 C CB  . LYS B 2 44  ? 50.027 14.040  -28.514 1.00 35.82  ? 44  LYS L CB  1 
ATOM   1898 C CG  . LYS B 2 44  ? 50.806 14.636  -29.674 1.00 37.78  ? 44  LYS L CG  1 
ATOM   1899 C CD  . LYS B 2 44  ? 49.879 15.040  -30.821 1.00 44.82  ? 44  LYS L CD  1 
ATOM   1900 C CE  . LYS B 2 44  ? 50.667 15.592  -32.001 1.00 47.35  ? 44  LYS L CE  1 
ATOM   1901 N NZ  . LYS B 2 44  ? 49.794 16.051  -33.122 1.00 50.76  ? 44  LYS L NZ  1 
ATOM   1902 N N   . PRO B 2 45  ? 49.489 14.065  -25.309 1.00 47.57  ? 45  PRO L N   1 
ATOM   1903 C CA  . PRO B 2 45  ? 48.616 13.630  -24.216 1.00 49.19  ? 45  PRO L CA  1 
ATOM   1904 C C   . PRO B 2 45  ? 47.403 12.842  -24.698 1.00 51.35  ? 45  PRO L C   1 
ATOM   1905 O O   . PRO B 2 45  ? 46.668 13.290  -25.584 1.00 48.46  ? 45  PRO L O   1 
ATOM   1906 C CB  . PRO B 2 45  ? 48.229 14.944  -23.542 1.00 53.01  ? 45  PRO L CB  1 
ATOM   1907 C CG  . PRO B 2 45  ? 48.247 15.919  -24.680 1.00 51.62  ? 45  PRO L CG  1 
ATOM   1908 C CD  . PRO B 2 45  ? 49.522 15.535  -25.397 1.00 50.85  ? 45  PRO L CD  1 
ATOM   1909 N N   . GLY B 2 46  ? 47.213 11.657  -24.124 1.00 51.43  ? 46  GLY L N   1 
ATOM   1910 C CA  . GLY B 2 46  ? 46.078 10.826  -24.486 1.00 54.06  ? 46  GLY L CA  1 
ATOM   1911 C C   . GLY B 2 46  ? 46.205 10.084  -25.802 1.00 55.23  ? 46  GLY L C   1 
ATOM   1912 O O   . GLY B 2 46  ? 45.207 9.634   -26.367 1.00 55.88  ? 46  GLY L O   1 
ATOM   1913 N N   . GLN B 2 47  ? 47.429 9.957   -26.299 1.00 53.82  ? 47  GLN L N   1 
ATOM   1914 C CA  . GLN B 2 47  ? 47.669 9.251   -27.551 1.00 49.98  ? 47  GLN L CA  1 
ATOM   1915 C C   . GLN B 2 47  ? 48.873 8.330   -27.432 1.00 44.76  ? 47  GLN L C   1 
ATOM   1916 O O   . GLN B 2 47  ? 49.752 8.550   -26.603 1.00 46.58  ? 47  GLN L O   1 
ATOM   1917 C CB  . GLN B 2 47  ? 47.906 10.241  -28.687 1.00 51.05  ? 47  GLN L CB  1 
ATOM   1918 C CG  . GLN B 2 47  ? 46.700 11.072  -29.054 1.00 59.90  ? 47  GLN L CG  1 
ATOM   1919 C CD  . GLN B 2 47  ? 46.845 11.704  -30.420 1.00 66.43  ? 47  GLN L CD  1 
ATOM   1920 O OE1 . GLN B 2 47  ? 47.755 12.498  -30.656 1.00 73.30  ? 47  GLN L OE1 1 
ATOM   1921 N NE2 . GLN B 2 47  ? 45.951 11.346  -31.335 1.00 73.08  ? 47  GLN L NE2 1 
ATOM   1922 N N   . SER B 2 48  ? 48.909 7.295   -28.262 1.00 41.96  ? 48  SER L N   1 
ATOM   1923 C CA  . SER B 2 48  ? 50.021 6.353   -28.244 1.00 38.61  ? 48  SER L CA  1 
ATOM   1924 C C   . SER B 2 48  ? 51.201 6.985   -28.969 1.00 31.34  ? 48  SER L C   1 
ATOM   1925 O O   . SER B 2 48  ? 51.020 7.899   -29.768 1.00 24.45  ? 48  SER L O   1 
ATOM   1926 C CB  . SER B 2 48  ? 49.624 5.048   -28.935 1.00 41.59  ? 48  SER L CB  1 
ATOM   1927 O OG  . SER B 2 48  ? 49.201 5.281   -30.262 1.00 44.11  ? 48  SER L OG  1 
ATOM   1928 N N   . PRO B 2 49  ? 52.427 6.516   -28.685 1.00 29.75  ? 49  PRO L N   1 
ATOM   1929 C CA  . PRO B 2 49  ? 53.613 7.072   -29.340 1.00 24.86  ? 49  PRO L CA  1 
ATOM   1930 C C   . PRO B 2 49  ? 53.481 6.984   -30.856 1.00 22.61  ? 49  PRO L C   1 
ATOM   1931 O O   . PRO B 2 49  ? 52.981 5.990   -31.381 1.00 20.40  ? 49  PRO L O   1 
ATOM   1932 C CB  . PRO B 2 49  ? 54.746 6.198   -28.806 1.00 26.02  ? 49  PRO L CB  1 
ATOM   1933 C CG  . PRO B 2 49  ? 54.266 5.842   -27.429 1.00 29.34  ? 49  PRO L CG  1 
ATOM   1934 C CD  . PRO B 2 49  ? 52.808 5.504   -27.683 1.00 26.28  ? 49  PRO L CD  1 
ATOM   1935 N N   . GLN B 2 50  ? 53.936 8.020   -31.550 1.00 22.03  ? 50  GLN L N   1 
ATOM   1936 C CA  . GLN B 2 50  ? 53.840 8.067   -33.006 1.00 22.80  ? 50  GLN L CA  1 
ATOM   1937 C C   . GLN B 2 50  ? 55.217 8.229   -33.619 1.00 16.11  ? 50  GLN L C   1 
ATOM   1938 O O   . GLN B 2 50  ? 55.930 9.178   -33.303 1.00 17.63  ? 50  GLN L O   1 
ATOM   1939 C CB  . GLN B 2 50  ? 52.959 9.252   -33.434 1.00 24.81  ? 50  GLN L CB  1 
ATOM   1940 C CG  . GLN B 2 50  ? 52.688 9.331   -34.930 1.00 33.94  ? 50  GLN L CG  1 
ATOM   1941 C CD  . GLN B 2 50  ? 52.441 10.757  -35.410 1.00 41.46  ? 50  GLN L CD  1 
ATOM   1942 O OE1 . GLN B 2 50  ? 51.796 11.557  -34.729 1.00 39.89  ? 50  GLN L OE1 1 
ATOM   1943 N NE2 . GLN B 2 50  ? 52.952 11.076  -36.596 1.00 45.56  ? 50  GLN L NE2 1 
ATOM   1944 N N   . LEU B 2 51  ? 55.590 7.317   -34.509 1.00 14.81  ? 51  LEU L N   1 
ATOM   1945 C CA  . LEU B 2 51  ? 56.894 7.403   -35.159 1.00 12.26  ? 51  LEU L CA  1 
ATOM   1946 C C   . LEU B 2 51  ? 56.917 8.605   -36.116 1.00 18.13  ? 51  LEU L C   1 
ATOM   1947 O O   . LEU B 2 51  ? 55.964 8.831   -36.860 1.00 17.38  ? 51  LEU L O   1 
ATOM   1948 C CB  . LEU B 2 51  ? 57.176 6.120   -35.949 1.00 17.25  ? 51  LEU L CB  1 
ATOM   1949 C CG  . LEU B 2 51  ? 58.537 6.057   -36.652 1.00 17.91  ? 51  LEU L CG  1 
ATOM   1950 C CD1 . LEU B 2 51  ? 59.647 5.994   -35.602 1.00 18.83  ? 51  LEU L CD1 1 
ATOM   1951 C CD2 . LEU B 2 51  ? 58.590 4.842   -37.566 1.00 16.75  ? 51  LEU L CD2 1 
ATOM   1952 N N   . LEU B 2 52  ? 58.009 9.366   -36.093 1.00 15.18  ? 52  LEU L N   1 
ATOM   1953 C CA  . LEU B 2 52  ? 58.152 10.540  -36.950 1.00 19.13  ? 52  LEU L CA  1 
ATOM   1954 C C   . LEU B 2 52  ? 59.200 10.336  -38.023 1.00 18.20  ? 52  LEU L C   1 
ATOM   1955 O O   . LEU B 2 52  ? 58.963 10.567  -39.213 1.00 20.88  ? 52  LEU L O   1 
ATOM   1956 C CB  . LEU B 2 52  ? 58.569 11.757  -36.137 1.00 20.40  ? 52  LEU L CB  1 
ATOM   1957 C CG  . LEU B 2 52  ? 57.595 12.372  -35.140 1.00 25.82  ? 52  LEU L CG  1 
ATOM   1958 C CD1 . LEU B 2 52  ? 58.307 13.520  -34.429 1.00 18.45  ? 52  LEU L CD1 1 
ATOM   1959 C CD2 . LEU B 2 52  ? 56.350 12.867  -35.859 1.00 24.30  ? 52  LEU L CD2 1 
ATOM   1960 N N   . ILE B 2 53  ? 60.375 9.916   -37.585 1.00 14.01  ? 53  ILE L N   1 
ATOM   1961 C CA  . ILE B 2 53  ? 61.495 9.704   -38.479 1.00 14.19  ? 53  ILE L CA  1 
ATOM   1962 C C   . ILE B 2 53  ? 62.252 8.449   -38.057 1.00 21.43  ? 53  ILE L C   1 
ATOM   1963 O O   . ILE B 2 53  ? 62.318 8.141   -36.864 1.00 16.05  ? 53  ILE L O   1 
ATOM   1964 C CB  . ILE B 2 53  ? 62.432 10.932  -38.423 1.00 14.00  ? 53  ILE L CB  1 
ATOM   1965 C CG1 . ILE B 2 53  ? 61.745 12.125  -39.098 1.00 23.11  ? 53  ILE L CG1 1 
ATOM   1966 C CG2 . ILE B 2 53  ? 63.780 10.617  -39.069 1.00 17.07  ? 53  ILE L CG2 1 
ATOM   1967 C CD1 . ILE B 2 53  ? 62.495 13.416  -38.995 1.00 26.23  ? 53  ILE L CD1 1 
ATOM   1968 N N   . TYR B 2 54  ? 62.791 7.715   -39.031 1.00 17.93  ? 54  TYR L N   1 
ATOM   1969 C CA  . TYR B 2 54  ? 63.565 6.515   -38.730 1.00 18.99  ? 54  TYR L CA  1 
ATOM   1970 C C   . TYR B 2 54  ? 64.814 6.481   -39.615 1.00 18.69  ? 54  TYR L C   1 
ATOM   1971 O O   . TYR B 2 54  ? 64.895 7.178   -40.639 1.00 15.33  ? 54  TYR L O   1 
ATOM   1972 C CB  . TYR B 2 54  ? 62.719 5.240   -38.912 1.00 13.39  ? 54  TYR L CB  1 
ATOM   1973 C CG  . TYR B 2 54  ? 62.349 4.943   -40.343 1.00 18.70  ? 54  TYR L CG  1 
ATOM   1974 C CD1 . TYR B 2 54  ? 61.281 5.602   -40.952 1.00 21.99  ? 54  TYR L CD1 1 
ATOM   1975 C CD2 . TYR B 2 54  ? 63.081 4.024   -41.099 1.00 17.04  ? 54  TYR L CD2 1 
ATOM   1976 C CE1 . TYR B 2 54  ? 60.947 5.355   -42.290 1.00 23.69  ? 54  TYR L CE1 1 
ATOM   1977 C CE2 . TYR B 2 54  ? 62.756 3.769   -42.441 1.00 19.30  ? 54  TYR L CE2 1 
ATOM   1978 C CZ  . TYR B 2 54  ? 61.689 4.441   -43.024 1.00 19.89  ? 54  TYR L CZ  1 
ATOM   1979 O OH  . TYR B 2 54  ? 61.367 4.213   -44.339 1.00 25.60  ? 54  TYR L OH  1 
ATOM   1980 N N   . GLN B 2 55  ? 65.792 5.683   -39.204 1.00 13.69  ? 55  GLN L N   1 
ATOM   1981 C CA  . GLN B 2 55  ? 67.053 5.584   -39.918 1.00 17.04  ? 55  GLN L CA  1 
ATOM   1982 C C   . GLN B 2 55  ? 67.570 6.996   -40.181 1.00 19.31  ? 55  GLN L C   1 
ATOM   1983 O O   . GLN B 2 55  ? 68.038 7.332   -41.267 1.00 17.39  ? 55  GLN L O   1 
ATOM   1984 C CB  . GLN B 2 55  ? 66.902 4.750   -41.205 1.00 13.82  ? 55  GLN L CB  1 
ATOM   1985 C CG  . GLN B 2 55  ? 66.592 3.275   -40.880 1.00 14.89  ? 55  GLN L CG  1 
ATOM   1986 C CD  . GLN B 2 55  ? 66.494 2.359   -42.094 1.00 22.44  ? 55  GLN L CD  1 
ATOM   1987 O OE1 . GLN B 2 55  ? 66.170 1.181   -41.956 1.00 22.01  ? 55  GLN L OE1 1 
ATOM   1988 N NE2 . GLN B 2 55  ? 66.779 2.889   -43.278 1.00 21.09  ? 55  GLN L NE2 1 
ATOM   1989 N N   . MET B 2 56  ? 67.451 7.824   -39.146 1.00 17.61  ? 56  MET L N   1 
ATOM   1990 C CA  . MET B 2 56  ? 67.947 9.198   -39.164 1.00 25.81  ? 56  MET L CA  1 
ATOM   1991 C C   . MET B 2 56  ? 67.247 10.251  -40.019 1.00 25.57  ? 56  MET L C   1 
ATOM   1992 O O   . MET B 2 56  ? 66.954 11.344  -39.531 1.00 30.76  ? 56  MET L O   1 
ATOM   1993 C CB  . MET B 2 56  ? 69.437 9.186   -39.530 1.00 30.92  ? 56  MET L CB  1 
ATOM   1994 C CG  . MET B 2 56  ? 70.006 10.540  -39.932 1.00 44.03  ? 56  MET L CG  1 
ATOM   1995 S SD  . MET B 2 56  ? 70.186 11.654  -38.538 1.00 57.53  ? 56  MET L SD  1 
ATOM   1996 C CE  . MET B 2 56  ? 71.932 11.393  -38.159 1.00 52.00  ? 56  MET L CE  1 
ATOM   1997 N N   . SER B 2 57  ? 66.987 9.946   -41.283 1.00 29.09  ? 57  SER L N   1 
ATOM   1998 C CA  . SER B 2 57  ? 66.384 10.944  -42.158 1.00 32.74  ? 57  SER L CA  1 
ATOM   1999 C C   . SER B 2 57  ? 65.140 10.533  -42.928 1.00 30.38  ? 57  SER L C   1 
ATOM   2000 O O   . SER B 2 57  ? 64.646 11.306  -43.746 1.00 38.31  ? 57  SER L O   1 
ATOM   2001 C CB  . SER B 2 57  ? 67.435 11.433  -43.155 1.00 34.34  ? 57  SER L CB  1 
ATOM   2002 O OG  . SER B 2 57  ? 67.863 10.367  -43.988 1.00 37.94  ? 57  SER L OG  1 
ATOM   2003 N N   . ASN B 2 58  ? 64.628 9.334   -42.685 1.00 23.98  ? 58  ASN L N   1 
ATOM   2004 C CA  . ASN B 2 58  ? 63.441 8.887   -43.400 1.00 20.66  ? 58  ASN L CA  1 
ATOM   2005 C C   . ASN B 2 58  ? 62.162 9.226   -42.659 1.00 23.36  ? 58  ASN L C   1 
ATOM   2006 O O   . ASN B 2 58  ? 61.997 8.882   -41.493 1.00 16.83  ? 58  ASN L O   1 
ATOM   2007 C CB  . ASN B 2 58  ? 63.499 7.380   -43.637 1.00 23.80  ? 58  ASN L CB  1 
ATOM   2008 C CG  . ASN B 2 58  ? 64.721 6.970   -44.425 1.00 30.64  ? 58  ASN L CG  1 
ATOM   2009 O OD1 . ASN B 2 58  ? 64.702 6.953   -45.654 1.00 31.06  ? 58  ASN L OD1 1 
ATOM   2010 N ND2 . ASN B 2 58  ? 65.803 6.656   -43.717 1.00 29.29  ? 58  ASN L ND2 1 
ATOM   2011 N N   . LEU B 2 59  ? 61.248 9.899   -43.343 1.00 22.70  ? 59  LEU L N   1 
ATOM   2012 C CA  . LEU B 2 59  ? 59.971 10.252  -42.743 1.00 18.61  ? 59  LEU L CA  1 
ATOM   2013 C C   . LEU B 2 59  ? 59.091 9.013   -42.632 1.00 22.89  ? 59  LEU L C   1 
ATOM   2014 O O   . LEU B 2 59  ? 59.047 8.189   -43.553 1.00 20.64  ? 59  LEU L O   1 
ATOM   2015 C CB  . LEU B 2 59  ? 59.265 11.303  -43.605 1.00 22.16  ? 59  LEU L CB  1 
ATOM   2016 C CG  . LEU B 2 59  ? 59.881 12.702  -43.560 1.00 22.98  ? 59  LEU L CG  1 
ATOM   2017 C CD1 . LEU B 2 59  ? 59.250 13.610  -44.627 1.00 26.82  ? 59  LEU L CD1 1 
ATOM   2018 C CD2 . LEU B 2 59  ? 59.647 13.272  -42.168 1.00 25.41  ? 59  LEU L CD2 1 
ATOM   2019 N N   . ALA B 2 60  ? 58.391 8.882   -41.506 1.00 18.23  ? 60  ALA L N   1 
ATOM   2020 C CA  . ALA B 2 60  ? 57.494 7.752   -41.296 1.00 21.61  ? 60  ALA L CA  1 
ATOM   2021 C C   . ALA B 2 60  ? 56.194 8.058   -42.034 1.00 31.44  ? 60  ALA L C   1 
ATOM   2022 O O   . ALA B 2 60  ? 56.040 9.145   -42.600 1.00 28.83  ? 60  ALA L O   1 
ATOM   2023 C CB  . ALA B 2 60  ? 57.218 7.566   -39.819 1.00 24.86  ? 60  ALA L CB  1 
ATOM   2024 N N   . SER B 2 61  ? 55.254 7.118   -42.008 1.00 33.72  ? 61  SER L N   1 
ATOM   2025 C CA  . SER B 2 61  ? 53.980 7.294   -42.697 1.00 36.59  ? 61  SER L CA  1 
ATOM   2026 C C   . SER B 2 61  ? 53.119 8.418   -42.125 1.00 38.24  ? 61  SER L C   1 
ATOM   2027 O O   . SER B 2 61  ? 52.953 8.550   -40.902 1.00 34.07  ? 61  SER L O   1 
ATOM   2028 C CB  . SER B 2 61  ? 53.180 5.986   -42.679 1.00 42.41  ? 61  SER L CB  1 
ATOM   2029 O OG  . SER B 2 61  ? 52.818 5.622   -41.358 1.00 47.44  ? 61  SER L OG  1 
ATOM   2030 N N   . GLY B 2 62  ? 52.574 9.227   -43.027 1.00 34.44  ? 62  GLY L N   1 
ATOM   2031 C CA  . GLY B 2 62  ? 51.713 10.320  -42.625 1.00 31.60  ? 62  GLY L CA  1 
ATOM   2032 C C   . GLY B 2 62  ? 52.407 11.524  -42.025 1.00 29.63  ? 62  GLY L C   1 
ATOM   2033 O O   . GLY B 2 62  ? 51.737 12.461  -41.599 1.00 34.01  ? 62  GLY L O   1 
ATOM   2034 N N   . VAL B 2 63  ? 53.736 11.518  -41.983 1.00 23.78  ? 63  VAL L N   1 
ATOM   2035 C CA  . VAL B 2 63  ? 54.460 12.651  -41.411 1.00 21.57  ? 63  VAL L CA  1 
ATOM   2036 C C   . VAL B 2 63  ? 54.762 13.732  -42.452 1.00 17.09  ? 63  VAL L C   1 
ATOM   2037 O O   . VAL B 2 63  ? 55.433 13.476  -43.451 1.00 17.96  ? 63  VAL L O   1 
ATOM   2038 C CB  . VAL B 2 63  ? 55.777 12.188  -40.757 1.00 17.67  ? 63  VAL L CB  1 
ATOM   2039 C CG1 . VAL B 2 63  ? 56.465 13.357  -40.101 1.00 19.30  ? 63  VAL L CG1 1 
ATOM   2040 C CG2 . VAL B 2 63  ? 55.477 11.097  -39.724 1.00 13.40  ? 63  VAL L CG2 1 
ATOM   2041 N N   . PRO B 2 64  ? 54.278 14.962  -42.221 1.00 17.56  ? 64  PRO L N   1 
ATOM   2042 C CA  . PRO B 2 64  ? 54.520 16.060  -43.172 1.00 21.12  ? 64  PRO L CA  1 
ATOM   2043 C C   . PRO B 2 64  ? 56.002 16.427  -43.284 1.00 25.63  ? 64  PRO L C   1 
ATOM   2044 O O   . PRO B 2 64  ? 56.763 16.294  -42.310 1.00 19.33  ? 64  PRO L O   1 
ATOM   2045 C CB  . PRO B 2 64  ? 53.649 17.193  -42.627 1.00 21.69  ? 64  PRO L CB  1 
ATOM   2046 C CG  . PRO B 2 64  ? 53.591 16.899  -41.129 1.00 27.30  ? 64  PRO L CG  1 
ATOM   2047 C CD  . PRO B 2 64  ? 53.438 15.397  -41.089 1.00 17.10  ? 64  PRO L CD  1 
ATOM   2048 N N   . ASN B 2 65  ? 56.424 16.898  -44.459 1.00 21.03  ? 65  ASN L N   1 
ATOM   2049 C CA  . ASN B 2 65  ? 57.832 17.226  -44.636 1.00 18.78  ? 65  ASN L CA  1 
ATOM   2050 C C   . ASN B 2 65  ? 58.321 18.444  -43.862 1.00 18.48  ? 65  ASN L C   1 
ATOM   2051 O O   . ASN B 2 65  ? 59.425 18.924  -44.090 1.00 19.52  ? 65  ASN L O   1 
ATOM   2052 C CB  . ASN B 2 65  ? 58.217 17.314  -46.132 1.00 16.83  ? 65  ASN L CB  1 
ATOM   2053 C CG  . ASN B 2 65  ? 57.480 18.418  -46.891 1.00 22.37  ? 65  ASN L CG  1 
ATOM   2054 O OD1 . ASN B 2 65  ? 57.548 18.479  -48.120 1.00 22.93  ? 65  ASN L OD1 1 
ATOM   2055 N ND2 . ASN B 2 65  ? 56.795 19.293  -46.173 1.00 18.43  ? 65  ASN L ND2 1 
ATOM   2056 N N   . ARG B 2 66  ? 57.496 18.933  -42.938 1.00 19.90  ? 66  ARG L N   1 
ATOM   2057 C CA  . ARG B 2 66  ? 57.902 20.033  -42.064 1.00 25.16  ? 66  ARG L CA  1 
ATOM   2058 C C   . ARG B 2 66  ? 58.921 19.455  -41.068 1.00 20.65  ? 66  ARG L C   1 
ATOM   2059 O O   . ARG B 2 66  ? 59.693 20.192  -40.440 1.00 21.03  ? 66  ARG L O   1 
ATOM   2060 C CB  . ARG B 2 66  ? 56.708 20.566  -41.261 1.00 26.87  ? 66  ARG L CB  1 
ATOM   2061 C CG  . ARG B 2 66  ? 55.634 21.240  -42.091 1.00 35.38  ? 66  ARG L CG  1 
ATOM   2062 C CD  . ARG B 2 66  ? 54.593 21.934  -41.213 1.00 29.68  ? 66  ARG L CD  1 
ATOM   2063 N NE  . ARG B 2 66  ? 53.764 21.005  -40.447 1.00 33.72  ? 66  ARG L NE  1 
ATOM   2064 C CZ  . ARG B 2 66  ? 53.847 20.831  -39.132 1.00 30.52  ? 66  ARG L CZ  1 
ATOM   2065 N NH1 . ARG B 2 66  ? 54.732 21.519  -38.424 1.00 29.67  ? 66  ARG L NH1 1 
ATOM   2066 N NH2 . ARG B 2 66  ? 53.028 19.982  -38.525 1.00 26.33  ? 66  ARG L NH2 1 
ATOM   2067 N N   . PHE B 2 67  ? 58.900 18.134  -40.918 1.00 21.54  ? 67  PHE L N   1 
ATOM   2068 C CA  . PHE B 2 67  ? 59.800 17.441  -39.992 1.00 17.67  ? 67  PHE L CA  1 
ATOM   2069 C C   . PHE B 2 67  ? 61.033 16.934  -40.717 1.00 22.61  ? 67  PHE L C   1 
ATOM   2070 O O   . PHE B 2 67  ? 60.919 16.385  -41.813 1.00 21.06  ? 67  PHE L O   1 
ATOM   2071 C CB  . PHE B 2 67  ? 59.080 16.244  -39.359 1.00 17.32  ? 67  PHE L CB  1 
ATOM   2072 C CG  . PHE B 2 67  ? 57.984 16.621  -38.411 1.00 20.59  ? 67  PHE L CG  1 
ATOM   2073 C CD1 . PHE B 2 67  ? 58.266 16.905  -37.076 1.00 17.62  ? 67  PHE L CD1 1 
ATOM   2074 C CD2 . PHE B 2 67  ? 56.668 16.732  -38.858 1.00 21.60  ? 67  PHE L CD2 1 
ATOM   2075 C CE1 . PHE B 2 67  ? 57.251 17.298  -36.197 1.00 16.63  ? 67  PHE L CE1 1 
ATOM   2076 C CE2 . PHE B 2 67  ? 55.645 17.126  -37.986 1.00 25.62  ? 67  PHE L CE2 1 
ATOM   2077 C CZ  . PHE B 2 67  ? 55.942 17.411  -36.650 1.00 21.56  ? 67  PHE L CZ  1 
ATOM   2078 N N   . SER B 2 68  ? 62.206 17.120  -40.112 1.00 20.08  ? 68  SER L N   1 
ATOM   2079 C CA  . SER B 2 68  ? 63.457 16.640  -40.693 1.00 19.42  ? 68  SER L CA  1 
ATOM   2080 C C   . SER B 2 68  ? 64.476 16.432  -39.580 1.00 18.94  ? 68  SER L C   1 
ATOM   2081 O O   . SER B 2 68  ? 64.363 17.021  -38.506 1.00 19.55  ? 68  SER L O   1 
ATOM   2082 C CB  . SER B 2 68  ? 64.013 17.634  -41.721 1.00 19.11  ? 68  SER L CB  1 
ATOM   2083 O OG  . SER B 2 68  ? 64.411 18.852  -41.110 1.00 20.84  ? 68  SER L OG  1 
ATOM   2084 N N   . SER B 2 69  ? 65.463 15.580  -39.827 1.00 16.19  ? 69  SER L N   1 
ATOM   2085 C CA  . SER B 2 69  ? 66.492 15.323  -38.824 1.00 19.47  ? 69  SER L CA  1 
ATOM   2086 C C   . SER B 2 69  ? 67.841 15.364  -39.498 1.00 22.48  ? 69  SER L C   1 
ATOM   2087 O O   . SER B 2 69  ? 67.978 14.920  -40.638 1.00 23.66  ? 69  SER L O   1 
ATOM   2088 C CB  . SER B 2 69  ? 66.274 13.954  -38.166 1.00 24.94  ? 69  SER L CB  1 
ATOM   2089 O OG  . SER B 2 69  ? 67.179 13.744  -37.087 1.00 26.17  ? 69  SER L OG  1 
ATOM   2090 N N   . SER B 2 70  ? 68.828 15.916  -38.803 1.00 23.35  ? 70  SER L N   1 
ATOM   2091 C CA  . SER B 2 70  ? 70.181 16.016  -39.344 1.00 27.15  ? 70  SER L CA  1 
ATOM   2092 C C   . SER B 2 70  ? 71.170 15.783  -38.214 1.00 26.09  ? 70  SER L C   1 
ATOM   2093 O O   . SER B 2 70  ? 70.798 15.807  -37.041 1.00 21.39  ? 70  SER L O   1 
ATOM   2094 C CB  . SER B 2 70  ? 70.419 17.407  -39.937 1.00 24.17  ? 70  SER L CB  1 
ATOM   2095 O OG  . SER B 2 70  ? 70.452 18.392  -38.913 1.00 37.73  ? 70  SER L OG  1 
ATOM   2096 N N   . GLY B 2 71  ? 72.430 15.570  -38.571 1.00 24.83  ? 71  GLY L N   1 
ATOM   2097 C CA  . GLY B 2 71  ? 73.442 15.359  -37.557 1.00 29.13  ? 71  GLY L CA  1 
ATOM   2098 C C   . GLY B 2 71  ? 74.464 14.331  -37.978 1.00 28.71  ? 71  GLY L C   1 
ATOM   2099 O O   . GLY B 2 71  ? 74.414 13.797  -39.089 1.00 28.15  ? 71  GLY L O   1 
ATOM   2100 N N   . SER B 2 72  ? 75.393 14.058  -37.072 1.00 26.78  ? 72  SER L N   1 
ATOM   2101 C CA  . SER B 2 72  ? 76.461 13.098  -37.298 1.00 24.26  ? 72  SER L CA  1 
ATOM   2102 C C   . SER B 2 72  ? 76.024 11.737  -36.763 1.00 28.12  ? 72  SER L C   1 
ATOM   2103 O O   . SER B 2 72  ? 74.844 11.405  -36.757 1.00 27.81  ? 72  SER L O   1 
ATOM   2104 C CB  . SER B 2 72  ? 77.711 13.547  -36.546 1.00 31.05  ? 72  SER L CB  1 
ATOM   2105 O OG  . SER B 2 72  ? 77.439 13.607  -35.147 1.00 19.34  ? 72  SER L OG  1 
ATOM   2106 N N   . GLY B 2 73  ? 76.995 10.957  -36.306 1.00 30.01  ? 73  GLY L N   1 
ATOM   2107 C CA  . GLY B 2 73  ? 76.687 9.655   -35.754 1.00 27.05  ? 73  GLY L CA  1 
ATOM   2108 C C   . GLY B 2 73  ? 76.354 9.727   -34.275 1.00 26.83  ? 73  GLY L C   1 
ATOM   2109 O O   . GLY B 2 73  ? 75.738 8.808   -33.750 1.00 22.41  ? 73  GLY L O   1 
ATOM   2110 N N   . THR B 2 74  ? 76.729 10.819  -33.608 1.00 20.49  ? 74  THR L N   1 
ATOM   2111 C CA  . THR B 2 74  ? 76.485 10.946  -32.168 1.00 21.59  ? 74  THR L CA  1 
ATOM   2112 C C   . THR B 2 74  ? 75.734 12.201  -31.727 1.00 21.25  ? 74  THR L C   1 
ATOM   2113 O O   . THR B 2 74  ? 75.318 12.297  -30.574 1.00 26.08  ? 74  THR L O   1 
ATOM   2114 C CB  . THR B 2 74  ? 77.818 10.931  -31.388 1.00 23.05  ? 74  THR L CB  1 
ATOM   2115 O OG1 . THR B 2 74  ? 78.586 12.076  -31.766 1.00 29.58  ? 74  THR L OG1 1 
ATOM   2116 C CG2 . THR B 2 74  ? 78.621 9.673   -31.706 1.00 25.82  ? 74  THR L CG2 1 
ATOM   2117 N N   . ASP B 2 75  ? 75.566 13.164  -32.627 1.00 18.82  ? 75  ASP L N   1 
ATOM   2118 C CA  . ASP B 2 75  ? 74.880 14.409  -32.281 1.00 19.86  ? 75  ASP L CA  1 
ATOM   2119 C C   . ASP B 2 75  ? 73.806 14.702  -33.317 1.00 19.40  ? 75  ASP L C   1 
ATOM   2120 O O   . ASP B 2 75  ? 74.101 14.844  -34.506 1.00 21.34  ? 75  ASP L O   1 
ATOM   2121 C CB  . ASP B 2 75  ? 75.899 15.540  -32.206 1.00 21.77  ? 75  ASP L CB  1 
ATOM   2122 C CG  . ASP B 2 75  ? 76.837 15.384  -31.017 1.00 26.57  ? 75  ASP L CG  1 
ATOM   2123 O OD1 . ASP B 2 75  ? 76.474 15.825  -29.906 1.00 22.19  ? 75  ASP L OD1 1 
ATOM   2124 O OD2 . ASP B 2 75  ? 77.920 14.789  -31.187 1.00 27.82  ? 75  ASP L OD2 1 
ATOM   2125 N N   . PHE B 2 76  ? 72.565 14.807  -32.858 1.00 19.34  ? 76  PHE L N   1 
ATOM   2126 C CA  . PHE B 2 76  ? 71.454 15.001  -33.772 1.00 21.67  ? 76  PHE L CA  1 
ATOM   2127 C C   . PHE B 2 76  ? 70.510 16.132  -33.435 1.00 22.35  ? 76  PHE L C   1 
ATOM   2128 O O   . PHE B 2 76  ? 70.420 16.575  -32.292 1.00 17.44  ? 76  PHE L O   1 
ATOM   2129 C CB  . PHE B 2 76  ? 70.657 13.699  -33.874 1.00 23.18  ? 76  PHE L CB  1 
ATOM   2130 C CG  . PHE B 2 76  ? 71.484 12.466  -33.657 1.00 22.58  ? 76  PHE L CG  1 
ATOM   2131 C CD1 . PHE B 2 76  ? 71.547 11.869  -32.400 1.00 29.18  ? 76  PHE L CD1 1 
ATOM   2132 C CD2 . PHE B 2 76  ? 72.214 11.907  -34.699 1.00 26.11  ? 76  PHE L CD2 1 
ATOM   2133 C CE1 . PHE B 2 76  ? 72.330 10.729  -32.186 1.00 26.34  ? 76  PHE L CE1 1 
ATOM   2134 C CE2 . PHE B 2 76  ? 72.996 10.774  -34.500 1.00 26.50  ? 76  PHE L CE2 1 
ATOM   2135 C CZ  . PHE B 2 76  ? 73.056 10.184  -33.245 1.00 24.95  ? 76  PHE L CZ  1 
ATOM   2136 N N   . THR B 2 77  ? 69.772 16.568  -34.452 1.00 18.84  ? 77  THR L N   1 
ATOM   2137 C CA  . THR B 2 77  ? 68.816 17.647  -34.289 1.00 17.83  ? 77  THR L CA  1 
ATOM   2138 C C   . THR B 2 77  ? 67.536 17.399  -35.078 1.00 18.65  ? 77  THR L C   1 
ATOM   2139 O O   . THR B 2 77  ? 67.581 17.212  -36.305 1.00 18.36  ? 77  THR L O   1 
ATOM   2140 C CB  . THR B 2 77  ? 69.409 18.982  -34.776 1.00 17.94  ? 77  THR L CB  1 
ATOM   2141 O OG1 . THR B 2 77  ? 70.614 19.261  -34.059 1.00 20.80  ? 77  THR L OG1 1 
ATOM   2142 C CG2 . THR B 2 77  ? 68.419 20.121  -34.567 1.00 23.54  ? 77  THR L CG2 1 
ATOM   2143 N N   . LEU B 2 78  ? 66.403 17.382  -34.381 1.00 14.02  ? 78  LEU L N   1 
ATOM   2144 C CA  . LEU B 2 78  ? 65.117 17.222  -35.048 1.00 13.66  ? 78  LEU L CA  1 
ATOM   2145 C C   . LEU B 2 78  ? 64.693 18.654  -35.311 1.00 17.98  ? 78  LEU L C   1 
ATOM   2146 O O   . LEU B 2 78  ? 64.731 19.489  -34.405 1.00 18.40  ? 78  LEU L O   1 
ATOM   2147 C CB  . LEU B 2 78  ? 64.074 16.555  -34.140 1.00 19.38  ? 78  LEU L CB  1 
ATOM   2148 C CG  . LEU B 2 78  ? 62.665 16.539  -34.755 1.00 17.73  ? 78  LEU L CG  1 
ATOM   2149 C CD1 . LEU B 2 78  ? 62.645 15.548  -35.908 1.00 14.06  ? 78  LEU L CD1 1 
ATOM   2150 C CD2 . LEU B 2 78  ? 61.620 16.144  -33.715 1.00 20.34  ? 78  LEU L CD2 1 
ATOM   2151 N N   . ARG B 2 79  ? 64.305 18.941  -36.547 1.00 19.18  ? 79  ARG L N   1 
ATOM   2152 C CA  . ARG B 2 79  ? 63.874 20.281  -36.925 1.00 23.29  ? 79  ARG L CA  1 
ATOM   2153 C C   . ARG B 2 79  ? 62.427 20.267  -37.368 1.00 20.78  ? 79  ARG L C   1 
ATOM   2154 O O   . ARG B 2 79  ? 62.025 19.439  -38.188 1.00 16.33  ? 79  ARG L O   1 
ATOM   2155 C CB  . ARG B 2 79  ? 64.735 20.813  -38.071 1.00 28.14  ? 79  ARG L CB  1 
ATOM   2156 C CG  . ARG B 2 79  ? 66.138 21.217  -37.668 1.00 33.34  ? 79  ARG L CG  1 
ATOM   2157 C CD  . ARG B 2 79  ? 66.134 22.597  -37.051 1.00 46.10  ? 79  ARG L CD  1 
ATOM   2158 N NE  . ARG B 2 79  ? 65.819 23.624  -38.044 1.00 50.81  ? 79  ARG L NE  1 
ATOM   2159 C CZ  . ARG B 2 79  ? 65.634 24.910  -37.760 1.00 55.03  ? 79  ARG L CZ  1 
ATOM   2160 N NH1 . ARG B 2 79  ? 65.725 25.337  -36.506 1.00 54.15  ? 79  ARG L NH1 1 
ATOM   2161 N NH2 . ARG B 2 79  ? 65.368 25.775  -38.734 1.00 58.90  ? 79  ARG L NH2 1 
ATOM   2162 N N   . ILE B 2 80  ? 61.649 21.198  -36.832 1.00 19.73  ? 80  ILE L N   1 
ATOM   2163 C CA  . ILE B 2 80  ? 60.249 21.301  -37.191 1.00 19.39  ? 80  ILE L CA  1 
ATOM   2164 C C   . ILE B 2 80  ? 60.053 22.688  -37.795 1.00 26.49  ? 80  ILE L C   1 
ATOM   2165 O O   . ILE B 2 80  ? 60.150 23.710  -37.100 1.00 19.98  ? 80  ILE L O   1 
ATOM   2166 C CB  . ILE B 2 80  ? 59.321 21.159  -35.962 1.00 21.70  ? 80  ILE L CB  1 
ATOM   2167 C CG1 . ILE B 2 80  ? 59.599 19.848  -35.225 1.00 22.86  ? 80  ILE L CG1 1 
ATOM   2168 C CG2 . ILE B 2 80  ? 57.866 21.205  -36.415 1.00 24.75  ? 80  ILE L CG2 1 
ATOM   2169 C CD1 . ILE B 2 80  ? 58.824 19.714  -33.910 1.00 24.95  ? 80  ILE L CD1 1 
ATOM   2170 N N   . SER B 2 81  ? 59.803 22.738  -39.098 1.00 23.08  ? 81  SER L N   1 
ATOM   2171 C CA  . SER B 2 81  ? 59.592 24.028  -39.726 1.00 26.04  ? 81  SER L CA  1 
ATOM   2172 C C   . SER B 2 81  ? 58.117 24.398  -39.615 1.00 23.76  ? 81  SER L C   1 
ATOM   2173 O O   . SER B 2 81  ? 57.251 23.528  -39.499 1.00 29.36  ? 81  SER L O   1 
ATOM   2174 C CB  . SER B 2 81  ? 60.029 23.997  -41.199 1.00 25.72  ? 81  SER L CB  1 
ATOM   2175 O OG  . SER B 2 81  ? 59.185 23.164  -41.974 1.00 26.22  ? 81  SER L OG  1 
ATOM   2176 N N   . ARG B 2 82  ? 57.845 25.695  -39.617 1.00 27.71  ? 82  ARG L N   1 
ATOM   2177 C CA  . ARG B 2 82  ? 56.487 26.212  -39.530 1.00 29.27  ? 82  ARG L CA  1 
ATOM   2178 C C   . ARG B 2 82  ? 55.637 25.525  -38.481 1.00 30.14  ? 82  ARG L C   1 
ATOM   2179 O O   . ARG B 2 82  ? 54.572 24.980  -38.787 1.00 31.60  ? 82  ARG L O   1 
ATOM   2180 C CB  . ARG B 2 82  ? 55.809 26.110  -40.895 1.00 31.38  ? 82  ARG L CB  1 
ATOM   2181 C CG  . ARG B 2 82  ? 56.515 26.922  -41.951 1.00 47.25  ? 82  ARG L CG  1 
ATOM   2182 C CD  . ARG B 2 82  ? 55.681 27.054  -43.210 1.00 60.35  ? 82  ARG L CD  1 
ATOM   2183 N NE  . ARG B 2 82  ? 56.234 28.072  -44.099 1.00 75.23  ? 82  ARG L NE  1 
ATOM   2184 C CZ  . ARG B 2 82  ? 56.386 29.352  -43.766 1.00 81.81  ? 82  ARG L CZ  1 
ATOM   2185 N NH1 . ARG B 2 82  ? 56.024 29.779  -42.562 1.00 84.69  ? 82  ARG L NH1 1 
ATOM   2186 N NH2 . ARG B 2 82  ? 56.902 30.208  -44.638 1.00 87.21  ? 82  ARG L NH2 1 
ATOM   2187 N N   . VAL B 2 83  ? 56.102 25.572  -37.238 1.00 21.48  ? 83  VAL L N   1 
ATOM   2188 C CA  . VAL B 2 83  ? 55.395 24.956  -36.136 1.00 19.08  ? 83  VAL L CA  1 
ATOM   2189 C C   . VAL B 2 83  ? 53.903 25.269  -36.109 1.00 22.45  ? 83  VAL L C   1 
ATOM   2190 O O   . VAL B 2 83  ? 53.497 26.417  -36.274 1.00 22.54  ? 83  VAL L O   1 
ATOM   2191 C CB  . VAL B 2 83  ? 56.024 25.381  -34.787 1.00 22.27  ? 83  VAL L CB  1 
ATOM   2192 C CG1 . VAL B 2 83  ? 55.177 24.881  -33.619 1.00 20.34  ? 83  VAL L CG1 1 
ATOM   2193 C CG2 . VAL B 2 83  ? 57.437 24.827  -34.699 1.00 19.59  ? 83  VAL L CG2 1 
ATOM   2194 N N   . GLU B 2 84  ? 53.095 24.230  -35.902 1.00 21.60  ? 84  GLU L N   1 
ATOM   2195 C CA  . GLU B 2 84  ? 51.642 24.381  -35.817 1.00 25.89  ? 84  GLU L CA  1 
ATOM   2196 C C   . GLU B 2 84  ? 51.214 24.079  -34.387 1.00 24.59  ? 84  GLU L C   1 
ATOM   2197 O O   . GLU B 2 84  ? 51.934 23.394  -33.661 1.00 21.41  ? 84  GLU L O   1 
ATOM   2198 C CB  . GLU B 2 84  ? 50.945 23.410  -36.766 1.00 28.27  ? 84  GLU L CB  1 
ATOM   2199 C CG  . GLU B 2 84  ? 51.318 23.609  -38.218 1.00 28.97  ? 84  GLU L CG  1 
ATOM   2200 C CD  . GLU B 2 84  ? 50.627 22.618  -39.146 1.00 34.90  ? 84  GLU L CD  1 
ATOM   2201 O OE1 . GLU B 2 84  ? 50.886 22.678  -40.364 1.00 31.36  ? 84  GLU L OE1 1 
ATOM   2202 O OE2 . GLU B 2 84  ? 49.833 21.781  -38.664 1.00 33.58  ? 84  GLU L OE2 1 
ATOM   2203 N N   . ALA B 2 85  ? 50.044 24.576  -33.997 1.00 21.75  ? 85  ALA L N   1 
ATOM   2204 C CA  . ALA B 2 85  ? 49.532 24.376  -32.649 1.00 24.85  ? 85  ALA L CA  1 
ATOM   2205 C C   . ALA B 2 85  ? 49.446 22.900  -32.279 1.00 26.67  ? 85  ALA L C   1 
ATOM   2206 O O   . ALA B 2 85  ? 49.735 22.511  -31.147 1.00 27.56  ? 85  ALA L O   1 
ATOM   2207 C CB  . ALA B 2 85  ? 48.150 25.033  -32.510 1.00 23.31  ? 85  ALA L CB  1 
ATOM   2208 N N   . GLU B 2 86  ? 49.045 22.074  -33.238 1.00 23.37  ? 86  GLU L N   1 
ATOM   2209 C CA  . GLU B 2 86  ? 48.902 20.646  -32.996 1.00 27.72  ? 86  GLU L CA  1 
ATOM   2210 C C   . GLU B 2 86  ? 50.229 19.918  -32.810 1.00 29.61  ? 86  GLU L C   1 
ATOM   2211 O O   . GLU B 2 86  ? 50.246 18.716  -32.539 1.00 28.80  ? 86  GLU L O   1 
ATOM   2212 C CB  . GLU B 2 86  ? 48.141 19.996  -34.149 1.00 35.50  ? 86  GLU L CB  1 
ATOM   2213 C CG  . GLU B 2 86  ? 48.879 20.071  -35.475 1.00 51.37  ? 86  GLU L CG  1 
ATOM   2214 C CD  . GLU B 2 86  ? 48.132 19.390  -36.599 1.00 63.86  ? 86  GLU L CD  1 
ATOM   2215 O OE1 . GLU B 2 86  ? 48.703 19.271  -37.705 1.00 66.56  ? 86  GLU L OE1 1 
ATOM   2216 O OE2 . GLU B 2 86  ? 46.973 18.976  -36.380 1.00 72.08  ? 86  GLU L OE2 1 
ATOM   2217 N N   . ASP B 2 87  ? 51.339 20.630  -32.965 1.00 27.07  ? 87  ASP L N   1 
ATOM   2218 C CA  . ASP B 2 87  ? 52.645 20.005  -32.805 1.00 26.02  ? 87  ASP L CA  1 
ATOM   2219 C C   . ASP B 2 87  ? 53.079 19.841  -31.350 1.00 23.26  ? 87  ASP L C   1 
ATOM   2220 O O   . ASP B 2 87  ? 54.080 19.179  -31.087 1.00 21.93  ? 87  ASP L O   1 
ATOM   2221 C CB  . ASP B 2 87  ? 53.724 20.792  -33.561 1.00 22.87  ? 87  ASP L CB  1 
ATOM   2222 C CG  . ASP B 2 87  ? 53.592 20.668  -35.078 1.00 26.98  ? 87  ASP L CG  1 
ATOM   2223 O OD1 . ASP B 2 87  ? 53.070 19.643  -35.556 1.00 23.33  ? 87  ASP L OD1 1 
ATOM   2224 O OD2 . ASP B 2 87  ? 54.024 21.585  -35.800 1.00 23.88  ? 87  ASP L OD2 1 
ATOM   2225 N N   . VAL B 2 88  ? 52.347 20.440  -30.414 1.00 22.16  ? 88  VAL L N   1 
ATOM   2226 C CA  . VAL B 2 88  ? 52.725 20.328  -29.004 1.00 27.18  ? 88  VAL L CA  1 
ATOM   2227 C C   . VAL B 2 88  ? 52.742 18.875  -28.563 1.00 20.05  ? 88  VAL L C   1 
ATOM   2228 O O   . VAL B 2 88  ? 51.926 18.068  -29.010 1.00 23.02  ? 88  VAL L O   1 
ATOM   2229 C CB  . VAL B 2 88  ? 51.765 21.105  -28.072 1.00 29.72  ? 88  VAL L CB  1 
ATOM   2230 C CG1 . VAL B 2 88  ? 52.004 22.600  -28.217 1.00 34.71  ? 88  VAL L CG1 1 
ATOM   2231 C CG2 . VAL B 2 88  ? 50.329 20.749  -28.394 1.00 29.38  ? 88  VAL L CG2 1 
ATOM   2232 N N   . GLY B 2 89  ? 53.680 18.555  -27.680 1.00 20.20  ? 89  GLY L N   1 
ATOM   2233 C CA  . GLY B 2 89  ? 53.815 17.199  -27.179 1.00 18.37  ? 89  GLY L CA  1 
ATOM   2234 C C   . GLY B 2 89  ? 55.255 16.958  -26.768 1.00 18.98  ? 89  GLY L C   1 
ATOM   2235 O O   . GLY B 2 89  ? 56.045 17.900  -26.670 1.00 20.70  ? 89  GLY L O   1 
ATOM   2236 N N   . VAL B 2 90  ? 55.608 15.700  -26.541 1.00 16.80  ? 90  VAL L N   1 
ATOM   2237 C CA  . VAL B 2 90  ? 56.962 15.365  -26.136 1.00 18.37  ? 90  VAL L CA  1 
ATOM   2238 C C   . VAL B 2 90  ? 57.657 14.566  -27.232 1.00 15.11  ? 90  VAL L C   1 
ATOM   2239 O O   . VAL B 2 90  ? 57.166 13.521  -27.652 1.00 16.18  ? 90  VAL L O   1 
ATOM   2240 C CB  . VAL B 2 90  ? 56.956 14.548  -24.836 1.00 20.55  ? 90  VAL L CB  1 
ATOM   2241 C CG1 . VAL B 2 90  ? 58.381 14.330  -24.358 1.00 18.01  ? 90  VAL L CG1 1 
ATOM   2242 C CG2 . VAL B 2 90  ? 56.142 15.273  -23.781 1.00 23.94  ? 90  VAL L CG2 1 
ATOM   2243 N N   . TYR B 2 91  ? 58.794 15.076  -27.687 1.00 13.68  ? 91  TYR L N   1 
ATOM   2244 C CA  . TYR B 2 91  ? 59.575 14.435  -28.740 1.00 13.37  ? 91  TYR L CA  1 
ATOM   2245 C C   . TYR B 2 91  ? 60.723 13.600  -28.195 1.00 13.76  ? 91  TYR L C   1 
ATOM   2246 O O   . TYR B 2 91  ? 61.577 14.095  -27.459 1.00 17.54  ? 91  TYR L O   1 
ATOM   2247 C CB  . TYR B 2 91  ? 60.113 15.497  -29.699 1.00 10.84  ? 91  TYR L CB  1 
ATOM   2248 C CG  . TYR B 2 91  ? 58.997 16.188  -30.454 1.00 12.90  ? 91  TYR L CG  1 
ATOM   2249 C CD1 . TYR B 2 91  ? 58.267 17.224  -29.868 1.00 16.81  ? 91  TYR L CD1 1 
ATOM   2250 C CD2 . TYR B 2 91  ? 58.632 15.763  -31.728 1.00 15.64  ? 91  TYR L CD2 1 
ATOM   2251 C CE1 . TYR B 2 91  ? 57.191 17.825  -30.545 1.00 15.70  ? 91  TYR L CE1 1 
ATOM   2252 C CE2 . TYR B 2 91  ? 57.566 16.346  -32.404 1.00 17.83  ? 91  TYR L CE2 1 
ATOM   2253 C CZ  . TYR B 2 91  ? 56.851 17.372  -31.814 1.00 16.18  ? 91  TYR L CZ  1 
ATOM   2254 O OH  . TYR B 2 91  ? 55.799 17.936  -32.508 1.00 18.40  ? 91  TYR L OH  1 
ATOM   2255 N N   . TYR B 2 92  ? 60.744 12.329  -28.582 1.00 12.72  ? 92  TYR L N   1 
ATOM   2256 C CA  . TYR B 2 92  ? 61.773 11.398  -28.141 1.00 15.01  ? 92  TYR L CA  1 
ATOM   2257 C C   . TYR B 2 92  ? 62.709 10.941  -29.247 1.00 17.00  ? 92  TYR L C   1 
ATOM   2258 O O   . TYR B 2 92  ? 62.262 10.684  -30.365 1.00 13.53  ? 92  TYR L O   1 
ATOM   2259 C CB  . TYR B 2 92  ? 61.109 10.147  -27.565 1.00 17.39  ? 92  TYR L CB  1 
ATOM   2260 C CG  . TYR B 2 92  ? 60.287 10.376  -26.317 1.00 22.45  ? 92  TYR L CG  1 
ATOM   2261 C CD1 . TYR B 2 92  ? 60.858 10.238  -25.051 1.00 25.48  ? 92  TYR L CD1 1 
ATOM   2262 C CD2 . TYR B 2 92  ? 58.939 10.720  -26.398 1.00 21.33  ? 92  TYR L CD2 1 
ATOM   2263 C CE1 . TYR B 2 92  ? 60.101 10.432  -23.887 1.00 22.92  ? 92  TYR L CE1 1 
ATOM   2264 C CE2 . TYR B 2 92  ? 58.175 10.924  -25.246 1.00 25.63  ? 92  TYR L CE2 1 
ATOM   2265 C CZ  . TYR B 2 92  ? 58.770 10.774  -23.993 1.00 26.40  ? 92  TYR L CZ  1 
ATOM   2266 O OH  . TYR B 2 92  ? 58.029 10.959  -22.851 1.00 30.96  ? 92  TYR L OH  1 
ATOM   2267 N N   . CYS B 2 93  ? 64.004 10.857  -28.933 1.00 13.28  ? 93  CYS L N   1 
ATOM   2268 C CA  . CYS B 2 93  ? 64.983 10.310  -29.866 1.00 14.61  ? 93  CYS L CA  1 
ATOM   2269 C C   . CYS B 2 93  ? 65.272 8.940   -29.261 1.00 19.46  ? 93  CYS L C   1 
ATOM   2270 O O   . CYS B 2 93  ? 65.068 8.736   -28.063 1.00 22.07  ? 93  CYS L O   1 
ATOM   2271 C CB  . CYS B 2 93  ? 66.274 11.131  -29.922 1.00 16.24  ? 93  CYS L CB  1 
ATOM   2272 S SG  . CYS B 2 93  ? 67.140 11.460  -28.332 1.00 22.34  ? 93  CYS L SG  1 
ATOM   2273 N N   . ALA B 2 94  ? 65.722 7.999   -30.077 1.00 13.31  ? 94  ALA L N   1 
ATOM   2274 C CA  . ALA B 2 94  ? 66.018 6.664   -29.591 1.00 17.71  ? 94  ALA L CA  1 
ATOM   2275 C C   . ALA B 2 94  ? 66.887 5.964   -30.616 1.00 21.98  ? 94  ALA L C   1 
ATOM   2276 O O   . ALA B 2 94  ? 67.004 6.428   -31.754 1.00 17.33  ? 94  ALA L O   1 
ATOM   2277 C CB  . ALA B 2 94  ? 64.727 5.893   -29.366 1.00 14.68  ? 94  ALA L CB  1 
ATOM   2278 N N   . GLN B 2 95  ? 67.502 4.850   -30.223 1.00 15.89  ? 95  GLN L N   1 
ATOM   2279 C CA  . GLN B 2 95  ? 68.362 4.132   -31.155 1.00 13.06  ? 95  GLN L CA  1 
ATOM   2280 C C   . GLN B 2 95  ? 67.939 2.689   -31.371 1.00 14.75  ? 95  GLN L C   1 
ATOM   2281 O O   . GLN B 2 95  ? 67.489 2.016   -30.438 1.00 19.89  ? 95  GLN L O   1 
ATOM   2282 C CB  . GLN B 2 95  ? 69.819 4.165   -30.666 1.00 15.53  ? 95  GLN L CB  1 
ATOM   2283 C CG  . GLN B 2 95  ? 70.079 3.450   -29.308 1.00 19.19  ? 95  GLN L CG  1 
ATOM   2284 C CD  . GLN B 2 95  ? 70.211 1.933   -29.418 1.00 18.67  ? 95  GLN L CD  1 
ATOM   2285 O OE1 . GLN B 2 95  ? 70.622 1.403   -30.449 1.00 22.10  ? 95  GLN L OE1 1 
ATOM   2286 N NE2 . GLN B 2 95  ? 69.891 1.227   -28.326 1.00 22.29  ? 95  GLN L NE2 1 
ATOM   2287 N N   . ASN B 2 96  ? 68.058 2.221   -32.610 1.00 14.24  ? 96  ASN L N   1 
ATOM   2288 C CA  . ASN B 2 96  ? 67.736 0.834   -32.905 1.00 16.80  ? 96  ASN L CA  1 
ATOM   2289 C C   . ASN B 2 96  ? 68.921 0.211   -33.636 1.00 16.59  ? 96  ASN L C   1 
ATOM   2290 O O   . ASN B 2 96  ? 68.770 -0.533  -34.612 1.00 22.23  ? 96  ASN L O   1 
ATOM   2291 C CB  . ASN B 2 96  ? 66.418 0.719   -33.693 1.00 19.29  ? 96  ASN L CB  1 
ATOM   2292 C CG  . ASN B 2 96  ? 66.470 1.349   -35.074 1.00 19.11  ? 96  ASN L CG  1 
ATOM   2293 O OD1 . ASN B 2 96  ? 67.242 2.274   -35.340 1.00 20.35  ? 96  ASN L OD1 1 
ATOM   2294 N ND2 . ASN B 2 96  ? 65.609 0.862   -35.957 1.00 16.41  ? 96  ASN L ND2 1 
ATOM   2295 N N   . LEU B 2 97  ? 70.110 0.547   -33.139 1.00 18.42  ? 97  LEU L N   1 
ATOM   2296 C CA  . LEU B 2 97  ? 71.364 0.039   -33.674 1.00 18.59  ? 97  LEU L CA  1 
ATOM   2297 C C   . LEU B 2 97  ? 71.691 -1.307  -33.021 1.00 24.75  ? 97  LEU L C   1 
ATOM   2298 O O   . LEU B 2 97  ? 72.148 -2.247  -33.678 1.00 23.40  ? 97  LEU L O   1 
ATOM   2299 C CB  . LEU B 2 97  ? 72.512 1.010   -33.368 1.00 23.65  ? 97  LEU L CB  1 
ATOM   2300 C CG  . LEU B 2 97  ? 73.896 0.541   -33.832 1.00 25.26  ? 97  LEU L CG  1 
ATOM   2301 C CD1 . LEU B 2 97  ? 73.983 0.681   -35.346 1.00 27.88  ? 97  LEU L CD1 1 
ATOM   2302 C CD2 . LEU B 2 97  ? 74.998 1.358   -33.161 1.00 28.69  ? 97  LEU L CD2 1 
ATOM   2303 N N   . GLU B 2 98  ? 71.459 -1.398  -31.720 1.00 23.95  ? 98  GLU L N   1 
ATOM   2304 C CA  . GLU B 2 98  ? 71.781 -2.622  -31.004 1.00 28.48  ? 98  GLU L CA  1 
ATOM   2305 C C   . GLU B 2 98  ? 71.000 -2.759  -29.712 1.00 24.71  ? 98  GLU L C   1 
ATOM   2306 O O   . GLU B 2 98  ? 70.387 -1.805  -29.232 1.00 24.38  ? 98  GLU L O   1 
ATOM   2307 C CB  . GLU B 2 98  ? 73.289 -2.659  -30.704 1.00 30.47  ? 98  GLU L CB  1 
ATOM   2308 C CG  . GLU B 2 98  ? 73.830 -1.366  -30.107 1.00 34.96  ? 98  GLU L CG  1 
ATOM   2309 C CD  . GLU B 2 98  ? 75.335 -1.394  -29.857 1.00 38.48  ? 98  GLU L CD  1 
ATOM   2310 O OE1 . GLU B 2 98  ? 76.108 -1.629  -30.816 1.00 33.76  ? 98  GLU L OE1 1 
ATOM   2311 O OE2 . GLU B 2 98  ? 75.746 -1.168  -28.699 1.00 36.81  ? 98  GLU L OE2 1 
ATOM   2312 N N   . LEU B 2 99  ? 71.019 -3.964  -29.157 1.00 27.87  ? 99  LEU L N   1 
ATOM   2313 C CA  . LEU B 2 99  ? 70.344 -4.241  -27.898 1.00 24.00  ? 99  LEU L CA  1 
ATOM   2314 C C   . LEU B 2 99  ? 71.308 -3.871  -26.773 1.00 25.76  ? 99  LEU L C   1 
ATOM   2315 O O   . LEU B 2 99  ? 72.518 -3.922  -26.952 1.00 26.33  ? 99  LEU L O   1 
ATOM   2316 C CB  . LEU B 2 99  ? 69.994 -5.732  -27.797 1.00 29.51  ? 99  LEU L CB  1 
ATOM   2317 C CG  . LEU B 2 99  ? 68.997 -6.292  -28.813 1.00 29.30  ? 99  LEU L CG  1 
ATOM   2318 C CD1 . LEU B 2 99  ? 68.948 -7.809  -28.713 1.00 29.55  ? 99  LEU L CD1 1 
ATOM   2319 C CD2 . LEU B 2 99  ? 67.630 -5.689  -28.562 1.00 27.21  ? 99  LEU L CD2 1 
ATOM   2320 N N   . PRO B 2 100 ? 70.781 -3.448  -25.618 1.00 25.88  ? 100 PRO L N   1 
ATOM   2321 C CA  . PRO B 2 100 ? 69.345 -3.313  -25.369 1.00 28.41  ? 100 PRO L CA  1 
ATOM   2322 C C   . PRO B 2 100 ? 68.828 -2.002  -25.960 1.00 29.47  ? 100 PRO L C   1 
ATOM   2323 O O   . PRO B 2 100 ? 69.578 -1.038  -26.101 1.00 28.46  ? 100 PRO L O   1 
ATOM   2324 C CB  . PRO B 2 100 ? 69.260 -3.315  -23.850 1.00 30.87  ? 100 PRO L CB  1 
ATOM   2325 C CG  . PRO B 2 100 ? 70.519 -2.594  -23.460 1.00 32.46  ? 100 PRO L CG  1 
ATOM   2326 C CD  . PRO B 2 100 ? 71.550 -3.233  -24.378 1.00 32.68  ? 100 PRO L CD  1 
ATOM   2327 N N   . PRO B 2 101 ? 67.538 -1.954  -26.309 1.00 27.88  ? 101 PRO L N   1 
ATOM   2328 C CA  . PRO B 2 101 ? 66.955 -0.737  -26.879 1.00 20.65  ? 101 PRO L CA  1 
ATOM   2329 C C   . PRO B 2 101 ? 67.025 0.338   -25.815 1.00 24.81  ? 101 PRO L C   1 
ATOM   2330 O O   . PRO B 2 101 ? 66.764 0.064   -24.645 1.00 20.32  ? 101 PRO L O   1 
ATOM   2331 C CB  . PRO B 2 101 ? 65.507 -1.136  -27.153 1.00 22.64  ? 101 PRO L CB  1 
ATOM   2332 C CG  . PRO B 2 101 ? 65.562 -2.645  -27.274 1.00 25.83  ? 101 PRO L CG  1 
ATOM   2333 C CD  . PRO B 2 101 ? 66.529 -3.018  -26.185 1.00 21.21  ? 101 PRO L CD  1 
ATOM   2334 N N   . THR B 2 102 ? 67.384 1.553   -26.207 1.00 21.02  ? 102 THR L N   1 
ATOM   2335 C CA  . THR B 2 102 ? 67.448 2.650   -25.261 1.00 20.52  ? 102 THR L CA  1 
ATOM   2336 C C   . THR B 2 102 ? 66.725 3.849   -25.858 1.00 25.16  ? 102 THR L C   1 
ATOM   2337 O O   . THR B 2 102 ? 66.670 4.010   -27.087 1.00 19.18  ? 102 THR L O   1 
ATOM   2338 C CB  . THR B 2 102 ? 68.898 3.018   -24.926 1.00 21.44  ? 102 THR L CB  1 
ATOM   2339 O OG1 . THR B 2 102 ? 69.643 3.182   -26.131 1.00 22.30  ? 102 THR L OG1 1 
ATOM   2340 C CG2 . THR B 2 102 ? 69.537 1.916   -24.069 1.00 22.23  ? 102 THR L CG2 1 
ATOM   2341 N N   . PHE B 2 103 ? 66.160 4.675   -24.986 1.00 19.35  ? 103 PHE L N   1 
ATOM   2342 C CA  . PHE B 2 103 ? 65.401 5.837   -25.420 1.00 24.59  ? 103 PHE L CA  1 
ATOM   2343 C C   . PHE B 2 103 ? 65.804 7.089   -24.665 1.00 25.69  ? 103 PHE L C   1 
ATOM   2344 O O   . PHE B 2 103 ? 66.294 7.018   -23.532 1.00 20.20  ? 103 PHE L O   1 
ATOM   2345 C CB  . PHE B 2 103 ? 63.904 5.577   -25.216 1.00 20.02  ? 103 PHE L CB  1 
ATOM   2346 C CG  . PHE B 2 103 ? 63.490 4.157   -25.511 1.00 21.75  ? 103 PHE L CG  1 
ATOM   2347 C CD1 . PHE B 2 103 ? 63.730 3.143   -24.593 1.00 23.83  ? 103 PHE L CD1 1 
ATOM   2348 C CD2 . PHE B 2 103 ? 62.898 3.827   -26.721 1.00 18.23  ? 103 PHE L CD2 1 
ATOM   2349 C CE1 . PHE B 2 103 ? 63.388 1.821   -24.877 1.00 22.70  ? 103 PHE L CE1 1 
ATOM   2350 C CE2 . PHE B 2 103 ? 62.552 2.512   -27.019 1.00 18.45  ? 103 PHE L CE2 1 
ATOM   2351 C CZ  . PHE B 2 103 ? 62.796 1.502   -26.098 1.00 20.83  ? 103 PHE L CZ  1 
ATOM   2352 N N   . GLY B 2 104 ? 65.610 8.236   -25.306 1.00 21.81  ? 104 GLY L N   1 
ATOM   2353 C CA  . GLY B 2 104 ? 65.944 9.496   -24.668 1.00 21.02  ? 104 GLY L CA  1 
ATOM   2354 C C   . GLY B 2 104 ? 64.860 9.841   -23.670 1.00 18.23  ? 104 GLY L C   1 
ATOM   2355 O O   . GLY B 2 104 ? 63.807 9.206   -23.657 1.00 17.81  ? 104 GLY L O   1 
ATOM   2356 N N   . GLY B 2 105 ? 65.109 10.844  -22.837 1.00 24.70  ? 105 GLY L N   1 
ATOM   2357 C CA  . GLY B 2 105 ? 64.128 11.235  -21.841 1.00 25.57  ? 105 GLY L CA  1 
ATOM   2358 C C   . GLY B 2 105 ? 62.996 12.077  -22.393 1.00 24.13  ? 105 GLY L C   1 
ATOM   2359 O O   . GLY B 2 105 ? 62.053 12.405  -21.666 1.00 17.20  ? 105 GLY L O   1 
ATOM   2360 N N   . GLY B 2 106 ? 63.089 12.452  -23.668 1.00 20.24  ? 106 GLY L N   1 
ATOM   2361 C CA  . GLY B 2 106 ? 62.029 13.244  -24.280 1.00 21.69  ? 106 GLY L CA  1 
ATOM   2362 C C   . GLY B 2 106 ? 62.135 14.741  -24.044 1.00 26.76  ? 106 GLY L C   1 
ATOM   2363 O O   . GLY B 2 106 ? 62.507 15.180  -22.955 1.00 25.55  ? 106 GLY L O   1 
ATOM   2364 N N   . THR B 2 107 ? 61.808 15.529  -25.066 1.00 23.28  ? 107 THR L N   1 
ATOM   2365 C CA  . THR B 2 107 ? 61.861 16.994  -24.972 1.00 20.54  ? 107 THR L CA  1 
ATOM   2366 C C   . THR B 2 107 ? 60.480 17.545  -25.251 1.00 22.41  ? 107 THR L C   1 
ATOM   2367 O O   . THR B 2 107 ? 59.931 17.328  -26.336 1.00 17.03  ? 107 THR L O   1 
ATOM   2368 C CB  . THR B 2 107 ? 62.818 17.595  -26.017 1.00 17.58  ? 107 THR L CB  1 
ATOM   2369 O OG1 . THR B 2 107 ? 64.132 17.081  -25.818 1.00 15.11  ? 107 THR L OG1 1 
ATOM   2370 C CG2 . THR B 2 107 ? 62.845 19.123  -25.915 1.00 21.77  ? 107 THR L CG2 1 
ATOM   2371 N N   . LYS B 2 108 ? 59.908 18.260  -24.286 1.00 19.21  ? 108 LYS L N   1 
ATOM   2372 C CA  . LYS B 2 108 ? 58.574 18.811  -24.487 1.00 22.67  ? 108 LYS L CA  1 
ATOM   2373 C C   . LYS B 2 108 ? 58.630 20.072  -25.349 1.00 21.73  ? 108 LYS L C   1 
ATOM   2374 O O   . LYS B 2 108 ? 59.428 20.974  -25.099 1.00 24.43  ? 108 LYS L O   1 
ATOM   2375 C CB  . LYS B 2 108 ? 57.903 19.118  -23.138 1.00 25.10  ? 108 LYS L CB  1 
ATOM   2376 C CG  . LYS B 2 108 ? 56.591 19.899  -23.265 1.00 31.14  ? 108 LYS L CG  1 
ATOM   2377 C CD  . LYS B 2 108 ? 55.780 19.883  -21.974 1.00 41.98  ? 108 LYS L CD  1 
ATOM   2378 C CE  . LYS B 2 108 ? 55.230 18.491  -21.676 1.00 45.94  ? 108 LYS L CE  1 
ATOM   2379 N NZ  . LYS B 2 108 ? 54.338 18.490  -20.483 1.00 55.73  ? 108 LYS L NZ  1 
ATOM   2380 N N   . LEU B 2 109 ? 57.793 20.120  -26.381 1.00 19.18  ? 109 LEU L N   1 
ATOM   2381 C CA  . LEU B 2 109 ? 57.755 21.287  -27.261 1.00 21.67  ? 109 LEU L CA  1 
ATOM   2382 C C   . LEU B 2 109 ? 56.751 22.291  -26.704 1.00 20.50  ? 109 LEU L C   1 
ATOM   2383 O O   . LEU B 2 109 ? 55.581 21.963  -26.526 1.00 23.57  ? 109 LEU L O   1 
ATOM   2384 C CB  . LEU B 2 109 ? 57.341 20.890  -28.685 1.00 18.06  ? 109 LEU L CB  1 
ATOM   2385 C CG  . LEU B 2 109 ? 57.150 22.091  -29.617 1.00 19.53  ? 109 LEU L CG  1 
ATOM   2386 C CD1 . LEU B 2 109 ? 58.466 22.819  -29.756 1.00 20.71  ? 109 LEU L CD1 1 
ATOM   2387 C CD2 . LEU B 2 109 ? 56.641 21.641  -30.979 1.00 21.33  ? 109 LEU L CD2 1 
ATOM   2388 N N   . GLU B 2 110 ? 57.212 23.504  -26.427 1.00 24.83  ? 110 GLU L N   1 
ATOM   2389 C CA  . GLU B 2 110 ? 56.344 24.544  -25.883 1.00 31.00  ? 110 GLU L CA  1 
ATOM   2390 C C   . GLU B 2 110 ? 56.043 25.629  -26.915 1.00 28.12  ? 110 GLU L C   1 
ATOM   2391 O O   . GLU B 2 110 ? 56.948 26.149  -27.567 1.00 28.26  ? 110 GLU L O   1 
ATOM   2392 C CB  . GLU B 2 110 ? 56.989 25.175  -24.641 1.00 37.11  ? 110 GLU L CB  1 
ATOM   2393 C CG  . GLU B 2 110 ? 57.258 24.181  -23.519 1.00 49.51  ? 110 GLU L CG  1 
ATOM   2394 C CD  . GLU B 2 110 ? 57.731 24.847  -22.242 1.00 56.95  ? 110 GLU L CD  1 
ATOM   2395 O OE1 . GLU B 2 110 ? 58.783 25.524  -22.270 1.00 62.00  ? 110 GLU L OE1 1 
ATOM   2396 O OE2 . GLU B 2 110 ? 57.047 24.691  -21.208 1.00 65.02  ? 110 GLU L OE2 1 
ATOM   2397 N N   . ILE B 2 111 ? 54.758 25.943  -27.066 1.00 26.07  ? 111 ILE L N   1 
ATOM   2398 C CA  . ILE B 2 111 ? 54.319 26.972  -27.998 1.00 27.68  ? 111 ILE L CA  1 
ATOM   2399 C C   . ILE B 2 111 ? 54.036 28.277  -27.272 1.00 29.03  ? 111 ILE L C   1 
ATOM   2400 O O   . ILE B 2 111 ? 53.315 28.312  -26.273 1.00 29.75  ? 111 ILE L O   1 
ATOM   2401 C CB  . ILE B 2 111 ? 53.055 26.545  -28.767 1.00 29.49  ? 111 ILE L CB  1 
ATOM   2402 C CG1 . ILE B 2 111 ? 53.436 25.523  -29.846 1.00 37.90  ? 111 ILE L CG1 1 
ATOM   2403 C CG2 . ILE B 2 111 ? 52.385 27.768  -29.394 1.00 26.42  ? 111 ILE L CG2 1 
ATOM   2404 C CD1 . ILE B 2 111 ? 52.292 25.102  -30.733 1.00 45.68  ? 111 ILE L CD1 1 
ATOM   2405 N N   . LYS B 2 112 ? 54.623 29.349  -27.786 1.00 31.23  ? 112 LYS L N   1 
ATOM   2406 C CA  . LYS B 2 112 ? 54.456 30.672  -27.215 1.00 33.89  ? 112 LYS L CA  1 
ATOM   2407 C C   . LYS B 2 112 ? 53.316 31.363  -27.950 1.00 35.94  ? 112 LYS L C   1 
ATOM   2408 O O   . LYS B 2 112 ? 53.238 31.305  -29.175 1.00 35.79  ? 112 LYS L O   1 
ATOM   2409 C CB  . LYS B 2 112 ? 55.754 31.467  -27.374 1.00 38.38  ? 112 LYS L CB  1 
ATOM   2410 C CG  . LYS B 2 112 ? 55.746 32.831  -26.713 1.00 47.17  ? 112 LYS L CG  1 
ATOM   2411 C CD  . LYS B 2 112 ? 57.154 33.410  -26.617 1.00 50.69  ? 112 LYS L CD  1 
ATOM   2412 C CE  . LYS B 2 112 ? 57.804 33.560  -27.983 1.00 55.39  ? 112 LYS L CE  1 
ATOM   2413 N NZ  . LYS B 2 112 ? 59.181 34.128  -27.873 1.00 57.78  ? 112 LYS L NZ  1 
ATOM   2414 N N   . ARG B 2 113 ? 52.425 31.999  -27.194 1.00 35.56  ? 113 ARG L N   1 
ATOM   2415 C CA  . ARG B 2 113 ? 51.283 32.702  -27.768 1.00 37.28  ? 113 ARG L CA  1 
ATOM   2416 C C   . ARG B 2 113 ? 50.946 33.940  -26.940 1.00 37.01  ? 113 ARG L C   1 
ATOM   2417 O O   . ARG B 2 113 ? 51.665 34.278  -25.999 1.00 38.80  ? 113 ARG L O   1 
ATOM   2418 C CB  . ARG B 2 113 ? 50.070 31.781  -27.813 1.00 32.53  ? 113 ARG L CB  1 
ATOM   2419 C CG  . ARG B 2 113 ? 49.731 31.154  -26.469 1.00 36.62  ? 113 ARG L CG  1 
ATOM   2420 C CD  . ARG B 2 113 ? 48.261 30.807  -26.404 1.00 39.31  ? 113 ARG L CD  1 
ATOM   2421 N NE  . ARG B 2 113 ? 47.452 32.020  -26.353 1.00 38.78  ? 113 ARG L NE  1 
ATOM   2422 C CZ  . ARG B 2 113 ? 46.185 32.094  -26.734 1.00 37.67  ? 113 ARG L CZ  1 
ATOM   2423 N NH1 . ARG B 2 113 ? 45.571 31.020  -27.203 1.00 40.43  ? 113 ARG L NH1 1 
ATOM   2424 N NH2 . ARG B 2 113 ? 45.535 33.245  -26.651 1.00 45.28  ? 113 ARG L NH2 1 
ATOM   2425 N N   . ALA B 2 114 ? 49.853 34.612  -27.291 1.00 40.33  ? 114 ALA L N   1 
ATOM   2426 C CA  . ALA B 2 114 ? 49.430 35.810  -26.570 1.00 42.68  ? 114 ALA L CA  1 
ATOM   2427 C C   . ALA B 2 114 ? 48.725 35.416  -25.281 1.00 45.26  ? 114 ALA L C   1 
ATOM   2428 O O   . ALA B 2 114 ? 47.986 34.428  -25.246 1.00 44.31  ? 114 ALA L O   1 
ATOM   2429 C CB  . ALA B 2 114 ? 48.501 36.646  -27.434 1.00 40.00  ? 114 ALA L CB  1 
ATOM   2430 N N   . ASP B 2 115 ? 48.955 36.191  -24.225 1.00 48.33  ? 115 ASP L N   1 
ATOM   2431 C CA  . ASP B 2 115 ? 48.342 35.915  -22.931 1.00 52.63  ? 115 ASP L CA  1 
ATOM   2432 C C   . ASP B 2 115 ? 46.830 35.782  -23.047 1.00 51.71  ? 115 ASP L C   1 
ATOM   2433 O O   . ASP B 2 115 ? 46.227 36.218  -24.029 1.00 54.38  ? 115 ASP L O   1 
ATOM   2434 C CB  . ASP B 2 115 ? 48.685 37.017  -21.923 1.00 55.71  ? 115 ASP L CB  1 
ATOM   2435 C CG  . ASP B 2 115 ? 50.164 37.067  -21.596 1.00 59.26  ? 115 ASP L CG  1 
ATOM   2436 O OD1 . ASP B 2 115 ? 50.760 35.994  -21.368 1.00 61.94  ? 115 ASP L OD1 1 
ATOM   2437 O OD2 . ASP B 2 115 ? 50.730 38.178  -21.557 1.00 62.96  ? 115 ASP L OD2 1 
ATOM   2438 N N   . ALA B 2 116 ? 46.223 35.165  -22.041 1.00 50.90  ? 116 ALA L N   1 
ATOM   2439 C CA  . ALA B 2 116 ? 44.782 34.968  -22.030 1.00 52.35  ? 116 ALA L CA  1 
ATOM   2440 C C   . ALA B 2 116 ? 44.305 34.696  -20.613 1.00 52.08  ? 116 ALA L C   1 
ATOM   2441 O O   . ALA B 2 116 ? 44.921 33.918  -19.878 1.00 50.77  ? 116 ALA L O   1 
ATOM   2442 C CB  . ALA B 2 116 ? 44.407 33.807  -22.942 1.00 54.00  ? 116 ALA L CB  1 
ATOM   2443 N N   . ALA B 2 117 ? 43.212 35.348  -20.229 1.00 51.40  ? 117 ALA L N   1 
ATOM   2444 C CA  . ALA B 2 117 ? 42.648 35.167  -18.897 1.00 51.22  ? 117 ALA L CA  1 
ATOM   2445 C C   . ALA B 2 117 ? 41.870 33.856  -18.859 1.00 48.09  ? 117 ALA L C   1 
ATOM   2446 O O   . ALA B 2 117 ? 41.334 33.410  -19.872 1.00 48.06  ? 117 ALA L O   1 
ATOM   2447 C CB  . ALA B 2 117 ? 41.730 36.340  -18.547 1.00 48.77  ? 117 ALA L CB  1 
ATOM   2448 N N   . PRO B 2 118 ? 41.806 33.214  -17.685 1.00 51.66  ? 118 PRO L N   1 
ATOM   2449 C CA  . PRO B 2 118 ? 41.079 31.950  -17.569 1.00 51.22  ? 118 PRO L CA  1 
ATOM   2450 C C   . PRO B 2 118 ? 39.574 32.138  -17.456 1.00 52.05  ? 118 PRO L C   1 
ATOM   2451 O O   . PRO B 2 118 ? 39.103 32.980  -16.694 1.00 53.14  ? 118 PRO L O   1 
ATOM   2452 C CB  . PRO B 2 118 ? 41.676 31.336  -16.310 1.00 50.92  ? 118 PRO L CB  1 
ATOM   2453 C CG  . PRO B 2 118 ? 41.907 32.540  -15.455 1.00 51.76  ? 118 PRO L CG  1 
ATOM   2454 C CD  . PRO B 2 118 ? 42.521 33.524  -16.434 1.00 51.88  ? 118 PRO L CD  1 
ATOM   2455 N N   . THR B 2 119 ? 38.824 31.364  -18.233 1.00 55.05  ? 119 THR L N   1 
ATOM   2456 C CA  . THR B 2 119 ? 37.369 31.421  -18.186 1.00 57.60  ? 119 THR L CA  1 
ATOM   2457 C C   . THR B 2 119 ? 36.987 30.565  -16.986 1.00 58.48  ? 119 THR L C   1 
ATOM   2458 O O   . THR B 2 119 ? 37.177 29.348  -16.998 1.00 58.43  ? 119 THR L O   1 
ATOM   2459 C CB  . THR B 2 119 ? 36.738 30.826  -19.458 1.00 59.42  ? 119 THR L CB  1 
ATOM   2460 O OG1 . THR B 2 119 ? 37.128 31.604  -20.596 1.00 61.90  ? 119 THR L OG1 1 
ATOM   2461 C CG2 . THR B 2 119 ? 35.221 30.827  -19.348 1.00 60.19  ? 119 THR L CG2 1 
ATOM   2462 N N   . VAL B 2 120 ? 36.458 31.205  -15.950 1.00 57.22  ? 120 VAL L N   1 
ATOM   2463 C CA  . VAL B 2 120 ? 36.090 30.503  -14.727 1.00 58.71  ? 120 VAL L CA  1 
ATOM   2464 C C   . VAL B 2 120 ? 34.607 30.148  -14.628 1.00 57.80  ? 120 VAL L C   1 
ATOM   2465 O O   . VAL B 2 120 ? 33.736 30.989  -14.841 1.00 58.50  ? 120 VAL L O   1 
ATOM   2466 C CB  . VAL B 2 120 ? 36.496 31.334  -13.489 1.00 58.38  ? 120 VAL L CB  1 
ATOM   2467 C CG1 . VAL B 2 120 ? 36.328 30.507  -12.231 1.00 60.61  ? 120 VAL L CG1 1 
ATOM   2468 C CG2 . VAL B 2 120 ? 37.940 31.803  -13.627 1.00 57.02  ? 120 VAL L CG2 1 
ATOM   2469 N N   . SER B 2 121 ? 34.337 28.887  -14.301 1.00 57.30  ? 121 SER L N   1 
ATOM   2470 C CA  . SER B 2 121 ? 32.976 28.379  -14.158 1.00 53.93  ? 121 SER L CA  1 
ATOM   2471 C C   . SER B 2 121 ? 32.938 27.492  -12.921 1.00 55.43  ? 121 SER L C   1 
ATOM   2472 O O   . SER B 2 121 ? 33.677 26.514  -12.841 1.00 54.72  ? 121 SER L O   1 
ATOM   2473 C CB  . SER B 2 121 ? 32.583 27.554  -15.385 1.00 53.78  ? 121 SER L CB  1 
ATOM   2474 O OG  . SER B 2 121 ? 32.628 28.330  -16.567 1.00 55.75  ? 121 SER L OG  1 
ATOM   2475 N N   . ILE B 2 122 ? 32.087 27.833  -11.956 1.00 54.11  ? 122 ILE L N   1 
ATOM   2476 C CA  . ILE B 2 122 ? 31.987 27.048  -10.727 1.00 53.65  ? 122 ILE L CA  1 
ATOM   2477 C C   . ILE B 2 122 ? 30.666 26.281  -10.664 1.00 50.83  ? 122 ILE L C   1 
ATOM   2478 O O   . ILE B 2 122 ? 29.661 26.713  -11.226 1.00 49.09  ? 122 ILE L O   1 
ATOM   2479 C CB  . ILE B 2 122 ? 32.127 27.952  -9.474  1.00 54.58  ? 122 ILE L CB  1 
ATOM   2480 C CG1 . ILE B 2 122 ? 32.208 27.088  -8.213  1.00 55.60  ? 122 ILE L CG1 1 
ATOM   2481 C CG2 . ILE B 2 122 ? 30.956 28.915  -9.390  1.00 53.48  ? 122 ILE L CG2 1 
ATOM   2482 C CD1 . ILE B 2 122 ? 32.517 27.868  -6.953  1.00 56.46  ? 122 ILE L CD1 1 
ATOM   2483 N N   . PHE B 2 123 ? 30.681 25.132  -9.993  1.00 48.28  ? 123 PHE L N   1 
ATOM   2484 C CA  . PHE B 2 123 ? 29.491 24.298  -9.867  1.00 46.64  ? 123 PHE L CA  1 
ATOM   2485 C C   . PHE B 2 123 ? 29.355 23.729  -8.457  1.00 48.83  ? 123 PHE L C   1 
ATOM   2486 O O   . PHE B 2 123 ? 30.322 23.227  -7.877  1.00 44.11  ? 123 PHE L O   1 
ATOM   2487 C CB  . PHE B 2 123 ? 29.533 23.137  -10.869 1.00 47.18  ? 123 PHE L CB  1 
ATOM   2488 C CG  . PHE B 2 123 ? 29.783 23.561  -12.290 1.00 44.62  ? 123 PHE L CG  1 
ATOM   2489 C CD1 . PHE B 2 123 ? 31.052 23.964  -12.699 1.00 45.86  ? 123 PHE L CD1 1 
ATOM   2490 C CD2 . PHE B 2 123 ? 28.749 23.570  -13.218 1.00 44.06  ? 123 PHE L CD2 1 
ATOM   2491 C CE1 . PHE B 2 123 ? 31.283 24.371  -14.011 1.00 42.83  ? 123 PHE L CE1 1 
ATOM   2492 C CE2 . PHE B 2 123 ? 28.972 23.976  -14.533 1.00 43.54  ? 123 PHE L CE2 1 
ATOM   2493 C CZ  . PHE B 2 123 ? 30.242 24.377  -14.927 1.00 39.99  ? 123 PHE L CZ  1 
ATOM   2494 N N   . PRO B 2 124 ? 28.145 23.805  -7.884  1.00 49.58  ? 124 PRO L N   1 
ATOM   2495 C CA  . PRO B 2 124 ? 27.881 23.294  -6.538  1.00 50.72  ? 124 PRO L CA  1 
ATOM   2496 C C   . PRO B 2 124 ? 27.621 21.794  -6.592  1.00 49.73  ? 124 PRO L C   1 
ATOM   2497 O O   . PRO B 2 124 ? 27.332 21.251  -7.658  1.00 47.63  ? 124 PRO L O   1 
ATOM   2498 C CB  . PRO B 2 124 ? 26.643 24.077  -6.122  1.00 52.19  ? 124 PRO L CB  1 
ATOM   2499 C CG  . PRO B 2 124 ? 25.882 24.150  -7.407  1.00 54.03  ? 124 PRO L CG  1 
ATOM   2500 C CD  . PRO B 2 124 ? 26.961 24.502  -8.421  1.00 51.83  ? 124 PRO L CD  1 
ATOM   2501 N N   . PRO B 2 125 ? 27.718 21.104  -5.444  1.00 49.31  ? 125 PRO L N   1 
ATOM   2502 C CA  . PRO B 2 125 ? 27.478 19.660  -5.432  1.00 49.96  ? 125 PRO L CA  1 
ATOM   2503 C C   . PRO B 2 125 ? 26.199 19.335  -6.191  1.00 50.00  ? 125 PRO L C   1 
ATOM   2504 O O   . PRO B 2 125 ? 25.221 20.074  -6.112  1.00 49.38  ? 125 PRO L O   1 
ATOM   2505 C CB  . PRO B 2 125 ? 27.363 19.343  -3.943  1.00 49.66  ? 125 PRO L CB  1 
ATOM   2506 C CG  . PRO B 2 125 ? 28.293 20.331  -3.322  1.00 52.31  ? 125 PRO L CG  1 
ATOM   2507 C CD  . PRO B 2 125 ? 27.973 21.606  -4.082  1.00 50.41  ? 125 PRO L CD  1 
ATOM   2508 N N   . SER B 2 126 ? 26.214 18.241  -6.939  1.00 52.07  ? 126 SER L N   1 
ATOM   2509 C CA  . SER B 2 126 ? 25.041 17.838  -7.697  1.00 52.54  ? 126 SER L CA  1 
ATOM   2510 C C   . SER B 2 126 ? 24.045 17.172  -6.754  1.00 52.94  ? 126 SER L C   1 
ATOM   2511 O O   . SER B 2 126 ? 24.439 16.561  -5.757  1.00 50.89  ? 126 SER L O   1 
ATOM   2512 C CB  . SER B 2 126 ? 25.447 16.874  -8.812  1.00 54.89  ? 126 SER L CB  1 
ATOM   2513 O OG  . SER B 2 126 ? 24.317 16.389  -9.515  1.00 56.50  ? 126 SER L OG  1 
ATOM   2514 N N   . SER B 2 127 ? 22.758 17.301  -7.061  1.00 53.70  ? 127 SER L N   1 
ATOM   2515 C CA  . SER B 2 127 ? 21.717 16.705  -6.230  1.00 56.38  ? 127 SER L CA  1 
ATOM   2516 C C   . SER B 2 127 ? 21.931 15.200  -6.122  1.00 54.65  ? 127 SER L C   1 
ATOM   2517 O O   . SER B 2 127 ? 21.783 14.612  -5.051  1.00 52.54  ? 127 SER L O   1 
ATOM   2518 C CB  . SER B 2 127 ? 20.334 16.994  -6.823  1.00 59.07  ? 127 SER L CB  1 
ATOM   2519 O OG  . SER B 2 127 ? 20.241 16.538  -8.162  1.00 64.73  ? 127 SER L OG  1 
ATOM   2520 N N   . GLU B 2 128 ? 22.297 14.586  -7.241  1.00 56.11  ? 128 GLU L N   1 
ATOM   2521 C CA  . GLU B 2 128 ? 22.535 13.151  -7.281  1.00 58.22  ? 128 GLU L CA  1 
ATOM   2522 C C   . GLU B 2 128 ? 23.694 12.762  -6.369  1.00 57.55  ? 128 GLU L C   1 
ATOM   2523 O O   . GLU B 2 128 ? 23.701 11.673  -5.797  1.00 56.89  ? 128 GLU L O   1 
ATOM   2524 C CB  . GLU B 2 128 ? 22.830 12.717  -8.716  1.00 62.00  ? 128 GLU L CB  1 
ATOM   2525 C CG  . GLU B 2 128 ? 21.786 13.191  -9.715  1.00 68.60  ? 128 GLU L CG  1 
ATOM   2526 C CD  . GLU B 2 128 ? 22.128 12.821  -11.142 1.00 72.98  ? 128 GLU L CD  1 
ATOM   2527 O OE1 . GLU B 2 128 ? 21.403 13.263  -12.060 1.00 73.64  ? 128 GLU L OE1 1 
ATOM   2528 O OE2 . GLU B 2 128 ? 23.121 12.087  -11.346 1.00 76.04  ? 128 GLU L OE2 1 
ATOM   2529 N N   . GLN B 2 129 ? 24.672 13.653  -6.231  1.00 56.80  ? 129 GLN L N   1 
ATOM   2530 C CA  . GLN B 2 129 ? 25.828 13.378  -5.387  1.00 56.10  ? 129 GLN L CA  1 
ATOM   2531 C C   . GLN B 2 129 ? 25.489 13.548  -3.911  1.00 55.96  ? 129 GLN L C   1 
ATOM   2532 O O   . GLN B 2 129 ? 25.946 12.778  -3.067  1.00 55.20  ? 129 GLN L O   1 
ATOM   2533 C CB  . GLN B 2 129 ? 27.001 14.293  -5.751  1.00 53.19  ? 129 GLN L CB  1 
ATOM   2534 C CG  . GLN B 2 129 ? 28.134 14.238  -4.734  1.00 52.33  ? 129 GLN L CG  1 
ATOM   2535 C CD  . GLN B 2 129 ? 29.333 15.079  -5.122  1.00 52.17  ? 129 GLN L CD  1 
ATOM   2536 O OE1 . GLN B 2 129 ? 29.194 16.227  -5.537  1.00 51.91  ? 129 GLN L OE1 1 
ATOM   2537 N NE2 . GLN B 2 129 ? 30.525 14.511  -4.971  1.00 51.12  ? 129 GLN L NE2 1 
ATOM   2538 N N   . LEU B 2 130 ? 24.691 14.561  -3.600  1.00 57.50  ? 130 LEU L N   1 
ATOM   2539 C CA  . LEU B 2 130 ? 24.305 14.807  -2.219  1.00 58.38  ? 130 LEU L CA  1 
ATOM   2540 C C   . LEU B 2 130 ? 23.429 13.679  -1.688  1.00 60.43  ? 130 LEU L C   1 
ATOM   2541 O O   . LEU B 2 130 ? 23.531 13.309  -0.519  1.00 57.58  ? 130 LEU L O   1 
ATOM   2542 C CB  . LEU B 2 130 ? 23.566 16.140  -2.106  1.00 56.33  ? 130 LEU L CB  1 
ATOM   2543 C CG  . LEU B 2 130 ? 24.431 17.381  -2.327  1.00 56.82  ? 130 LEU L CG  1 
ATOM   2544 C CD1 . LEU B 2 130 ? 23.569 18.624  -2.267  1.00 59.28  ? 130 LEU L CD1 1 
ATOM   2545 C CD2 . LEU B 2 130 ? 25.524 17.437  -1.272  1.00 54.76  ? 130 LEU L CD2 1 
ATOM   2546 N N   . THR B 2 131 ? 22.578 13.127  -2.549  1.00 62.24  ? 131 THR L N   1 
ATOM   2547 C CA  . THR B 2 131 ? 21.691 12.043  -2.143  1.00 64.14  ? 131 THR L CA  1 
ATOM   2548 C C   . THR B 2 131 ? 22.486 10.821  -1.694  1.00 65.76  ? 131 THR L C   1 
ATOM   2549 O O   . THR B 2 131 ? 21.938 9.909   -1.073  1.00 65.15  ? 131 THR L O   1 
ATOM   2550 C CB  . THR B 2 131 ? 20.739 11.625  -3.287  1.00 65.17  ? 131 THR L CB  1 
ATOM   2551 O OG1 . THR B 2 131 ? 21.503 11.167  -4.408  1.00 68.36  ? 131 THR L OG1 1 
ATOM   2552 C CG2 . THR B 2 131 ? 19.870 12.799  -3.711  1.00 62.92  ? 131 THR L CG2 1 
ATOM   2553 N N   . SER B 2 132 ? 23.778 10.808  -2.008  1.00 67.12  ? 132 SER L N   1 
ATOM   2554 C CA  . SER B 2 132 ? 24.641 9.697   -1.620  1.00 67.75  ? 132 SER L CA  1 
ATOM   2555 C C   . SER B 2 132 ? 25.522 10.094  -0.438  1.00 66.45  ? 132 SER L C   1 
ATOM   2556 O O   . SER B 2 132 ? 26.341 9.303   0.031   1.00 65.17  ? 132 SER L O   1 
ATOM   2557 C CB  . SER B 2 132 ? 25.515 9.260   -2.798  1.00 68.41  ? 132 SER L CB  1 
ATOM   2558 O OG  . SER B 2 132 ? 26.440 10.271  -3.155  1.00 73.82  ? 132 SER L OG  1 
ATOM   2559 N N   . GLY B 2 133 ? 25.353 11.327  0.033   1.00 65.96  ? 133 GLY L N   1 
ATOM   2560 C CA  . GLY B 2 133 ? 26.129 11.798  1.166   1.00 65.53  ? 133 GLY L CA  1 
ATOM   2561 C C   . GLY B 2 133 ? 27.361 12.604  0.809   1.00 65.22  ? 133 GLY L C   1 
ATOM   2562 O O   . GLY B 2 133 ? 27.888 13.338  1.645   1.00 65.65  ? 133 GLY L O   1 
ATOM   2563 N N   . GLY B 2 134 ? 27.826 12.468  -0.430  1.00 65.36  ? 134 GLY L N   1 
ATOM   2564 C CA  . GLY B 2 134 ? 29.003 13.198  -0.863  1.00 61.73  ? 134 GLY L CA  1 
ATOM   2565 C C   . GLY B 2 134 ? 28.716 14.663  -1.121  1.00 59.75  ? 134 GLY L C   1 
ATOM   2566 O O   . GLY B 2 134 ? 27.559 15.080  -1.142  1.00 60.34  ? 134 GLY L O   1 
ATOM   2567 N N   . ALA B 2 135 ? 29.771 15.446  -1.319  1.00 58.65  ? 135 ALA L N   1 
ATOM   2568 C CA  . ALA B 2 135 ? 29.628 16.874  -1.576  1.00 57.54  ? 135 ALA L CA  1 
ATOM   2569 C C   . ALA B 2 135 ? 30.936 17.484  -2.073  1.00 56.05  ? 135 ALA L C   1 
ATOM   2570 O O   . ALA B 2 135 ? 31.817 17.817  -1.282  1.00 58.39  ? 135 ALA L O   1 
ATOM   2571 C CB  . ALA B 2 135 ? 29.171 17.585  -0.308  1.00 59.43  ? 135 ALA L CB  1 
ATOM   2572 N N   . SER B 2 136 ? 31.060 17.630  -3.387  1.00 53.29  ? 136 SER L N   1 
ATOM   2573 C CA  . SER B 2 136 ? 32.263 18.209  -3.972  1.00 49.25  ? 136 SER L CA  1 
ATOM   2574 C C   . SER B 2 136 ? 31.894 19.402  -4.845  1.00 45.20  ? 136 SER L C   1 
ATOM   2575 O O   . SER B 2 136 ? 30.949 19.337  -5.631  1.00 44.29  ? 136 SER L O   1 
ATOM   2576 C CB  . SER B 2 136 ? 32.999 17.167  -4.813  1.00 49.38  ? 136 SER L CB  1 
ATOM   2577 O OG  . SER B 2 136 ? 32.268 16.853  -5.983  1.00 52.58  ? 136 SER L OG  1 
ATOM   2578 N N   . VAL B 2 137 ? 32.634 20.493  -4.689  1.00 41.25  ? 137 VAL L N   1 
ATOM   2579 C CA  . VAL B 2 137 ? 32.388 21.695  -5.469  1.00 41.70  ? 137 VAL L CA  1 
ATOM   2580 C C   . VAL B 2 137 ? 33.486 21.797  -6.528  1.00 41.27  ? 137 VAL L C   1 
ATOM   2581 O O   . VAL B 2 137 ? 34.675 21.657  -6.229  1.00 39.20  ? 137 VAL L O   1 
ATOM   2582 C CB  . VAL B 2 137 ? 32.386 22.952  -4.563  1.00 43.82  ? 137 VAL L CB  1 
ATOM   2583 C CG1 . VAL B 2 137 ? 33.720 23.085  -3.853  1.00 48.51  ? 137 VAL L CG1 1 
ATOM   2584 C CG2 . VAL B 2 137 ? 32.081 24.191  -5.387  1.00 43.35  ? 137 VAL L CG2 1 
ATOM   2585 N N   . VAL B 2 138 ? 33.076 22.037  -7.767  1.00 43.55  ? 138 VAL L N   1 
ATOM   2586 C CA  . VAL B 2 138 ? 34.011 22.110  -8.881  1.00 45.57  ? 138 VAL L CA  1 
ATOM   2587 C C   . VAL B 2 138 ? 33.986 23.435  -9.630  1.00 46.22  ? 138 VAL L C   1 
ATOM   2588 O O   . VAL B 2 138 ? 32.940 24.056  -9.783  1.00 45.45  ? 138 VAL L O   1 
ATOM   2589 C CB  . VAL B 2 138 ? 33.716 20.988  -9.905  1.00 43.45  ? 138 VAL L CB  1 
ATOM   2590 C CG1 . VAL B 2 138 ? 34.732 21.025  -11.036 1.00 47.42  ? 138 VAL L CG1 1 
ATOM   2591 C CG2 . VAL B 2 138 ? 33.726 19.637  -9.213  1.00 46.18  ? 138 VAL L CG2 1 
ATOM   2592 N N   . CYS B 2 139 ? 35.155 23.862  -10.091 1.00 51.69  ? 139 CYS L N   1 
ATOM   2593 C CA  . CYS B 2 139 ? 35.269 25.083  -10.871 1.00 56.72  ? 139 CYS L CA  1 
ATOM   2594 C C   . CYS B 2 139 ? 36.441 24.980  -11.837 1.00 54.31  ? 139 CYS L C   1 
ATOM   2595 O O   . CYS B 2 139 ? 37.552 24.605  -11.461 1.00 51.57  ? 139 CYS L O   1 
ATOM   2596 C CB  . CYS B 2 139 ? 35.403 26.317  -9.970  1.00 62.72  ? 139 CYS L CB  1 
ATOM   2597 S SG  . CYS B 2 139 ? 36.739 26.323  -8.737  1.00 75.00  ? 139 CYS L SG  1 
ATOM   2598 N N   . PHE B 2 140 ? 36.168 25.300  -13.096 1.00 52.60  ? 140 PHE L N   1 
ATOM   2599 C CA  . PHE B 2 140 ? 37.176 25.231  -14.140 1.00 53.31  ? 140 PHE L CA  1 
ATOM   2600 C C   . PHE B 2 140 ? 37.782 26.588  -14.475 1.00 53.09  ? 140 PHE L C   1 
ATOM   2601 O O   . PHE B 2 140 ? 37.083 27.600  -14.535 1.00 54.16  ? 140 PHE L O   1 
ATOM   2602 C CB  . PHE B 2 140 ? 36.571 24.653  -15.426 1.00 50.24  ? 140 PHE L CB  1 
ATOM   2603 C CG  . PHE B 2 140 ? 35.915 23.312  -15.252 1.00 52.25  ? 140 PHE L CG  1 
ATOM   2604 C CD1 . PHE B 2 140 ? 36.622 22.235  -14.730 1.00 50.46  ? 140 PHE L CD1 1 
ATOM   2605 C CD2 . PHE B 2 140 ? 34.599 23.115  -15.660 1.00 51.50  ? 140 PHE L CD2 1 
ATOM   2606 C CE1 . PHE B 2 140 ? 36.030 20.979  -14.622 1.00 50.66  ? 140 PHE L CE1 1 
ATOM   2607 C CE2 . PHE B 2 140 ? 33.999 21.863  -15.555 1.00 52.02  ? 140 PHE L CE2 1 
ATOM   2608 C CZ  . PHE B 2 140 ? 34.716 20.794  -15.037 1.00 50.90  ? 140 PHE L CZ  1 
ATOM   2609 N N   . LEU B 2 141 ? 39.094 26.591  -14.680 1.00 51.05  ? 141 LEU L N   1 
ATOM   2610 C CA  . LEU B 2 141 ? 39.831 27.781  -15.085 1.00 49.19  ? 141 LEU L CA  1 
ATOM   2611 C C   . LEU B 2 141 ? 40.358 27.318  -16.433 1.00 48.41  ? 141 LEU L C   1 
ATOM   2612 O O   . LEU B 2 141 ? 41.430 26.718  -16.524 1.00 48.67  ? 141 LEU L O   1 
ATOM   2613 C CB  . LEU B 2 141 ? 40.984 28.071  -14.123 1.00 49.49  ? 141 LEU L CB  1 
ATOM   2614 C CG  . LEU B 2 141 ? 40.612 28.671  -12.762 1.00 53.17  ? 141 LEU L CG  1 
ATOM   2615 C CD1 . LEU B 2 141 ? 39.656 27.752  -12.026 1.00 52.94  ? 141 LEU L CD1 1 
ATOM   2616 C CD2 . LEU B 2 141 ? 41.876 28.892  -11.946 1.00 50.38  ? 141 LEU L CD2 1 
ATOM   2617 N N   . ASN B 2 142 ? 39.578 27.579  -17.476 1.00 44.88  ? 142 ASN L N   1 
ATOM   2618 C CA  . ASN B 2 142 ? 39.919 27.133  -18.817 1.00 43.67  ? 142 ASN L CA  1 
ATOM   2619 C C   . ASN B 2 142 ? 40.559 28.137  -19.764 1.00 44.79  ? 142 ASN L C   1 
ATOM   2620 O O   . ASN B 2 142 ? 40.406 29.352  -19.625 1.00 42.79  ? 142 ASN L O   1 
ATOM   2621 C CB  . ASN B 2 142 ? 38.669 26.556  -19.487 1.00 40.33  ? 142 ASN L CB  1 
ATOM   2622 C CG  . ASN B 2 142 ? 38.137 25.322  -18.775 1.00 38.88  ? 142 ASN L CG  1 
ATOM   2623 O OD1 . ASN B 2 142 ? 37.073 24.812  -19.117 1.00 43.15  ? 142 ASN L OD1 1 
ATOM   2624 N ND2 . ASN B 2 142 ? 38.879 24.834  -17.788 1.00 34.55  ? 142 ASN L ND2 1 
ATOM   2625 N N   . ASN B 2 143 ? 41.280 27.587  -20.734 1.00 46.57  ? 143 ASN L N   1 
ATOM   2626 C CA  . ASN B 2 143 ? 41.952 28.345  -21.780 1.00 44.87  ? 143 ASN L CA  1 
ATOM   2627 C C   . ASN B 2 143 ? 42.715 29.602  -21.363 1.00 44.03  ? 143 ASN L C   1 
ATOM   2628 O O   . ASN B 2 143 ? 42.422 30.702  -21.836 1.00 44.37  ? 143 ASN L O   1 
ATOM   2629 C CB  . ASN B 2 143 ? 40.937 28.697  -22.867 1.00 46.61  ? 143 ASN L CB  1 
ATOM   2630 C CG  . ASN B 2 143 ? 40.219 27.474  -23.403 1.00 51.47  ? 143 ASN L CG  1 
ATOM   2631 O OD1 . ASN B 2 143 ? 39.551 26.759  -22.658 1.00 53.87  ? 143 ASN L OD1 1 
ATOM   2632 N ND2 . ASN B 2 143 ? 40.359 27.224  -24.699 1.00 53.81  ? 143 ASN L ND2 1 
ATOM   2633 N N   . PHE B 2 144 ? 43.701 29.437  -20.488 1.00 42.41  ? 144 PHE L N   1 
ATOM   2634 C CA  . PHE B 2 144 ? 44.514 30.564  -20.055 1.00 41.32  ? 144 PHE L CA  1 
ATOM   2635 C C   . PHE B 2 144 ? 45.962 30.387  -20.517 1.00 42.03  ? 144 PHE L C   1 
ATOM   2636 O O   . PHE B 2 144 ? 46.357 29.299  -20.921 1.00 37.21  ? 144 PHE L O   1 
ATOM   2637 C CB  . PHE B 2 144 ? 44.472 30.723  -18.530 1.00 38.34  ? 144 PHE L CB  1 
ATOM   2638 C CG  . PHE B 2 144 ? 44.916 29.502  -17.764 1.00 40.41  ? 144 PHE L CG  1 
ATOM   2639 C CD1 . PHE B 2 144 ? 44.024 28.468  -17.490 1.00 35.29  ? 144 PHE L CD1 1 
ATOM   2640 C CD2 . PHE B 2 144 ? 46.216 29.407  -17.278 1.00 38.56  ? 144 PHE L CD2 1 
ATOM   2641 C CE1 . PHE B 2 144 ? 44.420 27.364  -16.739 1.00 35.41  ? 144 PHE L CE1 1 
ATOM   2642 C CE2 . PHE B 2 144 ? 46.624 28.305  -16.523 1.00 40.10  ? 144 PHE L CE2 1 
ATOM   2643 C CZ  . PHE B 2 144 ? 45.722 27.281  -16.252 1.00 35.72  ? 144 PHE L CZ  1 
ATOM   2644 N N   . TYR B 2 145 ? 46.737 31.468  -20.459 1.00 42.07  ? 145 TYR L N   1 
ATOM   2645 C CA  . TYR B 2 145 ? 48.144 31.455  -20.856 1.00 43.29  ? 145 TYR L CA  1 
ATOM   2646 C C   . TYR B 2 145 ? 48.849 32.667  -20.243 1.00 42.04  ? 145 TYR L C   1 
ATOM   2647 O O   . TYR B 2 145 ? 48.317 33.774  -20.280 1.00 42.68  ? 145 TYR L O   1 
ATOM   2648 C CB  . TYR B 2 145 ? 48.276 31.524  -22.380 1.00 42.73  ? 145 TYR L CB  1 
ATOM   2649 C CG  . TYR B 2 145 ? 49.697 31.316  -22.858 1.00 44.44  ? 145 TYR L CG  1 
ATOM   2650 C CD1 . TYR B 2 145 ? 50.216 30.031  -23.025 1.00 40.29  ? 145 TYR L CD1 1 
ATOM   2651 C CD2 . TYR B 2 145 ? 50.542 32.401  -23.086 1.00 43.13  ? 145 TYR L CD2 1 
ATOM   2652 C CE1 . TYR B 2 145 ? 51.539 29.832  -23.403 1.00 41.63  ? 145 TYR L CE1 1 
ATOM   2653 C CE2 . TYR B 2 145 ? 51.872 32.212  -23.461 1.00 44.48  ? 145 TYR L CE2 1 
ATOM   2654 C CZ  . TYR B 2 145 ? 52.362 30.926  -23.617 1.00 42.97  ? 145 TYR L CZ  1 
ATOM   2655 O OH  . TYR B 2 145 ? 53.677 30.735  -23.971 1.00 44.44  ? 145 TYR L OH  1 
ATOM   2656 N N   . PRO B 2 146 ? 50.062 32.483  -19.692 1.00 46.15  ? 146 PRO L N   1 
ATOM   2657 C CA  . PRO B 2 146 ? 50.886 31.272  -19.563 1.00 48.99  ? 146 PRO L CA  1 
ATOM   2658 C C   . PRO B 2 146 ? 50.246 30.185  -18.700 1.00 52.63  ? 146 PRO L C   1 
ATOM   2659 O O   . PRO B 2 146 ? 49.102 30.319  -18.262 1.00 53.68  ? 146 PRO L O   1 
ATOM   2660 C CB  . PRO B 2 146 ? 52.178 31.796  -18.938 1.00 49.75  ? 146 PRO L CB  1 
ATOM   2661 C CG  . PRO B 2 146 ? 52.225 33.220  -19.381 1.00 50.35  ? 146 PRO L CG  1 
ATOM   2662 C CD  . PRO B 2 146 ? 50.802 33.652  -19.190 1.00 48.68  ? 146 PRO L CD  1 
ATOM   2663 N N   . LYS B 2 147 ? 50.996 29.117  -18.439 1.00 54.15  ? 147 LYS L N   1 
ATOM   2664 C CA  . LYS B 2 147 ? 50.471 28.021  -17.636 1.00 57.88  ? 147 LYS L CA  1 
ATOM   2665 C C   . LYS B 2 147 ? 50.524 28.295  -16.137 1.00 58.09  ? 147 LYS L C   1 
ATOM   2666 O O   . LYS B 2 147 ? 49.832 27.638  -15.365 1.00 56.07  ? 147 LYS L O   1 
ATOM   2667 C CB  . LYS B 2 147 ? 51.209 26.713  -17.947 1.00 59.74  ? 147 LYS L CB  1 
ATOM   2668 C CG  . LYS B 2 147 ? 52.636 26.619  -17.430 1.00 65.39  ? 147 LYS L CG  1 
ATOM   2669 C CD  . LYS B 2 147 ? 53.630 27.265  -18.376 1.00 70.35  ? 147 LYS L CD  1 
ATOM   2670 C CE  . LYS B 2 147 ? 55.060 26.923  -17.985 1.00 72.11  ? 147 LYS L CE  1 
ATOM   2671 N NZ  . LYS B 2 147 ? 56.057 27.458  -18.956 1.00 76.24  ? 147 LYS L NZ  1 
ATOM   2672 N N   . ASP B 2 148 ? 51.342 29.261  -15.728 1.00 60.45  ? 148 ASP L N   1 
ATOM   2673 C CA  . ASP B 2 148 ? 51.462 29.606  -14.313 1.00 63.00  ? 148 ASP L CA  1 
ATOM   2674 C C   . ASP B 2 148 ? 50.206 30.303  -13.815 1.00 61.36  ? 148 ASP L C   1 
ATOM   2675 O O   . ASP B 2 148 ? 49.826 31.359  -14.319 1.00 58.99  ? 148 ASP L O   1 
ATOM   2676 C CB  . ASP B 2 148 ? 52.678 30.506  -14.080 1.00 68.70  ? 148 ASP L CB  1 
ATOM   2677 C CG  . ASP B 2 148 ? 53.984 29.734  -14.097 1.00 74.40  ? 148 ASP L CG  1 
ATOM   2678 O OD1 . ASP B 2 148 ? 54.225 28.986  -15.069 1.00 78.46  ? 148 ASP L OD1 1 
ATOM   2679 O OD2 . ASP B 2 148 ? 54.772 29.878  -13.137 1.00 76.89  ? 148 ASP L OD2 1 
ATOM   2680 N N   . ILE B 2 149 ? 49.568 29.704  -12.815 1.00 61.35  ? 149 ILE L N   1 
ATOM   2681 C CA  . ILE B 2 149 ? 48.343 30.253  -12.252 1.00 62.05  ? 149 ILE L CA  1 
ATOM   2682 C C   . ILE B 2 149 ? 48.138 29.681  -10.848 1.00 63.34  ? 149 ILE L C   1 
ATOM   2683 O O   . ILE B 2 149 ? 48.823 28.736  -10.451 1.00 62.55  ? 149 ILE L O   1 
ATOM   2684 C CB  . ILE B 2 149 ? 47.138 29.896  -13.153 1.00 59.59  ? 149 ILE L CB  1 
ATOM   2685 C CG1 . ILE B 2 149 ? 45.969 30.834  -12.869 1.00 59.27  ? 149 ILE L CG1 1 
ATOM   2686 C CG2 . ILE B 2 149 ? 46.734 28.450  -12.933 1.00 57.05  ? 149 ILE L CG2 1 
ATOM   2687 C CD1 . ILE B 2 149 ? 44.795 30.658  -13.815 1.00 57.95  ? 149 ILE L CD1 1 
ATOM   2688 N N   . ASN B 2 150 ? 47.205 30.254  -10.095 1.00 64.63  ? 150 ASN L N   1 
ATOM   2689 C CA  . ASN B 2 150 ? 46.938 29.778  -8.742  1.00 67.40  ? 150 ASN L CA  1 
ATOM   2690 C C   . ASN B 2 150 ? 45.496 30.014  -8.311  1.00 66.44  ? 150 ASN L C   1 
ATOM   2691 O O   . ASN B 2 150 ? 44.948 31.101  -8.490  1.00 65.00  ? 150 ASN L O   1 
ATOM   2692 C CB  . ASN B 2 150 ? 47.898 30.448  -7.755  1.00 73.07  ? 150 ASN L CB  1 
ATOM   2693 C CG  . ASN B 2 150 ? 47.955 31.952  -7.927  1.00 79.56  ? 150 ASN L CG  1 
ATOM   2694 O OD1 . ASN B 2 150 ? 46.962 32.653  -7.720  1.00 83.47  ? 150 ASN L OD1 1 
ATOM   2695 N ND2 . ASN B 2 150 ? 49.121 32.459  -8.315  1.00 80.71  ? 150 ASN L ND2 1 
ATOM   2696 N N   . VAL B 2 151 ? 44.887 28.983  -7.738  1.00 64.19  ? 151 VAL L N   1 
ATOM   2697 C CA  . VAL B 2 151 ? 43.506 29.065  -7.286  1.00 64.04  ? 151 VAL L CA  1 
ATOM   2698 C C   . VAL B 2 151 ? 43.429 28.999  -5.762  1.00 65.10  ? 151 VAL L C   1 
ATOM   2699 O O   . VAL B 2 151 ? 44.235 28.326  -5.117  1.00 63.45  ? 151 VAL L O   1 
ATOM   2700 C CB  . VAL B 2 151 ? 42.668 27.914  -7.883  1.00 62.28  ? 151 VAL L CB  1 
ATOM   2701 C CG1 . VAL B 2 151 ? 43.206 26.579  -7.393  1.00 62.33  ? 151 VAL L CG1 1 
ATOM   2702 C CG2 . VAL B 2 151 ? 41.206 28.079  -7.509  1.00 61.67  ? 151 VAL L CG2 1 
ATOM   2703 N N   . LYS B 2 152 ? 42.452 29.700  -5.194  1.00 67.40  ? 152 LYS L N   1 
ATOM   2704 C CA  . LYS B 2 152 ? 42.265 29.724  -3.747  1.00 66.99  ? 152 LYS L CA  1 
ATOM   2705 C C   . LYS B 2 152 ? 40.786 29.591  -3.399  1.00 65.58  ? 152 LYS L C   1 
ATOM   2706 O O   . LYS B 2 152 ? 39.929 30.198  -4.045  1.00 62.46  ? 152 LYS L O   1 
ATOM   2707 C CB  . LYS B 2 152 ? 42.821 31.029  -3.167  1.00 69.10  ? 152 LYS L CB  1 
ATOM   2708 C CG  . LYS B 2 152 ? 42.709 31.141  -1.654  1.00 71.15  ? 152 LYS L CG  1 
ATOM   2709 C CD  . LYS B 2 152 ? 43.360 32.417  -1.136  1.00 72.63  ? 152 LYS L CD  1 
ATOM   2710 C CE  . LYS B 2 152 ? 42.668 33.663  -1.671  1.00 73.46  ? 152 LYS L CE  1 
ATOM   2711 N NZ  . LYS B 2 152 ? 43.287 34.920  -1.158  1.00 71.58  ? 152 LYS L NZ  1 
ATOM   2712 N N   . TRP B 2 153 ? 40.492 28.788  -2.381  1.00 65.63  ? 153 TRP L N   1 
ATOM   2713 C CA  . TRP B 2 153 ? 39.114 28.578  -1.952  1.00 66.29  ? 153 TRP L CA  1 
ATOM   2714 C C   . TRP B 2 153 ? 38.758 29.337  -0.676  1.00 66.41  ? 153 TRP L C   1 
ATOM   2715 O O   . TRP B 2 153 ? 39.580 29.477  0.229   1.00 65.46  ? 153 TRP L O   1 
ATOM   2716 C CB  . TRP B 2 153 ? 38.838 27.087  -1.732  1.00 64.56  ? 153 TRP L CB  1 
ATOM   2717 C CG  . TRP B 2 153 ? 38.761 26.282  -2.992  1.00 61.78  ? 153 TRP L CG  1 
ATOM   2718 C CD1 . TRP B 2 153 ? 39.796 25.691  -3.654  1.00 61.32  ? 153 TRP L CD1 1 
ATOM   2719 C CD2 . TRP B 2 153 ? 37.580 25.986  -3.746  1.00 59.58  ? 153 TRP L CD2 1 
ATOM   2720 N NE1 . TRP B 2 153 ? 39.334 25.042  -4.775  1.00 59.67  ? 153 TRP L NE1 1 
ATOM   2721 C CE2 . TRP B 2 153 ? 37.977 25.208  -4.855  1.00 59.07  ? 153 TRP L CE2 1 
ATOM   2722 C CE3 . TRP B 2 153 ? 36.223 26.304  -3.593  1.00 58.16  ? 153 TRP L CE3 1 
ATOM   2723 C CZ2 . TRP B 2 153 ? 37.066 24.741  -5.808  1.00 58.88  ? 153 TRP L CZ2 1 
ATOM   2724 C CZ3 . TRP B 2 153 ? 35.317 25.842  -4.540  1.00 58.08  ? 153 TRP L CZ3 1 
ATOM   2725 C CH2 . TRP B 2 153 ? 35.744 25.067  -5.634  1.00 60.03  ? 153 TRP L CH2 1 
ATOM   2726 N N   . LYS B 2 154 ? 37.520 29.818  -0.618  1.00 69.20  ? 154 LYS L N   1 
ATOM   2727 C CA  . LYS B 2 154 ? 37.023 30.550  0.540   1.00 71.20  ? 154 LYS L CA  1 
ATOM   2728 C C   . LYS B 2 154 ? 35.594 30.125  0.867   1.00 71.99  ? 154 LYS L C   1 
ATOM   2729 O O   . LYS B 2 154 ? 34.677 30.338  0.074   1.00 72.54  ? 154 LYS L O   1 
ATOM   2730 C CB  . LYS B 2 154 ? 37.042 32.058  0.281   1.00 72.45  ? 154 LYS L CB  1 
ATOM   2731 C CG  . LYS B 2 154 ? 38.418 32.658  0.078   1.00 72.92  ? 154 LYS L CG  1 
ATOM   2732 C CD  . LYS B 2 154 ? 38.320 34.173  -0.057  1.00 74.44  ? 154 LYS L CD  1 
ATOM   2733 C CE  . LYS B 2 154 ? 39.680 34.801  -0.303  1.00 76.98  ? 154 LYS L CE  1 
ATOM   2734 N NZ  . LYS B 2 154 ? 40.648 34.482  0.783   1.00 78.96  ? 154 LYS L NZ  1 
ATOM   2735 N N   . ILE B 2 155 ? 35.408 29.524  2.037   1.00 72.55  ? 155 ILE L N   1 
ATOM   2736 C CA  . ILE B 2 155 ? 34.085 29.088  2.470   1.00 72.99  ? 155 ILE L CA  1 
ATOM   2737 C C   . ILE B 2 155 ? 33.580 30.055  3.536   1.00 74.14  ? 155 ILE L C   1 
ATOM   2738 O O   . ILE B 2 155 ? 34.104 30.092  4.651   1.00 74.47  ? 155 ILE L O   1 
ATOM   2739 C CB  . ILE B 2 155 ? 34.131 27.666  3.062   1.00 72.51  ? 155 ILE L CB  1 
ATOM   2740 C CG1 . ILE B 2 155 ? 34.661 26.684  2.014   1.00 69.64  ? 155 ILE L CG1 1 
ATOM   2741 C CG2 . ILE B 2 155 ? 32.740 27.251  3.522   1.00 72.34  ? 155 ILE L CG2 1 
ATOM   2742 C CD1 . ILE B 2 155 ? 34.811 25.264  2.522   1.00 69.34  ? 155 ILE L CD1 1 
ATOM   2743 N N   . ASP B 2 156 ? 32.563 30.837  3.187   1.00 75.27  ? 156 ASP L N   1 
ATOM   2744 C CA  . ASP B 2 156 ? 32.002 31.817  4.111   1.00 77.08  ? 156 ASP L CA  1 
ATOM   2745 C C   . ASP B 2 156 ? 33.064 32.840  4.502   1.00 77.49  ? 156 ASP L C   1 
ATOM   2746 O O   . ASP B 2 156 ? 33.183 33.212  5.671   1.00 78.70  ? 156 ASP L O   1 
ATOM   2747 C CB  . ASP B 2 156 ? 31.457 31.125  5.368   1.00 76.27  ? 156 ASP L CB  1 
ATOM   2748 C CG  . ASP B 2 156 ? 30.127 30.436  5.126   1.00 75.41  ? 156 ASP L CG  1 
ATOM   2749 O OD1 . ASP B 2 156 ? 29.156 31.133  4.767   1.00 76.44  ? 156 ASP L OD1 1 
ATOM   2750 O OD2 . ASP B 2 156 ? 30.049 29.202  5.296   1.00 75.99  ? 156 ASP L OD2 1 
ATOM   2751 N N   . GLY B 2 157 ? 33.838 33.285  3.516   1.00 77.42  ? 157 GLY L N   1 
ATOM   2752 C CA  . GLY B 2 157 ? 34.875 34.268  3.771   1.00 76.60  ? 157 GLY L CA  1 
ATOM   2753 C C   . GLY B 2 157 ? 36.187 33.702  4.284   1.00 77.28  ? 157 GLY L C   1 
ATOM   2754 O O   . GLY B 2 157 ? 37.215 34.376  4.227   1.00 78.61  ? 157 GLY L O   1 
ATOM   2755 N N   . SER B 2 158 ? 36.161 32.472  4.791   1.00 77.87  ? 158 SER L N   1 
ATOM   2756 C CA  . SER B 2 158 ? 37.371 31.839  5.313   1.00 79.27  ? 158 SER L CA  1 
ATOM   2757 C C   . SER B 2 158 ? 38.045 30.983  4.242   1.00 80.41  ? 158 SER L C   1 
ATOM   2758 O O   . SER B 2 158 ? 37.371 30.384  3.406   1.00 80.27  ? 158 SER L O   1 
ATOM   2759 C CB  . SER B 2 158 ? 37.029 30.975  6.530   1.00 79.87  ? 158 SER L CB  1 
ATOM   2760 O OG  . SER B 2 158 ? 38.190 30.363  7.065   1.00 80.45  ? 158 SER L OG  1 
ATOM   2761 N N   . GLU B 2 159 ? 39.374 30.928  4.270   1.00 81.44  ? 159 GLU L N   1 
ATOM   2762 C CA  . GLU B 2 159 ? 40.123 30.145  3.291   1.00 83.32  ? 159 GLU L CA  1 
ATOM   2763 C C   . GLU B 2 159 ? 40.183 28.665  3.646   1.00 83.33  ? 159 GLU L C   1 
ATOM   2764 O O   . GLU B 2 159 ? 40.683 28.287  4.707   1.00 82.14  ? 159 GLU L O   1 
ATOM   2765 C CB  . GLU B 2 159 ? 41.550 30.681  3.145   1.00 86.24  ? 159 GLU L CB  1 
ATOM   2766 C CG  . GLU B 2 159 ? 41.645 32.076  2.554   1.00 91.23  ? 159 GLU L CG  1 
ATOM   2767 C CD  . GLU B 2 159 ? 43.071 32.472  2.214   1.00 93.97  ? 159 GLU L CD  1 
ATOM   2768 O OE1 . GLU B 2 159 ? 43.285 33.633  1.804   1.00 95.56  ? 159 GLU L OE1 1 
ATOM   2769 O OE2 . GLU B 2 159 ? 43.977 31.621  2.351   1.00 95.28  ? 159 GLU L OE2 1 
ATOM   2770 N N   . ARG B 2 160 ? 39.671 27.833  2.745   1.00 83.41  ? 160 ARG L N   1 
ATOM   2771 C CA  . ARG B 2 160 ? 39.667 26.388  2.938   1.00 83.24  ? 160 ARG L CA  1 
ATOM   2772 C C   . ARG B 2 160 ? 40.711 25.776  2.010   1.00 81.47  ? 160 ARG L C   1 
ATOM   2773 O O   . ARG B 2 160 ? 40.442 25.513  0.839   1.00 80.89  ? 160 ARG L O   1 
ATOM   2774 C CB  . ARG B 2 160 ? 38.280 25.818  2.622   1.00 85.54  ? 160 ARG L CB  1 
ATOM   2775 C CG  . ARG B 2 160 ? 38.116 24.332  2.914   1.00 88.29  ? 160 ARG L CG  1 
ATOM   2776 C CD  . ARG B 2 160 ? 38.368 24.022  4.384   1.00 92.72  ? 160 ARG L CD  1 
ATOM   2777 N NE  . ARG B 2 160 ? 37.953 22.667  4.741   1.00 96.42  ? 160 ARG L NE  1 
ATOM   2778 C CZ  . ARG B 2 160 ? 36.691 22.250  4.749   1.00 97.14  ? 160 ARG L CZ  1 
ATOM   2779 N NH1 . ARG B 2 160 ? 35.713 23.083  4.422   1.00 98.80  ? 160 ARG L NH1 1 
ATOM   2780 N NH2 . ARG B 2 160 ? 36.404 20.999  5.083   1.00 98.24  ? 160 ARG L NH2 1 
ATOM   2781 N N   . GLN B 2 161 ? 41.908 25.561  2.543   1.00 80.92  ? 161 GLN L N   1 
ATOM   2782 C CA  . GLN B 2 161 ? 43.005 24.993  1.772   1.00 79.59  ? 161 GLN L CA  1 
ATOM   2783 C C   . GLN B 2 161 ? 42.996 23.471  1.824   1.00 79.03  ? 161 GLN L C   1 
ATOM   2784 O O   . GLN B 2 161 ? 43.439 22.803  0.890   1.00 79.94  ? 161 GLN L O   1 
ATOM   2785 C CB  . GLN B 2 161 ? 44.338 25.518  2.310   1.00 81.07  ? 161 GLN L CB  1 
ATOM   2786 C CG  . GLN B 2 161 ? 45.563 25.008  1.571   1.00 82.34  ? 161 GLN L CG  1 
ATOM   2787 C CD  . GLN B 2 161 ? 46.855 25.556  2.146   1.00 82.44  ? 161 GLN L CD  1 
ATOM   2788 O OE1 . GLN B 2 161 ? 47.182 25.317  3.310   1.00 81.21  ? 161 GLN L OE1 1 
ATOM   2789 N NE2 . GLN B 2 161 ? 47.597 26.299  1.331   1.00 82.65  ? 161 GLN L NE2 1 
ATOM   2790 N N   . ASN B 2 162 ? 42.485 22.926  2.921   1.00 77.34  ? 162 ASN L N   1 
ATOM   2791 C CA  . ASN B 2 162 ? 42.434 21.482  3.101   1.00 75.21  ? 162 ASN L CA  1 
ATOM   2792 C C   . ASN B 2 162 ? 41.287 20.859  2.309   1.00 72.35  ? 162 ASN L C   1 
ATOM   2793 O O   . ASN B 2 162 ? 40.203 21.431  2.216   1.00 71.99  ? 162 ASN L O   1 
ATOM   2794 C CB  . ASN B 2 162 ? 42.281 21.153  4.590   1.00 77.32  ? 162 ASN L CB  1 
ATOM   2795 C CG  . ASN B 2 162 ? 42.615 19.708  4.907   1.00 79.88  ? 162 ASN L CG  1 
ATOM   2796 O OD1 . ASN B 2 162 ? 43.730 19.249  4.655   1.00 81.27  ? 162 ASN L OD1 1 
ATOM   2797 N ND2 . ASN B 2 162 ? 41.652 18.984  5.465   1.00 80.25  ? 162 ASN L ND2 1 
ATOM   2798 N N   . GLY B 2 163 ? 41.542 19.690  1.729   1.00 69.49  ? 163 GLY L N   1 
ATOM   2799 C CA  . GLY B 2 163 ? 40.519 18.998  0.964   1.00 69.40  ? 163 GLY L CA  1 
ATOM   2800 C C   . GLY B 2 163 ? 40.373 19.407  -0.493  1.00 68.89  ? 163 GLY L C   1 
ATOM   2801 O O   . GLY B 2 163 ? 39.441 18.966  -1.170  1.00 67.41  ? 163 GLY L O   1 
ATOM   2802 N N   . VAL B 2 164 ? 41.284 20.241  -0.986  1.00 67.23  ? 164 VAL L N   1 
ATOM   2803 C CA  . VAL B 2 164 ? 41.216 20.688  -2.374  1.00 64.30  ? 164 VAL L CA  1 
ATOM   2804 C C   . VAL B 2 164 ? 42.181 19.926  -3.277  1.00 60.84  ? 164 VAL L C   1 
ATOM   2805 O O   . VAL B 2 164 ? 43.327 19.671  -2.909  1.00 60.91  ? 164 VAL L O   1 
ATOM   2806 C CB  . VAL B 2 164 ? 41.519 22.197  -2.495  1.00 64.32  ? 164 VAL L CB  1 
ATOM   2807 C CG1 . VAL B 2 164 ? 42.940 22.483  -2.048  1.00 64.78  ? 164 VAL L CG1 1 
ATOM   2808 C CG2 . VAL B 2 164 ? 41.313 22.650  -3.928  1.00 65.54  ? 164 VAL L CG2 1 
ATOM   2809 N N   . LEU B 2 165 ? 41.702 19.559  -4.461  1.00 57.50  ? 165 LEU L N   1 
ATOM   2810 C CA  . LEU B 2 165 ? 42.515 18.839  -5.435  1.00 55.01  ? 165 LEU L CA  1 
ATOM   2811 C C   . LEU B 2 165 ? 42.535 19.597  -6.762  1.00 53.21  ? 165 LEU L C   1 
ATOM   2812 O O   . LEU B 2 165 ? 41.499 20.059  -7.243  1.00 52.71  ? 165 LEU L O   1 
ATOM   2813 C CB  . LEU B 2 165 ? 41.965 17.428  -5.654  1.00 54.04  ? 165 LEU L CB  1 
ATOM   2814 C CG  . LEU B 2 165 ? 42.146 16.430  -4.509  1.00 54.69  ? 165 LEU L CG  1 
ATOM   2815 C CD1 . LEU B 2 165 ? 41.435 15.130  -4.855  1.00 55.89  ? 165 LEU L CD1 1 
ATOM   2816 C CD2 . LEU B 2 165 ? 43.629 16.185  -4.262  1.00 53.77  ? 165 LEU L CD2 1 
ATOM   2817 N N   . ASN B 2 166 ? 43.720 19.724  -7.347  1.00 48.75  ? 166 ASN L N   1 
ATOM   2818 C CA  . ASN B 2 166 ? 43.867 20.435  -8.605  1.00 45.58  ? 166 ASN L CA  1 
ATOM   2819 C C   . ASN B 2 166 ? 44.436 19.532  -9.694  1.00 42.96  ? 166 ASN L C   1 
ATOM   2820 O O   . ASN B 2 166 ? 45.271 18.668  -9.428  1.00 39.63  ? 166 ASN L O   1 
ATOM   2821 C CB  . ASN B 2 166 ? 44.770 21.653  -8.409  1.00 45.43  ? 166 ASN L CB  1 
ATOM   2822 C CG  . ASN B 2 166 ? 44.251 22.594  -7.337  1.00 46.13  ? 166 ASN L CG  1 
ATOM   2823 O OD1 . ASN B 2 166 ? 43.106 23.038  -7.388  1.00 43.64  ? 166 ASN L OD1 1 
ATOM   2824 N ND2 . ASN B 2 166 ? 45.095 22.904  -6.362  1.00 44.27  ? 166 ASN L ND2 1 
ATOM   2825 N N   . SER B 2 167 ? 43.968 19.738  -10.921 1.00 40.17  ? 167 SER L N   1 
ATOM   2826 C CA  . SER B 2 167 ? 44.419 18.952  -12.062 1.00 39.84  ? 167 SER L CA  1 
ATOM   2827 C C   . SER B 2 167 ? 44.597 19.865  -13.279 1.00 37.92  ? 167 SER L C   1 
ATOM   2828 O O   . SER B 2 167 ? 43.683 20.602  -13.646 1.00 33.71  ? 167 SER L O   1 
ATOM   2829 C CB  . SER B 2 167 ? 43.401 17.855  -12.372 1.00 40.76  ? 167 SER L CB  1 
ATOM   2830 O OG  . SER B 2 167 ? 43.877 16.990  -13.387 1.00 45.93  ? 167 SER L OG  1 
ATOM   2831 N N   . TRP B 2 168 ? 45.778 19.803  -13.896 1.00 37.90  ? 168 TRP L N   1 
ATOM   2832 C CA  . TRP B 2 168 ? 46.107 20.631  -15.058 1.00 38.19  ? 168 TRP L CA  1 
ATOM   2833 C C   . TRP B 2 168 ? 46.285 19.813  -16.335 1.00 36.27  ? 168 TRP L C   1 
ATOM   2834 O O   . TRP B 2 168 ? 46.826 18.707  -16.304 1.00 31.31  ? 168 TRP L O   1 
ATOM   2835 C CB  . TRP B 2 168 ? 47.410 21.395  -14.810 1.00 41.92  ? 168 TRP L CB  1 
ATOM   2836 C CG  . TRP B 2 168 ? 47.417 22.241  -13.570 1.00 51.59  ? 168 TRP L CG  1 
ATOM   2837 C CD1 . TRP B 2 168 ? 47.148 23.577  -13.484 1.00 52.07  ? 168 TRP L CD1 1 
ATOM   2838 C CD2 . TRP B 2 168 ? 47.723 21.806  -12.241 1.00 51.39  ? 168 TRP L CD2 1 
ATOM   2839 N NE1 . TRP B 2 168 ? 47.272 24.003  -12.182 1.00 52.70  ? 168 TRP L NE1 1 
ATOM   2840 C CE2 . TRP B 2 168 ? 47.623 22.936  -11.398 1.00 53.14  ? 168 TRP L CE2 1 
ATOM   2841 C CE3 . TRP B 2 168 ? 48.074 20.570  -11.679 1.00 55.01  ? 168 TRP L CE3 1 
ATOM   2842 C CZ2 . TRP B 2 168 ? 47.863 22.868  -10.020 1.00 55.40  ? 168 TRP L CZ2 1 
ATOM   2843 C CZ3 . TRP B 2 168 ? 48.314 20.502  -10.307 1.00 58.19  ? 168 TRP L CZ3 1 
ATOM   2844 C CH2 . TRP B 2 168 ? 48.207 21.646  -9.495  1.00 56.17  ? 168 TRP L CH2 1 
ATOM   2845 N N   . THR B 2 169 ? 45.848 20.374  -17.457 1.00 32.48  ? 169 THR L N   1 
ATOM   2846 C CA  . THR B 2 169 ? 45.988 19.710  -18.747 1.00 33.23  ? 169 THR L CA  1 
ATOM   2847 C C   . THR B 2 169 ? 47.309 20.150  -19.377 1.00 35.48  ? 169 THR L C   1 
ATOM   2848 O O   . THR B 2 169 ? 47.980 21.057  -18.868 1.00 32.49  ? 169 THR L O   1 
ATOM   2849 C CB  . THR B 2 169 ? 44.847 20.103  -19.714 1.00 36.20  ? 169 THR L CB  1 
ATOM   2850 O OG1 . THR B 2 169 ? 44.789 21.532  -19.826 1.00 37.41  ? 169 THR L OG1 1 
ATOM   2851 C CG2 . THR B 2 169 ? 43.512 19.586  -19.211 1.00 38.97  ? 169 THR L CG2 1 
ATOM   2852 N N   . ASP B 2 170 ? 47.693 19.500  -20.472 1.00 33.51  ? 170 ASP L N   1 
ATOM   2853 C CA  . ASP B 2 170 ? 48.911 19.877  -21.178 1.00 33.28  ? 170 ASP L CA  1 
ATOM   2854 C C   . ASP B 2 170 ? 48.483 20.972  -22.141 1.00 29.74  ? 170 ASP L C   1 
ATOM   2855 O O   . ASP B 2 170 ? 47.292 21.223  -22.291 1.00 29.36  ? 170 ASP L O   1 
ATOM   2856 C CB  . ASP B 2 170 ? 49.490 18.697  -21.966 1.00 37.76  ? 170 ASP L CB  1 
ATOM   2857 C CG  . ASP B 2 170 ? 50.040 17.611  -21.067 1.00 49.38  ? 170 ASP L CG  1 
ATOM   2858 O OD1 . ASP B 2 170 ? 50.771 17.946  -20.110 1.00 46.75  ? 170 ASP L OD1 1 
ATOM   2859 O OD2 . ASP B 2 170 ? 49.747 16.422  -21.321 1.00 55.31  ? 170 ASP L OD2 1 
ATOM   2860 N N   . GLN B 2 171 ? 49.438 21.621  -22.795 1.00 27.29  ? 171 GLN L N   1 
ATOM   2861 C CA  . GLN B 2 171 ? 49.098 22.692  -23.719 1.00 25.92  ? 171 GLN L CA  1 
ATOM   2862 C C   . GLN B 2 171 ? 48.145 22.189  -24.805 1.00 28.14  ? 171 GLN L C   1 
ATOM   2863 O O   . GLN B 2 171 ? 48.394 21.169  -25.443 1.00 28.62  ? 171 GLN L O   1 
ATOM   2864 C CB  . GLN B 2 171 ? 50.366 23.278  -24.345 1.00 26.86  ? 171 GLN L CB  1 
ATOM   2865 C CG  . GLN B 2 171 ? 50.127 24.630  -24.993 1.00 26.41  ? 171 GLN L CG  1 
ATOM   2866 C CD  . GLN B 2 171 ? 51.405 25.385  -25.285 1.00 29.15  ? 171 GLN L CD  1 
ATOM   2867 O OE1 . GLN B 2 171 ? 51.384 26.599  -25.485 1.00 30.82  ? 171 GLN L OE1 1 
ATOM   2868 N NE2 . GLN B 2 171 ? 52.524 24.674  -25.316 1.00 23.04  ? 171 GLN L NE2 1 
ATOM   2869 N N   . ASP B 2 172 ? 47.049 22.915  -25.005 1.00 27.49  ? 172 ASP L N   1 
ATOM   2870 C CA  . ASP B 2 172 ? 46.048 22.540  -25.990 1.00 29.72  ? 172 ASP L CA  1 
ATOM   2871 C C   . ASP B 2 172 ? 46.614 22.444  -27.403 1.00 30.57  ? 172 ASP L C   1 
ATOM   2872 O O   . ASP B 2 172 ? 47.332 23.332  -27.864 1.00 28.12  ? 172 ASP L O   1 
ATOM   2873 C CB  . ASP B 2 172 ? 44.898 23.542  -25.981 1.00 34.20  ? 172 ASP L CB  1 
ATOM   2874 C CG  . ASP B 2 172 ? 43.697 23.041  -26.748 1.00 38.96  ? 172 ASP L CG  1 
ATOM   2875 O OD1 . ASP B 2 172 ? 43.002 22.141  -26.230 1.00 48.99  ? 172 ASP L OD1 1 
ATOM   2876 O OD2 . ASP B 2 172 ? 43.457 23.527  -27.869 1.00 40.63  ? 172 ASP L OD2 1 
ATOM   2877 N N   . SER B 2 173 ? 46.260 21.365  -28.089 1.00 30.54  ? 173 SER L N   1 
ATOM   2878 C CA  . SER B 2 173 ? 46.723 21.112  -29.448 1.00 35.11  ? 173 SER L CA  1 
ATOM   2879 C C   . SER B 2 173 ? 46.091 22.030  -30.486 1.00 35.74  ? 173 SER L C   1 
ATOM   2880 O O   . SER B 2 173 ? 46.522 22.064  -31.638 1.00 35.51  ? 173 SER L O   1 
ATOM   2881 C CB  . SER B 2 173 ? 46.439 19.653  -29.818 1.00 37.23  ? 173 SER L CB  1 
ATOM   2882 O OG  . SER B 2 173 ? 46.667 19.423  -31.197 1.00 53.00  ? 173 SER L OG  1 
ATOM   2883 N N   . LYS B 2 174 ? 45.072 22.779  -30.085 1.00 38.96  ? 174 LYS L N   1 
ATOM   2884 C CA  . LYS B 2 174 ? 44.399 23.669  -31.019 1.00 45.00  ? 174 LYS L CA  1 
ATOM   2885 C C   . LYS B 2 174 ? 44.608 25.158  -30.752 1.00 44.12  ? 174 LYS L C   1 
ATOM   2886 O O   . LYS B 2 174 ? 45.003 25.903  -31.647 1.00 41.75  ? 174 LYS L O   1 
ATOM   2887 C CB  . LYS B 2 174 ? 42.900 23.362  -31.031 1.00 51.37  ? 174 LYS L CB  1 
ATOM   2888 C CG  . LYS B 2 174 ? 42.576 21.899  -31.287 1.00 59.94  ? 174 LYS L CG  1 
ATOM   2889 C CD  . LYS B 2 174 ? 43.104 21.434  -32.635 1.00 67.96  ? 174 LYS L CD  1 
ATOM   2890 C CE  . LYS B 2 174 ? 42.887 19.939  -32.825 1.00 73.24  ? 174 LYS L CE  1 
ATOM   2891 N NZ  . LYS B 2 174 ? 41.449 19.568  -32.712 1.00 79.37  ? 174 LYS L NZ  1 
ATOM   2892 N N   . ASP B 2 175 ? 44.348 25.584  -29.521 1.00 45.46  ? 175 ASP L N   1 
ATOM   2893 C CA  . ASP B 2 175 ? 44.470 26.991  -29.155 1.00 44.06  ? 175 ASP L CA  1 
ATOM   2894 C C   . ASP B 2 175 ? 45.771 27.326  -28.406 1.00 39.78  ? 175 ASP L C   1 
ATOM   2895 O O   . ASP B 2 175 ? 46.056 28.493  -28.129 1.00 35.35  ? 175 ASP L O   1 
ATOM   2896 C CB  . ASP B 2 175 ? 43.240 27.384  -28.323 1.00 56.05  ? 175 ASP L CB  1 
ATOM   2897 C CG  . ASP B 2 175 ? 43.157 28.871  -28.049 1.00 67.84  ? 175 ASP L CG  1 
ATOM   2898 O OD1 . ASP B 2 175 ? 42.317 29.269  -27.212 1.00 73.20  ? 175 ASP L OD1 1 
ATOM   2899 O OD2 . ASP B 2 175 ? 43.917 29.643  -28.672 1.00 75.62  ? 175 ASP L OD2 1 
ATOM   2900 N N   . SER B 2 176 ? 46.558 26.303  -28.085 1.00 29.49  ? 176 SER L N   1 
ATOM   2901 C CA  . SER B 2 176 ? 47.828 26.486  -27.382 1.00 29.58  ? 176 SER L CA  1 
ATOM   2902 C C   . SER B 2 176 ? 47.679 27.031  -25.965 1.00 32.37  ? 176 SER L C   1 
ATOM   2903 O O   . SER B 2 176 ? 48.642 27.543  -25.392 1.00 29.25  ? 176 SER L O   1 
ATOM   2904 C CB  . SER B 2 176 ? 48.762 27.411  -28.178 1.00 26.25  ? 176 SER L CB  1 
ATOM   2905 O OG  . SER B 2 176 ? 49.143 26.811  -29.401 1.00 27.80  ? 176 SER L OG  1 
ATOM   2906 N N   . THR B 2 177 ? 46.481 26.923  -25.398 1.00 30.49  ? 177 THR L N   1 
ATOM   2907 C CA  . THR B 2 177 ? 46.259 27.405  -24.038 1.00 31.29  ? 177 THR L CA  1 
ATOM   2908 C C   . THR B 2 177 ? 46.312 26.252  -23.040 1.00 31.89  ? 177 THR L C   1 
ATOM   2909 O O   . THR B 2 177 ? 46.488 25.086  -23.409 1.00 27.40  ? 177 THR L O   1 
ATOM   2910 C CB  . THR B 2 177 ? 44.887 28.107  -23.879 1.00 33.84  ? 177 THR L CB  1 
ATOM   2911 O OG1 . THR B 2 177 ? 43.839 27.134  -23.951 1.00 32.38  ? 177 THR L OG1 1 
ATOM   2912 C CG2 . THR B 2 177 ? 44.683 29.152  -24.970 1.00 33.28  ? 177 THR L CG2 1 
ATOM   2913 N N   . TYR B 2 178 ? 46.154 26.600  -21.770 1.00 30.52  ? 178 TYR L N   1 
ATOM   2914 C CA  . TYR B 2 178 ? 46.174 25.642  -20.677 1.00 31.46  ? 178 TYR L CA  1 
ATOM   2915 C C   . TYR B 2 178 ? 44.842 25.719  -19.936 1.00 36.23  ? 178 TYR L C   1 
ATOM   2916 O O   . TYR B 2 178 ? 44.140 26.730  -20.012 1.00 33.26  ? 178 TYR L O   1 
ATOM   2917 C CB  . TYR B 2 178 ? 47.319 25.980  -19.716 1.00 29.27  ? 178 TYR L CB  1 
ATOM   2918 C CG  . TYR B 2 178 ? 48.695 25.790  -20.320 1.00 35.53  ? 178 TYR L CG  1 
ATOM   2919 C CD1 . TYR B 2 178 ? 49.343 24.554  -20.259 1.00 30.15  ? 178 TYR L CD1 1 
ATOM   2920 C CD2 . TYR B 2 178 ? 49.334 26.837  -20.984 1.00 33.16  ? 178 TYR L CD2 1 
ATOM   2921 C CE1 . TYR B 2 178 ? 50.595 24.369  -20.847 1.00 31.55  ? 178 TYR L CE1 1 
ATOM   2922 C CE2 . TYR B 2 178 ? 50.585 26.662  -21.576 1.00 35.67  ? 178 TYR L CE2 1 
ATOM   2923 C CZ  . TYR B 2 178 ? 51.208 25.428  -21.504 1.00 35.05  ? 178 TYR L CZ  1 
ATOM   2924 O OH  . TYR B 2 178 ? 52.442 25.257  -22.087 1.00 36.85  ? 178 TYR L OH  1 
ATOM   2925 N N   . SER B 2 179 ? 44.499 24.644  -19.232 1.00 33.31  ? 179 SER L N   1 
ATOM   2926 C CA  . SER B 2 179 ? 43.265 24.583  -18.456 1.00 31.85  ? 179 SER L CA  1 
ATOM   2927 C C   . SER B 2 179 ? 43.517 23.781  -17.188 1.00 33.64  ? 179 SER L C   1 
ATOM   2928 O O   . SER B 2 179 ? 44.489 23.033  -17.095 1.00 31.84  ? 179 SER L O   1 
ATOM   2929 C CB  . SER B 2 179 ? 42.144 23.917  -19.260 1.00 26.51  ? 179 SER L CB  1 
ATOM   2930 O OG  . SER B 2 179 ? 41.707 24.739  -20.325 1.00 36.22  ? 179 SER L OG  1 
ATOM   2931 N N   . MET B 2 180 ? 42.650 23.950  -16.199 1.00 35.08  ? 180 MET L N   1 
ATOM   2932 C CA  . MET B 2 180 ? 42.796 23.210  -14.961 1.00 41.15  ? 180 MET L CA  1 
ATOM   2933 C C   . MET B 2 180 ? 41.478 23.200  -14.215 1.00 42.52  ? 180 MET L C   1 
ATOM   2934 O O   . MET B 2 180 ? 40.583 23.996  -14.501 1.00 40.89  ? 180 MET L O   1 
ATOM   2935 C CB  . MET B 2 180 ? 43.874 23.830  -14.076 1.00 45.97  ? 180 MET L CB  1 
ATOM   2936 C CG  . MET B 2 180 ? 43.442 25.096  -13.369 1.00 57.89  ? 180 MET L CG  1 
ATOM   2937 S SD  . MET B 2 180 ? 44.383 25.331  -11.853 1.00 66.32  ? 180 MET L SD  1 
ATOM   2938 C CE  . MET B 2 180 ? 43.463 24.286  -10.734 1.00 67.21  ? 180 MET L CE  1 
ATOM   2939 N N   . SER B 2 181 ? 41.364 22.291  -13.257 1.00 43.94  ? 181 SER L N   1 
ATOM   2940 C CA  . SER B 2 181 ? 40.154 22.187  -12.466 1.00 43.25  ? 181 SER L CA  1 
ATOM   2941 C C   . SER B 2 181 ? 40.527 22.125  -10.997 1.00 42.70  ? 181 SER L C   1 
ATOM   2942 O O   . SER B 2 181 ? 41.556 21.557  -10.632 1.00 42.33  ? 181 SER L O   1 
ATOM   2943 C CB  . SER B 2 181 ? 39.377 20.928  -12.848 1.00 40.87  ? 181 SER L CB  1 
ATOM   2944 O OG  . SER B 2 181 ? 40.098 19.771  -12.468 1.00 38.59  ? 181 SER L OG  1 
ATOM   2945 N N   . SER B 2 182 ? 39.696 22.735  -10.161 1.00 45.15  ? 182 SER L N   1 
ATOM   2946 C CA  . SER B 2 182 ? 39.915 22.720  -8.721  1.00 46.79  ? 182 SER L CA  1 
ATOM   2947 C C   . SER B 2 182 ? 38.684 22.075  -8.107  1.00 43.58  ? 182 SER L C   1 
ATOM   2948 O O   . SER B 2 182 ? 37.557 22.472  -8.399  1.00 40.04  ? 182 SER L O   1 
ATOM   2949 C CB  . SER B 2 182 ? 40.090 24.140  -8.180  1.00 50.73  ? 182 SER L CB  1 
ATOM   2950 O OG  . SER B 2 182 ? 41.258 24.743  -8.710  1.00 58.42  ? 182 SER L OG  1 
ATOM   2951 N N   . THR B 2 183 ? 38.896 21.068  -7.270  1.00 45.42  ? 183 THR L N   1 
ATOM   2952 C CA  . THR B 2 183 ? 37.777 20.383  -6.646  1.00 47.21  ? 183 THR L CA  1 
ATOM   2953 C C   . THR B 2 183 ? 37.917 20.257  -5.138  1.00 48.18  ? 183 THR L C   1 
ATOM   2954 O O   . THR B 2 183 ? 38.779 19.533  -4.639  1.00 46.76  ? 183 THR L O   1 
ATOM   2955 C CB  . THR B 2 183 ? 37.596 18.979  -7.244  1.00 48.20  ? 183 THR L CB  1 
ATOM   2956 O OG1 . THR B 2 183 ? 37.347 19.093  -8.651  1.00 45.58  ? 183 THR L OG1 1 
ATOM   2957 C CG2 . THR B 2 183 ? 36.430 18.259  -6.580  1.00 50.64  ? 183 THR L CG2 1 
ATOM   2958 N N   . LEU B 2 184 ? 37.061 20.977  -4.421  1.00 53.30  ? 184 LEU L N   1 
ATOM   2959 C CA  . LEU B 2 184 ? 37.046 20.939  -2.963  1.00 53.52  ? 184 LEU L CA  1 
ATOM   2960 C C   . LEU B 2 184 ? 36.063 19.830  -2.599  1.00 52.02  ? 184 LEU L C   1 
ATOM   2961 O O   . LEU B 2 184 ? 34.867 19.937  -2.868  1.00 50.26  ? 184 LEU L O   1 
ATOM   2962 C CB  . LEU B 2 184 ? 36.571 22.289  -2.409  1.00 57.13  ? 184 LEU L CB  1 
ATOM   2963 C CG  . LEU B 2 184 ? 36.507 22.537  -0.893  1.00 59.95  ? 184 LEU L CG  1 
ATOM   2964 C CD1 . LEU B 2 184 ? 35.383 21.725  -0.273  1.00 60.21  ? 184 LEU L CD1 1 
ATOM   2965 C CD2 . LEU B 2 184 ? 37.845 22.194  -0.252  1.00 60.11  ? 184 LEU L CD2 1 
ATOM   2966 N N   . THR B 2 185 ? 36.574 18.754  -2.013  1.00 53.29  ? 185 THR L N   1 
ATOM   2967 C CA  . THR B 2 185 ? 35.731 17.626  -1.633  1.00 56.60  ? 185 THR L CA  1 
ATOM   2968 C C   . THR B 2 185 ? 35.520 17.541  -0.124  1.00 56.77  ? 185 THR L C   1 
ATOM   2969 O O   . THR B 2 185 ? 36.475 17.552  0.652   1.00 56.66  ? 185 THR L O   1 
ATOM   2970 C CB  . THR B 2 185 ? 36.333 16.289  -2.123  1.00 56.05  ? 185 THR L CB  1 
ATOM   2971 O OG1 . THR B 2 185 ? 36.452 16.311  -3.551  1.00 57.67  ? 185 THR L OG1 1 
ATOM   2972 C CG2 . THR B 2 185 ? 35.442 15.119  -1.715  1.00 57.81  ? 185 THR L CG2 1 
ATOM   2973 N N   . LEU B 2 186 ? 34.258 17.456  0.280   1.00 58.52  ? 186 LEU L N   1 
ATOM   2974 C CA  . LEU B 2 186 ? 33.910 17.358  1.690   1.00 61.20  ? 186 LEU L CA  1 
ATOM   2975 C C   . LEU B 2 186 ? 32.616 16.571  1.883   1.00 62.21  ? 186 LEU L C   1 
ATOM   2976 O O   . LEU B 2 186 ? 31.952 16.201  0.915   1.00 59.34  ? 186 LEU L O   1 
ATOM   2977 C CB  . LEU B 2 186 ? 33.786 18.761  2.301   1.00 60.83  ? 186 LEU L CB  1 
ATOM   2978 C CG  . LEU B 2 186 ? 33.044 19.840  1.505   1.00 59.04  ? 186 LEU L CG  1 
ATOM   2979 C CD1 . LEU B 2 186 ? 31.604 19.429  1.269   1.00 59.16  ? 186 LEU L CD1 1 
ATOM   2980 C CD2 . LEU B 2 186 ? 33.104 21.154  2.262   1.00 56.74  ? 186 LEU L CD2 1 
ATOM   2981 N N   . THR B 2 187 ? 32.270 16.306  3.138   1.00 66.72  ? 187 THR L N   1 
ATOM   2982 C CA  . THR B 2 187 ? 31.053 15.568  3.454   1.00 69.32  ? 187 THR L CA  1 
ATOM   2983 C C   . THR B 2 187 ? 29.847 16.482  3.279   1.00 70.42  ? 187 THR L C   1 
ATOM   2984 O O   . THR B 2 187 ? 29.960 17.701  3.420   1.00 69.18  ? 187 THR L O   1 
ATOM   2985 C CB  . THR B 2 187 ? 31.076 15.047  4.909   1.00 70.24  ? 187 THR L CB  1 
ATOM   2986 O OG1 . THR B 2 187 ? 31.210 16.151  5.813   1.00 70.12  ? 187 THR L OG1 1 
ATOM   2987 C CG2 . THR B 2 187 ? 32.241 14.090  5.114   1.00 70.08  ? 187 THR L CG2 1 
ATOM   2988 N N   . LYS B 2 188 ? 28.697 15.897  2.965   1.00 72.29  ? 188 LYS L N   1 
ATOM   2989 C CA  . LYS B 2 188 ? 27.483 16.683  2.790   1.00 75.74  ? 188 LYS L CA  1 
ATOM   2990 C C   . LYS B 2 188 ? 27.185 17.450  4.073   1.00 76.60  ? 188 LYS L C   1 
ATOM   2991 O O   . LYS B 2 188 ? 26.590 18.525  4.040   1.00 76.82  ? 188 LYS L O   1 
ATOM   2992 C CB  . LYS B 2 188 ? 26.301 15.776  2.447   1.00 76.34  ? 188 LYS L CB  1 
ATOM   2993 C CG  . LYS B 2 188 ? 24.974 16.510  2.338   1.00 76.67  ? 188 LYS L CG  1 
ATOM   2994 C CD  . LYS B 2 188 ? 23.832 15.541  2.098   1.00 77.93  ? 188 LYS L CD  1 
ATOM   2995 C CE  . LYS B 2 188 ? 22.490 16.251  2.122   1.00 77.51  ? 188 LYS L CE  1 
ATOM   2996 N NZ  . LYS B 2 188 ? 21.366 15.295  1.931   1.00 79.99  ? 188 LYS L NZ  1 
ATOM   2997 N N   . ASP B 2 189 ? 27.606 16.889  5.203   1.00 78.99  ? 189 ASP L N   1 
ATOM   2998 C CA  . ASP B 2 189 ? 27.391 17.519  6.501   1.00 81.99  ? 189 ASP L CA  1 
ATOM   2999 C C   . ASP B 2 189 ? 28.195 18.808  6.628   1.00 81.56  ? 189 ASP L C   1 
ATOM   3000 O O   . ASP B 2 189 ? 27.659 19.846  7.019   1.00 81.35  ? 189 ASP L O   1 
ATOM   3001 C CB  . ASP B 2 189 ? 27.785 16.561  7.629   1.00 86.33  ? 189 ASP L CB  1 
ATOM   3002 C CG  . ASP B 2 189 ? 26.881 15.346  7.704   1.00 90.54  ? 189 ASP L CG  1 
ATOM   3003 O OD1 . ASP B 2 189 ? 25.655 15.524  7.870   1.00 90.91  ? 189 ASP L OD1 1 
ATOM   3004 O OD2 . ASP B 2 189 ? 27.397 14.212  7.601   1.00 93.17  ? 189 ASP L OD2 1 
ATOM   3005 N N   . GLU B 2 190 ? 29.482 18.733  6.302   1.00 80.35  ? 190 GLU L N   1 
ATOM   3006 C CA  . GLU B 2 190 ? 30.362 19.894  6.373   1.00 77.93  ? 190 GLU L CA  1 
ATOM   3007 C C   . GLU B 2 190 ? 29.892 20.947  5.375   1.00 75.18  ? 190 GLU L C   1 
ATOM   3008 O O   . GLU B 2 190 ? 29.990 22.147  5.626   1.00 75.34  ? 190 GLU L O   1 
ATOM   3009 C CB  . GLU B 2 190 ? 31.803 19.480  6.061   1.00 80.32  ? 190 GLU L CB  1 
ATOM   3010 C CG  . GLU B 2 190 ? 32.826 20.607  6.159   1.00 85.90  ? 190 GLU L CG  1 
ATOM   3011 C CD  . GLU B 2 190 ? 32.974 21.153  7.568   1.00 88.78  ? 190 GLU L CD  1 
ATOM   3012 O OE1 . GLU B 2 190 ? 33.320 20.372  8.481   1.00 89.94  ? 190 GLU L OE1 1 
ATOM   3013 O OE2 . GLU B 2 190 ? 32.747 22.366  7.762   1.00 91.84  ? 190 GLU L OE2 1 
ATOM   3014 N N   . TYR B 2 191 ? 29.374 20.484  4.242   1.00 73.24  ? 191 TYR L N   1 
ATOM   3015 C CA  . TYR B 2 191 ? 28.883 21.372  3.196   1.00 71.15  ? 191 TYR L CA  1 
ATOM   3016 C C   . TYR B 2 191 ? 27.635 22.130  3.635   1.00 72.12  ? 191 TYR L C   1 
ATOM   3017 O O   . TYR B 2 191 ? 27.501 23.324  3.370   1.00 71.69  ? 191 TYR L O   1 
ATOM   3018 C CB  . TYR B 2 191 ? 28.574 20.565  1.929   1.00 67.22  ? 191 TYR L CB  1 
ATOM   3019 C CG  . TYR B 2 191 ? 27.880 21.352  0.835   1.00 61.03  ? 191 TYR L CG  1 
ATOM   3020 C CD1 . TYR B 2 191 ? 28.466 22.491  0.282   1.00 62.07  ? 191 TYR L CD1 1 
ATOM   3021 C CD2 . TYR B 2 191 ? 26.634 20.958  0.355   1.00 58.82  ? 191 TYR L CD2 1 
ATOM   3022 C CE1 . TYR B 2 191 ? 27.823 23.220  -0.725  1.00 55.71  ? 191 TYR L CE1 1 
ATOM   3023 C CE2 . TYR B 2 191 ? 25.985 21.677  -0.649  1.00 56.65  ? 191 TYR L CE2 1 
ATOM   3024 C CZ  . TYR B 2 191 ? 26.585 22.806  -1.183  1.00 54.61  ? 191 TYR L CZ  1 
ATOM   3025 O OH  . TYR B 2 191 ? 25.937 23.519  -2.167  1.00 51.30  ? 191 TYR L OH  1 
ATOM   3026 N N   . GLU B 2 192 ? 26.727 21.431  4.307   1.00 76.10  ? 192 GLU L N   1 
ATOM   3027 C CA  . GLU B 2 192 ? 25.480 22.032  4.770   1.00 79.52  ? 192 GLU L CA  1 
ATOM   3028 C C   . GLU B 2 192 ? 25.671 23.160  5.777   1.00 80.76  ? 192 GLU L C   1 
ATOM   3029 O O   . GLU B 2 192 ? 25.084 24.233  5.629   1.00 81.27  ? 192 GLU L O   1 
ATOM   3030 C CB  . GLU B 2 192 ? 24.572 20.964  5.386   1.00 81.71  ? 192 GLU L CB  1 
ATOM   3031 C CG  . GLU B 2 192 ? 24.144 19.870  4.424   1.00 84.79  ? 192 GLU L CG  1 
ATOM   3032 C CD  . GLU B 2 192 ? 23.573 20.419  3.133   1.00 86.44  ? 192 GLU L CD  1 
ATOM   3033 O OE1 . GLU B 2 192 ? 22.641 21.248  3.195   1.00 86.60  ? 192 GLU L OE1 1 
ATOM   3034 O OE2 . GLU B 2 192 ? 24.058 20.018  2.055   1.00 89.36  ? 192 GLU L OE2 1 
ATOM   3035 N N   . ARG B 2 193 ? 26.487 22.914  6.799   1.00 82.78  ? 193 ARG L N   1 
ATOM   3036 C CA  . ARG B 2 193 ? 26.740 23.907  7.842   1.00 84.26  ? 193 ARG L CA  1 
ATOM   3037 C C   . ARG B 2 193 ? 27.400 25.181  7.319   1.00 84.56  ? 193 ARG L C   1 
ATOM   3038 O O   . ARG B 2 193 ? 27.901 25.995  8.097   1.00 84.85  ? 193 ARG L O   1 
ATOM   3039 C CB  . ARG B 2 193 ? 27.597 23.295  8.955   1.00 85.74  ? 193 ARG L CB  1 
ATOM   3040 C CG  . ARG B 2 193 ? 28.880 22.645  8.470   1.00 87.94  ? 193 ARG L CG  1 
ATOM   3041 C CD  . ARG B 2 193 ? 29.625 21.982  9.617   1.00 90.56  ? 193 ARG L CD  1 
ATOM   3042 N NE  . ARG B 2 193 ? 28.785 21.015  10.319  1.00 95.28  ? 193 ARG L NE  1 
ATOM   3043 C CZ  . ARG B 2 193 ? 29.199 20.258  11.330  1.00 97.42  ? 193 ARG L CZ  1 
ATOM   3044 N NH1 . ARG B 2 193 ? 30.450 20.350  11.765  1.00 98.04  ? 193 ARG L NH1 1 
ATOM   3045 N NH2 . ARG B 2 193 ? 28.360 19.410  11.911  1.00 98.61  ? 193 ARG L NH2 1 
ATOM   3046 N N   . HIS B 2 194 ? 27.395 25.346  6.000   1.00 83.87  ? 194 HIS L N   1 
ATOM   3047 C CA  . HIS B 2 194 ? 27.977 26.521  5.361   1.00 81.45  ? 194 HIS L CA  1 
ATOM   3048 C C   . HIS B 2 194 ? 27.179 26.895  4.120   1.00 79.79  ? 194 HIS L C   1 
ATOM   3049 O O   . HIS B 2 194 ? 26.323 26.136  3.663   1.00 78.25  ? 194 HIS L O   1 
ATOM   3050 C CB  . HIS B 2 194 ? 29.434 26.262  4.960   1.00 80.17  ? 194 HIS L CB  1 
ATOM   3051 C CG  . HIS B 2 194 ? 30.365 26.093  6.119   1.00 80.36  ? 194 HIS L CG  1 
ATOM   3052 N ND1 . HIS B 2 194 ? 30.316 25.005  6.963   1.00 82.26  ? 194 HIS L ND1 1 
ATOM   3053 C CD2 . HIS B 2 194 ? 31.368 26.879  6.578   1.00 80.96  ? 194 HIS L CD2 1 
ATOM   3054 C CE1 . HIS B 2 194 ? 31.249 25.126  7.891   1.00 82.32  ? 194 HIS L CE1 1 
ATOM   3055 N NE2 . HIS B 2 194 ? 31.901 26.255  7.680   1.00 82.08  ? 194 HIS L NE2 1 
ATOM   3056 N N   . ASN B 2 195 ? 27.465 28.075  3.587   1.00 79.10  ? 195 ASN L N   1 
ATOM   3057 C CA  . ASN B 2 195 ? 26.807 28.566  2.384   1.00 80.95  ? 195 ASN L CA  1 
ATOM   3058 C C   . ASN B 2 195 ? 27.670 29.693  1.839   1.00 81.86  ? 195 ASN L C   1 
ATOM   3059 O O   . ASN B 2 195 ? 28.253 30.460  2.605   1.00 83.81  ? 195 ASN L O   1 
ATOM   3060 C CB  . ASN B 2 195 ? 25.398 29.073  2.703   1.00 82.29  ? 195 ASN L CB  1 
ATOM   3061 C CG  . ASN B 2 195 ? 25.403 30.335  3.540   1.00 83.83  ? 195 ASN L CG  1 
ATOM   3062 O OD1 . ASN B 2 195 ? 25.822 31.397  3.079   1.00 86.18  ? 195 ASN L OD1 1 
ATOM   3063 N ND2 . ASN B 2 195 ? 24.935 30.226  4.779   1.00 84.42  ? 195 ASN L ND2 1 
ATOM   3064 N N   . GLY B 2 196 ? 27.759 29.792  0.519   1.00 80.18  ? 196 GLY L N   1 
ATOM   3065 C CA  . GLY B 2 196 ? 28.585 30.826  -0.074  1.00 77.88  ? 196 GLY L CA  1 
ATOM   3066 C C   . GLY B 2 196 ? 30.012 30.328  -0.209  1.00 75.86  ? 196 GLY L C   1 
ATOM   3067 O O   . GLY B 2 196 ? 30.845 30.544  0.674   1.00 75.56  ? 196 GLY L O   1 
ATOM   3068 N N   . TYR B 2 197 ? 30.291 29.646  -1.315  1.00 74.43  ? 197 TYR L N   1 
ATOM   3069 C CA  . TYR B 2 197 ? 31.624 29.110  -1.570  1.00 73.38  ? 197 TYR L CA  1 
ATOM   3070 C C   . TYR B 2 197 ? 32.328 29.924  -2.652  1.00 71.36  ? 197 TYR L C   1 
ATOM   3071 O O   . TYR B 2 197 ? 31.712 30.318  -3.644  1.00 67.67  ? 197 TYR L O   1 
ATOM   3072 C CB  . TYR B 2 197 ? 31.527 27.636  -1.973  1.00 72.14  ? 197 TYR L CB  1 
ATOM   3073 C CG  . TYR B 2 197 ? 31.049 26.740  -0.849  1.00 70.90  ? 197 TYR L CG  1 
ATOM   3074 C CD1 . TYR B 2 197 ? 29.756 26.856  -0.339  1.00 71.58  ? 197 TYR L CD1 1 
ATOM   3075 C CD2 . TYR B 2 197 ? 31.902 25.801  -0.272  1.00 71.79  ? 197 TYR L CD2 1 
ATOM   3076 C CE1 . TYR B 2 197 ? 29.326 26.061  0.719   1.00 73.66  ? 197 TYR L CE1 1 
ATOM   3077 C CE2 . TYR B 2 197 ? 31.483 25.000  0.786   1.00 74.81  ? 197 TYR L CE2 1 
ATOM   3078 C CZ  . TYR B 2 197 ? 30.195 25.136  1.278   1.00 76.06  ? 197 TYR L CZ  1 
ATOM   3079 O OH  . TYR B 2 197 ? 29.783 24.355  2.333   1.00 77.26  ? 197 TYR L OH  1 
ATOM   3080 N N   . THR B 2 198 ? 33.623 30.165  -2.455  1.00 70.95  ? 198 THR L N   1 
ATOM   3081 C CA  . THR B 2 198 ? 34.409 30.964  -3.391  1.00 70.60  ? 198 THR L CA  1 
ATOM   3082 C C   . THR B 2 198 ? 35.592 30.266  -4.061  1.00 69.11  ? 198 THR L C   1 
ATOM   3083 O O   . THR B 2 198 ? 36.469 29.709  -3.399  1.00 67.81  ? 198 THR L O   1 
ATOM   3084 C CB  . THR B 2 198 ? 34.950 32.234  -2.696  1.00 69.97  ? 198 THR L CB  1 
ATOM   3085 O OG1 . THR B 2 198 ? 33.855 33.003  -2.185  1.00 71.22  ? 198 THR L OG1 1 
ATOM   3086 C CG2 . THR B 2 198 ? 35.748 33.082  -3.677  1.00 68.65  ? 198 THR L CG2 1 
ATOM   3087 N N   . CYS B 2 199 ? 35.601 30.323  -5.388  1.00 69.14  ? 199 CYS L N   1 
ATOM   3088 C CA  . CYS B 2 199 ? 36.666 29.752  -6.204  1.00 69.92  ? 199 CYS L CA  1 
ATOM   3089 C C   . CYS B 2 199 ? 37.419 30.971  -6.733  1.00 69.50  ? 199 CYS L C   1 
ATOM   3090 O O   . CYS B 2 199 ? 36.931 31.672  -7.620  1.00 67.48  ? 199 CYS L O   1 
ATOM   3091 C CB  . CYS B 2 199 ? 36.065 28.950  -7.363  1.00 70.58  ? 199 CYS L CB  1 
ATOM   3092 S SG  . CYS B 2 199 ? 37.232 28.291  -8.604  1.00 72.04  ? 199 CYS L SG  1 
ATOM   3093 N N   . GLU B 2 200 ? 38.596 31.230  -6.174  1.00 69.42  ? 200 GLU L N   1 
ATOM   3094 C CA  . GLU B 2 200 ? 39.396 32.383  -6.572  1.00 71.05  ? 200 GLU L CA  1 
ATOM   3095 C C   . GLU B 2 200 ? 40.585 32.025  -7.461  1.00 70.08  ? 200 GLU L C   1 
ATOM   3096 O O   . GLU B 2 200 ? 41.378 31.143  -7.133  1.00 67.36  ? 200 GLU L O   1 
ATOM   3097 C CB  . GLU B 2 200 ? 39.882 33.114  -5.321  1.00 73.87  ? 200 GLU L CB  1 
ATOM   3098 C CG  . GLU B 2 200 ? 40.767 34.312  -5.593  1.00 79.55  ? 200 GLU L CG  1 
ATOM   3099 C CD  . GLU B 2 200 ? 41.067 35.095  -4.332  1.00 83.12  ? 200 GLU L CD  1 
ATOM   3100 O OE1 . GLU B 2 200 ? 41.870 36.050  -4.398  1.00 86.22  ? 200 GLU L OE1 1 
ATOM   3101 O OE2 . GLU B 2 200 ? 40.494 34.756  -3.275  1.00 83.63  ? 200 GLU L OE2 1 
ATOM   3102 N N   . ALA B 2 201 ? 40.706 32.728  -8.585  1.00 69.93  ? 201 ALA L N   1 
ATOM   3103 C CA  . ALA B 2 201 ? 41.790 32.489  -9.531  1.00 71.27  ? 201 ALA L CA  1 
ATOM   3104 C C   . ALA B 2 201 ? 42.630 33.738  -9.774  1.00 73.07  ? 201 ALA L C   1 
ATOM   3105 O O   . ALA B 2 201 ? 42.176 34.691  -10.411 1.00 73.36  ? 201 ALA L O   1 
ATOM   3106 C CB  . ALA B 2 201 ? 41.224 31.987  -10.851 1.00 69.71  ? 201 ALA L CB  1 
ATOM   3107 N N   . THR B 2 202 ? 43.859 33.725  -9.265  1.00 74.67  ? 202 THR L N   1 
ATOM   3108 C CA  . THR B 2 202 ? 44.775 34.848  -9.429  1.00 76.78  ? 202 THR L CA  1 
ATOM   3109 C C   . THR B 2 202 ? 45.857 34.520  -10.458 1.00 77.15  ? 202 THR L C   1 
ATOM   3110 O O   . THR B 2 202 ? 46.797 33.773  -10.175 1.00 75.35  ? 202 THR L O   1 
ATOM   3111 C CB  . THR B 2 202 ? 45.449 35.216  -8.091  1.00 76.80  ? 202 THR L CB  1 
ATOM   3112 O OG1 . THR B 2 202 ? 44.448 35.633  -7.154  1.00 80.09  ? 202 THR L OG1 1 
ATOM   3113 C CG2 . THR B 2 202 ? 46.452 36.345  -8.288  1.00 76.90  ? 202 THR L CG2 1 
ATOM   3114 N N   . HIS B 2 203 ? 45.707 35.076  -11.657 1.00 77.56  ? 203 HIS L N   1 
ATOM   3115 C CA  . HIS B 2 203 ? 46.663 34.853  -12.734 1.00 79.28  ? 203 HIS L CA  1 
ATOM   3116 C C   . HIS B 2 203 ? 47.739 35.933  -12.657 1.00 80.27  ? 203 HIS L C   1 
ATOM   3117 O O   . HIS B 2 203 ? 47.740 36.752  -11.737 1.00 81.20  ? 203 HIS L O   1 
ATOM   3118 C CB  . HIS B 2 203 ? 45.950 34.919  -14.088 1.00 78.30  ? 203 HIS L CB  1 
ATOM   3119 C CG  . HIS B 2 203 ? 46.682 34.225  -15.195 1.00 79.69  ? 203 HIS L CG  1 
ATOM   3120 N ND1 . HIS B 2 203 ? 46.261 34.270  -16.506 1.00 79.06  ? 203 HIS L ND1 1 
ATOM   3121 C CD2 . HIS B 2 203 ? 47.795 33.452  -15.183 1.00 80.19  ? 203 HIS L CD2 1 
ATOM   3122 C CE1 . HIS B 2 203 ? 47.082 33.554  -17.255 1.00 78.76  ? 203 HIS L CE1 1 
ATOM   3123 N NE2 . HIS B 2 203 ? 48.021 33.047  -16.477 1.00 77.73  ? 203 HIS L NE2 1 
ATOM   3124 N N   . LYS B 2 204 ? 48.653 35.936  -13.619 1.00 81.37  ? 204 LYS L N   1 
ATOM   3125 C CA  . LYS B 2 204 ? 49.723 36.924  -13.637 1.00 83.26  ? 204 LYS L CA  1 
ATOM   3126 C C   . LYS B 2 204 ? 49.516 37.931  -14.764 1.00 83.28  ? 204 LYS L C   1 
ATOM   3127 O O   . LYS B 2 204 ? 50.275 38.891  -14.902 1.00 82.63  ? 204 LYS L O   1 
ATOM   3128 C CB  . LYS B 2 204 ? 51.077 36.230  -13.799 1.00 83.26  ? 204 LYS L CB  1 
ATOM   3129 C CG  . LYS B 2 204 ? 51.382 35.192  -12.723 1.00 85.20  ? 204 LYS L CG  1 
ATOM   3130 C CD  . LYS B 2 204 ? 51.407 35.807  -11.329 1.00 85.85  ? 204 LYS L CD  1 
ATOM   3131 C CE  . LYS B 2 204 ? 51.798 34.779  -10.277 1.00 86.33  ? 204 LYS L CE  1 
ATOM   3132 N NZ  . LYS B 2 204 ? 50.868 33.616  -10.260 1.00 88.17  ? 204 LYS L NZ  1 
ATOM   3133 N N   . THR B 2 205 ? 48.479 37.705  -15.565 1.00 83.51  ? 205 THR L N   1 
ATOM   3134 C CA  . THR B 2 205 ? 48.166 38.590  -16.678 1.00 83.61  ? 205 THR L CA  1 
ATOM   3135 C C   . THR B 2 205 ? 47.544 39.890  -16.181 1.00 84.95  ? 205 THR L C   1 
ATOM   3136 O O   . THR B 2 205 ? 48.058 40.977  -16.451 1.00 86.33  ? 205 THR L O   1 
ATOM   3137 C CB  . THR B 2 205 ? 47.193 37.916  -17.667 1.00 84.18  ? 205 THR L CB  1 
ATOM   3138 O OG1 . THR B 2 205 ? 46.004 37.513  -16.975 1.00 83.71  ? 205 THR L OG1 1 
ATOM   3139 C CG2 . THR B 2 205 ? 47.843 36.698  -18.304 1.00 82.47  ? 205 THR L CG2 1 
ATOM   3140 N N   . SER B 2 206 ? 46.437 39.777  -15.453 1.00 85.14  ? 206 SER L N   1 
ATOM   3141 C CA  . SER B 2 206 ? 45.752 40.951  -14.925 1.00 86.15  ? 206 SER L CA  1 
ATOM   3142 C C   . SER B 2 206 ? 45.985 41.110  -13.427 1.00 85.54  ? 206 SER L C   1 
ATOM   3143 O O   . SER B 2 206 ? 46.607 40.260  -12.787 1.00 83.26  ? 206 SER L O   1 
ATOM   3144 C CB  . SER B 2 206 ? 44.247 40.858  -15.198 1.00 86.36  ? 206 SER L CB  1 
ATOM   3145 O OG  . SER B 2 206 ? 43.657 39.794  -14.471 1.00 88.21  ? 206 SER L OG  1 
ATOM   3146 N N   . THR B 2 207 ? 45.482 42.211  -12.877 1.00 85.55  ? 207 THR L N   1 
ATOM   3147 C CA  . THR B 2 207 ? 45.619 42.498  -11.455 1.00 85.07  ? 207 THR L CA  1 
ATOM   3148 C C   . THR B 2 207 ? 44.251 42.330  -10.798 1.00 85.02  ? 207 THR L C   1 
ATOM   3149 O O   . THR B 2 207 ? 44.094 42.533  -9.592  1.00 84.81  ? 207 THR L O   1 
ATOM   3150 C CB  . THR B 2 207 ? 46.118 43.941  -11.227 1.00 85.17  ? 207 THR L CB  1 
ATOM   3151 O OG1 . THR B 2 207 ? 47.275 44.180  -12.039 1.00 83.38  ? 207 THR L OG1 1 
ATOM   3152 C CG2 . THR B 2 207 ? 46.487 44.154  -9.763  1.00 83.94  ? 207 THR L CG2 1 
ATOM   3153 N N   . SER B 2 208 ? 43.266 41.955  -11.610 1.00 84.56  ? 208 SER L N   1 
ATOM   3154 C CA  . SER B 2 208 ? 41.899 41.750  -11.140 1.00 83.51  ? 208 SER L CA  1 
ATOM   3155 C C   . SER B 2 208 ? 41.561 40.260  -11.074 1.00 81.14  ? 208 SER L C   1 
ATOM   3156 O O   . SER B 2 208 ? 40.961 39.710  -12.000 1.00 78.40  ? 208 SER L O   1 
ATOM   3157 C CB  . SER B 2 208 ? 40.915 42.461  -12.074 1.00 84.30  ? 208 SER L CB  1 
ATOM   3158 O OG  . SER B 2 208 ? 39.574 42.222  -11.686 1.00 88.49  ? 208 SER L OG  1 
ATOM   3159 N N   . PRO B 2 209 ? 41.941 39.590  -9.970  1.00 81.27  ? 209 PRO L N   1 
ATOM   3160 C CA  . PRO B 2 209 ? 41.686 38.161  -9.767  1.00 79.50  ? 209 PRO L CA  1 
ATOM   3161 C C   . PRO B 2 209 ? 40.246 37.754  -10.061 1.00 77.30  ? 209 PRO L C   1 
ATOM   3162 O O   . PRO B 2 209 ? 39.325 38.150  -9.346  1.00 77.47  ? 209 PRO L O   1 
ATOM   3163 C CB  . PRO B 2 209 ? 42.055 37.954  -8.300  1.00 78.79  ? 209 PRO L CB  1 
ATOM   3164 C CG  . PRO B 2 209 ? 43.172 38.920  -8.111  1.00 78.62  ? 209 PRO L CG  1 
ATOM   3165 C CD  . PRO B 2 209 ? 42.644 40.157  -8.804  1.00 81.24  ? 209 PRO L CD  1 
ATOM   3166 N N   . ILE B 2 210 ? 40.058 36.965  -11.115 1.00 75.91  ? 210 ILE L N   1 
ATOM   3167 C CA  . ILE B 2 210 ? 38.727 36.501  -11.485 1.00 75.09  ? 210 ILE L CA  1 
ATOM   3168 C C   . ILE B 2 210 ? 38.240 35.523  -10.424 1.00 74.41  ? 210 ILE L C   1 
ATOM   3169 O O   . ILE B 2 210 ? 38.764 34.416  -10.300 1.00 75.04  ? 210 ILE L O   1 
ATOM   3170 C CB  . ILE B 2 210 ? 38.732 35.796  -12.859 1.00 74.02  ? 210 ILE L CB  1 
ATOM   3171 C CG1 . ILE B 2 210 ? 39.150 36.786  -13.950 1.00 74.04  ? 210 ILE L CG1 1 
ATOM   3172 C CG2 . ILE B 2 210 ? 37.351 35.232  -13.158 1.00 74.67  ? 210 ILE L CG2 1 
ATOM   3173 C CD1 . ILE B 2 210 ? 39.155 36.202  -15.349 1.00 73.53  ? 210 ILE L CD1 1 
ATOM   3174 N N   . VAL B 2 211 ? 37.241 35.944  -9.657  1.00 71.70  ? 211 VAL L N   1 
ATOM   3175 C CA  . VAL B 2 211 ? 36.690 35.113  -8.596  1.00 70.20  ? 211 VAL L CA  1 
ATOM   3176 C C   . VAL B 2 211 ? 35.224 34.778  -8.848  1.00 67.81  ? 211 VAL L C   1 
ATOM   3177 O O   . VAL B 2 211 ? 34.438 35.641  -9.237  1.00 68.93  ? 211 VAL L O   1 
ATOM   3178 C CB  . VAL B 2 211 ? 36.808 35.823  -7.227  1.00 71.04  ? 211 VAL L CB  1 
ATOM   3179 C CG1 . VAL B 2 211 ? 38.262 36.148  -6.934  1.00 69.31  ? 211 VAL L CG1 1 
ATOM   3180 C CG2 . VAL B 2 211 ? 35.972 37.095  -7.223  1.00 71.53  ? 211 VAL L CG2 1 
ATOM   3181 N N   . LYS B 2 212 ? 34.861 33.518  -8.631  1.00 65.39  ? 212 LYS L N   1 
ATOM   3182 C CA  . LYS B 2 212 ? 33.482 33.083  -8.819  1.00 62.83  ? 212 LYS L CA  1 
ATOM   3183 C C   . LYS B 2 212 ? 32.996 32.388  -7.553  1.00 62.89  ? 212 LYS L C   1 
ATOM   3184 O O   . LYS B 2 212 ? 33.709 31.570  -6.967  1.00 60.61  ? 212 LYS L O   1 
ATOM   3185 C CB  . LYS B 2 212 ? 33.375 32.133  -10.014 1.00 60.63  ? 212 LYS L CB  1 
ATOM   3186 C CG  . LYS B 2 212 ? 33.906 32.718  -11.315 1.00 62.06  ? 212 LYS L CG  1 
ATOM   3187 C CD  . LYS B 2 212 ? 33.200 34.016  -11.686 1.00 60.94  ? 212 LYS L CD  1 
ATOM   3188 C CE  . LYS B 2 212 ? 31.790 33.768  -12.188 1.00 60.30  ? 212 LYS L CE  1 
ATOM   3189 N NZ  . LYS B 2 212 ? 31.784 33.034  -13.483 1.00 59.73  ? 212 LYS L NZ  1 
ATOM   3190 N N   . SER B 2 213 ? 31.784 32.729  -7.130  1.00 63.25  ? 213 SER L N   1 
ATOM   3191 C CA  . SER B 2 213 ? 31.198 32.153  -5.927  1.00 62.80  ? 213 SER L CA  1 
ATOM   3192 C C   . SER B 2 213 ? 29.709 31.916  -6.125  1.00 64.07  ? 213 SER L C   1 
ATOM   3193 O O   . SER B 2 213 ? 29.130 32.334  -7.128  1.00 62.08  ? 213 SER L O   1 
ATOM   3194 C CB  . SER B 2 213 ? 31.397 33.095  -4.735  1.00 62.70  ? 213 SER L CB  1 
ATOM   3195 O OG  . SER B 2 213 ? 32.768 33.357  -4.500  1.00 60.77  ? 213 SER L OG  1 
ATOM   3196 N N   . PHE B 2 214 ? 29.096 31.240  -5.160  1.00 66.96  ? 214 PHE L N   1 
ATOM   3197 C CA  . PHE B 2 214 ? 27.667 30.963  -5.216  1.00 70.76  ? 214 PHE L CA  1 
ATOM   3198 C C   . PHE B 2 214 ? 27.123 30.843  -3.797  1.00 72.01  ? 214 PHE L C   1 
ATOM   3199 O O   . PHE B 2 214 ? 27.952 30.814  -2.863  1.00 69.51  ? 214 PHE L O   1 
ATOM   3200 C CB  . PHE B 2 214 ? 27.404 29.672  -6.006  1.00 73.72  ? 214 PHE L CB  1 
ATOM   3201 C CG  . PHE B 2 214 ? 27.885 28.420  -5.320  1.00 78.64  ? 214 PHE L CG  1 
ATOM   3202 C CD1 . PHE B 2 214 ? 27.088 27.771  -4.381  1.00 80.15  ? 214 PHE L CD1 1 
ATOM   3203 C CD2 . PHE B 2 214 ? 29.136 27.887  -5.616  1.00 80.19  ? 214 PHE L CD2 1 
ATOM   3204 C CE1 . PHE B 2 214 ? 27.529 26.609  -3.747  1.00 81.20  ? 214 PHE L CE1 1 
ATOM   3205 C CE2 . PHE B 2 214 ? 29.586 26.726  -4.987  1.00 82.01  ? 214 PHE L CE2 1 
ATOM   3206 C CZ  . PHE B 2 214 ? 28.780 26.087  -4.052  1.00 81.97  ? 214 PHE L CZ  1 
ATOM   3207 O OXT . PHE B 2 214 ? 25.884 30.781  -3.637  1.00 75.39  ? 214 PHE L OXT 1 
ATOM   3208 N N   . GLU C 1 1   ? 49.199 44.136  42.177  1.00 54.16  ? 1   GLU A N   1 
ATOM   3209 C CA  . GLU C 1 1   ? 49.284 43.228  43.359  1.00 53.74  ? 1   GLU A CA  1 
ATOM   3210 C C   . GLU C 1 1   ? 48.510 43.797  44.537  1.00 49.41  ? 1   GLU A C   1 
ATOM   3211 O O   . GLU C 1 1   ? 48.109 44.963  44.531  1.00 51.18  ? 1   GLU A O   1 
ATOM   3212 C CB  . GLU C 1 1   ? 50.741 43.025  43.779  1.00 57.86  ? 1   GLU A CB  1 
ATOM   3213 C CG  . GLU C 1 1   ? 51.501 44.322  44.023  1.00 69.86  ? 1   GLU A CG  1 
ATOM   3214 C CD  . GLU C 1 1   ? 52.776 44.120  44.830  1.00 72.96  ? 1   GLU A CD  1 
ATOM   3215 O OE1 . GLU C 1 1   ? 53.544 43.185  44.521  1.00 76.85  ? 1   GLU A OE1 1 
ATOM   3216 O OE2 . GLU C 1 1   ? 53.015 44.904  45.772  1.00 74.63  ? 1   GLU A OE2 1 
ATOM   3217 N N   . VAL C 1 2   ? 48.294 42.964  45.546  1.00 37.18  ? 2   VAL A N   1 
ATOM   3218 C CA  . VAL C 1 2   ? 47.581 43.390  46.735  1.00 33.02  ? 2   VAL A CA  1 
ATOM   3219 C C   . VAL C 1 2   ? 48.340 42.853  47.932  1.00 31.70  ? 2   VAL A C   1 
ATOM   3220 O O   . VAL C 1 2   ? 48.511 41.640  48.076  1.00 27.55  ? 2   VAL A O   1 
ATOM   3221 C CB  . VAL C 1 2   ? 46.138 42.844  46.763  1.00 32.14  ? 2   VAL A CB  1 
ATOM   3222 C CG1 . VAL C 1 2   ? 45.410 43.361  47.989  1.00 34.99  ? 2   VAL A CG1 1 
ATOM   3223 C CG2 . VAL C 1 2   ? 45.399 43.253  45.496  1.00 34.94  ? 2   VAL A CG2 1 
ATOM   3224 N N   . LYS C 1 3   ? 48.818 43.762  48.774  1.00 27.95  ? 3   LYS A N   1 
ATOM   3225 C CA  . LYS C 1 3   ? 49.551 43.375  49.968  1.00 29.08  ? 3   LYS A CA  1 
ATOM   3226 C C   . LYS C 1 3   ? 49.632 44.521  50.967  1.00 30.19  ? 3   LYS A C   1 
ATOM   3227 O O   . LYS C 1 3   ? 49.571 45.697  50.595  1.00 33.81  ? 3   LYS A O   1 
ATOM   3228 C CB  . LYS C 1 3   ? 50.965 42.917  49.598  1.00 32.55  ? 3   LYS A CB  1 
ATOM   3229 C CG  . LYS C 1 3   ? 51.781 43.959  48.850  1.00 44.31  ? 3   LYS A CG  1 
ATOM   3230 C CD  . LYS C 1 3   ? 53.146 43.421  48.417  1.00 52.97  ? 3   LYS A CD  1 
ATOM   3231 C CE  . LYS C 1 3   ? 54.108 43.268  49.586  1.00 56.68  ? 3   LYS A CE  1 
ATOM   3232 N NZ  . LYS C 1 3   ? 53.645 42.263  50.579  1.00 67.06  ? 3   LYS A NZ  1 
ATOM   3233 N N   . LEU C 1 4   ? 49.741 44.160  52.240  1.00 27.34  ? 4   LEU A N   1 
ATOM   3234 C CA  . LEU C 1 4   ? 49.865 45.122  53.326  1.00 24.42  ? 4   LEU A CA  1 
ATOM   3235 C C   . LEU C 1 4   ? 51.263 44.923  53.893  1.00 25.84  ? 4   LEU A C   1 
ATOM   3236 O O   . LEU C 1 4   ? 51.744 43.797  53.954  1.00 22.66  ? 4   LEU A O   1 
ATOM   3237 C CB  . LEU C 1 4   ? 48.837 44.837  54.410  1.00 25.66  ? 4   LEU A CB  1 
ATOM   3238 C CG  . LEU C 1 4   ? 47.371 44.953  54.015  1.00 30.14  ? 4   LEU A CG  1 
ATOM   3239 C CD1 . LEU C 1 4   ? 46.494 44.535  55.180  1.00 31.65  ? 4   LEU A CD1 1 
ATOM   3240 C CD2 . LEU C 1 4   ? 47.071 46.368  53.611  1.00 31.55  ? 4   LEU A CD2 1 
ATOM   3241 N N   . LEU C 1 5   ? 51.915 46.010  54.289  1.00 21.80  ? 5   LEU A N   1 
ATOM   3242 C CA  . LEU C 1 5   ? 53.263 45.933  54.837  1.00 28.07  ? 5   LEU A CA  1 
ATOM   3243 C C   . LEU C 1 5   ? 53.417 46.754  56.117  1.00 28.16  ? 5   LEU A C   1 
ATOM   3244 O O   . LEU C 1 5   ? 53.331 47.981  56.080  1.00 23.79  ? 5   LEU A O   1 
ATOM   3245 C CB  . LEU C 1 5   ? 54.272 46.422  53.799  1.00 30.31  ? 5   LEU A CB  1 
ATOM   3246 C CG  . LEU C 1 5   ? 55.712 46.579  54.283  1.00 36.34  ? 5   LEU A CG  1 
ATOM   3247 C CD1 . LEU C 1 5   ? 56.177 45.291  54.933  1.00 43.94  ? 5   LEU A CD1 1 
ATOM   3248 C CD2 . LEU C 1 5   ? 56.611 46.944  53.110  1.00 46.71  ? 5   LEU A CD2 1 
ATOM   3249 N N   . GLU C 1 6   ? 53.633 46.077  57.244  1.00 26.81  ? 6   GLU A N   1 
ATOM   3250 C CA  . GLU C 1 6   ? 53.810 46.767  58.523  1.00 25.68  ? 6   GLU A CA  1 
ATOM   3251 C C   . GLU C 1 6   ? 55.279 47.093  58.742  1.00 26.44  ? 6   GLU A C   1 
ATOM   3252 O O   . GLU C 1 6   ? 56.166 46.386  58.248  1.00 24.97  ? 6   GLU A O   1 
ATOM   3253 C CB  . GLU C 1 6   ? 53.329 45.910  59.697  1.00 22.29  ? 6   GLU A CB  1 
ATOM   3254 C CG  . GLU C 1 6   ? 51.900 45.419  59.580  1.00 23.99  ? 6   GLU A CG  1 
ATOM   3255 C CD  . GLU C 1 6   ? 51.806 44.078  58.870  1.00 15.81  ? 6   GLU A CD  1 
ATOM   3256 O OE1 . GLU C 1 6   ? 52.767 43.698  58.156  1.00 20.83  ? 6   GLU A OE1 1 
ATOM   3257 O OE2 . GLU C 1 6   ? 50.766 43.416  59.019  1.00 18.37  ? 6   GLU A OE2 1 
ATOM   3258 N N   . SER C 1 7   ? 55.532 48.166  59.484  1.00 25.15  ? 7   SER A N   1 
ATOM   3259 C CA  . SER C 1 7   ? 56.895 48.577  59.793  1.00 24.04  ? 7   SER A CA  1 
ATOM   3260 C C   . SER C 1 7   ? 56.891 49.384  61.082  1.00 23.82  ? 7   SER A C   1 
ATOM   3261 O O   . SER C 1 7   ? 55.829 49.733  61.595  1.00 20.99  ? 7   SER A O   1 
ATOM   3262 C CB  . SER C 1 7   ? 57.465 49.427  58.658  1.00 28.55  ? 7   SER A CB  1 
ATOM   3263 O OG  . SER C 1 7   ? 56.716 50.619  58.496  1.00 34.94  ? 7   SER A OG  1 
ATOM   3264 N N   . GLY C 1 8   ? 58.078 49.653  61.615  1.00 26.92  ? 8   GLY A N   1 
ATOM   3265 C CA  . GLY C 1 8   ? 58.169 50.444  62.828  1.00 27.65  ? 8   GLY A CA  1 
ATOM   3266 C C   . GLY C 1 8   ? 58.469 49.691  64.108  1.00 30.93  ? 8   GLY A C   1 
ATOM   3267 O O   . GLY C 1 8   ? 58.731 50.315  65.135  1.00 25.98  ? 8   GLY A O   1 
ATOM   3268 N N   . GLY C 1 9   ? 58.440 48.362  64.057  1.00 26.11  ? 9   GLY A N   1 
ATOM   3269 C CA  . GLY C 1 9   ? 58.712 47.575  65.248  1.00 29.40  ? 9   GLY A CA  1 
ATOM   3270 C C   . GLY C 1 9   ? 60.164 47.569  65.700  1.00 28.57  ? 9   GLY A C   1 
ATOM   3271 O O   . GLY C 1 9   ? 61.063 47.984  64.970  1.00 26.49  ? 9   GLY A O   1 
ATOM   3272 N N   . GLY C 1 10  ? 60.402 47.089  66.915  1.00 31.98  ? 10  GLY A N   1 
ATOM   3273 C CA  . GLY C 1 10  ? 61.762 47.038  67.422  1.00 29.77  ? 10  GLY A CA  1 
ATOM   3274 C C   . GLY C 1 10  ? 61.791 46.906  68.930  1.00 33.79  ? 10  GLY A C   1 
ATOM   3275 O O   . GLY C 1 10  ? 60.781 46.576  69.547  1.00 28.56  ? 10  GLY A O   1 
ATOM   3276 N N   . LEU C 1 11  ? 62.954 47.151  69.525  1.00 34.67  ? 11  LEU A N   1 
ATOM   3277 C CA  . LEU C 1 11  ? 63.093 47.077  70.973  1.00 37.47  ? 11  LEU A CA  1 
ATOM   3278 C C   . LEU C 1 11  ? 62.689 48.395  71.615  1.00 36.46  ? 11  LEU A C   1 
ATOM   3279 O O   . LEU C 1 11  ? 63.073 49.469  71.150  1.00 39.09  ? 11  LEU A O   1 
ATOM   3280 C CB  . LEU C 1 11  ? 64.535 46.750  71.359  1.00 41.42  ? 11  LEU A CB  1 
ATOM   3281 C CG  . LEU C 1 11  ? 64.928 45.276  71.331  1.00 43.27  ? 11  LEU A CG  1 
ATOM   3282 C CD1 . LEU C 1 11  ? 64.689 44.699  69.947  1.00 49.05  ? 11  LEU A CD1 1 
ATOM   3283 C CD2 . LEU C 1 11  ? 66.388 45.142  71.722  1.00 43.95  ? 11  LEU A CD2 1 
ATOM   3284 N N   . VAL C 1 12  ? 61.909 48.306  72.686  1.00 34.48  ? 12  VAL A N   1 
ATOM   3285 C CA  . VAL C 1 12  ? 61.452 49.487  73.403  1.00 34.20  ? 12  VAL A CA  1 
ATOM   3286 C C   . VAL C 1 12  ? 61.502 49.201  74.901  1.00 36.46  ? 12  VAL A C   1 
ATOM   3287 O O   . VAL C 1 12  ? 61.221 48.085  75.339  1.00 31.82  ? 12  VAL A O   1 
ATOM   3288 C CB  . VAL C 1 12  ? 60.003 49.860  73.012  1.00 36.58  ? 12  VAL A CB  1 
ATOM   3289 C CG1 . VAL C 1 12  ? 59.549 51.087  73.792  1.00 37.80  ? 12  VAL A CG1 1 
ATOM   3290 C CG2 . VAL C 1 12  ? 59.921 50.130  71.520  1.00 44.21  ? 12  VAL A CG2 1 
ATOM   3291 N N   . LYS C 1 13  ? 61.873 50.212  75.680  1.00 38.24  ? 13  LYS A N   1 
ATOM   3292 C CA  . LYS C 1 13  ? 61.954 50.064  77.127  1.00 40.68  ? 13  LYS A CA  1 
ATOM   3293 C C   . LYS C 1 13  ? 60.569 50.142  77.739  1.00 37.26  ? 13  LYS A C   1 
ATOM   3294 O O   . LYS C 1 13  ? 59.697 50.858  77.238  1.00 32.91  ? 13  LYS A O   1 
ATOM   3295 C CB  . LYS C 1 13  ? 62.827 51.171  77.732  1.00 44.92  ? 13  LYS A CB  1 
ATOM   3296 C CG  . LYS C 1 13  ? 64.306 51.058  77.404  1.00 53.44  ? 13  LYS A CG  1 
ATOM   3297 C CD  . LYS C 1 13  ? 64.911 49.810  78.026  1.00 58.08  ? 13  LYS A CD  1 
ATOM   3298 C CE  . LYS C 1 13  ? 66.409 49.743  77.784  1.00 61.99  ? 13  LYS A CE  1 
ATOM   3299 N NZ  . LYS C 1 13  ? 67.117 50.901  78.395  1.00 68.03  ? 13  LYS A NZ  1 
ATOM   3300 N N   . PRO C 1 14  ? 60.346 49.400  78.836  1.00 37.82  ? 14  PRO A N   1 
ATOM   3301 C CA  . PRO C 1 14  ? 59.041 49.421  79.497  1.00 36.09  ? 14  PRO A CA  1 
ATOM   3302 C C   . PRO C 1 14  ? 58.672 50.873  79.789  1.00 34.52  ? 14  PRO A C   1 
ATOM   3303 O O   . PRO C 1 14  ? 59.521 51.658  80.210  1.00 35.30  ? 14  PRO A O   1 
ATOM   3304 C CB  . PRO C 1 14  ? 59.292 48.614  80.768  1.00 36.86  ? 14  PRO A CB  1 
ATOM   3305 C CG  . PRO C 1 14  ? 60.298 47.604  80.309  1.00 34.84  ? 14  PRO A CG  1 
ATOM   3306 C CD  . PRO C 1 14  ? 61.259 48.457  79.507  1.00 35.37  ? 14  PRO A CD  1 
ATOM   3307 N N   . GLY C 1 15  ? 57.418 51.229  79.536  1.00 34.24  ? 15  GLY A N   1 
ATOM   3308 C CA  . GLY C 1 15  ? 56.967 52.589  79.772  1.00 30.69  ? 15  GLY A CA  1 
ATOM   3309 C C   . GLY C 1 15  ? 57.190 53.508  78.584  1.00 33.21  ? 15  GLY A C   1 
ATOM   3310 O O   . GLY C 1 15  ? 56.695 54.635  78.563  1.00 34.71  ? 15  GLY A O   1 
ATOM   3311 N N   . GLY C 1 16  ? 57.929 53.030  77.590  1.00 31.43  ? 16  GLY A N   1 
ATOM   3312 C CA  . GLY C 1 16  ? 58.203 53.846  76.418  1.00 34.18  ? 16  GLY A CA  1 
ATOM   3313 C C   . GLY C 1 16  ? 57.093 53.840  75.377  1.00 30.83  ? 16  GLY A C   1 
ATOM   3314 O O   . GLY C 1 16  ? 56.038 53.246  75.584  1.00 26.89  ? 16  GLY A O   1 
ATOM   3315 N N   . SER C 1 17  ? 57.333 54.514  74.257  1.00 33.39  ? 17  SER A N   1 
ATOM   3316 C CA  . SER C 1 17  ? 56.349 54.589  73.182  1.00 33.80  ? 17  SER A CA  1 
ATOM   3317 C C   . SER C 1 17  ? 56.945 54.186  71.840  1.00 35.51  ? 17  SER A C   1 
ATOM   3318 O O   . SER C 1 17  ? 58.164 54.171  71.647  1.00 33.02  ? 17  SER A O   1 
ATOM   3319 C CB  . SER C 1 17  ? 55.767 55.998  73.082  1.00 28.62  ? 17  SER A CB  1 
ATOM   3320 O OG  . SER C 1 17  ? 56.743 56.912  72.627  1.00 46.67  ? 17  SER A OG  1 
ATOM   3321 N N   . LEU C 1 18  ? 56.069 53.864  70.901  1.00 32.36  ? 18  LEU A N   1 
ATOM   3322 C CA  . LEU C 1 18  ? 56.507 53.430  69.588  1.00 30.16  ? 18  LEU A CA  1 
ATOM   3323 C C   . LEU C 1 18  ? 55.339 53.607  68.633  1.00 30.13  ? 18  LEU A C   1 
ATOM   3324 O O   . LEU C 1 18  ? 54.181 53.449  69.022  1.00 28.07  ? 18  LEU A O   1 
ATOM   3325 C CB  . LEU C 1 18  ? 56.909 51.958  69.656  1.00 31.16  ? 18  LEU A CB  1 
ATOM   3326 C CG  . LEU C 1 18  ? 57.525 51.307  68.425  1.00 37.47  ? 18  LEU A CG  1 
ATOM   3327 C CD1 . LEU C 1 18  ? 58.856 51.966  68.096  1.00 41.15  ? 18  LEU A CD1 1 
ATOM   3328 C CD2 . LEU C 1 18  ? 57.717 49.828  68.702  1.00 34.15  ? 18  LEU A CD2 1 
ATOM   3329 N N   . LYS C 1 19  ? 55.639 53.942  67.385  1.00 25.31  ? 19  LYS A N   1 
ATOM   3330 C CA  . LYS C 1 19  ? 54.587 54.138  66.403  1.00 28.02  ? 19  LYS A CA  1 
ATOM   3331 C C   . LYS C 1 19  ? 54.755 53.185  65.228  1.00 22.25  ? 19  LYS A C   1 
ATOM   3332 O O   . LYS C 1 19  ? 55.760 53.224  64.523  1.00 23.50  ? 19  LYS A O   1 
ATOM   3333 C CB  . LYS C 1 19  ? 54.607 55.582  65.904  1.00 27.26  ? 19  LYS A CB  1 
ATOM   3334 C CG  . LYS C 1 19  ? 53.446 55.951  65.010  1.00 37.81  ? 19  LYS A CG  1 
ATOM   3335 C CD  . LYS C 1 19  ? 53.593 57.394  64.529  1.00 41.21  ? 19  LYS A CD  1 
ATOM   3336 C CE  . LYS C 1 19  ? 52.372 57.845  63.758  1.00 45.30  ? 19  LYS A CE  1 
ATOM   3337 N NZ  . LYS C 1 19  ? 51.144 57.784  64.604  1.00 50.22  ? 19  LYS A NZ  1 
ATOM   3338 N N   . LEU C 1 20  ? 53.768 52.324  65.019  1.00 24.73  ? 20  LEU A N   1 
ATOM   3339 C CA  . LEU C 1 20  ? 53.840 51.386  63.907  1.00 20.98  ? 20  LEU A CA  1 
ATOM   3340 C C   . LEU C 1 20  ? 53.095 52.005  62.724  1.00 23.24  ? 20  LEU A C   1 
ATOM   3341 O O   . LEU C 1 20  ? 52.199 52.824  62.906  1.00 19.32  ? 20  LEU A O   1 
ATOM   3342 C CB  . LEU C 1 20  ? 53.192 50.055  64.281  1.00 20.03  ? 20  LEU A CB  1 
ATOM   3343 C CG  . LEU C 1 20  ? 53.603 49.394  65.605  1.00 20.39  ? 20  LEU A CG  1 
ATOM   3344 C CD1 . LEU C 1 20  ? 52.978 47.997  65.702  1.00 16.54  ? 20  LEU A CD1 1 
ATOM   3345 C CD2 . LEU C 1 20  ? 55.116 49.297  65.674  1.00 16.74  ? 20  LEU A CD2 1 
ATOM   3346 N N   . SER C 1 21  ? 53.478 51.617  61.517  1.00 22.71  ? 21  SER A N   1 
ATOM   3347 C CA  . SER C 1 21  ? 52.816 52.130  60.329  1.00 26.19  ? 21  SER A CA  1 
ATOM   3348 C C   . SER C 1 21  ? 52.468 50.967  59.407  1.00 23.84  ? 21  SER A C   1 
ATOM   3349 O O   . SER C 1 21  ? 53.018 49.866  59.529  1.00 19.55  ? 21  SER A O   1 
ATOM   3350 C CB  . SER C 1 21  ? 53.720 53.129  59.608  1.00 23.24  ? 21  SER A CB  1 
ATOM   3351 O OG  . SER C 1 21  ? 54.935 52.507  59.229  1.00 45.27  ? 21  SER A OG  1 
ATOM   3352 N N   . CYS C 1 22  ? 51.547 51.215  58.487  1.00 22.62  ? 22  CYS A N   1 
ATOM   3353 C CA  . CYS C 1 22  ? 51.111 50.186  57.552  1.00 23.36  ? 22  CYS A CA  1 
ATOM   3354 C C   . CYS C 1 22  ? 50.760 50.832  56.218  1.00 21.04  ? 22  CYS A C   1 
ATOM   3355 O O   . CYS C 1 22  ? 50.004 51.794  56.173  1.00 21.66  ? 22  CYS A O   1 
ATOM   3356 C CB  . CYS C 1 22  ? 49.875 49.466  58.101  1.00 29.26  ? 22  CYS A CB  1 
ATOM   3357 S SG  . CYS C 1 22  ? 49.186 48.156  57.021  1.00 33.89  ? 22  CYS A SG  1 
ATOM   3358 N N   . THR C 1 23  ? 51.335 50.308  55.147  1.00 21.26  ? 23  THR A N   1 
ATOM   3359 C CA  . THR C 1 23  ? 51.067 50.811  53.808  1.00 26.03  ? 23  THR A CA  1 
ATOM   3360 C C   . THR C 1 23  ? 50.569 49.623  52.989  1.00 25.87  ? 23  THR A C   1 
ATOM   3361 O O   . THR C 1 23  ? 50.704 48.475  53.397  1.00 25.14  ? 23  THR A O   1 
ATOM   3362 C CB  . THR C 1 23  ? 52.338 51.377  53.145  1.00 27.33  ? 23  THR A CB  1 
ATOM   3363 O OG1 . THR C 1 23  ? 53.356 50.369  53.113  1.00 29.54  ? 23  THR A OG1 1 
ATOM   3364 C CG2 . THR C 1 23  ? 52.848 52.587  53.909  1.00 28.29  ? 23  THR A CG2 1 
ATOM   3365 N N   . ALA C 1 24  ? 49.983 49.888  51.836  1.00 24.47  ? 24  ALA A N   1 
ATOM   3366 C CA  . ALA C 1 24  ? 49.500 48.791  51.026  1.00 25.62  ? 24  ALA A CA  1 
ATOM   3367 C C   . ALA C 1 24  ? 49.420 49.167  49.564  1.00 27.27  ? 24  ALA A C   1 
ATOM   3368 O O   . ALA C 1 24  ? 49.454 50.339  49.210  1.00 25.51  ? 24  ALA A O   1 
ATOM   3369 C CB  . ALA C 1 24  ? 48.140 48.366  51.505  1.00 29.93  ? 24  ALA A CB  1 
ATOM   3370 N N   . SER C 1 25  ? 49.339 48.149  48.723  1.00 26.25  ? 25  SER A N   1 
ATOM   3371 C CA  . SER C 1 25  ? 49.184 48.351  47.299  1.00 30.37  ? 25  SER A CA  1 
ATOM   3372 C C   . SER C 1 25  ? 47.921 47.565  46.969  1.00 26.85  ? 25  SER A C   1 
ATOM   3373 O O   . SER C 1 25  ? 47.800 46.393  47.346  1.00 31.11  ? 25  SER A O   1 
ATOM   3374 C CB  . SER C 1 25  ? 50.382 47.787  46.534  1.00 31.05  ? 25  SER A CB  1 
ATOM   3375 O OG  . SER C 1 25  ? 50.529 46.403  46.776  1.00 43.21  ? 25  SER A OG  1 
ATOM   3376 N N   . GLY C 1 26  ? 46.961 48.228  46.331  1.00 23.70  ? 26  GLY A N   1 
ATOM   3377 C CA  . GLY C 1 26  ? 45.724 47.558  45.945  1.00 20.89  ? 26  GLY A CA  1 
ATOM   3378 C C   . GLY C 1 26  ? 44.559 47.654  46.909  1.00 21.20  ? 26  GLY A C   1 
ATOM   3379 O O   . GLY C 1 26  ? 43.455 47.223  46.583  1.00 17.69  ? 26  GLY A O   1 
ATOM   3380 N N   . ILE C 1 27  ? 44.802 48.212  48.092  1.00 20.56  ? 27  ILE A N   1 
ATOM   3381 C CA  . ILE C 1 27  ? 43.765 48.369  49.105  1.00 19.85  ? 27  ILE A CA  1 
ATOM   3382 C C   . ILE C 1 27  ? 43.701 49.837  49.521  1.00 20.00  ? 27  ILE A C   1 
ATOM   3383 O O   . ILE C 1 27  ? 44.723 50.434  49.862  1.00 24.11  ? 27  ILE A O   1 
ATOM   3384 C CB  . ILE C 1 27  ? 44.069 47.498  50.352  1.00 24.60  ? 27  ILE A CB  1 
ATOM   3385 C CG1 . ILE C 1 27  ? 44.020 46.019  49.971  1.00 28.75  ? 27  ILE A CG1 1 
ATOM   3386 C CG2 . ILE C 1 27  ? 43.071 47.791  51.460  1.00 25.00  ? 27  ILE A CG2 1 
ATOM   3387 C CD1 . ILE C 1 27  ? 44.326 45.074  51.129  1.00 36.71  ? 27  ILE A CD1 1 
ATOM   3388 N N   . THR C 1 28  ? 42.504 50.415  49.474  1.00 17.56  ? 28  THR A N   1 
ATOM   3389 C CA  . THR C 1 28  ? 42.298 51.814  49.849  1.00 22.05  ? 28  THR A CA  1 
ATOM   3390 C C   . THR C 1 28  ? 41.760 51.862  51.290  1.00 17.10  ? 28  THR A C   1 
ATOM   3391 O O   . THR C 1 28  ? 40.566 51.745  51.516  1.00 18.66  ? 28  THR A O   1 
ATOM   3392 C CB  . THR C 1 28  ? 41.285 52.492  48.894  1.00 26.00  ? 28  THR A CB  1 
ATOM   3393 O OG1 . THR C 1 28  ? 41.695 52.272  47.539  1.00 23.86  ? 28  THR A OG1 1 
ATOM   3394 C CG2 . THR C 1 28  ? 41.231 54.004  49.149  1.00 23.50  ? 28  THR A CG2 1 
ATOM   3395 N N   . PHE C 1 29  ? 42.662 52.039  52.252  1.00 21.27  ? 29  PHE A N   1 
ATOM   3396 C CA  . PHE C 1 29  ? 42.315 52.066  53.680  1.00 18.88  ? 29  PHE A CA  1 
ATOM   3397 C C   . PHE C 1 29  ? 41.075 52.867  54.080  1.00 18.86  ? 29  PHE A C   1 
ATOM   3398 O O   . PHE C 1 29  ? 40.297 52.438  54.931  1.00 18.50  ? 29  PHE A O   1 
ATOM   3399 C CB  . PHE C 1 29  ? 43.511 52.579  54.487  1.00 20.81  ? 29  PHE A CB  1 
ATOM   3400 C CG  . PHE C 1 29  ? 44.706 51.658  54.477  1.00 21.34  ? 29  PHE A CG  1 
ATOM   3401 C CD1 . PHE C 1 29  ? 45.971 52.148  54.788  1.00 25.60  ? 29  PHE A CD1 1 
ATOM   3402 C CD2 . PHE C 1 29  ? 44.570 50.302  54.193  1.00 23.93  ? 29  PHE A CD2 1 
ATOM   3403 C CE1 . PHE C 1 29  ? 47.088 51.302  54.817  1.00 21.01  ? 29  PHE A CE1 1 
ATOM   3404 C CE2 . PHE C 1 29  ? 45.673 49.449  54.219  1.00 24.52  ? 29  PHE A CE2 1 
ATOM   3405 C CZ  . PHE C 1 29  ? 46.938 49.951  54.533  1.00 25.28  ? 29  PHE A CZ  1 
ATOM   3406 N N   . SER C 1 30  ? 40.879 54.026  53.462  1.00 17.46  ? 30  SER A N   1 
ATOM   3407 C CA  . SER C 1 30  ? 39.743 54.876  53.800  1.00 19.30  ? 30  SER A CA  1 
ATOM   3408 C C   . SER C 1 30  ? 38.384 54.216  53.651  1.00 17.12  ? 30  SER A C   1 
ATOM   3409 O O   . SER C 1 30  ? 37.416 54.636  54.280  1.00 17.31  ? 30  SER A O   1 
ATOM   3410 C CB  . SER C 1 30  ? 39.768 56.144  52.945  1.00 24.82  ? 30  SER A CB  1 
ATOM   3411 O OG  . SER C 1 30  ? 39.490 55.833  51.589  1.00 25.15  ? 30  SER A OG  1 
ATOM   3412 N N   . ARG C 1 31  ? 38.309 53.173  52.834  1.00 19.58  ? 32  ARG A N   1 
ATOM   3413 C CA  . ARG C 1 31  ? 37.035 52.500  52.590  1.00 21.27  ? 32  ARG A CA  1 
ATOM   3414 C C   . ARG C 1 31  ? 36.646 51.375  53.547  1.00 22.91  ? 32  ARG A C   1 
ATOM   3415 O O   . ARG C 1 31  ? 35.506 50.913  53.523  1.00 20.57  ? 32  ARG A O   1 
ATOM   3416 C CB  . ARG C 1 31  ? 37.042 51.918  51.175  1.00 29.65  ? 32  ARG A CB  1 
ATOM   3417 C CG  . ARG C 1 31  ? 37.096 52.947  50.060  1.00 32.29  ? 32  ARG A CG  1 
ATOM   3418 C CD  . ARG C 1 31  ? 37.370 52.258  48.729  1.00 43.62  ? 32  ARG A CD  1 
ATOM   3419 N NE  . ARG C 1 31  ? 36.584 51.034  48.580  1.00 49.84  ? 32  ARG A NE  1 
ATOM   3420 C CZ  . ARG C 1 31  ? 36.623 50.246  47.508  1.00 54.40  ? 32  ARG A CZ  1 
ATOM   3421 N NH1 . ARG C 1 31  ? 37.410 50.557  46.483  1.00 44.79  ? 32  ARG A NH1 1 
ATOM   3422 N NH2 . ARG C 1 31  ? 35.885 49.142  47.465  1.00 46.85  ? 32  ARG A NH2 1 
ATOM   3423 N N   . TYR C 1 32  ? 37.574 50.940  54.389  1.00 22.51  ? 34  TYR A N   1 
ATOM   3424 C CA  . TYR C 1 32  ? 37.307 49.803  55.264  1.00 22.79  ? 34  TYR A CA  1 
ATOM   3425 C C   . TYR C 1 32  ? 37.477 49.997  56.760  1.00 24.58  ? 34  TYR A C   1 
ATOM   3426 O O   . TYR C 1 32  ? 37.941 51.031  57.230  1.00 19.89  ? 34  TYR A O   1 
ATOM   3427 C CB  . TYR C 1 32  ? 38.217 48.638  54.871  1.00 20.28  ? 34  TYR A CB  1 
ATOM   3428 C CG  . TYR C 1 32  ? 38.323 48.388  53.377  1.00 23.41  ? 34  TYR A CG  1 
ATOM   3429 C CD1 . TYR C 1 32  ? 39.372 48.927  52.637  1.00 22.52  ? 34  TYR A CD1 1 
ATOM   3430 C CD2 . TYR C 1 32  ? 37.385 47.597  52.715  1.00 21.36  ? 34  TYR A CD2 1 
ATOM   3431 C CE1 . TYR C 1 32  ? 39.488 48.680  51.262  1.00 26.19  ? 34  TYR A CE1 1 
ATOM   3432 C CE2 . TYR C 1 32  ? 37.489 47.346  51.348  1.00 25.09  ? 34  TYR A CE2 1 
ATOM   3433 C CZ  . TYR C 1 32  ? 38.543 47.888  50.631  1.00 26.09  ? 34  TYR A CZ  1 
ATOM   3434 O OH  . TYR C 1 32  ? 38.668 47.624  49.282  1.00 25.69  ? 34  TYR A OH  1 
ATOM   3435 N N   . ILE C 1 33  ? 37.070 48.971  57.497  1.00 23.74  ? 35  ILE A N   1 
ATOM   3436 C CA  . ILE C 1 33  ? 37.256 48.943  58.940  1.00 22.48  ? 35  ILE A CA  1 
ATOM   3437 C C   . ILE C 1 33  ? 38.653 48.346  58.951  1.00 17.36  ? 35  ILE A C   1 
ATOM   3438 O O   . ILE C 1 33  ? 38.826 47.172  58.599  1.00 20.52  ? 35  ILE A O   1 
ATOM   3439 C CB  . ILE C 1 33  ? 36.308 47.949  59.630  1.00 23.58  ? 35  ILE A CB  1 
ATOM   3440 C CG1 . ILE C 1 33  ? 34.868 48.448  59.524  1.00 26.56  ? 35  ILE A CG1 1 
ATOM   3441 C CG2 . ILE C 1 33  ? 36.712 47.778  61.107  1.00 19.93  ? 35  ILE A CG2 1 
ATOM   3442 C CD1 . ILE C 1 33  ? 33.835 47.428  59.949  1.00 29.73  ? 35  ILE A CD1 1 
ATOM   3443 N N   . MET C 1 34  ? 39.650 49.143  59.308  1.00 12.38  ? 36  MET A N   1 
ATOM   3444 C CA  . MET C 1 34  ? 41.027 48.656  59.323  1.00 17.45  ? 36  MET A CA  1 
ATOM   3445 C C   . MET C 1 34  ? 41.389 48.286  60.756  1.00 21.68  ? 36  MET A C   1 
ATOM   3446 O O   . MET C 1 34  ? 40.926 48.928  61.698  1.00 20.30  ? 36  MET A O   1 
ATOM   3447 C CB  . MET C 1 34  ? 41.975 49.721  58.797  1.00 14.88  ? 36  MET A CB  1 
ATOM   3448 C CG  . MET C 1 34  ? 41.836 49.989  57.299  1.00 24.79  ? 36  MET A CG  1 
ATOM   3449 S SD  . MET C 1 34  ? 42.020 48.491  56.329  1.00 23.47  ? 36  MET A SD  1 
ATOM   3450 C CE  . MET C 1 34  ? 43.756 48.068  56.604  1.00 19.97  ? 36  MET A CE  1 
ATOM   3451 N N   . SER C 1 35  ? 42.211 47.257  60.916  1.00 18.89  ? 37  SER A N   1 
ATOM   3452 C CA  . SER C 1 35  ? 42.560 46.796  62.257  1.00 18.98  ? 37  SER A CA  1 
ATOM   3453 C C   . SER C 1 35  ? 44.031 46.473  62.466  1.00 18.84  ? 37  SER A C   1 
ATOM   3454 O O   . SER C 1 35  ? 44.816 46.370  61.520  1.00 21.19  ? 37  SER A O   1 
ATOM   3455 C CB  . SER C 1 35  ? 41.778 45.530  62.580  1.00 16.76  ? 37  SER A CB  1 
ATOM   3456 O OG  . SER C 1 35  ? 40.393 45.698  62.407  1.00 20.37  ? 37  SER A OG  1 
ATOM   3457 N N   . TRP C 1 36  ? 44.373 46.304  63.737  1.00 21.23  ? 38  TRP A N   1 
ATOM   3458 C CA  . TRP C 1 36  ? 45.700 45.899  64.155  1.00 15.10  ? 38  TRP A CA  1 
ATOM   3459 C C   . TRP C 1 36  ? 45.410 44.700  65.063  1.00 15.90  ? 38  TRP A C   1 
ATOM   3460 O O   . TRP C 1 36  ? 44.455 44.707  65.845  1.00 16.92  ? 38  TRP A O   1 
ATOM   3461 C CB  . TRP C 1 36  ? 46.409 47.003  64.952  1.00 20.16  ? 38  TRP A CB  1 
ATOM   3462 C CG  . TRP C 1 36  ? 47.018 48.083  64.112  1.00 19.61  ? 38  TRP A CG  1 
ATOM   3463 C CD1 . TRP C 1 36  ? 46.466 49.296  63.808  1.00 17.92  ? 38  TRP A CD1 1 
ATOM   3464 C CD2 . TRP C 1 36  ? 48.290 48.042  63.450  1.00 17.23  ? 38  TRP A CD2 1 
ATOM   3465 N NE1 . TRP C 1 36  ? 47.317 50.013  63.003  1.00 20.57  ? 38  TRP A NE1 1 
ATOM   3466 C CE2 . TRP C 1 36  ? 48.442 49.266  62.766  1.00 18.84  ? 38  TRP A CE2 1 
ATOM   3467 C CE3 . TRP C 1 36  ? 49.317 47.089  63.369  1.00 12.72  ? 38  TRP A CE3 1 
ATOM   3468 C CZ2 . TRP C 1 36  ? 49.581 49.563  62.006  1.00 16.73  ? 38  TRP A CZ2 1 
ATOM   3469 C CZ3 . TRP C 1 36  ? 50.445 47.387  62.619  1.00 16.92  ? 38  TRP A CZ3 1 
ATOM   3470 C CH2 . TRP C 1 36  ? 50.567 48.611  61.948  1.00 16.36  ? 38  TRP A CH2 1 
ATOM   3471 N N   . VAL C 1 37  ? 46.199 43.649  64.912  1.00 16.58  ? 39  VAL A N   1 
ATOM   3472 C CA  . VAL C 1 37  ? 46.033 42.463  65.736  1.00 20.07  ? 39  VAL A CA  1 
ATOM   3473 C C   . VAL C 1 37  ? 47.454 42.068  66.098  1.00 18.21  ? 39  VAL A C   1 
ATOM   3474 O O   . VAL C 1 37  ? 48.388 42.483  65.426  1.00 20.82  ? 39  VAL A O   1 
ATOM   3475 C CB  . VAL C 1 37  ? 45.324 41.337  64.943  1.00 20.80  ? 39  VAL A CB  1 
ATOM   3476 C CG1 . VAL C 1 37  ? 45.320 40.062  65.740  1.00 30.47  ? 39  VAL A CG1 1 
ATOM   3477 C CG2 . VAL C 1 37  ? 43.880 41.753  64.646  1.00 20.71  ? 39  VAL A CG2 1 
ATOM   3478 N N   . ARG C 1 38  ? 47.631 41.291  67.160  1.00 19.93  ? 40  ARG A N   1 
ATOM   3479 C CA  . ARG C 1 38  ? 48.979 40.893  67.549  1.00 20.96  ? 40  ARG A CA  1 
ATOM   3480 C C   . ARG C 1 38  ? 49.051 39.434  67.977  1.00 21.09  ? 40  ARG A C   1 
ATOM   3481 O O   . ARG C 1 38  ? 48.108 38.887  68.545  1.00 21.25  ? 40  ARG A O   1 
ATOM   3482 C CB  . ARG C 1 38  ? 49.511 41.799  68.668  1.00 13.61  ? 40  ARG A CB  1 
ATOM   3483 C CG  . ARG C 1 38  ? 48.754 41.690  69.991  1.00 19.21  ? 40  ARG A CG  1 
ATOM   3484 C CD  . ARG C 1 38  ? 49.269 42.712  71.016  1.00 18.88  ? 40  ARG A CD  1 
ATOM   3485 N NE  . ARG C 1 38  ? 48.546 42.612  72.281  1.00 24.52  ? 40  ARG A NE  1 
ATOM   3486 C CZ  . ARG C 1 38  ? 48.690 43.455  73.299  1.00 29.13  ? 40  ARG A CZ  1 
ATOM   3487 N NH1 . ARG C 1 38  ? 49.527 44.479  73.206  1.00 22.05  ? 40  ARG A NH1 1 
ATOM   3488 N NH2 . ARG C 1 38  ? 48.015 43.258  74.422  1.00 28.22  ? 40  ARG A NH2 1 
ATOM   3489 N N   . GLN C 1 39  ? 50.198 38.830  67.687  1.00 27.68  ? 41  GLN A N   1 
ATOM   3490 C CA  . GLN C 1 39  ? 50.488 37.431  67.968  1.00 32.39  ? 41  GLN A CA  1 
ATOM   3491 C C   . GLN C 1 39  ? 51.595 37.324  69.017  1.00 36.62  ? 41  GLN A C   1 
ATOM   3492 O O   . GLN C 1 39  ? 52.731 37.723  68.772  1.00 28.47  ? 41  GLN A O   1 
ATOM   3493 C CB  . GLN C 1 39  ? 50.922 36.778  66.651  1.00 37.05  ? 41  GLN A CB  1 
ATOM   3494 C CG  . GLN C 1 39  ? 51.267 35.308  66.679  1.00 45.67  ? 41  GLN A CG  1 
ATOM   3495 C CD  . GLN C 1 39  ? 51.166 34.689  65.285  1.00 49.44  ? 41  GLN A CD  1 
ATOM   3496 O OE1 . GLN C 1 39  ? 51.891 35.072  64.358  1.00 42.68  ? 41  GLN A OE1 1 
ATOM   3497 N NE2 . GLN C 1 39  ? 50.252 33.739  65.129  1.00 48.25  ? 41  GLN A NE2 1 
ATOM   3498 N N   . ILE C 1 40  ? 51.255 36.799  70.189  1.00 44.00  ? 42  ILE A N   1 
ATOM   3499 C CA  . ILE C 1 40  ? 52.236 36.634  71.259  1.00 57.26  ? 42  ILE A CA  1 
ATOM   3500 C C   . ILE C 1 40  ? 52.710 35.177  71.283  1.00 63.53  ? 42  ILE A C   1 
ATOM   3501 O O   . ILE C 1 40  ? 52.237 34.356  70.496  1.00 63.51  ? 42  ILE A O   1 
ATOM   3502 C CB  . ILE C 1 40  ? 51.633 37.003  72.638  1.00 58.62  ? 42  ILE A CB  1 
ATOM   3503 C CG1 . ILE C 1 40  ? 50.425 36.116  72.936  1.00 63.49  ? 42  ILE A CG1 1 
ATOM   3504 C CG2 . ILE C 1 40  ? 51.231 38.470  72.657  1.00 57.32  ? 42  ILE A CG2 1 
ATOM   3505 C CD1 . ILE C 1 40  ? 49.811 36.360  74.298  1.00 67.90  ? 42  ILE A CD1 1 
ATOM   3506 N N   . PRO C 1 41  ? 53.658 34.839  72.177  1.00 70.99  ? 43  PRO A N   1 
ATOM   3507 C CA  . PRO C 1 41  ? 54.180 33.471  72.280  1.00 72.61  ? 43  PRO A CA  1 
ATOM   3508 C C   . PRO C 1 41  ? 53.116 32.375  72.237  1.00 75.21  ? 43  PRO A C   1 
ATOM   3509 O O   . PRO C 1 41  ? 53.308 31.347  71.587  1.00 74.49  ? 43  PRO A O   1 
ATOM   3510 C CB  . PRO C 1 41  ? 54.929 33.498  73.605  1.00 74.14  ? 43  PRO A CB  1 
ATOM   3511 C CG  . PRO C 1 41  ? 55.517 34.870  73.595  1.00 75.23  ? 43  PRO A CG  1 
ATOM   3512 C CD  . PRO C 1 41  ? 54.356 35.730  73.125  1.00 73.49  ? 43  PRO A CD  1 
ATOM   3513 N N   . GLU C 1 42  ? 52.001 32.596  72.930  1.00 78.37  ? 44  GLU A N   1 
ATOM   3514 C CA  . GLU C 1 42  ? 50.910 31.624  72.962  1.00 80.92  ? 44  GLU A CA  1 
ATOM   3515 C C   . GLU C 1 42  ? 50.563 31.228  71.532  1.00 81.42  ? 44  GLU A C   1 
ATOM   3516 O O   . GLU C 1 42  ? 50.087 30.121  71.278  1.00 83.87  ? 44  GLU A O   1 
ATOM   3517 C CB  . GLU C 1 42  ? 49.672 32.225  73.636  1.00 82.11  ? 44  GLU A CB  1 
ATOM   3518 C CG  . GLU C 1 42  ? 48.854 33.145  72.737  1.00 85.57  ? 44  GLU A CG  1 
ATOM   3519 C CD  . GLU C 1 42  ? 47.637 33.722  73.437  1.00 89.27  ? 44  GLU A CD  1 
ATOM   3520 O OE1 . GLU C 1 42  ? 46.816 34.379  72.762  1.00 90.71  ? 44  GLU A OE1 1 
ATOM   3521 O OE2 . GLU C 1 42  ? 47.501 33.524  74.663  1.00 91.76  ? 44  GLU A OE2 1 
ATOM   3522 N N   . LYS C 1 43  ? 50.802 32.160  70.613  1.00 79.95  ? 45  LYS A N   1 
ATOM   3523 C CA  . LYS C 1 43  ? 50.554 31.976  69.186  1.00 75.66  ? 45  LYS A CA  1 
ATOM   3524 C C   . LYS C 1 43  ? 49.078 32.113  68.817  1.00 70.96  ? 45  LYS A C   1 
ATOM   3525 O O   . LYS C 1 43  ? 48.666 31.716  67.727  1.00 71.32  ? 45  LYS A O   1 
ATOM   3526 C CB  . LYS C 1 43  ? 51.090 30.616  68.722  1.00 75.04  ? 45  LYS A CB  1 
ATOM   3527 C CG  . LYS C 1 43  ? 51.651 30.621  67.310  1.00 73.11  ? 45  LYS A CG  1 
ATOM   3528 C CD  . LYS C 1 43  ? 52.860 31.540  67.211  1.00 71.67  ? 45  LYS A CD  1 
ATOM   3529 C CE  . LYS C 1 43  ? 53.428 31.560  65.802  1.00 70.91  ? 45  LYS A CE  1 
ATOM   3530 N NZ  . LYS C 1 43  ? 53.888 30.214  65.354  1.00 70.52  ? 45  LYS A NZ  1 
ATOM   3531 N N   . ARG C 1 44  ? 48.288 32.678  69.726  1.00 66.40  ? 46  ARG A N   1 
ATOM   3532 C CA  . ARG C 1 44  ? 46.863 32.884  69.480  1.00 59.12  ? 46  ARG A CA  1 
ATOM   3533 C C   . ARG C 1 44  ? 46.578 34.380  69.311  1.00 51.45  ? 46  ARG A C   1 
ATOM   3534 O O   . ARG C 1 44  ? 46.766 35.164  70.241  1.00 50.46  ? 46  ARG A O   1 
ATOM   3535 C CB  . ARG C 1 44  ? 46.032 32.320  70.634  1.00 56.56  ? 46  ARG A CB  1 
ATOM   3536 C CG  . ARG C 1 44  ? 44.542 32.409  70.374  1.00 58.47  ? 46  ARG A CG  1 
ATOM   3537 C CD  . ARG C 1 44  ? 43.713 31.677  71.410  1.00 55.71  ? 46  ARG A CD  1 
ATOM   3538 N NE  . ARG C 1 44  ? 42.300 31.756  71.062  1.00 47.48  ? 46  ARG A NE  1 
ATOM   3539 C CZ  . ARG C 1 44  ? 41.324 31.127  71.704  1.00 47.64  ? 46  ARG A CZ  1 
ATOM   3540 N NH1 . ARG C 1 44  ? 41.592 30.353  72.751  1.00 42.34  ? 46  ARG A NH1 1 
ATOM   3541 N NH2 . ARG C 1 44  ? 40.075 31.271  71.287  1.00 43.97  ? 46  ARG A NH2 1 
ATOM   3542 N N   . LEU C 1 45  ? 46.120 34.763  68.123  1.00 45.66  ? 47  LEU A N   1 
ATOM   3543 C CA  . LEU C 1 45  ? 45.829 36.161  67.812  1.00 38.61  ? 47  LEU A CA  1 
ATOM   3544 C C   . LEU C 1 45  ? 44.957 36.926  68.799  1.00 35.49  ? 47  LEU A C   1 
ATOM   3545 O O   . LEU C 1 45  ? 43.968 36.412  69.318  1.00 34.63  ? 47  LEU A O   1 
ATOM   3546 C CB  . LEU C 1 45  ? 45.204 36.279  66.420  1.00 42.15  ? 47  LEU A CB  1 
ATOM   3547 C CG  . LEU C 1 45  ? 46.150 36.261  65.221  1.00 40.89  ? 47  LEU A CG  1 
ATOM   3548 C CD1 . LEU C 1 45  ? 47.168 37.379  65.365  1.00 38.98  ? 47  LEU A CD1 1 
ATOM   3549 C CD2 . LEU C 1 45  ? 46.852 34.931  65.135  1.00 45.55  ? 47  LEU A CD2 1 
ATOM   3550 N N   . GLU C 1 46  ? 45.344 38.176  69.033  1.00 26.07  ? 48  GLU A N   1 
ATOM   3551 C CA  . GLU C 1 46  ? 44.635 39.068  69.931  1.00 27.51  ? 48  GLU A CA  1 
ATOM   3552 C C   . GLU C 1 46  ? 44.345 40.363  69.179  1.00 20.44  ? 48  GLU A C   1 
ATOM   3553 O O   . GLU C 1 46  ? 45.236 40.933  68.569  1.00 21.31  ? 48  GLU A O   1 
ATOM   3554 C CB  . GLU C 1 46  ? 45.501 39.380  71.162  1.00 25.33  ? 48  GLU A CB  1 
ATOM   3555 C CG  . GLU C 1 46  ? 44.842 40.330  72.159  1.00 39.28  ? 48  GLU A CG  1 
ATOM   3556 C CD  . GLU C 1 46  ? 45.756 40.727  73.318  1.00 43.58  ? 48  GLU A CD  1 
ATOM   3557 O OE1 . GLU C 1 46  ? 45.298 41.484  74.199  1.00 50.78  ? 48  GLU A OE1 1 
ATOM   3558 O OE2 . GLU C 1 46  ? 46.929 40.294  73.350  1.00 38.14  ? 48  GLU A OE2 1 
ATOM   3559 N N   . TRP C 1 47  ? 43.097 40.812  69.227  1.00 22.17  ? 49  TRP A N   1 
ATOM   3560 C CA  . TRP C 1 47  ? 42.701 42.060  68.570  1.00 22.87  ? 49  TRP A CA  1 
ATOM   3561 C C   . TRP C 1 47  ? 43.284 43.221  69.379  1.00 24.20  ? 49  TRP A C   1 
ATOM   3562 O O   . TRP C 1 47  ? 43.226 43.204  70.608  1.00 18.06  ? 49  TRP A O   1 
ATOM   3563 C CB  . TRP C 1 47  ? 41.182 42.158  68.543  1.00 20.52  ? 49  TRP A CB  1 
ATOM   3564 C CG  . TRP C 1 47  ? 40.646 43.480  68.103  1.00 21.83  ? 49  TRP A CG  1 
ATOM   3565 C CD1 . TRP C 1 47  ? 40.868 44.109  66.901  1.00 19.50  ? 49  TRP A CD1 1 
ATOM   3566 C CD2 . TRP C 1 47  ? 39.737 44.310  68.831  1.00 22.41  ? 49  TRP A CD2 1 
ATOM   3567 N NE1 . TRP C 1 47  ? 40.145 45.279  66.842  1.00 15.28  ? 49  TRP A NE1 1 
ATOM   3568 C CE2 . TRP C 1 47  ? 39.442 45.427  68.011  1.00 22.23  ? 49  TRP A CE2 1 
ATOM   3569 C CE3 . TRP C 1 47  ? 39.137 44.219  70.097  1.00 24.77  ? 49  TRP A CE3 1 
ATOM   3570 C CZ2 . TRP C 1 47  ? 38.571 46.445  68.418  1.00 24.24  ? 49  TRP A CZ2 1 
ATOM   3571 C CZ3 . TRP C 1 47  ? 38.270 45.233  70.503  1.00 24.35  ? 49  TRP A CZ3 1 
ATOM   3572 C CH2 . TRP C 1 47  ? 37.996 46.333  69.662  1.00 26.75  ? 49  TRP A CH2 1 
ATOM   3573 N N   . VAL C 1 48  ? 43.823 44.219  68.683  1.00 20.39  ? 50  VAL A N   1 
ATOM   3574 C CA  . VAL C 1 48  ? 44.449 45.384  69.308  1.00 20.79  ? 50  VAL A CA  1 
ATOM   3575 C C   . VAL C 1 48  ? 43.657 46.670  69.076  1.00 22.44  ? 50  VAL A C   1 
ATOM   3576 O O   . VAL C 1 48  ? 43.441 47.449  70.004  1.00 18.60  ? 50  VAL A O   1 
ATOM   3577 C CB  . VAL C 1 48  ? 45.895 45.571  68.765  1.00 20.39  ? 50  VAL A CB  1 
ATOM   3578 C CG1 . VAL C 1 48  ? 46.509 46.865  69.286  1.00 20.81  ? 50  VAL A CG1 1 
ATOM   3579 C CG2 . VAL C 1 48  ? 46.752 44.383  69.172  1.00 22.94  ? 50  VAL A CG2 1 
ATOM   3580 N N   . ALA C 1 49  ? 43.220 46.894  67.837  1.00 15.19  ? 51  ALA A N   1 
ATOM   3581 C CA  . ALA C 1 49  ? 42.470 48.110  67.536  1.00 16.03  ? 51  ALA A CA  1 
ATOM   3582 C C   . ALA C 1 49  ? 41.853 48.066  66.152  1.00 14.72  ? 51  ALA A C   1 
ATOM   3583 O O   . ALA C 1 49  ? 42.358 47.371  65.269  1.00 19.79  ? 51  ALA A O   1 
ATOM   3584 C CB  . ALA C 1 49  ? 43.391 49.310  67.625  1.00 12.37  ? 51  ALA A CB  1 
ATOM   3585 N N   . SER C 1 50  ? 40.775 48.828  65.978  1.00 20.06  ? 52  SER A N   1 
ATOM   3586 C CA  . SER C 1 50  ? 40.082 48.942  64.696  1.00 20.60  ? 52  SER A CA  1 
ATOM   3587 C C   . SER C 1 50  ? 39.600 50.380  64.524  1.00 24.47  ? 52  SER A C   1 
ATOM   3588 O O   . SER C 1 50  ? 39.339 51.074  65.508  1.00 25.14  ? 52  SER A O   1 
ATOM   3589 C CB  . SER C 1 50  ? 38.858 48.021  64.641  1.00 16.72  ? 52  SER A CB  1 
ATOM   3590 O OG  . SER C 1 50  ? 39.218 46.655  64.618  1.00 21.50  ? 52  SER A OG  1 
ATOM   3591 N N   . ILE C 1 51  ? 39.496 50.819  63.272  1.00 21.14  ? 53  ILE A N   1 
ATOM   3592 C CA  . ILE C 1 51  ? 38.985 52.143  62.951  1.00 17.52  ? 53  ILE A CA  1 
ATOM   3593 C C   . ILE C 1 51  ? 38.073 51.984  61.716  1.00 21.84  ? 53  ILE A C   1 
ATOM   3594 O O   . ILE C 1 51  ? 38.492 51.446  60.700  1.00 19.42  ? 53  ILE A O   1 
ATOM   3595 C CB  . ILE C 1 51  ? 40.134 53.139  62.672  1.00 13.10  ? 53  ILE A CB  1 
ATOM   3596 C CG1 . ILE C 1 51  ? 39.541 54.534  62.437  1.00 20.34  ? 53  ILE A CG1 1 
ATOM   3597 C CG2 . ILE C 1 51  ? 41.000 52.668  61.497  1.00 16.13  ? 53  ILE A CG2 1 
ATOM   3598 C CD1 . ILE C 1 51  ? 40.573 55.629  62.285  1.00 20.11  ? 53  ILE A CD1 1 
ATOM   3599 N N   . SER C 1 52  ? 36.818 52.413  61.836  1.00 21.99  ? 54  SER A N   1 
ATOM   3600 C CA  . SER C 1 52  ? 35.849 52.303  60.744  1.00 25.72  ? 54  SER A CA  1 
ATOM   3601 C C   . SER C 1 52  ? 36.147 53.270  59.605  1.00 22.36  ? 54  SER A C   1 
ATOM   3602 O O   . SER C 1 52  ? 37.071 54.084  59.687  1.00 25.10  ? 54  SER A O   1 
ATOM   3603 C CB  . SER C 1 52  ? 34.428 52.548  61.265  1.00 21.32  ? 54  SER A CB  1 
ATOM   3604 O OG  . SER C 1 52  ? 34.236 53.895  61.674  1.00 23.61  ? 54  SER A OG  1 
ATOM   3605 N N   . SER C 1 53  ? 35.376 53.176  58.527  1.00 24.24  ? 55  SER A N   1 
ATOM   3606 C CA  . SER C 1 53  ? 35.600 54.079  57.406  1.00 26.53  ? 55  SER A CA  1 
ATOM   3607 C C   . SER C 1 53  ? 35.213 55.474  57.886  1.00 23.08  ? 55  SER A C   1 
ATOM   3608 O O   . SER C 1 53  ? 35.805 56.470  57.481  1.00 29.21  ? 55  SER A O   1 
ATOM   3609 C CB  . SER C 1 53  ? 34.743 53.670  56.192  1.00 26.15  ? 55  SER A CB  1 
ATOM   3610 O OG  . SER C 1 53  ? 33.368 53.659  56.526  1.00 30.51  ? 55  SER A OG  1 
ATOM   3611 N N   . GLY C 1 54  ? 34.215 55.526  58.760  1.00 23.32  ? 56  GLY A N   1 
ATOM   3612 C CA  . GLY C 1 54  ? 33.762 56.789  59.315  1.00 27.44  ? 56  GLY A CA  1 
ATOM   3613 C C   . GLY C 1 54  ? 34.762 57.402  60.282  1.00 33.26  ? 56  GLY A C   1 
ATOM   3614 O O   . GLY C 1 54  ? 34.608 58.557  60.697  1.00 33.22  ? 56  GLY A O   1 
ATOM   3615 N N   . GLY C 1 55  ? 35.786 56.635  60.653  1.00 32.23  ? 57  GLY A N   1 
ATOM   3616 C CA  . GLY C 1 55  ? 36.798 57.151  61.560  1.00 31.60  ? 57  GLY A CA  1 
ATOM   3617 C C   . GLY C 1 55  ? 36.602 56.820  63.029  1.00 27.24  ? 57  GLY A C   1 
ATOM   3618 O O   . GLY C 1 55  ? 37.389 57.244  63.866  1.00 26.62  ? 57  GLY A O   1 
ATOM   3619 N N   . ILE C 1 56  ? 35.551 56.075  63.347  1.00 24.44  ? 58  ILE A N   1 
ATOM   3620 C CA  . ILE C 1 56  ? 35.279 55.675  64.724  1.00 28.45  ? 58  ILE A CA  1 
ATOM   3621 C C   . ILE C 1 56  ? 36.332 54.642  65.154  1.00 31.57  ? 58  ILE A C   1 
ATOM   3622 O O   . ILE C 1 56  ? 36.601 53.690  64.418  1.00 29.38  ? 58  ILE A O   1 
ATOM   3623 C CB  . ILE C 1 56  ? 33.893 55.019  64.846  1.00 30.64  ? 58  ILE A CB  1 
ATOM   3624 C CG1 . ILE C 1 56  ? 32.816 55.954  64.289  1.00 31.87  ? 58  ILE A CG1 1 
ATOM   3625 C CG2 . ILE C 1 56  ? 33.614 54.669  66.305  1.00 32.84  ? 58  ILE A CG2 1 
ATOM   3626 C CD1 . ILE C 1 56  ? 32.770 57.319  64.955  1.00 33.40  ? 58  ILE A CD1 1 
ATOM   3627 N N   . THR C 1 57  ? 36.921 54.830  66.337  1.00 25.80  ? 59  THR A N   1 
ATOM   3628 C CA  . THR C 1 57  ? 37.941 53.906  66.841  1.00 23.79  ? 59  THR A CA  1 
ATOM   3629 C C   . THR C 1 57  ? 37.400 52.942  67.898  1.00 27.30  ? 59  THR A C   1 
ATOM   3630 O O   . THR C 1 57  ? 36.498 53.284  68.670  1.00 27.26  ? 59  THR A O   1 
ATOM   3631 C CB  . THR C 1 57  ? 39.145 54.671  67.437  1.00 27.27  ? 59  THR A CB  1 
ATOM   3632 O OG1 . THR C 1 57  ? 38.692 55.568  68.463  1.00 19.77  ? 59  THR A OG1 1 
ATOM   3633 C CG2 . THR C 1 57  ? 39.862 55.460  66.342  1.00 28.15  ? 59  THR A CG2 1 
ATOM   3634 N N   . TYR C 1 58  ? 37.958 51.732  67.920  1.00 23.33  ? 60  TYR A N   1 
ATOM   3635 C CA  . TYR C 1 58  ? 37.550 50.693  68.863  1.00 26.16  ? 60  TYR A CA  1 
ATOM   3636 C C   . TYR C 1 58  ? 38.785 50.046  69.479  1.00 25.07  ? 60  TYR A C   1 
ATOM   3637 O O   . TYR C 1 58  ? 39.778 49.803  68.792  1.00 22.89  ? 60  TYR A O   1 
ATOM   3638 C CB  . TYR C 1 58  ? 36.716 49.617  68.157  1.00 26.78  ? 60  TYR A CB  1 
ATOM   3639 C CG  . TYR C 1 58  ? 35.544 50.157  67.375  1.00 26.97  ? 60  TYR A CG  1 
ATOM   3640 C CD1 . TYR C 1 58  ? 35.725 50.714  66.110  1.00 35.45  ? 60  TYR A CD1 1 
ATOM   3641 C CD2 . TYR C 1 58  ? 34.254 50.114  67.897  1.00 33.52  ? 60  TYR A CD2 1 
ATOM   3642 C CE1 . TYR C 1 58  ? 34.648 51.213  65.381  1.00 37.79  ? 60  TYR A CE1 1 
ATOM   3643 C CE2 . TYR C 1 58  ? 33.169 50.613  67.178  1.00 38.54  ? 60  TYR A CE2 1 
ATOM   3644 C CZ  . TYR C 1 58  ? 33.375 51.160  65.920  1.00 39.13  ? 60  TYR A CZ  1 
ATOM   3645 O OH  . TYR C 1 58  ? 32.308 51.649  65.201  1.00 49.51  ? 60  TYR A OH  1 
ATOM   3646 N N   . TYR C 1 59  ? 38.718 49.752  70.773  1.00 24.40  ? 61  TYR A N   1 
ATOM   3647 C CA  . TYR C 1 59  ? 39.865 49.165  71.461  1.00 25.01  ? 61  TYR A CA  1 
ATOM   3648 C C   . TYR C 1 59  ? 39.439 48.217  72.561  1.00 20.13  ? 61  TYR A C   1 
ATOM   3649 O O   . TYR C 1 59  ? 38.379 48.381  73.165  1.00 23.38  ? 61  TYR A O   1 
ATOM   3650 C CB  . TYR C 1 59  ? 40.713 50.250  72.151  1.00 23.75  ? 61  TYR A CB  1 
ATOM   3651 C CG  . TYR C 1 59  ? 41.214 51.382  71.290  1.00 20.42  ? 61  TYR A CG  1 
ATOM   3652 C CD1 . TYR C 1 59  ? 42.393 51.261  70.565  1.00 16.29  ? 61  TYR A CD1 1 
ATOM   3653 C CD2 . TYR C 1 59  ? 40.510 52.585  71.214  1.00 22.51  ? 61  TYR A CD2 1 
ATOM   3654 C CE1 . TYR C 1 59  ? 42.866 52.308  69.781  1.00 20.42  ? 61  TYR A CE1 1 
ATOM   3655 C CE2 . TYR C 1 59  ? 40.977 53.645  70.425  1.00 25.71  ? 61  TYR A CE2 1 
ATOM   3656 C CZ  . TYR C 1 59  ? 42.151 53.496  69.717  1.00 18.69  ? 61  TYR A CZ  1 
ATOM   3657 O OH  . TYR C 1 59  ? 42.630 54.518  68.933  1.00 25.96  ? 61  TYR A OH  1 
ATOM   3658 N N   . PRO C 1 60  ? 40.252 47.187  72.821  1.00 21.88  ? 62  PRO A N   1 
ATOM   3659 C CA  . PRO C 1 60  ? 39.905 46.258  73.900  1.00 24.28  ? 62  PRO A CA  1 
ATOM   3660 C C   . PRO C 1 60  ? 40.477 46.948  75.152  1.00 25.64  ? 62  PRO A C   1 
ATOM   3661 O O   . PRO C 1 60  ? 41.292 47.868  75.029  1.00 19.59  ? 62  PRO A O   1 
ATOM   3662 C CB  . PRO C 1 60  ? 40.673 44.994  73.528  1.00 22.53  ? 62  PRO A CB  1 
ATOM   3663 C CG  . PRO C 1 60  ? 41.887 45.538  72.840  1.00 18.55  ? 62  PRO A CG  1 
ATOM   3664 C CD  . PRO C 1 60  ? 41.302 46.619  71.961  1.00 22.48  ? 62  PRO A CD  1 
ATOM   3665 N N   . ASP C 1 61  ? 40.057 46.518  76.337  1.00 29.70  ? 63  ASP A N   1 
ATOM   3666 C CA  . ASP C 1 61  ? 40.521 47.124  77.584  1.00 33.34  ? 63  ASP A CA  1 
ATOM   3667 C C   . ASP C 1 61  ? 42.025 47.039  77.767  1.00 30.92  ? 63  ASP A C   1 
ATOM   3668 O O   . ASP C 1 61  ? 42.638 47.924  78.363  1.00 34.20  ? 63  ASP A O   1 
ATOM   3669 C CB  . ASP C 1 61  ? 39.836 46.454  78.778  1.00 34.45  ? 63  ASP A CB  1 
ATOM   3670 C CG  . ASP C 1 61  ? 38.364 46.773  78.852  1.00 43.12  ? 63  ASP A CG  1 
ATOM   3671 O OD1 . ASP C 1 61  ? 37.645 46.084  79.608  1.00 45.64  ? 63  ASP A OD1 1 
ATOM   3672 O OD2 . ASP C 1 61  ? 37.928 47.718  78.158  1.00 40.76  ? 63  ASP A OD2 1 
ATOM   3673 N N   . SER C 1 62  ? 42.608 45.964  77.256  1.00 28.49  ? 64  SER A N   1 
ATOM   3674 C CA  . SER C 1 62  ? 44.039 45.721  77.362  1.00 28.78  ? 64  SER A CA  1 
ATOM   3675 C C   . SER C 1 62  ? 44.924 46.870  76.904  1.00 31.53  ? 64  SER A C   1 
ATOM   3676 O O   . SER C 1 62  ? 46.034 47.040  77.417  1.00 26.60  ? 64  SER A O   1 
ATOM   3677 C CB  . SER C 1 62  ? 44.404 44.477  76.559  1.00 31.87  ? 64  SER A CB  1 
ATOM   3678 O OG  . SER C 1 62  ? 44.053 44.664  75.198  1.00 33.09  ? 64  SER A OG  1 
ATOM   3679 N N   . VAL C 1 63  ? 44.452 47.651  75.933  1.00 25.13  ? 65  VAL A N   1 
ATOM   3680 C CA  . VAL C 1 63  ? 45.256 48.748  75.416  1.00 24.97  ? 65  VAL A CA  1 
ATOM   3681 C C   . VAL C 1 63  ? 44.524 50.081  75.433  1.00 24.97  ? 65  VAL A C   1 
ATOM   3682 O O   . VAL C 1 63  ? 45.115 51.114  75.132  1.00 25.96  ? 65  VAL A O   1 
ATOM   3683 C CB  . VAL C 1 63  ? 45.731 48.458  73.961  1.00 26.85  ? 65  VAL A CB  1 
ATOM   3684 C CG1 . VAL C 1 63  ? 46.435 47.107  73.901  1.00 23.91  ? 65  VAL A CG1 1 
ATOM   3685 C CG2 . VAL C 1 63  ? 44.546 48.491  72.997  1.00 21.94  ? 65  VAL A CG2 1 
ATOM   3686 N N   . ALA C 1 64  ? 43.241 50.058  75.781  1.00 30.42  ? 66  ALA A N   1 
ATOM   3687 C CA  . ALA C 1 64  ? 42.445 51.282  75.820  1.00 32.52  ? 66  ALA A CA  1 
ATOM   3688 C C   . ALA C 1 64  ? 43.165 52.353  76.632  1.00 35.62  ? 66  ALA A C   1 
ATOM   3689 O O   . ALA C 1 64  ? 43.603 52.099  77.754  1.00 30.01  ? 66  ALA A O   1 
ATOM   3690 C CB  . ALA C 1 64  ? 41.073 51.007  76.423  1.00 26.63  ? 66  ALA A CB  1 
ATOM   3691 N N   . GLY C 1 65  ? 43.301 53.540  76.048  1.00 33.54  ? 67  GLY A N   1 
ATOM   3692 C CA  . GLY C 1 65  ? 43.964 54.635  76.740  1.00 32.17  ? 67  GLY A CA  1 
ATOM   3693 C C   . GLY C 1 65  ? 45.453 54.752  76.480  1.00 27.44  ? 67  GLY A C   1 
ATOM   3694 O O   . GLY C 1 65  ? 46.035 55.814  76.676  1.00 32.13  ? 67  GLY A O   1 
ATOM   3695 N N   . ARG C 1 66  ? 46.082 53.670  76.040  1.00 21.85  ? 68  ARG A N   1 
ATOM   3696 C CA  . ARG C 1 66  ? 47.510 53.696  75.782  1.00 25.83  ? 68  ARG A CA  1 
ATOM   3697 C C   . ARG C 1 66  ? 47.832 53.660  74.296  1.00 24.06  ? 68  ARG A C   1 
ATOM   3698 O O   . ARG C 1 66  ? 48.835 54.227  73.867  1.00 23.50  ? 68  ARG A O   1 
ATOM   3699 C CB  . ARG C 1 66  ? 48.202 52.513  76.471  1.00 24.46  ? 68  ARG A CB  1 
ATOM   3700 C CG  . ARG C 1 66  ? 48.099 52.526  77.989  1.00 28.77  ? 68  ARG A CG  1 
ATOM   3701 C CD  . ARG C 1 66  ? 48.882 51.357  78.590  1.00 28.32  ? 68  ARG A CD  1 
ATOM   3702 N NE  . ARG C 1 66  ? 48.369 50.070  78.126  1.00 28.67  ? 68  ARG A NE  1 
ATOM   3703 C CZ  . ARG C 1 66  ? 49.093 49.156  77.492  1.00 22.64  ? 68  ARG A CZ  1 
ATOM   3704 N NH1 . ARG C 1 66  ? 50.373 49.379  77.241  1.00 25.03  ? 68  ARG A NH1 1 
ATOM   3705 N NH2 . ARG C 1 66  ? 48.533 48.015  77.105  1.00 30.94  ? 68  ARG A NH2 1 
ATOM   3706 N N   . PHE C 1 67  ? 46.985 52.978  73.527  1.00 24.02  ? 69  PHE A N   1 
ATOM   3707 C CA  . PHE C 1 67  ? 47.182 52.835  72.079  1.00 21.15  ? 69  PHE A CA  1 
ATOM   3708 C C   . PHE C 1 67  ? 46.193 53.689  71.296  1.00 18.87  ? 69  PHE A C   1 
ATOM   3709 O O   . PHE C 1 67  ? 45.045 53.857  71.702  1.00 19.77  ? 69  PHE A O   1 
ATOM   3710 C CB  . PHE C 1 67  ? 46.995 51.370  71.644  1.00 23.70  ? 69  PHE A CB  1 
ATOM   3711 C CG  . PHE C 1 67  ? 48.093 50.442  72.084  1.00 25.70  ? 69  PHE A CG  1 
ATOM   3712 C CD1 . PHE C 1 67  ? 48.171 49.156  71.560  1.00 26.77  ? 69  PHE A CD1 1 
ATOM   3713 C CD2 . PHE C 1 67  ? 49.049 50.845  73.012  1.00 31.90  ? 69  PHE A CD2 1 
ATOM   3714 C CE1 . PHE C 1 67  ? 49.184 48.282  71.950  1.00 30.46  ? 69  PHE A CE1 1 
ATOM   3715 C CE2 . PHE C 1 67  ? 50.071 49.974  73.412  1.00 31.84  ? 69  PHE A CE2 1 
ATOM   3716 C CZ  . PHE C 1 67  ? 50.141 48.698  72.884  1.00 28.04  ? 69  PHE A CZ  1 
ATOM   3717 N N   . THR C 1 68  ? 46.646 54.209  70.159  1.00 21.14  ? 70  THR A N   1 
ATOM   3718 C CA  . THR C 1 68  ? 45.788 55.027  69.309  1.00 28.07  ? 70  THR A CA  1 
ATOM   3719 C C   . THR C 1 68  ? 45.937 54.603  67.859  1.00 24.04  ? 70  THR A C   1 
ATOM   3720 O O   . THR C 1 68  ? 47.037 54.633  67.313  1.00 22.70  ? 70  THR A O   1 
ATOM   3721 C CB  . THR C 1 68  ? 46.149 56.526  69.387  1.00 27.95  ? 70  THR A CB  1 
ATOM   3722 O OG1 . THR C 1 68  ? 46.057 56.979  70.745  1.00 29.04  ? 70  THR A OG1 1 
ATOM   3723 C CG2 . THR C 1 68  ? 45.183 57.338  68.518  1.00 29.77  ? 70  THR A CG2 1 
ATOM   3724 N N   . ILE C 1 69  ? 44.829 54.200  67.246  1.00 22.52  ? 71  ILE A N   1 
ATOM   3725 C CA  . ILE C 1 69  ? 44.863 53.798  65.847  1.00 25.53  ? 71  ILE A CA  1 
ATOM   3726 C C   . ILE C 1 69  ? 44.391 54.994  65.033  1.00 23.16  ? 71  ILE A C   1 
ATOM   3727 O O   . ILE C 1 69  ? 43.419 55.660  65.394  1.00 19.00  ? 71  ILE A O   1 
ATOM   3728 C CB  . ILE C 1 69  ? 43.946 52.571  65.581  1.00 21.19  ? 71  ILE A CB  1 
ATOM   3729 C CG1 . ILE C 1 69  ? 44.058 52.134  64.115  1.00 26.87  ? 71  ILE A CG1 1 
ATOM   3730 C CG2 . ILE C 1 69  ? 42.522 52.899  65.937  1.00 17.11  ? 71  ILE A CG2 1 
ATOM   3731 C CD1 . ILE C 1 69  ? 43.332 50.828  63.807  1.00 16.70  ? 71  ILE A CD1 1 
ATOM   3732 N N   . SER C 1 70  ? 45.100 55.281  63.950  1.00 21.70  ? 72  SER A N   1 
ATOM   3733 C CA  . SER C 1 70  ? 44.745 56.408  63.106  1.00 22.98  ? 72  SER A CA  1 
ATOM   3734 C C   . SER C 1 70  ? 45.031 56.075  61.647  1.00 26.28  ? 72  SER A C   1 
ATOM   3735 O O   . SER C 1 70  ? 45.761 55.132  61.344  1.00 22.59  ? 72  SER A O   1 
ATOM   3736 C CB  . SER C 1 70  ? 45.530 57.653  63.519  1.00 16.54  ? 72  SER A CB  1 
ATOM   3737 O OG  . SER C 1 70  ? 46.917 57.451  63.369  1.00 23.05  ? 72  SER A OG  1 
ATOM   3738 N N   . ARG C 1 71  ? 44.458 56.863  60.744  1.00 24.51  ? 73  ARG A N   1 
ATOM   3739 C CA  . ARG C 1 71  ? 44.639 56.622  59.323  1.00 23.37  ? 73  ARG A CA  1 
ATOM   3740 C C   . ARG C 1 71  ? 44.841 57.921  58.550  1.00 27.49  ? 73  ARG A C   1 
ATOM   3741 O O   . ARG C 1 71  ? 44.173 58.920  58.811  1.00 26.44  ? 73  ARG A O   1 
ATOM   3742 C CB  . ARG C 1 71  ? 43.409 55.875  58.791  1.00 22.54  ? 73  ARG A CB  1 
ATOM   3743 C CG  . ARG C 1 71  ? 43.320 55.742  57.269  1.00 24.45  ? 73  ARG A CG  1 
ATOM   3744 C CD  . ARG C 1 71  ? 42.093 54.917  56.884  1.00 20.89  ? 73  ARG A CD  1 
ATOM   3745 N NE  . ARG C 1 71  ? 40.880 55.489  57.449  1.00 21.92  ? 73  ARG A NE  1 
ATOM   3746 C CZ  . ARG C 1 71  ? 39.831 54.777  57.850  1.00 23.14  ? 73  ARG A CZ  1 
ATOM   3747 N NH1 . ARG C 1 71  ? 39.829 53.447  57.748  1.00 23.19  ? 73  ARG A NH1 1 
ATOM   3748 N NH2 . ARG C 1 71  ? 38.797 55.396  58.390  1.00 24.43  ? 73  ARG A NH2 1 
ATOM   3749 N N   . ASP C 1 72  ? 45.790 57.910  57.622  1.00 24.87  ? 74  ASP A N   1 
ATOM   3750 C CA  . ASP C 1 72  ? 46.023 59.068  56.775  1.00 26.14  ? 74  ASP A CA  1 
ATOM   3751 C C   . ASP C 1 72  ? 45.368 58.658  55.456  1.00 26.66  ? 74  ASP A C   1 
ATOM   3752 O O   . ASP C 1 72  ? 45.946 57.901  54.675  1.00 24.30  ? 74  ASP A O   1 
ATOM   3753 C CB  . ASP C 1 72  ? 47.516 59.319  56.575  1.00 23.54  ? 74  ASP A CB  1 
ATOM   3754 C CG  . ASP C 1 72  ? 47.791 60.494  55.642  1.00 34.28  ? 74  ASP A CG  1 
ATOM   3755 O OD1 . ASP C 1 72  ? 48.944 60.979  55.608  1.00 29.33  ? 74  ASP A OD1 1 
ATOM   3756 O OD2 . ASP C 1 72  ? 46.851 60.930  54.936  1.00 27.99  ? 74  ASP A OD2 1 
ATOM   3757 N N   . ASN C 1 73  ? 44.154 59.149  55.232  1.00 29.21  ? 75  ASN A N   1 
ATOM   3758 C CA  . ASN C 1 73  ? 43.392 58.811  54.036  1.00 32.54  ? 75  ASN A CA  1 
ATOM   3759 C C   . ASN C 1 73  ? 44.012 59.217  52.716  1.00 33.60  ? 75  ASN A C   1 
ATOM   3760 O O   . ASN C 1 73  ? 43.819 58.542  51.709  1.00 37.71  ? 75  ASN A O   1 
ATOM   3761 C CB  . ASN C 1 73  ? 41.982 59.389  54.129  1.00 34.50  ? 75  ASN A CB  1 
ATOM   3762 C CG  . ASN C 1 73  ? 41.138 58.682  55.163  1.00 38.29  ? 75  ASN A CG  1 
ATOM   3763 O OD1 . ASN C 1 73  ? 41.371 57.513  55.467  1.00 38.95  ? 75  ASN A OD1 1 
ATOM   3764 N ND2 . ASN C 1 73  ? 40.140 59.377  55.695  1.00 40.63  ? 75  ASN A ND2 1 
ATOM   3765 N N   . VAL C 1 74  ? 44.756 60.315  52.719  1.00 30.13  ? 76  VAL A N   1 
ATOM   3766 C CA  . VAL C 1 74  ? 45.393 60.810  51.512  1.00 33.48  ? 76  VAL A CA  1 
ATOM   3767 C C   . VAL C 1 74  ? 46.567 59.945  51.082  1.00 34.38  ? 76  VAL A C   1 
ATOM   3768 O O   . VAL C 1 74  ? 46.603 59.456  49.954  1.00 35.91  ? 76  VAL A O   1 
ATOM   3769 C CB  . VAL C 1 74  ? 45.892 62.262  51.708  1.00 36.41  ? 76  VAL A CB  1 
ATOM   3770 C CG1 . VAL C 1 74  ? 46.571 62.755  50.437  1.00 34.28  ? 76  VAL A CG1 1 
ATOM   3771 C CG2 . VAL C 1 74  ? 44.724 63.161  52.076  1.00 35.15  ? 76  VAL A CG2 1 
ATOM   3772 N N   . ARG C 1 75  ? 47.528 59.758  51.981  1.00 32.08  ? 77  ARG A N   1 
ATOM   3773 C CA  . ARG C 1 75  ? 48.700 58.954  51.672  1.00 31.71  ? 77  ARG A CA  1 
ATOM   3774 C C   . ARG C 1 75  ? 48.455 57.449  51.788  1.00 26.86  ? 77  ARG A C   1 
ATOM   3775 O O   . ARG C 1 75  ? 49.319 56.654  51.429  1.00 27.14  ? 77  ARG A O   1 
ATOM   3776 C CB  . ARG C 1 75  ? 49.872 59.368  52.573  1.00 39.55  ? 77  ARG A CB  1 
ATOM   3777 C CG  . ARG C 1 75  ? 50.603 60.619  52.097  1.00 45.22  ? 77  ARG A CG  1 
ATOM   3778 C CD  . ARG C 1 75  ? 51.837 60.914  52.942  1.00 52.19  ? 77  ARG A CD  1 
ATOM   3779 N NE  . ARG C 1 75  ? 51.512 61.657  54.155  1.00 57.75  ? 77  ARG A NE  1 
ATOM   3780 C CZ  . ARG C 1 75  ? 51.106 62.923  54.165  1.00 58.51  ? 77  ARG A CZ  1 
ATOM   3781 N NH1 . ARG C 1 75  ? 50.980 63.587  53.025  1.00 64.33  ? 77  ARG A NH1 1 
ATOM   3782 N NH2 . ARG C 1 75  ? 50.818 63.524  55.309  1.00 54.23  ? 77  ARG A NH2 1 
ATOM   3783 N N   . ASN C 1 76  ? 47.285 57.072  52.293  1.00 22.02  ? 78  ASN A N   1 
ATOM   3784 C CA  . ASN C 1 76  ? 46.906 55.664  52.461  1.00 21.20  ? 78  ASN A CA  1 
ATOM   3785 C C   . ASN C 1 76  ? 47.874 54.954  53.394  1.00 19.64  ? 78  ASN A C   1 
ATOM   3786 O O   . ASN C 1 76  ? 48.586 54.032  52.991  1.00 21.98  ? 78  ASN A O   1 
ATOM   3787 C CB  . ASN C 1 76  ? 46.870 54.933  51.110  1.00 20.54  ? 78  ASN A CB  1 
ATOM   3788 C CG  . ASN C 1 76  ? 45.978 53.699  51.143  1.00 23.52  ? 78  ASN A CG  1 
ATOM   3789 O OD1 . ASN C 1 76  ? 44.850 53.758  51.634  1.00 21.64  ? 78  ASN A OD1 1 
ATOM   3790 N ND2 . ASN C 1 76  ? 46.472 52.584  50.619  1.00 22.67  ? 78  ASN A ND2 1 
ATOM   3791 N N   . ILE C 1 77  ? 47.891 55.394  54.648  1.00 22.39  ? 79  ILE A N   1 
ATOM   3792 C CA  . ILE C 1 77  ? 48.778 54.826  55.658  1.00 24.68  ? 79  ILE A CA  1 
ATOM   3793 C C   . ILE C 1 77  ? 47.986 54.588  56.937  1.00 23.15  ? 79  ILE A C   1 
ATOM   3794 O O   . ILE C 1 77  ? 47.182 55.429  57.341  1.00 22.01  ? 79  ILE A O   1 
ATOM   3795 C CB  . ILE C 1 77  ? 49.949 55.783  55.979  1.00 28.03  ? 79  ILE A CB  1 
ATOM   3796 C CG1 . ILE C 1 77  ? 50.704 56.140  54.699  1.00 25.27  ? 79  ILE A CG1 1 
ATOM   3797 C CG2 . ILE C 1 77  ? 50.913 55.127  56.960  1.00 27.39  ? 79  ILE A CG2 1 
ATOM   3798 C CD1 . ILE C 1 77  ? 51.770 57.216  54.905  1.00 32.97  ? 79  ILE A CD1 1 
ATOM   3799 N N   . LEU C 1 78  ? 48.201 53.429  57.552  1.00 18.81  ? 80  LEU A N   1 
ATOM   3800 C CA  . LEU C 1 78  ? 47.516 53.074  58.789  1.00 20.17  ? 80  LEU A CA  1 
ATOM   3801 C C   . LEU C 1 78  ? 48.559 53.164  59.902  1.00 19.37  ? 80  LEU A C   1 
ATOM   3802 O O   . LEU C 1 78  ? 49.690 52.718  59.719  1.00 17.95  ? 80  LEU A O   1 
ATOM   3803 C CB  . LEU C 1 78  ? 46.989 51.638  58.710  1.00 18.10  ? 80  LEU A CB  1 
ATOM   3804 C CG  . LEU C 1 78  ? 45.679 51.280  59.416  1.00 23.87  ? 80  LEU A CG  1 
ATOM   3805 C CD1 . LEU C 1 78  ? 45.828 49.893  59.997  1.00 29.50  ? 80  LEU A CD1 1 
ATOM   3806 C CD2 . LEU C 1 78  ? 45.328 52.273  60.502  1.00 29.23  ? 80  LEU A CD2 1 
ATOM   3807 N N   . TYR C 1 79  ? 48.181 53.736  61.041  1.00 22.25  ? 81  TYR A N   1 
ATOM   3808 C CA  . TYR C 1 79  ? 49.120 53.870  62.156  1.00 21.97  ? 81  TYR A CA  1 
ATOM   3809 C C   . TYR C 1 79  ? 48.602 53.269  63.446  1.00 18.37  ? 81  TYR A C   1 
ATOM   3810 O O   . TYR C 1 79  ? 47.400 53.115  63.636  1.00 19.96  ? 81  TYR A O   1 
ATOM   3811 C CB  . TYR C 1 79  ? 49.428 55.341  62.448  1.00 21.52  ? 81  TYR A CB  1 
ATOM   3812 C CG  . TYR C 1 79  ? 50.047 56.114  61.313  1.00 25.43  ? 81  TYR A CG  1 
ATOM   3813 C CD1 . TYR C 1 79  ? 49.299 57.046  60.595  1.00 27.13  ? 81  TYR A CD1 1 
ATOM   3814 C CD2 . TYR C 1 79  ? 51.389 55.944  60.977  1.00 21.27  ? 81  TYR A CD2 1 
ATOM   3815 C CE1 . TYR C 1 79  ? 49.877 57.792  59.574  1.00 25.95  ? 81  TYR A CE1 1 
ATOM   3816 C CE2 . TYR C 1 79  ? 51.975 56.686  59.959  1.00 23.16  ? 81  TYR A CE2 1 
ATOM   3817 C CZ  . TYR C 1 79  ? 51.211 57.608  59.263  1.00 27.30  ? 81  TYR A CZ  1 
ATOM   3818 O OH  . TYR C 1 79  ? 51.781 58.340  58.245  1.00 34.61  ? 81  TYR A OH  1 
ATOM   3819 N N   . LEU C 1 80  ? 49.539 52.947  64.331  1.00 22.87  ? 82  LEU A N   1 
ATOM   3820 C CA  . LEU C 1 80  ? 49.224 52.425  65.649  1.00 21.41  ? 82  LEU A CA  1 
ATOM   3821 C C   . LEU C 1 80  ? 50.247 53.100  66.573  1.00 21.86  ? 82  LEU A C   1 
ATOM   3822 O O   . LEU C 1 80  ? 51.415 52.708  66.628  1.00 20.13  ? 82  LEU A O   1 
ATOM   3823 C CB  . LEU C 1 80  ? 49.388 50.902  65.693  1.00 19.32  ? 82  LEU A CB  1 
ATOM   3824 C CG  . LEU C 1 80  ? 48.574 50.084  66.716  1.00 26.63  ? 82  LEU A CG  1 
ATOM   3825 C CD1 . LEU C 1 80  ? 49.508 49.311  67.620  1.00 25.06  ? 82  LEU A CD1 1 
ATOM   3826 C CD2 . LEU C 1 80  ? 47.655 50.977  67.528  1.00 24.09  ? 82  LEU A CD2 1 
ATOM   3827 N N   . GLN C 1 81  ? 49.813 54.144  67.265  1.00 19.72  ? 83  GLN A N   1 
ATOM   3828 C CA  . GLN C 1 81  ? 50.701 54.849  68.182  1.00 22.67  ? 83  GLN A CA  1 
ATOM   3829 C C   . GLN C 1 81  ? 50.587 54.137  69.527  1.00 21.10  ? 83  GLN A C   1 
ATOM   3830 O O   . GLN C 1 81  ? 49.504 54.040  70.092  1.00 21.95  ? 83  GLN A O   1 
ATOM   3831 C CB  . GLN C 1 81  ? 50.265 56.308  68.316  1.00 25.01  ? 83  GLN A CB  1 
ATOM   3832 C CG  . GLN C 1 81  ? 51.048 57.121  69.353  1.00 28.50  ? 83  GLN A CG  1 
ATOM   3833 C CD  . GLN C 1 81  ? 52.535 57.130  69.095  1.00 30.89  ? 83  GLN A CD  1 
ATOM   3834 O OE1 . GLN C 1 81  ? 53.305 56.495  69.817  1.00 36.05  ? 83  GLN A OE1 1 
ATOM   3835 N NE2 . GLN C 1 81  ? 52.951 57.842  68.052  1.00 29.64  ? 83  GLN A NE2 1 
ATOM   3836 N N   . MET C 1 82  ? 51.696 53.614  70.031  1.00 24.76  ? 84  MET A N   1 
ATOM   3837 C CA  . MET C 1 82  ? 51.653 52.919  71.311  1.00 24.77  ? 84  MET A CA  1 
ATOM   3838 C C   . MET C 1 82  ? 52.338 53.769  72.387  1.00 27.59  ? 84  MET A C   1 
ATOM   3839 O O   . MET C 1 82  ? 53.303 54.475  72.106  1.00 29.90  ? 84  MET A O   1 
ATOM   3840 C CB  . MET C 1 82  ? 52.346 51.555  71.192  1.00 27.70  ? 84  MET A CB  1 
ATOM   3841 C CG  . MET C 1 82  ? 51.771 50.662  70.092  1.00 28.40  ? 84  MET A CG  1 
ATOM   3842 S SD  . MET C 1 82  ? 52.580 49.054  69.982  1.00 39.30  ? 84  MET A SD  1 
ATOM   3843 C CE  . MET C 1 82  ? 53.946 49.453  69.034  1.00 22.71  ? 84  MET A CE  1 
ATOM   3844 N N   . SER C 1 83  ? 51.827 53.704  73.610  1.00 29.52  ? 85  SER A N   1 
ATOM   3845 C CA  . SER C 1 83  ? 52.396 54.466  74.720  1.00 32.40  ? 85  SER A CA  1 
ATOM   3846 C C   . SER C 1 83  ? 52.342 53.656  76.003  1.00 25.18  ? 85  SER A C   1 
ATOM   3847 O O   . SER C 1 83  ? 51.601 52.679  76.099  1.00 24.02  ? 85  SER A O   1 
ATOM   3848 C CB  . SER C 1 83  ? 51.629 55.773  74.913  1.00 33.77  ? 85  SER A CB  1 
ATOM   3849 O OG  . SER C 1 83  ? 51.766 56.601  73.772  1.00 44.85  ? 85  SER A OG  1 
ATOM   3850 N N   . SER C 1 84  ? 53.122 54.076  76.994  1.00 27.78  ? 86  SER A N   1 
ATOM   3851 C CA  . SER C 1 84  ? 53.165 53.383  78.277  1.00 24.79  ? 86  SER A CA  1 
ATOM   3852 C C   . SER C 1 84  ? 53.249 51.888  78.019  1.00 19.14  ? 86  SER A C   1 
ATOM   3853 O O   . SER C 1 84  ? 52.493 51.102  78.595  1.00 22.38  ? 86  SER A O   1 
ATOM   3854 C CB  . SER C 1 84  ? 51.913 53.698  79.100  1.00 27.44  ? 86  SER A CB  1 
ATOM   3855 O OG  . SER C 1 84  ? 51.780 55.093  79.310  1.00 33.37  ? 86  SER A OG  1 
ATOM   3856 N N   . LEU C 1 85  ? 54.168 51.508  77.139  1.00 20.69  ? 87  LEU A N   1 
ATOM   3857 C CA  . LEU C 1 85  ? 54.358 50.112  76.787  1.00 21.68  ? 87  LEU A CA  1 
ATOM   3858 C C   . LEU C 1 85  ? 54.694 49.233  77.984  1.00 31.20  ? 87  LEU A C   1 
ATOM   3859 O O   . LEU C 1 85  ? 55.446 49.630  78.873  1.00 28.11  ? 87  LEU A O   1 
ATOM   3860 C CB  . LEU C 1 85  ? 55.445 49.988  75.729  1.00 22.67  ? 87  LEU A CB  1 
ATOM   3861 C CG  . LEU C 1 85  ? 54.954 50.272  74.303  1.00 29.73  ? 87  LEU A CG  1 
ATOM   3862 C CD1 . LEU C 1 85  ? 56.115 50.258  73.326  1.00 25.65  ? 87  LEU A CD1 1 
ATOM   3863 C CD2 . LEU C 1 85  ? 53.921 49.217  73.929  1.00 23.38  ? 87  LEU A CD2 1 
ATOM   3864 N N   . ARG C 1 86  ? 54.130 48.031  77.979  1.00 30.87  ? 88  ARG A N   1 
ATOM   3865 C CA  . ARG C 1 86  ? 54.319 47.050  79.032  1.00 33.83  ? 88  ARG A CA  1 
ATOM   3866 C C   . ARG C 1 86  ? 54.912 45.780  78.444  1.00 34.65  ? 88  ARG A C   1 
ATOM   3867 O O   . ARG C 1 86  ? 54.775 45.522  77.247  1.00 32.92  ? 88  ARG A O   1 
ATOM   3868 C CB  . ARG C 1 86  ? 52.973 46.735  79.692  1.00 37.72  ? 88  ARG A CB  1 
ATOM   3869 C CG  . ARG C 1 86  ? 52.616 47.667  80.833  1.00 42.31  ? 88  ARG A CG  1 
ATOM   3870 C CD  . ARG C 1 86  ? 51.361 48.492  80.579  1.00 41.53  ? 88  ARG A CD  1 
ATOM   3871 N NE  . ARG C 1 86  ? 50.147 47.688  80.472  1.00 37.20  ? 88  ARG A NE  1 
ATOM   3872 C CZ  . ARG C 1 86  ? 48.934 48.128  80.794  1.00 31.65  ? 88  ARG A CZ  1 
ATOM   3873 N NH1 . ARG C 1 86  ? 48.770 49.360  81.254  1.00 32.81  ? 88  ARG A NH1 1 
ATOM   3874 N NH2 . ARG C 1 86  ? 47.880 47.343  80.641  1.00 36.29  ? 88  ARG A NH2 1 
ATOM   3875 N N   . SER C 1 87  ? 55.575 44.991  79.284  1.00 27.60  ? 89  SER A N   1 
ATOM   3876 C CA  . SER C 1 87  ? 56.183 43.745  78.827  1.00 31.86  ? 89  SER A CA  1 
ATOM   3877 C C   . SER C 1 87  ? 55.136 42.865  78.142  1.00 29.23  ? 89  SER A C   1 
ATOM   3878 O O   . SER C 1 87  ? 55.445 42.127  77.205  1.00 30.20  ? 89  SER A O   1 
ATOM   3879 C CB  . SER C 1 87  ? 56.775 42.984  80.014  1.00 29.28  ? 89  SER A CB  1 
ATOM   3880 O OG  . SER C 1 87  ? 55.761 42.726  80.973  1.00 34.34  ? 89  SER A OG  1 
ATOM   3881 N N   . GLU C 1 88  ? 53.901 42.948  78.625  1.00 27.99  ? 90  GLU A N   1 
ATOM   3882 C CA  . GLU C 1 88  ? 52.798 42.165  78.074  1.00 35.44  ? 90  GLU A CA  1 
ATOM   3883 C C   . GLU C 1 88  ? 52.431 42.565  76.636  1.00 33.57  ? 90  GLU A C   1 
ATOM   3884 O O   . GLU C 1 88  ? 51.666 41.861  75.979  1.00 28.87  ? 90  GLU A O   1 
ATOM   3885 C CB  . GLU C 1 88  ? 51.561 42.290  78.975  1.00 42.37  ? 90  GLU A CB  1 
ATOM   3886 C CG  . GLU C 1 88  ? 51.022 43.716  79.104  1.00 57.02  ? 90  GLU A CG  1 
ATOM   3887 C CD  . GLU C 1 88  ? 49.869 43.838  80.093  1.00 62.94  ? 90  GLU A CD  1 
ATOM   3888 O OE1 . GLU C 1 88  ? 50.052 43.457  81.268  1.00 64.68  ? 90  GLU A OE1 1 
ATOM   3889 O OE2 . GLU C 1 88  ? 48.782 44.322  79.696  1.00 64.31  ? 90  GLU A OE2 1 
ATOM   3890 N N   . ASP C 1 89  ? 52.973 43.682  76.152  1.00 31.82  ? 91  ASP A N   1 
ATOM   3891 C CA  . ASP C 1 89  ? 52.688 44.150  74.790  1.00 33.47  ? 91  ASP A CA  1 
ATOM   3892 C C   . ASP C 1 89  ? 53.628 43.552  73.756  1.00 33.12  ? 91  ASP A C   1 
ATOM   3893 O O   . ASP C 1 89  ? 53.435 43.738  72.552  1.00 30.31  ? 91  ASP A O   1 
ATOM   3894 C CB  . ASP C 1 89  ? 52.788 45.671  74.700  1.00 29.12  ? 91  ASP A CB  1 
ATOM   3895 C CG  . ASP C 1 89  ? 51.742 46.377  75.534  1.00 33.97  ? 91  ASP A CG  1 
ATOM   3896 O OD1 . ASP C 1 89  ? 50.553 45.999  75.458  1.00 26.16  ? 91  ASP A OD1 1 
ATOM   3897 O OD2 . ASP C 1 89  ? 52.115 47.318  76.262  1.00 29.18  ? 91  ASP A OD2 1 
ATOM   3898 N N   . THR C 1 90  ? 54.660 42.859  74.227  1.00 27.60  ? 92  THR A N   1 
ATOM   3899 C CA  . THR C 1 90  ? 55.623 42.235  73.335  1.00 25.91  ? 92  THR A CA  1 
ATOM   3900 C C   . THR C 1 90  ? 54.865 41.250  72.452  1.00 23.74  ? 92  THR A C   1 
ATOM   3901 O O   . THR C 1 90  ? 54.126 40.407  72.950  1.00 23.84  ? 92  THR A O   1 
ATOM   3902 C CB  . THR C 1 90  ? 56.719 41.496  74.138  1.00 32.93  ? 92  THR A CB  1 
ATOM   3903 O OG1 . THR C 1 90  ? 57.500 42.454  74.870  1.00 30.58  ? 92  THR A OG1 1 
ATOM   3904 C CG2 . THR C 1 90  ? 57.624 40.700  73.203  1.00 27.85  ? 92  THR A CG2 1 
ATOM   3905 N N   . ALA C 1 91  ? 55.047 41.373  71.141  1.00 26.70  ? 93  ALA A N   1 
ATOM   3906 C CA  . ALA C 1 91  ? 54.358 40.510  70.185  1.00 25.40  ? 93  ALA A CA  1 
ATOM   3907 C C   . ALA C 1 91  ? 54.654 40.940  68.754  1.00 26.33  ? 93  ALA A C   1 
ATOM   3908 O O   . ALA C 1 91  ? 55.341 41.940  68.509  1.00 21.69  ? 93  ALA A O   1 
ATOM   3909 C CB  . ALA C 1 91  ? 52.850 40.573  70.423  1.00 22.59  ? 93  ALA A CB  1 
ATOM   3910 N N   . LEU C 1 92  ? 54.122 40.168  67.812  1.00 23.70  ? 94  LEU A N   1 
ATOM   3911 C CA  . LEU C 1 92  ? 54.265 40.465  66.397  1.00 21.53  ? 94  LEU A CA  1 
ATOM   3912 C C   . LEU C 1 92  ? 52.937 41.152  66.035  1.00 19.89  ? 94  LEU A C   1 
ATOM   3913 O O   . LEU C 1 92  ? 51.874 40.560  66.181  1.00 22.95  ? 94  LEU A O   1 
ATOM   3914 C CB  . LEU C 1 92  ? 54.445 39.162  65.611  1.00 26.17  ? 94  LEU A CB  1 
ATOM   3915 C CG  . LEU C 1 92  ? 54.755 39.263  64.115  1.00 26.86  ? 94  LEU A CG  1 
ATOM   3916 C CD1 . LEU C 1 92  ? 56.110 39.909  63.907  1.00 24.30  ? 94  LEU A CD1 1 
ATOM   3917 C CD2 . LEU C 1 92  ? 54.732 37.866  63.507  1.00 29.12  ? 94  LEU A CD2 1 
ATOM   3918 N N   . TYR C 1 93  ? 53.007 42.404  65.589  1.00 19.28  ? 95  TYR A N   1 
ATOM   3919 C CA  . TYR C 1 93  ? 51.808 43.173  65.261  1.00 21.79  ? 95  TYR A CA  1 
ATOM   3920 C C   . TYR C 1 93  ? 51.468 43.140  63.781  1.00 19.99  ? 95  TYR A C   1 
ATOM   3921 O O   . TYR C 1 93  ? 52.326 43.356  62.938  1.00 20.06  ? 95  TYR A O   1 
ATOM   3922 C CB  . TYR C 1 93  ? 51.972 44.631  65.707  1.00 19.41  ? 95  TYR A CB  1 
ATOM   3923 C CG  . TYR C 1 93  ? 51.904 44.801  67.211  1.00 22.09  ? 95  TYR A CG  1 
ATOM   3924 C CD1 . TYR C 1 93  ? 52.938 44.347  68.035  1.00 21.62  ? 95  TYR A CD1 1 
ATOM   3925 C CD2 . TYR C 1 93  ? 50.783 45.369  67.810  1.00 19.03  ? 95  TYR A CD2 1 
ATOM   3926 C CE1 . TYR C 1 93  ? 52.849 44.459  69.437  1.00 19.59  ? 95  TYR A CE1 1 
ATOM   3927 C CE2 . TYR C 1 93  ? 50.678 45.481  69.195  1.00 24.70  ? 95  TYR A CE2 1 
ATOM   3928 C CZ  . TYR C 1 93  ? 51.716 45.023  70.004  1.00 23.71  ? 95  TYR A CZ  1 
ATOM   3929 O OH  . TYR C 1 93  ? 51.589 45.110  71.371  1.00 20.88  ? 95  TYR A OH  1 
ATOM   3930 N N   . TYR C 1 94  ? 50.204 42.862  63.492  1.00 21.26  ? 96  TYR A N   1 
ATOM   3931 C CA  . TYR C 1 94  ? 49.720 42.792  62.124  1.00 24.16  ? 96  TYR A CA  1 
ATOM   3932 C C   . TYR C 1 94  ? 48.703 43.878  61.820  1.00 19.08  ? 96  TYR A C   1 
ATOM   3933 O O   . TYR C 1 94  ? 47.882 44.249  62.655  1.00 19.19  ? 96  TYR A O   1 
ATOM   3934 C CB  . TYR C 1 94  ? 49.037 41.449  61.855  1.00 25.67  ? 96  TYR A CB  1 
ATOM   3935 C CG  . TYR C 1 94  ? 49.942 40.242  61.863  1.00 22.61  ? 96  TYR A CG  1 
ATOM   3936 C CD1 . TYR C 1 94  ? 50.575 39.815  60.695  1.00 23.94  ? 96  TYR A CD1 1 
ATOM   3937 C CD2 . TYR C 1 94  ? 50.113 39.488  63.023  1.00 22.99  ? 96  TYR A CD2 1 
ATOM   3938 C CE1 . TYR C 1 94  ? 51.345 38.665  60.675  1.00 21.29  ? 96  TYR A CE1 1 
ATOM   3939 C CE2 . TYR C 1 94  ? 50.885 38.327  63.017  1.00 22.50  ? 96  TYR A CE2 1 
ATOM   3940 C CZ  . TYR C 1 94  ? 51.492 37.923  61.834  1.00 25.58  ? 96  TYR A CZ  1 
ATOM   3941 O OH  . TYR C 1 94  ? 52.210 36.757  61.792  1.00 29.78  ? 96  TYR A OH  1 
ATOM   3942 N N   . CYS C 1 95  ? 48.761 44.346  60.583  1.00 25.59  ? 97  CYS A N   1 
ATOM   3943 C CA  . CYS C 1 95  ? 47.844 45.344  60.056  1.00 22.58  ? 97  CYS A CA  1 
ATOM   3944 C C   . CYS C 1 95  ? 46.859 44.488  59.248  1.00 18.87  ? 97  CYS A C   1 
ATOM   3945 O O   . CYS C 1 95  ? 47.293 43.590  58.538  1.00 22.92  ? 97  CYS A O   1 
ATOM   3946 C CB  . CYS C 1 95  ? 48.627 46.239  59.128  1.00 30.08  ? 97  CYS A CB  1 
ATOM   3947 S SG  . CYS C 1 95  ? 47.670 47.406  58.136  1.00 42.26  ? 97  CYS A SG  1 
ATOM   3948 N N   . ALA C 1 96  ? 45.561 44.760  59.334  1.00 19.88  ? 98  ALA A N   1 
ATOM   3949 C CA  . ALA C 1 96  ? 44.601 43.933  58.611  1.00 21.37  ? 98  ALA A CA  1 
ATOM   3950 C C   . ALA C 1 96  ? 43.341 44.601  58.069  1.00 20.24  ? 98  ALA A C   1 
ATOM   3951 O O   . ALA C 1 96  ? 42.751 45.471  58.710  1.00 18.45  ? 98  ALA A O   1 
ATOM   3952 C CB  . ALA C 1 96  ? 44.189 42.745  59.498  1.00 18.92  ? 98  ALA A CB  1 
ATOM   3953 N N   . ARG C 1 97  ? 42.933 44.151  56.882  1.00 22.04  ? 99  ARG A N   1 
ATOM   3954 C CA  . ARG C 1 97  ? 41.703 44.604  56.221  1.00 19.25  ? 99  ARG A CA  1 
ATOM   3955 C C   . ARG C 1 97  ? 40.857 43.350  56.425  1.00 20.56  ? 99  ARG A C   1 
ATOM   3956 O O   . ARG C 1 97  ? 40.832 42.452  55.570  1.00 19.00  ? 99  ARG A O   1 
ATOM   3957 C CB  . ARG C 1 97  ? 41.958 44.848  54.723  1.00 20.46  ? 99  ARG A CB  1 
ATOM   3958 C CG  . ARG C 1 97  ? 40.812 45.524  53.952  1.00 18.52  ? 99  ARG A CG  1 
ATOM   3959 C CD  . ARG C 1 97  ? 39.571 44.627  53.798  1.00 17.47  ? 99  ARG A CD  1 
ATOM   3960 N NE  . ARG C 1 97  ? 39.764 43.476  52.912  1.00 18.47  ? 99  ARG A NE  1 
ATOM   3961 C CZ  . ARG C 1 97  ? 39.799 43.534  51.576  1.00 25.30  ? 99  ARG A CZ  1 
ATOM   3962 N NH1 . ARG C 1 97  ? 39.665 44.692  50.938  1.00 19.35  ? 99  ARG A NH1 1 
ATOM   3963 N NH2 . ARG C 1 97  ? 39.938 42.423  50.867  1.00 17.39  ? 99  ARG A NH2 1 
ATOM   3964 N N   . GLY C 1 98  ? 40.182 43.281  57.569  1.00 18.77  ? 100 GLY A N   1 
ATOM   3965 C CA  . GLY C 1 98  ? 39.401 42.100  57.910  1.00 17.67  ? 100 GLY A CA  1 
ATOM   3966 C C   . GLY C 1 98  ? 38.097 41.763  57.198  1.00 20.68  ? 100 GLY A C   1 
ATOM   3967 O O   . GLY C 1 98  ? 37.703 40.601  57.186  1.00 20.46  ? 100 GLY A O   1 
ATOM   3968 N N   . GLN C 1 99  ? 37.424 42.754  56.625  1.00 16.75  ? 101 GLN A N   1 
ATOM   3969 C CA  . GLN C 1 99  ? 36.148 42.540  55.941  1.00 22.23  ? 101 GLN A CA  1 
ATOM   3970 C C   . GLN C 1 99  ? 36.230 41.690  54.671  1.00 17.89  ? 101 GLN A C   1 
ATOM   3971 O O   . GLN C 1 99  ? 37.196 41.766  53.932  1.00 21.55  ? 101 GLN A O   1 
ATOM   3972 C CB  . GLN C 1 99  ? 35.529 43.892  55.576  1.00 22.06  ? 101 GLN A CB  1 
ATOM   3973 C CG  . GLN C 1 99  ? 35.119 44.744  56.771  1.00 26.68  ? 101 GLN A CG  1 
ATOM   3974 C CD  . GLN C 1 99  ? 34.879 46.197  56.392  1.00 26.07  ? 101 GLN A CD  1 
ATOM   3975 O OE1 . GLN C 1 99  ? 35.791 46.894  55.951  1.00 28.09  ? 101 GLN A OE1 1 
ATOM   3976 N NE2 . GLN C 1 99  ? 33.647 46.657  56.561  1.00 27.68  ? 101 GLN A NE2 1 
ATOM   3977 N N   . GLY C 1 100 ? 35.185 40.901  54.423  1.00 24.64  ? 102 GLY A N   1 
ATOM   3978 C CA  . GLY C 1 100 ? 35.132 40.071  53.228  1.00 22.24  ? 102 GLY A CA  1 
ATOM   3979 C C   . GLY C 1 100 ? 36.232 39.038  53.152  1.00 18.78  ? 102 GLY A C   1 
ATOM   3980 O O   . GLY C 1 100 ? 36.195 38.028  53.853  1.00 18.12  ? 102 GLY A O   1 
ATOM   3981 N N   . ARG C 1 101 ? 37.193 39.266  52.267  1.00 18.74  ? 103 ARG A N   1 
ATOM   3982 C CA  . ARG C 1 101 ? 38.336 38.369  52.139  1.00 20.93  ? 103 ARG A CA  1 
ATOM   3983 C C   . ARG C 1 101 ? 39.428 39.071  52.940  1.00 16.12  ? 103 ARG A C   1 
ATOM   3984 O O   . ARG C 1 101 ? 39.984 40.075  52.492  1.00 20.80  ? 103 ARG A O   1 
ATOM   3985 C CB  . ARG C 1 101 ? 38.766 38.223  50.673  1.00 18.58  ? 103 ARG A CB  1 
ATOM   3986 C CG  . ARG C 1 101 ? 39.969 37.301  50.437  1.00 27.03  ? 103 ARG A CG  1 
ATOM   3987 C CD  . ARG C 1 101 ? 41.255 38.096  50.329  1.00 34.27  ? 103 ARG A CD  1 
ATOM   3988 N NE  . ARG C 1 101 ? 42.494 37.306  50.333  1.00 39.68  ? 103 ARG A NE  1 
ATOM   3989 C CZ  . ARG C 1 101 ? 42.839 36.390  49.428  1.00 43.13  ? 103 ARG A CZ  1 
ATOM   3990 N NH1 . ARG C 1 101 ? 42.036 36.093  48.406  1.00 49.30  ? 103 ARG A NH1 1 
ATOM   3991 N NH2 . ARG C 1 101 ? 44.025 35.798  49.522  1.00 29.80  ? 103 ARG A NH2 1 
ATOM   3992 N N   . PRO C 1 102 ? 39.751 38.552  54.135  1.00 22.68  ? 104 PRO A N   1 
ATOM   3993 C CA  . PRO C 1 102 ? 40.784 39.172  54.976  1.00 18.17  ? 104 PRO A CA  1 
ATOM   3994 C C   . PRO C 1 102 ? 42.167 39.249  54.351  1.00 18.90  ? 104 PRO A C   1 
ATOM   3995 O O   . PRO C 1 102 ? 42.612 38.312  53.706  1.00 15.48  ? 104 PRO A O   1 
ATOM   3996 C CB  . PRO C 1 102 ? 40.795 38.287  56.234  1.00 20.64  ? 104 PRO A CB  1 
ATOM   3997 C CG  . PRO C 1 102 ? 39.453 37.619  56.226  1.00 25.32  ? 104 PRO A CG  1 
ATOM   3998 C CD  . PRO C 1 102 ? 39.248 37.321  54.761  1.00 13.32  ? 104 PRO A CD  1 
ATOM   3999 N N   . TYR C 1 103 ? 42.838 40.383  54.556  1.00 18.27  ? 105 TYR A N   1 
ATOM   4000 C CA  . TYR C 1 103 ? 44.209 40.597  54.107  1.00 18.71  ? 105 TYR A CA  1 
ATOM   4001 C C   . TYR C 1 103 ? 45.004 41.077  55.334  1.00 22.55  ? 105 TYR A C   1 
ATOM   4002 O O   . TYR C 1 103 ? 44.483 41.843  56.148  1.00 19.90  ? 105 TYR A O   1 
ATOM   4003 C CB  . TYR C 1 103 ? 44.283 41.692  53.043  1.00 24.55  ? 105 TYR A CB  1 
ATOM   4004 C CG  . TYR C 1 103 ? 44.046 41.229  51.618  1.00 30.31  ? 105 TYR A CG  1 
ATOM   4005 C CD1 . TYR C 1 103 ? 45.014 40.501  50.927  1.00 31.34  ? 105 TYR A CD1 1 
ATOM   4006 C CD2 . TYR C 1 103 ? 42.873 41.563  50.952  1.00 30.68  ? 105 TYR A CD2 1 
ATOM   4007 C CE1 . TYR C 1 103 ? 44.819 40.121  49.597  1.00 33.08  ? 105 TYR A CE1 1 
ATOM   4008 C CE2 . TYR C 1 103 ? 42.665 41.191  49.628  1.00 34.74  ? 105 TYR A CE2 1 
ATOM   4009 C CZ  . TYR C 1 103 ? 43.638 40.474  48.957  1.00 33.66  ? 105 TYR A CZ  1 
ATOM   4010 O OH  . TYR C 1 103 ? 43.428 40.121  47.647  1.00 38.63  ? 105 TYR A OH  1 
ATOM   4011 N N   . TRP C 1 104 ? 46.243 40.613  55.470  1.00 22.15  ? 106 TRP A N   1 
ATOM   4012 C CA  . TRP C 1 104 ? 47.113 41.045  56.572  1.00 24.32  ? 106 TRP A CA  1 
ATOM   4013 C C   . TRP C 1 104 ? 48.552 40.996  56.093  1.00 25.24  ? 106 TRP A C   1 
ATOM   4014 O O   . TRP C 1 104 ? 48.862 40.300  55.125  1.00 27.08  ? 106 TRP A O   1 
ATOM   4015 C CB  . TRP C 1 104 ? 46.933 40.160  57.817  1.00 19.95  ? 106 TRP A CB  1 
ATOM   4016 C CG  . TRP C 1 104 ? 47.132 38.696  57.566  1.00 20.04  ? 106 TRP A CG  1 
ATOM   4017 C CD1 . TRP C 1 104 ? 48.326 38.038  57.430  1.00 23.05  ? 106 TRP A CD1 1 
ATOM   4018 C CD2 . TRP C 1 104 ? 46.107 37.697  57.451  1.00 19.98  ? 106 TRP A CD2 1 
ATOM   4019 N NE1 . TRP C 1 104 ? 48.103 36.692  57.245  1.00 23.34  ? 106 TRP A NE1 1 
ATOM   4020 C CE2 . TRP C 1 104 ? 46.752 36.456  57.257  1.00 18.56  ? 106 TRP A CE2 1 
ATOM   4021 C CE3 . TRP C 1 104 ? 44.704 37.733  57.495  1.00 19.14  ? 106 TRP A CE3 1 
ATOM   4022 C CZ2 . TRP C 1 104 ? 46.042 35.253  57.113  1.00 19.02  ? 106 TRP A CZ2 1 
ATOM   4023 C CZ3 . TRP C 1 104 ? 43.993 36.536  57.351  1.00 25.20  ? 106 TRP A CZ3 1 
ATOM   4024 C CH2 . TRP C 1 104 ? 44.669 35.311  57.164  1.00 16.31  ? 106 TRP A CH2 1 
ATOM   4025 N N   . GLY C 1 105 ? 49.434 41.731  56.767  1.00 26.95  ? 107 GLY A N   1 
ATOM   4026 C CA  . GLY C 1 105 ? 50.829 41.762  56.356  1.00 24.73  ? 107 GLY A CA  1 
ATOM   4027 C C   . GLY C 1 105 ? 51.678 40.652  56.938  1.00 22.78  ? 107 GLY A C   1 
ATOM   4028 O O   . GLY C 1 105 ? 51.156 39.670  57.467  1.00 23.62  ? 107 GLY A O   1 
ATOM   4029 N N   . GLN C 1 106 ? 52.992 40.805  56.825  1.00 21.37  ? 108 GLN A N   1 
ATOM   4030 C CA  . GLN C 1 106 ? 53.935 39.827  57.357  1.00 25.85  ? 108 GLN A CA  1 
ATOM   4031 C C   . GLN C 1 106 ? 54.162 40.108  58.840  1.00 26.85  ? 108 GLN A C   1 
ATOM   4032 O O   . GLN C 1 106 ? 54.738 39.295  59.553  1.00 23.19  ? 108 GLN A O   1 
ATOM   4033 C CB  . GLN C 1 106 ? 55.262 39.900  56.600  1.00 29.80  ? 108 GLN A CB  1 
ATOM   4034 C CG  . GLN C 1 106 ? 55.193 39.366  55.176  1.00 43.52  ? 108 GLN A CG  1 
ATOM   4035 C CD  . GLN C 1 106 ? 54.856 37.880  55.119  1.00 49.20  ? 108 GLN A CD  1 
ATOM   4036 O OE1 . GLN C 1 106 ? 55.603 37.039  55.627  1.00 52.89  ? 108 GLN A OE1 1 
ATOM   4037 N NE2 . GLN C 1 106 ? 53.726 37.555  54.501  1.00 47.24  ? 108 GLN A NE2 1 
ATOM   4038 N N   . GLY C 1 107 ? 53.703 41.270  59.290  1.00 23.82  ? 109 GLY A N   1 
ATOM   4039 C CA  . GLY C 1 107 ? 53.837 41.627  60.692  1.00 28.99  ? 109 GLY A CA  1 
ATOM   4040 C C   . GLY C 1 107 ? 55.148 42.298  61.058  1.00 25.71  ? 109 GLY A C   1 
ATOM   4041 O O   . GLY C 1 107 ? 56.162 42.130  60.375  1.00 28.16  ? 109 GLY A O   1 
ATOM   4042 N N   . THR C 1 108 ? 55.124 43.078  62.134  1.00 23.87  ? 110 THR A N   1 
ATOM   4043 C CA  . THR C 1 108 ? 56.322 43.759  62.599  1.00 19.85  ? 110 THR A CA  1 
ATOM   4044 C C   . THR C 1 108 ? 56.455 43.432  64.084  1.00 24.65  ? 110 THR A C   1 
ATOM   4045 O O   . THR C 1 108 ? 55.489 43.539  64.840  1.00 20.45  ? 110 THR A O   1 
ATOM   4046 C CB  . THR C 1 108 ? 56.230 45.289  62.366  1.00 19.71  ? 110 THR A CB  1 
ATOM   4047 O OG1 . THR C 1 108 ? 57.498 45.890  62.672  1.00 23.45  ? 110 THR A OG1 1 
ATOM   4048 C CG2 . THR C 1 108 ? 55.134 45.913  63.225  1.00 20.95  ? 110 THR A CG2 1 
ATOM   4049 N N   . LEU C 1 109 ? 57.652 43.023  64.497  1.00 24.92  ? 111 LEU A N   1 
ATOM   4050 C CA  . LEU C 1 109 ? 57.881 42.622  65.882  1.00 26.13  ? 111 LEU A CA  1 
ATOM   4051 C C   . LEU C 1 109 ? 58.129 43.749  66.878  1.00 21.79  ? 111 LEU A C   1 
ATOM   4052 O O   . LEU C 1 109 ? 58.966 44.617  66.653  1.00 21.16  ? 111 LEU A O   1 
ATOM   4053 C CB  . LEU C 1 109 ? 59.053 41.642  65.947  1.00 27.23  ? 111 LEU A CB  1 
ATOM   4054 C CG  . LEU C 1 109 ? 59.413 41.144  67.352  1.00 36.67  ? 111 LEU A CG  1 
ATOM   4055 C CD1 . LEU C 1 109 ? 58.284 40.273  67.881  1.00 30.07  ? 111 LEU A CD1 1 
ATOM   4056 C CD2 . LEU C 1 109 ? 60.719 40.360  67.311  1.00 35.85  ? 111 LEU A CD2 1 
ATOM   4057 N N   . VAL C 1 110 ? 57.399 43.709  67.989  1.00 26.55  ? 112 VAL A N   1 
ATOM   4058 C CA  . VAL C 1 110 ? 57.546 44.701  69.054  1.00 27.93  ? 112 VAL A CA  1 
ATOM   4059 C C   . VAL C 1 110 ? 57.993 44.004  70.339  1.00 27.74  ? 112 VAL A C   1 
ATOM   4060 O O   . VAL C 1 110 ? 57.289 43.139  70.858  1.00 25.70  ? 112 VAL A O   1 
ATOM   4061 C CB  . VAL C 1 110 ? 56.221 45.437  69.328  1.00 23.53  ? 112 VAL A CB  1 
ATOM   4062 C CG1 . VAL C 1 110 ? 56.355 46.288  70.576  1.00 26.25  ? 112 VAL A CG1 1 
ATOM   4063 C CG2 . VAL C 1 110 ? 55.853 46.325  68.126  1.00 23.34  ? 112 VAL A CG2 1 
ATOM   4064 N N   . THR C 1 111 ? 59.163 44.387  70.843  1.00 25.95  ? 113 THR A N   1 
ATOM   4065 C CA  . THR C 1 111 ? 59.713 43.794  72.056  1.00 27.42  ? 113 THR A CA  1 
ATOM   4066 C C   . THR C 1 111 ? 59.935 44.850  73.140  1.00 25.53  ? 113 THR A C   1 
ATOM   4067 O O   . THR C 1 111 ? 60.735 45.777  72.984  1.00 26.11  ? 113 THR A O   1 
ATOM   4068 C CB  . THR C 1 111 ? 61.038 43.085  71.757  1.00 30.86  ? 113 THR A CB  1 
ATOM   4069 O OG1 . THR C 1 111 ? 60.855 42.183  70.655  1.00 33.60  ? 113 THR A OG1 1 
ATOM   4070 C CG2 . THR C 1 111 ? 61.500 42.289  72.974  1.00 30.72  ? 113 THR A CG2 1 
ATOM   4071 N N   . VAL C 1 112 ? 59.201 44.714  74.233  1.00 23.93  ? 114 VAL A N   1 
ATOM   4072 C CA  . VAL C 1 112 ? 59.304 45.659  75.335  1.00 25.02  ? 114 VAL A CA  1 
ATOM   4073 C C   . VAL C 1 112 ? 60.049 44.974  76.468  1.00 24.63  ? 114 VAL A C   1 
ATOM   4074 O O   . VAL C 1 112 ? 59.528 44.055  77.105  1.00 24.61  ? 114 VAL A O   1 
ATOM   4075 C CB  . VAL C 1 112 ? 57.917 46.094  75.837  1.00 23.26  ? 114 VAL A CB  1 
ATOM   4076 C CG1 . VAL C 1 112 ? 58.055 47.237  76.852  1.00 23.73  ? 114 VAL A CG1 1 
ATOM   4077 C CG2 . VAL C 1 112 ? 57.050 46.528  74.660  1.00 25.39  ? 114 VAL A CG2 1 
ATOM   4078 N N   . SER C 1 113 ? 61.280 45.412  76.693  1.00 31.20  ? 115 SER A N   1 
ATOM   4079 C CA  . SER C 1 113 ? 62.099 44.839  77.748  1.00 37.24  ? 115 SER A CA  1 
ATOM   4080 C C   . SER C 1 113 ? 63.167 45.824  78.191  1.00 34.98  ? 115 SER A C   1 
ATOM   4081 O O   . SER C 1 113 ? 63.531 46.746  77.459  1.00 36.05  ? 115 SER A O   1 
ATOM   4082 C CB  . SER C 1 113 ? 62.761 43.556  77.252  1.00 35.69  ? 115 SER A CB  1 
ATOM   4083 O OG  . SER C 1 113 ? 63.552 43.823  76.109  1.00 44.82  ? 115 SER A OG  1 
ATOM   4084 N N   . SER C 1 114 ? 63.663 45.628  79.402  1.00 38.94  ? 116 SER A N   1 
ATOM   4085 C CA  . SER C 1 114 ? 64.702 46.493  79.932  1.00 44.45  ? 116 SER A CA  1 
ATOM   4086 C C   . SER C 1 114 ? 65.993 45.677  79.913  1.00 46.58  ? 116 SER A C   1 
ATOM   4087 O O   . SER C 1 114 ? 67.097 46.222  80.012  1.00 45.25  ? 116 SER A O   1 
ATOM   4088 C CB  . SER C 1 114 ? 64.355 46.919  81.360  1.00 43.23  ? 116 SER A CB  1 
ATOM   4089 O OG  . SER C 1 114 ? 65.124 48.042  81.756  1.00 53.60  ? 116 SER A OG  1 
ATOM   4090 N N   . ALA C 1 115 ? 65.830 44.362  79.774  1.00 45.18  ? 117 ALA A N   1 
ATOM   4091 C CA  . ALA C 1 115 ? 66.949 43.434  79.729  1.00 46.41  ? 117 ALA A CA  1 
ATOM   4092 C C   . ALA C 1 115 ? 67.952 43.879  78.675  1.00 47.74  ? 117 ALA A C   1 
ATOM   4093 O O   . ALA C 1 115 ? 67.582 44.482  77.665  1.00 44.61  ? 117 ALA A O   1 
ATOM   4094 C CB  . ALA C 1 115 ? 66.447 42.031  79.419  1.00 46.91  ? 117 ALA A CB  1 
ATOM   4095 N N   . LYS C 1 116 ? 69.225 43.581  78.915  1.00 48.31  ? 118 LYS A N   1 
ATOM   4096 C CA  . LYS C 1 116 ? 70.284 43.966  77.991  1.00 50.91  ? 118 LYS A CA  1 
ATOM   4097 C C   . LYS C 1 116 ? 70.393 43.034  76.787  1.00 48.53  ? 118 LYS A C   1 
ATOM   4098 O O   . LYS C 1 116 ? 70.377 41.811  76.931  1.00 45.69  ? 118 LYS A O   1 
ATOM   4099 C CB  . LYS C 1 116 ? 71.633 44.000  78.720  1.00 56.33  ? 118 LYS A CB  1 
ATOM   4100 C CG  . LYS C 1 116 ? 71.695 44.968  79.893  1.00 64.01  ? 118 LYS A CG  1 
ATOM   4101 C CD  . LYS C 1 116 ? 71.510 46.410  79.444  1.00 68.30  ? 118 LYS A CD  1 
ATOM   4102 C CE  . LYS C 1 116 ? 71.542 47.366  80.630  1.00 69.66  ? 118 LYS A CE  1 
ATOM   4103 N NZ  . LYS C 1 116 ? 70.465 47.067  81.616  1.00 71.04  ? 118 LYS A NZ  1 
ATOM   4104 N N   . THR C 1 117 ? 70.498 43.622  75.599  1.00 51.21  ? 119 THR A N   1 
ATOM   4105 C CA  . THR C 1 117 ? 70.643 42.843  74.376  1.00 53.90  ? 119 THR A CA  1 
ATOM   4106 C C   . THR C 1 117 ? 72.006 42.170  74.461  1.00 54.28  ? 119 THR A C   1 
ATOM   4107 O O   . THR C 1 117 ? 73.040 42.836  74.410  1.00 55.94  ? 119 THR A O   1 
ATOM   4108 C CB  . THR C 1 117 ? 70.583 43.744  73.128  1.00 53.61  ? 119 THR A CB  1 
ATOM   4109 O OG1 . THR C 1 117 ? 71.197 43.073  72.021  1.00 54.63  ? 119 THR A OG1 1 
ATOM   4110 C CG2 . THR C 1 117 ? 71.295 45.059  73.384  1.00 58.22  ? 119 THR A CG2 1 
ATOM   4111 N N   . THR C 1 118 ? 72.002 40.850  74.605  1.00 52.37  ? 120 THR A N   1 
ATOM   4112 C CA  . THR C 1 118 ? 73.242 40.098  74.736  1.00 51.15  ? 120 THR A CA  1 
ATOM   4113 C C   . THR C 1 118 ? 73.548 39.181  73.551  1.00 51.36  ? 120 THR A C   1 
ATOM   4114 O O   . THR C 1 118 ? 72.683 38.438  73.084  1.00 47.83  ? 120 THR A O   1 
ATOM   4115 C CB  . THR C 1 118 ? 73.217 39.244  76.017  1.00 49.52  ? 120 THR A CB  1 
ATOM   4116 O OG1 . THR C 1 118 ? 72.864 40.070  77.134  1.00 51.81  ? 120 THR A OG1 1 
ATOM   4117 C CG2 . THR C 1 118 ? 74.575 38.624  76.270  1.00 50.39  ? 120 THR A CG2 1 
ATOM   4118 N N   . PRO C 1 119 ? 74.796 39.221  73.053  1.00 51.42  ? 121 PRO A N   1 
ATOM   4119 C CA  . PRO C 1 119 ? 75.206 38.385  71.922  1.00 48.00  ? 121 PRO A CA  1 
ATOM   4120 C C   . PRO C 1 119 ? 75.282 36.918  72.336  1.00 46.17  ? 121 PRO A C   1 
ATOM   4121 O O   . PRO C 1 119 ? 75.516 36.602  73.502  1.00 42.79  ? 121 PRO A O   1 
ATOM   4122 C CB  . PRO C 1 119 ? 76.567 38.961  71.546  1.00 50.48  ? 121 PRO A CB  1 
ATOM   4123 C CG  . PRO C 1 119 ? 77.112 39.387  72.873  1.00 52.99  ? 121 PRO A CG  1 
ATOM   4124 C CD  . PRO C 1 119 ? 75.918 40.060  73.516  1.00 52.87  ? 121 PRO A CD  1 
ATOM   4125 N N   . PRO C 1 120 ? 75.095 35.999  71.378  1.00 44.81  ? 122 PRO A N   1 
ATOM   4126 C CA  . PRO C 1 120 ? 75.137 34.565  71.662  1.00 43.05  ? 122 PRO A CA  1 
ATOM   4127 C C   . PRO C 1 120 ? 76.526 33.938  71.732  1.00 44.60  ? 122 PRO A C   1 
ATOM   4128 O O   . PRO C 1 120 ? 77.447 34.348  71.024  1.00 42.27  ? 122 PRO A O   1 
ATOM   4129 C CB  . PRO C 1 120 ? 74.327 33.982  70.521  1.00 42.47  ? 122 PRO A CB  1 
ATOM   4130 C CG  . PRO C 1 120 ? 74.778 34.842  69.374  1.00 45.98  ? 122 PRO A CG  1 
ATOM   4131 C CD  . PRO C 1 120 ? 74.732 36.240  69.969  1.00 42.20  ? 122 PRO A CD  1 
ATOM   4132 N N   . SER C 1 121 ? 76.661 32.946  72.607  1.00 42.01  ? 123 SER A N   1 
ATOM   4133 C CA  . SER C 1 121 ? 77.904 32.200  72.741  1.00 44.33  ? 123 SER A CA  1 
ATOM   4134 C C   . SER C 1 121 ? 77.637 30.917  71.958  1.00 43.82  ? 123 SER A C   1 
ATOM   4135 O O   . SER C 1 121 ? 76.655 30.216  72.222  1.00 40.85  ? 123 SER A O   1 
ATOM   4136 C CB  . SER C 1 121 ? 78.194 31.860  74.209  1.00 45.49  ? 123 SER A CB  1 
ATOM   4137 O OG  . SER C 1 121 ? 78.488 33.024  74.965  1.00 45.36  ? 123 SER A OG  1 
ATOM   4138 N N   . VAL C 1 122 ? 78.490 30.625  70.983  1.00 42.23  ? 124 VAL A N   1 
ATOM   4139 C CA  . VAL C 1 122 ? 78.318 29.433  70.169  1.00 41.84  ? 124 VAL A CA  1 
ATOM   4140 C C   . VAL C 1 122 ? 79.395 28.398  70.480  1.00 46.47  ? 124 VAL A C   1 
ATOM   4141 O O   . VAL C 1 122 ? 80.590 28.672  70.354  1.00 45.06  ? 124 VAL A O   1 
ATOM   4142 C CB  . VAL C 1 122 ? 78.369 29.783  68.669  1.00 42.85  ? 124 VAL A CB  1 
ATOM   4143 C CG1 . VAL C 1 122 ? 78.069 28.543  67.830  1.00 43.55  ? 124 VAL A CG1 1 
ATOM   4144 C CG2 . VAL C 1 122 ? 77.364 30.889  68.365  1.00 44.33  ? 124 VAL A CG2 1 
ATOM   4145 N N   . TYR C 1 123 ? 78.962 27.211  70.895  1.00 45.95  ? 125 TYR A N   1 
ATOM   4146 C CA  . TYR C 1 123 ? 79.883 26.133  71.230  1.00 48.96  ? 125 TYR A CA  1 
ATOM   4147 C C   . TYR C 1 123 ? 79.690 24.965  70.272  1.00 50.95  ? 125 TYR A C   1 
ATOM   4148 O O   . TYR C 1 123 ? 78.568 24.515  70.044  1.00 51.75  ? 125 TYR A O   1 
ATOM   4149 C CB  . TYR C 1 123 ? 79.644 25.662  72.665  1.00 45.36  ? 125 TYR A CB  1 
ATOM   4150 C CG  . TYR C 1 123 ? 79.801 26.754  73.691  1.00 45.98  ? 125 TYR A CG  1 
ATOM   4151 C CD1 . TYR C 1 123 ? 81.019 27.418  73.850  1.00 46.68  ? 125 TYR A CD1 1 
ATOM   4152 C CD2 . TYR C 1 123 ? 78.732 27.133  74.500  1.00 43.38  ? 125 TYR A CD2 1 
ATOM   4153 C CE1 . TYR C 1 123 ? 81.166 28.436  74.789  1.00 44.90  ? 125 TYR A CE1 1 
ATOM   4154 C CE2 . TYR C 1 123 ? 78.869 28.149  75.441  1.00 47.03  ? 125 TYR A CE2 1 
ATOM   4155 C CZ  . TYR C 1 123 ? 80.088 28.794  75.579  1.00 45.05  ? 125 TYR A CZ  1 
ATOM   4156 O OH  . TYR C 1 123 ? 80.227 29.800  76.502  1.00 52.64  ? 125 TYR A OH  1 
ATOM   4157 N N   . PRO C 1 124 ? 80.787 24.459  69.694  1.00 53.76  ? 126 PRO A N   1 
ATOM   4158 C CA  . PRO C 1 124 ? 80.677 23.336  68.762  1.00 55.00  ? 126 PRO A CA  1 
ATOM   4159 C C   . PRO C 1 124 ? 80.337 22.034  69.482  1.00 54.97  ? 126 PRO A C   1 
ATOM   4160 O O   . PRO C 1 124 ? 80.723 21.831  70.634  1.00 53.87  ? 126 PRO A O   1 
ATOM   4161 C CB  . PRO C 1 124 ? 82.056 23.300  68.109  1.00 55.53  ? 126 PRO A CB  1 
ATOM   4162 C CG  . PRO C 1 124 ? 82.952 23.715  69.238  1.00 57.11  ? 126 PRO A CG  1 
ATOM   4163 C CD  . PRO C 1 124 ? 82.190 24.880  69.853  1.00 54.53  ? 126 PRO A CD  1 
ATOM   4164 N N   . ALA C 1 125 ? 79.600 21.165  68.799  1.00 58.77  ? 127 ALA A N   1 
ATOM   4165 C CA  . ALA C 1 125 ? 79.210 19.874  69.354  1.00 60.82  ? 127 ALA A CA  1 
ATOM   4166 C C   . ALA C 1 125 ? 79.589 18.774  68.367  1.00 64.10  ? 127 ALA A C   1 
ATOM   4167 O O   . ALA C 1 125 ? 78.801 18.417  67.489  1.00 64.84  ? 127 ALA A O   1 
ATOM   4168 C CB  . ALA C 1 125 ? 77.715 19.845  69.623  1.00 60.07  ? 127 ALA A CB  1 
ATOM   4169 N N   . ALA C 1 126 ? 80.803 18.249  68.518  1.00 67.68  ? 128 ALA A N   1 
ATOM   4170 C CA  . ALA C 1 126 ? 81.315 17.193  67.648  1.00 70.48  ? 128 ALA A CA  1 
ATOM   4171 C C   . ALA C 1 126 ? 81.752 15.979  68.467  1.00 72.70  ? 128 ALA A C   1 
ATOM   4172 O O   . ALA C 1 126 ? 81.879 16.057  69.690  1.00 72.71  ? 128 ALA A O   1 
ATOM   4173 C CB  . ALA C 1 126 ? 82.490 17.721  66.830  1.00 67.17  ? 128 ALA A CB  1 
ATOM   4174 N N   . PRO C 1 127 ? 81.981 14.835  67.799  1.00 75.59  ? 129 PRO A N   1 
ATOM   4175 C CA  . PRO C 1 127 ? 82.408 13.604  68.477  1.00 78.47  ? 129 PRO A CA  1 
ATOM   4176 C C   . PRO C 1 127 ? 83.859 13.661  68.977  1.00 80.65  ? 129 PRO A C   1 
ATOM   4177 O O   . PRO C 1 127 ? 84.745 14.161  68.282  1.00 81.40  ? 129 PRO A O   1 
ATOM   4178 C CB  . PRO C 1 127 ? 82.194 12.537  67.406  1.00 77.03  ? 129 PRO A CB  1 
ATOM   4179 C CG  . PRO C 1 127 ? 82.482 13.284  66.139  1.00 76.77  ? 129 PRO A CG  1 
ATOM   4180 C CD  . PRO C 1 127 ? 81.756 14.590  66.362  1.00 76.32  ? 129 PRO A CD  1 
ATOM   4181 N N   . GLY C 1 128 ? 84.092 13.143  70.183  1.00 83.15  ? 130 GLY A N   1 
ATOM   4182 C CA  . GLY C 1 128 ? 85.430 13.156  70.754  1.00 85.57  ? 130 GLY A CA  1 
ATOM   4183 C C   . GLY C 1 128 ? 86.038 11.785  70.992  1.00 87.27  ? 130 GLY A C   1 
ATOM   4184 O O   . GLY C 1 128 ? 86.322 11.053  70.043  1.00 87.13  ? 130 GLY A O   1 
ATOM   4185 N N   . CYS C 1 129 ? 86.246 11.439  72.261  1.00 89.70  ? 131 CYS A N   1 
ATOM   4186 C CA  . CYS C 1 129 ? 86.832 10.149  72.628  1.00 92.36  ? 131 CYS A CA  1 
ATOM   4187 C C   . CYS C 1 129 ? 85.840 8.997   72.527  1.00 93.77  ? 131 CYS A C   1 
ATOM   4188 O O   . CYS C 1 129 ? 84.794 9.008   73.178  1.00 95.10  ? 131 CYS A O   1 
ATOM   4189 C CB  . CYS C 1 129 ? 87.391 10.195  74.056  1.00 92.33  ? 131 CYS A CB  1 
ATOM   4190 S SG  . CYS C 1 129 ? 88.948 11.098  74.256  1.00 93.21  ? 131 CYS A SG  1 
ATOM   4191 N N   . GLY C 1 130 ? 86.180 8.002   71.712  1.00 94.67  ? 132 GLY A N   1 
ATOM   4192 C CA  . GLY C 1 130 ? 85.323 6.841   71.542  1.00 94.26  ? 132 GLY A CA  1 
ATOM   4193 C C   . GLY C 1 130 ? 83.916 7.162   71.076  1.00 94.83  ? 132 GLY A C   1 
ATOM   4194 O O   . GLY C 1 130 ? 82.984 7.222   71.881  1.00 94.92  ? 132 GLY A O   1 
ATOM   4195 N N   . ASP C 1 131 ? 83.758 7.363   69.772  1.00 94.64  ? 133 ASP A N   1 
ATOM   4196 C CA  . ASP C 1 131 ? 82.452 7.676   69.202  1.00 94.70  ? 133 ASP A CA  1 
ATOM   4197 C C   . ASP C 1 131 ? 82.099 6.761   68.035  1.00 93.54  ? 133 ASP A C   1 
ATOM   4198 O O   . ASP C 1 131 ? 82.889 5.902   67.637  1.00 92.20  ? 133 ASP A O   1 
ATOM   4199 C CB  . ASP C 1 131 ? 82.411 9.135   68.732  1.00 96.10  ? 133 ASP A CB  1 
ATOM   4200 C CG  . ASP C 1 131 ? 82.358 10.119  69.885  1.00 97.23  ? 133 ASP A CG  1 
ATOM   4201 O OD1 . ASP C 1 131 ? 83.296 10.126  70.711  1.00 98.61  ? 133 ASP A OD1 1 
ATOM   4202 O OD2 . ASP C 1 131 ? 81.376 10.888  69.965  1.00 97.22  ? 133 ASP A OD2 1 
ATOM   4203 N N   . THR C 1 132 ? 80.900 6.957   67.495  1.00 92.75  ? 134 THR A N   1 
ATOM   4204 C CA  . THR C 1 132 ? 80.414 6.171   66.367  1.00 91.71  ? 134 THR A CA  1 
ATOM   4205 C C   . THR C 1 132 ? 80.989 6.748   65.072  1.00 91.46  ? 134 THR A C   1 
ATOM   4206 O O   . THR C 1 132 ? 80.255 7.053   64.129  1.00 90.60  ? 134 THR A O   1 
ATOM   4207 C CB  . THR C 1 132 ? 78.867 6.198   66.301  1.00 90.68  ? 134 THR A CB  1 
ATOM   4208 O OG1 . THR C 1 132 ? 78.326 5.794   67.565  1.00 89.93  ? 134 THR A OG1 1 
ATOM   4209 C CG2 . THR C 1 132 ? 78.359 5.252   65.222  1.00 90.05  ? 134 THR A CG2 1 
ATOM   4210 N N   . THR C 1 133 ? 82.310 6.902   65.042  1.00 90.42  ? 135 THR A N   1 
ATOM   4211 C CA  . THR C 1 133 ? 83.001 7.442   63.876  1.00 90.42  ? 135 THR A CA  1 
ATOM   4212 C C   . THR C 1 133 ? 82.736 6.580   62.643  1.00 89.83  ? 135 THR A C   1 
ATOM   4213 O O   . THR C 1 133 ? 83.515 5.684   62.317  1.00 89.92  ? 135 THR A O   1 
ATOM   4214 C CB  . THR C 1 133 ? 84.528 7.516   64.120  1.00 90.44  ? 135 THR A CB  1 
ATOM   4215 O OG1 . THR C 1 133 ? 84.789 8.307   65.287  1.00 91.34  ? 135 THR A OG1 1 
ATOM   4216 C CG2 . THR C 1 133 ? 85.232 8.146   62.924  1.00 89.86  ? 135 THR A CG2 1 
ATOM   4217 N N   . GLY C 1 134 ? 81.632 6.857   61.958  1.00 89.26  ? 136 GLY A N   1 
ATOM   4218 C CA  . GLY C 1 134 ? 81.293 6.094   60.772  1.00 88.16  ? 136 GLY A CA  1 
ATOM   4219 C C   . GLY C 1 134 ? 80.190 6.739   59.957  1.00 88.03  ? 136 GLY A C   1 
ATOM   4220 O O   . GLY C 1 134 ? 79.859 7.908   60.162  1.00 87.79  ? 136 GLY A O   1 
ATOM   4221 N N   . SER C 1 135 ? 79.624 5.974   59.027  1.00 87.30  ? 137 SER A N   1 
ATOM   4222 C CA  . SER C 1 135 ? 78.551 6.464   58.168  1.00 85.18  ? 137 SER A CA  1 
ATOM   4223 C C   . SER C 1 135 ? 77.521 7.236   58.984  1.00 82.67  ? 137 SER A C   1 
ATOM   4224 O O   . SER C 1 135 ? 77.048 6.755   60.014  1.00 83.67  ? 137 SER A O   1 
ATOM   4225 C CB  . SER C 1 135 ? 77.869 5.294   57.454  1.00 84.58  ? 137 SER A CB  1 
ATOM   4226 O OG  . SER C 1 135 ? 76.821 5.747   56.612  1.00 87.29  ? 137 SER A OG  1 
ATOM   4227 N N   . SER C 1 136 ? 77.186 8.435   58.517  1.00 80.54  ? 138 SER A N   1 
ATOM   4228 C CA  . SER C 1 136 ? 76.212 9.286   59.192  1.00 77.56  ? 138 SER A CA  1 
ATOM   4229 C C   . SER C 1 136 ? 76.683 9.696   60.583  1.00 74.76  ? 138 SER A C   1 
ATOM   4230 O O   . SER C 1 136 ? 76.670 8.895   61.519  1.00 74.59  ? 138 SER A O   1 
ATOM   4231 C CB  . SER C 1 136 ? 74.862 8.569   59.300  1.00 78.27  ? 138 SER A CB  1 
ATOM   4232 O OG  . SER C 1 136 ? 74.350 8.246   58.018  1.00 82.80  ? 138 SER A OG  1 
ATOM   4233 N N   . VAL C 1 137 ? 77.098 10.951  60.711  1.00 70.26  ? 139 VAL A N   1 
ATOM   4234 C CA  . VAL C 1 137 ? 77.565 11.476  61.986  1.00 65.58  ? 139 VAL A CA  1 
ATOM   4235 C C   . VAL C 1 137 ? 76.718 12.679  62.391  1.00 63.41  ? 139 VAL A C   1 
ATOM   4236 O O   . VAL C 1 137 ? 76.358 13.506  61.551  1.00 59.93  ? 139 VAL A O   1 
ATOM   4237 C CB  . VAL C 1 137 ? 79.046 11.901  61.902  1.00 64.60  ? 139 VAL A CB  1 
ATOM   4238 C CG1 . VAL C 1 137 ? 79.235 12.905  60.774  1.00 66.02  ? 139 VAL A CG1 1 
ATOM   4239 C CG2 . VAL C 1 137 ? 79.494 12.493  63.233  1.00 65.64  ? 139 VAL A CG2 1 
ATOM   4240 N N   . THR C 1 138 ? 76.402 12.768  63.680  1.00 61.37  ? 140 THR A N   1 
ATOM   4241 C CA  . THR C 1 138 ? 75.591 13.866  64.195  1.00 60.76  ? 140 THR A CA  1 
ATOM   4242 C C   . THR C 1 138 ? 76.441 14.993  64.772  1.00 59.58  ? 140 THR A C   1 
ATOM   4243 O O   . THR C 1 138 ? 77.067 14.840  65.822  1.00 56.58  ? 140 THR A O   1 
ATOM   4244 C CB  . THR C 1 138 ? 74.616 13.384  65.298  1.00 60.97  ? 140 THR A CB  1 
ATOM   4245 O OG1 . THR C 1 138 ? 73.814 12.305  64.801  1.00 58.98  ? 140 THR A OG1 1 
ATOM   4246 C CG2 . THR C 1 138 ? 73.699 14.523  65.729  1.00 60.32  ? 140 THR A CG2 1 
ATOM   4247 N N   . LEU C 1 139 ? 76.453 16.125  64.077  1.00 60.07  ? 141 LEU A N   1 
ATOM   4248 C CA  . LEU C 1 139 ? 77.206 17.294  64.514  1.00 60.25  ? 141 LEU A CA  1 
ATOM   4249 C C   . LEU C 1 139 ? 76.213 18.340  65.017  1.00 59.14  ? 141 LEU A C   1 
ATOM   4250 O O   . LEU C 1 139 ? 75.010 18.216  64.785  1.00 58.04  ? 141 LEU A O   1 
ATOM   4251 C CB  . LEU C 1 139 ? 78.016 17.865  63.349  1.00 62.36  ? 141 LEU A CB  1 
ATOM   4252 C CG  . LEU C 1 139 ? 79.100 16.967  62.744  1.00 64.32  ? 141 LEU A CG  1 
ATOM   4253 C CD1 . LEU C 1 139 ? 79.716 17.664  61.537  1.00 62.36  ? 141 LEU A CD1 1 
ATOM   4254 C CD2 . LEU C 1 139 ? 80.167 16.652  63.794  1.00 62.95  ? 141 LEU A CD2 1 
ATOM   4255 N N   . GLY C 1 140 ? 76.707 19.364  65.704  1.00 57.74  ? 142 GLY A N   1 
ATOM   4256 C CA  . GLY C 1 140 ? 75.808 20.386  66.206  1.00 56.63  ? 142 GLY A CA  1 
ATOM   4257 C C   . GLY C 1 140 ? 76.468 21.583  66.860  1.00 56.40  ? 142 GLY A C   1 
ATOM   4258 O O   . GLY C 1 140 ? 77.649 21.553  67.204  1.00 56.72  ? 142 GLY A O   1 
ATOM   4259 N N   . CYS C 1 141 ? 75.691 22.647  67.026  1.00 54.36  ? 143 CYS A N   1 
ATOM   4260 C CA  . CYS C 1 141 ? 76.176 23.870  67.644  1.00 50.82  ? 143 CYS A CA  1 
ATOM   4261 C C   . CYS C 1 141 ? 75.222 24.304  68.746  1.00 48.81  ? 143 CYS A C   1 
ATOM   4262 O O   . CYS C 1 141 ? 74.014 24.398  68.535  1.00 47.76  ? 143 CYS A O   1 
ATOM   4263 C CB  . CYS C 1 141 ? 76.334 24.977  66.584  1.00 52.24  ? 143 CYS A CB  1 
ATOM   4264 S SG  . CYS C 1 141 ? 77.782 24.709  65.502  1.00 57.16  ? 143 CYS A SG  1 
ATOM   4265 N N   . LEU C 1 142 ? 75.772 24.532  69.933  1.00 48.48  ? 144 LEU A N   1 
ATOM   4266 C CA  . LEU C 1 142 ? 74.988 24.963  71.080  1.00 46.20  ? 144 LEU A CA  1 
ATOM   4267 C C   . LEU C 1 142 ? 75.088 26.480  71.198  1.00 46.97  ? 144 LEU A C   1 
ATOM   4268 O O   . LEU C 1 142 ? 76.190 27.031  71.258  1.00 47.72  ? 144 LEU A O   1 
ATOM   4269 C CB  . LEU C 1 142 ? 75.517 24.308  72.358  1.00 46.16  ? 144 LEU A CB  1 
ATOM   4270 C CG  . LEU C 1 142 ? 74.990 24.860  73.687  1.00 48.56  ? 144 LEU A CG  1 
ATOM   4271 C CD1 . LEU C 1 142 ? 73.501 24.590  73.810  1.00 49.64  ? 144 LEU A CD1 1 
ATOM   4272 C CD2 . LEU C 1 142 ? 75.743 24.227  74.842  1.00 45.51  ? 144 LEU A CD2 1 
ATOM   4273 N N   . VAL C 1 143 ? 73.939 27.149  71.224  1.00 42.94  ? 145 VAL A N   1 
ATOM   4274 C CA  . VAL C 1 143 ? 73.898 28.603  71.332  1.00 41.66  ? 145 VAL A CA  1 
ATOM   4275 C C   . VAL C 1 143 ? 73.201 29.000  72.635  1.00 43.96  ? 145 VAL A C   1 
ATOM   4276 O O   . VAL C 1 143 ? 72.053 28.624  72.867  1.00 43.72  ? 145 VAL A O   1 
ATOM   4277 C CB  . VAL C 1 143 ? 73.131 29.217  70.140  1.00 43.00  ? 145 VAL A CB  1 
ATOM   4278 C CG1 . VAL C 1 143 ? 73.228 30.731  70.177  1.00 42.07  ? 145 VAL A CG1 1 
ATOM   4279 C CG2 . VAL C 1 143 ? 73.682 28.674  68.831  1.00 39.26  ? 145 VAL A CG2 1 
ATOM   4280 N N   . LYS C 1 144 ? 73.892 29.754  73.486  1.00 42.99  ? 146 LYS A N   1 
ATOM   4281 C CA  . LYS C 1 144 ? 73.304 30.178  74.754  1.00 43.94  ? 146 LYS A CA  1 
ATOM   4282 C C   . LYS C 1 144 ? 73.720 31.586  75.168  1.00 43.21  ? 146 LYS A C   1 
ATOM   4283 O O   . LYS C 1 144 ? 74.627 32.184  74.581  1.00 44.44  ? 146 LYS A O   1 
ATOM   4284 C CB  . LYS C 1 144 ? 73.686 29.201  75.870  1.00 50.05  ? 146 LYS A CB  1 
ATOM   4285 C CG  . LYS C 1 144 ? 75.151 29.281  76.279  1.00 54.43  ? 146 LYS A CG  1 
ATOM   4286 C CD  . LYS C 1 144 ? 75.540 28.204  77.284  1.00 55.20  ? 146 LYS A CD  1 
ATOM   4287 C CE  . LYS C 1 144 ? 74.833 28.352  78.628  1.00 55.35  ? 146 LYS A CE  1 
ATOM   4288 N NZ  . LYS C 1 144 ? 73.393 27.984  78.578  1.00 56.07  ? 146 LYS A NZ  1 
ATOM   4289 N N   . GLY C 1 145 ? 73.033 32.107  76.180  1.00 41.05  ? 147 GLY A N   1 
ATOM   4290 C CA  . GLY C 1 145 ? 73.335 33.427  76.702  1.00 44.43  ? 147 GLY A CA  1 
ATOM   4291 C C   . GLY C 1 145 ? 72.969 34.626  75.852  1.00 46.02  ? 147 GLY A C   1 
ATOM   4292 O O   . GLY C 1 145 ? 73.550 35.698  76.035  1.00 46.28  ? 147 GLY A O   1 
ATOM   4293 N N   . TYR C 1 146 ? 72.016 34.475  74.932  1.00 42.99  ? 148 TYR A N   1 
ATOM   4294 C CA  . TYR C 1 146 ? 71.623 35.603  74.092  1.00 44.12  ? 148 TYR A CA  1 
ATOM   4295 C C   . TYR C 1 146 ? 70.244 36.169  74.431  1.00 43.80  ? 148 TYR A C   1 
ATOM   4296 O O   . TYR C 1 146 ? 69.456 35.547  75.147  1.00 40.80  ? 148 TYR A O   1 
ATOM   4297 C CB  . TYR C 1 146 ? 71.674 35.226  72.606  1.00 42.55  ? 148 TYR A CB  1 
ATOM   4298 C CG  . TYR C 1 146 ? 70.685 34.161  72.182  1.00 45.79  ? 148 TYR A CG  1 
ATOM   4299 C CD1 . TYR C 1 146 ? 70.914 32.816  72.460  1.00 44.67  ? 148 TYR A CD1 1 
ATOM   4300 C CD2 . TYR C 1 146 ? 69.521 34.503  71.494  1.00 43.84  ? 148 TYR A CD2 1 
ATOM   4301 C CE1 . TYR C 1 146 ? 70.010 31.834  72.059  1.00 46.25  ? 148 TYR A CE1 1 
ATOM   4302 C CE2 . TYR C 1 146 ? 68.609 33.532  71.091  1.00 45.49  ? 148 TYR A CE2 1 
ATOM   4303 C CZ  . TYR C 1 146 ? 68.860 32.199  71.374  1.00 47.30  ? 148 TYR A CZ  1 
ATOM   4304 O OH  . TYR C 1 146 ? 67.968 31.231  70.967  1.00 47.73  ? 148 TYR A OH  1 
ATOM   4305 N N   . PHE C 1 147 ? 69.973 37.361  73.905  1.00 46.42  ? 149 PHE A N   1 
ATOM   4306 C CA  . PHE C 1 147 ? 68.710 38.067  74.118  1.00 48.75  ? 149 PHE A CA  1 
ATOM   4307 C C   . PHE C 1 147 ? 68.716 39.307  73.227  1.00 50.66  ? 149 PHE A C   1 
ATOM   4308 O O   . PHE C 1 147 ? 69.712 40.030  73.182  1.00 50.18  ? 149 PHE A O   1 
ATOM   4309 C CB  . PHE C 1 147 ? 68.582 38.503  75.579  1.00 49.79  ? 149 PHE A CB  1 
ATOM   4310 C CG  . PHE C 1 147 ? 67.262 39.145  75.906  1.00 50.36  ? 149 PHE A CG  1 
ATOM   4311 C CD1 . PHE C 1 147 ? 66.148 38.365  76.199  1.00 51.50  ? 149 PHE A CD1 1 
ATOM   4312 C CD2 . PHE C 1 147 ? 67.125 40.527  75.891  1.00 50.73  ? 149 PHE A CD2 1 
ATOM   4313 C CE1 . PHE C 1 147 ? 64.915 38.953  76.471  1.00 50.41  ? 149 PHE A CE1 1 
ATOM   4314 C CE2 . PHE C 1 147 ? 65.895 41.125  76.161  1.00 52.07  ? 149 PHE A CE2 1 
ATOM   4315 C CZ  . PHE C 1 147 ? 64.789 40.335  76.451  1.00 49.74  ? 149 PHE A CZ  1 
ATOM   4316 N N   . PRO C 1 148 ? 67.611 39.574  72.504  1.00 51.01  ? 150 PRO A N   1 
ATOM   4317 C CA  . PRO C 1 148 ? 66.348 38.828  72.435  1.00 52.91  ? 150 PRO A CA  1 
ATOM   4318 C C   . PRO C 1 148 ? 66.494 37.436  71.828  1.00 51.57  ? 150 PRO A C   1 
ATOM   4319 O O   . PRO C 1 148 ? 67.591 37.008  71.485  1.00 50.27  ? 150 PRO A O   1 
ATOM   4320 C CB  . PRO C 1 148 ? 65.461 39.724  71.572  1.00 53.51  ? 150 PRO A CB  1 
ATOM   4321 C CG  . PRO C 1 148 ? 66.009 41.083  71.811  1.00 56.35  ? 150 PRO A CG  1 
ATOM   4322 C CD  . PRO C 1 148 ? 67.491 40.839  71.764  1.00 52.14  ? 150 PRO A CD  1 
ATOM   4323 N N   . GLU C 1 149 ? 65.363 36.754  71.679  1.00 52.71  ? 151 GLU A N   1 
ATOM   4324 C CA  . GLU C 1 149 ? 65.313 35.402  71.137  1.00 55.30  ? 151 GLU A CA  1 
ATOM   4325 C C   . GLU C 1 149 ? 65.646 35.215  69.653  1.00 55.66  ? 151 GLU A C   1 
ATOM   4326 O O   . GLU C 1 149 ? 66.272 34.224  69.279  1.00 58.70  ? 151 GLU A O   1 
ATOM   4327 C CB  . GLU C 1 149 ? 63.933 34.801  71.401  1.00 57.34  ? 151 GLU A CB  1 
ATOM   4328 C CG  . GLU C 1 149 ? 63.828 33.334  71.038  1.00 64.42  ? 151 GLU A CG  1 
ATOM   4329 C CD  . GLU C 1 149 ? 62.417 32.811  71.163  1.00 67.72  ? 151 GLU A CD  1 
ATOM   4330 O OE1 . GLU C 1 149 ? 61.804 33.000  72.233  1.00 66.18  ? 151 GLU A OE1 1 
ATOM   4331 O OE2 . GLU C 1 149 ? 61.923 32.207  70.189  1.00 73.64  ? 151 GLU A OE2 1 
ATOM   4332 N N   . PRO C 1 150 ? 65.231 36.152  68.788  1.00 53.75  ? 152 PRO A N   1 
ATOM   4333 C CA  . PRO C 1 150 ? 65.526 36.001  67.357  1.00 54.77  ? 152 PRO A CA  1 
ATOM   4334 C C   . PRO C 1 150 ? 66.976 35.674  66.992  1.00 53.66  ? 152 PRO A C   1 
ATOM   4335 O O   . PRO C 1 150 ? 67.857 36.524  67.074  1.00 54.22  ? 152 PRO A O   1 
ATOM   4336 C CB  . PRO C 1 150 ? 65.052 37.331  66.762  1.00 55.88  ? 152 PRO A CB  1 
ATOM   4337 C CG  . PRO C 1 150 ? 65.177 38.290  67.918  1.00 59.71  ? 152 PRO A CG  1 
ATOM   4338 C CD  . PRO C 1 150 ? 64.643 37.474  69.062  1.00 55.91  ? 152 PRO A CD  1 
ATOM   4339 N N   . VAL C 1 151 ? 67.207 34.431  66.579  1.00 52.75  ? 153 VAL A N   1 
ATOM   4340 C CA  . VAL C 1 151 ? 68.532 33.965  66.182  1.00 51.88  ? 153 VAL A CA  1 
ATOM   4341 C C   . VAL C 1 151 ? 68.380 32.900  65.093  1.00 50.04  ? 153 VAL A C   1 
ATOM   4342 O O   . VAL C 1 151 ? 67.480 32.063  65.155  1.00 46.68  ? 153 VAL A O   1 
ATOM   4343 C CB  . VAL C 1 151 ? 69.300 33.359  67.381  1.00 55.32  ? 153 VAL A CB  1 
ATOM   4344 C CG1 . VAL C 1 151 ? 68.613 32.091  67.856  1.00 58.70  ? 153 VAL A CG1 1 
ATOM   4345 C CG2 . VAL C 1 151 ? 70.736 33.074  66.987  1.00 56.08  ? 153 VAL A CG2 1 
ATOM   4346 N N   . THR C 1 152 ? 69.258 32.927  64.097  1.00 47.25  ? 154 THR A N   1 
ATOM   4347 C CA  . THR C 1 152 ? 69.169 31.965  63.006  1.00 48.98  ? 154 THR A CA  1 
ATOM   4348 C C   . THR C 1 152 ? 70.438 31.154  62.788  1.00 48.04  ? 154 THR A C   1 
ATOM   4349 O O   . THR C 1 152 ? 71.525 31.711  62.645  1.00 48.45  ? 154 THR A O   1 
ATOM   4350 C CB  . THR C 1 152 ? 68.822 32.670  61.679  1.00 52.20  ? 154 THR A CB  1 
ATOM   4351 O OG1 . THR C 1 152 ? 67.601 33.406  61.834  1.00 50.87  ? 154 THR A OG1 1 
ATOM   4352 C CG2 . THR C 1 152 ? 68.659 31.647  60.555  1.00 51.19  ? 154 THR A CG2 1 
ATOM   4353 N N   . VAL C 1 153 ? 70.288 29.835  62.753  1.00 45.14  ? 155 VAL A N   1 
ATOM   4354 C CA  . VAL C 1 153 ? 71.418 28.943  62.531  1.00 48.97  ? 155 VAL A CA  1 
ATOM   4355 C C   . VAL C 1 153 ? 71.356 28.360  61.121  1.00 53.14  ? 155 VAL A C   1 
ATOM   4356 O O   . VAL C 1 153 ? 70.361 27.746  60.738  1.00 55.96  ? 155 VAL A O   1 
ATOM   4357 C CB  . VAL C 1 153 ? 71.424 27.783  63.539  1.00 45.03  ? 155 VAL A CB  1 
ATOM   4358 C CG1 . VAL C 1 153 ? 72.633 26.896  63.296  1.00 49.60  ? 155 VAL A CG1 1 
ATOM   4359 C CG2 . VAL C 1 153 ? 71.443 28.329  64.957  1.00 47.49  ? 155 VAL A CG2 1 
ATOM   4360 N N   . THR C 1 154 ? 72.420 28.561  60.351  1.00 54.28  ? 156 THR A N   1 
ATOM   4361 C CA  . THR C 1 154 ? 72.486 28.048  58.988  1.00 56.26  ? 156 THR A CA  1 
ATOM   4362 C C   . THR C 1 154 ? 73.754 27.228  58.784  1.00 56.80  ? 156 THR A C   1 
ATOM   4363 O O   . THR C 1 154 ? 74.836 27.624  59.219  1.00 54.25  ? 156 THR A O   1 
ATOM   4364 C CB  . THR C 1 154 ? 72.469 29.194  57.955  1.00 57.20  ? 156 THR A CB  1 
ATOM   4365 O OG1 . THR C 1 154 ? 73.453 30.171  58.311  1.00 60.90  ? 156 THR A OG1 1 
ATOM   4366 C CG2 . THR C 1 154 ? 71.103 29.856  57.909  1.00 60.06  ? 156 THR A CG2 1 
ATOM   4367 N N   . TRP C 1 155 ? 73.612 26.082  58.127  1.00 57.25  ? 157 TRP A N   1 
ATOM   4368 C CA  . TRP C 1 155 ? 74.746 25.208  57.858  1.00 60.51  ? 157 TRP A CA  1 
ATOM   4369 C C   . TRP C 1 155 ? 75.137 25.235  56.386  1.00 63.33  ? 157 TRP A C   1 
ATOM   4370 O O   . TRP C 1 155 ? 74.488 24.599  55.556  1.00 66.05  ? 157 TRP A O   1 
ATOM   4371 C CB  . TRP C 1 155 ? 74.419 23.773  58.259  1.00 57.34  ? 157 TRP A CB  1 
ATOM   4372 C CG  . TRP C 1 155 ? 74.165 23.606  59.709  1.00 54.35  ? 157 TRP A CG  1 
ATOM   4373 C CD1 . TRP C 1 155 ? 73.018 23.906  60.382  1.00 54.83  ? 157 TRP A CD1 1 
ATOM   4374 C CD2 . TRP C 1 155 ? 75.085 23.105  60.681  1.00 51.85  ? 157 TRP A CD2 1 
ATOM   4375 N NE1 . TRP C 1 155 ? 73.166 23.620  61.719  1.00 54.03  ? 157 TRP A NE1 1 
ATOM   4376 C CE2 . TRP C 1 155 ? 74.427 23.128  61.929  1.00 51.30  ? 157 TRP A CE2 1 
ATOM   4377 C CE3 . TRP C 1 155 ? 76.404 22.640  60.621  1.00 51.05  ? 157 TRP A CE3 1 
ATOM   4378 C CZ2 . TRP C 1 155 ? 75.042 22.701  63.108  1.00 50.31  ? 157 TRP A CZ2 1 
ATOM   4379 C CZ3 . TRP C 1 155 ? 77.016 22.216  61.795  1.00 48.48  ? 157 TRP A CZ3 1 
ATOM   4380 C CH2 . TRP C 1 155 ? 76.332 22.250  63.019  1.00 49.21  ? 157 TRP A CH2 1 
ATOM   4381 N N   . ASN C 1 156 ? 76.199 25.971  56.069  1.00 65.86  ? 158 ASN A N   1 
ATOM   4382 C CA  . ASN C 1 156 ? 76.684 26.085  54.697  1.00 69.09  ? 158 ASN A CA  1 
ATOM   4383 C C   . ASN C 1 156 ? 75.540 26.391  53.732  1.00 72.05  ? 158 ASN A C   1 
ATOM   4384 O O   . ASN C 1 156 ? 75.689 26.253  52.517  1.00 73.15  ? 158 ASN A O   1 
ATOM   4385 C CB  . ASN C 1 156 ? 77.377 24.785  54.276  1.00 69.02  ? 158 ASN A CB  1 
ATOM   4386 C CG  . ASN C 1 156 ? 78.497 24.386  55.222  1.00 72.41  ? 158 ASN A CG  1 
ATOM   4387 O OD1 . ASN C 1 156 ? 79.465 25.125  55.406  1.00 73.89  ? 158 ASN A OD1 1 
ATOM   4388 N ND2 . ASN C 1 156 ? 78.368 23.212  55.828  1.00 70.97  ? 158 ASN A ND2 1 
ATOM   4389 N N   . SER C 1 157 ? 74.402 26.807  54.284  1.00 73.58  ? 159 SER A N   1 
ATOM   4390 C CA  . SER C 1 157 ? 73.213 27.127  53.500  1.00 75.44  ? 159 SER A CA  1 
ATOM   4391 C C   . SER C 1 157 ? 72.554 25.862  52.948  1.00 77.73  ? 159 SER A C   1 
ATOM   4392 O O   . SER C 1 157 ? 71.329 25.777  52.862  1.00 77.62  ? 159 SER A O   1 
ATOM   4393 C CB  . SER C 1 157 ? 73.572 28.069  52.347  1.00 75.51  ? 159 SER A CB  1 
ATOM   4394 O OG  . SER C 1 157 ? 74.171 29.258  52.830  1.00 76.59  ? 159 SER A OG  1 
ATOM   4395 N N   . GLY C 1 158 ? 73.374 24.882  52.579  1.00 79.30  ? 160 GLY A N   1 
ATOM   4396 C CA  . GLY C 1 158 ? 72.852 23.639  52.039  1.00 80.41  ? 160 GLY A CA  1 
ATOM   4397 C C   . GLY C 1 158 ? 72.610 22.585  53.102  1.00 82.00  ? 160 GLY A C   1 
ATOM   4398 O O   . GLY C 1 158 ? 73.236 21.523  53.094  1.00 81.74  ? 160 GLY A O   1 
ATOM   4399 N N   . GLY C 1 159 ? 71.697 22.879  54.023  1.00 83.71  ? 161 GLY A N   1 
ATOM   4400 C CA  . GLY C 1 159 ? 71.382 21.941  55.086  1.00 84.12  ? 161 GLY A CA  1 
ATOM   4401 C C   . GLY C 1 159 ? 69.977 21.388  54.943  1.00 82.92  ? 161 GLY A C   1 
ATOM   4402 O O   . GLY C 1 159 ? 69.001 22.139  54.969  1.00 82.26  ? 161 GLY A O   1 
ATOM   4403 N N   . SER C 1 160 ? 69.874 20.071  54.792  1.00 82.41  ? 164 SER A N   1 
ATOM   4404 C CA  . SER C 1 160 ? 68.580 19.417  54.636  1.00 80.14  ? 164 SER A CA  1 
ATOM   4405 C C   . SER C 1 160 ? 68.301 18.452  55.783  1.00 78.11  ? 164 SER A C   1 
ATOM   4406 O O   . SER C 1 160 ? 67.157 18.061  56.015  1.00 78.91  ? 164 SER A O   1 
ATOM   4407 C CB  . SER C 1 160 ? 68.531 18.664  53.304  1.00 81.27  ? 164 SER A CB  1 
ATOM   4408 O OG  . SER C 1 160 ? 67.266 18.057  53.109  1.00 83.74  ? 164 SER A OG  1 
ATOM   4409 N N   . SER C 1 161 ? 69.353 18.074  56.500  1.00 74.56  ? 165 SER A N   1 
ATOM   4410 C CA  . SER C 1 161 ? 69.219 17.160  57.627  1.00 72.55  ? 165 SER A CA  1 
ATOM   4411 C C   . SER C 1 161 ? 69.425 17.920  58.934  1.00 70.56  ? 165 SER A C   1 
ATOM   4412 O O   . SER C 1 161 ? 69.918 17.365  59.920  1.00 68.57  ? 165 SER A O   1 
ATOM   4413 C CB  . SER C 1 161 ? 70.250 16.036  57.513  1.00 74.65  ? 165 SER A CB  1 
ATOM   4414 O OG  . SER C 1 161 ? 70.119 15.114  58.581  1.00 78.21  ? 165 SER A OG  1 
ATOM   4415 N N   . VAL C 1 162 ? 69.036 19.192  58.937  1.00 66.62  ? 166 VAL A N   1 
ATOM   4416 C CA  . VAL C 1 162 ? 69.196 20.033  60.116  1.00 63.87  ? 166 VAL A CA  1 
ATOM   4417 C C   . VAL C 1 162 ? 67.997 19.974  61.060  1.00 61.23  ? 166 VAL A C   1 
ATOM   4418 O O   . VAL C 1 162 ? 66.856 19.830  60.624  1.00 62.05  ? 166 VAL A O   1 
ATOM   4419 C CB  . VAL C 1 162 ? 69.436 21.511  59.712  1.00 64.80  ? 166 VAL A CB  1 
ATOM   4420 C CG1 . VAL C 1 162 ? 70.501 21.584  58.628  1.00 63.15  ? 166 VAL A CG1 1 
ATOM   4421 C CG2 . VAL C 1 162 ? 68.142 22.151  59.242  1.00 66.84  ? 166 VAL A CG2 1 
ATOM   4422 N N   . HIS C 1 163 ? 68.275 20.080  62.355  1.00 58.37  ? 167 HIS A N   1 
ATOM   4423 C CA  . HIS C 1 163 ? 67.245 20.066  63.387  1.00 56.43  ? 167 HIS A CA  1 
ATOM   4424 C C   . HIS C 1 163 ? 67.506 21.178  64.395  1.00 55.84  ? 167 HIS A C   1 
ATOM   4425 O O   . HIS C 1 163 ? 68.264 20.993  65.347  1.00 55.20  ? 167 HIS A O   1 
ATOM   4426 C CB  . HIS C 1 163 ? 67.230 18.729  64.133  1.00 56.52  ? 167 HIS A CB  1 
ATOM   4427 C CG  . HIS C 1 163 ? 66.689 17.589  63.329  1.00 60.38  ? 167 HIS A CG  1 
ATOM   4428 N ND1 . HIS C 1 163 ? 65.434 17.610  62.758  1.00 60.98  ? 167 HIS A ND1 1 
ATOM   4429 C CD2 . HIS C 1 163 ? 67.223 16.384  63.020  1.00 58.87  ? 167 HIS A CD2 1 
ATOM   4430 C CE1 . HIS C 1 163 ? 65.219 16.467  62.131  1.00 60.71  ? 167 HIS A CE1 1 
ATOM   4431 N NE2 . HIS C 1 163 ? 66.289 15.706  62.275  1.00 61.87  ? 167 HIS A NE2 1 
ATOM   4432 N N   . THR C 1 164 ? 66.883 22.333  64.184  1.00 53.90  ? 168 THR A N   1 
ATOM   4433 C CA  . THR C 1 164 ? 67.055 23.451  65.100  1.00 52.51  ? 168 THR A CA  1 
ATOM   4434 C C   . THR C 1 164 ? 65.907 23.437  66.092  1.00 50.86  ? 168 THR A C   1 
ATOM   4435 O O   . THR C 1 164 ? 64.751 23.639  65.728  1.00 52.71  ? 168 THR A O   1 
ATOM   4436 C CB  . THR C 1 164 ? 67.089 24.791  64.349  1.00 53.96  ? 168 THR A CB  1 
ATOM   4437 O OG1 . THR C 1 164 ? 68.226 24.810  63.475  1.00 50.84  ? 168 THR A OG1 1 
ATOM   4438 C CG2 . THR C 1 164 ? 67.192 25.955  65.332  1.00 54.09  ? 168 THR A CG2 1 
ATOM   4439 N N   . PHE C 1 165 ? 66.243 23.189  67.351  1.00 48.72  ? 169 PHE A N   1 
ATOM   4440 C CA  . PHE C 1 165 ? 65.262 23.103  68.420  1.00 46.68  ? 169 PHE A CA  1 
ATOM   4441 C C   . PHE C 1 165 ? 64.840 24.458  68.979  1.00 45.76  ? 169 PHE A C   1 
ATOM   4442 O O   . PHE C 1 165 ? 65.614 25.410  68.977  1.00 45.26  ? 169 PHE A O   1 
ATOM   4443 C CB  . PHE C 1 165 ? 65.832 22.214  69.526  1.00 46.32  ? 169 PHE A CB  1 
ATOM   4444 C CG  . PHE C 1 165 ? 66.286 20.873  69.029  1.00 46.17  ? 169 PHE A CG  1 
ATOM   4445 C CD1 . PHE C 1 165 ? 65.379 19.827  68.878  1.00 46.51  ? 169 PHE A CD1 1 
ATOM   4446 C CD2 . PHE C 1 165 ? 67.603 20.680  68.624  1.00 45.11  ? 169 PHE A CD2 1 
ATOM   4447 C CE1 . PHE C 1 165 ? 65.774 18.609  68.324  1.00 45.48  ? 169 PHE A CE1 1 
ATOM   4448 C CE2 . PHE C 1 165 ? 68.009 19.465  68.067  1.00 48.44  ? 169 PHE A CE2 1 
ATOM   4449 C CZ  . PHE C 1 165 ? 67.092 18.429  67.917  1.00 46.09  ? 169 PHE A CZ  1 
ATOM   4450 N N   . PRO C 1 166 ? 63.590 24.555  69.459  1.00 44.44  ? 170 PRO A N   1 
ATOM   4451 C CA  . PRO C 1 166 ? 63.042 25.790  70.031  1.00 44.56  ? 170 PRO A CA  1 
ATOM   4452 C C   . PRO C 1 166 ? 63.931 26.325  71.146  1.00 44.53  ? 170 PRO A C   1 
ATOM   4453 O O   . PRO C 1 166 ? 64.374 25.569  72.013  1.00 42.53  ? 170 PRO A O   1 
ATOM   4454 C CB  . PRO C 1 166 ? 61.675 25.349  70.552  1.00 44.22  ? 170 PRO A CB  1 
ATOM   4455 C CG  . PRO C 1 166 ? 61.281 24.276  69.581  1.00 45.38  ? 170 PRO A CG  1 
ATOM   4456 C CD  . PRO C 1 166 ? 62.570 23.490  69.445  1.00 44.37  ? 170 PRO A CD  1 
ATOM   4457 N N   . ALA C 1 167 ? 64.194 27.628  71.123  1.00 42.78  ? 171 ALA A N   1 
ATOM   4458 C CA  . ALA C 1 167 ? 65.026 28.239  72.149  1.00 46.20  ? 171 ALA A CA  1 
ATOM   4459 C C   . ALA C 1 167 ? 64.289 28.204  73.479  1.00 47.61  ? 171 ALA A C   1 
ATOM   4460 O O   . ALA C 1 167 ? 63.062 28.263  73.518  1.00 50.83  ? 171 ALA A O   1 
ATOM   4461 C CB  . ALA C 1 167 ? 65.356 29.674  71.772  1.00 46.36  ? 171 ALA A CB  1 
ATOM   4462 N N   . LEU C 1 168 ? 65.041 28.090  74.567  1.00 49.32  ? 172 LEU A N   1 
ATOM   4463 C CA  . LEU C 1 168 ? 64.457 28.063  75.898  1.00 50.99  ? 172 LEU A CA  1 
ATOM   4464 C C   . LEU C 1 168 ? 65.065 29.177  76.737  1.00 54.10  ? 172 LEU A C   1 
ATOM   4465 O O   . LEU C 1 168 ? 66.277 29.395  76.712  1.00 50.31  ? 172 LEU A O   1 
ATOM   4466 C CB  . LEU C 1 168 ? 64.711 26.713  76.568  1.00 52.73  ? 172 LEU A CB  1 
ATOM   4467 C CG  . LEU C 1 168 ? 64.014 25.497  75.953  1.00 54.51  ? 172 LEU A CG  1 
ATOM   4468 C CD1 . LEU C 1 168 ? 64.376 24.251  76.744  1.00 56.98  ? 172 LEU A CD1 1 
ATOM   4469 C CD2 . LEU C 1 168 ? 62.506 25.709  75.960  1.00 52.84  ? 172 LEU A CD2 1 
ATOM   4470 N N   . LEU C 1 169 ? 64.215 29.887  77.472  1.00 57.52  ? 173 LEU A N   1 
ATOM   4471 C CA  . LEU C 1 169 ? 64.669 30.980  78.318  1.00 61.68  ? 173 LEU A CA  1 
ATOM   4472 C C   . LEU C 1 169 ? 65.288 30.396  79.584  1.00 65.96  ? 173 LEU A C   1 
ATOM   4473 O O   . LEU C 1 169 ? 64.721 29.503  80.216  1.00 66.61  ? 173 LEU A O   1 
ATOM   4474 C CB  . LEU C 1 169 ? 63.495 31.898  78.666  1.00 59.14  ? 173 LEU A CB  1 
ATOM   4475 C CG  . LEU C 1 169 ? 63.822 33.264  79.271  1.00 57.75  ? 173 LEU A CG  1 
ATOM   4476 C CD1 . LEU C 1 169 ? 64.805 34.009  78.382  1.00 54.61  ? 173 LEU A CD1 1 
ATOM   4477 C CD2 . LEU C 1 169 ? 62.537 34.063  79.430  1.00 58.83  ? 173 LEU A CD2 1 
ATOM   4478 N N   . GLN C 1 170 ? 66.461 30.903  79.942  1.00 69.78  ? 174 GLN A N   1 
ATOM   4479 C CA  . GLN C 1 170 ? 67.175 30.423  81.114  1.00 72.47  ? 174 GLN A CA  1 
ATOM   4480 C C   . GLN C 1 170 ? 67.801 31.586  81.881  1.00 71.61  ? 174 GLN A C   1 
ATOM   4481 O O   . GLN C 1 170 ? 68.786 32.179  81.439  1.00 70.52  ? 174 GLN A O   1 
ATOM   4482 C CB  . GLN C 1 170 ? 68.254 29.432  80.669  1.00 76.95  ? 174 GLN A CB  1 
ATOM   4483 C CG  . GLN C 1 170 ? 68.987 28.726  81.792  1.00 84.01  ? 174 GLN A CG  1 
ATOM   4484 C CD  . GLN C 1 170 ? 69.908 27.633  81.278  1.00 88.15  ? 174 GLN A CD  1 
ATOM   4485 O OE1 . GLN C 1 170 ? 70.792 27.884  80.456  1.00 91.10  ? 174 GLN A OE1 1 
ATOM   4486 N NE2 . GLN C 1 170 ? 69.704 26.410  81.759  1.00 89.15  ? 174 GLN A NE2 1 
ATOM   4487 N N   . SER C 1 171 ? 67.212 31.909  83.028  1.00 69.58  ? 175 SER A N   1 
ATOM   4488 C CA  . SER C 1 171 ? 67.696 32.995  83.871  1.00 69.21  ? 175 SER A CA  1 
ATOM   4489 C C   . SER C 1 171 ? 67.722 34.334  83.145  1.00 67.77  ? 175 SER A C   1 
ATOM   4490 O O   . SER C 1 171 ? 68.547 35.195  83.452  1.00 70.12  ? 175 SER A O   1 
ATOM   4491 C CB  . SER C 1 171 ? 69.097 32.675  84.397  1.00 71.93  ? 175 SER A CB  1 
ATOM   4492 O OG  . SER C 1 171 ? 69.078 31.522  85.219  1.00 75.67  ? 175 SER A OG  1 
ATOM   4493 N N   . GLY C 1 172 ? 66.825 34.506  82.179  1.00 64.20  ? 176 GLY A N   1 
ATOM   4494 C CA  . GLY C 1 172 ? 66.770 35.759  81.448  1.00 57.90  ? 176 GLY A CA  1 
ATOM   4495 C C   . GLY C 1 172 ? 67.459 35.746  80.098  1.00 55.05  ? 176 GLY A C   1 
ATOM   4496 O O   . GLY C 1 172 ? 67.395 36.726  79.357  1.00 50.05  ? 176 GLY A O   1 
ATOM   4497 N N   . LEU C 1 173 ? 68.126 34.642  79.777  1.00 50.87  ? 177 LEU A N   1 
ATOM   4498 C CA  . LEU C 1 173 ? 68.816 34.519  78.498  1.00 51.72  ? 177 LEU A CA  1 
ATOM   4499 C C   . LEU C 1 173 ? 68.327 33.277  77.768  1.00 48.85  ? 177 LEU A C   1 
ATOM   4500 O O   . LEU C 1 173 ? 67.998 32.271  78.394  1.00 50.97  ? 177 LEU A O   1 
ATOM   4501 C CB  . LEU C 1 173 ? 70.328 34.427  78.714  1.00 49.36  ? 177 LEU A CB  1 
ATOM   4502 C CG  . LEU C 1 173 ? 70.968 35.584  79.482  1.00 50.25  ? 177 LEU A CG  1 
ATOM   4503 C CD1 . LEU C 1 173 ? 72.448 35.299  79.674  1.00 48.94  ? 177 LEU A CD1 1 
ATOM   4504 C CD2 . LEU C 1 173 ? 70.758 36.891  78.730  1.00 48.55  ? 177 LEU A CD2 1 
ATOM   4505 N N   . TYR C 1 174 ? 68.286 33.349  76.444  1.00 47.90  ? 178 TYR A N   1 
ATOM   4506 C CA  . TYR C 1 174 ? 67.824 32.227  75.640  1.00 47.47  ? 178 TYR A CA  1 
ATOM   4507 C C   . TYR C 1 174 ? 68.939 31.264  75.269  1.00 46.99  ? 178 TYR A C   1 
ATOM   4508 O O   . TYR C 1 174 ? 70.099 31.652  75.131  1.00 44.90  ? 178 TYR A O   1 
ATOM   4509 C CB  . TYR C 1 174 ? 67.143 32.742  74.371  1.00 50.78  ? 178 TYR A CB  1 
ATOM   4510 C CG  . TYR C 1 174 ? 65.802 33.386  74.629  1.00 53.66  ? 178 TYR A CG  1 
ATOM   4511 C CD1 . TYR C 1 174 ? 64.700 32.618  74.996  1.00 55.58  ? 178 TYR A CD1 1 
ATOM   4512 C CD2 . TYR C 1 174 ? 65.637 34.764  74.525  1.00 55.35  ? 178 TYR A CD2 1 
ATOM   4513 C CE1 . TYR C 1 174 ? 63.466 33.205  75.252  1.00 57.53  ? 178 TYR A CE1 1 
ATOM   4514 C CE2 . TYR C 1 174 ? 64.404 35.364  74.781  1.00 57.91  ? 178 TYR A CE2 1 
ATOM   4515 C CZ  . TYR C 1 174 ? 63.324 34.576  75.143  1.00 57.44  ? 178 TYR A CZ  1 
ATOM   4516 O OH  . TYR C 1 174 ? 62.101 35.155  75.385  1.00 58.62  ? 178 TYR A OH  1 
ATOM   4517 N N   . THR C 1 175 ? 68.569 29.999  75.108  1.00 47.23  ? 179 THR A N   1 
ATOM   4518 C CA  . THR C 1 175 ? 69.515 28.955  74.746  1.00 47.88  ? 179 THR A CA  1 
ATOM   4519 C C   . THR C 1 175 ? 68.850 27.976  73.795  1.00 46.65  ? 179 THR A C   1 
ATOM   4520 O O   . THR C 1 175 ? 67.694 27.602  73.987  1.00 45.26  ? 179 THR A O   1 
ATOM   4521 C CB  . THR C 1 175 ? 69.989 28.161  75.977  1.00 49.05  ? 179 THR A CB  1 
ATOM   4522 O OG1 . THR C 1 175 ? 70.569 29.053  76.937  1.00 54.25  ? 179 THR A OG1 1 
ATOM   4523 C CG2 . THR C 1 175 ? 71.020 27.124  75.564  1.00 49.20  ? 179 THR A CG2 1 
ATOM   4524 N N   . MET C 1 176 ? 69.587 27.567  72.769  1.00 47.71  ? 180 MET A N   1 
ATOM   4525 C CA  . MET C 1 176 ? 69.079 26.615  71.795  1.00 49.65  ? 180 MET A CA  1 
ATOM   4526 C C   . MET C 1 176 ? 70.241 25.918  71.112  1.00 49.94  ? 180 MET A C   1 
ATOM   4527 O O   . MET C 1 176 ? 71.352 26.448  71.051  1.00 49.24  ? 180 MET A O   1 
ATOM   4528 C CB  . MET C 1 176 ? 68.228 27.314  70.732  1.00 53.25  ? 180 MET A CB  1 
ATOM   4529 C CG  . MET C 1 176 ? 69.005 28.273  69.844  1.00 56.47  ? 180 MET A CG  1 
ATOM   4530 S SD  . MET C 1 176 ? 68.385 28.280  68.153  1.00 63.89  ? 180 MET A SD  1 
ATOM   4531 C CE  . MET C 1 176 ? 66.813 29.087  68.372  1.00 60.93  ? 180 MET A CE  1 
ATOM   4532 N N   . SER C 1 177 ? 69.978 24.725  70.598  1.00 47.91  ? 181 SER A N   1 
ATOM   4533 C CA  . SER C 1 177 ? 70.999 23.960  69.905  1.00 48.87  ? 181 SER A CA  1 
ATOM   4534 C C   . SER C 1 177 ? 70.473 23.564  68.540  1.00 45.50  ? 181 SER A C   1 
ATOM   4535 O O   . SER C 1 177 ? 69.268 23.584  68.303  1.00 47.13  ? 181 SER A O   1 
ATOM   4536 C CB  . SER C 1 177 ? 71.364 22.712  70.709  1.00 49.85  ? 181 SER A CB  1 
ATOM   4537 O OG  . SER C 1 177 ? 70.205 21.958  71.012  1.00 58.63  ? 181 SER A OG  1 
ATOM   4538 N N   . SER C 1 178 ? 71.385 23.215  67.643  1.00 44.29  ? 182 SER A N   1 
ATOM   4539 C CA  . SER C 1 178 ? 71.022 22.808  66.295  1.00 42.50  ? 182 SER A CA  1 
ATOM   4540 C C   . SER C 1 178 ? 71.905 21.635  65.893  1.00 48.25  ? 182 SER A C   1 
ATOM   4541 O O   . SER C 1 178 ? 73.130 21.715  65.989  1.00 47.37  ? 182 SER A O   1 
ATOM   4542 C CB  . SER C 1 178 ? 71.231 23.969  65.326  1.00 40.81  ? 182 SER A CB  1 
ATOM   4543 O OG  . SER C 1 178 ? 70.876 23.606  64.005  1.00 43.57  ? 182 SER A OG  1 
ATOM   4544 N N   . SER C 1 179 ? 71.286 20.542  65.453  1.00 50.29  ? 183 SER A N   1 
ATOM   4545 C CA  . SER C 1 179 ? 72.045 19.366  65.037  1.00 53.69  ? 183 SER A CA  1 
ATOM   4546 C C   . SER C 1 179 ? 71.955 19.157  63.528  1.00 53.84  ? 183 SER A C   1 
ATOM   4547 O O   . SER C 1 179 ? 70.965 19.525  62.897  1.00 55.54  ? 183 SER A O   1 
ATOM   4548 C CB  . SER C 1 179 ? 71.533 18.113  65.756  1.00 52.55  ? 183 SER A CB  1 
ATOM   4549 O OG  . SER C 1 179 ? 70.232 17.764  65.320  1.00 55.11  ? 183 SER A OG  1 
ATOM   4550 N N   . VAL C 1 180 ? 73.004 18.576  62.956  1.00 57.62  ? 184 VAL A N   1 
ATOM   4551 C CA  . VAL C 1 180 ? 73.053 18.303  61.526  1.00 58.13  ? 184 VAL A CA  1 
ATOM   4552 C C   . VAL C 1 180 ? 73.582 16.889  61.337  1.00 61.05  ? 184 VAL A C   1 
ATOM   4553 O O   . VAL C 1 180 ? 74.306 16.373  62.191  1.00 59.79  ? 184 VAL A O   1 
ATOM   4554 C CB  . VAL C 1 180 ? 73.979 19.297  60.792  1.00 56.74  ? 184 VAL A CB  1 
ATOM   4555 C CG1 . VAL C 1 180 ? 75.405 19.152  61.294  1.00 59.39  ? 184 VAL A CG1 1 
ATOM   4556 C CG2 . VAL C 1 180 ? 73.900 19.071  59.291  1.00 55.84  ? 184 VAL A CG2 1 
ATOM   4557 N N   . THR C 1 181 ? 73.214 16.263  60.224  1.00 64.77  ? 185 THR A N   1 
ATOM   4558 C CA  . THR C 1 181 ? 73.649 14.901  59.937  1.00 66.85  ? 185 THR A CA  1 
ATOM   4559 C C   . THR C 1 181 ? 74.239 14.775  58.537  1.00 68.55  ? 185 THR A C   1 
ATOM   4560 O O   . THR C 1 181 ? 73.675 15.281  57.563  1.00 66.20  ? 185 THR A O   1 
ATOM   4561 C CB  . THR C 1 181 ? 72.477 13.909  60.073  1.00 66.60  ? 185 THR A CB  1 
ATOM   4562 O OG1 . THR C 1 181 ? 71.988 13.932  61.421  1.00 66.38  ? 185 THR A OG1 1 
ATOM   4563 C CG2 . THR C 1 181 ? 72.929 12.498  59.720  1.00 66.46  ? 185 THR A CG2 1 
ATOM   4564 N N   . VAL C 1 182 ? 75.383 14.101  58.454  1.00 71.84  ? 186 VAL A N   1 
ATOM   4565 C CA  . VAL C 1 182 ? 76.073 13.881  57.187  1.00 73.47  ? 186 VAL A CA  1 
ATOM   4566 C C   . VAL C 1 182 ? 76.870 12.577  57.238  1.00 74.19  ? 186 VAL A C   1 
ATOM   4567 O O   . VAL C 1 182 ? 77.316 12.150  58.307  1.00 71.24  ? 186 VAL A O   1 
ATOM   4568 C CB  . VAL C 1 182 ? 77.053 15.033  56.865  1.00 74.40  ? 186 VAL A CB  1 
ATOM   4569 C CG1 . VAL C 1 182 ? 76.290 16.333  56.667  1.00 74.34  ? 186 VAL A CG1 1 
ATOM   4570 C CG2 . VAL C 1 182 ? 78.073 15.173  57.984  1.00 75.10  ? 186 VAL A CG2 1 
ATOM   4571 N N   . PRO C 1 183 ? 77.056 11.926  56.076  1.00 76.21  ? 187 PRO A N   1 
ATOM   4572 C CA  . PRO C 1 183 ? 77.805 10.667  55.994  1.00 77.28  ? 187 PRO A CA  1 
ATOM   4573 C C   . PRO C 1 183 ? 79.290 10.885  56.278  1.00 78.09  ? 187 PRO A C   1 
ATOM   4574 O O   . PRO C 1 183 ? 79.883 11.860  55.810  1.00 79.35  ? 187 PRO A O   1 
ATOM   4575 C CB  . PRO C 1 183 ? 77.544 10.209  54.562  1.00 77.47  ? 187 PRO A CB  1 
ATOM   4576 C CG  . PRO C 1 183 ? 77.440 11.505  53.820  1.00 77.40  ? 187 PRO A CG  1 
ATOM   4577 C CD  . PRO C 1 183 ? 76.578 12.339  54.744  1.00 75.83  ? 187 PRO A CD  1 
ATOM   4578 N N   . SER C 1 184 ? 79.886 9.977   57.045  1.00 78.27  ? 188 SER A N   1 
ATOM   4579 C CA  . SER C 1 184 ? 81.299 10.082  57.398  1.00 77.76  ? 188 SER A CA  1 
ATOM   4580 C C   . SER C 1 184 ? 82.200 10.225  56.174  1.00 77.90  ? 188 SER A C   1 
ATOM   4581 O O   . SER C 1 184 ? 83.288 10.796  56.261  1.00 76.75  ? 188 SER A O   1 
ATOM   4582 C CB  . SER C 1 184 ? 81.730 8.858   58.207  1.00 76.01  ? 188 SER A CB  1 
ATOM   4583 O OG  . SER C 1 184 ? 83.044 9.018   58.710  1.00 76.39  ? 188 SER A OG  1 
ATOM   4584 N N   . SER C 1 185 ? 81.743 9.707   55.036  1.00 78.23  ? 189 SER A N   1 
ATOM   4585 C CA  . SER C 1 185 ? 82.512 9.776   53.796  1.00 80.58  ? 189 SER A CA  1 
ATOM   4586 C C   . SER C 1 185 ? 82.645 11.203  53.277  1.00 81.06  ? 189 SER A C   1 
ATOM   4587 O O   . SER C 1 185 ? 83.192 11.428  52.197  1.00 82.26  ? 189 SER A O   1 
ATOM   4588 C CB  . SER C 1 185 ? 81.861 8.904   52.719  1.00 80.70  ? 189 SER A CB  1 
ATOM   4589 O OG  . SER C 1 185 ? 81.869 7.537   53.092  1.00 84.69  ? 189 SER A OG  1 
ATOM   4590 N N   . THR C 1 186 ? 82.144 12.165  54.044  1.00 81.27  ? 190 THR A N   1 
ATOM   4591 C CA  . THR C 1 186 ? 82.221 13.562  53.640  1.00 82.21  ? 190 THR A CA  1 
ATOM   4592 C C   . THR C 1 186 ? 82.429 14.486  54.835  1.00 83.76  ? 190 THR A C   1 
ATOM   4593 O O   . THR C 1 186 ? 82.385 15.709  54.696  1.00 83.65  ? 190 THR A O   1 
ATOM   4594 C CB  . THR C 1 186 ? 80.942 13.999  52.891  1.00 81.80  ? 190 THR A CB  1 
ATOM   4595 O OG1 . THR C 1 186 ? 81.103 15.338  52.405  1.00 81.39  ? 190 THR A OG1 1 
ATOM   4596 C CG2 . THR C 1 186 ? 79.736 13.946  53.818  1.00 79.57  ? 190 THR A CG2 1 
ATOM   4597 N N   . TRP C 1 187 ? 82.658 13.903  56.009  1.00 85.11  ? 191 TRP A N   1 
ATOM   4598 C CA  . TRP C 1 187 ? 82.873 14.697  57.212  1.00 88.05  ? 191 TRP A CA  1 
ATOM   4599 C C   . TRP C 1 187 ? 84.079 15.619  57.034  1.00 87.70  ? 191 TRP A C   1 
ATOM   4600 O O   . TRP C 1 187 ? 84.011 16.809  57.347  1.00 88.31  ? 191 TRP A O   1 
ATOM   4601 C CB  . TRP C 1 187 ? 83.073 13.786  58.431  1.00 91.27  ? 191 TRP A CB  1 
ATOM   4602 C CG  . TRP C 1 187 ? 83.039 14.526  59.740  1.00 97.06  ? 191 TRP A CG  1 
ATOM   4603 C CD1 . TRP C 1 187 ? 82.280 15.622  60.041  1.00 97.78  ? 191 TRP A CD1 1 
ATOM   4604 C CD2 . TRP C 1 187 ? 83.750 14.191  60.939  1.00 100.22 ? 191 TRP A CD2 1 
ATOM   4605 N NE1 . TRP C 1 187 ? 82.473 15.990  61.350  1.00 99.56  ? 191 TRP A NE1 1 
ATOM   4606 C CE2 . TRP C 1 187 ? 83.369 15.130  61.927  1.00 100.38 ? 191 TRP A CE2 1 
ATOM   4607 C CE3 . TRP C 1 187 ? 84.670 13.189  61.277  1.00 102.13 ? 191 TRP A CE3 1 
ATOM   4608 C CZ2 . TRP C 1 187 ? 83.875 15.096  63.231  1.00 101.97 ? 191 TRP A CZ2 1 
ATOM   4609 C CZ3 . TRP C 1 187 ? 85.174 13.156  62.576  1.00 104.56 ? 191 TRP A CZ3 1 
ATOM   4610 C CH2 . TRP C 1 187 ? 84.773 14.107  63.536  1.00 104.40 ? 191 TRP A CH2 1 
ATOM   4611 N N   . PRO C 1 188 ? 85.203 15.082  56.530  1.00 86.31  ? 192 PRO A N   1 
ATOM   4612 C CA  . PRO C 1 188 ? 86.390 15.916  56.331  1.00 84.38  ? 192 PRO A CA  1 
ATOM   4613 C C   . PRO C 1 188 ? 86.269 16.757  55.062  1.00 83.02  ? 192 PRO A C   1 
ATOM   4614 O O   . PRO C 1 188 ? 87.103 16.663  54.161  1.00 82.49  ? 192 PRO A O   1 
ATOM   4615 C CB  . PRO C 1 188 ? 87.510 14.890  56.242  1.00 85.46  ? 192 PRO A CB  1 
ATOM   4616 C CG  . PRO C 1 188 ? 86.841 13.757  55.532  1.00 87.10  ? 192 PRO A CG  1 
ATOM   4617 C CD  . PRO C 1 188 ? 85.509 13.667  56.249  1.00 86.21  ? 192 PRO A CD  1 
ATOM   4618 N N   . SER C 1 189 ? 85.219 17.570  54.995  1.00 81.40  ? 193 SER A N   1 
ATOM   4619 C CA  . SER C 1 189 ? 84.984 18.436  53.843  1.00 81.04  ? 193 SER A CA  1 
ATOM   4620 C C   . SER C 1 189 ? 84.540 19.823  54.302  1.00 79.50  ? 193 SER A C   1 
ATOM   4621 O O   . SER C 1 189 ? 84.076 20.637  53.499  1.00 79.59  ? 193 SER A O   1 
ATOM   4622 C CB  . SER C 1 189 ? 83.917 17.827  52.927  1.00 80.95  ? 193 SER A CB  1 
ATOM   4623 O OG  . SER C 1 189 ? 84.339 16.578  52.410  1.00 81.66  ? 193 SER A OG  1 
ATOM   4624 N N   . THR C 1 190 ? 84.683 20.074  55.602  1.00 77.75  ? 195 THR A N   1 
ATOM   4625 C CA  . THR C 1 190 ? 84.321 21.350  56.218  1.00 75.97  ? 195 THR A CA  1 
ATOM   4626 C C   . THR C 1 190 ? 82.824 21.518  56.478  1.00 74.05  ? 195 THR A C   1 
ATOM   4627 O O   . THR C 1 190 ? 82.041 21.767  55.559  1.00 72.65  ? 195 THR A O   1 
ATOM   4628 C CB  . THR C 1 190 ? 84.803 22.554  55.369  1.00 77.23  ? 195 THR A CB  1 
ATOM   4629 O OG1 . THR C 1 190 ? 86.219 22.465  55.164  1.00 76.67  ? 195 THR A OG1 1 
ATOM   4630 C CG2 . THR C 1 190 ? 84.488 23.864  56.077  1.00 77.45  ? 195 THR A CG2 1 
ATOM   4631 N N   . VAL C 1 191 ? 82.440 21.376  57.743  1.00 71.67  ? 196 VAL A N   1 
ATOM   4632 C CA  . VAL C 1 191 ? 81.051 21.537  58.162  1.00 68.50  ? 196 VAL A CA  1 
ATOM   4633 C C   . VAL C 1 191 ? 81.016 22.754  59.082  1.00 65.85  ? 196 VAL A C   1 
ATOM   4634 O O   . VAL C 1 191 ? 81.596 22.732  60.169  1.00 64.73  ? 196 VAL A O   1 
ATOM   4635 C CB  . VAL C 1 191 ? 80.544 20.305  58.942  1.00 69.72  ? 196 VAL A CB  1 
ATOM   4636 C CG1 . VAL C 1 191 ? 79.079 20.487  59.311  1.00 68.00  ? 196 VAL A CG1 1 
ATOM   4637 C CG2 . VAL C 1 191 ? 80.738 19.047  58.113  1.00 68.12  ? 196 VAL A CG2 1 
ATOM   4638 N N   . THR C 1 192 ? 80.340 23.812  58.647  1.00 61.99  ? 197 THR A N   1 
ATOM   4639 C CA  . THR C 1 192 ? 80.273 25.034  59.441  1.00 60.63  ? 197 THR A CA  1 
ATOM   4640 C C   . THR C 1 192 ? 78.858 25.512  59.772  1.00 58.83  ? 197 THR A C   1 
ATOM   4641 O O   . THR C 1 192 ? 77.977 25.538  58.909  1.00 57.15  ? 197 THR A O   1 
ATOM   4642 C CB  . THR C 1 192 ? 81.007 26.185  58.723  1.00 60.69  ? 197 THR A CB  1 
ATOM   4643 O OG1 . THR C 1 192 ? 82.355 25.791  58.440  1.00 62.08  ? 197 THR A OG1 1 
ATOM   4644 C CG2 . THR C 1 192 ? 81.020 27.437  59.589  1.00 59.63  ? 197 THR A CG2 1 
ATOM   4645 N N   . CYS C 1 193 ? 78.648 25.888  61.030  1.00 55.84  ? 198 CYS A N   1 
ATOM   4646 C CA  . CYS C 1 193 ? 77.353 26.403  61.454  1.00 54.62  ? 198 CYS A CA  1 
ATOM   4647 C C   . CYS C 1 193 ? 77.509 27.913  61.594  1.00 54.41  ? 198 CYS A C   1 
ATOM   4648 O O   . CYS C 1 193 ? 78.437 28.394  62.250  1.00 52.86  ? 198 CYS A O   1 
ATOM   4649 C CB  . CYS C 1 193 ? 76.917 25.793  62.795  1.00 54.24  ? 198 CYS A CB  1 
ATOM   4650 S SG  . CYS C 1 193 ? 77.880 26.309  64.256  1.00 59.67  ? 198 CYS A SG  1 
ATOM   4651 N N   . SER C 1 194 ? 76.619 28.657  60.951  1.00 52.00  ? 199 SER A N   1 
ATOM   4652 C CA  . SER C 1 194 ? 76.656 30.111  61.013  1.00 49.95  ? 199 SER A CA  1 
ATOM   4653 C C   . SER C 1 194 ? 75.486 30.608  61.857  1.00 49.18  ? 199 SER A C   1 
ATOM   4654 O O   . SER C 1 194 ? 74.326 30.461  61.470  1.00 46.88  ? 199 SER A O   1 
ATOM   4655 C CB  . SER C 1 194 ? 76.574 30.698  59.604  1.00 50.20  ? 199 SER A CB  1 
ATOM   4656 O OG  . SER C 1 194 ? 76.627 32.113  59.636  1.00 53.35  ? 199 SER A OG  1 
ATOM   4657 N N   . VAL C 1 195 ? 75.797 31.185  63.015  1.00 45.77  ? 200 VAL A N   1 
ATOM   4658 C CA  . VAL C 1 195 ? 74.773 31.696  63.921  1.00 42.43  ? 200 VAL A CA  1 
ATOM   4659 C C   . VAL C 1 195 ? 74.627 33.206  63.781  1.00 43.44  ? 200 VAL A C   1 
ATOM   4660 O O   . VAL C 1 195 ? 75.562 33.956  64.053  1.00 47.12  ? 200 VAL A O   1 
ATOM   4661 C CB  . VAL C 1 195 ? 75.120 31.374  65.386  1.00 38.63  ? 200 VAL A CB  1 
ATOM   4662 C CG1 . VAL C 1 195 ? 73.983 31.804  66.297  1.00 39.15  ? 200 VAL A CG1 1 
ATOM   4663 C CG2 . VAL C 1 195 ? 75.401 29.891  65.540  1.00 41.37  ? 200 VAL A CG2 1 
ATOM   4664 N N   . ALA C 1 196 ? 73.449 33.647  63.356  1.00 42.82  ? 201 ALA A N   1 
ATOM   4665 C CA  . ALA C 1 196 ? 73.180 35.070  63.180  1.00 43.81  ? 201 ALA A CA  1 
ATOM   4666 C C   . ALA C 1 196 ? 72.214 35.584  64.242  1.00 44.00  ? 201 ALA A C   1 
ATOM   4667 O O   . ALA C 1 196 ? 71.185 34.963  64.515  1.00 42.65  ? 201 ALA A O   1 
ATOM   4668 C CB  . ALA C 1 196 ? 72.607 35.325  61.790  1.00 41.87  ? 201 ALA A CB  1 
ATOM   4669 N N   . HIS C 1 197 ? 72.557 36.723  64.836  1.00 42.81  ? 202 HIS A N   1 
ATOM   4670 C CA  . HIS C 1 197 ? 71.735 37.346  65.869  1.00 45.04  ? 202 HIS A CA  1 
ATOM   4671 C C   . HIS C 1 197 ? 71.642 38.840  65.575  1.00 47.30  ? 202 HIS A C   1 
ATOM   4672 O O   . HIS C 1 197 ? 72.321 39.649  66.208  1.00 43.57  ? 202 HIS A O   1 
ATOM   4673 C CB  . HIS C 1 197 ? 72.372 37.140  67.245  1.00 46.92  ? 202 HIS A CB  1 
ATOM   4674 C CG  . HIS C 1 197 ? 71.525 37.617  68.383  1.00 47.41  ? 202 HIS A CG  1 
ATOM   4675 N ND1 . HIS C 1 197 ? 72.062 38.130  69.544  1.00 46.49  ? 202 HIS A ND1 1 
ATOM   4676 C CD2 . HIS C 1 197 ? 70.183 37.621  68.556  1.00 47.76  ? 202 HIS A CD2 1 
ATOM   4677 C CE1 . HIS C 1 197 ? 71.088 38.428  70.385  1.00 47.56  ? 202 HIS A CE1 1 
ATOM   4678 N NE2 . HIS C 1 197 ? 69.937 38.128  69.810  1.00 48.46  ? 202 HIS A NE2 1 
ATOM   4679 N N   . PRO C 1 198 ? 70.790 39.226  64.612  1.00 50.26  ? 203 PRO A N   1 
ATOM   4680 C CA  . PRO C 1 198 ? 70.619 40.634  64.238  1.00 53.77  ? 203 PRO A CA  1 
ATOM   4681 C C   . PRO C 1 198 ? 70.403 41.582  65.415  1.00 53.58  ? 203 PRO A C   1 
ATOM   4682 O O   . PRO C 1 198 ? 70.769 42.755  65.352  1.00 54.66  ? 203 PRO A O   1 
ATOM   4683 C CB  . PRO C 1 198 ? 69.424 40.596  63.281  1.00 54.40  ? 203 PRO A CB  1 
ATOM   4684 C CG  . PRO C 1 198 ? 68.663 39.379  63.722  1.00 54.58  ? 203 PRO A CG  1 
ATOM   4685 C CD  . PRO C 1 198 ? 69.773 38.388  63.954  1.00 54.33  ? 203 PRO A CD  1 
ATOM   4686 N N   . ALA C 1 199 ? 69.820 41.068  66.491  1.00 54.14  ? 204 ALA A N   1 
ATOM   4687 C CA  . ALA C 1 199 ? 69.565 41.878  67.675  1.00 55.41  ? 204 ALA A CA  1 
ATOM   4688 C C   . ALA C 1 199 ? 70.847 42.519  68.215  1.00 54.30  ? 204 ALA A C   1 
ATOM   4689 O O   . ALA C 1 199 ? 70.823 43.643  68.717  1.00 57.01  ? 204 ALA A O   1 
ATOM   4690 C CB  . ALA C 1 199 ? 68.910 41.026  68.755  1.00 56.66  ? 204 ALA A CB  1 
ATOM   4691 N N   . SER C 1 200 ? 71.961 41.803  68.116  1.00 48.38  ? 205 SER A N   1 
ATOM   4692 C CA  . SER C 1 200 ? 73.238 42.323  68.590  1.00 46.17  ? 205 SER A CA  1 
ATOM   4693 C C   . SER C 1 200 ? 74.187 42.564  67.423  1.00 45.25  ? 205 SER A C   1 
ATOM   4694 O O   . SER C 1 200 ? 75.377 42.803  67.621  1.00 45.56  ? 205 SER A O   1 
ATOM   4695 C CB  . SER C 1 200 ? 73.879 41.347  69.582  1.00 42.93  ? 205 SER A CB  1 
ATOM   4696 O OG  . SER C 1 200 ? 74.120 40.086  68.986  1.00 30.42  ? 205 SER A OG  1 
ATOM   4697 N N   . SER C 1 201 ? 73.651 42.502  66.209  1.00 46.07  ? 206 SER A N   1 
ATOM   4698 C CA  . SER C 1 201 ? 74.446 42.707  65.002  1.00 48.09  ? 206 SER A CA  1 
ATOM   4699 C C   . SER C 1 201 ? 75.651 41.774  65.007  1.00 46.50  ? 206 SER A C   1 
ATOM   4700 O O   . SER C 1 201 ? 76.737 42.143  64.557  1.00 48.05  ? 206 SER A O   1 
ATOM   4701 C CB  . SER C 1 201 ? 74.915 44.160  64.926  1.00 49.46  ? 206 SER A CB  1 
ATOM   4702 O OG  . SER C 1 201 ? 73.813 45.049  64.970  1.00 54.35  ? 206 SER A OG  1 
ATOM   4703 N N   . THR C 1 202 ? 75.447 40.560  65.511  1.00 45.27  ? 207 THR A N   1 
ATOM   4704 C CA  . THR C 1 202 ? 76.513 39.570  65.602  1.00 44.10  ? 207 THR A CA  1 
ATOM   4705 C C   . THR C 1 202 ? 76.252 38.317  64.775  1.00 45.17  ? 207 THR A C   1 
ATOM   4706 O O   . THR C 1 202 ? 75.126 37.822  64.700  1.00 43.24  ? 207 THR A O   1 
ATOM   4707 C CB  . THR C 1 202 ? 76.728 39.121  67.069  1.00 44.02  ? 207 THR A CB  1 
ATOM   4708 O OG1 . THR C 1 202 ? 76.994 40.265  67.888  1.00 40.18  ? 207 THR A OG1 1 
ATOM   4709 C CG2 . THR C 1 202 ? 77.896 38.156  67.168  1.00 42.26  ? 207 THR A CG2 1 
ATOM   4710 N N   . THR C 1 203 ? 77.312 37.812  64.159  1.00 44.14  ? 208 THR A N   1 
ATOM   4711 C CA  . THR C 1 203 ? 77.240 36.594  63.368  1.00 47.35  ? 208 THR A CA  1 
ATOM   4712 C C   . THR C 1 203 ? 78.469 35.782  63.745  1.00 47.58  ? 208 THR A C   1 
ATOM   4713 O O   . THR C 1 203 ? 79.598 36.243  63.582  1.00 46.19  ? 208 THR A O   1 
ATOM   4714 C CB  . THR C 1 203 ? 77.270 36.884  61.862  1.00 46.96  ? 208 THR A CB  1 
ATOM   4715 O OG1 . THR C 1 203 ? 76.193 37.767  61.527  1.00 51.42  ? 208 THR A OG1 1 
ATOM   4716 C CG2 . THR C 1 203 ? 77.115 35.590  61.072  1.00 49.74  ? 208 THR A CG2 1 
ATOM   4717 N N   . VAL C 1 204 ? 78.247 34.583  64.268  1.00 47.56  ? 209 VAL A N   1 
ATOM   4718 C CA  . VAL C 1 204 ? 79.345 33.726  64.676  1.00 47.95  ? 209 VAL A CA  1 
ATOM   4719 C C   . VAL C 1 204 ? 79.374 32.457  63.840  1.00 52.37  ? 209 VAL A C   1 
ATOM   4720 O O   . VAL C 1 204 ? 78.366 31.758  63.716  1.00 52.00  ? 209 VAL A O   1 
ATOM   4721 C CB  . VAL C 1 204 ? 79.221 33.358  66.168  1.00 46.76  ? 209 VAL A CB  1 
ATOM   4722 C CG1 . VAL C 1 204 ? 80.372 32.459  66.589  1.00 45.77  ? 209 VAL A CG1 1 
ATOM   4723 C CG2 . VAL C 1 204 ? 79.199 34.627  67.003  1.00 44.38  ? 209 VAL A CG2 1 
ATOM   4724 N N   . ASP C 1 205 ? 80.534 32.176  63.255  1.00 55.38  ? 210 ASP A N   1 
ATOM   4725 C CA  . ASP C 1 205 ? 80.712 30.988  62.430  1.00 56.32  ? 210 ASP A CA  1 
ATOM   4726 C C   . ASP C 1 205 ? 81.671 30.034  63.131  1.00 57.16  ? 210 ASP A C   1 
ATOM   4727 O O   . ASP C 1 205 ? 82.806 30.401  63.447  1.00 53.91  ? 210 ASP A O   1 
ATOM   4728 C CB  . ASP C 1 205 ? 81.276 31.370  61.062  1.00 58.47  ? 210 ASP A CB  1 
ATOM   4729 C CG  . ASP C 1 205 ? 80.457 32.446  60.377  1.00 63.48  ? 210 ASP A CG  1 
ATOM   4730 O OD1 . ASP C 1 205 ? 79.237 32.247  60.203  1.00 63.68  ? 210 ASP A OD1 1 
ATOM   4731 O OD2 . ASP C 1 205 ? 81.035 33.491  60.012  1.00 66.05  ? 210 ASP A OD2 1 
ATOM   4732 N N   . LYS C 1 206 ? 81.207 28.812  63.373  1.00 56.63  ? 211 LYS A N   1 
ATOM   4733 C CA  . LYS C 1 206 ? 82.013 27.805  64.044  1.00 59.73  ? 211 LYS A CA  1 
ATOM   4734 C C   . LYS C 1 206 ? 82.219 26.592  63.138  1.00 62.98  ? 211 LYS A C   1 
ATOM   4735 O O   . LYS C 1 206 ? 81.261 25.900  62.787  1.00 63.70  ? 211 LYS A O   1 
ATOM   4736 C CB  . LYS C 1 206 ? 81.322 27.374  65.341  1.00 60.64  ? 211 LYS A CB  1 
ATOM   4737 C CG  . LYS C 1 206 ? 82.190 26.550  66.275  1.00 63.42  ? 211 LYS A CG  1 
ATOM   4738 C CD  . LYS C 1 206 ? 83.242 27.412  66.952  1.00 65.22  ? 211 LYS A CD  1 
ATOM   4739 C CE  . LYS C 1 206 ? 82.603 28.396  67.919  1.00 63.90  ? 211 LYS A CE  1 
ATOM   4740 N NZ  . LYS C 1 206 ? 83.616 29.240  68.611  1.00 65.61  ? 211 LYS A NZ  1 
ATOM   4741 N N   . LYS C 1 207 ? 83.468 26.340  62.753  1.00 65.02  ? 212 LYS A N   1 
ATOM   4742 C CA  . LYS C 1 207 ? 83.782 25.197  61.902  1.00 65.98  ? 212 LYS A CA  1 
ATOM   4743 C C   . LYS C 1 207 ? 84.094 24.001  62.789  1.00 65.20  ? 212 LYS A C   1 
ATOM   4744 O O   . LYS C 1 207 ? 85.071 24.009  63.535  1.00 66.49  ? 212 LYS A O   1 
ATOM   4745 C CB  . LYS C 1 207 ? 84.983 25.502  61.006  1.00 68.08  ? 212 LYS A CB  1 
ATOM   4746 C CG  . LYS C 1 207 ? 85.308 24.386  60.025  1.00 72.62  ? 212 LYS A CG  1 
ATOM   4747 C CD  . LYS C 1 207 ? 86.452 24.763  59.099  1.00 76.33  ? 212 LYS A CD  1 
ATOM   4748 C CE  . LYS C 1 207 ? 87.752 24.963  59.866  1.00 81.30  ? 212 LYS A CE  1 
ATOM   4749 N NZ  . LYS C 1 207 ? 88.187 23.723  60.566  1.00 83.12  ? 212 LYS A NZ  1 
ATOM   4750 N N   . LEU C 1 208 ? 83.252 22.977  62.712  1.00 65.48  ? 213 LEU A N   1 
ATOM   4751 C CA  . LEU C 1 208 ? 83.436 21.780  63.519  1.00 66.97  ? 213 LEU A CA  1 
ATOM   4752 C C   . LEU C 1 208 ? 84.763 21.100  63.202  1.00 69.00  ? 213 LEU A C   1 
ATOM   4753 O O   . LEU C 1 208 ? 84.976 20.613  62.089  1.00 66.22  ? 213 LEU A O   1 
ATOM   4754 C CB  . LEU C 1 208 ? 82.272 20.822  63.283  1.00 66.78  ? 213 LEU A CB  1 
ATOM   4755 C CG  . LEU C 1 208 ? 80.927 21.464  63.621  1.00 66.46  ? 213 LEU A CG  1 
ATOM   4756 C CD1 . LEU C 1 208 ? 79.795 20.563  63.171  1.00 67.32  ? 213 LEU A CD1 1 
ATOM   4757 C CD2 . LEU C 1 208 ? 80.863 21.739  65.119  1.00 66.90  ? 213 LEU A CD2 1 
ATOM   4758 N N   . GLU C 1 209 ? 85.650 21.076  64.195  1.00 70.34  ? 214 GLU A N   1 
ATOM   4759 C CA  . GLU C 1 209 ? 86.975 20.483  64.048  1.00 71.80  ? 214 GLU A CA  1 
ATOM   4760 C C   . GLU C 1 209 ? 87.687 20.997  62.800  1.00 72.94  ? 214 GLU A C   1 
ATOM   4761 O O   . GLU C 1 209 ? 88.014 20.169  61.924  1.00 76.23  ? 214 GLU A O   1 
ATOM   4762 C CB  . GLU C 1 209 ? 86.883 18.956  63.998  1.00 71.28  ? 214 GLU A CB  1 
ATOM   4763 C CG  . GLU C 1 209 ? 86.583 18.306  65.339  1.00 69.67  ? 214 GLU A CG  1 
ATOM   4764 C CD  . GLU C 1 209 ? 87.075 16.874  65.403  1.00 69.59  ? 214 GLU A CD  1 
ATOM   4765 O OE1 . GLU C 1 209 ? 86.894 16.227  66.455  1.00 70.31  ? 214 GLU A OE1 1 
ATOM   4766 O OE2 . GLU C 1 209 ? 87.648 16.396  64.400  1.00 70.73  ? 214 GLU A OE2 1 
ATOM   4767 O OXT . GLU C 1 209 ? 87.912 22.224  62.715  1.00 71.48  ? 214 GLU A OXT 1 
ATOM   4768 N N   . ASP D 2 1   ? 31.128 38.749  72.879  1.00 39.09  ? 1   ASP B N   1 
ATOM   4769 C CA  . ASP D 2 1   ? 32.099 38.297  71.842  1.00 33.97  ? 1   ASP B CA  1 
ATOM   4770 C C   . ASP D 2 1   ? 31.689 36.946  71.294  1.00 36.13  ? 1   ASP B C   1 
ATOM   4771 O O   . ASP D 2 1   ? 31.074 36.137  71.986  1.00 31.17  ? 1   ASP B O   1 
ATOM   4772 C CB  . ASP D 2 1   ? 33.498 38.185  72.434  1.00 33.80  ? 1   ASP B CB  1 
ATOM   4773 C CG  . ASP D 2 1   ? 34.029 39.514  72.919  1.00 37.82  ? 1   ASP B CG  1 
ATOM   4774 O OD1 . ASP D 2 1   ? 33.210 40.441  73.117  1.00 33.15  ? 1   ASP B OD1 1 
ATOM   4775 O OD2 . ASP D 2 1   ? 35.258 39.625  73.111  1.00 35.87  ? 1   ASP B OD2 1 
ATOM   4776 N N   . ILE D 2 2   ? 32.037 36.700  70.042  1.00 32.48  ? 2   ILE B N   1 
ATOM   4777 C CA  . ILE D 2 2   ? 31.703 35.436  69.425  1.00 28.49  ? 2   ILE B CA  1 
ATOM   4778 C C   . ILE D 2 2   ? 32.907 34.524  69.643  1.00 26.43  ? 2   ILE B C   1 
ATOM   4779 O O   . ILE D 2 2   ? 33.969 34.725  69.059  1.00 27.70  ? 2   ILE B O   1 
ATOM   4780 C CB  . ILE D 2 2   ? 31.408 35.631  67.919  1.00 31.88  ? 2   ILE B CB  1 
ATOM   4781 C CG1 . ILE D 2 2   ? 31.264 34.274  67.238  1.00 26.60  ? 2   ILE B CG1 1 
ATOM   4782 C CG2 . ILE D 2 2   ? 32.491 36.453  67.290  1.00 32.92  ? 2   ILE B CG2 1 
ATOM   4783 C CD1 . ILE D 2 2   ? 30.175 33.439  67.849  1.00 40.76  ? 2   ILE B CD1 1 
ATOM   4784 N N   . VAL D 2 3   ? 32.744 33.529  70.507  1.00 23.41  ? 3   VAL B N   1 
ATOM   4785 C CA  . VAL D 2 3   ? 33.833 32.608  70.816  1.00 22.69  ? 3   VAL B CA  1 
ATOM   4786 C C   . VAL D 2 3   ? 33.921 31.462  69.826  1.00 20.22  ? 3   VAL B C   1 
ATOM   4787 O O   . VAL D 2 3   ? 32.926 30.798  69.537  1.00 23.32  ? 3   VAL B O   1 
ATOM   4788 C CB  . VAL D 2 3   ? 33.685 32.018  72.236  1.00 26.02  ? 3   VAL B CB  1 
ATOM   4789 C CG1 . VAL D 2 3   ? 34.842 31.079  72.525  1.00 24.76  ? 3   VAL B CG1 1 
ATOM   4790 C CG2 . VAL D 2 3   ? 33.646 33.137  73.257  1.00 24.93  ? 3   VAL B CG2 1 
ATOM   4791 N N   . MET D 2 4   ? 35.128 31.245  69.313  1.00 21.47  ? 4   MET B N   1 
ATOM   4792 C CA  . MET D 2 4   ? 35.389 30.199  68.329  1.00 26.35  ? 4   MET B CA  1 
ATOM   4793 C C   . MET D 2 4   ? 36.112 29.055  69.020  1.00 24.02  ? 4   MET B C   1 
ATOM   4794 O O   . MET D 2 4   ? 37.183 29.249  69.598  1.00 23.14  ? 4   MET B O   1 
ATOM   4795 C CB  . MET D 2 4   ? 36.256 30.755  67.192  1.00 25.19  ? 4   MET B CB  1 
ATOM   4796 C CG  . MET D 2 4   ? 35.680 31.997  66.501  1.00 26.14  ? 4   MET B CG  1 
ATOM   4797 S SD  . MET D 2 4   ? 34.154 31.662  65.571  1.00 27.37  ? 4   MET B SD  1 
ATOM   4798 C CE  . MET D 2 4   ? 34.812 30.653  64.218  1.00 20.30  ? 4   MET B CE  1 
ATOM   4799 N N   . THR D 2 5   ? 35.539 27.859  68.937  1.00 25.49  ? 5   THR B N   1 
ATOM   4800 C CA  . THR D 2 5   ? 36.116 26.695  69.596  1.00 26.79  ? 5   THR B CA  1 
ATOM   4801 C C   . THR D 2 5   ? 36.551 25.552  68.678  1.00 25.51  ? 5   THR B C   1 
ATOM   4802 O O   . THR D 2 5   ? 35.775 25.071  67.859  1.00 26.12  ? 5   THR B O   1 
ATOM   4803 C CB  . THR D 2 5   ? 35.115 26.135  70.638  1.00 30.13  ? 5   THR B CB  1 
ATOM   4804 O OG1 . THR D 2 5   ? 34.797 27.157  71.591  1.00 29.71  ? 5   THR B OG1 1 
ATOM   4805 C CG2 . THR D 2 5   ? 35.708 24.939  71.378  1.00 36.43  ? 5   THR B CG2 1 
ATOM   4806 N N   . GLN D 2 6   ? 37.802 25.125  68.837  1.00 23.17  ? 6   GLN B N   1 
ATOM   4807 C CA  . GLN D 2 6   ? 38.370 24.011  68.076  1.00 27.90  ? 6   GLN B CA  1 
ATOM   4808 C C   . GLN D 2 6   ? 39.188 23.165  69.047  1.00 30.33  ? 6   GLN B C   1 
ATOM   4809 O O   . GLN D 2 6   ? 39.687 23.671  70.051  1.00 28.14  ? 6   GLN B O   1 
ATOM   4810 C CB  . GLN D 2 6   ? 39.368 24.460  67.009  1.00 23.99  ? 6   GLN B CB  1 
ATOM   4811 C CG  . GLN D 2 6   ? 39.118 25.745  66.273  1.00 27.54  ? 6   GLN B CG  1 
ATOM   4812 C CD  . GLN D 2 6   ? 40.284 26.042  65.356  1.00 24.53  ? 6   GLN B CD  1 
ATOM   4813 O OE1 . GLN D 2 6   ? 40.619 25.238  64.482  1.00 35.34  ? 6   GLN B OE1 1 
ATOM   4814 N NE2 . GLN D 2 6   ? 40.922 27.175  65.559  1.00 17.20  ? 6   GLN B NE2 1 
ATOM   4815 N N   . ALA D 2 7   ? 39.359 21.890  68.725  1.00 31.15  ? 7   ALA B N   1 
ATOM   4816 C CA  . ALA D 2 7   ? 40.165 21.002  69.560  1.00 32.88  ? 7   ALA B CA  1 
ATOM   4817 C C   . ALA D 2 7   ? 41.633 21.308  69.260  1.00 33.24  ? 7   ALA B C   1 
ATOM   4818 O O   . ALA D 2 7   ? 41.981 21.650  68.129  1.00 30.68  ? 7   ALA B O   1 
ATOM   4819 C CB  . ALA D 2 7   ? 39.852 19.545  69.230  1.00 33.48  ? 7   ALA B CB  1 
ATOM   4820 N N   . ALA D 2 8   ? 42.497 21.190  70.263  1.00 30.84  ? 8   ALA B N   1 
ATOM   4821 C CA  . ALA D 2 8   ? 43.915 21.470  70.065  1.00 30.40  ? 8   ALA B CA  1 
ATOM   4822 C C   . ALA D 2 8   ? 44.578 20.500  69.084  1.00 30.15  ? 8   ALA B C   1 
ATOM   4823 O O   . ALA D 2 8   ? 45.523 20.860  68.381  1.00 27.79  ? 8   ALA B O   1 
ATOM   4824 C CB  . ALA D 2 8   ? 44.641 21.440  71.410  1.00 33.51  ? 8   ALA B CB  1 
ATOM   4825 N N   . PHE D 2 9   ? 44.083 19.269  69.032  1.00 32.31  ? 9   PHE B N   1 
ATOM   4826 C CA  . PHE D 2 9   ? 44.652 18.282  68.126  1.00 35.82  ? 9   PHE B CA  1 
ATOM   4827 C C   . PHE D 2 9   ? 43.565 17.481  67.438  1.00 36.84  ? 9   PHE B C   1 
ATOM   4828 O O   . PHE D 2 9   ? 42.394 17.534  67.815  1.00 43.43  ? 9   PHE B O   1 
ATOM   4829 C CB  . PHE D 2 9   ? 45.563 17.298  68.872  1.00 39.33  ? 9   PHE B CB  1 
ATOM   4830 C CG  . PHE D 2 9   ? 46.645 17.951  69.683  1.00 40.23  ? 9   PHE B CG  1 
ATOM   4831 C CD1 . PHE D 2 9   ? 46.395 18.380  70.981  1.00 43.85  ? 9   PHE B CD1 1 
ATOM   4832 C CD2 . PHE D 2 9   ? 47.920 18.128  69.152  1.00 41.50  ? 9   PHE B CD2 1 
ATOM   4833 C CE1 . PHE D 2 9   ? 47.401 18.975  71.744  1.00 44.21  ? 9   PHE B CE1 1 
ATOM   4834 C CE2 . PHE D 2 9   ? 48.932 18.723  69.904  1.00 41.16  ? 9   PHE B CE2 1 
ATOM   4835 C CZ  . PHE D 2 9   ? 48.672 19.146  71.203  1.00 42.05  ? 9   PHE B CZ  1 
ATOM   4836 N N   . SER D 2 10  ? 43.973 16.751  66.410  1.00 38.74  ? 10  SER B N   1 
ATOM   4837 C CA  . SER D 2 10  ? 43.081 15.879  65.662  1.00 43.13  ? 10  SER B CA  1 
ATOM   4838 C C   . SER D 2 10  ? 43.867 14.575  65.599  1.00 41.03  ? 10  SER B C   1 
ATOM   4839 O O   . SER D 2 10  ? 45.080 14.580  65.806  1.00 41.81  ? 10  SER B O   1 
ATOM   4840 C CB  . SER D 2 10  ? 42.852 16.419  64.254  1.00 44.33  ? 10  SER B CB  1 
ATOM   4841 O OG  . SER D 2 10  ? 44.053 16.357  63.504  1.00 48.88  ? 10  SER B OG  1 
ATOM   4842 N N   . ASN D 2 11  ? 43.202 13.461  65.330  1.00 40.16  ? 11  ASN B N   1 
ATOM   4843 C CA  . ASN D 2 11  ? 43.920 12.197  65.268  1.00 42.44  ? 11  ASN B CA  1 
ATOM   4844 C C   . ASN D 2 11  ? 44.904 12.193  64.104  1.00 42.00  ? 11  ASN B C   1 
ATOM   4845 O O   . ASN D 2 11  ? 44.693 12.863  63.096  1.00 41.93  ? 11  ASN B O   1 
ATOM   4846 C CB  . ASN D 2 11  ? 42.936 11.036  65.123  1.00 43.67  ? 11  ASN B CB  1 
ATOM   4847 C CG  . ASN D 2 11  ? 41.966 10.959  66.278  1.00 46.91  ? 11  ASN B CG  1 
ATOM   4848 O OD1 . ASN D 2 11  ? 42.371 10.886  67.443  1.00 49.43  ? 11  ASN B OD1 1 
ATOM   4849 N ND2 . ASN D 2 11  ? 40.674 10.979  65.966  1.00 45.74  ? 11  ASN B ND2 1 
ATOM   4850 N N   . PRO D 2 12  ? 46.010 11.449  64.238  1.00 42.28  ? 12  PRO B N   1 
ATOM   4851 C CA  . PRO D 2 12  ? 46.981 11.410  63.143  1.00 41.23  ? 12  PRO B CA  1 
ATOM   4852 C C   . PRO D 2 12  ? 46.300 10.893  61.884  1.00 38.67  ? 12  PRO B C   1 
ATOM   4853 O O   . PRO D 2 12  ? 45.486 9.973   61.941  1.00 37.05  ? 12  PRO B O   1 
ATOM   4854 C CB  . PRO D 2 12  ? 48.060 10.465  63.669  1.00 42.11  ? 12  PRO B CB  1 
ATOM   4855 C CG  . PRO D 2 12  ? 47.315 9.589   64.630  1.00 46.78  ? 12  PRO B CG  1 
ATOM   4856 C CD  . PRO D 2 12  ? 46.426 10.571  65.342  1.00 44.52  ? 12  PRO B CD  1 
ATOM   4857 N N   . VAL D 2 13  ? 46.621 11.497  60.750  1.00 34.30  ? 13  VAL B N   1 
ATOM   4858 C CA  . VAL D 2 13  ? 46.006 11.095  59.500  1.00 31.40  ? 13  VAL B CA  1 
ATOM   4859 C C   . VAL D 2 13  ? 47.023 10.470  58.571  1.00 28.63  ? 13  VAL B C   1 
ATOM   4860 O O   . VAL D 2 13  ? 48.166 10.914  58.495  1.00 25.07  ? 13  VAL B O   1 
ATOM   4861 C CB  . VAL D 2 13  ? 45.336 12.299  58.799  1.00 34.54  ? 13  VAL B CB  1 
ATOM   4862 C CG1 . VAL D 2 13  ? 44.308 12.917  59.725  1.00 37.42  ? 13  VAL B CG1 1 
ATOM   4863 C CG2 . VAL D 2 13  ? 46.377 13.335  58.414  1.00 40.41  ? 13  VAL B CG2 1 
ATOM   4864 N N   . THR D 2 14  ? 46.594 9.423   57.874  1.00 30.97  ? 14  THR B N   1 
ATOM   4865 C CA  . THR D 2 14  ? 47.458 8.722   56.938  1.00 31.69  ? 14  THR B CA  1 
ATOM   4866 C C   . THR D 2 14  ? 47.603 9.535   55.664  1.00 32.28  ? 14  THR B C   1 
ATOM   4867 O O   . THR D 2 14  ? 46.619 10.089  55.165  1.00 33.75  ? 14  THR B O   1 
ATOM   4868 C CB  . THR D 2 14  ? 46.871 7.344   56.582  1.00 36.06  ? 14  THR B CB  1 
ATOM   4869 O OG1 . THR D 2 14  ? 46.704 6.575   57.783  1.00 39.69  ? 14  THR B OG1 1 
ATOM   4870 C CG2 . THR D 2 14  ? 47.787 6.603   55.615  1.00 39.91  ? 14  THR B CG2 1 
ATOM   4871 N N   . LEU D 2 15  ? 48.819 9.608   55.136  1.00 27.25  ? 15  LEU B N   1 
ATOM   4872 C CA  . LEU D 2 15  ? 49.051 10.353  53.913  1.00 33.04  ? 15  LEU B CA  1 
ATOM   4873 C C   . LEU D 2 15  ? 48.110 9.808   52.847  1.00 33.70  ? 15  LEU B C   1 
ATOM   4874 O O   . LEU D 2 15  ? 47.876 8.601   52.772  1.00 34.13  ? 15  LEU B O   1 
ATOM   4875 C CB  . LEU D 2 15  ? 50.510 10.201  53.467  1.00 36.52  ? 15  LEU B CB  1 
ATOM   4876 C CG  . LEU D 2 15  ? 51.533 10.913  54.359  1.00 35.50  ? 15  LEU B CG  1 
ATOM   4877 C CD1 . LEU D 2 15  ? 52.946 10.595  53.898  1.00 37.82  ? 15  LEU B CD1 1 
ATOM   4878 C CD2 . LEU D 2 15  ? 51.281 12.416  54.307  1.00 35.93  ? 15  LEU B CD2 1 
ATOM   4879 N N   . GLY D 2 16  ? 47.545 10.697  52.038  1.00 33.45  ? 16  GLY B N   1 
ATOM   4880 C CA  . GLY D 2 16  ? 46.649 10.254  50.988  1.00 27.97  ? 16  GLY B CA  1 
ATOM   4881 C C   . GLY D 2 16  ? 45.195 10.122  51.390  1.00 28.39  ? 16  GLY B C   1 
ATOM   4882 O O   . GLY D 2 16  ? 44.343 9.905   50.537  1.00 29.51  ? 16  GLY B O   1 
ATOM   4883 N N   . THR D 2 17  ? 44.896 10.237  52.680  1.00 26.63  ? 17  THR B N   1 
ATOM   4884 C CA  . THR D 2 17  ? 43.515 10.138  53.142  1.00 27.42  ? 17  THR B CA  1 
ATOM   4885 C C   . THR D 2 17  ? 43.006 11.517  53.566  1.00 27.47  ? 17  THR B C   1 
ATOM   4886 O O   . THR D 2 17  ? 43.760 12.487  53.585  1.00 26.73  ? 17  THR B O   1 
ATOM   4887 C CB  . THR D 2 17  ? 43.379 9.157   54.332  1.00 30.71  ? 17  THR B CB  1 
ATOM   4888 O OG1 . THR D 2 17  ? 44.093 9.669   55.462  1.00 36.07  ? 17  THR B OG1 1 
ATOM   4889 C CG2 . THR D 2 17  ? 43.944 7.783   53.955  1.00 32.41  ? 17  THR B CG2 1 
ATOM   4890 N N   . SER D 2 18  ? 41.725 11.603  53.904  1.00 23.73  ? 18  SER B N   1 
ATOM   4891 C CA  . SER D 2 18  ? 41.131 12.873  54.316  1.00 28.11  ? 18  SER B CA  1 
ATOM   4892 C C   . SER D 2 18  ? 41.239 13.213  55.802  1.00 27.87  ? 18  SER B C   1 
ATOM   4893 O O   . SER D 2 18  ? 41.165 12.343  56.663  1.00 28.20  ? 18  SER B O   1 
ATOM   4894 C CB  . SER D 2 18  ? 39.648 12.913  53.937  1.00 28.41  ? 18  SER B CB  1 
ATOM   4895 O OG  . SER D 2 18  ? 39.471 13.040  52.536  1.00 28.68  ? 18  SER B OG  1 
ATOM   4896 N N   . ALA D 2 19  ? 41.412 14.498  56.089  1.00 24.35  ? 19  ALA B N   1 
ATOM   4897 C CA  . ALA D 2 19  ? 41.471 14.972  57.465  1.00 24.23  ? 19  ALA B CA  1 
ATOM   4898 C C   . ALA D 2 19  ? 40.267 15.884  57.646  1.00 23.53  ? 19  ALA B C   1 
ATOM   4899 O O   . ALA D 2 19  ? 39.836 16.533  56.692  1.00 22.02  ? 19  ALA B O   1 
ATOM   4900 C CB  . ALA D 2 19  ? 42.765 15.755  57.709  1.00 26.01  ? 19  ALA B CB  1 
ATOM   4901 N N   . SER D 2 20  ? 39.716 15.926  58.858  1.00 20.88  ? 20  SER B N   1 
ATOM   4902 C CA  . SER D 2 20  ? 38.568 16.783  59.148  1.00 23.61  ? 20  SER B CA  1 
ATOM   4903 C C   . SER D 2 20  ? 38.882 17.601  60.396  1.00 28.31  ? 20  SER B C   1 
ATOM   4904 O O   . SER D 2 20  ? 39.264 17.040  61.422  1.00 24.56  ? 20  SER B O   1 
ATOM   4905 C CB  . SER D 2 20  ? 37.306 15.953  59.424  1.00 26.29  ? 20  SER B CB  1 
ATOM   4906 O OG  . SER D 2 20  ? 36.985 15.093  58.345  1.00 36.06  ? 20  SER B OG  1 
ATOM   4907 N N   . ILE D 2 21  ? 38.726 18.919  60.308  1.00 19.56  ? 21  ILE B N   1 
ATOM   4908 C CA  . ILE D 2 21  ? 38.971 19.788  61.456  1.00 26.88  ? 21  ILE B CA  1 
ATOM   4909 C C   . ILE D 2 21  ? 37.687 20.538  61.778  1.00 29.90  ? 21  ILE B C   1 
ATOM   4910 O O   . ILE D 2 21  ? 37.145 21.264  60.936  1.00 26.88  ? 21  ILE B O   1 
ATOM   4911 C CB  . ILE D 2 21  ? 40.109 20.787  61.176  1.00 22.70  ? 21  ILE B CB  1 
ATOM   4912 C CG1 . ILE D 2 21  ? 41.398 20.004  60.902  1.00 27.56  ? 21  ILE B CG1 1 
ATOM   4913 C CG2 . ILE D 2 21  ? 40.303 21.722  62.389  1.00 23.78  ? 21  ILE B CG2 1 
ATOM   4914 C CD1 . ILE D 2 21  ? 42.583 20.861  60.542  1.00 31.86  ? 21  ILE B CD1 1 
ATOM   4915 N N   . SER D 2 22  ? 37.201 20.364  63.001  1.00 26.45  ? 22  SER B N   1 
ATOM   4916 C CA  . SER D 2 22  ? 35.952 20.996  63.406  1.00 27.87  ? 22  SER B CA  1 
ATOM   4917 C C   . SER D 2 22  ? 36.149 22.334  64.095  1.00 27.82  ? 22  SER B C   1 
ATOM   4918 O O   . SER D 2 22  ? 37.234 22.660  64.583  1.00 31.53  ? 22  SER B O   1 
ATOM   4919 C CB  . SER D 2 22  ? 35.167 20.072  64.339  1.00 34.20  ? 22  SER B CB  1 
ATOM   4920 O OG  . SER D 2 22  ? 35.725 20.092  65.642  1.00 42.74  ? 22  SER B OG  1 
ATOM   4921 N N   . CYS D 2 23  ? 35.079 23.111  64.125  1.00 25.57  ? 23  CYS B N   1 
ATOM   4922 C CA  . CYS D 2 23  ? 35.095 24.415  64.758  1.00 25.09  ? 23  CYS B CA  1 
ATOM   4923 C C   . CYS D 2 23  ? 33.659 24.807  65.000  1.00 26.62  ? 23  CYS B C   1 
ATOM   4924 O O   . CYS D 2 23  ? 32.774 24.463  64.212  1.00 26.20  ? 23  CYS B O   1 
ATOM   4925 C CB  . CYS D 2 23  ? 35.767 25.424  63.839  1.00 29.89  ? 23  CYS B CB  1 
ATOM   4926 S SG  . CYS D 2 23  ? 35.605 27.194  64.259  1.00 40.85  ? 23  CYS B SG  1 
ATOM   4927 N N   . ARG D 2 24  ? 33.416 25.487  66.112  1.00 25.57  ? 24  ARG B N   1 
ATOM   4928 C CA  . ARG D 2 24  ? 32.074 25.942  66.416  1.00 26.68  ? 24  ARG B CA  1 
ATOM   4929 C C   . ARG D 2 24  ? 32.114 27.357  66.949  1.00 25.92  ? 24  ARG B C   1 
ATOM   4930 O O   . ARG D 2 24  ? 33.107 27.792  67.530  1.00 29.25  ? 24  ARG B O   1 
ATOM   4931 C CB  . ARG D 2 24  ? 31.354 25.000  67.386  1.00 29.02  ? 24  ARG B CB  1 
ATOM   4932 C CG  . ARG D 2 24  ? 31.908 24.926  68.784  1.00 38.28  ? 24  ARG B CG  1 
ATOM   4933 C CD  . ARG D 2 24  ? 30.883 24.253  69.704  1.00 45.64  ? 24  ARG B CD  1 
ATOM   4934 N NE  . ARG D 2 24  ? 31.378 24.086  71.068  1.00 48.89  ? 24  ARG B NE  1 
ATOM   4935 C CZ  . ARG D 2 24  ? 32.259 23.163  71.436  1.00 52.74  ? 24  ARG B CZ  1 
ATOM   4936 N NH1 . ARG D 2 24  ? 32.742 22.311  70.541  1.00 53.46  ? 24  ARG B NH1 1 
ATOM   4937 N NH2 . ARG D 2 24  ? 32.670 23.100  72.697  1.00 56.35  ? 24  ARG B NH2 1 
ATOM   4938 N N   . SER D 2 25  ? 31.022 28.071  66.723  1.00 25.07  ? 25  SER B N   1 
ATOM   4939 C CA  . SER D 2 25  ? 30.882 29.458  67.122  1.00 27.67  ? 25  SER B CA  1 
ATOM   4940 C C   . SER D 2 25  ? 29.727 29.575  68.116  1.00 26.10  ? 25  SER B C   1 
ATOM   4941 O O   . SER D 2 25  ? 28.801 28.775  68.076  1.00 28.04  ? 25  SER B O   1 
ATOM   4942 C CB  . SER D 2 25  ? 30.581 30.275  65.867  1.00 25.04  ? 25  SER B CB  1 
ATOM   4943 O OG  . SER D 2 25  ? 30.865 31.644  66.046  1.00 43.10  ? 25  SER B OG  1 
ATOM   4944 N N   . THR D 2 26  ? 29.780 30.563  69.007  1.00 26.69  ? 26  THR B N   1 
ATOM   4945 C CA  . THR D 2 26  ? 28.698 30.761  69.973  1.00 27.61  ? 26  THR B CA  1 
ATOM   4946 C C   . THR D 2 26  ? 27.524 31.504  69.328  1.00 31.18  ? 26  THR B C   1 
ATOM   4947 O O   . THR D 2 26  ? 26.448 31.612  69.908  1.00 31.89  ? 26  THR B O   1 
ATOM   4948 C CB  . THR D 2 26  ? 29.172 31.571  71.204  1.00 30.14  ? 26  THR B CB  1 
ATOM   4949 O OG1 . THR D 2 26  ? 29.863 32.748  70.771  1.00 25.50  ? 26  THR B OG1 1 
ATOM   4950 C CG2 . THR D 2 26  ? 30.098 30.738  72.067  1.00 30.20  ? 26  THR B CG2 1 
ATOM   4951 N N   . LYS D 2 27  ? 27.740 32.009  68.116  1.00 31.22  ? 27  LYS B N   1 
ATOM   4952 C CA  . LYS D 2 27  ? 26.710 32.752  67.396  1.00 28.86  ? 27  LYS B CA  1 
ATOM   4953 C C   . LYS D 2 27  ? 26.785 32.411  65.916  1.00 29.21  ? 27  LYS B C   1 
ATOM   4954 O O   . LYS D 2 27  ? 27.870 32.205  65.379  1.00 27.00  ? 27  LYS B O   1 
ATOM   4955 C CB  . LYS D 2 27  ? 26.929 34.260  67.584  1.00 33.98  ? 27  LYS B CB  1 
ATOM   4956 C CG  . LYS D 2 27  ? 25.931 35.142  66.845  1.00 36.87  ? 27  LYS B CG  1 
ATOM   4957 C CD  . LYS D 2 27  ? 26.227 36.620  67.059  1.00 35.27  ? 27  LYS B CD  1 
ATOM   4958 C CE  . LYS D 2 27  ? 25.215 37.485  66.321  1.00 41.74  ? 27  LYS B CE  1 
ATOM   4959 N NZ  . LYS D 2 27  ? 25.437 38.937  66.552  1.00 43.15  ? 27  LYS B NZ  1 
ATOM   4960 N N   . SER D 2 28  ? 25.636 32.346  65.255  1.00 30.05  ? 28  SER B N   1 
ATOM   4961 C CA  . SER D 2 28  ? 25.631 32.045  63.831  1.00 29.28  ? 28  SER B CA  1 
ATOM   4962 C C   . SER D 2 28  ? 26.453 33.075  63.072  1.00 26.30  ? 28  SER B C   1 
ATOM   4963 O O   . SER D 2 28  ? 26.391 34.271  63.356  1.00 24.10  ? 28  SER B O   1 
ATOM   4964 C CB  . SER D 2 28  ? 24.207 32.041  63.277  1.00 26.25  ? 28  SER B CB  1 
ATOM   4965 O OG  . SER D 2 28  ? 24.233 31.846  61.873  1.00 24.07  ? 28  SER B OG  1 
ATOM   4966 N N   . LEU D 2 29  ? 27.222 32.600  62.100  1.00 24.13  ? 29  LEU B N   1 
ATOM   4967 C CA  . LEU D 2 29  ? 28.049 33.482  61.284  1.00 24.75  ? 29  LEU B CA  1 
ATOM   4968 C C   . LEU D 2 29  ? 27.341 33.796  59.960  1.00 24.42  ? 29  LEU B C   1 
ATOM   4969 O O   . LEU D 2 29  ? 27.902 34.470  59.084  1.00 22.15  ? 29  LEU B O   1 
ATOM   4970 C CB  . LEU D 2 29  ? 29.404 32.817  61.037  1.00 20.21  ? 29  LEU B CB  1 
ATOM   4971 C CG  . LEU D 2 29  ? 30.569 33.125  61.999  1.00 29.26  ? 29  LEU B CG  1 
ATOM   4972 C CD1 . LEU D 2 29  ? 30.076 33.416  63.403  1.00 26.87  ? 29  LEU B CD1 1 
ATOM   4973 C CD2 . LEU D 2 29  ? 31.543 31.965  61.986  1.00 22.01  ? 29  LEU B CD2 1 
ATOM   4974 N N   . LEU D 2 30  ? 26.114 33.295  59.825  1.00 23.13  ? 30  LEU B N   1 
ATOM   4975 C CA  . LEU D 2 30  ? 25.308 33.521  58.624  1.00 26.37  ? 30  LEU B CA  1 
ATOM   4976 C C   . LEU D 2 30  ? 24.749 34.933  58.662  1.00 27.07  ? 30  LEU B C   1 
ATOM   4977 O O   . LEU D 2 30  ? 23.961 35.263  59.540  1.00 26.50  ? 30  LEU B O   1 
ATOM   4978 C CB  . LEU D 2 30  ? 24.145 32.524  58.542  1.00 26.21  ? 30  LEU B CB  1 
ATOM   4979 C CG  . LEU D 2 30  ? 23.071 32.865  57.495  1.00 26.70  ? 30  LEU B CG  1 
ATOM   4980 C CD1 . LEU D 2 30  ? 23.709 32.951  56.109  1.00 29.18  ? 30  LEU B CD1 1 
ATOM   4981 C CD2 . LEU D 2 30  ? 21.980 31.815  57.505  1.00 30.80  ? 30  LEU B CD2 1 
ATOM   4982 N N   . HIS D 2 31  ? 25.161 35.758  57.705  1.00 21.30  ? 31  HIS B N   1 
ATOM   4983 C CA  . HIS D 2 31  ? 24.707 37.137  57.643  1.00 24.86  ? 31  HIS B CA  1 
ATOM   4984 C C   . HIS D 2 31  ? 23.397 37.245  56.868  1.00 28.34  ? 31  HIS B C   1 
ATOM   4985 O O   . HIS D 2 31  ? 23.009 36.323  56.135  1.00 23.13  ? 31  HIS B O   1 
ATOM   4986 C CB  . HIS D 2 31  ? 25.788 38.003  56.983  1.00 24.81  ? 31  HIS B CB  1 
ATOM   4987 C CG  . HIS D 2 31  ? 25.487 39.466  56.990  1.00 29.67  ? 31  HIS B CG  1 
ATOM   4988 N ND1 . HIS D 2 31  ? 24.532 40.035  56.174  1.00 34.91  ? 31  HIS B ND1 1 
ATOM   4989 C CD2 . HIS D 2 31  ? 26.022 40.481  57.707  1.00 34.65  ? 31  HIS B CD2 1 
ATOM   4990 C CE1 . HIS D 2 31  ? 24.492 41.338  56.389  1.00 38.31  ? 31  HIS B CE1 1 
ATOM   4991 N NE2 . HIS D 2 31  ? 25.387 41.635  57.315  1.00 36.89  ? 31  HIS B NE2 1 
ATOM   4992 N N   . SER D 2 32  ? 22.717 38.371  57.049  1.00 30.44  ? 32  SER B N   1 
ATOM   4993 C CA  . SER D 2 32  ? 21.459 38.639  56.369  1.00 34.06  ? 32  SER B CA  1 
ATOM   4994 C C   . SER D 2 32  ? 21.614 38.618  54.844  1.00 30.66  ? 32  SER B C   1 
ATOM   4995 O O   . SER D 2 32  ? 20.653 38.345  54.129  1.00 32.19  ? 32  SER B O   1 
ATOM   4996 C CB  . SER D 2 32  ? 20.910 40.005  56.804  1.00 26.35  ? 32  SER B CB  1 
ATOM   4997 O OG  . SER D 2 32  ? 19.654 40.242  56.201  1.00 49.22  ? 32  SER B OG  1 
ATOM   4998 N N   . ASN D 2 33  ? 22.810 38.913  54.345  1.00 29.73  ? 33  ASN B N   1 
ATOM   4999 C CA  . ASN D 2 33  ? 23.029 38.918  52.899  1.00 28.14  ? 33  ASN B CA  1 
ATOM   5000 C C   . ASN D 2 33  ? 23.236 37.516  52.314  1.00 29.29  ? 33  ASN B C   1 
ATOM   5001 O O   . ASN D 2 33  ? 23.483 37.368  51.117  1.00 27.85  ? 33  ASN B O   1 
ATOM   5002 C CB  . ASN D 2 33  ? 24.229 39.801  52.530  1.00 31.20  ? 33  ASN B CB  1 
ATOM   5003 C CG  . ASN D 2 33  ? 25.514 39.358  53.197  1.00 31.52  ? 33  ASN B CG  1 
ATOM   5004 O OD1 . ASN D 2 33  ? 25.612 38.238  53.711  1.00 20.17  ? 33  ASN B OD1 1 
ATOM   5005 N ND2 . ASN D 2 33  ? 26.516 40.236  53.185  1.00 31.64  ? 33  ASN B ND2 1 
ATOM   5006 N N   . GLY D 2 34  ? 23.143 36.492  53.156  1.00 25.68  ? 34  GLY B N   1 
ATOM   5007 C CA  . GLY D 2 34  ? 23.316 35.129  52.679  1.00 23.43  ? 34  GLY B CA  1 
ATOM   5008 C C   . GLY D 2 34  ? 24.738 34.597  52.756  1.00 25.96  ? 34  GLY B C   1 
ATOM   5009 O O   . GLY D 2 34  ? 24.993 33.423  52.463  1.00 19.24  ? 34  GLY B O   1 
ATOM   5010 N N   . ILE D 2 35  ? 25.673 35.452  53.150  1.00 18.88  ? 35  ILE B N   1 
ATOM   5011 C CA  . ILE D 2 35  ? 27.065 35.043  53.255  1.00 22.60  ? 35  ILE B CA  1 
ATOM   5012 C C   . ILE D 2 35  ? 27.375 34.666  54.708  1.00 21.84  ? 35  ILE B C   1 
ATOM   5013 O O   . ILE D 2 35  ? 26.867 35.295  55.638  1.00 18.63  ? 35  ILE B O   1 
ATOM   5014 C CB  . ILE D 2 35  ? 28.001 36.191  52.786  1.00 20.62  ? 35  ILE B CB  1 
ATOM   5015 C CG1 . ILE D 2 35  ? 27.735 36.484  51.299  1.00 28.54  ? 35  ILE B CG1 1 
ATOM   5016 C CG2 . ILE D 2 35  ? 29.463 35.816  53.007  1.00 17.56  ? 35  ILE B CG2 1 
ATOM   5017 C CD1 . ILE D 2 35  ? 28.550 37.638  50.729  1.00 22.07  ? 35  ILE B CD1 1 
ATOM   5018 N N   . THR D 2 36  ? 28.170 33.614  54.888  1.00 21.11  ? 36  THR B N   1 
ATOM   5019 C CA  . THR D 2 36  ? 28.566 33.156  56.222  1.00 22.41  ? 36  THR B CA  1 
ATOM   5020 C C   . THR D 2 36  ? 30.011 33.604  56.421  1.00 18.23  ? 36  THR B C   1 
ATOM   5021 O O   . THR D 2 36  ? 30.919 33.154  55.731  1.00 19.38  ? 36  THR B O   1 
ATOM   5022 C CB  . THR D 2 36  ? 28.448 31.632  56.341  1.00 21.29  ? 36  THR B CB  1 
ATOM   5023 O OG1 . THR D 2 36  ? 27.070 31.271  56.213  1.00 18.90  ? 36  THR B OG1 1 
ATOM   5024 C CG2 . THR D 2 36  ? 28.951 31.146  57.712  1.00 23.57  ? 36  THR B CG2 1 
ATOM   5025 N N   . TYR D 2 37  ? 30.205 34.516  57.362  1.00 20.32  ? 37  TYR B N   1 
ATOM   5026 C CA  . TYR D 2 37  ? 31.518 35.085  57.601  1.00 17.79  ? 37  TYR B CA  1 
ATOM   5027 C C   . TYR D 2 37  ? 32.473 34.303  58.483  1.00 20.38  ? 37  TYR B C   1 
ATOM   5028 O O   . TYR D 2 37  ? 32.833 34.724  59.587  1.00 14.79  ? 37  TYR B O   1 
ATOM   5029 C CB  . TYR D 2 37  ? 31.346 36.523  58.085  1.00 24.23  ? 37  TYR B CB  1 
ATOM   5030 C CG  . TYR D 2 37  ? 30.832 37.402  56.967  1.00 21.30  ? 37  TYR B CG  1 
ATOM   5031 C CD1 . TYR D 2 37  ? 29.467 37.563  56.753  1.00 24.50  ? 37  TYR B CD1 1 
ATOM   5032 C CD2 . TYR D 2 37  ? 31.714 37.983  56.057  1.00 26.95  ? 37  TYR B CD2 1 
ATOM   5033 C CE1 . TYR D 2 37  ? 28.988 38.284  55.649  1.00 27.21  ? 37  TYR B CE1 1 
ATOM   5034 C CE2 . TYR D 2 37  ? 31.250 38.699  54.949  1.00 23.59  ? 37  TYR B CE2 1 
ATOM   5035 C CZ  . TYR D 2 37  ? 29.888 38.843  54.753  1.00 26.10  ? 37  TYR B CZ  1 
ATOM   5036 O OH  . TYR D 2 37  ? 29.421 39.537  53.656  1.00 27.50  ? 37  TYR B OH  1 
ATOM   5037 N N   . LEU D 2 38  ? 32.887 33.162  57.941  1.00 14.60  ? 38  LEU B N   1 
ATOM   5038 C CA  . LEU D 2 38  ? 33.828 32.247  58.575  1.00 16.28  ? 38  LEU B CA  1 
ATOM   5039 C C   . LEU D 2 38  ? 35.043 32.149  57.677  1.00 18.98  ? 38  LEU B C   1 
ATOM   5040 O O   . LEU D 2 38  ? 34.898 32.027  56.458  1.00 21.74  ? 38  LEU B O   1 
ATOM   5041 C CB  . LEU D 2 38  ? 33.214 30.843  58.686  1.00 12.39  ? 38  LEU B CB  1 
ATOM   5042 C CG  . LEU D 2 38  ? 34.231 29.765  59.049  1.00 15.32  ? 38  LEU B CG  1 
ATOM   5043 C CD1 . LEU D 2 38  ? 34.458 29.826  60.558  1.00 16.93  ? 38  LEU B CD1 1 
ATOM   5044 C CD2 . LEU D 2 38  ? 33.720 28.380  58.640  1.00 20.47  ? 38  LEU B CD2 1 
ATOM   5045 N N   . TYR D 2 39  ? 36.243 32.230  58.242  1.00 13.72  ? 39  TYR B N   1 
ATOM   5046 C CA  . TYR D 2 39  ? 37.422 32.044  57.418  1.00 19.96  ? 39  TYR B CA  1 
ATOM   5047 C C   . TYR D 2 39  ? 38.386 31.096  58.130  1.00 21.00  ? 39  TYR B C   1 
ATOM   5048 O O   . TYR D 2 39  ? 38.318 30.921  59.346  1.00 18.40  ? 39  TYR B O   1 
ATOM   5049 C CB  . TYR D 2 39  ? 38.080 33.389  57.036  1.00 19.38  ? 39  TYR B CB  1 
ATOM   5050 C CG  . TYR D 2 39  ? 38.712 34.193  58.155  1.00 20.79  ? 39  TYR B CG  1 
ATOM   5051 C CD1 . TYR D 2 39  ? 40.078 34.119  58.403  1.00 24.00  ? 39  TYR B CD1 1 
ATOM   5052 C CD2 . TYR D 2 39  ? 37.940 35.043  58.953  1.00 16.38  ? 39  TYR B CD2 1 
ATOM   5053 C CE1 . TYR D 2 39  ? 40.672 34.877  59.431  1.00 22.82  ? 39  TYR B CE1 1 
ATOM   5054 C CE2 . TYR D 2 39  ? 38.522 35.799  59.983  1.00 18.29  ? 39  TYR B CE2 1 
ATOM   5055 C CZ  . TYR D 2 39  ? 39.884 35.707  60.215  1.00 23.26  ? 39  TYR B CZ  1 
ATOM   5056 O OH  . TYR D 2 39  ? 40.455 36.419  61.255  1.00 23.30  ? 39  TYR B OH  1 
ATOM   5057 N N   . TRP D 2 40  ? 39.238 30.443  57.354  1.00 19.15  ? 40  TRP B N   1 
ATOM   5058 C CA  . TRP D 2 40  ? 40.206 29.497  57.891  1.00 21.17  ? 40  TRP B CA  1 
ATOM   5059 C C   . TRP D 2 40  ? 41.579 29.921  57.416  1.00 23.62  ? 40  TRP B C   1 
ATOM   5060 O O   . TRP D 2 40  ? 41.734 30.362  56.274  1.00 21.26  ? 40  TRP B O   1 
ATOM   5061 C CB  . TRP D 2 40  ? 39.959 28.074  57.357  1.00 21.05  ? 40  TRP B CB  1 
ATOM   5062 C CG  . TRP D 2 40  ? 38.702 27.388  57.807  1.00 21.77  ? 40  TRP B CG  1 
ATOM   5063 C CD1 . TRP D 2 40  ? 37.472 27.442  57.209  1.00 24.06  ? 40  TRP B CD1 1 
ATOM   5064 C CD2 . TRP D 2 40  ? 38.567 26.490  58.920  1.00 21.52  ? 40  TRP B CD2 1 
ATOM   5065 N NE1 . TRP D 2 40  ? 36.582 26.625  57.876  1.00 24.51  ? 40  TRP B NE1 1 
ATOM   5066 C CE2 . TRP D 2 40  ? 37.229 26.032  58.930  1.00 24.60  ? 40  TRP B CE2 1 
ATOM   5067 C CE3 . TRP D 2 40  ? 39.450 26.026  59.907  1.00 25.06  ? 40  TRP B CE3 1 
ATOM   5068 C CZ2 . TRP D 2 40  ? 36.749 25.127  59.892  1.00 24.80  ? 40  TRP B CZ2 1 
ATOM   5069 C CZ3 . TRP D 2 40  ? 38.970 25.120  60.866  1.00 22.38  ? 40  TRP B CZ3 1 
ATOM   5070 C CH2 . TRP D 2 40  ? 37.633 24.684  60.845  1.00 23.86  ? 40  TRP B CH2 1 
ATOM   5071 N N   . TYR D 2 41  ? 42.574 29.802  58.286  1.00 20.46  ? 41  TYR B N   1 
ATOM   5072 C CA  . TYR D 2 41  ? 43.936 30.123  57.897  1.00 17.15  ? 41  TYR B CA  1 
ATOM   5073 C C   . TYR D 2 41  ? 44.880 29.097  58.509  1.00 19.55  ? 41  TYR B C   1 
ATOM   5074 O O   . TYR D 2 41  ? 44.533 28.409  59.468  1.00 22.20  ? 41  TYR B O   1 
ATOM   5075 C CB  . TYR D 2 41  ? 44.321 31.558  58.282  1.00 21.63  ? 41  TYR B CB  1 
ATOM   5076 C CG  . TYR D 2 41  ? 44.306 31.881  59.753  1.00 22.23  ? 41  TYR B CG  1 
ATOM   5077 C CD1 . TYR D 2 41  ? 45.439 31.682  60.545  1.00 25.04  ? 41  TYR B CD1 1 
ATOM   5078 C CD2 . TYR D 2 41  ? 43.177 32.436  60.342  1.00 24.92  ? 41  TYR B CD2 1 
ATOM   5079 C CE1 . TYR D 2 41  ? 45.441 32.039  61.896  1.00 28.27  ? 41  TYR B CE1 1 
ATOM   5080 C CE2 . TYR D 2 41  ? 43.165 32.791  61.685  1.00 28.87  ? 41  TYR B CE2 1 
ATOM   5081 C CZ  . TYR D 2 41  ? 44.298 32.591  62.454  1.00 27.54  ? 41  TYR B CZ  1 
ATOM   5082 O OH  . TYR D 2 41  ? 44.271 32.948  63.775  1.00 30.66  ? 41  TYR B OH  1 
ATOM   5083 N N   . LEU D 2 42  ? 46.062 28.984  57.922  1.00 19.74  ? 42  LEU B N   1 
ATOM   5084 C CA  . LEU D 2 42  ? 47.051 28.009  58.352  1.00 24.54  ? 42  LEU B CA  1 
ATOM   5085 C C   . LEU D 2 42  ? 48.359 28.640  58.807  1.00 25.42  ? 42  LEU B C   1 
ATOM   5086 O O   . LEU D 2 42  ? 48.851 29.586  58.197  1.00 24.42  ? 42  LEU B O   1 
ATOM   5087 C CB  . LEU D 2 42  ? 47.333 27.048  57.196  1.00 22.47  ? 42  LEU B CB  1 
ATOM   5088 C CG  . LEU D 2 42  ? 48.556 26.125  57.266  1.00 32.92  ? 42  LEU B CG  1 
ATOM   5089 C CD1 . LEU D 2 42  ? 48.433 25.163  58.448  1.00 33.26  ? 42  LEU B CD1 1 
ATOM   5090 C CD2 . LEU D 2 42  ? 48.664 25.349  55.954  1.00 29.23  ? 42  LEU B CD2 1 
ATOM   5091 N N   . GLN D 2 43  ? 48.920 28.094  59.878  1.00 28.09  ? 43  GLN B N   1 
ATOM   5092 C CA  . GLN D 2 43  ? 50.181 28.587  60.401  1.00 31.53  ? 43  GLN B CA  1 
ATOM   5093 C C   . GLN D 2 43  ? 51.163 27.432  60.469  1.00 28.50  ? 43  GLN B C   1 
ATOM   5094 O O   . GLN D 2 43  ? 50.950 26.473  61.215  1.00 28.24  ? 43  GLN B O   1 
ATOM   5095 C CB  . GLN D 2 43  ? 49.991 29.180  61.797  1.00 31.59  ? 43  GLN B CB  1 
ATOM   5096 C CG  . GLN D 2 43  ? 51.287 29.642  62.445  1.00 45.21  ? 43  GLN B CG  1 
ATOM   5097 C CD  . GLN D 2 43  ? 51.380 31.149  62.558  1.00 46.63  ? 43  GLN B CD  1 
ATOM   5098 O OE1 . GLN D 2 43  ? 50.538 31.782  63.193  1.00 49.44  ? 43  GLN B OE1 1 
ATOM   5099 N NE2 . GLN D 2 43  ? 52.404 31.731  61.945  1.00 46.02  ? 43  GLN B NE2 1 
ATOM   5100 N N   . LYS D 2 44  ? 52.215 27.518  59.663  1.00 33.15  ? 44  LYS B N   1 
ATOM   5101 C CA  . LYS D 2 44  ? 53.263 26.503  59.635  1.00 41.15  ? 44  LYS B CA  1 
ATOM   5102 C C   . LYS D 2 44  ? 54.470 27.075  60.374  1.00 44.30  ? 44  LYS B C   1 
ATOM   5103 O O   . LYS D 2 44  ? 54.689 28.288  60.375  1.00 46.69  ? 44  LYS B O   1 
ATOM   5104 C CB  . LYS D 2 44  ? 53.657 26.170  58.191  1.00 40.33  ? 44  LYS B CB  1 
ATOM   5105 C CG  . LYS D 2 44  ? 52.561 25.503  57.374  1.00 41.14  ? 44  LYS B CG  1 
ATOM   5106 C CD  . LYS D 2 44  ? 53.052 25.141  55.981  1.00 46.78  ? 44  LYS B CD  1 
ATOM   5107 C CE  . LYS D 2 44  ? 51.937 24.530  55.141  1.00 50.57  ? 44  LYS B CE  1 
ATOM   5108 N NZ  . LYS D 2 44  ? 52.401 24.104  53.790  1.00 47.91  ? 44  LYS B NZ  1 
ATOM   5109 N N   . PRO D 2 45  ? 55.274 26.212  61.014  1.00 51.17  ? 45  PRO B N   1 
ATOM   5110 C CA  . PRO D 2 45  ? 56.447 26.706  61.742  1.00 50.93  ? 45  PRO B CA  1 
ATOM   5111 C C   . PRO D 2 45  ? 57.379 27.553  60.878  1.00 52.35  ? 45  PRO B C   1 
ATOM   5112 O O   . PRO D 2 45  ? 57.797 27.129  59.799  1.00 52.76  ? 45  PRO B O   1 
ATOM   5113 C CB  . PRO D 2 45  ? 57.113 25.421  62.228  1.00 52.46  ? 45  PRO B CB  1 
ATOM   5114 C CG  . PRO D 2 45  ? 56.756 24.436  61.159  1.00 52.79  ? 45  PRO B CG  1 
ATOM   5115 C CD  . PRO D 2 45  ? 55.294 24.742  60.927  1.00 50.55  ? 45  PRO B CD  1 
ATOM   5116 N N   . GLY D 2 46  ? 57.685 28.757  61.355  1.00 53.56  ? 46  GLY B N   1 
ATOM   5117 C CA  . GLY D 2 46  ? 58.576 29.644  60.628  1.00 55.07  ? 46  GLY B CA  1 
ATOM   5118 C C   . GLY D 2 46  ? 57.954 30.364  59.449  1.00 56.03  ? 46  GLY B C   1 
ATOM   5119 O O   . GLY D 2 46  ? 58.667 30.864  58.578  1.00 59.54  ? 46  GLY B O   1 
ATOM   5120 N N   . GLN D 2 47  ? 56.626 30.417  59.410  1.00 54.13  ? 47  GLN B N   1 
ATOM   5121 C CA  . GLN D 2 47  ? 55.925 31.096  58.328  1.00 49.35  ? 47  GLN B CA  1 
ATOM   5122 C C   . GLN D 2 47  ? 54.789 31.949  58.867  1.00 43.25  ? 47  GLN B C   1 
ATOM   5123 O O   . GLN D 2 47  ? 54.268 31.690  59.949  1.00 43.71  ? 47  GLN B O   1 
ATOM   5124 C CB  . GLN D 2 47  ? 55.364 30.083  57.331  1.00 53.66  ? 47  GLN B CB  1 
ATOM   5125 C CG  . GLN D 2 47  ? 56.414 29.319  56.554  1.00 61.80  ? 47  GLN B CG  1 
ATOM   5126 C CD  . GLN D 2 47  ? 55.837 28.662  55.319  1.00 66.31  ? 47  GLN B CD  1 
ATOM   5127 O OE1 . GLN D 2 47  ? 54.946 27.817  55.409  1.00 69.20  ? 47  GLN B OE1 1 
ATOM   5128 N NE2 . GLN D 2 47  ? 56.337 29.055  54.152  1.00 68.28  ? 47  GLN B NE2 1 
ATOM   5129 N N   . SER D 2 48  ? 54.410 32.974  58.111  1.00 40.44  ? 48  SER B N   1 
ATOM   5130 C CA  . SER D 2 48  ? 53.323 33.851  58.524  1.00 37.71  ? 48  SER B CA  1 
ATOM   5131 C C   . SER D 2 48  ? 52.000 33.136  58.255  1.00 32.73  ? 48  SER B C   1 
ATOM   5132 O O   . SER D 2 48  ? 51.941 32.215  57.441  1.00 31.23  ? 48  SER B O   1 
ATOM   5133 C CB  . SER D 2 48  ? 53.378 35.168  57.742  1.00 39.33  ? 48  SER B CB  1 
ATOM   5134 O OG  . SER D 2 48  ? 53.340 34.942  56.345  1.00 44.92  ? 48  SER B OG  1 
ATOM   5135 N N   . PRO D 2 49  ? 50.929 33.535  58.952  1.00 29.45  ? 49  PRO B N   1 
ATOM   5136 C CA  . PRO D 2 49  ? 49.622 32.899  58.748  1.00 26.43  ? 49  PRO B CA  1 
ATOM   5137 C C   . PRO D 2 49  ? 49.224 32.980  57.278  1.00 24.82  ? 49  PRO B C   1 
ATOM   5138 O O   . PRO D 2 49  ? 49.473 33.986  56.624  1.00 25.13  ? 49  PRO B O   1 
ATOM   5139 C CB  . PRO D 2 49  ? 48.699 33.716  59.646  1.00 27.44  ? 49  PRO B CB  1 
ATOM   5140 C CG  . PRO D 2 49  ? 49.606 34.126  60.768  1.00 27.35  ? 49  PRO B CG  1 
ATOM   5141 C CD  . PRO D 2 49  ? 50.872 34.526  60.041  1.00 27.98  ? 49  PRO B CD  1 
ATOM   5142 N N   . GLN D 2 50  ? 48.603 31.920  56.769  1.00 25.35  ? 50  GLN B N   1 
ATOM   5143 C CA  . GLN D 2 50  ? 48.192 31.866  55.363  1.00 24.74  ? 50  GLN B CA  1 
ATOM   5144 C C   . GLN D 2 50  ? 46.691 31.608  55.254  1.00 21.21  ? 50  GLN B C   1 
ATOM   5145 O O   . GLN D 2 50  ? 46.184 30.629  55.797  1.00 21.45  ? 50  GLN B O   1 
ATOM   5146 C CB  . GLN D 2 50  ? 48.948 30.745  54.644  1.00 27.10  ? 50  GLN B CB  1 
ATOM   5147 C CG  . GLN D 2 50  ? 48.671 30.659  53.150  1.00 35.71  ? 50  GLN B CG  1 
ATOM   5148 C CD  . GLN D 2 50  ? 48.819 29.246  52.604  1.00 43.88  ? 50  GLN B CD  1 
ATOM   5149 O OE1 . GLN D 2 50  ? 49.716 28.498  53.001  1.00 44.25  ? 50  GLN B OE1 1 
ATOM   5150 N NE2 . GLN D 2 50  ? 47.939 28.879  51.677  1.00 48.37  ? 50  GLN B NE2 1 
ATOM   5151 N N   . LEU D 2 51  ? 45.981 32.481  54.547  1.00 19.64  ? 51  LEU B N   1 
ATOM   5152 C CA  . LEU D 2 51  ? 44.540 32.322  54.393  1.00 18.01  ? 51  LEU B CA  1 
ATOM   5153 C C   . LEU D 2 51  ? 44.248 31.120  53.502  1.00 20.04  ? 51  LEU B C   1 
ATOM   5154 O O   . LEU D 2 51  ? 44.874 30.943  52.457  1.00 17.72  ? 51  LEU B O   1 
ATOM   5155 C CB  . LEU D 2 51  ? 43.929 33.578  53.767  1.00 16.81  ? 51  LEU B CB  1 
ATOM   5156 C CG  . LEU D 2 51  ? 42.407 33.565  53.597  1.00 18.99  ? 51  LEU B CG  1 
ATOM   5157 C CD1 . LEU D 2 51  ? 41.723 33.567  54.960  1.00 18.42  ? 51  LEU B CD1 1 
ATOM   5158 C CD2 . LEU D 2 51  ? 41.979 34.788  52.792  1.00 14.66  ? 51  LEU B CD2 1 
ATOM   5159 N N   . LEU D 2 52  ? 43.289 30.299  53.913  1.00 19.59  ? 52  LEU B N   1 
ATOM   5160 C CA  . LEU D 2 52  ? 42.921 29.110  53.145  1.00 20.16  ? 52  LEU B CA  1 
ATOM   5161 C C   . LEU D 2 52  ? 41.554 29.267  52.505  1.00 19.50  ? 52  LEU B C   1 
ATOM   5162 O O   . LEU D 2 52  ? 41.385 29.084  51.298  1.00 18.44  ? 52  LEU B O   1 
ATOM   5163 C CB  . LEU D 2 52  ? 42.880 27.879  54.045  1.00 22.12  ? 52  LEU B CB  1 
ATOM   5164 C CG  . LEU D 2 52  ? 44.179 27.339  54.644  1.00 19.05  ? 52  LEU B CG  1 
ATOM   5165 C CD1 . LEU D 2 52  ? 43.840 26.161  55.536  1.00 21.91  ? 52  LEU B CD1 1 
ATOM   5166 C CD2 . LEU D 2 52  ? 45.140 26.923  53.541  1.00 24.31  ? 52  LEU B CD2 1 
ATOM   5167 N N   . ILE D 2 53  ? 40.577 29.614  53.328  1.00 19.16  ? 53  ILE B N   1 
ATOM   5168 C CA  . ILE D 2 53  ? 39.206 29.759  52.868  1.00 17.81  ? 53  ILE B CA  1 
ATOM   5169 C C   . ILE D 2 53  ? 38.573 30.968  53.543  1.00 22.47  ? 53  ILE B C   1 
ATOM   5170 O O   . ILE D 2 53  ? 38.898 31.278  54.690  1.00 20.90  ? 53  ILE B O   1 
ATOM   5171 C CB  . ILE D 2 53  ? 38.413 28.477  53.229  1.00 17.30  ? 53  ILE B CB  1 
ATOM   5172 C CG1 . ILE D 2 53  ? 38.886 27.316  52.349  1.00 20.74  ? 53  ILE B CG1 1 
ATOM   5173 C CG2 . ILE D 2 53  ? 36.930 28.709  53.124  1.00 15.86  ? 53  ILE B CG2 1 
ATOM   5174 C CD1 . ILE D 2 53  ? 38.278 25.974  52.721  1.00 28.08  ? 53  ILE B CD1 1 
ATOM   5175 N N   . TYR D 2 54  ? 37.694 31.665  52.823  1.00 16.98  ? 54  TYR B N   1 
ATOM   5176 C CA  . TYR D 2 54  ? 36.994 32.817  53.397  1.00 19.74  ? 54  TYR B CA  1 
ATOM   5177 C C   . TYR D 2 54  ? 35.526 32.789  52.997  1.00 19.00  ? 54  TYR B C   1 
ATOM   5178 O O   . TYR D 2 54  ? 35.138 32.127  52.019  1.00 18.27  ? 54  TYR B O   1 
ATOM   5179 C CB  . TYR D 2 54  ? 37.635 34.146  52.969  1.00 17.35  ? 54  TYR B CB  1 
ATOM   5180 C CG  . TYR D 2 54  ? 37.488 34.451  51.491  1.00 13.23  ? 54  TYR B CG  1 
ATOM   5181 C CD1 . TYR D 2 54  ? 38.314 33.842  50.548  1.00 21.60  ? 54  TYR B CD1 1 
ATOM   5182 C CD2 . TYR D 2 54  ? 36.492 35.326  51.039  1.00 18.53  ? 54  TYR B CD2 1 
ATOM   5183 C CE1 . TYR D 2 54  ? 38.156 34.093  49.177  1.00 18.44  ? 54  TYR B CE1 1 
ATOM   5184 C CE2 . TYR D 2 54  ? 36.323 35.583  49.671  1.00 18.23  ? 54  TYR B CE2 1 
ATOM   5185 C CZ  . TYR D 2 54  ? 37.160 34.961  48.753  1.00 23.35  ? 54  TYR B CZ  1 
ATOM   5186 O OH  . TYR D 2 54  ? 37.009 35.203  47.406  1.00 21.96  ? 54  TYR B OH  1 
ATOM   5187 N N   . GLN D 2 55  ? 34.710 33.526  53.745  1.00 15.99  ? 55  GLN B N   1 
ATOM   5188 C CA  . GLN D 2 55  ? 33.281 33.553  53.515  1.00 16.18  ? 55  GLN B CA  1 
ATOM   5189 C C   . GLN D 2 55  ? 32.773 32.115  53.426  1.00 21.13  ? 55  GLN B C   1 
ATOM   5190 O O   . GLN D 2 55  ? 31.973 31.766  52.549  1.00 19.42  ? 55  GLN B O   1 
ATOM   5191 C CB  . GLN D 2 55  ? 32.947 34.374  52.253  1.00 17.48  ? 55  GLN B CB  1 
ATOM   5192 C CG  . GLN D 2 55  ? 33.240 35.859  52.474  1.00 19.68  ? 55  GLN B CG  1 
ATOM   5193 C CD  . GLN D 2 55  ? 32.828 36.775  51.329  1.00 27.60  ? 55  GLN B CD  1 
ATOM   5194 O OE1 . GLN D 2 55  ? 33.101 37.980  51.370  1.00 23.43  ? 55  GLN B OE1 1 
ATOM   5195 N NE2 . GLN D 2 55  ? 32.163 36.221  50.313  1.00 19.50  ? 55  GLN B NE2 1 
ATOM   5196 N N   . MET D 2 56  ? 33.300 31.281  54.328  1.00 17.63  ? 56  MET B N   1 
ATOM   5197 C CA  . MET D 2 56  ? 32.900 29.886  54.479  1.00 21.68  ? 56  MET B CA  1 
ATOM   5198 C C   . MET D 2 56  ? 33.312 28.870  53.427  1.00 23.80  ? 56  MET B C   1 
ATOM   5199 O O   . MET D 2 56  ? 33.825 27.810  53.764  1.00 26.46  ? 56  MET B O   1 
ATOM   5200 C CB  . MET D 2 56  ? 31.380 29.815  54.660  1.00 23.78  ? 56  MET B CB  1 
ATOM   5201 C CG  . MET D 2 56  ? 30.789 28.413  54.499  1.00 40.77  ? 56  MET B CG  1 
ATOM   5202 S SD  . MET D 2 56  ? 31.172 27.335  55.876  1.00 61.22  ? 56  MET B SD  1 
ATOM   5203 C CE  . MET D 2 56  ? 29.655 27.481  56.821  1.00 57.88  ? 56  MET B CE  1 
ATOM   5204 N N   . SER D 2 57  ? 33.095 29.178  52.156  1.00 27.57  ? 57  SER B N   1 
ATOM   5205 C CA  . SER D 2 57  ? 33.417 28.202  51.116  1.00 31.56  ? 57  SER B CA  1 
ATOM   5206 C C   . SER D 2 57  ? 34.283 28.683  49.963  1.00 29.04  ? 57  SER B C   1 
ATOM   5207 O O   . SER D 2 57  ? 34.491 27.942  49.009  1.00 33.54  ? 57  SER B O   1 
ATOM   5208 C CB  . SER D 2 57  ? 32.119 27.634  50.543  1.00 34.02  ? 57  SER B CB  1 
ATOM   5209 O OG  . SER D 2 57  ? 31.371 28.668  49.923  1.00 37.18  ? 57  SER B OG  1 
ATOM   5210 N N   . ASN D 2 58  ? 34.782 29.913  50.029  1.00 24.05  ? 58  ASN B N   1 
ATOM   5211 C CA  . ASN D 2 58  ? 35.626 30.423  48.950  1.00 19.62  ? 58  ASN B CA  1 
ATOM   5212 C C   . ASN D 2 58  ? 37.103 30.171  49.184  1.00 23.81  ? 58  ASN B C   1 
ATOM   5213 O O   . ASN D 2 58  ? 37.656 30.566  50.206  1.00 20.54  ? 58  ASN B O   1 
ATOM   5214 C CB  . ASN D 2 58  ? 35.403 31.919  48.776  1.00 23.24  ? 58  ASN B CB  1 
ATOM   5215 C CG  . ASN D 2 58  ? 33.968 32.249  48.470  1.00 24.92  ? 58  ASN B CG  1 
ATOM   5216 O OD1 . ASN D 2 58  ? 33.552 32.254  47.311  1.00 31.39  ? 58  ASN B OD1 1 
ATOM   5217 N ND2 . ASN D 2 58  ? 33.190 32.499  49.510  1.00 30.11  ? 58  ASN B ND2 1 
ATOM   5218 N N   . LEU D 2 59  ? 37.749 29.515  48.229  1.00 22.07  ? 59  LEU B N   1 
ATOM   5219 C CA  . LEU D 2 59  ? 39.174 29.253  48.346  1.00 22.32  ? 59  LEU B CA  1 
ATOM   5220 C C   . LEU D 2 59  ? 39.958 30.546  48.154  1.00 23.71  ? 59  LEU B C   1 
ATOM   5221 O O   . LEU D 2 59  ? 39.618 31.366  47.299  1.00 18.12  ? 59  LEU B O   1 
ATOM   5222 C CB  . LEU D 2 59  ? 39.611 28.228  47.295  1.00 23.18  ? 59  LEU B CB  1 
ATOM   5223 C CG  . LEU D 2 59  ? 39.129 26.796  47.538  1.00 30.21  ? 59  LEU B CG  1 
ATOM   5224 C CD1 . LEU D 2 59  ? 39.405 25.924  46.308  1.00 25.21  ? 59  LEU B CD1 1 
ATOM   5225 C CD2 . LEU D 2 59  ? 39.849 26.252  48.772  1.00 29.85  ? 59  LEU B CD2 1 
ATOM   5226 N N   . ALA D 2 60  ? 41.003 30.727  48.958  1.00 23.36  ? 60  ALA B N   1 
ATOM   5227 C CA  . ALA D 2 60  ? 41.857 31.905  48.859  1.00 27.35  ? 60  ALA B CA  1 
ATOM   5228 C C   . ALA D 2 60  ? 42.834 31.659  47.714  1.00 32.58  ? 60  ALA B C   1 
ATOM   5229 O O   . ALA D 2 60  ? 42.840 30.584  47.114  1.00 25.55  ? 60  ALA B O   1 
ATOM   5230 C CB  . ALA D 2 60  ? 42.619 32.121  50.158  1.00 28.10  ? 60  ALA B CB  1 
ATOM   5231 N N   . SER D 2 61  ? 43.672 32.649  47.424  1.00 38.58  ? 61  SER B N   1 
ATOM   5232 C CA  . SER D 2 61  ? 44.640 32.534  46.334  1.00 39.15  ? 61  SER B CA  1 
ATOM   5233 C C   . SER D 2 61  ? 45.705 31.472  46.567  1.00 39.78  ? 61  SER B C   1 
ATOM   5234 O O   . SER D 2 61  ? 46.286 31.372  47.652  1.00 36.91  ? 61  SER B O   1 
ATOM   5235 C CB  . SER D 2 61  ? 45.322 33.883  46.092  1.00 46.64  ? 61  SER B CB  1 
ATOM   5236 O OG  . SER D 2 61  ? 46.084 34.279  47.222  1.00 46.62  ? 61  SER B OG  1 
ATOM   5237 N N   . GLY D 2 62  ? 45.950 30.677  45.530  1.00 41.58  ? 62  GLY B N   1 
ATOM   5238 C CA  . GLY D 2 62  ? 46.951 29.629  45.595  1.00 39.48  ? 62  GLY B CA  1 
ATOM   5239 C C   . GLY D 2 62  ? 46.582 28.400  46.397  1.00 35.30  ? 62  GLY B C   1 
ATOM   5240 O O   . GLY D 2 62  ? 47.417 27.515  46.584  1.00 39.74  ? 62  GLY B O   1 
ATOM   5241 N N   . VAL D 2 63  ? 45.345 28.330  46.878  1.00 30.02  ? 63  VAL B N   1 
ATOM   5242 C CA  . VAL D 2 63  ? 44.936 27.174  47.661  1.00 28.17  ? 63  VAL B CA  1 
ATOM   5243 C C   . VAL D 2 63  ? 44.351 26.074  46.773  1.00 27.37  ? 63  VAL B C   1 
ATOM   5244 O O   . VAL D 2 63  ? 43.386 26.301  46.036  1.00 26.18  ? 63  VAL B O   1 
ATOM   5245 C CB  . VAL D 2 63  ? 43.906 27.578  48.740  1.00 25.95  ? 63  VAL B CB  1 
ATOM   5246 C CG1 . VAL D 2 63  ? 43.562 26.382  49.598  1.00 21.09  ? 63  VAL B CG1 1 
ATOM   5247 C CG2 . VAL D 2 63  ? 44.485 28.701  49.614  1.00 25.99  ? 63  VAL B CG2 1 
ATOM   5248 N N   . PRO D 2 64  ? 44.941 24.868  46.820  1.00 27.92  ? 64  PRO B N   1 
ATOM   5249 C CA  . PRO D 2 64  ? 44.454 23.744  46.004  1.00 26.40  ? 64  PRO B CA  1 
ATOM   5250 C C   . PRO D 2 64  ? 43.053 23.302  46.417  1.00 27.09  ? 64  PRO B C   1 
ATOM   5251 O O   . PRO D 2 64  ? 42.688 23.420  47.589  1.00 27.27  ? 64  PRO B O   1 
ATOM   5252 C CB  . PRO D 2 64  ? 45.517 22.666  46.223  1.00 27.80  ? 64  PRO B CB  1 
ATOM   5253 C CG  . PRO D 2 64  ? 46.066 22.984  47.594  1.00 32.05  ? 64  PRO B CG  1 
ATOM   5254 C CD  . PRO D 2 64  ? 46.150 24.492  47.580  1.00 28.75  ? 64  PRO B CD  1 
ATOM   5255 N N   . ASN D 2 65  ? 42.266 22.795  45.466  1.00 23.18  ? 65  ASN B N   1 
ATOM   5256 C CA  . ASN D 2 65  ? 40.907 22.385  45.795  1.00 21.41  ? 65  ASN B CA  1 
ATOM   5257 C C   . ASN D 2 65  ? 40.795 21.146  46.684  1.00 24.07  ? 65  ASN B C   1 
ATOM   5258 O O   . ASN D 2 65  ? 39.708 20.591  46.861  1.00 22.95  ? 65  ASN B O   1 
ATOM   5259 C CB  . ASN D 2 65  ? 40.033 22.258  44.521  1.00 25.85  ? 65  ASN B CB  1 
ATOM   5260 C CG  . ASN D 2 65  ? 40.540 21.215  43.537  1.00 23.99  ? 65  ASN B CG  1 
ATOM   5261 O OD1 . ASN D 2 65  ? 40.046 21.128  42.408  1.00 22.66  ? 65  ASN B OD1 1 
ATOM   5262 N ND2 . ASN D 2 65  ? 41.503 20.413  43.958  1.00 23.04  ? 65  ASN B ND2 1 
ATOM   5263 N N   . ARG D 2 66  ? 41.920 20.732  47.266  1.00 21.02  ? 66  ARG B N   1 
ATOM   5264 C CA  . ARG D 2 66  ? 41.921 19.610  48.212  1.00 26.51  ? 66  ARG B CA  1 
ATOM   5265 C C   . ARG D 2 66  ? 41.297 20.150  49.504  1.00 24.22  ? 66  ARG B C   1 
ATOM   5266 O O   . ARG D 2 66  ? 40.870 19.396  50.378  1.00 24.65  ? 66  ARG B O   1 
ATOM   5267 C CB  . ARG D 2 66  ? 43.349 19.150  48.530  1.00 29.35  ? 66  ARG B CB  1 
ATOM   5268 C CG  . ARG D 2 66  ? 44.099 18.541  47.371  1.00 30.33  ? 66  ARG B CG  1 
ATOM   5269 C CD  . ARG D 2 66  ? 45.411 17.908  47.823  1.00 29.02  ? 66  ARG B CD  1 
ATOM   5270 N NE  . ARG D 2 66  ? 46.400 18.881  48.275  1.00 29.46  ? 66  ARG B NE  1 
ATOM   5271 C CZ  . ARG D 2 66  ? 46.773 19.052  49.541  1.00 26.87  ? 66  ARG B CZ  1 
ATOM   5272 N NH1 . ARG D 2 66  ? 46.240 18.320  50.511  1.00 30.69  ? 66  ARG B NH1 1 
ATOM   5273 N NH2 . ARG D 2 66  ? 47.706 19.942  49.839  1.00 33.37  ? 66  ARG B NH2 1 
ATOM   5274 N N   . PHE D 2 67  ? 41.265 21.476  49.624  1.00 24.42  ? 67  PHE B N   1 
ATOM   5275 C CA  . PHE D 2 67  ? 40.703 22.127  50.811  1.00 20.96  ? 67  PHE B CA  1 
ATOM   5276 C C   . PHE D 2 67  ? 39.259 22.545  50.570  1.00 24.52  ? 67  PHE B C   1 
ATOM   5277 O O   . PHE D 2 67  ? 38.939 23.088  49.519  1.00 23.34  ? 67  PHE B O   1 
ATOM   5278 C CB  . PHE D 2 67  ? 41.524 23.371  51.170  1.00 23.51  ? 67  PHE B CB  1 
ATOM   5279 C CG  . PHE D 2 67  ? 42.907 23.066  51.674  1.00 23.87  ? 67  PHE B CG  1 
ATOM   5280 C CD1 . PHE D 2 67  ? 43.124 22.779  53.020  1.00 22.57  ? 67  PHE B CD1 1 
ATOM   5281 C CD2 . PHE D 2 67  ? 43.990 23.037  50.800  1.00 22.66  ? 67  PHE B CD2 1 
ATOM   5282 C CE1 . PHE D 2 67  ? 44.404 22.465  53.488  1.00 24.42  ? 67  PHE B CE1 1 
ATOM   5283 C CE2 . PHE D 2 67  ? 45.272 22.723  51.260  1.00 27.84  ? 67  PHE B CE2 1 
ATOM   5284 C CZ  . PHE D 2 67  ? 45.475 22.438  52.607  1.00 23.35  ? 67  PHE B CZ  1 
ATOM   5285 N N   . SER D 2 68  ? 38.389 22.290  51.543  1.00 23.47  ? 68  SER B N   1 
ATOM   5286 C CA  . SER D 2 68  ? 36.988 22.677  51.432  1.00 23.00  ? 68  SER B CA  1 
ATOM   5287 C C   . SER D 2 68  ? 36.407 22.827  52.830  1.00 27.25  ? 68  SER B C   1 
ATOM   5288 O O   . SER D 2 68  ? 36.922 22.245  53.787  1.00 24.47  ? 68  SER B O   1 
ATOM   5289 C CB  . SER D 2 68  ? 36.186 21.629  50.641  1.00 26.42  ? 68  SER B CB  1 
ATOM   5290 O OG  . SER D 2 68  ? 36.101 20.384  51.322  1.00 26.48  ? 68  SER B OG  1 
ATOM   5291 N N   . SER D 2 69  ? 35.347 23.618  52.953  1.00 24.88  ? 69  SER B N   1 
ATOM   5292 C CA  . SER D 2 69  ? 34.715 23.823  54.252  1.00 28.48  ? 69  SER B CA  1 
ATOM   5293 C C   . SER D 2 69  ? 33.213 23.681  54.094  1.00 33.65  ? 69  SER B C   1 
ATOM   5294 O O   . SER D 2 69  ? 32.641 24.068  53.070  1.00 30.60  ? 69  SER B O   1 
ATOM   5295 C CB  . SER D 2 69  ? 35.057 25.211  54.817  1.00 33.99  ? 69  SER B CB  1 
ATOM   5296 O OG  . SER D 2 69  ? 34.553 25.373  56.139  1.00 32.84  ? 69  SER B OG  1 
ATOM   5297 N N   . SER D 2 70  ? 32.577 23.100  55.104  1.00 26.92  ? 70  SER B N   1 
ATOM   5298 C CA  . SER D 2 70  ? 31.137 22.903  55.080  1.00 30.32  ? 70  SER B CA  1 
ATOM   5299 C C   . SER D 2 70  ? 30.596 23.102  56.483  1.00 26.33  ? 70  SER B C   1 
ATOM   5300 O O   . SER D 2 70  ? 31.358 23.161  57.444  1.00 21.16  ? 70  SER B O   1 
ATOM   5301 C CB  . SER D 2 70  ? 30.799 21.492  54.613  1.00 30.46  ? 70  SER B CB  1 
ATOM   5302 O OG  . SER D 2 70  ? 31.207 20.544  55.586  1.00 34.50  ? 70  SER B OG  1 
ATOM   5303 N N   . GLY D 2 71  ? 29.277 23.201  56.594  1.00 26.76  ? 71  GLY B N   1 
ATOM   5304 C CA  . GLY D 2 71  ? 28.664 23.397  57.892  1.00 30.20  ? 71  GLY B CA  1 
ATOM   5305 C C   . GLY D 2 71  ? 27.536 24.405  57.850  1.00 28.59  ? 71  GLY B C   1 
ATOM   5306 O O   . GLY D 2 71  ? 27.227 24.968  56.796  1.00 30.68  ? 71  GLY B O   1 
ATOM   5307 N N   . SER D 2 72  ? 26.930 24.623  59.008  1.00 27.39  ? 72  SER B N   1 
ATOM   5308 C CA  . SER D 2 72  ? 25.816 25.546  59.177  1.00 36.52  ? 72  SER B CA  1 
ATOM   5309 C C   . SER D 2 72  ? 26.329 26.923  59.546  1.00 38.79  ? 72  SER B C   1 
ATOM   5310 O O   . SER D 2 72  ? 27.407 27.332  59.123  1.00 48.39  ? 72  SER B O   1 
ATOM   5311 C CB  . SER D 2 72  ? 24.918 25.065  60.310  1.00 45.59  ? 72  SER B CB  1 
ATOM   5312 O OG  . SER D 2 72  ? 25.650 25.086  61.527  1.00 43.51  ? 72  SER B OG  1 
ATOM   5313 N N   . GLY D 2 73  ? 25.547 27.628  60.356  1.00 34.84  ? 73  GLY B N   1 
ATOM   5314 C CA  . GLY D 2 73  ? 25.936 28.956  60.780  1.00 34.31  ? 73  GLY B CA  1 
ATOM   5315 C C   . GLY D 2 73  ? 26.771 28.928  62.046  1.00 30.68  ? 73  GLY B C   1 
ATOM   5316 O O   . GLY D 2 73  ? 27.507 29.871  62.313  1.00 29.25  ? 73  GLY B O   1 
ATOM   5317 N N   . THR D 2 74  ? 26.679 27.843  62.816  1.00 30.30  ? 74  THR B N   1 
ATOM   5318 C CA  . THR D 2 74  ? 27.434 27.732  64.067  1.00 33.74  ? 74  THR B CA  1 
ATOM   5319 C C   . THR D 2 74  ? 28.364 26.523  64.196  1.00 32.92  ? 74  THR B C   1 
ATOM   5320 O O   . THR D 2 74  ? 29.160 26.457  65.135  1.00 34.45  ? 74  THR B O   1 
ATOM   5321 C CB  . THR D 2 74  ? 26.488 27.685  65.280  1.00 37.43  ? 74  THR B CB  1 
ATOM   5322 O OG1 . THR D 2 74  ? 25.699 26.488  65.215  1.00 41.49  ? 74  THR B OG1 1 
ATOM   5323 C CG2 . THR D 2 74  ? 25.559 28.894  65.288  1.00 35.02  ? 74  THR B CG2 1 
ATOM   5324 N N   . ASP D 2 75  ? 28.265 25.570  63.274  1.00 33.45  ? 75  ASP B N   1 
ATOM   5325 C CA  . ASP D 2 75  ? 29.098 24.365  63.324  1.00 30.28  ? 75  ASP B CA  1 
ATOM   5326 C C   . ASP D 2 75  ? 29.765 24.132  61.977  1.00 27.11  ? 75  ASP B C   1 
ATOM   5327 O O   . ASP D 2 75  ? 29.091 23.977  60.959  1.00 25.08  ? 75  ASP B O   1 
ATOM   5328 C CB  . ASP D 2 75  ? 28.239 23.171  63.733  1.00 34.41  ? 75  ASP B CB  1 
ATOM   5329 C CG  . ASP D 2 75  ? 27.768 23.270  65.176  1.00 40.35  ? 75  ASP B CG  1 
ATOM   5330 O OD1 . ASP D 2 75  ? 28.530 22.865  66.081  1.00 47.65  ? 75  ASP B OD1 1 
ATOM   5331 O OD2 . ASP D 2 75  ? 26.648 23.773  65.406  1.00 43.87  ? 75  ASP B OD2 1 
ATOM   5332 N N   . PHE D 2 76  ? 31.094 24.094  61.974  1.00 23.60  ? 76  PHE B N   1 
ATOM   5333 C CA  . PHE D 2 76  ? 31.830 23.948  60.725  1.00 25.51  ? 76  PHE B CA  1 
ATOM   5334 C C   . PHE D 2 76  ? 32.912 22.891  60.720  1.00 25.92  ? 76  PHE B C   1 
ATOM   5335 O O   . PHE D 2 76  ? 33.418 22.479  61.767  1.00 23.15  ? 76  PHE B O   1 
ATOM   5336 C CB  . PHE D 2 76  ? 32.456 25.291  60.336  1.00 26.79  ? 76  PHE B CB  1 
ATOM   5337 C CG  . PHE D 2 76  ? 31.687 26.480  60.833  1.00 30.34  ? 76  PHE B CG  1 
ATOM   5338 C CD1 . PHE D 2 76  ? 32.033 27.089  62.036  1.00 39.08  ? 76  PHE B CD1 1 
ATOM   5339 C CD2 . PHE D 2 76  ? 30.607 26.975  60.119  1.00 37.07  ? 76  PHE B CD2 1 
ATOM   5340 C CE1 . PHE D 2 76  ? 31.310 28.179  62.525  1.00 41.58  ? 76  PHE B CE1 1 
ATOM   5341 C CE2 . PHE D 2 76  ? 29.874 28.068  60.599  1.00 37.83  ? 76  PHE B CE2 1 
ATOM   5342 C CZ  . PHE D 2 76  ? 30.228 28.666  61.803  1.00 39.38  ? 76  PHE B CZ  1 
ATOM   5343 N N   . THR D 2 77  ? 33.279 22.483  59.514  1.00 19.88  ? 77  THR B N   1 
ATOM   5344 C CA  . THR D 2 77  ? 34.295 21.473  59.326  1.00 23.43  ? 77  THR B CA  1 
ATOM   5345 C C   . THR D 2 77  ? 35.191 21.793  58.140  1.00 24.41  ? 77  THR B C   1 
ATOM   5346 O O   . THR D 2 77  ? 34.706 21.993  57.023  1.00 24.57  ? 77  THR B O   1 
ATOM   5347 C CB  . THR D 2 77  ? 33.648 20.089  59.070  1.00 25.44  ? 77  THR B CB  1 
ATOM   5348 O OG1 . THR D 2 77  ? 32.791 19.750  60.166  1.00 23.96  ? 77  THR B OG1 1 
ATOM   5349 C CG2 . THR D 2 77  ? 34.716 19.019  58.902  1.00 28.63  ? 77  THR B CG2 1 
ATOM   5350 N N   . LEU D 2 78  ? 36.496 21.857  58.387  1.00 24.86  ? 78  LEU B N   1 
ATOM   5351 C CA  . LEU D 2 78  ? 37.457 22.077  57.314  1.00 19.74  ? 78  LEU B CA  1 
ATOM   5352 C C   . LEU D 2 78  ? 37.849 20.672  56.896  1.00 21.74  ? 78  LEU B C   1 
ATOM   5353 O O   . LEU D 2 78  ? 38.204 19.847  57.740  1.00 19.05  ? 78  LEU B O   1 
ATOM   5354 C CB  . LEU D 2 78  ? 38.711 22.815  57.805  1.00 21.83  ? 78  LEU B CB  1 
ATOM   5355 C CG  . LEU D 2 78  ? 39.815 22.910  56.737  1.00 26.82  ? 78  LEU B CG  1 
ATOM   5356 C CD1 . LEU D 2 78  ? 39.389 23.890  55.651  1.00 20.87  ? 78  LEU B CD1 1 
ATOM   5357 C CD2 . LEU D 2 78  ? 41.126 23.354  57.354  1.00 26.87  ? 78  LEU B CD2 1 
ATOM   5358 N N   . ARG D 2 79  ? 37.768 20.391  55.601  1.00 21.26  ? 79  ARG B N   1 
ATOM   5359 C CA  . ARG D 2 79  ? 38.127 19.082  55.085  1.00 18.41  ? 79  ARG B CA  1 
ATOM   5360 C C   . ARG D 2 79  ? 39.340 19.186  54.182  1.00 23.41  ? 79  ARG B C   1 
ATOM   5361 O O   . ARG D 2 79  ? 39.396 20.043  53.296  1.00 24.59  ? 79  ARG B O   1 
ATOM   5362 C CB  . ARG D 2 79  ? 36.956 18.480  54.292  1.00 23.30  ? 79  ARG B CB  1 
ATOM   5363 C CG  . ARG D 2 79  ? 35.802 17.996  55.157  1.00 19.86  ? 79  ARG B CG  1 
ATOM   5364 C CD  . ARG D 2 79  ? 36.103 16.627  55.738  1.00 22.28  ? 79  ARG B CD  1 
ATOM   5365 N NE  . ARG D 2 79  ? 36.088 15.601  54.697  1.00 24.23  ? 79  ARG B NE  1 
ATOM   5366 C CZ  . ARG D 2 79  ? 36.426 14.331  54.892  1.00 28.15  ? 79  ARG B CZ  1 
ATOM   5367 N NH1 . ARG D 2 79  ? 36.810 13.925  56.095  1.00 22.67  ? 79  ARG B NH1 1 
ATOM   5368 N NH2 . ARG D 2 79  ? 36.377 13.465  53.887  1.00 27.14  ? 79  ARG B NH2 1 
ATOM   5369 N N   . ILE D 2 80  ? 40.311 18.310  54.403  1.00 18.15  ? 80  ILE B N   1 
ATOM   5370 C CA  . ILE D 2 80  ? 41.509 18.284  53.580  1.00 23.17  ? 80  ILE B CA  1 
ATOM   5371 C C   . ILE D 2 80  ? 41.583 16.905  52.943  1.00 26.88  ? 80  ILE B C   1 
ATOM   5372 O O   . ILE D 2 80  ? 41.818 15.910  53.634  1.00 23.14  ? 80  ILE B O   1 
ATOM   5373 C CB  . ILE D 2 80  ? 42.787 18.496  54.415  1.00 20.97  ? 80  ILE B CB  1 
ATOM   5374 C CG1 . ILE D 2 80  ? 42.681 19.787  55.225  1.00 24.41  ? 80  ILE B CG1 1 
ATOM   5375 C CG2 . ILE D 2 80  ? 43.999 18.552  53.500  1.00 19.45  ? 80  ILE B CG2 1 
ATOM   5376 C CD1 . ILE D 2 80  ? 43.843 19.984  56.212  1.00 25.60  ? 80  ILE B CD1 1 
ATOM   5377 N N   . SER D 2 81  ? 41.367 16.838  51.634  1.00 27.44  ? 81  SER B N   1 
ATOM   5378 C CA  . SER D 2 81  ? 41.422 15.551  50.962  1.00 30.60  ? 81  SER B CA  1 
ATOM   5379 C C   . SER D 2 81  ? 42.855 15.256  50.550  1.00 30.23  ? 81  SER B C   1 
ATOM   5380 O O   . SER D 2 81  ? 43.670 16.167  50.363  1.00 25.92  ? 81  SER B O   1 
ATOM   5381 C CB  . SER D 2 81  ? 40.501 15.537  49.732  1.00 32.51  ? 81  SER B CB  1 
ATOM   5382 O OG  . SER D 2 81  ? 40.991 16.395  48.726  1.00 36.95  ? 81  SER B OG  1 
ATOM   5383 N N   . ARG D 2 82  ? 43.162 13.971  50.431  1.00 30.12  ? 82  ARG B N   1 
ATOM   5384 C CA  . ARG D 2 82  ? 44.484 13.520  50.025  1.00 31.73  ? 82  ARG B CA  1 
ATOM   5385 C C   . ARG D 2 82  ? 45.622 14.246  50.725  1.00 29.59  ? 82  ARG B C   1 
ATOM   5386 O O   . ARG D 2 82  ? 46.517 14.791  50.082  1.00 28.57  ? 82  ARG B O   1 
ATOM   5387 C CB  . ARG D 2 82  ? 44.628 13.656  48.509  1.00 38.63  ? 82  ARG B CB  1 
ATOM   5388 C CG  . ARG D 2 82  ? 43.643 12.793  47.752  1.00 44.91  ? 82  ARG B CG  1 
ATOM   5389 C CD  . ARG D 2 82  ? 43.986 12.695  46.283  1.00 57.62  ? 82  ARG B CD  1 
ATOM   5390 N NE  . ARG D 2 82  ? 43.215 11.636  45.636  1.00 72.47  ? 82  ARG B NE  1 
ATOM   5391 C CZ  . ARG D 2 82  ? 43.263 10.354  45.987  1.00 79.60  ? 82  ARG B CZ  1 
ATOM   5392 N NH1 . ARG D 2 82  ? 44.048 9.960   46.982  1.00 83.11  ? 82  ARG B NH1 1 
ATOM   5393 N NH2 . ARG D 2 82  ? 42.523 9.461   45.343  1.00 84.99  ? 82  ARG B NH2 1 
ATOM   5394 N N   . VAL D 2 83  ? 45.590 14.224  52.052  1.00 29.58  ? 83  VAL B N   1 
ATOM   5395 C CA  . VAL D 2 83  ? 46.603 14.878  52.864  1.00 28.99  ? 83  VAL B CA  1 
ATOM   5396 C C   . VAL D 2 83  ? 48.031 14.627  52.382  1.00 34.04  ? 83  VAL B C   1 
ATOM   5397 O O   . VAL D 2 83  ? 48.416 13.488  52.100  1.00 30.05  ? 83  VAL B O   1 
ATOM   5398 C CB  . VAL D 2 83  ? 46.483 14.432  54.331  1.00 29.40  ? 83  VAL B CB  1 
ATOM   5399 C CG1 . VAL D 2 83  ? 47.650 14.975  55.153  1.00 28.10  ? 83  VAL B CG1 1 
ATOM   5400 C CG2 . VAL D 2 83  ? 45.168 14.924  54.902  1.00 25.79  ? 83  VAL B CG2 1 
ATOM   5401 N N   . GLU D 2 84  ? 48.807 15.706  52.293  1.00 36.54  ? 84  GLU B N   1 
ATOM   5402 C CA  . GLU D 2 84  ? 50.200 15.638  51.859  1.00 38.17  ? 84  GLU B CA  1 
ATOM   5403 C C   . GLU D 2 84  ? 51.082 15.966  53.056  1.00 41.15  ? 84  GLU B C   1 
ATOM   5404 O O   . GLU D 2 84  ? 50.636 16.589  54.021  1.00 39.82  ? 84  GLU B O   1 
ATOM   5405 C CB  . GLU D 2 84  ? 50.466 16.643  50.732  1.00 39.82  ? 84  GLU B CB  1 
ATOM   5406 C CG  . GLU D 2 84  ? 49.624 16.416  49.487  1.00 44.04  ? 84  GLU B CG  1 
ATOM   5407 C CD  . GLU D 2 84  ? 49.885 17.439  48.399  1.00 41.60  ? 84  GLU B CD  1 
ATOM   5408 O OE1 . GLU D 2 84  ? 49.226 17.355  47.340  1.00 51.16  ? 84  GLU B OE1 1 
ATOM   5409 O OE2 . GLU D 2 84  ? 50.744 18.326  48.599  1.00 45.06  ? 84  GLU B OE2 1 
ATOM   5410 N N   . ALA D 2 85  ? 52.336 15.539  52.995  1.00 40.68  ? 85  ALA B N   1 
ATOM   5411 C CA  . ALA D 2 85  ? 53.277 15.786  54.077  1.00 40.15  ? 85  ALA B CA  1 
ATOM   5412 C C   . ALA D 2 85  ? 53.413 17.267  54.409  1.00 34.86  ? 85  ALA B C   1 
ATOM   5413 O O   . ALA D 2 85  ? 53.526 17.626  55.580  1.00 37.65  ? 85  ALA B O   1 
ATOM   5414 C CB  . ALA D 2 85  ? 54.644 15.213  53.717  1.00 39.48  ? 85  ALA B CB  1 
ATOM   5415 N N   . GLU D 2 86  ? 53.399 18.112  53.380  1.00 38.81  ? 86  GLU B N   1 
ATOM   5416 C CA  . GLU D 2 86  ? 53.544 19.552  53.560  1.00 40.28  ? 86  GLU B CA  1 
ATOM   5417 C C   . GLU D 2 86  ? 52.334 20.210  54.212  1.00 38.74  ? 86  GLU B C   1 
ATOM   5418 O O   . GLU D 2 86  ? 52.360 21.410  54.480  1.00 38.54  ? 86  GLU B O   1 
ATOM   5419 C CB  . GLU D 2 86  ? 53.815 20.226  52.211  1.00 47.74  ? 86  GLU B CB  1 
ATOM   5420 C CG  . GLU D 2 86  ? 52.652 20.129  51.229  1.00 63.56  ? 86  GLU B CG  1 
ATOM   5421 C CD  . GLU D 2 86  ? 52.924 20.848  49.919  1.00 70.37  ? 86  GLU B CD  1 
ATOM   5422 O OE1 . GLU D 2 86  ? 51.999 20.924  49.081  1.00 75.48  ? 86  GLU B OE1 1 
ATOM   5423 O OE2 . GLU D 2 86  ? 54.060 21.333  49.728  1.00 73.42  ? 86  GLU B OE2 1 
ATOM   5424 N N   . ASP D 2 87  ? 51.282 19.434  54.475  1.00 34.10  ? 87  ASP B N   1 
ATOM   5425 C CA  . ASP D 2 87  ? 50.077 19.992  55.083  1.00 31.38  ? 87  ASP B CA  1 
ATOM   5426 C C   . ASP D 2 87  ? 50.175 20.147  56.601  1.00 32.22  ? 87  ASP B C   1 
ATOM   5427 O O   . ASP D 2 87  ? 49.309 20.756  57.226  1.00 31.34  ? 87  ASP B O   1 
ATOM   5428 C CB  . ASP D 2 87  ? 48.846 19.139  54.738  1.00 29.70  ? 87  ASP B CB  1 
ATOM   5429 C CG  . ASP D 2 87  ? 48.437 19.252  53.276  1.00 36.64  ? 87  ASP B CG  1 
ATOM   5430 O OD1 . ASP D 2 87  ? 48.690 20.306  52.658  1.00 35.24  ? 87  ASP B OD1 1 
ATOM   5431 O OD2 . ASP D 2 87  ? 47.839 18.288  52.752  1.00 39.75  ? 87  ASP B OD2 1 
ATOM   5432 N N   . VAL D 2 88  ? 51.219 19.595  57.206  1.00 32.00  ? 88  VAL B N   1 
ATOM   5433 C CA  . VAL D 2 88  ? 51.355 19.718  58.654  1.00 33.93  ? 88  VAL B CA  1 
ATOM   5434 C C   . VAL D 2 88  ? 51.405 21.179  59.088  1.00 32.63  ? 88  VAL B C   1 
ATOM   5435 O O   . VAL D 2 88  ? 51.968 22.028  58.400  1.00 35.88  ? 88  VAL B O   1 
ATOM   5436 C CB  . VAL D 2 88  ? 52.612 19.020  59.184  1.00 35.77  ? 88  VAL B CB  1 
ATOM   5437 C CG1 . VAL D 2 88  ? 52.424 17.518  59.129  1.00 38.67  ? 88  VAL B CG1 1 
ATOM   5438 C CG2 . VAL D 2 88  ? 53.824 19.449  58.379  1.00 37.29  ? 88  VAL B CG2 1 
ATOM   5439 N N   . GLY D 2 89  ? 50.807 21.454  60.239  1.00 26.45  ? 89  GLY B N   1 
ATOM   5440 C CA  . GLY D 2 89  ? 50.760 22.809  60.751  1.00 26.62  ? 89  GLY B CA  1 
ATOM   5441 C C   . GLY D 2 89  ? 49.537 22.988  61.631  1.00 26.22  ? 89  GLY B C   1 
ATOM   5442 O O   . GLY D 2 89  ? 48.884 22.013  62.002  1.00 30.39  ? 89  GLY B O   1 
ATOM   5443 N N   . VAL D 2 90  ? 49.220 24.231  61.971  1.00 21.81  ? 90  VAL B N   1 
ATOM   5444 C CA  . VAL D 2 90  ? 48.073 24.502  62.823  1.00 22.35  ? 90  VAL B CA  1 
ATOM   5445 C C   . VAL D 2 90  ? 46.996 25.234  62.026  1.00 25.90  ? 90  VAL B C   1 
ATOM   5446 O O   . VAL D 2 90  ? 47.252 26.283  61.431  1.00 19.98  ? 90  VAL B O   1 
ATOM   5447 C CB  . VAL D 2 90  ? 48.481 25.351  64.039  1.00 22.51  ? 90  VAL B CB  1 
ATOM   5448 C CG1 . VAL D 2 90  ? 47.295 25.510  64.981  1.00 24.02  ? 90  VAL B CG1 1 
ATOM   5449 C CG2 . VAL D 2 90  ? 49.653 24.682  64.766  1.00 27.19  ? 90  VAL B CG2 1 
ATOM   5450 N N   . TYR D 2 91  ? 45.795 24.662  62.014  1.00 24.76  ? 91  TYR B N   1 
ATOM   5451 C CA  . TYR D 2 91  ? 44.665 25.234  61.287  1.00 21.59  ? 91  TYR B CA  1 
ATOM   5452 C C   . TYR D 2 91  ? 43.717 25.999  62.187  1.00 17.27  ? 91  TYR B C   1 
ATOM   5453 O O   . TYR D 2 91  ? 43.180 25.456  63.147  1.00 19.54  ? 91  TYR B O   1 
ATOM   5454 C CB  . TYR D 2 91  ? 43.903 24.126  60.560  1.00 19.66  ? 91  TYR B CB  1 
ATOM   5455 C CG  . TYR D 2 91  ? 44.732 23.499  59.474  1.00 20.05  ? 91  TYR B CG  1 
ATOM   5456 C CD1 . TYR D 2 91  ? 45.683 22.523  59.766  1.00 20.84  ? 91  TYR B CD1 1 
ATOM   5457 C CD2 . TYR D 2 91  ? 44.611 23.926  58.155  1.00 19.89  ? 91  TYR B CD2 1 
ATOM   5458 C CE1 . TYR D 2 91  ? 46.495 21.985  58.774  1.00 19.44  ? 91  TYR B CE1 1 
ATOM   5459 C CE2 . TYR D 2 91  ? 45.420 23.404  57.154  1.00 18.69  ? 91  TYR B CE2 1 
ATOM   5460 C CZ  . TYR D 2 91  ? 46.362 22.432  57.472  1.00 24.77  ? 91  TYR B CZ  1 
ATOM   5461 O OH  . TYR D 2 91  ? 47.190 21.924  56.503  1.00 24.74  ? 91  TYR B OH  1 
ATOM   5462 N N   . TYR D 2 92  ? 43.502 27.266  61.850  1.00 17.45  ? 92  TYR B N   1 
ATOM   5463 C CA  . TYR D 2 92  ? 42.641 28.138  62.641  1.00 19.50  ? 92  TYR B CA  1 
ATOM   5464 C C   . TYR D 2 92  ? 41.361 28.544  61.922  1.00 21.31  ? 92  TYR B C   1 
ATOM   5465 O O   . TYR D 2 92  ? 41.377 28.823  60.720  1.00 20.96  ? 92  TYR B O   1 
ATOM   5466 C CB  . TYR D 2 92  ? 43.389 29.431  62.976  1.00 22.11  ? 92  TYR B CB  1 
ATOM   5467 C CG  . TYR D 2 92  ? 44.615 29.273  63.851  1.00 26.30  ? 92  TYR B CG  1 
ATOM   5468 C CD1 . TYR D 2 92  ? 44.526 29.404  65.235  1.00 28.24  ? 92  TYR B CD1 1 
ATOM   5469 C CD2 . TYR D 2 92  ? 45.866 29.004  63.294  1.00 28.49  ? 92  TYR B CD2 1 
ATOM   5470 C CE1 . TYR D 2 92  ? 45.652 29.272  66.049  1.00 27.36  ? 92  TYR B CE1 1 
ATOM   5471 C CE2 . TYR D 2 92  ? 47.004 28.872  64.103  1.00 30.22  ? 92  TYR B CE2 1 
ATOM   5472 C CZ  . TYR D 2 92  ? 46.882 29.008  65.480  1.00 27.92  ? 92  TYR B CZ  1 
ATOM   5473 O OH  . TYR D 2 92  ? 47.994 28.878  66.284  1.00 35.04  ? 92  TYR B OH  1 
ATOM   5474 N N   . CYS D 2 93  ? 40.261 28.583  62.663  1.00 22.33  ? 93  CYS B N   1 
ATOM   5475 C CA  . CYS D 2 93  ? 39.005 29.071  62.123  1.00 20.57  ? 93  CYS B CA  1 
ATOM   5476 C C   . CYS D 2 93  ? 38.855 30.418  62.822  1.00 24.30  ? 93  CYS B C   1 
ATOM   5477 O O   . CYS D 2 93  ? 39.450 30.648  63.880  1.00 22.58  ? 93  CYS B O   1 
ATOM   5478 C CB  . CYS D 2 93  ? 37.825 28.167  62.478  1.00 22.79  ? 93  CYS B CB  1 
ATOM   5479 S SG  . CYS D 2 93  ? 37.529 27.863  64.240  1.00 30.23  ? 93  CYS B SG  1 
ATOM   5480 N N   . ALA D 2 94  ? 38.067 31.309  62.239  1.00 20.99  ? 94  ALA B N   1 
ATOM   5481 C CA  . ALA D 2 94  ? 37.879 32.627  62.822  1.00 18.91  ? 94  ALA B CA  1 
ATOM   5482 C C   . ALA D 2 94  ? 36.681 33.275  62.148  1.00 22.07  ? 94  ALA B C   1 
ATOM   5483 O O   . ALA D 2 94  ? 36.243 32.825  61.086  1.00 16.32  ? 94  ALA B O   1 
ATOM   5484 C CB  . ALA D 2 94  ? 39.141 33.471  62.608  1.00 17.99  ? 94  ALA B CB  1 
ATOM   5485 N N   . GLN D 2 95  ? 36.168 34.344  62.743  1.00 21.50  ? 95  GLN B N   1 
ATOM   5486 C CA  . GLN D 2 95  ? 35.006 35.014  62.189  1.00 17.47  ? 95  GLN B CA  1 
ATOM   5487 C C   . GLN D 2 95  ? 35.242 36.473  61.846  1.00 19.76  ? 95  GLN B C   1 
ATOM   5488 O O   . GLN D 2 95  ? 35.946 37.185  62.555  1.00 21.18  ? 95  GLN B O   1 
ATOM   5489 C CB  . GLN D 2 95  ? 33.827 34.906  63.169  1.00 20.38  ? 95  GLN B CB  1 
ATOM   5490 C CG  . GLN D 2 95  ? 34.008 35.615  64.525  1.00 21.92  ? 95  GLN B CG  1 
ATOM   5491 C CD  . GLN D 2 95  ? 33.752 37.123  64.486  1.00 22.68  ? 95  GLN B CD  1 
ATOM   5492 O OE1 . GLN D 2 95  ? 32.968 37.616  63.672  1.00 19.54  ? 95  GLN B OE1 1 
ATOM   5493 N NE2 . GLN D 2 95  ? 34.393 37.854  65.387  1.00 20.88  ? 95  GLN B NE2 1 
ATOM   5494 N N   . ASN D 2 96  ? 34.669 36.918  60.734  1.00 16.79  ? 96  ASN B N   1 
ATOM   5495 C CA  . ASN D 2 96  ? 34.797 38.318  60.367  1.00 14.49  ? 96  ASN B CA  1 
ATOM   5496 C C   . ASN D 2 96  ? 33.399 38.850  60.105  1.00 19.74  ? 96  ASN B C   1 
ATOM   5497 O O   . ASN D 2 96  ? 33.141 39.588  59.157  1.00 20.72  ? 96  ASN B O   1 
ATOM   5498 C CB  . ASN D 2 96  ? 35.755 38.508  59.178  1.00 15.57  ? 96  ASN B CB  1 
ATOM   5499 C CG  . ASN D 2 96  ? 35.269 37.864  57.896  1.00 18.08  ? 96  ASN B CG  1 
ATOM   5500 O OD1 . ASN D 2 96  ? 34.510 36.895  57.910  1.00 17.72  ? 96  ASN B OD1 1 
ATOM   5501 N ND2 . ASN D 2 96  ? 35.740 38.396  56.762  1.00 17.30  ? 96  ASN B ND2 1 
ATOM   5502 N N   . LEU D 2 97  ? 32.492 38.452  60.991  1.00 18.66  ? 97  LEU B N   1 
ATOM   5503 C CA  . LEU D 2 97  ? 31.102 38.875  60.937  1.00 20.63  ? 97  LEU B CA  1 
ATOM   5504 C C   . LEU D 2 97  ? 30.936 40.200  61.677  1.00 23.04  ? 97  LEU B C   1 
ATOM   5505 O O   . LEU D 2 97  ? 30.215 41.095  61.231  1.00 19.78  ? 97  LEU B O   1 
ATOM   5506 C CB  . LEU D 2 97  ? 30.198 37.837  61.604  1.00 19.03  ? 97  LEU B CB  1 
ATOM   5507 C CG  . LEU D 2 97  ? 28.716 38.232  61.657  1.00 23.14  ? 97  LEU B CG  1 
ATOM   5508 C CD1 . LEU D 2 97  ? 28.115 38.081  60.262  1.00 21.20  ? 97  LEU B CD1 1 
ATOM   5509 C CD2 . LEU D 2 97  ? 27.958 37.370  62.660  1.00 24.26  ? 97  LEU B CD2 1 
ATOM   5510 N N   . GLU D 2 98  ? 31.607 40.324  62.817  1.00 24.38  ? 98  GLU B N   1 
ATOM   5511 C CA  . GLU D 2 98  ? 31.485 41.540  63.606  1.00 24.93  ? 98  GLU B CA  1 
ATOM   5512 C C   . GLU D 2 98  ? 32.663 41.747  64.546  1.00 24.81  ? 98  GLU B C   1 
ATOM   5513 O O   . GLU D 2 98  ? 33.480 40.848  64.756  1.00 20.37  ? 98  GLU B O   1 
ATOM   5514 C CB  . GLU D 2 98  ? 30.179 41.496  64.407  1.00 29.89  ? 98  GLU B CB  1 
ATOM   5515 C CG  . GLU D 2 98  ? 29.968 40.185  65.148  1.00 37.79  ? 98  GLU B CG  1 
ATOM   5516 C CD  . GLU D 2 98  ? 28.653 40.126  65.918  1.00 39.88  ? 98  GLU B CD  1 
ATOM   5517 O OE1 . GLU D 2 98  ? 27.577 40.312  65.311  1.00 39.42  ? 98  GLU B OE1 1 
ATOM   5518 O OE2 . GLU D 2 98  ? 28.704 39.882  67.140  1.00 36.87  ? 98  GLU B OE2 1 
ATOM   5519 N N   . LEU D 2 99  ? 32.754 42.953  65.094  1.00 24.92  ? 99  LEU B N   1 
ATOM   5520 C CA  . LEU D 2 99  ? 33.822 43.288  66.029  1.00 25.73  ? 99  LEU B CA  1 
ATOM   5521 C C   . LEU D 2 99  ? 33.338 42.885  67.420  1.00 23.82  ? 99  LEU B C   1 
ATOM   5522 O O   . LEU D 2 99  ? 32.140 42.884  67.692  1.00 26.53  ? 99  LEU B O   1 
ATOM   5523 C CB  . LEU D 2 99  ? 34.100 44.795  66.003  1.00 24.07  ? 99  LEU B CB  1 
ATOM   5524 C CG  . LEU D 2 99  ? 34.654 45.404  64.711  1.00 27.22  ? 99  LEU B CG  1 
ATOM   5525 C CD1 . LEU D 2 99  ? 34.640 46.926  64.821  1.00 26.88  ? 99  LEU B CD1 1 
ATOM   5526 C CD2 . LEU D 2 99  ? 36.060 44.898  64.468  1.00 25.68  ? 99  LEU B CD2 1 
ATOM   5527 N N   . PRO D 2 100 ? 34.263 42.504  68.308  1.00 27.23  ? 100 PRO B N   1 
ATOM   5528 C CA  . PRO D 2 100 ? 35.696 42.444  68.036  1.00 25.88  ? 100 PRO B CA  1 
ATOM   5529 C C   . PRO D 2 100 ? 36.044 41.161  67.291  1.00 26.69  ? 100 PRO B C   1 
ATOM   5530 O O   . PRO D 2 100 ? 35.346 40.152  67.412  1.00 23.08  ? 100 PRO B O   1 
ATOM   5531 C CB  . PRO D 2 100 ? 36.303 42.474  69.432  1.00 29.84  ? 100 PRO B CB  1 
ATOM   5532 C CG  . PRO D 2 100 ? 35.318 41.691  70.219  1.00 29.63  ? 100 PRO B CG  1 
ATOM   5533 C CD  . PRO D 2 100 ? 33.995 42.255  69.738  1.00 28.50  ? 100 PRO B CD  1 
ATOM   5534 N N   . PRO D 2 101 ? 37.127 41.185  66.506  1.00 24.08  ? 101 PRO B N   1 
ATOM   5535 C CA  . PRO D 2 101 ? 37.545 39.998  65.755  1.00 24.89  ? 101 PRO B CA  1 
ATOM   5536 C C   . PRO D 2 101 ? 37.915 38.922  66.769  1.00 29.05  ? 101 PRO B C   1 
ATOM   5537 O O   . PRO D 2 101 ? 38.544 39.220  67.778  1.00 22.00  ? 101 PRO B O   1 
ATOM   5538 C CB  . PRO D 2 101 ? 38.779 40.476  64.994  1.00 20.97  ? 101 PRO B CB  1 
ATOM   5539 C CG  . PRO D 2 101 ? 38.610 41.971  64.934  1.00 27.31  ? 101 PRO B CG  1 
ATOM   5540 C CD  . PRO D 2 101 ? 38.047 42.310  66.276  1.00 19.35  ? 101 PRO B CD  1 
ATOM   5541 N N   . THR D 2 102 ? 37.519 37.683  66.512  1.00 25.37  ? 102 THR B N   1 
ATOM   5542 C CA  . THR D 2 102 ? 37.853 36.593  67.417  1.00 23.69  ? 102 THR B CA  1 
ATOM   5543 C C   . THR D 2 102 ? 38.388 35.434  66.597  1.00 25.46  ? 102 THR B C   1 
ATOM   5544 O O   . THR D 2 102 ? 38.038 35.269  65.422  1.00 22.23  ? 102 THR B O   1 
ATOM   5545 C CB  . THR D 2 102 ? 36.637 36.153  68.238  1.00 26.26  ? 102 THR B CB  1 
ATOM   5546 O OG1 . THR D 2 102 ? 35.523 35.947  67.365  1.00 23.56  ? 102 THR B OG1 1 
ATOM   5547 C CG2 . THR D 2 102 ? 36.283 37.221  69.275  1.00 23.12  ? 102 THR B CG2 1 
ATOM   5548 N N   . PHE D 2 103 ? 39.253 34.640  67.213  1.00 20.44  ? 103 PHE B N   1 
ATOM   5549 C CA  . PHE D 2 103 ? 39.881 33.526  66.528  1.00 19.43  ? 103 PHE B CA  1 
ATOM   5550 C C   . PHE D 2 103 ? 39.849 32.259  67.363  1.00 25.97  ? 103 PHE B C   1 
ATOM   5551 O O   . PHE D 2 103 ? 39.795 32.308  68.596  1.00 24.80  ? 103 PHE B O   1 
ATOM   5552 C CB  . PHE D 2 103 ? 41.334 33.874  66.194  1.00 19.42  ? 103 PHE B CB  1 
ATOM   5553 C CG  . PHE D 2 103 ? 41.537 35.310  65.788  1.00 26.39  ? 103 PHE B CG  1 
ATOM   5554 C CD1 . PHE D 2 103 ? 41.575 36.323  66.749  1.00 23.65  ? 103 PHE B CD1 1 
ATOM   5555 C CD2 . PHE D 2 103 ? 41.652 35.657  64.445  1.00 19.53  ? 103 PHE B CD2 1 
ATOM   5556 C CE1 . PHE D 2 103 ? 41.721 37.657  66.379  1.00 23.41  ? 103 PHE B CE1 1 
ATOM   5557 C CE2 . PHE D 2 103 ? 41.797 36.992  64.062  1.00 20.09  ? 103 PHE B CE2 1 
ATOM   5558 C CZ  . PHE D 2 103 ? 41.831 37.995  65.027  1.00 23.72  ? 103 PHE B CZ  1 
ATOM   5559 N N   . GLY D 2 104 ? 39.860 31.124  66.679  1.00 20.31  ? 104 GLY B N   1 
ATOM   5560 C CA  . GLY D 2 104 ? 39.851 29.853  67.375  1.00 23.93  ? 104 GLY B CA  1 
ATOM   5561 C C   . GLY D 2 104 ? 41.241 29.583  67.918  1.00 19.28  ? 104 GLY B C   1 
ATOM   5562 O O   . GLY D 2 104 ? 42.198 30.251  67.526  1.00 16.93  ? 104 GLY B O   1 
ATOM   5563 N N   . GLY D 2 105 ? 41.354 28.601  68.806  1.00 27.33  ? 105 GLY B N   1 
ATOM   5564 C CA  . GLY D 2 105 ? 42.647 28.270  69.381  1.00 28.13  ? 105 GLY B CA  1 
ATOM   5565 C C   . GLY D 2 105 ? 43.556 27.495  68.444  1.00 28.62  ? 105 GLY B C   1 
ATOM   5566 O O   . GLY D 2 105 ? 44.717 27.248  68.765  1.00 25.70  ? 105 GLY B O   1 
ATOM   5567 N N   . GLY D 2 106 ? 43.032 27.093  67.289  1.00 25.48  ? 106 GLY B N   1 
ATOM   5568 C CA  . GLY D 2 106 ? 43.842 26.354  66.331  1.00 26.17  ? 106 GLY B CA  1 
ATOM   5569 C C   . GLY D 2 106 ? 43.927 24.858  66.588  1.00 28.59  ? 106 GLY B C   1 
ATOM   5570 O O   . GLY D 2 106 ? 43.997 24.422  67.738  1.00 24.93  ? 106 GLY B O   1 
ATOM   5571 N N   . THR D 2 107 ? 43.916 24.072  65.510  1.00 24.13  ? 107 THR B N   1 
ATOM   5572 C CA  . THR D 2 107 ? 43.995 22.614  65.602  1.00 23.40  ? 107 THR B CA  1 
ATOM   5573 C C   . THR D 2 107 ? 45.231 22.146  64.859  1.00 27.00  ? 107 THR B C   1 
ATOM   5574 O O   . THR D 2 107 ? 45.362 22.389  63.660  1.00 25.27  ? 107 THR B O   1 
ATOM   5575 C CB  . THR D 2 107 ? 42.772 21.925  64.940  1.00 20.30  ? 107 THR B CB  1 
ATOM   5576 O OG1 . THR D 2 107 ? 41.576 22.332  65.595  1.00 20.07  ? 107 THR B OG1 1 
ATOM   5577 C CG2 . THR D 2 107 ? 42.890 20.415  65.030  1.00 21.40  ? 107 THR B CG2 1 
ATOM   5578 N N   . LYS D 2 108 ? 46.143 21.477  65.558  1.00 26.08  ? 108 LYS B N   1 
ATOM   5579 C CA  . LYS D 2 108 ? 47.347 20.985  64.908  1.00 25.85  ? 108 LYS B CA  1 
ATOM   5580 C C   . LYS D 2 108 ? 47.057 19.706  64.128  1.00 27.40  ? 108 LYS B C   1 
ATOM   5581 O O   . LYS D 2 108 ? 46.461 18.767  64.654  1.00 28.28  ? 108 LYS B O   1 
ATOM   5582 C CB  . LYS D 2 108 ? 48.455 20.730  65.942  1.00 33.12  ? 108 LYS B CB  1 
ATOM   5583 C CG  . LYS D 2 108 ? 49.684 20.035  65.365  1.00 34.97  ? 108 LYS B CG  1 
ATOM   5584 C CD  . LYS D 2 108 ? 50.881 20.104  66.296  1.00 42.22  ? 108 LYS B CD  1 
ATOM   5585 C CE  . LYS D 2 108 ? 51.422 21.524  66.387  1.00 46.35  ? 108 LYS B CE  1 
ATOM   5586 N NZ  . LYS D 2 108 ? 52.672 21.595  67.197  1.00 55.94  ? 108 LYS B NZ  1 
ATOM   5587 N N   . LEU D 2 109 ? 47.466 19.684  62.862  1.00 25.44  ? 109 LEU B N   1 
ATOM   5588 C CA  . LEU D 2 109 ? 47.268 18.510  62.017  1.00 25.12  ? 109 LEU B CA  1 
ATOM   5589 C C   . LEU D 2 109 ? 48.456 17.555  62.190  1.00 27.27  ? 109 LEU B C   1 
ATOM   5590 O O   . LEU D 2 109 ? 49.606 17.920  61.942  1.00 27.71  ? 109 LEU B O   1 
ATOM   5591 C CB  . LEU D 2 109 ? 47.163 18.909  60.541  1.00 19.61  ? 109 LEU B CB  1 
ATOM   5592 C CG  . LEU D 2 109 ? 47.082 17.710  59.590  1.00 19.19  ? 109 LEU B CG  1 
ATOM   5593 C CD1 . LEU D 2 109 ? 45.836 16.903  59.915  1.00 27.07  ? 109 LEU B CD1 1 
ATOM   5594 C CD2 . LEU D 2 109 ? 47.042 18.173  58.134  1.00 27.00  ? 109 LEU B CD2 1 
ATOM   5595 N N   . GLU D 2 110 ? 48.176 16.329  62.608  1.00 31.66  ? 110 GLU B N   1 
ATOM   5596 C CA  . GLU D 2 110 ? 49.235 15.344  62.799  1.00 37.47  ? 110 GLU B CA  1 
ATOM   5597 C C   . GLU D 2 110 ? 49.206 14.259  61.729  1.00 38.61  ? 110 GLU B C   1 
ATOM   5598 O O   . GLU D 2 110 ? 48.149 13.720  61.403  1.00 38.06  ? 110 GLU B O   1 
ATOM   5599 C CB  . GLU D 2 110 ? 49.108 14.702  64.176  1.00 38.95  ? 110 GLU B CB  1 
ATOM   5600 C CG  . GLU D 2 110 ? 49.198 15.696  65.322  1.00 52.37  ? 110 GLU B CG  1 
ATOM   5601 C CD  . GLU D 2 110 ? 49.243 15.022  66.681  1.00 58.94  ? 110 GLU B CD  1 
ATOM   5602 O OE1 . GLU D 2 110 ? 48.297 14.276  67.012  1.00 63.71  ? 110 GLU B OE1 1 
ATOM   5603 O OE2 . GLU D 2 110 ? 50.228 15.240  67.420  1.00 65.05  ? 110 GLU B OE2 1 
ATOM   5604 N N   . ILE D 2 111 ? 50.372 13.931  61.189  1.00 37.24  ? 111 ILE B N   1 
ATOM   5605 C CA  . ILE D 2 111 ? 50.458 12.906  60.164  1.00 37.04  ? 111 ILE B CA  1 
ATOM   5606 C C   . ILE D 2 111 ? 50.859 11.568  60.773  1.00 39.54  ? 111 ILE B C   1 
ATOM   5607 O O   . ILE D 2 111 ? 51.685 11.514  61.688  1.00 37.66  ? 111 ILE B O   1 
ATOM   5608 C CB  . ILE D 2 111 ? 51.487 13.286  59.088  1.00 38.66  ? 111 ILE B CB  1 
ATOM   5609 C CG1 . ILE D 2 111 ? 51.171 14.679  58.540  1.00 40.14  ? 111 ILE B CG1 1 
ATOM   5610 C CG2 . ILE D 2 111 ? 51.492 12.250  57.972  1.00 38.05  ? 111 ILE B CG2 1 
ATOM   5611 C CD1 . ILE D 2 111 ? 49.737 14.860  58.079  1.00 37.62  ? 111 ILE B CD1 1 
ATOM   5612 N N   . LYS D 2 112 ? 50.255 10.495  60.272  1.00 41.61  ? 112 LYS B N   1 
ATOM   5613 C CA  . LYS D 2 112 ? 50.556 9.149   60.741  1.00 43.10  ? 112 LYS B CA  1 
ATOM   5614 C C   . LYS D 2 112 ? 51.720 8.573   59.941  1.00 43.89  ? 112 LYS B C   1 
ATOM   5615 O O   . LYS D 2 112 ? 51.828 8.792   58.734  1.00 42.98  ? 112 LYS B O   1 
ATOM   5616 C CB  . LYS D 2 112 ? 49.337 8.232   60.588  1.00 47.60  ? 112 LYS B CB  1 
ATOM   5617 C CG  . LYS D 2 112 ? 49.646 6.761   60.860  1.00 52.79  ? 112 LYS B CG  1 
ATOM   5618 C CD  . LYS D 2 112 ? 48.443 5.856   60.618  1.00 59.23  ? 112 LYS B CD  1 
ATOM   5619 C CE  . LYS D 2 112 ? 47.386 6.017   61.699  1.00 62.39  ? 112 LYS B CE  1 
ATOM   5620 N NZ  . LYS D 2 112 ? 47.907 5.621   63.040  1.00 64.36  ? 112 LYS B NZ  1 
ATOM   5621 N N   . ARG D 2 113 ? 52.589 7.840   60.627  1.00 45.00  ? 113 ARG B N   1 
ATOM   5622 C CA  . ARG D 2 113 ? 53.744 7.211   60.001  1.00 47.54  ? 113 ARG B CA  1 
ATOM   5623 C C   . ARG D 2 113 ? 54.114 5.994   60.831  1.00 46.64  ? 113 ARG B C   1 
ATOM   5624 O O   . ARG D 2 113 ? 53.508 5.744   61.871  1.00 46.38  ? 113 ARG B O   1 
ATOM   5625 C CB  . ARG D 2 113 ? 54.935 8.173   59.952  1.00 47.69  ? 113 ARG B CB  1 
ATOM   5626 C CG  . ARG D 2 113 ? 55.419 8.638   61.316  1.00 51.57  ? 113 ARG B CG  1 
ATOM   5627 C CD  . ARG D 2 113 ? 56.805 9.280   61.252  1.00 54.62  ? 113 ARG B CD  1 
ATOM   5628 N NE  . ARG D 2 113 ? 57.879 8.304   61.051  1.00 56.65  ? 113 ARG B NE  1 
ATOM   5629 C CZ  . ARG D 2 113 ? 58.217 7.774   59.878  1.00 58.37  ? 113 ARG B CZ  1 
ATOM   5630 N NH1 . ARG D 2 113 ? 57.571 8.118   58.772  1.00 61.72  ? 113 ARG B NH1 1 
ATOM   5631 N NH2 . ARG D 2 113 ? 59.205 6.892   59.812  1.00 58.39  ? 113 ARG B NH2 1 
ATOM   5632 N N   . ALA D 2 114 ? 55.107 5.242   60.368  1.00 52.27  ? 114 ALA B N   1 
ATOM   5633 C CA  . ALA D 2 114 ? 55.558 4.048   61.075  1.00 54.08  ? 114 ALA B CA  1 
ATOM   5634 C C   . ALA D 2 114 ? 56.356 4.427   62.320  1.00 55.77  ? 114 ALA B C   1 
ATOM   5635 O O   . ALA D 2 114 ? 57.039 5.453   62.341  1.00 57.87  ? 114 ALA B O   1 
ATOM   5636 C CB  . ALA D 2 114 ? 56.414 3.193   60.148  1.00 52.57  ? 114 ALA B CB  1 
ATOM   5637 N N   . ASP D 2 115 ? 56.263 3.603   63.360  1.00 56.52  ? 115 ASP B N   1 
ATOM   5638 C CA  . ASP D 2 115 ? 57.000 3.859   64.593  1.00 58.00  ? 115 ASP B CA  1 
ATOM   5639 C C   . ASP D 2 115 ? 58.481 3.993   64.247  1.00 55.24  ? 115 ASP B C   1 
ATOM   5640 O O   . ASP D 2 115 ? 58.908 3.618   63.152  1.00 48.97  ? 115 ASP B O   1 
ATOM   5641 C CB  . ASP D 2 115 ? 56.811 2.707   65.585  1.00 63.81  ? 115 ASP B CB  1 
ATOM   5642 C CG  . ASP D 2 115 ? 55.357 2.478   65.947  1.00 70.70  ? 115 ASP B CG  1 
ATOM   5643 O OD1 . ASP D 2 115 ? 54.549 2.229   65.026  1.00 75.30  ? 115 ASP B OD1 1 
ATOM   5644 O OD2 . ASP D 2 115 ? 55.022 2.543   67.152  1.00 70.66  ? 115 ASP B OD2 1 
ATOM   5645 N N   . ALA D 2 116 ? 59.264 4.528   65.178  1.00 51.79  ? 116 ALA B N   1 
ATOM   5646 C CA  . ALA D 2 116 ? 60.692 4.697   64.947  1.00 49.91  ? 116 ALA B CA  1 
ATOM   5647 C C   . ALA D 2 116 ? 61.399 5.120   66.222  1.00 51.55  ? 116 ALA B C   1 
ATOM   5648 O O   . ALA D 2 116 ? 60.990 6.077   66.882  1.00 53.24  ? 116 ALA B O   1 
ATOM   5649 C CB  . ALA D 2 116 ? 60.929 5.732   63.854  1.00 45.42  ? 116 ALA B CB  1 
ATOM   5650 N N   . ALA D 2 117 ? 62.457 4.392   66.572  1.00 51.02  ? 117 ALA B N   1 
ATOM   5651 C CA  . ALA D 2 117 ? 63.236 4.700   67.765  1.00 51.26  ? 117 ALA B CA  1 
ATOM   5652 C C   . ALA D 2 117 ? 64.138 5.892   67.446  1.00 49.90  ? 117 ALA B C   1 
ATOM   5653 O O   . ALA D 2 117 ? 64.663 6.006   66.338  1.00 43.26  ? 117 ALA B O   1 
ATOM   5654 C CB  . ALA D 2 117 ? 64.077 3.487   68.176  1.00 51.03  ? 117 ALA B CB  1 
ATOM   5655 N N   . PRO D 2 118 ? 64.330 6.797   68.420  1.00 52.07  ? 118 PRO B N   1 
ATOM   5656 C CA  . PRO D 2 118 ? 65.168 7.986   68.236  1.00 52.36  ? 118 PRO B CA  1 
ATOM   5657 C C   . PRO D 2 118 ? 66.665 7.709   68.125  1.00 53.24  ? 118 PRO B C   1 
ATOM   5658 O O   . PRO D 2 118 ? 67.184 6.787   68.758  1.00 54.04  ? 118 PRO B O   1 
ATOM   5659 C CB  . PRO D 2 118 ? 64.834 8.826   69.467  1.00 53.52  ? 118 PRO B CB  1 
ATOM   5660 C CG  . PRO D 2 118 ? 64.631 7.776   70.522  1.00 53.02  ? 118 PRO B CG  1 
ATOM   5661 C CD  . PRO D 2 118 ? 63.777 6.752   69.787  1.00 51.94  ? 118 PRO B CD  1 
ATOM   5662 N N   . THR D 2 119 ? 67.350 8.509   67.311  1.00 54.63  ? 119 THR B N   1 
ATOM   5663 C CA  . THR D 2 119 ? 68.796 8.387   67.141  1.00 58.05  ? 119 THR B CA  1 
ATOM   5664 C C   . THR D 2 119 ? 69.404 9.244   68.245  1.00 59.04  ? 119 THR B C   1 
ATOM   5665 O O   . THR D 2 119 ? 69.385 10.472  68.162  1.00 59.73  ? 119 THR B O   1 
ATOM   5666 C CB  . THR D 2 119 ? 69.264 8.942   65.775  1.00 59.02  ? 119 THR B CB  1 
ATOM   5667 O OG1 . THR D 2 119 ? 68.695 8.164   64.714  1.00 56.34  ? 119 THR B OG1 1 
ATOM   5668 C CG2 . THR D 2 119 ? 70.783 8.899   65.678  1.00 57.09  ? 119 THR B CG2 1 
ATOM   5669 N N   . VAL D 2 120 ? 69.935 8.602   69.281  1.00 59.39  ? 120 VAL B N   1 
ATOM   5670 C CA  . VAL D 2 120 ? 70.511 9.335   70.401  1.00 59.64  ? 120 VAL B CA  1 
ATOM   5671 C C   . VAL D 2 120 ? 72.000 9.642   70.240  1.00 60.00  ? 120 VAL B C   1 
ATOM   5672 O O   . VAL D 2 120 ? 72.802 8.758   69.939  1.00 62.20  ? 120 VAL B O   1 
ATOM   5673 C CB  . VAL D 2 120 ? 70.290 8.567   71.723  1.00 60.27  ? 120 VAL B CB  1 
ATOM   5674 C CG1 . VAL D 2 120 ? 70.683 9.433   72.905  1.00 61.65  ? 120 VAL B CG1 1 
ATOM   5675 C CG2 . VAL D 2 120 ? 68.832 8.149   71.843  1.00 58.91  ? 120 VAL B CG2 1 
ATOM   5676 N N   . SER D 2 121 ? 72.353 10.910  70.440  1.00 58.63  ? 121 SER B N   1 
ATOM   5677 C CA  . SER D 2 121 ? 73.732 11.384  70.336  1.00 56.10  ? 121 SER B CA  1 
ATOM   5678 C C   . SER D 2 121 ? 74.000 12.329  71.505  1.00 58.62  ? 121 SER B C   1 
ATOM   5679 O O   . SER D 2 121 ? 73.317 13.345  71.652  1.00 58.41  ? 121 SER B O   1 
ATOM   5680 C CB  . SER D 2 121 ? 73.940 12.139  69.020  1.00 52.17  ? 121 SER B CB  1 
ATOM   5681 O OG  . SER D 2 121 ? 73.681 11.315  67.896  1.00 53.79  ? 121 SER B OG  1 
ATOM   5682 N N   . ILE D 2 122 ? 74.979 11.994  72.341  1.00 57.27  ? 122 ILE B N   1 
ATOM   5683 C CA  . ILE D 2 122 ? 75.303 12.831  73.494  1.00 58.07  ? 122 ILE B CA  1 
ATOM   5684 C C   . ILE D 2 122 ? 76.636 13.554  73.303  1.00 56.98  ? 122 ILE B C   1 
ATOM   5685 O O   . ILE D 2 122 ? 77.526 13.058  72.612  1.00 56.87  ? 122 ILE B O   1 
ATOM   5686 C CB  . ILE D 2 122 ? 75.351 11.992  74.796  1.00 59.79  ? 122 ILE B CB  1 
ATOM   5687 C CG1 . ILE D 2 122 ? 75.505 12.916  76.007  1.00 59.57  ? 122 ILE B CG1 1 
ATOM   5688 C CG2 . ILE D 2 122 ? 76.496 10.989  74.730  1.00 57.47  ? 122 ILE B CG2 1 
ATOM   5689 C CD1 . ILE D 2 122 ? 75.382 12.210  77.340  1.00 60.22  ? 122 ILE B CD1 1 
ATOM   5690 N N   . PHE D 2 123 ? 76.760 14.734  73.906  1.00 55.15  ? 123 PHE B N   1 
ATOM   5691 C CA  . PHE D 2 123 ? 77.979 15.529  73.796  1.00 53.26  ? 123 PHE B CA  1 
ATOM   5692 C C   . PHE D 2 123 ? 78.357 16.155  75.137  1.00 55.06  ? 123 PHE B C   1 
ATOM   5693 O O   . PHE D 2 123 ? 77.506 16.709  75.842  1.00 54.82  ? 123 PHE B O   1 
ATOM   5694 C CB  . PHE D 2 123 ? 77.805 16.644  72.758  1.00 53.91  ? 123 PHE B CB  1 
ATOM   5695 C CG  . PHE D 2 123 ? 77.311 16.165  71.422  1.00 51.49  ? 123 PHE B CG  1 
ATOM   5696 C CD1 . PHE D 2 123 ? 75.982 15.783  71.251  1.00 50.51  ? 123 PHE B CD1 1 
ATOM   5697 C CD2 . PHE D 2 123 ? 78.176 16.088  70.335  1.00 48.25  ? 123 PHE B CD2 1 
ATOM   5698 C CE1 . PHE D 2 123 ? 75.524 15.331  70.013  1.00 48.14  ? 123 PHE B CE1 1 
ATOM   5699 C CE2 . PHE D 2 123 ? 77.726 15.639  69.095  1.00 45.54  ? 123 PHE B CE2 1 
ATOM   5700 C CZ  . PHE D 2 123 ? 76.398 15.260  68.937  1.00 44.90  ? 123 PHE B CZ  1 
ATOM   5701 N N   . PRO D 2 124 ? 79.645 16.067  75.509  1.00 54.43  ? 124 PRO B N   1 
ATOM   5702 C CA  . PRO D 2 124 ? 80.145 16.628  76.768  1.00 53.14  ? 124 PRO B CA  1 
ATOM   5703 C C   . PRO D 2 124 ? 80.433 18.117  76.596  1.00 52.17  ? 124 PRO B C   1 
ATOM   5704 O O   . PRO D 2 124 ? 80.566 18.603  75.470  1.00 49.65  ? 124 PRO B O   1 
ATOM   5705 C CB  . PRO D 2 124 ? 81.416 15.827  77.009  1.00 54.19  ? 124 PRO B CB  1 
ATOM   5706 C CG  . PRO D 2 124 ? 81.951 15.676  75.615  1.00 56.04  ? 124 PRO B CG  1 
ATOM   5707 C CD  . PRO D 2 124 ? 80.705 15.304  74.823  1.00 56.11  ? 124 PRO B CD  1 
ATOM   5708 N N   . PRO D 2 125 ? 80.541 18.860  77.710  1.00 52.84  ? 125 PRO B N   1 
ATOM   5709 C CA  . PRO D 2 125 ? 80.818 20.295  77.607  1.00 53.20  ? 125 PRO B CA  1 
ATOM   5710 C C   . PRO D 2 125 ? 81.963 20.547  76.632  1.00 53.58  ? 125 PRO B C   1 
ATOM   5711 O O   . PRO D 2 125 ? 82.926 19.785  76.590  1.00 53.66  ? 125 PRO B O   1 
ATOM   5712 C CB  . PRO D 2 125 ? 81.183 20.677  79.040  1.00 52.63  ? 125 PRO B CB  1 
ATOM   5713 C CG  . PRO D 2 125 ? 80.347 19.750  79.851  1.00 52.72  ? 125 PRO B CG  1 
ATOM   5714 C CD  . PRO D 2 125 ? 80.503 18.432  79.119  1.00 50.54  ? 125 PRO B CD  1 
ATOM   5715 N N   . SER D 2 126 ? 81.849 21.606  75.840  1.00 56.04  ? 126 SER B N   1 
ATOM   5716 C CA  . SER D 2 126 ? 82.887 21.944  74.877  1.00 56.73  ? 126 SER B CA  1 
ATOM   5717 C C   . SER D 2 126 ? 84.043 22.614  75.613  1.00 59.12  ? 126 SER B C   1 
ATOM   5718 O O   . SER D 2 126 ? 83.837 23.278  76.633  1.00 58.13  ? 126 SER B O   1 
ATOM   5719 C CB  . SER D 2 126 ? 82.327 22.887  73.811  1.00 57.86  ? 126 SER B CB  1 
ATOM   5720 O OG  . SER D 2 126 ? 83.329 23.277  72.889  1.00 59.98  ? 126 SER B OG  1 
ATOM   5721 N N   . SER D 2 127 ? 85.258 22.432  75.103  1.00 59.20  ? 127 SER B N   1 
ATOM   5722 C CA  . SER D 2 127 ? 86.437 23.024  75.724  1.00 61.09  ? 127 SER B CA  1 
ATOM   5723 C C   . SER D 2 127 ? 86.282 24.537  75.792  1.00 61.80  ? 127 SER B C   1 
ATOM   5724 O O   . SER D 2 127 ? 86.626 25.167  76.794  1.00 58.36  ? 127 SER B O   1 
ATOM   5725 C CB  . SER D 2 127 ? 87.694 22.664  74.926  1.00 62.30  ? 127 SER B CB  1 
ATOM   5726 O OG  . SER D 2 127 ? 87.572 23.063  73.572  1.00 62.91  ? 127 SER B OG  1 
ATOM   5727 N N   . GLU D 2 128 ? 85.749 25.111  74.719  1.00 62.11  ? 128 GLU B N   1 
ATOM   5728 C CA  . GLU D 2 128 ? 85.543 26.549  74.644  1.00 61.24  ? 128 GLU B CA  1 
ATOM   5729 C C   . GLU D 2 128 ? 84.562 27.015  75.713  1.00 59.80  ? 128 GLU B C   1 
ATOM   5730 O O   . GLU D 2 128 ? 84.678 28.126  76.226  1.00 59.37  ? 128 GLU B O   1 
ATOM   5731 C CB  . GLU D 2 128 ? 85.024 26.924  73.258  1.00 63.14  ? 128 GLU B CB  1 
ATOM   5732 C CG  . GLU D 2 128 ? 85.874 26.370  72.128  1.00 67.86  ? 128 GLU B CG  1 
ATOM   5733 C CD  . GLU D 2 128 ? 85.313 26.694  70.759  1.00 70.72  ? 128 GLU B CD  1 
ATOM   5734 O OE1 . GLU D 2 128 ? 85.864 26.190  69.757  1.00 70.45  ? 128 GLU B OE1 1 
ATOM   5735 O OE2 . GLU D 2 128 ? 84.323 27.453  70.683  1.00 74.83  ? 128 GLU B OE2 1 
ATOM   5736 N N   . GLN D 2 129 ? 83.597 26.164  76.049  1.00 60.07  ? 129 GLN B N   1 
ATOM   5737 C CA  . GLN D 2 129 ? 82.608 26.512  77.063  1.00 60.94  ? 129 GLN B CA  1 
ATOM   5738 C C   . GLN D 2 129 ? 83.183 26.398  78.469  1.00 60.74  ? 129 GLN B C   1 
ATOM   5739 O O   . GLN D 2 129 ? 82.887 27.218  79.339  1.00 62.49  ? 129 GLN B O   1 
ATOM   5740 C CB  . GLN D 2 129 ? 81.369 25.619  76.945  1.00 59.57  ? 129 GLN B CB  1 
ATOM   5741 C CG  . GLN D 2 129 ? 80.428 25.749  78.135  1.00 59.16  ? 129 GLN B CG  1 
ATOM   5742 C CD  . GLN D 2 129 ? 79.155 24.938  77.989  1.00 59.72  ? 129 GLN B CD  1 
ATOM   5743 O OE1 . GLN D 2 129 ? 79.187 23.766  77.609  1.00 55.99  ? 129 GLN B OE1 1 
ATOM   5744 N NE2 . GLN D 2 129 ? 78.024 25.557  78.311  1.00 58.51  ? 129 GLN B NE2 1 
ATOM   5745 N N   . LEU D 2 130 ? 83.999 25.376  78.694  1.00 61.83  ? 130 LEU B N   1 
ATOM   5746 C CA  . LEU D 2 130 ? 84.603 25.179  80.003  1.00 63.33  ? 130 LEU B CA  1 
ATOM   5747 C C   . LEU D 2 130 ? 85.581 26.298  80.332  1.00 64.57  ? 130 LEU B C   1 
ATOM   5748 O O   . LEU D 2 130 ? 85.685 26.717  81.485  1.00 63.88  ? 130 LEU B O   1 
ATOM   5749 C CB  . LEU D 2 130 ? 85.317 23.829  80.060  1.00 61.02  ? 130 LEU B CB  1 
ATOM   5750 C CG  . LEU D 2 130 ? 84.394 22.610  80.057  1.00 59.36  ? 130 LEU B CG  1 
ATOM   5751 C CD1 . LEU D 2 130 ? 85.226 21.346  80.034  1.00 59.51  ? 130 LEU B CD1 1 
ATOM   5752 C CD2 . LEU D 2 130 ? 83.499 22.636  81.290  1.00 57.31  ? 130 LEU B CD2 1 
ATOM   5753 N N   . THR D 2 131 ? 86.290 26.786  79.317  1.00 64.94  ? 131 THR B N   1 
ATOM   5754 C CA  . THR D 2 131 ? 87.258 27.858  79.515  1.00 66.56  ? 131 THR B CA  1 
ATOM   5755 C C   . THR D 2 131 ? 86.578 29.123  80.031  1.00 68.95  ? 131 THR B C   1 
ATOM   5756 O O   . THR D 2 131 ? 87.243 30.042  80.509  1.00 69.61  ? 131 THR B O   1 
ATOM   5757 C CB  . THR D 2 131 ? 88.012 28.195  78.208  1.00 67.68  ? 131 THR B CB  1 
ATOM   5758 O OG1 . THR D 2 131 ? 87.080 28.625  77.209  1.00 68.08  ? 131 THR B OG1 1 
ATOM   5759 C CG2 . THR D 2 131 ? 88.771 26.978  77.701  1.00 66.24  ? 131 THR B CG2 1 
ATOM   5760 N N   . SER D 2 132 ? 85.252 29.166  79.934  1.00 69.30  ? 132 SER B N   1 
ATOM   5761 C CA  . SER D 2 132 ? 84.495 30.321  80.402  1.00 70.32  ? 132 SER B CA  1 
ATOM   5762 C C   . SER D 2 132 ? 83.810 30.003  81.731  1.00 70.63  ? 132 SER B C   1 
ATOM   5763 O O   . SER D 2 132 ? 83.099 30.837  82.292  1.00 70.22  ? 132 SER B O   1 
ATOM   5764 C CB  . SER D 2 132 ? 83.447 30.733  79.363  1.00 71.12  ? 132 SER B CB  1 
ATOM   5765 O OG  . SER D 2 132 ? 82.448 29.740  79.219  1.00 75.45  ? 132 SER B OG  1 
ATOM   5766 N N   . GLY D 2 133 ? 84.025 28.789  82.227  1.00 69.62  ? 133 GLY B N   1 
ATOM   5767 C CA  . GLY D 2 133 ? 83.434 28.397  83.493  1.00 69.71  ? 133 GLY B CA  1 
ATOM   5768 C C   . GLY D 2 133 ? 82.140 27.617  83.379  1.00 69.41  ? 133 GLY B C   1 
ATOM   5769 O O   . GLY D 2 133 ? 81.736 26.936  84.325  1.00 69.76  ? 133 GLY B O   1 
ATOM   5770 N N   . GLY D 2 134 ? 81.484 27.715  82.227  1.00 68.58  ? 134 GLY B N   1 
ATOM   5771 C CA  . GLY D 2 134 ? 80.233 27.005  82.030  1.00 66.58  ? 134 GLY B CA  1 
ATOM   5772 C C   . GLY D 2 134 ? 80.437 25.520  81.808  1.00 65.31  ? 134 GLY B C   1 
ATOM   5773 O O   . GLY D 2 134 ? 81.566 25.064  81.618  1.00 64.25  ? 134 GLY B O   1 
ATOM   5774 N N   . ALA D 2 135 ? 79.342 24.763  81.830  1.00 63.02  ? 135 ALA B N   1 
ATOM   5775 C CA  . ALA D 2 135 ? 79.402 23.320  81.628  1.00 61.62  ? 135 ALA B CA  1 
ATOM   5776 C C   . ALA D 2 135 ? 78.019 22.725  81.380  1.00 60.45  ? 135 ALA B C   1 
ATOM   5777 O O   . ALA D 2 135 ? 77.280 22.442  82.323  1.00 62.41  ? 135 ALA B O   1 
ATOM   5778 C CB  . ALA D 2 135 ? 80.045 22.653  82.838  1.00 60.85  ? 135 ALA B CB  1 
ATOM   5779 N N   . SER D 2 136 ? 77.674 22.533  80.112  1.00 56.25  ? 136 SER B N   1 
ATOM   5780 C CA  . SER D 2 136 ? 76.380 21.961  79.760  1.00 54.41  ? 136 SER B CA  1 
ATOM   5781 C C   . SER D 2 136 ? 76.574 20.718  78.899  1.00 52.78  ? 136 SER B C   1 
ATOM   5782 O O   . SER D 2 136 ? 77.382 20.715  77.963  1.00 50.27  ? 136 SER B O   1 
ATOM   5783 C CB  . SER D 2 136 ? 75.533 22.979  78.996  1.00 54.21  ? 136 SER B CB  1 
ATOM   5784 O OG  . SER D 2 136 ? 76.071 23.207  77.705  1.00 58.05  ? 136 SER B OG  1 
ATOM   5785 N N   . VAL D 2 137 ? 75.838 19.661  79.227  1.00 50.03  ? 137 VAL B N   1 
ATOM   5786 C CA  . VAL D 2 137 ? 75.918 18.414  78.480  1.00 49.55  ? 137 VAL B CA  1 
ATOM   5787 C C   . VAL D 2 137 ? 74.661 18.306  77.622  1.00 49.62  ? 137 VAL B C   1 
ATOM   5788 O O   . VAL D 2 137 ? 73.546 18.502  78.109  1.00 49.35  ? 137 VAL B O   1 
ATOM   5789 C CB  . VAL D 2 137 ? 76.032 17.202  79.433  1.00 47.59  ? 137 VAL B CB  1 
ATOM   5790 C CG1 . VAL D 2 137 ? 74.833 17.150  80.355  1.00 51.74  ? 137 VAL B CG1 1 
ATOM   5791 C CG2 . VAL D 2 137 ? 76.167 15.919  78.632  1.00 47.93  ? 137 VAL B CG2 1 
ATOM   5792 N N   . VAL D 2 138 ? 74.852 17.999  76.343  1.00 51.28  ? 138 VAL B N   1 
ATOM   5793 C CA  . VAL D 2 138 ? 73.743 17.912  75.402  1.00 53.01  ? 138 VAL B CA  1 
ATOM   5794 C C   . VAL D 2 138 ? 73.610 16.558  74.725  1.00 56.72  ? 138 VAL B C   1 
ATOM   5795 O O   . VAL D 2 138 ? 74.604 15.898  74.429  1.00 56.34  ? 138 VAL B O   1 
ATOM   5796 C CB  . VAL D 2 138 ? 73.893 18.981  74.290  1.00 53.12  ? 138 VAL B CB  1 
ATOM   5797 C CG1 . VAL D 2 138 ? 72.701 18.935  73.343  1.00 52.06  ? 138 VAL B CG1 1 
ATOM   5798 C CG2 . VAL D 2 138 ? 74.035 20.362  74.912  1.00 52.81  ? 138 VAL B CG2 1 
ATOM   5799 N N   . CYS D 2 139 ? 72.368 16.150  74.483  1.00 60.01  ? 139 CYS B N   1 
ATOM   5800 C CA  . CYS D 2 139 ? 72.097 14.899  73.797  1.00 61.81  ? 139 CYS B CA  1 
ATOM   5801 C C   . CYS D 2 139 ? 70.785 14.992  73.031  1.00 60.27  ? 139 CYS B C   1 
ATOM   5802 O O   . CYS D 2 139 ? 69.761 15.416  73.567  1.00 59.85  ? 139 CYS B O   1 
ATOM   5803 C CB  . CYS D 2 139 ? 72.090 13.720  74.778  1.00 65.47  ? 139 CYS B CB  1 
ATOM   5804 S SG  . CYS D 2 139 ? 70.988 13.813  76.220  1.00 74.94  ? 139 CYS B SG  1 
ATOM   5805 N N   . PHE D 2 140 ? 70.840 14.616  71.759  1.00 57.58  ? 140 PHE B N   1 
ATOM   5806 C CA  . PHE D 2 140 ? 69.676 14.666  70.893  1.00 56.48  ? 140 PHE B CA  1 
ATOM   5807 C C   . PHE D 2 140 ? 68.985 13.319  70.728  1.00 56.99  ? 140 PHE B C   1 
ATOM   5808 O O   . PHE D 2 140 ? 69.636 12.283  70.598  1.00 57.97  ? 140 PHE B O   1 
ATOM   5809 C CB  . PHE D 2 140 ? 70.075 15.162  69.500  1.00 58.11  ? 140 PHE B CB  1 
ATOM   5810 C CG  . PHE D 2 140 ? 70.779 16.488  69.495  1.00 59.70  ? 140 PHE B CG  1 
ATOM   5811 C CD1 . PHE D 2 140 ? 70.191 17.610  70.069  1.00 58.00  ? 140 PHE B CD1 1 
ATOM   5812 C CD2 . PHE D 2 140 ? 72.017 16.625  68.870  1.00 60.48  ? 140 PHE B CD2 1 
ATOM   5813 C CE1 . PHE D 2 140 ? 70.825 18.852  70.018  1.00 58.86  ? 140 PHE B CE1 1 
ATOM   5814 C CE2 . PHE D 2 140 ? 72.659 17.860  68.814  1.00 60.47  ? 140 PHE B CE2 1 
ATOM   5815 C CZ  . PHE D 2 140 ? 72.061 18.977  69.387  1.00 59.35  ? 140 PHE B CZ  1 
ATOM   5816 N N   . LEU D 2 141 ? 67.657 13.352  70.744  1.00 55.32  ? 141 LEU B N   1 
ATOM   5817 C CA  . LEU D 2 141 ? 66.832 12.169  70.528  1.00 53.62  ? 141 LEU B CA  1 
ATOM   5818 C C   . LEU D 2 141 ? 66.101 12.587  69.263  1.00 53.76  ? 141 LEU B C   1 
ATOM   5819 O O   . LEU D 2 141 ? 65.043 13.215  69.318  1.00 55.53  ? 141 LEU B O   1 
ATOM   5820 C CB  . LEU D 2 141 ? 65.846 11.960  71.682  1.00 55.11  ? 141 LEU B CB  1 
ATOM   5821 C CG  . LEU D 2 141 ? 66.420 11.404  72.991  1.00 55.22  ? 141 LEU B CG  1 
ATOM   5822 C CD1 . LEU D 2 141 ? 67.502 12.322  73.510  1.00 54.02  ? 141 LEU B CD1 1 
ATOM   5823 C CD2 . LEU D 2 141 ? 65.312 11.260  74.018  1.00 56.17  ? 141 LEU B CD2 1 
ATOM   5824 N N   . ASN D 2 142 ? 66.693 12.259  68.120  1.00 51.58  ? 142 ASN B N   1 
ATOM   5825 C CA  . ASN D 2 142 ? 66.142 12.653  66.834  1.00 49.76  ? 142 ASN B CA  1 
ATOM   5826 C C   . ASN D 2 142 ? 65.330 11.627  66.059  1.00 52.23  ? 142 ASN B C   1 
ATOM   5827 O O   . ASN D 2 142 ? 65.477 10.416  66.237  1.00 50.04  ? 142 ASN B O   1 
ATOM   5828 C CB  . ASN D 2 142 ? 67.274 13.162  65.936  1.00 49.22  ? 142 ASN B CB  1 
ATOM   5829 C CG  . ASN D 2 142 ? 67.950 14.406  66.493  1.00 48.60  ? 142 ASN B CG  1 
ATOM   5830 O OD1 . ASN D 2 142 ? 68.952 14.875  65.954  1.00 45.18  ? 142 ASN B OD1 1 
ATOM   5831 N ND2 . ASN D 2 142 ? 67.397 14.950  67.572  1.00 47.19  ? 142 ASN B ND2 1 
ATOM   5832 N N   . ASN D 2 143 ? 64.471 12.154  65.189  1.00 52.95  ? 143 ASN B N   1 
ATOM   5833 C CA  . ASN D 2 143 ? 63.611 11.375  64.305  1.00 52.75  ? 143 ASN B CA  1 
ATOM   5834 C C   . ASN D 2 143 ? 62.893 10.168  64.905  1.00 48.97  ? 143 ASN B C   1 
ATOM   5835 O O   . ASN D 2 143 ? 63.071 9.041   64.446  1.00 45.73  ? 143 ASN B O   1 
ATOM   5836 C CB  . ASN D 2 143 ? 64.422 10.936  63.085  1.00 53.08  ? 143 ASN B CB  1 
ATOM   5837 C CG  . ASN D 2 143 ? 65.078 12.106  62.378  1.00 56.98  ? 143 ASN B CG  1 
ATOM   5838 O OD1 . ASN D 2 143 ? 65.875 12.833  62.969  1.00 62.16  ? 143 ASN B OD1 1 
ATOM   5839 N ND2 . ASN D 2 143 ? 64.743 12.296  61.108  1.00 60.90  ? 143 ASN B ND2 1 
ATOM   5840 N N   . PHE D 2 144 ? 62.078 10.405  65.928  1.00 48.59  ? 144 PHE B N   1 
ATOM   5841 C CA  . PHE D 2 144 ? 61.321 9.323   66.544  1.00 47.60  ? 144 PHE B CA  1 
ATOM   5842 C C   . PHE D 2 144 ? 59.823 9.526   66.320  1.00 48.83  ? 144 PHE B C   1 
ATOM   5843 O O   . PHE D 2 144 ? 59.391 10.614  65.935  1.00 44.27  ? 144 PHE B O   1 
ATOM   5844 C CB  . PHE D 2 144 ? 61.614 9.231   68.044  1.00 47.55  ? 144 PHE B CB  1 
ATOM   5845 C CG  . PHE D 2 144 ? 61.330 10.495  68.811  1.00 47.26  ? 144 PHE B CG  1 
ATOM   5846 C CD1 . PHE D 2 144 ? 62.278 11.514  68.879  1.00 48.71  ? 144 PHE B CD1 1 
ATOM   5847 C CD2 . PHE D 2 144 ? 60.133 10.647  69.504  1.00 48.33  ? 144 PHE B CD2 1 
ATOM   5848 C CE1 . PHE D 2 144 ? 62.042 12.661  69.631  1.00 45.58  ? 144 PHE B CE1 1 
ATOM   5849 C CE2 . PHE D 2 144 ? 59.885 11.794  70.260  1.00 49.46  ? 144 PHE B CE2 1 
ATOM   5850 C CZ  . PHE D 2 144 ? 60.843 12.803  70.324  1.00 47.14  ? 144 PHE B CZ  1 
ATOM   5851 N N   . TYR D 2 145 ? 59.043 8.470   66.550  1.00 49.80  ? 145 TYR B N   1 
ATOM   5852 C CA  . TYR D 2 145 ? 57.588 8.510   66.389  1.00 50.32  ? 145 TYR B CA  1 
ATOM   5853 C C   . TYR D 2 145 ? 56.967 7.353   67.168  1.00 51.76  ? 145 TYR B C   1 
ATOM   5854 O O   . TYR D 2 145 ? 57.458 6.226   67.099  1.00 51.71  ? 145 TYR B O   1 
ATOM   5855 C CB  . TYR D 2 145 ? 57.201 8.372   64.914  1.00 48.78  ? 145 TYR B CB  1 
ATOM   5856 C CG  . TYR D 2 145 ? 55.729 8.609   64.669  1.00 49.98  ? 145 TYR B CG  1 
ATOM   5857 C CD1 . TYR D 2 145 ? 55.225 9.902   64.529  1.00 48.40  ? 145 TYR B CD1 1 
ATOM   5858 C CD2 . TYR D 2 145 ? 54.831 7.545   64.632  1.00 49.28  ? 145 TYR B CD2 1 
ATOM   5859 C CE1 . TYR D 2 145 ? 53.861 10.128  64.361  1.00 50.15  ? 145 TYR B CE1 1 
ATOM   5860 C CE2 . TYR D 2 145 ? 53.465 7.759   64.468  1.00 49.22  ? 145 TYR B CE2 1 
ATOM   5861 C CZ  . TYR D 2 145 ? 52.987 9.051   64.334  1.00 49.53  ? 145 TYR B CZ  1 
ATOM   5862 O OH  . TYR D 2 145 ? 51.637 9.265   64.189  1.00 49.89  ? 145 TYR B OH  1 
ATOM   5863 N N   . PRO D 2 146 ? 55.865 7.601   67.902  1.00 53.18  ? 146 PRO B N   1 
ATOM   5864 C CA  . PRO D 2 146 ? 55.108 8.845   68.103  1.00 55.70  ? 146 PRO B CA  1 
ATOM   5865 C C   . PRO D 2 146 ? 55.908 9.950   68.790  1.00 58.16  ? 146 PRO B C   1 
ATOM   5866 O O   . PRO D 2 146 ? 57.105 9.802   69.029  1.00 60.15  ? 146 PRO B O   1 
ATOM   5867 C CB  . PRO D 2 146 ? 53.922 8.395   68.957  1.00 56.76  ? 146 PRO B CB  1 
ATOM   5868 C CG  . PRO D 2 146 ? 53.764 6.948   68.599  1.00 56.17  ? 146 PRO B CG  1 
ATOM   5869 C CD  . PRO D 2 146 ? 55.192 6.483   68.581  1.00 53.18  ? 146 PRO B CD  1 
ATOM   5870 N N   . LYS D 2 147 ? 55.238 11.048  69.128  1.00 59.71  ? 147 LYS B N   1 
ATOM   5871 C CA  . LYS D 2 147 ? 55.919 12.161  69.777  1.00 63.34  ? 147 LYS B CA  1 
ATOM   5872 C C   . LYS D 2 147 ? 56.110 11.954  71.278  1.00 63.76  ? 147 LYS B C   1 
ATOM   5873 O O   . LYS D 2 147 ? 56.946 12.615  71.896  1.00 62.62  ? 147 LYS B O   1 
ATOM   5874 C CB  . LYS D 2 147 ? 55.172 13.480  69.528  1.00 63.26  ? 147 LYS B CB  1 
ATOM   5875 C CG  . LYS D 2 147 ? 53.848 13.639  70.263  1.00 67.53  ? 147 LYS B CG  1 
ATOM   5876 C CD  . LYS D 2 147 ? 52.695 12.984  69.522  1.00 73.70  ? 147 LYS B CD  1 
ATOM   5877 C CE  . LYS D 2 147 ? 51.357 13.386  70.134  1.00 76.28  ? 147 LYS B CE  1 
ATOM   5878 N NZ  . LYS D 2 147 ? 50.197 12.845  69.369  1.00 79.48  ? 147 LYS B NZ  1 
ATOM   5879 N N   . ASP D 2 148 ? 55.340 11.041  71.863  1.00 65.36  ? 148 ASP B N   1 
ATOM   5880 C CA  . ASP D 2 148 ? 55.446 10.759  73.294  1.00 67.35  ? 148 ASP B CA  1 
ATOM   5881 C C   . ASP D 2 148 ? 56.751 10.043  73.616  1.00 67.23  ? 148 ASP B C   1 
ATOM   5882 O O   . ASP D 2 148 ? 57.019 8.953   73.109  1.00 64.35  ? 148 ASP B O   1 
ATOM   5883 C CB  . ASP D 2 148 ? 54.261 9.911   73.762  1.00 70.14  ? 148 ASP B CB  1 
ATOM   5884 C CG  . ASP D 2 148 ? 52.994 10.726  73.926  1.00 74.57  ? 148 ASP B CG  1 
ATOM   5885 O OD1 . ASP D 2 148 ? 52.618 11.441  72.973  1.00 76.89  ? 148 ASP B OD1 1 
ATOM   5886 O OD2 . ASP D 2 148 ? 52.374 10.651  75.007  1.00 77.32  ? 148 ASP B OD2 1 
ATOM   5887 N N   . ILE D 2 149 ? 57.560 10.663  74.468  1.00 66.38  ? 149 ILE B N   1 
ATOM   5888 C CA  . ILE D 2 149 ? 58.846 10.096  74.846  1.00 65.74  ? 149 ILE B CA  1 
ATOM   5889 C C   . ILE D 2 149 ? 59.296 10.726  76.164  1.00 67.36  ? 149 ILE B C   1 
ATOM   5890 O O   . ILE D 2 149 ? 58.712 11.713  76.615  1.00 65.07  ? 149 ILE B O   1 
ATOM   5891 C CB  . ILE D 2 149 ? 59.894 10.370  73.740  1.00 63.92  ? 149 ILE B CB  1 
ATOM   5892 C CG1 . ILE D 2 149 ? 61.073 9.410   73.878  1.00 61.30  ? 149 ILE B CG1 1 
ATOM   5893 C CG2 . ILE D 2 149 ? 60.366 11.818  73.815  1.00 64.17  ? 149 ILE B CG2 1 
ATOM   5894 C CD1 . ILE D 2 149 ? 62.074 9.510   72.740  1.00 59.55  ? 149 ILE B CD1 1 
ATOM   5895 N N   . ASN D 2 150 ? 60.326 10.157  76.783  1.00 69.20  ? 150 ASN B N   1 
ATOM   5896 C CA  . ASN D 2 150 ? 60.826 10.685  78.049  1.00 70.30  ? 150 ASN B CA  1 
ATOM   5897 C C   . ASN D 2 150 ? 62.312 10.417  78.247  1.00 68.68  ? 150 ASN B C   1 
ATOM   5898 O O   . ASN D 2 150 ? 62.789 9.302   78.036  1.00 66.95  ? 150 ASN B O   1 
ATOM   5899 C CB  . ASN D 2 150 ? 60.028 10.093  79.214  1.00 75.52  ? 150 ASN B CB  1 
ATOM   5900 C CG  . ASN D 2 150 ? 59.906 8.586   79.129  1.00 80.92  ? 150 ASN B CG  1 
ATOM   5901 O OD1 . ASN D 2 150 ? 60.901 7.866   79.206  1.00 84.34  ? 150 ASN B OD1 1 
ATOM   5902 N ND2 . ASN D 2 150 ? 58.679 8.100   78.965  1.00 83.58  ? 150 ASN B ND2 1 
ATOM   5903 N N   . VAL D 2 151 ? 63.036 11.452  78.658  1.00 67.42  ? 151 VAL B N   1 
ATOM   5904 C CA  . VAL D 2 151 ? 64.470 11.349  78.882  1.00 66.70  ? 151 VAL B CA  1 
ATOM   5905 C C   . VAL D 2 151 ? 64.801 11.480  80.367  1.00 67.72  ? 151 VAL B C   1 
ATOM   5906 O O   . VAL D 2 151 ? 64.129 12.204  81.103  1.00 69.40  ? 151 VAL B O   1 
ATOM   5907 C CB  . VAL D 2 151 ? 65.225 12.443  78.099  1.00 65.56  ? 151 VAL B CB  1 
ATOM   5908 C CG1 . VAL D 2 151 ? 64.801 13.813  78.593  1.00 63.63  ? 151 VAL B CG1 1 
ATOM   5909 C CG2 . VAL D 2 151 ? 66.727 12.254  78.248  1.00 63.46  ? 151 VAL B CG2 1 
ATOM   5910 N N   . LYS D 2 152 ? 65.838 10.772  80.801  1.00 66.96  ? 152 LYS B N   1 
ATOM   5911 C CA  . LYS D 2 152 ? 66.262 10.806  82.195  1.00 69.19  ? 152 LYS B CA  1 
ATOM   5912 C C   . LYS D 2 152 ? 67.783 10.905  82.290  1.00 68.61  ? 152 LYS B C   1 
ATOM   5913 O O   . LYS D 2 152 ? 68.504 10.234  81.550  1.00 68.32  ? 152 LYS B O   1 
ATOM   5914 C CB  . LYS D 2 152 ? 65.773 9.549   82.923  1.00 68.04  ? 152 LYS B CB  1 
ATOM   5915 C CG  . LYS D 2 152 ? 66.134 9.502   84.400  1.00 70.79  ? 152 LYS B CG  1 
ATOM   5916 C CD  . LYS D 2 152 ? 65.546 8.272   85.081  1.00 72.10  ? 152 LYS B CD  1 
ATOM   5917 C CE  . LYS D 2 152 ? 66.108 6.984   84.502  1.00 73.01  ? 152 LYS B CE  1 
ATOM   5918 N NZ  . LYS D 2 152 ? 65.550 5.776   85.175  1.00 72.77  ? 152 LYS B NZ  1 
ATOM   5919 N N   . TRP D 2 153 ? 68.264 11.746  83.202  1.00 68.10  ? 153 TRP B N   1 
ATOM   5920 C CA  . TRP D 2 153 ? 69.700 11.930  83.389  1.00 66.72  ? 153 TRP B CA  1 
ATOM   5921 C C   . TRP D 2 153 ? 70.239 11.217  84.625  1.00 67.22  ? 153 TRP B C   1 
ATOM   5922 O O   . TRP D 2 153 ? 69.571 11.143  85.657  1.00 66.02  ? 153 TRP B O   1 
ATOM   5923 C CB  . TRP D 2 153 ? 70.045 13.420  83.488  1.00 62.39  ? 153 TRP B CB  1 
ATOM   5924 C CG  . TRP D 2 153 ? 69.932 14.165  82.194  1.00 60.08  ? 153 TRP B CG  1 
ATOM   5925 C CD1 . TRP D 2 153 ? 68.814 14.758  81.681  1.00 59.93  ? 153 TRP B CD1 1 
ATOM   5926 C CD2 . TRP D 2 153 ? 70.979 14.389  81.241  1.00 58.95  ? 153 TRP B CD2 1 
ATOM   5927 N NE1 . TRP D 2 153 ? 69.101 15.340  80.469  1.00 60.22  ? 153 TRP B NE1 1 
ATOM   5928 C CE2 . TRP D 2 153 ? 70.423 15.128  80.175  1.00 58.83  ? 153 TRP B CE2 1 
ATOM   5929 C CE3 . TRP D 2 153 ? 72.335 14.036  81.186  1.00 56.39  ? 153 TRP B CE3 1 
ATOM   5930 C CZ2 . TRP D 2 153 ? 71.176 15.521  79.065  1.00 58.78  ? 153 TRP B CZ2 1 
ATOM   5931 C CZ3 . TRP D 2 153 ? 73.083 14.426  80.081  1.00 56.54  ? 153 TRP B CZ3 1 
ATOM   5932 C CH2 . TRP D 2 153 ? 72.500 15.162  79.035  1.00 59.49  ? 153 TRP B CH2 1 
ATOM   5933 N N   . LYS D 2 154 ? 71.457 10.697  84.505  1.00 69.63  ? 154 LYS B N   1 
ATOM   5934 C CA  . LYS D 2 154 ? 72.119 9.999   85.601  1.00 69.23  ? 154 LYS B CA  1 
ATOM   5935 C C   . LYS D 2 154 ? 73.592 10.392  85.667  1.00 70.40  ? 154 LYS B C   1 
ATOM   5936 O O   . LYS D 2 154 ? 74.357 10.115  84.743  1.00 71.03  ? 154 LYS B O   1 
ATOM   5937 C CB  . LYS D 2 154 ? 72.021 8.483   85.420  1.00 69.44  ? 154 LYS B CB  1 
ATOM   5938 C CG  . LYS D 2 154 ? 70.617 7.920   85.480  1.00 70.42  ? 154 LYS B CG  1 
ATOM   5939 C CD  . LYS D 2 154 ? 70.655 6.403   85.404  1.00 72.91  ? 154 LYS B CD  1 
ATOM   5940 C CE  . LYS D 2 154 ? 69.257 5.812   85.411  1.00 76.99  ? 154 LYS B CE  1 
ATOM   5941 N NZ  . LYS D 2 154 ? 68.490 6.211   86.622  1.00 80.13  ? 154 LYS B NZ  1 
ATOM   5942 N N   . ILE D 2 155 ? 73.984 11.041  86.759  1.00 71.15  ? 155 ILE B N   1 
ATOM   5943 C CA  . ILE D 2 155 ? 75.370 11.452  86.947  1.00 71.38  ? 155 ILE B CA  1 
ATOM   5944 C C   . ILE D 2 155 ? 76.020 10.516  87.960  1.00 72.40  ? 155 ILE B C   1 
ATOM   5945 O O   . ILE D 2 155 ? 75.686 10.543  89.144  1.00 72.72  ? 155 ILE B O   1 
ATOM   5946 C CB  . ILE D 2 155 ? 75.459 12.901  87.469  1.00 69.78  ? 155 ILE B CB  1 
ATOM   5947 C CG1 . ILE D 2 155 ? 74.790 13.853  86.474  1.00 66.71  ? 155 ILE B CG1 1 
ATOM   5948 C CG2 . ILE D 2 155 ? 76.917 13.289  87.673  1.00 70.52  ? 155 ILE B CG2 1 
ATOM   5949 C CD1 . ILE D 2 155 ? 74.767 15.296  86.924  1.00 64.81  ? 155 ILE B CD1 1 
ATOM   5950 N N   . ASP D 2 156 ? 76.946 9.688   87.487  1.00 73.69  ? 156 ASP B N   1 
ATOM   5951 C CA  . ASP D 2 156 ? 77.628 8.732   88.352  1.00 75.55  ? 156 ASP B CA  1 
ATOM   5952 C C   . ASP D 2 156 ? 76.623 7.762   88.963  1.00 76.35  ? 156 ASP B C   1 
ATOM   5953 O O   . ASP D 2 156 ? 76.692 7.447   90.152  1.00 77.12  ? 156 ASP B O   1 
ATOM   5954 C CB  . ASP D 2 156 ? 78.393 9.458   89.465  1.00 75.43  ? 156 ASP B CB  1 
ATOM   5955 C CG  . ASP D 2 156 ? 79.681 10.090  88.972  1.00 76.76  ? 156 ASP B CG  1 
ATOM   5956 O OD1 . ASP D 2 156 ? 80.563 9.346   88.496  1.00 78.31  ? 156 ASP B OD1 1 
ATOM   5957 O OD2 . ASP D 2 156 ? 79.816 11.328  89.061  1.00 78.56  ? 156 ASP B OD2 1 
ATOM   5958 N N   . GLY D 2 157 ? 75.685 7.299   88.143  1.00 77.42  ? 157 GLY B N   1 
ATOM   5959 C CA  . GLY D 2 157 ? 74.683 6.362   88.618  1.00 78.22  ? 157 GLY B CA  1 
ATOM   5960 C C   . GLY D 2 157 ? 73.487 6.993   89.309  1.00 79.28  ? 157 GLY B C   1 
ATOM   5961 O O   . GLY D 2 157 ? 72.445 6.353   89.451  1.00 80.41  ? 157 GLY B O   1 
ATOM   5962 N N   . SER D 2 158 ? 73.627 8.242   89.742  1.00 79.67  ? 158 SER B N   1 
ATOM   5963 C CA  . SER D 2 158 ? 72.537 8.937   90.420  1.00 79.98  ? 158 SER B CA  1 
ATOM   5964 C C   . SER D 2 158 ? 71.716 9.767   89.433  1.00 80.35  ? 158 SER B C   1 
ATOM   5965 O O   . SER D 2 158 ? 72.256 10.308  88.471  1.00 79.26  ? 158 SER B O   1 
ATOM   5966 C CB  . SER D 2 158 ? 73.099 9.843   91.520  1.00 79.85  ? 158 SER B CB  1 
ATOM   5967 O OG  . SER D 2 158 ? 72.061 10.512  92.214  1.00 80.19  ? 158 SER B OG  1 
ATOM   5968 N N   . GLU D 2 159 ? 70.412 9.867   89.675  1.00 81.06  ? 159 GLU B N   1 
ATOM   5969 C CA  . GLU D 2 159 ? 69.534 10.632  88.797  1.00 82.67  ? 159 GLU B CA  1 
ATOM   5970 C C   . GLU D 2 159 ? 69.573 12.128  89.084  1.00 82.38  ? 159 GLU B C   1 
ATOM   5971 O O   . GLU D 2 159 ? 69.270 12.569  90.194  1.00 80.97  ? 159 GLU B O   1 
ATOM   5972 C CB  . GLU D 2 159 ? 68.089 10.139  88.914  1.00 85.44  ? 159 GLU B CB  1 
ATOM   5973 C CG  . GLU D 2 159 ? 67.864 8.719   88.420  1.00 90.40  ? 159 GLU B CG  1 
ATOM   5974 C CD  . GLU D 2 159 ? 66.391 8.358   88.335  1.00 93.12  ? 159 GLU B CD  1 
ATOM   5975 O OE1 . GLU D 2 159 ? 66.081 7.188   88.021  1.00 95.03  ? 159 GLU B OE1 1 
ATOM   5976 O OE2 . GLU D 2 159 ? 65.542 9.244   88.578  1.00 93.54  ? 159 GLU B OE2 1 
ATOM   5977 N N   . ARG D 2 160 ? 69.946 12.902  88.070  1.00 82.58  ? 160 ARG B N   1 
ATOM   5978 C CA  . ARG D 2 160 ? 70.019 14.354  88.187  1.00 84.15  ? 160 ARG B CA  1 
ATOM   5979 C C   . ARG D 2 160 ? 68.852 14.960  87.414  1.00 84.01  ? 160 ARG B C   1 
ATOM   5980 O O   . ARG D 2 160 ? 68.934 15.169  86.203  1.00 83.79  ? 160 ARG B O   1 
ATOM   5981 C CB  . ARG D 2 160 ? 71.346 14.865  87.619  1.00 86.66  ? 160 ARG B CB  1 
ATOM   5982 C CG  . ARG D 2 160 ? 71.586 16.358  87.803  1.00 88.97  ? 160 ARG B CG  1 
ATOM   5983 C CD  . ARG D 2 160 ? 71.591 16.744  89.275  1.00 91.76  ? 160 ARG B CD  1 
ATOM   5984 N NE  . ARG D 2 160 ? 72.095 18.099  89.489  1.00 95.35  ? 160 ARG B NE  1 
ATOM   5985 C CZ  . ARG D 2 160 ? 73.353 18.473  89.272  1.00 96.52  ? 160 ARG B CZ  1 
ATOM   5986 N NH1 . ARG D 2 160 ? 74.244 17.594  88.832  1.00 98.45  ? 160 ARG B NH1 1 
ATOM   5987 N NH2 . ARG D 2 160 ? 73.723 19.727  89.495  1.00 96.54  ? 160 ARG B NH2 1 
ATOM   5988 N N   . GLN D 2 161 ? 67.764 15.234  88.126  1.00 83.07  ? 161 GLN B N   1 
ATOM   5989 C CA  . GLN D 2 161 ? 66.567 15.803  87.519  1.00 81.97  ? 161 GLN B CA  1 
ATOM   5990 C C   . GLN D 2 161 ? 66.621 17.327  87.491  1.00 81.13  ? 161 GLN B C   1 
ATOM   5991 O O   . GLN D 2 161 ? 66.046 17.964  86.607  1.00 80.45  ? 161 GLN B O   1 
ATOM   5992 C CB  . GLN D 2 161 ? 65.330 15.346  88.296  1.00 82.01  ? 161 GLN B CB  1 
ATOM   5993 C CG  . GLN D 2 161 ? 64.013 15.861  87.745  1.00 83.46  ? 161 GLN B CG  1 
ATOM   5994 C CD  . GLN D 2 161 ? 62.821 15.380  88.550  1.00 84.19  ? 161 GLN B CD  1 
ATOM   5995 O OE1 . GLN D 2 161 ? 62.697 15.682  89.738  1.00 84.65  ? 161 GLN B OE1 1 
ATOM   5996 N NE2 . GLN D 2 161 ? 61.938 14.623  87.906  1.00 83.61  ? 161 GLN B NE2 1 
ATOM   5997 N N   . ASN D 2 162 ? 67.320 17.905  88.461  1.00 80.31  ? 162 ASN B N   1 
ATOM   5998 C CA  . ASN D 2 162 ? 67.438 19.353  88.560  1.00 77.86  ? 162 ASN B CA  1 
ATOM   5999 C C   . ASN D 2 162 ? 68.453 19.899  87.560  1.00 76.66  ? 162 ASN B C   1 
ATOM   6000 O O   . ASN D 2 162 ? 69.494 19.284  87.319  1.00 77.55  ? 162 ASN B O   1 
ATOM   6001 C CB  . ASN D 2 162 ? 67.845 19.741  89.985  1.00 79.14  ? 162 ASN B CB  1 
ATOM   6002 C CG  . ASN D 2 162 ? 67.605 21.208  90.282  1.00 79.71  ? 162 ASN B CG  1 
ATOM   6003 O OD1 . ASN D 2 162 ? 66.475 21.692  90.195  1.00 80.34  ? 162 ASN B OD1 1 
ATOM   6004 N ND2 . ASN D 2 162 ? 68.666 21.924  90.638  1.00 80.19  ? 162 ASN B ND2 1 
ATOM   6005 N N   . GLY D 2 163 ? 68.136 21.049  86.971  1.00 74.31  ? 163 GLY B N   1 
ATOM   6006 C CA  . GLY D 2 163 ? 69.035 21.673  86.016  1.00 72.29  ? 163 GLY B CA  1 
ATOM   6007 C C   . GLY D 2 163 ? 68.925 21.197  84.578  1.00 70.35  ? 163 GLY B C   1 
ATOM   6008 O O   . GLY D 2 163 ? 69.735 21.583  83.734  1.00 70.70  ? 163 GLY B O   1 
ATOM   6009 N N   . VAL D 2 164 ? 67.929 20.367  84.286  1.00 68.11  ? 164 VAL B N   1 
ATOM   6010 C CA  . VAL D 2 164 ? 67.752 19.859  82.930  1.00 65.56  ? 164 VAL B CA  1 
ATOM   6011 C C   . VAL D 2 164 ? 66.670 20.611  82.159  1.00 62.80  ? 164 VAL B C   1 
ATOM   6012 O O   . VAL D 2 164 ? 65.607 20.921  82.699  1.00 62.35  ? 164 VAL B O   1 
ATOM   6013 C CB  . VAL D 2 164 ? 67.397 18.355  82.936  1.00 65.18  ? 164 VAL B CB  1 
ATOM   6014 C CG1 . VAL D 2 164 ? 66.065 18.134  83.632  1.00 64.94  ? 164 VAL B CG1 1 
ATOM   6015 C CG2 . VAL D 2 164 ? 67.348 17.831  81.510  1.00 65.56  ? 164 VAL B CG2 1 
ATOM   6016 N N   . LEU D 2 165 ? 66.955 20.906  80.894  1.00 60.03  ? 165 LEU B N   1 
ATOM   6017 C CA  . LEU D 2 165 ? 66.009 21.607  80.034  1.00 57.44  ? 165 LEU B CA  1 
ATOM   6018 C C   . LEU D 2 165 ? 65.753 20.788  78.775  1.00 56.31  ? 165 LEU B C   1 
ATOM   6019 O O   . LEU D 2 165 ? 66.687 20.269  78.159  1.00 53.83  ? 165 LEU B O   1 
ATOM   6020 C CB  . LEU D 2 165 ? 66.548 22.989  79.654  1.00 57.18  ? 165 LEU B CB  1 
ATOM   6021 C CG  . LEU D 2 165 ? 66.584 24.047  80.761  1.00 59.94  ? 165 LEU B CG  1 
ATOM   6022 C CD1 . LEU D 2 165 ? 67.257 25.310  80.238  1.00 58.56  ? 165 LEU B CD1 1 
ATOM   6023 C CD2 . LEU D 2 165 ? 65.167 24.351  81.233  1.00 57.77  ? 165 LEU B CD2 1 
ATOM   6024 N N   . ASN D 2 166 ? 64.482 20.674  78.398  1.00 55.30  ? 166 ASN B N   1 
ATOM   6025 C CA  . ASN D 2 166 ? 64.104 19.911  77.213  1.00 53.95  ? 166 ASN B CA  1 
ATOM   6026 C C   . ASN D 2 166 ? 63.389 20.783  76.187  1.00 52.87  ? 166 ASN B C   1 
ATOM   6027 O O   . ASN D 2 166 ? 62.629 21.685  76.545  1.00 55.62  ? 166 ASN B O   1 
ATOM   6028 C CB  . ASN D 2 166 ? 63.211 18.738  77.618  1.00 53.10  ? 166 ASN B CB  1 
ATOM   6029 C CG  . ASN D 2 166 ? 63.877 17.829  78.628  1.00 53.43  ? 166 ASN B CG  1 
ATOM   6030 O OD1 . ASN D 2 166 ? 64.983 17.338  78.402  1.00 51.35  ? 166 ASN B OD1 1 
ATOM   6031 N ND2 . ASN D 2 166 ? 63.207 17.598  79.752  1.00 52.83  ? 166 ASN B ND2 1 
ATOM   6032 N N   . SER D 2 167 ? 63.643 20.509  74.910  1.00 49.53  ? 167 SER B N   1 
ATOM   6033 C CA  . SER D 2 167 ? 63.036 21.263  73.818  1.00 48.54  ? 167 SER B CA  1 
ATOM   6034 C C   . SER D 2 167 ? 62.640 20.307  72.694  1.00 49.27  ? 167 SER B C   1 
ATOM   6035 O O   . SER D 2 167 ? 63.469 19.533  72.211  1.00 47.99  ? 167 SER B O   1 
ATOM   6036 C CB  . SER D 2 167 ? 64.023 22.308  73.290  1.00 42.98  ? 167 SER B CB  1 
ATOM   6037 O OG  . SER D 2 167 ? 63.417 23.151  72.329  1.00 49.74  ? 167 SER B OG  1 
ATOM   6038 N N   . TRP D 2 168 ? 61.374 20.375  72.282  1.00 49.80  ? 168 TRP B N   1 
ATOM   6039 C CA  . TRP D 2 168 ? 60.838 19.508  71.231  1.00 46.33  ? 168 TRP B CA  1 
ATOM   6040 C C   . TRP D 2 168 ? 60.476 20.273  69.957  1.00 45.26  ? 168 TRP B C   1 
ATOM   6041 O O   . TRP D 2 168 ? 59.981 21.400  70.016  1.00 46.25  ? 168 TRP B O   1 
ATOM   6042 C CB  . TRP D 2 168 ? 59.575 18.803  71.733  1.00 49.96  ? 168 TRP B CB  1 
ATOM   6043 C CG  . TRP D 2 168 ? 59.751 18.017  72.992  1.00 52.67  ? 168 TRP B CG  1 
ATOM   6044 C CD1 . TRP D 2 168 ? 59.999 16.677  73.099  1.00 50.33  ? 168 TRP B CD1 1 
ATOM   6045 C CD2 . TRP D 2 168 ? 59.677 18.521  74.331  1.00 53.97  ? 168 TRP B CD2 1 
ATOM   6046 N NE1 . TRP D 2 168 ? 60.081 16.315  74.423  1.00 52.71  ? 168 TRP B NE1 1 
ATOM   6047 C CE2 . TRP D 2 168 ? 59.887 17.427  75.201  1.00 54.25  ? 168 TRP B CE2 1 
ATOM   6048 C CE3 . TRP D 2 168 ? 59.452 19.791  74.880  1.00 55.58  ? 168 TRP B CE3 1 
ATOM   6049 C CZ2 . TRP D 2 168 ? 59.878 17.564  76.595  1.00 58.37  ? 168 TRP B CZ2 1 
ATOM   6050 C CZ3 . TRP D 2 168 ? 59.442 19.928  76.269  1.00 57.90  ? 168 TRP B CZ3 1 
ATOM   6051 C CH2 . TRP D 2 168 ? 59.654 18.818  77.108  1.00 58.79  ? 168 TRP B CH2 1 
ATOM   6052 N N   . THR D 2 169 ? 60.714 19.649  68.809  1.00 36.98  ? 169 THR B N   1 
ATOM   6053 C CA  . THR D 2 169 ? 60.372 20.261  67.528  1.00 43.47  ? 169 THR B CA  1 
ATOM   6054 C C   . THR D 2 169 ? 58.953 19.835  67.147  1.00 41.77  ? 169 THR B C   1 
ATOM   6055 O O   . THR D 2 169 ? 58.359 18.979  67.807  1.00 40.46  ? 169 THR B O   1 
ATOM   6056 C CB  . THR D 2 169 ? 61.320 19.796  66.400  1.00 41.99  ? 169 THR B CB  1 
ATOM   6057 O OG1 . THR D 2 169 ? 61.317 18.363  66.329  1.00 48.36  ? 169 THR B OG1 1 
ATOM   6058 C CG2 . THR D 2 169 ? 62.733 20.278  66.654  1.00 47.78  ? 169 THR B CG2 1 
ATOM   6059 N N   . ASP D 2 170 ? 58.407 20.445  66.097  1.00 42.06  ? 170 ASP B N   1 
ATOM   6060 C CA  . ASP D 2 170 ? 57.076 20.080  65.620  1.00 40.90  ? 170 ASP B CA  1 
ATOM   6061 C C   . ASP D 2 170 ? 57.307 18.929  64.651  1.00 39.57  ? 170 ASP B C   1 
ATOM   6062 O O   . ASP D 2 170 ? 58.452 18.635  64.300  1.00 37.63  ? 170 ASP B O   1 
ATOM   6063 C CB  . ASP D 2 170 ? 56.407 21.245  64.882  1.00 44.84  ? 170 ASP B CB  1 
ATOM   6064 C CG  . ASP D 2 170 ? 56.034 22.387  65.806  1.00 51.93  ? 170 ASP B CG  1 
ATOM   6065 O OD1 . ASP D 2 170 ? 55.453 22.121  66.881  1.00 53.03  ? 170 ASP B OD1 1 
ATOM   6066 O OD2 . ASP D 2 170 ? 56.312 23.553  65.452  1.00 55.58  ? 170 ASP B OD2 1 
ATOM   6067 N N   . GLN D 2 171 ? 56.237 18.286  64.203  1.00 36.69  ? 171 GLN B N   1 
ATOM   6068 C CA  . GLN D 2 171 ? 56.387 17.167  63.285  1.00 34.62  ? 171 GLN B CA  1 
ATOM   6069 C C   . GLN D 2 171 ? 57.147 17.578  62.028  1.00 36.01  ? 171 GLN B C   1 
ATOM   6070 O O   . GLN D 2 171 ? 56.808 18.560  61.370  1.00 34.07  ? 171 GLN B O   1 
ATOM   6071 C CB  . GLN D 2 171 ? 55.021 16.592  62.914  1.00 31.97  ? 171 GLN B CB  1 
ATOM   6072 C CG  . GLN D 2 171 ? 55.120 15.202  62.312  1.00 34.92  ? 171 GLN B CG  1 
ATOM   6073 C CD  . GLN D 2 171 ? 53.790 14.471  62.285  1.00 40.10  ? 171 GLN B CD  1 
ATOM   6074 O OE1 . GLN D 2 171 ? 53.750 13.247  62.136  1.00 34.98  ? 171 GLN B OE1 1 
ATOM   6075 N NE2 . GLN D 2 171 ? 52.695 15.216  62.415  1.00 31.64  ? 171 GLN B NE2 1 
ATOM   6076 N N   . ASP D 2 172 ? 58.181 16.814  61.697  1.00 37.18  ? 172 ASP B N   1 
ATOM   6077 C CA  . ASP D 2 172 ? 59.003 17.113  60.540  1.00 39.56  ? 172 ASP B CA  1 
ATOM   6078 C C   . ASP D 2 172 ? 58.200 17.171  59.245  1.00 41.29  ? 172 ASP B C   1 
ATOM   6079 O O   . ASP D 2 172 ? 57.377 16.303  58.961  1.00 42.69  ? 172 ASP B O   1 
ATOM   6080 C CB  . ASP D 2 172 ? 60.116 16.079  60.402  1.00 43.52  ? 172 ASP B CB  1 
ATOM   6081 C CG  . ASP D 2 172 ? 61.182 16.512  59.425  1.00 49.88  ? 172 ASP B CG  1 
ATOM   6082 O OD1 . ASP D 2 172 ? 61.982 17.407  59.779  1.00 54.40  ? 172 ASP B OD1 1 
ATOM   6083 O OD2 . ASP D 2 172 ? 61.210 15.971  58.299  1.00 50.80  ? 172 ASP B OD2 1 
ATOM   6084 N N   . SER D 2 173 ? 58.463 18.202  58.455  1.00 42.38  ? 173 SER B N   1 
ATOM   6085 C CA  . SER D 2 173 ? 57.783 18.405  57.187  1.00 45.45  ? 173 SER B CA  1 
ATOM   6086 C C   . SER D 2 173 ? 58.207 17.413  56.106  1.00 50.05  ? 173 SER B C   1 
ATOM   6087 O O   . SER D 2 173 ? 57.572 17.331  55.054  1.00 48.10  ? 173 SER B O   1 
ATOM   6088 C CB  . SER D 2 173 ? 58.043 19.831  56.696  1.00 47.96  ? 173 SER B CB  1 
ATOM   6089 O OG  . SER D 2 173 ? 57.609 20.001  55.360  1.00 54.75  ? 173 SER B OG  1 
ATOM   6090 N N   . LYS D 2 174 ? 59.270 16.657  56.361  1.00 52.28  ? 174 LYS B N   1 
ATOM   6091 C CA  . LYS D 2 174 ? 59.758 15.705  55.373  1.00 54.52  ? 174 LYS B CA  1 
ATOM   6092 C C   . LYS D 2 174 ? 59.561 14.239  55.753  1.00 54.94  ? 174 LYS B C   1 
ATOM   6093 O O   . LYS D 2 174 ? 58.986 13.466  54.987  1.00 54.42  ? 174 LYS B O   1 
ATOM   6094 C CB  . LYS D 2 174 ? 61.245 15.962  55.099  1.00 58.95  ? 174 LYS B CB  1 
ATOM   6095 C CG  . LYS D 2 174 ? 61.568 17.404  54.726  1.00 65.39  ? 174 LYS B CG  1 
ATOM   6096 C CD  . LYS D 2 174 ? 60.847 17.828  53.454  1.00 70.08  ? 174 LYS B CD  1 
ATOM   6097 C CE  . LYS D 2 174 ? 61.073 19.304  53.159  1.00 74.14  ? 174 LYS B CE  1 
ATOM   6098 N NZ  . LYS D 2 174 ? 62.520 19.632  53.025  1.00 77.52  ? 174 LYS B NZ  1 
ATOM   6099 N N   . ASP D 2 175 ? 60.034 13.860  56.937  1.00 54.62  ? 175 ASP B N   1 
ATOM   6100 C CA  . ASP D 2 175 ? 59.944 12.477  57.393  1.00 53.47  ? 175 ASP B CA  1 
ATOM   6101 C C   . ASP D 2 175 ? 58.777 12.218  58.356  1.00 47.31  ? 175 ASP B C   1 
ATOM   6102 O O   . ASP D 2 175 ? 58.510 11.076  58.725  1.00 46.65  ? 175 ASP B O   1 
ATOM   6103 C CB  . ASP D 2 175 ? 61.281 12.083  58.036  1.00 62.46  ? 175 ASP B CB  1 
ATOM   6104 C CG  . ASP D 2 175 ? 61.375 10.602  58.361  1.00 73.44  ? 175 ASP B CG  1 
ATOM   6105 O OD1 . ASP D 2 175 ? 62.335 10.211  59.064  1.00 76.28  ? 175 ASP B OD1 1 
ATOM   6106 O OD2 . ASP D 2 175 ? 60.504 9.826   57.912  1.00 79.77  ? 175 ASP B OD2 1 
ATOM   6107 N N   . SER D 2 176 ? 58.078 13.279  58.751  1.00 38.59  ? 176 SER B N   1 
ATOM   6108 C CA  . SER D 2 176 ? 56.943 13.167  59.664  1.00 35.64  ? 176 SER B CA  1 
ATOM   6109 C C   . SER D 2 176 ? 57.315 12.680  61.060  1.00 38.08  ? 176 SER B C   1 
ATOM   6110 O O   . SER D 2 176 ? 56.450 12.219  61.809  1.00 36.68  ? 176 SER B O   1 
ATOM   6111 C CB  . SER D 2 176 ? 55.869 12.238  59.081  1.00 37.26  ? 176 SER B CB  1 
ATOM   6112 O OG  . SER D 2 176 ? 55.297 12.783  57.906  1.00 34.92  ? 176 SER B OG  1 
ATOM   6113 N N   . THR D 2 177 ? 58.594 12.782  61.416  1.00 36.34  ? 177 THR B N   1 
ATOM   6114 C CA  . THR D 2 177 ? 59.029 12.353  62.741  1.00 38.00  ? 177 THR B CA  1 
ATOM   6115 C C   . THR D 2 177 ? 59.176 13.548  63.669  1.00 35.96  ? 177 THR B C   1 
ATOM   6116 O O   . THR D 2 177 ? 58.985 14.699  63.264  1.00 36.05  ? 177 THR B O   1 
ATOM   6117 C CB  . THR D 2 177 ? 60.386 11.608  62.702  1.00 42.38  ? 177 THR B CB  1 
ATOM   6118 O OG1 . THR D 2 177 ? 61.441 12.540  62.430  1.00 40.20  ? 177 THR B OG1 1 
ATOM   6119 C CG2 . THR D 2 177 ? 60.378 10.535  61.623  1.00 40.69  ? 177 THR B CG2 1 
ATOM   6120 N N   . TYR D 2 178 ? 59.514 13.253  64.919  1.00 38.73  ? 178 TYR B N   1 
ATOM   6121 C CA  . TYR D 2 178 ? 59.702 14.259  65.950  1.00 37.46  ? 178 TYR B CA  1 
ATOM   6122 C C   . TYR D 2 178 ? 61.139 14.181  66.463  1.00 41.79  ? 178 TYR B C   1 
ATOM   6123 O O   . TYR D 2 178 ? 61.799 13.149  66.326  1.00 44.17  ? 178 TYR B O   1 
ATOM   6124 C CB  . TYR D 2 178 ? 58.730 14.004  67.103  1.00 39.05  ? 178 TYR B CB  1 
ATOM   6125 C CG  . TYR D 2 178 ? 57.278 14.208  66.730  1.00 41.31  ? 178 TYR B CG  1 
ATOM   6126 C CD1 . TYR D 2 178 ? 56.679 15.463  66.840  1.00 36.52  ? 178 TYR B CD1 1 
ATOM   6127 C CD2 . TYR D 2 178 ? 56.512 13.152  66.235  1.00 41.35  ? 178 TYR B CD2 1 
ATOM   6128 C CE1 . TYR D 2 178 ? 55.346 15.660  66.461  1.00 42.92  ? 178 TYR B CE1 1 
ATOM   6129 C CE2 . TYR D 2 178 ? 55.184 13.337  65.854  1.00 39.83  ? 178 TYR B CE2 1 
ATOM   6130 C CZ  . TYR D 2 178 ? 54.609 14.590  65.969  1.00 40.66  ? 178 TYR B CZ  1 
ATOM   6131 O OH  . TYR D 2 178 ? 53.301 14.771  65.588  1.00 46.03  ? 178 TYR B OH  1 
ATOM   6132 N N   . SER D 2 179 ? 61.618 15.278  67.043  1.00 40.73  ? 179 SER B N   1 
ATOM   6133 C CA  . SER D 2 179 ? 62.968 15.341  67.599  1.00 40.19  ? 179 SER B CA  1 
ATOM   6134 C C   . SER D 2 179 ? 62.950 16.198  68.854  1.00 42.50  ? 179 SER B C   1 
ATOM   6135 O O   . SER D 2 179 ? 62.021 16.977  69.074  1.00 42.49  ? 179 SER B O   1 
ATOM   6136 C CB  . SER D 2 179 ? 63.947 15.942  66.589  1.00 32.26  ? 179 SER B CB  1 
ATOM   6137 O OG  . SER D 2 179 ? 64.184 15.066  65.503  1.00 40.11  ? 179 SER B OG  1 
ATOM   6138 N N   . MET D 2 180 ? 63.969 16.044  69.690  1.00 46.28  ? 180 MET B N   1 
ATOM   6139 C CA  . MET D 2 180 ? 64.054 16.834  70.906  1.00 50.41  ? 180 MET B CA  1 
ATOM   6140 C C   . MET D 2 180 ? 65.478 16.832  71.422  1.00 52.51  ? 180 MET B C   1 
ATOM   6141 O O   . MET D 2 180 ? 66.296 16.002  71.025  1.00 51.81  ? 180 MET B O   1 
ATOM   6142 C CB  . MET D 2 180 ? 63.122 16.284  71.987  1.00 54.61  ? 180 MET B CB  1 
ATOM   6143 C CG  . MET D 2 180 ? 63.630 15.035  72.676  1.00 61.12  ? 180 MET B CG  1 
ATOM   6144 S SD  . MET D 2 180 ? 62.939 14.895  74.332  1.00 71.76  ? 180 MET B SD  1 
ATOM   6145 C CE  . MET D 2 180 ? 64.057 15.968  75.245  1.00 70.78  ? 180 MET B CE  1 
ATOM   6146 N N   . SER D 2 181 ? 65.770 17.770  72.312  1.00 52.65  ? 181 SER B N   1 
ATOM   6147 C CA  . SER D 2 181 ? 67.096 17.869  72.886  1.00 51.91  ? 181 SER B CA  1 
ATOM   6148 C C   . SER D 2 181 ? 66.971 18.018  74.390  1.00 53.05  ? 181 SER B C   1 
ATOM   6149 O O   . SER D 2 181 ? 66.032 18.644  74.885  1.00 56.74  ? 181 SER B O   1 
ATOM   6150 C CB  . SER D 2 181 ? 67.828 19.082  72.316  1.00 50.39  ? 181 SER B CB  1 
ATOM   6151 O OG  . SER D 2 181 ? 67.204 20.282  72.734  1.00 52.33  ? 181 SER B OG  1 
ATOM   6152 N N   . SER D 2 182 ? 67.907 17.417  75.113  1.00 52.38  ? 182 SER B N   1 
ATOM   6153 C CA  . SER D 2 182 ? 67.930 17.508  76.565  1.00 52.40  ? 182 SER B CA  1 
ATOM   6154 C C   . SER D 2 182 ? 69.266 18.131  76.931  1.00 51.96  ? 182 SER B C   1 
ATOM   6155 O O   . SER D 2 182 ? 70.316 17.678  76.474  1.00 45.28  ? 182 SER B O   1 
ATOM   6156 C CB  . SER D 2 182 ? 67.809 16.123  77.200  1.00 53.77  ? 182 SER B CB  1 
ATOM   6157 O OG  . SER D 2 182 ? 66.559 15.534  76.891  1.00 60.47  ? 182 SER B OG  1 
ATOM   6158 N N   . THR D 2 183 ? 69.225 19.177  77.745  1.00 50.96  ? 183 THR B N   1 
ATOM   6159 C CA  . THR D 2 183 ? 70.445 19.859  78.140  1.00 53.25  ? 183 THR B CA  1 
ATOM   6160 C C   . THR D 2 183 ? 70.560 20.060  79.642  1.00 53.88  ? 183 THR B C   1 
ATOM   6161 O O   . THR D 2 183 ? 69.811 20.835  80.238  1.00 53.66  ? 183 THR B O   1 
ATOM   6162 C CB  . THR D 2 183 ? 70.552 21.230  77.453  1.00 54.72  ? 183 THR B CB  1 
ATOM   6163 O OG1 . THR D 2 183 ? 70.562 21.050  76.030  1.00 53.52  ? 183 THR B OG1 1 
ATOM   6164 C CG2 . THR D 2 183 ? 71.830 21.943  77.883  1.00 57.77  ? 183 THR B CG2 1 
ATOM   6165 N N   . LEU D 2 184 ? 71.501 19.343  80.245  1.00 57.74  ? 184 LEU B N   1 
ATOM   6166 C CA  . LEU D 2 184 ? 71.757 19.445  81.675  1.00 58.61  ? 184 LEU B CA  1 
ATOM   6167 C C   . LEU D 2 184 ? 72.816 20.534  81.812  1.00 60.53  ? 184 LEU B C   1 
ATOM   6168 O O   . LEU D 2 184 ? 73.946 20.371  81.347  1.00 59.27  ? 184 LEU B O   1 
ATOM   6169 C CB  . LEU D 2 184 ? 72.280 18.106  82.213  1.00 61.35  ? 184 LEU B CB  1 
ATOM   6170 C CG  . LEU D 2 184 ? 72.587 17.925  83.708  1.00 63.22  ? 184 LEU B CG  1 
ATOM   6171 C CD1 . LEU D 2 184 ? 73.815 18.728  84.088  1.00 65.15  ? 184 LEU B CD1 1 
ATOM   6172 C CD2 . LEU D 2 184 ? 71.385 18.340  84.544  1.00 62.09  ? 184 LEU B CD2 1 
ATOM   6173 N N   . THR D 2 185 ? 72.440 21.653  82.425  1.00 60.33  ? 185 THR B N   1 
ATOM   6174 C CA  . THR D 2 185 ? 73.363 22.769  82.600  1.00 61.90  ? 185 THR B CA  1 
ATOM   6175 C C   . THR D 2 185 ? 73.821 22.911  84.048  1.00 62.95  ? 185 THR B C   1 
ATOM   6176 O O   . THR D 2 185 ? 73.007 22.955  84.972  1.00 63.29  ? 185 THR B O   1 
ATOM   6177 C CB  . THR D 2 185 ? 72.720 24.104  82.149  1.00 62.96  ? 185 THR B CB  1 
ATOM   6178 O OG1 . THR D 2 185 ? 72.370 24.024  80.761  1.00 61.26  ? 185 THR B OG1 1 
ATOM   6179 C CG2 . THR D 2 185 ? 73.693 25.262  82.348  1.00 63.28  ? 185 THR B CG2 1 
ATOM   6180 N N   . LEU D 2 186 ? 75.134 22.979  84.237  1.00 63.89  ? 186 LEU B N   1 
ATOM   6181 C CA  . LEU D 2 186 ? 75.711 23.126  85.566  1.00 65.92  ? 186 LEU B CA  1 
ATOM   6182 C C   . LEU D 2 186 ? 77.038 23.876  85.504  1.00 67.01  ? 186 LEU B C   1 
ATOM   6183 O O   . LEU D 2 186 ? 77.540 24.184  84.422  1.00 65.53  ? 186 LEU B O   1 
ATOM   6184 C CB  . LEU D 2 186 ? 75.901 21.749  86.217  1.00 64.69  ? 186 LEU B CB  1 
ATOM   6185 C CG  . LEU D 2 186 ? 76.476 20.609  85.366  1.00 63.60  ? 186 LEU B CG  1 
ATOM   6186 C CD1 . LEU D 2 186 ? 77.867 20.959  84.873  1.00 63.60  ? 186 LEU B CD1 1 
ATOM   6187 C CD2 . LEU D 2 186 ? 76.512 19.335  86.190  1.00 64.24  ? 186 LEU B CD2 1 
ATOM   6188 N N   . THR D 2 187 ? 77.593 24.184  86.670  1.00 70.21  ? 187 THR B N   1 
ATOM   6189 C CA  . THR D 2 187 ? 78.864 24.893  86.745  1.00 72.53  ? 187 THR B CA  1 
ATOM   6190 C C   . THR D 2 187 ? 80.003 23.931  86.420  1.00 72.68  ? 187 THR B C   1 
ATOM   6191 O O   . THR D 2 187 ? 79.887 22.723  86.638  1.00 69.54  ? 187 THR B O   1 
ATOM   6192 C CB  . THR D 2 187 ? 79.094 25.479  88.157  1.00 73.53  ? 187 THR B CB  1 
ATOM   6193 O OG1 . THR D 2 187 ? 79.075 24.421  89.125  1.00 74.60  ? 187 THR B OG1 1 
ATOM   6194 C CG2 . THR D 2 187 ? 78.006 26.488  88.501  1.00 73.62  ? 187 THR B CG2 1 
ATOM   6195 N N   . LYS D 2 188 ? 81.099 24.464  85.889  1.00 75.08  ? 188 LYS B N   1 
ATOM   6196 C CA  . LYS D 2 188 ? 82.248 23.633  85.555  1.00 77.37  ? 188 LYS B CA  1 
ATOM   6197 C C   . LYS D 2 188 ? 82.735 22.913  86.809  1.00 78.80  ? 188 LYS B C   1 
ATOM   6198 O O   . LYS D 2 188 ? 83.291 21.818  86.729  1.00 78.71  ? 188 LYS B O   1 
ATOM   6199 C CB  . LYS D 2 188 ? 83.379 24.488  84.982  1.00 77.33  ? 188 LYS B CB  1 
ATOM   6200 C CG  . LYS D 2 188 ? 84.652 23.710  84.695  1.00 76.78  ? 188 LYS B CG  1 
ATOM   6201 C CD  . LYS D 2 188 ? 85.758 24.630  84.213  1.00 76.99  ? 188 LYS B CD  1 
ATOM   6202 C CE  . LYS D 2 188 ? 87.069 23.881  84.054  1.00 78.18  ? 188 LYS B CE  1 
ATOM   6203 N NZ  . LYS D 2 188 ? 88.173 24.787  83.634  1.00 77.64  ? 188 LYS B NZ  1 
ATOM   6204 N N   . ASP D 2 189 ? 82.517 23.535  87.965  1.00 80.61  ? 189 ASP B N   1 
ATOM   6205 C CA  . ASP D 2 189 ? 82.929 22.962  89.243  1.00 82.51  ? 189 ASP B CA  1 
ATOM   6206 C C   . ASP D 2 189 ? 82.126 21.708  89.569  1.00 81.47  ? 189 ASP B C   1 
ATOM   6207 O O   . ASP D 2 189 ? 82.690 20.673  89.927  1.00 80.93  ? 189 ASP B O   1 
ATOM   6208 C CB  . ASP D 2 189 ? 82.750 23.986  90.366  1.00 86.71  ? 189 ASP B CB  1 
ATOM   6209 C CG  . ASP D 2 189 ? 83.687 25.169  90.234  1.00 90.86  ? 189 ASP B CG  1 
ATOM   6210 O OD1 . ASP D 2 189 ? 84.919 24.954  90.210  1.00 91.83  ? 189 ASP B OD1 1 
ATOM   6211 O OD2 . ASP D 2 189 ? 83.192 26.314  90.159  1.00 93.54  ? 189 ASP B OD2 1 
ATOM   6212 N N   . GLU D 2 190 ? 80.807 21.811  89.449  1.00 79.81  ? 190 GLU B N   1 
ATOM   6213 C CA  . GLU D 2 190 ? 79.925 20.684  89.723  1.00 79.47  ? 190 GLU B CA  1 
ATOM   6214 C C   . GLU D 2 190 ? 80.195 19.573  88.711  1.00 77.29  ? 190 GLU B C   1 
ATOM   6215 O O   . GLU D 2 190 ? 80.109 18.387  89.034  1.00 77.20  ? 190 GLU B O   1 
ATOM   6216 C CB  . GLU D 2 190 ? 78.463 21.131  89.633  1.00 82.65  ? 190 GLU B CB  1 
ATOM   6217 C CG  . GLU D 2 190 ? 77.445 20.044  89.951  1.00 87.17  ? 190 GLU B CG  1 
ATOM   6218 C CD  . GLU D 2 190 ? 77.521 19.566  91.390  1.00 89.71  ? 190 GLU B CD  1 
ATOM   6219 O OE1 . GLU D 2 190 ? 77.355 20.401  92.305  1.00 91.54  ? 190 GLU B OE1 1 
ATOM   6220 O OE2 . GLU D 2 190 ? 77.744 18.355  91.606  1.00 90.18  ? 190 GLU B OE2 1 
ATOM   6221 N N   . TYR D 2 191 ? 80.528 19.969  87.486  1.00 74.22  ? 191 TYR B N   1 
ATOM   6222 C CA  . TYR D 2 191 ? 80.816 19.019  86.417  1.00 72.32  ? 191 TYR B CA  1 
ATOM   6223 C C   . TYR D 2 191 ? 82.100 18.240  86.682  1.00 73.33  ? 191 TYR B C   1 
ATOM   6224 O O   . TYR D 2 191 ? 82.158 17.031  86.458  1.00 73.05  ? 191 TYR B O   1 
ATOM   6225 C CB  . TYR D 2 191 ? 80.930 19.757  85.079  1.00 66.29  ? 191 TYR B CB  1 
ATOM   6226 C CG  . TYR D 2 191 ? 81.417 18.897  83.930  1.00 62.59  ? 191 TYR B CG  1 
ATOM   6227 C CD1 . TYR D 2 191 ? 80.724 17.750  83.544  1.00 60.64  ? 191 TYR B CD1 1 
ATOM   6228 C CD2 . TYR D 2 191 ? 82.575 19.231  83.230  1.00 60.32  ? 191 TYR B CD2 1 
ATOM   6229 C CE1 . TYR D 2 191 ? 81.175 16.955  82.487  1.00 55.79  ? 191 TYR B CE1 1 
ATOM   6230 C CE2 . TYR D 2 191 ? 83.034 18.445  82.174  1.00 55.20  ? 191 TYR B CE2 1 
ATOM   6231 C CZ  . TYR D 2 191 ? 82.331 17.310  81.808  1.00 54.45  ? 191 TYR B CZ  1 
ATOM   6232 O OH  . TYR D 2 191 ? 82.789 16.535  80.767  1.00 46.54  ? 191 TYR B OH  1 
ATOM   6233 N N   . GLU D 2 192 ? 83.126 18.938  87.161  1.00 75.90  ? 192 GLU B N   1 
ATOM   6234 C CA  . GLU D 2 192 ? 84.417 18.319  87.443  1.00 79.35  ? 192 GLU B CA  1 
ATOM   6235 C C   . GLU D 2 192 ? 84.367 17.245  88.524  1.00 80.56  ? 192 GLU B C   1 
ATOM   6236 O O   . GLU D 2 192 ? 84.895 16.149  88.336  1.00 81.73  ? 192 GLU B O   1 
ATOM   6237 C CB  . GLU D 2 192 ? 85.441 19.382  87.846  1.00 81.00  ? 192 GLU B CB  1 
ATOM   6238 C CG  . GLU D 2 192 ? 85.726 20.417  86.776  1.00 84.24  ? 192 GLU B CG  1 
ATOM   6239 C CD  . GLU D 2 192 ? 86.057 19.793  85.438  1.00 86.96  ? 192 GLU B CD  1 
ATOM   6240 O OE1 . GLU D 2 192 ? 86.964 18.935  85.385  1.00 89.46  ? 192 GLU B OE1 1 
ATOM   6241 O OE2 . GLU D 2 192 ? 85.410 20.165  84.437  1.00 89.60  ? 192 GLU B OE2 1 
ATOM   6242 N N   . ARG D 2 193 ? 83.737 17.563  89.652  1.00 81.71  ? 193 ARG B N   1 
ATOM   6243 C CA  . ARG D 2 193 ? 83.635 16.626  90.769  1.00 83.09  ? 193 ARG B CA  1 
ATOM   6244 C C   . ARG D 2 193 ? 82.867 15.354  90.426  1.00 83.05  ? 193 ARG B C   1 
ATOM   6245 O O   . ARG D 2 193 ? 82.482 14.591  91.314  1.00 82.76  ? 193 ARG B O   1 
ATOM   6246 C CB  . ARG D 2 193 ? 82.989 17.315  91.975  1.00 84.90  ? 193 ARG B CB  1 
ATOM   6247 C CG  . ARG D 2 193 ? 81.662 17.987  91.674  1.00 87.52  ? 193 ARG B CG  1 
ATOM   6248 C CD  . ARG D 2 193 ? 81.135 18.725  92.892  1.00 91.01  ? 193 ARG B CD  1 
ATOM   6249 N NE  . ARG D 2 193 ? 82.105 19.693  93.399  1.00 94.53  ? 193 ARG B NE  1 
ATOM   6250 C CZ  . ARG D 2 193 ? 81.887 20.502  94.431  1.00 96.34  ? 193 ARG B CZ  1 
ATOM   6251 N NH1 . ARG D 2 193 ? 80.727 20.467  95.073  1.00 97.86  ? 193 ARG B NH1 1 
ATOM   6252 N NH2 . ARG D 2 193 ? 82.833 21.344  94.825  1.00 96.15  ? 193 ARG B NH2 1 
ATOM   6253 N N   . HIS D 2 194 ? 82.648 15.132  89.133  1.00 83.14  ? 194 HIS B N   1 
ATOM   6254 C CA  . HIS D 2 194 ? 81.941 13.950  88.656  1.00 83.06  ? 194 HIS B CA  1 
ATOM   6255 C C   . HIS D 2 194 ? 82.512 13.490  87.320  1.00 82.58  ? 194 HIS B C   1 
ATOM   6256 O O   . HIS D 2 194 ? 83.300 14.195  86.687  1.00 83.17  ? 194 HIS B O   1 
ATOM   6257 C CB  . HIS D 2 194 ? 80.443 14.240  88.487  1.00 83.17  ? 194 HIS B CB  1 
ATOM   6258 C CG  . HIS D 2 194 ? 79.721 14.491  89.775  1.00 83.33  ? 194 HIS B CG  1 
ATOM   6259 N ND1 . HIS D 2 194 ? 79.934 15.614  90.543  1.00 83.73  ? 194 HIS B ND1 1 
ATOM   6260 C CD2 . HIS D 2 194 ? 78.790 13.759  90.430  1.00 82.48  ? 194 HIS B CD2 1 
ATOM   6261 C CE1 . HIS D 2 194 ? 79.165 15.564  91.616  1.00 83.16  ? 194 HIS B CE1 1 
ATOM   6262 N NE2 . HIS D 2 194 ? 78.461 14.448  91.572  1.00 83.75  ? 194 HIS B NE2 1 
ATOM   6263 N N   . ASN D 2 195 ? 82.112 12.295  86.902  1.00 81.16  ? 195 ASN B N   1 
ATOM   6264 C CA  . ASN D 2 195 ? 82.549 11.729  85.635  1.00 80.97  ? 195 ASN B CA  1 
ATOM   6265 C C   . ASN D 2 195 ? 81.578 10.607  85.299  1.00 80.03  ? 195 ASN B C   1 
ATOM   6266 O O   . ASN D 2 195 ? 81.108 9.898   86.186  1.00 79.04  ? 195 ASN B O   1 
ATOM   6267 C CB  . ASN D 2 195 ? 83.980 11.192  85.742  1.00 82.23  ? 195 ASN B CB  1 
ATOM   6268 C CG  . ASN D 2 195 ? 84.082 9.970   86.629  1.00 83.36  ? 195 ASN B CG  1 
ATOM   6269 O OD1 . ASN D 2 195 ? 83.568 8.902   86.296  1.00 85.41  ? 195 ASN B OD1 1 
ATOM   6270 N ND2 . ASN D 2 195 ? 84.751 10.119  87.766  1.00 85.47  ? 195 ASN B ND2 1 
ATOM   6271 N N   . GLY D 2 196 ? 81.268 10.451  84.019  1.00 79.54  ? 196 GLY B N   1 
ATOM   6272 C CA  . GLY D 2 196 ? 80.325 9.421   83.626  1.00 79.66  ? 196 GLY B CA  1 
ATOM   6273 C C   . GLY D 2 196 ? 78.907 9.961   83.702  1.00 78.00  ? 196 GLY B C   1 
ATOM   6274 O O   . GLY D 2 196 ? 78.227 9.812   84.718  1.00 77.36  ? 196 GLY B O   1 
ATOM   6275 N N   . TYR D 2 197 ? 78.465 10.604  82.626  1.00 76.77  ? 197 TYR B N   1 
ATOM   6276 C CA  . TYR D 2 197 ? 77.125 11.173  82.565  1.00 74.95  ? 197 TYR B CA  1 
ATOM   6277 C C   . TYR D 2 197 ? 76.234 10.333  81.655  1.00 73.52  ? 197 TYR B C   1 
ATOM   6278 O O   . TYR D 2 197 ? 76.672 9.872   80.600  1.00 71.37  ? 197 TYR B O   1 
ATOM   6279 C CB  . TYR D 2 197 ? 77.193 12.621  82.073  1.00 74.98  ? 197 TYR B CB  1 
ATOM   6280 C CG  . TYR D 2 197 ? 77.874 13.551  83.055  1.00 76.07  ? 197 TYR B CG  1 
ATOM   6281 C CD1 . TYR D 2 197 ? 79.230 13.415  83.352  1.00 77.98  ? 197 TYR B CD1 1 
ATOM   6282 C CD2 . TYR D 2 197 ? 77.153 14.544  83.717  1.00 78.48  ? 197 TYR B CD2 1 
ATOM   6283 C CE1 . TYR D 2 197 ? 79.854 14.242  84.288  1.00 79.72  ? 197 TYR B CE1 1 
ATOM   6284 C CE2 . TYR D 2 197 ? 77.765 15.379  84.655  1.00 80.00  ? 197 TYR B CE2 1 
ATOM   6285 C CZ  . TYR D 2 197 ? 79.114 15.221  84.936  1.00 80.41  ? 197 TYR B CZ  1 
ATOM   6286 O OH  . TYR D 2 197 ? 79.719 16.033  85.870  1.00 79.43  ? 197 TYR B OH  1 
ATOM   6287 N N   . THR D 2 198 ? 74.983 10.146  82.069  1.00 73.00  ? 198 THR B N   1 
ATOM   6288 C CA  . THR D 2 198 ? 74.034 9.331   81.317  1.00 71.87  ? 198 THR B CA  1 
ATOM   6289 C C   . THR D 2 198 ? 72.773 10.037  80.816  1.00 71.54  ? 198 THR B C   1 
ATOM   6290 O O   . THR D 2 198 ? 72.029 10.648  81.585  1.00 68.75  ? 198 THR B O   1 
ATOM   6291 C CB  . THR D 2 198 ? 73.585 8.110   82.154  1.00 72.04  ? 198 THR B CB  1 
ATOM   6292 O OG1 . THR D 2 198 ? 74.730 7.330   82.517  1.00 70.66  ? 198 THR B OG1 1 
ATOM   6293 C CG2 . THR D 2 198 ? 72.616 7.243   81.360  1.00 72.81  ? 198 THR B CG2 1 
ATOM   6294 N N   . CYS D 2 199 ? 72.545 9.927   79.512  1.00 71.66  ? 199 CYS B N   1 
ATOM   6295 C CA  . CYS D 2 199 ? 71.374 10.495  78.853  1.00 72.09  ? 199 CYS B CA  1 
ATOM   6296 C C   . CYS D 2 199 ? 70.511 9.281   78.516  1.00 71.59  ? 199 CYS B C   1 
ATOM   6297 O O   . CYS D 2 199 ? 70.820 8.531   77.588  1.00 71.29  ? 199 CYS B O   1 
ATOM   6298 C CB  . CYS D 2 199 ? 71.798 11.218  77.571  1.00 74.35  ? 199 CYS B CB  1 
ATOM   6299 S SG  . CYS D 2 199 ? 70.458 11.875  76.518  1.00 76.62  ? 199 CYS B SG  1 
ATOM   6300 N N   . GLU D 2 200 ? 69.442 9.080   79.280  1.00 70.70  ? 200 GLU B N   1 
ATOM   6301 C CA  . GLU D 2 200 ? 68.560 7.937   79.074  1.00 71.20  ? 200 GLU B CA  1 
ATOM   6302 C C   . GLU D 2 200 ? 67.252 8.294   78.374  1.00 71.23  ? 200 GLU B C   1 
ATOM   6303 O O   . GLU D 2 200 ? 66.553 9.222   78.778  1.00 69.73  ? 200 GLU B O   1 
ATOM   6304 C CB  . GLU D 2 200 ? 68.270 7.275   80.422  1.00 73.59  ? 200 GLU B CB  1 
ATOM   6305 C CG  . GLU D 2 200 ? 67.326 6.093   80.356  1.00 78.92  ? 200 GLU B CG  1 
ATOM   6306 C CD  . GLU D 2 200 ? 67.216 5.378   81.685  1.00 82.37  ? 200 GLU B CD  1 
ATOM   6307 O OE1 . GLU D 2 200 ? 66.391 4.447   81.798  1.00 85.20  ? 200 GLU B OE1 1 
ATOM   6308 O OE2 . GLU D 2 200 ? 67.962 5.746   82.617  1.00 83.76  ? 200 GLU B OE2 1 
ATOM   6309 N N   . ALA D 2 201 ? 66.926 7.542   77.327  1.00 71.10  ? 201 ALA B N   1 
ATOM   6310 C CA  . ALA D 2 201 ? 65.707 7.774   76.561  1.00 73.12  ? 201 ALA B CA  1 
ATOM   6311 C C   . ALA D 2 201 ? 64.808 6.541   76.522  1.00 74.55  ? 201 ALA B C   1 
ATOM   6312 O O   . ALA D 2 201 ? 65.127 5.543   75.872  1.00 73.28  ? 201 ALA B O   1 
ATOM   6313 C CB  . ALA D 2 201 ? 66.061 8.203   75.142  1.00 74.12  ? 201 ALA B CB  1 
ATOM   6314 N N   . THR D 2 202 ? 63.678 6.620   77.219  1.00 76.53  ? 202 THR B N   1 
ATOM   6315 C CA  . THR D 2 202 ? 62.719 5.521   77.264  1.00 78.23  ? 202 THR B CA  1 
ATOM   6316 C C   . THR D 2 202 ? 61.490 5.840   76.413  1.00 78.71  ? 202 THR B C   1 
ATOM   6317 O O   . THR D 2 202 ? 60.627 6.628   76.810  1.00 76.68  ? 202 THR B O   1 
ATOM   6318 C CB  . THR D 2 202 ? 62.267 5.234   78.713  1.00 78.41  ? 202 THR B CB  1 
ATOM   6319 O OG1 . THR D 2 202 ? 63.399 4.827   79.493  1.00 80.50  ? 202 THR B OG1 1 
ATOM   6320 C CG2 . THR D 2 202 ? 61.215 4.134   78.739  1.00 78.18  ? 202 THR B CG2 1 
ATOM   6321 N N   . HIS D 2 203 ? 61.424 5.227   75.236  1.00 80.05  ? 203 HIS B N   1 
ATOM   6322 C CA  . HIS D 2 203 ? 60.309 5.435   74.321  1.00 81.20  ? 203 HIS B CA  1 
ATOM   6323 C C   . HIS D 2 203 ? 59.234 4.394   74.629  1.00 82.28  ? 203 HIS B C   1 
ATOM   6324 O O   . HIS D 2 203 ? 59.367 3.619   75.577  1.00 82.61  ? 203 HIS B O   1 
ATOM   6325 C CB  . HIS D 2 203 ? 60.788 5.289   72.871  1.00 80.22  ? 203 HIS B CB  1 
ATOM   6326 C CG  . HIS D 2 203 ? 59.901 5.955   71.865  1.00 80.59  ? 203 HIS B CG  1 
ATOM   6327 N ND1 . HIS D 2 203 ? 60.098 5.836   70.506  1.00 80.41  ? 203 HIS B ND1 1 
ATOM   6328 C CD2 . HIS D 2 203 ? 58.828 6.766   72.020  1.00 80.36  ? 203 HIS B CD2 1 
ATOM   6329 C CE1 . HIS D 2 203 ? 59.185 6.546   69.867  1.00 80.06  ? 203 HIS B CE1 1 
ATOM   6330 N NE2 . HIS D 2 203 ? 58.402 7.120   70.763  1.00 78.70  ? 203 HIS B NE2 1 
ATOM   6331 N N   . LYS D 2 204 ? 58.173 4.373   73.831  1.00 83.84  ? 204 LYS B N   1 
ATOM   6332 C CA  . LYS D 2 204 ? 57.091 3.417   74.040  1.00 84.84  ? 204 LYS B CA  1 
ATOM   6333 C C   . LYS D 2 204 ? 57.082 2.357   72.942  1.00 85.10  ? 204 LYS B C   1 
ATOM   6334 O O   . LYS D 2 204 ? 56.285 1.418   72.978  1.00 85.09  ? 204 LYS B O   1 
ATOM   6335 C CB  . LYS D 2 204 ? 55.743 4.143   74.074  1.00 85.42  ? 204 LYS B CB  1 
ATOM   6336 C CG  . LYS D 2 204 ? 55.646 5.243   75.127  1.00 85.52  ? 204 LYS B CG  1 
ATOM   6337 C CD  . LYS D 2 204 ? 55.840 4.697   76.534  1.00 86.25  ? 204 LYS B CD  1 
ATOM   6338 C CE  . LYS D 2 204 ? 55.653 5.789   77.578  1.00 86.10  ? 204 LYS B CE  1 
ATOM   6339 N NZ  . LYS D 2 204 ? 56.607 6.916   77.385  1.00 86.00  ? 204 LYS B NZ  1 
ATOM   6340 N N   . THR D 2 205 ? 57.977 2.513   71.971  1.00 85.01  ? 205 THR B N   1 
ATOM   6341 C CA  . THR D 2 205 ? 58.079 1.571   70.863  1.00 84.77  ? 205 THR B CA  1 
ATOM   6342 C C   . THR D 2 205 ? 58.741 0.273   71.313  1.00 85.54  ? 205 THR B C   1 
ATOM   6343 O O   . THR D 2 205 ? 58.160 -0.805  71.185  1.00 86.56  ? 205 THR B O   1 
ATOM   6344 C CB  . THR D 2 205 ? 58.893 2.167   69.695  1.00 84.29  ? 205 THR B CB  1 
ATOM   6345 O OG1 . THR D 2 205 ? 60.191 2.558   70.161  1.00 83.57  ? 205 THR B OG1 1 
ATOM   6346 C CG2 . THR D 2 205 ? 58.177 3.379   69.115  1.00 82.98  ? 205 THR B CG2 1 
ATOM   6347 N N   . SER D 2 206 ? 59.956 0.382   71.842  1.00 86.17  ? 206 SER B N   1 
ATOM   6348 C CA  . SER D 2 206 ? 60.691 -0.789  72.308  1.00 87.17  ? 206 SER B CA  1 
ATOM   6349 C C   . SER D 2 206 ? 60.704 -0.873  73.833  1.00 87.08  ? 206 SER B C   1 
ATOM   6350 O O   . SER D 2 206 ? 60.216 0.024   74.524  1.00 86.49  ? 206 SER B O   1 
ATOM   6351 C CB  . SER D 2 206 ? 62.132 -0.755  71.786  1.00 87.69  ? 206 SER B CB  1 
ATOM   6352 O OG  . SER D 2 206 ? 62.860 0.325   72.348  1.00 88.98  ? 206 SER B OG  1 
ATOM   6353 N N   . THR D 2 207 ? 61.263 -1.964  74.348  1.00 86.77  ? 207 THR B N   1 
ATOM   6354 C CA  . THR D 2 207 ? 61.357 -2.181  75.787  1.00 86.02  ? 207 THR B CA  1 
ATOM   6355 C C   . THR D 2 207 ? 62.820 -2.027  76.201  1.00 85.49  ? 207 THR B C   1 
ATOM   6356 O O   . THR D 2 207 ? 63.169 -2.176  77.374  1.00 85.29  ? 207 THR B O   1 
ATOM   6357 C CB  . THR D 2 207 ? 60.868 -3.598  76.167  1.00 85.74  ? 207 THR B CB  1 
ATOM   6358 O OG1 . THR D 2 207 ? 59.586 -3.838  75.573  1.00 86.06  ? 207 THR B OG1 1 
ATOM   6359 C CG2 . THR D 2 207 ? 60.743 -3.734  77.678  1.00 85.14  ? 207 THR B CG2 1 
ATOM   6360 N N   . SER D 2 208 ? 63.666 -1.724  75.220  1.00 84.52  ? 208 SER B N   1 
ATOM   6361 C CA  . SER D 2 208 ? 65.096 -1.542  75.445  1.00 84.23  ? 208 SER B CA  1 
ATOM   6362 C C   . SER D 2 208 ? 65.480 -0.062  75.384  1.00 83.80  ? 208 SER B C   1 
ATOM   6363 O O   . SER D 2 208 ? 65.936 0.428   74.346  1.00 83.94  ? 208 SER B O   1 
ATOM   6364 C CB  . SER D 2 208 ? 65.894 -2.323  74.395  1.00 84.71  ? 208 SER B CB  1 
ATOM   6365 O OG  . SER D 2 208 ? 67.288 -2.108  74.543  1.00 85.29  ? 208 SER B OG  1 
ATOM   6366 N N   . PRO D 2 209 ? 65.303 0.667   76.503  1.00 81.19  ? 209 PRO B N   1 
ATOM   6367 C CA  . PRO D 2 209 ? 65.625 2.095   76.590  1.00 79.56  ? 209 PRO B CA  1 
ATOM   6368 C C   . PRO D 2 209 ? 67.008 2.441   76.041  1.00 77.54  ? 209 PRO B C   1 
ATOM   6369 O O   . PRO D 2 209 ? 68.026 2.046   76.612  1.00 75.35  ? 209 PRO B O   1 
ATOM   6370 C CB  . PRO D 2 209 ? 65.513 2.378   78.085  1.00 78.78  ? 209 PRO B CB  1 
ATOM   6371 C CG  . PRO D 2 209 ? 64.418 1.458   78.505  1.00 79.37  ? 209 PRO B CG  1 
ATOM   6372 C CD  . PRO D 2 209 ? 64.791 0.175   77.795  1.00 79.63  ? 209 PRO B CD  1 
ATOM   6373 N N   . ILE D 2 210 ? 67.037 3.175   74.933  1.00 76.88  ? 210 ILE B N   1 
ATOM   6374 C CA  . ILE D 2 210 ? 68.299 3.580   74.325  1.00 76.11  ? 210 ILE B CA  1 
ATOM   6375 C C   . ILE D 2 210 ? 68.981 4.590   75.239  1.00 74.82  ? 210 ILE B C   1 
ATOM   6376 O O   . ILE D 2 210 ? 68.519 5.722   75.386  1.00 74.86  ? 210 ILE B O   1 
ATOM   6377 C CB  . ILE D 2 210 ? 68.082 4.224   72.937  1.00 76.42  ? 210 ILE B CB  1 
ATOM   6378 C CG1 . ILE D 2 210 ? 67.461 3.200   71.981  1.00 77.35  ? 210 ILE B CG1 1 
ATOM   6379 C CG2 . ILE D 2 210 ? 69.412 4.725   72.384  1.00 74.79  ? 210 ILE B CG2 1 
ATOM   6380 C CD1 . ILE D 2 210 ? 67.234 3.723   70.575  1.00 76.79  ? 210 ILE B CD1 1 
ATOM   6381 N N   . VAL D 2 211 ? 70.080 4.168   75.856  1.00 73.40  ? 211 VAL B N   1 
ATOM   6382 C CA  . VAL D 2 211 ? 70.825 5.023   76.770  1.00 71.78  ? 211 VAL B CA  1 
ATOM   6383 C C   . VAL D 2 211 ? 72.239 5.302   76.265  1.00 70.11  ? 211 VAL B C   1 
ATOM   6384 O O   . VAL D 2 211 ? 72.930 4.397   75.794  1.00 70.49  ? 211 VAL B O   1 
ATOM   6385 C CB  . VAL D 2 211 ? 70.915 4.379   78.172  1.00 71.67  ? 211 VAL B CB  1 
ATOM   6386 C CG1 . VAL D 2 211 ? 69.519 4.113   78.710  1.00 71.08  ? 211 VAL B CG1 1 
ATOM   6387 C CG2 . VAL D 2 211 ? 71.706 3.082   78.101  1.00 71.87  ? 211 VAL B CG2 1 
ATOM   6388 N N   . LYS D 2 212 ? 72.660 6.559   76.356  1.00 66.75  ? 212 LYS B N   1 
ATOM   6389 C CA  . LYS D 2 212 ? 73.995 6.943   75.920  1.00 62.58  ? 212 LYS B CA  1 
ATOM   6390 C C   . LYS D 2 212 ? 74.702 7.674   77.052  1.00 62.03  ? 212 LYS B C   1 
ATOM   6391 O O   . LYS D 2 212 ? 74.118 8.540   77.705  1.00 58.86  ? 212 LYS B O   1 
ATOM   6392 C CB  . LYS D 2 212 ? 73.919 7.838   74.679  1.00 63.42  ? 212 LYS B CB  1 
ATOM   6393 C CG  . LYS D 2 212 ? 73.171 7.209   73.506  1.00 62.97  ? 212 LYS B CG  1 
ATOM   6394 C CD  . LYS D 2 212 ? 73.778 5.871   73.092  1.00 61.27  ? 212 LYS B CD  1 
ATOM   6395 C CE  . LYS D 2 212 ? 75.094 6.049   72.356  1.00 60.12  ? 212 LYS B CE  1 
ATOM   6396 N NZ  . LYS D 2 212 ? 74.905 6.720   71.040  1.00 58.48  ? 212 LYS B NZ  1 
ATOM   6397 N N   . SER D 2 213 ? 75.958 7.309   77.287  1.00 62.00  ? 213 SER B N   1 
ATOM   6398 C CA  . SER D 2 213 ? 76.751 7.921   78.345  1.00 63.39  ? 213 SER B CA  1 
ATOM   6399 C C   . SER D 2 213 ? 78.191 8.106   77.895  1.00 64.25  ? 213 SER B C   1 
ATOM   6400 O O   . SER D 2 213 ? 78.583 7.635   76.828  1.00 64.12  ? 213 SER B O   1 
ATOM   6401 C CB  . SER D 2 213 ? 76.729 7.040   79.597  1.00 63.20  ? 213 SER B CB  1 
ATOM   6402 O OG  . SER D 2 213 ? 75.405 6.824   80.050  1.00 63.39  ? 213 SER B OG  1 
ATOM   6403 N N   . PHE D 2 214 ? 78.974 8.796   78.716  1.00 66.44  ? 214 PHE B N   1 
ATOM   6404 C CA  . PHE D 2 214 ? 80.379 9.025   78.413  1.00 70.21  ? 214 PHE B CA  1 
ATOM   6405 C C   . PHE D 2 214 ? 81.155 9.185   79.715  1.00 70.38  ? 214 PHE B C   1 
ATOM   6406 O O   . PHE D 2 214 ? 80.491 9.273   80.767  1.00 68.47  ? 214 PHE B O   1 
ATOM   6407 C CB  . PHE D 2 214 ? 80.539 10.271  77.529  1.00 73.43  ? 214 PHE B CB  1 
ATOM   6408 C CG  . PHE D 2 214 ? 80.208 11.566  78.221  1.00 75.95  ? 214 PHE B CG  1 
ATOM   6409 C CD1 . PHE D 2 214 ? 81.168 12.233  78.976  1.00 76.16  ? 214 PHE B CD1 1 
ATOM   6410 C CD2 . PHE D 2 214 ? 78.939 12.123  78.110  1.00 77.61  ? 214 PHE B CD2 1 
ATOM   6411 C CE1 . PHE D 2 214 ? 80.870 13.438  79.611  1.00 78.10  ? 214 PHE B CE1 1 
ATOM   6412 C CE2 . PHE D 2 214 ? 78.630 13.327  78.742  1.00 80.64  ? 214 PHE B CE2 1 
ATOM   6413 C CZ  . PHE D 2 214 ? 79.599 13.985  79.494  1.00 80.81  ? 214 PHE B CZ  1 
ATOM   6414 O OXT . PHE D 2 214 ? 82.403 9.216   79.670  1.00 71.50  ? 214 PHE B OXT 1 
HETATM 6415 C C1  . SPB E 3 .   ? 58.769 2.883   -29.182 1.00 22.38  ? 601 SPB H C1  1 
HETATM 6416 C C2  . SPB E 3 .   ? 57.534 3.465   -28.796 1.00 22.68  ? 601 SPB H C2  1 
HETATM 6417 C C3  . SPB E 3 .   ? 56.490 2.644   -28.301 1.00 26.09  ? 601 SPB H C3  1 
HETATM 6418 C C4  . SPB E 3 .   ? 56.675 1.238   -28.191 1.00 22.49  ? 601 SPB H C4  1 
HETATM 6419 C C5  . SPB E 3 .   ? 57.904 0.649   -28.574 1.00 20.30  ? 601 SPB H C5  1 
HETATM 6420 C C6  . SPB E 3 .   ? 58.976 1.471   -29.075 1.00 24.02  ? 601 SPB H C6  1 
HETATM 6421 C C7  . SPB E 3 .   ? 60.336 0.916   -29.513 1.00 20.19  ? 601 SPB H C7  1 
HETATM 6422 C C8  . SPB E 3 .   ? 60.613 -0.404  -29.372 1.00 15.50  ? 601 SPB H C8  1 
HETATM 6423 C C9  . SPB E 3 .   ? 61.964 -0.955  -29.815 1.00 19.55  ? 601 SPB H C9  1 
HETATM 6424 C C10 . SPB E 3 .   ? 62.279 -2.328  -29.599 1.00 17.33  ? 601 SPB H C10 1 
HETATM 6425 C C11 . SPB E 3 .   ? 63.519 -2.827  -30.017 1.00 18.50  ? 601 SPB H C11 1 
HETATM 6426 C C12 . SPB E 3 .   ? 64.474 -1.976  -30.666 1.00 19.66  ? 601 SPB H C12 1 
HETATM 6427 C C13 . SPB E 3 .   ? 64.157 -0.608  -30.888 1.00 19.76  ? 601 SPB H C13 1 
HETATM 6428 C C14 . SPB E 3 .   ? 62.916 -0.098  -30.468 1.00 19.10  ? 601 SPB H C14 1 
HETATM 6429 N N15 . SPB E 3 .   ? 65.725 -2.562  -31.081 1.00 21.50  ? 601 SPB H N15 1 
HETATM 6430 C C16 . SPB E 3 .   ? 66.027 -3.700  -31.721 1.00 25.50  ? 601 SPB H C16 1 
HETATM 6431 C C17 . SPB E 3 .   ? 67.508 -3.962  -31.990 1.00 25.00  ? 601 SPB H C17 1 
HETATM 6432 C C18 . SPB E 3 .   ? 67.848 -3.801  -33.481 1.00 33.30  ? 601 SPB H C18 1 
HETATM 6433 C C19 . SPB E 3 .   ? 69.354 -3.778  -33.757 1.00 37.46  ? 601 SPB H C19 1 
HETATM 6434 C C20 . SPB E 3 .   ? 69.902 -5.173  -34.041 1.00 46.01  ? 601 SPB H C20 1 
HETATM 6435 O O21 . SPB E 3 .   ? 70.342 -5.782  -32.899 1.00 48.13  ? 601 SPB H O21 1 
HETATM 6436 O O22 . SPB E 3 .   ? 65.181 -4.512  -32.095 1.00 28.18  ? 601 SPB H O22 1 
HETATM 6437 O O23 . SPB E 3 .   ? 69.921 -5.685  -35.165 1.00 48.51  ? 601 SPB H O23 1 
HETATM 6438 C C1  . SPB F 3 .   ? 44.552 36.700  60.734  1.00 19.07  ? 701 SPB B C1  1 
HETATM 6439 C C2  . SPB F 3 .   ? 45.868 36.172  60.705  1.00 23.60  ? 701 SPB B C2  1 
HETATM 6440 C C3  . SPB F 3 .   ? 46.985 37.029  60.871  1.00 22.61  ? 701 SPB B C3  1 
HETATM 6441 C C4  . SPB F 3 .   ? 46.792 38.420  61.068  1.00 24.43  ? 701 SPB B C4  1 
HETATM 6442 C C5  . SPB F 3 .   ? 45.476 38.958  61.102  1.00 21.13  ? 701 SPB B C5  1 
HETATM 6443 C C6  . SPB F 3 .   ? 44.335 38.096  60.936  1.00 18.57  ? 701 SPB B C6  1 
HETATM 6444 C C7  . SPB F 3 .   ? 42.892 38.599  60.959  1.00 19.26  ? 701 SPB B C7  1 
HETATM 6445 C C8  . SPB F 3 .   ? 42.626 39.909  61.237  1.00 17.41  ? 701 SPB B C8  1 
HETATM 6446 C C9  . SPB F 3 .   ? 41.180 40.410  61.277  1.00 17.39  ? 701 SPB B C9  1 
HETATM 6447 C C10 . SPB F 3 .   ? 40.900 41.744  61.690  1.00 22.94  ? 701 SPB B C10 1 
HETATM 6448 C C11 . SPB F 3 .   ? 39.566 42.198  61.739  1.00 15.93  ? 701 SPB B C11 1 
HETATM 6449 C C12 . SPB F 3 .   ? 38.486 41.332  61.368  1.00 17.48  ? 701 SPB B C12 1 
HETATM 6450 C C13 . SPB F 3 .   ? 38.769 39.999  60.940  1.00 21.04  ? 701 SPB B C13 1 
HETATM 6451 C C14 . SPB F 3 .   ? 40.099 39.540  60.895  1.00 18.68  ? 701 SPB B C14 1 
HETATM 6452 N N15 . SPB F 3 .   ? 37.145 41.869  61.451  1.00 21.26  ? 701 SPB B N15 1 
HETATM 6453 C C16 . SPB F 3 .   ? 36.574 42.993  60.986  1.00 23.16  ? 701 SPB B C16 1 
HETATM 6454 C C17 . SPB F 3 .   ? 35.095 43.191  61.322  1.00 29.30  ? 701 SPB B C17 1 
HETATM 6455 C C18 . SPB F 3 .   ? 34.145 42.749  60.193  1.00 38.15  ? 701 SPB B C18 1 
HETATM 6456 C C19 . SPB F 3 .   ? 33.296 43.916  59.658  1.00 45.32  ? 701 SPB B C19 1 
HETATM 6457 C C20 . SPB F 3 .   ? 31.963 44.080  60.390  1.00 45.05  ? 701 SPB B C20 1 
HETATM 6458 O O21 . SPB F 3 .   ? 32.125 44.389  61.720  1.00 44.92  ? 701 SPB B O21 1 
HETATM 6459 O O22 . SPB F 3 .   ? 37.179 43.846  60.336  1.00 21.10  ? 701 SPB B O22 1 
HETATM 6460 O O23 . SPB F 3 .   ? 30.875 43.950  59.836  1.00 54.27  ? 701 SPB B O23 1 
HETATM 6461 O O   . HOH G 4 .   ? 62.751 -5.410  -31.758 1.00 17.80  ? 602 HOH H O   1 
HETATM 6462 O O   . HOH G 4 .   ? 59.735 -1.347  -43.277 1.00 17.58  ? 603 HOH H O   1 
HETATM 6463 O O   . HOH G 4 .   ? 62.327 -1.495  -41.919 1.00 21.28  ? 604 HOH H O   1 
HETATM 6464 O O   . HOH G 4 .   ? 62.829 -6.034  -35.544 1.00 22.95  ? 605 HOH H O   1 
HETATM 6465 O O   . HOH G 4 .   ? 58.582 -4.461  -42.749 1.00 29.11  ? 606 HOH H O   1 
HETATM 6466 O O   . HOH G 4 .   ? 54.105 1.539   -35.483 1.00 31.30  ? 607 HOH H O   1 
HETATM 6467 O O   . HOH G 4 .   ? 68.338 -11.612 -35.454 1.00 31.33  ? 608 HOH H O   1 
HETATM 6468 O O   . HOH G 4 .   ? 60.024 -19.252 -28.754 1.00 32.88  ? 609 HOH H O   1 
HETATM 6469 O O   . HOH G 4 .   ? 46.371 -3.514  -28.148 1.00 36.74  ? 610 HOH H O   1 
HETATM 6470 O O   . HOH G 4 .   ? 55.547 -14.665 -44.801 1.00 40.93  ? 611 HOH H O   1 
HETATM 6471 O O   . HOH G 4 .   ? 56.079 -5.095  -43.404 1.00 26.88  ? 612 HOH H O   1 
HETATM 6472 O O   . HOH G 4 .   ? 39.375 17.121  -12.598 1.00 34.33  ? 613 HOH H O   1 
HETATM 6473 O O   . HOH G 4 .   ? 69.008 8.962   -20.968 1.00 26.87  ? 614 HOH H O   1 
HETATM 6474 O O   . HOH G 4 .   ? 59.296 -14.690 -44.788 1.00 37.09  ? 615 HOH H O   1 
HETATM 6475 O O   . HOH G 4 .   ? 21.952 21.558  -22.416 1.00 49.63  ? 616 HOH H O   1 
HETATM 6476 O O   . HOH G 4 .   ? 63.387 -12.538 -45.001 1.00 37.43  ? 617 HOH H O   1 
HETATM 6477 O O   . HOH G 4 .   ? 64.966 0.164   -20.568 1.00 28.16  ? 618 HOH H O   1 
HETATM 6478 O O   . HOH G 4 .   ? 67.481 -15.870 -21.513 1.00 39.68  ? 619 HOH H O   1 
HETATM 6479 O O   . HOH G 4 .   ? 51.163 -1.202  -35.283 1.00 38.72  ? 620 HOH H O   1 
HETATM 6480 O O   . HOH G 4 .   ? 19.145 24.987  -22.617 1.00 51.32  ? 621 HOH H O   1 
HETATM 6481 O O   . HOH G 4 .   ? 44.608 -3.249  -16.127 1.00 40.33  ? 622 HOH H O   1 
HETATM 6482 O O   . HOH G 4 .   ? 56.518 -15.801 -37.658 1.00 39.38  ? 623 HOH H O   1 
HETATM 6483 O O   . HOH G 4 .   ? 60.691 -5.528  -43.491 1.00 34.44  ? 624 HOH H O   1 
HETATM 6484 O O   . HOH G 4 .   ? 53.421 -20.099 -41.008 1.00 51.55  ? 625 HOH H O   1 
HETATM 6485 O O   . HOH G 4 .   ? 58.030 -16.185 -16.995 1.00 39.95  ? 626 HOH H O   1 
HETATM 6486 O O   . HOH G 4 .   ? 62.932 6.216   -14.984 1.00 55.75  ? 627 HOH H O   1 
HETATM 6487 O O   . HOH G 4 .   ? 47.723 -18.191 -29.527 1.00 42.58  ? 628 HOH H O   1 
HETATM 6488 O O   . HOH G 4 .   ? 56.347 -16.711 -23.203 1.00 34.62  ? 629 HOH H O   1 
HETATM 6489 O O   . HOH G 4 .   ? 41.292 7.900   -16.706 1.00 44.12  ? 630 HOH H O   1 
HETATM 6490 O O   . HOH G 4 .   ? 67.578 12.044  -19.496 1.00 41.64  ? 631 HOH H O   1 
HETATM 6491 O O   . HOH G 4 .   ? 70.198 -15.605 -33.060 1.00 48.40  ? 632 HOH H O   1 
HETATM 6492 O O   . HOH G 4 .   ? 53.551 -10.501 -37.175 1.00 86.82  ? 633 HOH H O   1 
HETATM 6493 O O   . HOH G 4 .   ? 64.093 -14.508 -17.688 1.00 58.02  ? 634 HOH H O   1 
HETATM 6494 O O   . HOH G 4 .   ? 63.605 -17.682 -22.610 1.00 49.16  ? 635 HOH H O   1 
HETATM 6495 O O   . HOH G 4 .   ? 50.033 -13.101 -39.204 1.00 43.14  ? 636 HOH H O   1 
HETATM 6496 O O   . HOH G 4 .   ? 49.580 -12.653 -36.325 1.00 34.52  ? 637 HOH H O   1 
HETATM 6497 O O   . HOH G 4 .   ? 21.208 18.454  -22.625 1.00 49.69  ? 638 HOH H O   1 
HETATM 6498 O O   . HOH G 4 .   ? 28.917 29.130  -18.609 1.00 53.33  ? 639 HOH H O   1 
HETATM 6499 O O   . HOH G 4 .   ? 45.943 -0.951  -6.542  1.00 66.46  ? 640 HOH H O   1 
HETATM 6500 O O   . HOH G 4 .   ? 34.263 0.383   -22.537 1.00 56.23  ? 641 HOH H O   1 
HETATM 6501 O O   . HOH G 4 .   ? 62.702 -3.925  -42.323 1.00 39.30  ? 642 HOH H O   1 
HETATM 6502 O O   . HOH G 4 .   ? 55.961 2.749   -37.528 1.00 34.95  ? 643 HOH H O   1 
HETATM 6503 O O   . HOH G 4 .   ? 56.847 5.314   -21.186 1.00 52.83  ? 644 HOH H O   1 
HETATM 6504 O O   . HOH G 4 .   ? 58.523 2.098   -43.089 1.00 50.68  ? 645 HOH H O   1 
HETATM 6505 O O   . HOH G 4 .   ? 45.844 -13.116 -20.666 1.00 42.87  ? 646 HOH H O   1 
HETATM 6506 O O   . HOH G 4 .   ? 50.972 0.431   -37.625 1.00 32.55  ? 647 HOH H O   1 
HETATM 6507 O O   . HOH G 4 .   ? 47.887 -14.648 -11.040 1.00 46.93  ? 648 HOH H O   1 
HETATM 6508 O O   . HOH G 4 .   ? 24.409 28.865  -30.428 1.00 77.84  ? 649 HOH H O   1 
HETATM 6509 O O   . HOH G 4 .   ? 50.108 9.658   -24.104 1.00 66.51  ? 650 HOH H O   1 
HETATM 6510 O O   . HOH G 4 .   ? 47.471 -2.750  -30.381 1.00 50.65  ? 651 HOH H O   1 
HETATM 6511 O O   . HOH G 4 .   ? 69.089 -4.685  -16.307 1.00 55.69  ? 652 HOH H O   1 
HETATM 6512 O O   . HOH G 4 .   ? 34.194 14.348  -26.919 1.00 44.65  ? 653 HOH H O   1 
HETATM 6513 O O   . HOH G 4 .   ? 69.226 -12.020 -20.836 1.00 33.93  ? 654 HOH H O   1 
HETATM 6514 O O   . HOH G 4 .   ? 56.036 -19.013 -21.359 1.00 38.86  ? 655 HOH H O   1 
HETATM 6515 O O   . HOH G 4 .   ? 49.049 -0.361  -42.761 1.00 54.40  ? 656 HOH H O   1 
HETATM 6516 O O   . HOH G 4 .   ? 43.831 -4.215  -19.637 1.00 37.23  ? 657 HOH H O   1 
HETATM 6517 O O   . HOH G 4 .   ? 67.345 -10.115 -37.549 1.00 37.06  ? 658 HOH H O   1 
HETATM 6518 O O   . HOH G 4 .   ? 68.890 -20.723 -33.472 1.00 43.94  ? 659 HOH H O   1 
HETATM 6519 O O   . HOH G 4 .   ? 22.392 18.419  -15.324 1.00 38.09  ? 660 HOH H O   1 
HETATM 6520 O O   . HOH G 4 .   ? 62.381 -11.291 -47.554 1.00 38.66  ? 661 HOH H O   1 
HETATM 6521 O O   . HOH G 4 .   ? 46.463 0.404   -14.074 1.00 45.53  ? 662 HOH H O   1 
HETATM 6522 O O   . HOH G 4 .   ? 49.226 -17.079 -17.397 1.00 54.55  ? 663 HOH H O   1 
HETATM 6523 O O   . HOH G 4 .   ? 38.009 4.633   -1.148  1.00 40.24  ? 664 HOH H O   1 
HETATM 6524 O O   . HOH G 4 .   ? 52.517 2.720   -33.962 1.00 47.79  ? 665 HOH H O   1 
HETATM 6525 O O   . HOH G 4 .   ? 59.762 -17.103 -15.274 1.00 57.37  ? 666 HOH H O   1 
HETATM 6526 O O   . HOH G 4 .   ? 33.559 -3.631  -21.117 1.00 68.67  ? 667 HOH H O   1 
HETATM 6527 O O   . HOH G 4 .   ? 20.258 27.770  -23.225 1.00 66.34  ? 668 HOH H O   1 
HETATM 6528 O O   . HOH G 4 .   ? 35.279 23.517  -21.878 1.00 44.67  ? 669 HOH H O   1 
HETATM 6529 O O   . HOH G 4 .   ? 32.269 1.635   -21.329 1.00 69.20  ? 670 HOH H O   1 
HETATM 6530 O O   . HOH G 4 .   ? 63.144 -4.345  -39.949 1.00 35.38  ? 671 HOH H O   1 
HETATM 6531 O O   . HOH G 4 .   ? 46.870 -10.040 -29.810 1.00 39.90  ? 672 HOH H O   1 
HETATM 6532 O O   . HOH G 4 .   ? 71.820 -7.782  -32.257 1.00 45.31  ? 673 HOH H O   1 
HETATM 6533 O O   . HOH G 4 .   ? 64.369 -8.856  -47.957 1.00 52.99  ? 674 HOH H O   1 
HETATM 6534 O O   . HOH G 4 .   ? 21.739 15.842  -15.644 1.00 44.13  ? 675 HOH H O   1 
HETATM 6535 O O   . HOH G 4 .   ? 58.836 -16.258 -12.870 1.00 72.04  ? 676 HOH H O   1 
HETATM 6536 O O   . HOH G 4 .   ? 64.321 4.172   -20.923 1.00 56.32  ? 677 HOH H O   1 
HETATM 6537 O O   . HOH G 4 .   ? 30.610 -1.604  -13.267 1.00 74.42  ? 678 HOH H O   1 
HETATM 6538 O O   . HOH G 4 .   ? 26.228 7.576   -11.468 1.00 57.24  ? 679 HOH H O   1 
HETATM 6539 O O   . HOH G 4 .   ? 43.628 -7.186  -24.014 1.00 51.63  ? 680 HOH H O   1 
HETATM 6540 O O   . HOH G 4 .   ? 62.815 -10.098 -11.973 1.00 49.23  ? 681 HOH H O   1 
HETATM 6541 O O   . HOH G 4 .   ? 47.207 -15.169 -18.856 1.00 44.69  ? 682 HOH H O   1 
HETATM 6542 O O   . HOH G 4 .   ? 21.837 29.547  -21.372 1.00 56.46  ? 683 HOH H O   1 
HETATM 6543 O O   . HOH G 4 .   ? 47.230 10.518  -8.317  1.00 46.72  ? 684 HOH H O   1 
HETATM 6544 O O   . HOH G 4 .   ? 58.263 -17.876 -40.920 1.00 49.14  ? 685 HOH H O   1 
HETATM 6545 O O   . HOH G 4 .   ? 48.997 3.271   -26.883 1.00 46.44  ? 686 HOH H O   1 
HETATM 6546 O O   . HOH G 4 .   ? 45.204 -1.856  -29.513 1.00 59.41  ? 687 HOH H O   1 
HETATM 6547 O O   . HOH G 4 .   ? 48.288 -0.498  -34.232 1.00 50.91  ? 688 HOH H O   1 
HETATM 6548 O O   . HOH G 4 .   ? 64.406 -9.131  -42.369 1.00 44.30  ? 689 HOH H O   1 
HETATM 6549 O O   . HOH G 4 .   ? 52.867 -18.596 -13.976 1.00 64.27  ? 690 HOH H O   1 
HETATM 6550 O O   . HOH G 4 .   ? 38.389 11.092  -22.300 1.00 54.87  ? 691 HOH H O   1 
HETATM 6551 O O   . HOH G 4 .   ? 64.836 -3.952  -43.884 1.00 48.27  ? 692 HOH H O   1 
HETATM 6552 O O   . HOH G 4 .   ? 19.859 34.965  -18.275 1.00 68.89  ? 693 HOH H O   1 
HETATM 6553 O O   . HOH H 4 .   ? 65.777 3.751   -37.271 1.00 15.87  ? 215 HOH L O   1 
HETATM 6554 O O   . HOH H 4 .   ? 62.657 1.836   -45.109 1.00 24.43  ? 216 HOH L O   1 
HETATM 6555 O O   . HOH H 4 .   ? 65.286 2.205   -28.887 1.00 18.16  ? 217 HOH L O   1 
HETATM 6556 O O   . HOH H 4 .   ? 61.860 10.918  -45.890 1.00 25.63  ? 218 HOH L O   1 
HETATM 6557 O O   . HOH H 4 .   ? 66.499 3.714   -22.334 1.00 23.73  ? 219 HOH L O   1 
HETATM 6558 O O   . HOH H 4 .   ? 67.473 11.811  -22.354 1.00 24.41  ? 220 HOH L O   1 
HETATM 6559 O O   . HOH H 4 .   ? 67.852 -0.721  -29.899 1.00 21.30  ? 221 HOH L O   1 
HETATM 6560 O O   . HOH H 4 .   ? 64.119 0.310   -43.394 1.00 26.32  ? 222 HOH L O   1 
HETATM 6561 O O   . HOH H 4 .   ? 70.464 6.668   -42.260 1.00 22.78  ? 223 HOH L O   1 
HETATM 6562 O O   . HOH H 4 .   ? 49.532 23.971  -29.184 1.00 18.29  ? 224 HOH L O   1 
HETATM 6563 O O   . HOH H 4 .   ? 79.210 10.640  -28.121 1.00 23.57  ? 225 HOH L O   1 
HETATM 6564 O O   . HOH H 4 .   ? 64.733 14.557  -21.326 1.00 21.09  ? 226 HOH L O   1 
HETATM 6565 O O   . HOH H 4 .   ? 62.420 20.570  -40.943 1.00 19.14  ? 227 HOH L O   1 
HETATM 6566 O O   . HOH H 4 .   ? 73.717 17.483  -26.847 1.00 25.35  ? 228 HOH L O   1 
HETATM 6567 O O   . HOH H 4 .   ? 80.181 15.731  -30.353 1.00 21.57  ? 229 HOH L O   1 
HETATM 6568 O O   . HOH H 4 .   ? 67.716 -0.876  -42.146 1.00 22.42  ? 230 HOH L O   1 
HETATM 6569 O O   . HOH H 4 .   ? 74.171 10.443  -24.372 1.00 26.41  ? 231 HOH L O   1 
HETATM 6570 O O   . HOH H 4 .   ? 67.634 -1.684  -36.735 1.00 23.54  ? 232 HOH L O   1 
HETATM 6571 O O   . HOH H 4 .   ? 52.316 20.704  -20.496 1.00 28.34  ? 233 HOH L O   1 
HETATM 6572 O O   . HOH H 4 .   ? 76.718 -0.772  -25.430 1.00 30.80  ? 234 HOH L O   1 
HETATM 6573 O O   . HOH H 4 .   ? 74.431 17.474  -29.406 1.00 22.52  ? 235 HOH L O   1 
HETATM 6574 O O   . HOH H 4 .   ? 69.247 6.675   -23.072 1.00 25.65  ? 236 HOH L O   1 
HETATM 6575 O O   . HOH H 4 .   ? 60.516 14.545  -20.731 1.00 29.29  ? 237 HOH L O   1 
HETATM 6576 O O   . HOH H 4 .   ? 74.352 -1.948  -26.889 1.00 31.01  ? 238 HOH L O   1 
HETATM 6577 O O   . HOH H 4 .   ? 43.268 24.799  -22.599 1.00 30.07  ? 239 HOH L O   1 
HETATM 6578 O O   . HOH H 4 .   ? 59.720 31.201  -32.400 1.00 32.59  ? 240 HOH L O   1 
HETATM 6579 O O   . HOH H 4 .   ? 52.406 31.834  -31.423 1.00 27.19  ? 241 HOH L O   1 
HETATM 6580 O O   . HOH H 4 .   ? 55.719 11.181  -44.586 1.00 31.65  ? 242 HOH L O   1 
HETATM 6581 O O   . HOH H 4 .   ? 53.622 22.353  -24.602 1.00 23.46  ? 243 HOH L O   1 
HETATM 6582 O O   . HOH H 4 .   ? 59.704 7.965   -46.127 1.00 33.30  ? 244 HOH L O   1 
HETATM 6583 O O   . HOH H 4 .   ? 59.169 7.453   -24.448 1.00 39.59  ? 245 HOH L O   1 
HETATM 6584 O O   . HOH H 4 .   ? 73.965 7.436   -42.317 1.00 26.35  ? 246 HOH L O   1 
HETATM 6585 O O   . HOH H 4 .   ? 46.144 16.885  -21.137 1.00 30.09  ? 247 HOH L O   1 
HETATM 6586 O O   . HOH H 4 .   ? 55.499 12.237  -22.527 1.00 31.29  ? 248 HOH L O   1 
HETATM 6587 O O   . HOH H 4 .   ? 64.779 14.212  -42.418 1.00 26.05  ? 249 HOH L O   1 
HETATM 6588 O O   . HOH H 4 .   ? 52.800 24.689  -40.893 1.00 33.49  ? 250 HOH L O   1 
HETATM 6589 O O   . HOH H 4 .   ? 66.917 18.619  -19.107 1.00 27.64  ? 251 HOH L O   1 
HETATM 6590 O O   . HOH H 4 .   ? 66.954 18.502  -26.478 1.00 35.75  ? 252 HOH L O   1 
HETATM 6591 O O   . HOH H 4 .   ? 51.233 10.478  -30.159 1.00 24.64  ? 253 HOH L O   1 
HETATM 6592 O O   . HOH H 4 .   ? 71.663 20.402  -31.995 1.00 38.13  ? 254 HOH L O   1 
HETATM 6593 O O   . HOH H 4 .   ? 53.690 22.962  -22.019 1.00 34.24  ? 255 HOH L O   1 
HETATM 6594 O O   . HOH H 4 .   ? 71.181 10.873  -20.543 1.00 29.29  ? 256 HOH L O   1 
HETATM 6595 O O   . HOH H 4 .   ? 68.121 5.408   -44.385 1.00 27.57  ? 257 HOH L O   1 
HETATM 6596 O O   . HOH H 4 .   ? 52.061 16.940  -35.422 1.00 39.26  ? 258 HOH L O   1 
HETATM 6597 O O   . HOH H 4 .   ? 53.844 7.634   -38.188 1.00 31.63  ? 259 HOH L O   1 
HETATM 6598 O O   . HOH H 4 .   ? 72.997 -3.901  -20.728 1.00 48.50  ? 260 HOH L O   1 
HETATM 6599 O O   . HOH H 4 .   ? 66.979 19.349  -40.833 1.00 30.55  ? 261 HOH L O   1 
HETATM 6600 O O   . HOH H 4 .   ? 53.832 5.231   -35.234 1.00 27.07  ? 262 HOH L O   1 
HETATM 6601 O O   . HOH H 4 .   ? 72.502 -5.957  -30.448 1.00 35.70  ? 263 HOH L O   1 
HETATM 6602 O O   . HOH H 4 .   ? 40.137 18.871  -9.595  1.00 32.58  ? 264 HOH L O   1 
HETATM 6603 O O   . HOH H 4 .   ? 58.747 3.846   -44.737 1.00 47.27  ? 265 HOH L O   1 
HETATM 6604 O O   . HOH H 4 .   ? 59.843 17.197  -20.483 1.00 37.34  ? 266 HOH L O   1 
HETATM 6605 O O   . HOH H 4 .   ? 62.393 15.533  -43.884 1.00 36.02  ? 267 HOH L O   1 
HETATM 6606 O O   . HOH H 4 .   ? 71.883 -2.735  -36.487 1.00 42.17  ? 268 HOH L O   1 
HETATM 6607 O O   . HOH H 4 .   ? 63.776 25.355  -30.737 1.00 33.48  ? 269 HOH L O   1 
HETATM 6608 O O   . HOH H 4 .   ? 77.855 3.736   -25.232 1.00 40.43  ? 270 HOH L O   1 
HETATM 6609 O O   . HOH H 4 .   ? 55.749 22.660  -20.590 1.00 67.01  ? 271 HOH L O   1 
HETATM 6610 O O   . HOH H 4 .   ? 47.324 23.185  -17.297 1.00 30.97  ? 272 HOH L O   1 
HETATM 6611 O O   . HOH H 4 .   ? 43.608 23.902  5.436   1.00 38.96  ? 273 HOH L O   1 
HETATM 6612 O O   . HOH H 4 .   ? 65.954 21.365  -20.319 1.00 37.01  ? 274 HOH L O   1 
HETATM 6613 O O   . HOH H 4 .   ? 68.714 15.078  -20.189 1.00 37.72  ? 275 HOH L O   1 
HETATM 6614 O O   . HOH H 4 .   ? 54.388 19.668  -45.183 1.00 32.77  ? 276 HOH L O   1 
HETATM 6615 O O   . HOH H 4 .   ? 72.578 17.840  -31.063 1.00 28.81  ? 277 HOH L O   1 
HETATM 6616 O O   . HOH H 4 .   ? 49.309 18.049  -30.138 1.00 41.84  ? 278 HOH L O   1 
HETATM 6617 O O   . HOH H 4 .   ? 72.055 0.008   -25.695 1.00 25.94  ? 279 HOH L O   1 
HETATM 6618 O O   . HOH H 4 .   ? 54.977 6.530   -45.360 1.00 66.35  ? 280 HOH L O   1 
HETATM 6619 O O   . HOH H 4 .   ? 48.320 26.082  -36.016 1.00 33.23  ? 281 HOH L O   1 
HETATM 6620 O O   . HOH H 4 .   ? 23.684 28.860  -2.489  1.00 49.40  ? 282 HOH L O   1 
HETATM 6621 O O   . HOH H 4 .   ? 78.130 4.378   -22.395 1.00 49.64  ? 283 HOH L O   1 
HETATM 6622 O O   . HOH H 4 .   ? 66.658 6.635   -47.460 1.00 33.39  ? 284 HOH L O   1 
HETATM 6623 O O   . HOH H 4 .   ? 51.725 27.540  -38.123 1.00 38.27  ? 285 HOH L O   1 
HETATM 6624 O O   . HOH H 4 .   ? 28.359 16.650  -8.007  1.00 40.94  ? 286 HOH L O   1 
HETATM 6625 O O   . HOH H 4 .   ? 71.146 16.464  -26.525 1.00 33.41  ? 287 HOH L O   1 
HETATM 6626 O O   . HOH H 4 .   ? 47.747 22.810  -35.525 1.00 36.56  ? 288 HOH L O   1 
HETATM 6627 O O   . HOH H 4 .   ? 50.613 6.597   -33.438 1.00 60.75  ? 289 HOH L O   1 
HETATM 6628 O O   . HOH H 4 .   ? 35.029 29.580  -9.882  1.00 76.03  ? 290 HOH L O   1 
HETATM 6629 O O   . HOH H 4 .   ? 74.363 -3.771  -34.431 1.00 39.24  ? 291 HOH L O   1 
HETATM 6630 O O   . HOH H 4 .   ? 53.021 8.621   -45.484 1.00 43.94  ? 292 HOH L O   1 
HETATM 6631 O O   . HOH H 4 .   ? 59.430 24.345  -26.690 1.00 32.47  ? 293 HOH L O   1 
HETATM 6632 O O   . HOH H 4 .   ? 51.919 14.426  -35.744 1.00 30.16  ? 294 HOH L O   1 
HETATM 6633 O O   . HOH H 4 .   ? 44.128 26.438  -26.175 1.00 43.56  ? 295 HOH L O   1 
HETATM 6634 O O   . HOH H 4 .   ? 61.274 14.890  -18.221 1.00 38.44  ? 296 HOH L O   1 
HETATM 6635 O O   . HOH H 4 .   ? 64.335 -1.443  -45.374 1.00 27.44  ? 297 HOH L O   1 
HETATM 6636 O O   . HOH H 4 .   ? 71.327 -4.427  -38.555 1.00 38.85  ? 298 HOH L O   1 
HETATM 6637 O O   . HOH H 4 .   ? 64.549 14.269  -18.725 1.00 33.72  ? 299 HOH L O   1 
HETATM 6638 O O   . HOH H 4 .   ? 38.311 32.181  -9.555  1.00 80.44  ? 300 HOH L O   1 
HETATM 6639 O O   . HOH H 4 .   ? 69.267 4.603   -21.172 1.00 33.86  ? 301 HOH L O   1 
HETATM 6640 O O   . HOH H 4 .   ? 66.844 0.748   -22.180 1.00 49.54  ? 302 HOH L O   1 
HETATM 6641 O O   . HOH H 4 .   ? 53.519 29.020  -20.520 1.00 41.81  ? 303 HOH L O   1 
HETATM 6642 O O   . HOH H 4 .   ? 23.499 26.382  -0.377  1.00 54.35  ? 304 HOH L O   1 
HETATM 6643 O O   . HOH H 4 .   ? 66.559 21.023  -27.195 1.00 37.28  ? 305 HOH L O   1 
HETATM 6644 O O   . HOH H 4 .   ? 62.555 13.902  -45.828 1.00 36.18  ? 306 HOH L O   1 
HETATM 6645 O O   . HOH H 4 .   ? 68.075 18.895  -38.604 1.00 43.41  ? 307 HOH L O   1 
HETATM 6646 O O   . HOH H 4 .   ? 78.625 -1.286  -38.210 1.00 41.84  ? 308 HOH L O   1 
HETATM 6647 O O   . HOH H 4 .   ? 44.803 19.262  -26.573 1.00 42.47  ? 309 HOH L O   1 
HETATM 6648 O O   . HOH H 4 .   ? 69.006 -3.643  -38.315 1.00 41.11  ? 310 HOH L O   1 
HETATM 6649 O O   . HOH H 4 .   ? 76.715 11.840  -24.420 1.00 45.73  ? 311 HOH L O   1 
HETATM 6650 O O   . HOH H 4 .   ? 41.341 41.108  -14.686 1.00 61.08  ? 312 HOH L O   1 
HETATM 6651 O O   . HOH H 4 .   ? 79.314 15.101  -34.034 1.00 35.11  ? 313 HOH L O   1 
HETATM 6652 O O   . HOH H 4 .   ? 56.092 29.524  -16.717 1.00 57.45  ? 314 HOH L O   1 
HETATM 6653 O O   . HOH H 4 .   ? 62.772 29.751  -35.081 1.00 32.31  ? 315 HOH L O   1 
HETATM 6654 O O   . HOH H 4 .   ? 79.092 11.059  -25.197 1.00 32.37  ? 316 HOH L O   1 
HETATM 6655 O O   . HOH H 4 .   ? 45.496 22.054  -34.350 1.00 44.00  ? 317 HOH L O   1 
HETATM 6656 O O   . HOH H 4 .   ? 48.713 18.714  -25.857 1.00 47.39  ? 318 HOH L O   1 
HETATM 6657 O O   . HOH H 4 .   ? 35.271 36.770  -11.385 1.00 52.69  ? 319 HOH L O   1 
HETATM 6658 O O   . HOH H 4 .   ? 58.145 13.518  -20.314 1.00 49.08  ? 320 HOH L O   1 
HETATM 6659 O O   . HOH H 4 .   ? 52.283 13.738  -38.159 1.00 47.86  ? 321 HOH L O   1 
HETATM 6660 O O   . HOH H 4 .   ? 47.290 17.343  -12.987 1.00 33.53  ? 322 HOH L O   1 
HETATM 6661 O O   . HOH H 4 .   ? 72.287 -1.137  -27.825 1.00 84.07  ? 323 HOH L O   1 
HETATM 6662 O O   . HOH H 4 .   ? 35.042 14.771  -5.213  1.00 65.59  ? 324 HOH L O   1 
HETATM 6663 O O   . HOH H 4 .   ? 73.355 17.662  -34.932 1.00 41.90  ? 325 HOH L O   1 
HETATM 6664 O O   . HOH H 4 .   ? 78.728 -0.559  -24.043 1.00 50.44  ? 326 HOH L O   1 
HETATM 6665 O O   . HOH H 4 .   ? 33.086 32.442  0.447   1.00 46.20  ? 327 HOH L O   1 
HETATM 6666 O O   . HOH H 4 .   ? 32.628 21.029  -1.980  1.00 90.20  ? 328 HOH L O   1 
HETATM 6667 O O   . HOH H 4 .   ? 46.324 27.486  -34.712 1.00 50.78  ? 329 HOH L O   1 
HETATM 6668 O O   . HOH H 4 .   ? 62.032 11.384  -19.100 1.00 42.09  ? 330 HOH L O   1 
HETATM 6669 O O   . HOH H 4 .   ? 52.619 35.781  -23.989 1.00 37.08  ? 331 HOH L O   1 
HETATM 6670 O O   . HOH H 4 .   ? 18.939 13.829  -11.058 1.00 40.02  ? 332 HOH L O   1 
HETATM 6671 O O   . HOH H 4 .   ? 75.673 9.164   -39.067 1.00 41.98  ? 333 HOH L O   1 
HETATM 6672 O O   . HOH H 4 .   ? 69.618 13.632  -36.669 1.00 93.34  ? 334 HOH L O   1 
HETATM 6673 O O   . HOH H 4 .   ? 67.402 16.441  -17.971 1.00 56.11  ? 335 HOH L O   1 
HETATM 6674 O O   . HOH H 4 .   ? 70.013 -4.482  -19.487 1.00 32.98  ? 336 HOH L O   1 
HETATM 6675 O O   . HOH H 4 .   ? 47.820 17.040  -27.743 1.00 50.90  ? 337 HOH L O   1 
HETATM 6676 O O   . HOH H 4 .   ? 72.243 19.203  -37.127 1.00 48.79  ? 338 HOH L O   1 
HETATM 6677 O O   . HOH H 4 .   ? 73.838 -5.811  -32.716 1.00 51.17  ? 339 HOH L O   1 
HETATM 6678 O O   . HOH H 4 .   ? 57.686 28.898  -22.521 1.00 80.56  ? 340 HOH L O   1 
HETATM 6679 O O   . HOH H 4 .   ? 74.624 -1.881  -24.381 1.00 76.11  ? 341 HOH L O   1 
HETATM 6680 O O   . HOH H 4 .   ? 72.242 14.076  -41.452 1.00 34.46  ? 342 HOH L O   1 
HETATM 6681 O O   . HOH H 4 .   ? 52.788 20.897  -43.350 1.00 52.83  ? 343 HOH L O   1 
HETATM 6682 O O   . HOH H 4 .   ? 56.098 9.550   -23.740 1.00 43.94  ? 344 HOH L O   1 
HETATM 6683 O O   . HOH H 4 .   ? 60.041 26.579  -39.826 1.00 70.74  ? 345 HOH L O   1 
HETATM 6684 O O   . HOH H 4 .   ? 43.027 28.256  3.641   1.00 65.04  ? 346 HOH L O   1 
HETATM 6685 O O   . HOH H 4 .   ? 68.269 -2.094  -19.596 1.00 45.22  ? 347 HOH L O   1 
HETATM 6686 O O   . HOH H 4 .   ? 25.470 14.347  -8.304  1.00 73.14  ? 348 HOH L O   1 
HETATM 6687 O O   . HOH H 4 .   ? 76.623 8.726   -30.048 1.00 70.98  ? 349 HOH L O   1 
HETATM 6688 O O   . HOH H 4 .   ? 67.964 4.984   -23.391 1.00 78.53  ? 350 HOH L O   1 
HETATM 6689 O O   . HOH H 4 .   ? 44.277 22.142  -22.602 1.00 42.89  ? 351 HOH L O   1 
HETATM 6690 O O   . HOH H 4 .   ? 67.503 8.838   -48.198 1.00 60.75  ? 352 HOH L O   1 
HETATM 6691 O O   . HOH H 4 .   ? 81.247 5.727   -31.236 1.00 39.05  ? 353 HOH L O   1 
HETATM 6692 O O   . HOH H 4 .   ? 51.270 15.997  -37.751 1.00 61.58  ? 354 HOH L O   1 
HETATM 6693 O O   . HOH H 4 .   ? 53.369 20.178  -25.766 1.00 79.31  ? 355 HOH L O   1 
HETATM 6694 O O   . HOH H 4 .   ? 41.290 24.667  4.995   1.00 66.18  ? 356 HOH L O   1 
HETATM 6695 O O   . HOH H 4 .   ? 45.017 31.957  -10.608 1.00 81.22  ? 357 HOH L O   1 
HETATM 6696 O O   . HOH H 4 .   ? 61.083 31.507  -26.743 1.00 39.46  ? 358 HOH L O   1 
HETATM 6697 O O   . HOH H 4 .   ? 76.342 -1.875  -33.856 1.00 47.24  ? 359 HOH L O   1 
HETATM 6698 O O   . HOH H 4 .   ? 54.135 27.376  -22.559 1.00 54.83  ? 360 HOH L O   1 
HETATM 6699 O O   . HOH H 4 .   ? 75.639 9.281   -43.068 1.00 51.89  ? 361 HOH L O   1 
HETATM 6700 O O   . HOH H 4 .   ? 44.752 25.367  -34.289 1.00 57.81  ? 362 HOH L O   1 
HETATM 6701 O O   . HOH H 4 .   ? 77.739 -0.744  -35.847 1.00 51.14  ? 363 HOH L O   1 
HETATM 6702 O O   . HOH H 4 .   ? 30.773 11.589  -3.365  1.00 48.00  ? 364 HOH L O   1 
HETATM 6703 O O   . HOH H 4 .   ? 35.435 27.388  -17.145 1.00 44.77  ? 365 HOH L O   1 
HETATM 6704 O O   . HOH H 4 .   ? 42.247 9.409   -25.442 1.00 49.58  ? 366 HOH L O   1 
HETATM 6705 O O   . HOH H 4 .   ? 47.099 16.707  -32.210 1.00 46.96  ? 367 HOH L O   1 
HETATM 6706 O O   . HOH H 4 .   ? 46.003 43.281  -17.108 1.00 54.05  ? 368 HOH L O   1 
HETATM 6707 O O   . HOH H 4 .   ? 79.950 10.889  -35.943 1.00 59.13  ? 369 HOH L O   1 
HETATM 6708 O O   . HOH H 4 .   ? 25.550 29.791  -0.999  1.00 53.02  ? 370 HOH L O   1 
HETATM 6709 O O   . HOH H 4 .   ? 77.831 10.371  -40.361 1.00 52.80  ? 371 HOH L O   1 
HETATM 6710 O O   . HOH H 4 .   ? 74.116 21.285  -31.318 1.00 63.77  ? 372 HOH L O   1 
HETATM 6711 O O   . HOH H 4 .   ? 23.206 29.362  0.609   1.00 51.88  ? 373 HOH L O   1 
HETATM 6712 O O   . HOH H 4 .   ? 76.268 1.982   -20.652 1.00 49.19  ? 374 HOH L O   1 
HETATM 6713 O O   . HOH H 4 .   ? 74.362 8.033   -31.915 1.00 70.26  ? 375 HOH L O   1 
HETATM 6714 O O   . HOH H 4 .   ? 42.201 40.407  -17.710 1.00 59.71  ? 376 HOH L O   1 
HETATM 6715 O O   . HOH H 4 .   ? 39.034 33.260  2.845   1.00 75.33  ? 377 HOH L O   1 
HETATM 6716 O O   . HOH I 4 .   ? 42.159 44.872  46.317  1.00 20.74  ? 215 HOH A O   1 
HETATM 6717 O O   . HOH I 4 .   ? 38.128 45.462  56.416  1.00 18.97  ? 216 HOH A O   1 
HETATM 6718 O O   . HOH I 4 .   ? 39.542 45.075  59.910  1.00 16.71  ? 217 HOH A O   1 
HETATM 6719 O O   . HOH I 4 .   ? 38.839 41.085  47.783  1.00 21.62  ? 218 HOH A O   1 
HETATM 6720 O O   . HOH I 4 .   ? 39.750 44.068  48.039  1.00 25.97  ? 219 HOH A O   1 
HETATM 6721 O O   . HOH I 4 .   ? 36.723 41.064  50.060  1.00 18.85  ? 220 HOH A O   1 
HETATM 6722 O O   . HOH I 4 .   ? 36.530 44.102  52.206  1.00 20.29  ? 221 HOH A O   1 
HETATM 6723 O O   . HOH I 4 .   ? 52.697 43.544  81.334  1.00 41.87  ? 222 HOH A O   1 
HETATM 6724 O O   . HOH I 4 .   ? 43.196 55.570  52.172  1.00 30.77  ? 223 HOH A O   1 
HETATM 6725 O O   . HOH I 4 .   ? 50.173 52.646  51.298  1.00 29.11  ? 224 HOH A O   1 
HETATM 6726 O O   . HOH I 4 .   ? 41.248 39.239  70.910  1.00 28.82  ? 225 HOH A O   1 
HETATM 6727 O O   . HOH I 4 .   ? 41.163 56.684  69.412  1.00 30.07  ? 226 HOH A O   1 
HETATM 6728 O O   . HOH I 4 .   ? 50.643 60.556  57.599  1.00 27.02  ? 227 HOH A O   1 
HETATM 6729 O O   . HOH I 4 .   ? 47.935 56.792  65.663  1.00 23.41  ? 228 HOH A O   1 
HETATM 6730 O O   . HOH I 4 .   ? 38.362 29.734  71.873  1.00 29.96  ? 229 HOH A O   1 
HETATM 6731 O O   . HOH I 4 .   ? 48.285 56.548  72.018  1.00 29.74  ? 230 HOH A O   1 
HETATM 6732 O O   . HOH I 4 .   ? 38.048 44.323  76.327  1.00 28.58  ? 231 HOH A O   1 
HETATM 6733 O O   . HOH I 4 .   ? 40.114 58.336  59.235  1.00 30.60  ? 232 HOH A O   1 
HETATM 6734 O O   . HOH I 4 .   ? 49.488 41.231  52.626  1.00 23.39  ? 233 HOH A O   1 
HETATM 6735 O O   . HOH I 4 .   ? 41.205 40.849  46.722  1.00 31.85  ? 234 HOH A O   1 
HETATM 6736 O O   . HOH I 4 .   ? 46.846 63.844  55.250  1.00 38.29  ? 235 HOH A O   1 
HETATM 6737 O O   . HOH I 4 .   ? 77.086 40.074  61.534  1.00 46.72  ? 236 HOH A O   1 
HETATM 6738 O O   . HOH I 4 .   ? 85.995 14.517  52.440  1.00 72.61  ? 237 HOH A O   1 
HETATM 6739 O O   . HOH I 4 .   ? 41.035 43.326  76.944  1.00 25.44  ? 238 HOH A O   1 
HETATM 6740 O O   . HOH I 4 .   ? 56.215 43.779  57.661  1.00 28.58  ? 239 HOH A O   1 
HETATM 6741 O O   . HOH I 4 .   ? 45.475 49.965  78.585  1.00 29.56  ? 240 HOH A O   1 
HETATM 6742 O O   . HOH I 4 .   ? 42.403 58.766  61.992  1.00 35.30  ? 241 HOH A O   1 
HETATM 6743 O O   . HOH I 4 .   ? 60.037 42.987  62.584  1.00 32.16  ? 242 HOH A O   1 
HETATM 6744 O O   . HOH I 4 .   ? 37.710 57.272  55.893  1.00 34.25  ? 243 HOH A O   1 
HETATM 6745 O O   . HOH I 4 .   ? 54.298 36.629  59.981  1.00 32.44  ? 244 HOH A O   1 
HETATM 6746 O O   . HOH I 4 .   ? 42.796 54.137  73.279  1.00 34.78  ? 245 HOH A O   1 
HETATM 6747 O O   . HOH I 4 .   ? 44.742 48.116  80.483  1.00 36.41  ? 246 HOH A O   1 
HETATM 6748 O O   . HOH I 4 .   ? 41.647 49.752  79.956  1.00 54.84  ? 247 HOH A O   1 
HETATM 6749 O O   . HOH I 4 .   ? 59.146 41.206  76.873  1.00 40.32  ? 248 HOH A O   1 
HETATM 6750 O O   . HOH I 4 .   ? 44.824 59.864  48.097  1.00 45.62  ? 249 HOH A O   1 
HETATM 6751 O O   . HOH I 4 .   ? 47.874 65.098  52.661  1.00 32.40  ? 250 HOH A O   1 
HETATM 6752 O O   . HOH I 4 .   ? 31.808 54.973  60.635  1.00 44.54  ? 251 HOH A O   1 
HETATM 6753 O O   . HOH I 4 .   ? 46.867 38.355  53.495  1.00 30.57  ? 252 HOH A O   1 
HETATM 6754 O O   . HOH I 4 .   ? 54.587 42.918  55.953  1.00 40.15  ? 253 HOH A O   1 
HETATM 6755 O O   . HOH I 4 .   ? 65.791 31.758  68.706  1.00 57.40  ? 254 HOH A O   1 
HETATM 6756 O O   . HOH I 4 .   ? 81.118 32.227  71.291  1.00 40.47  ? 255 HOH A O   1 
HETATM 6757 O O   . HOH I 4 .   ? 62.250 44.023  81.178  1.00 35.12  ? 256 HOH A O   1 
HETATM 6758 O O   . HOH I 4 .   ? 56.922 56.862  69.322  1.00 38.22  ? 257 HOH A O   1 
HETATM 6759 O O   . HOH I 4 .   ? 58.616 47.258  68.801  1.00 86.92  ? 258 HOH A O   1 
HETATM 6760 O O   . HOH I 4 .   ? 36.851 51.193  72.349  1.00 30.35  ? 259 HOH A O   1 
HETATM 6761 O O   . HOH I 4 .   ? 50.646 59.607  62.311  1.00 48.41  ? 260 HOH A O   1 
HETATM 6762 O O   . HOH I 4 .   ? 55.016 56.208  76.936  1.00 28.65  ? 261 HOH A O   1 
HETATM 6763 O O   . HOH I 4 .   ? 72.393 21.805  63.374  1.00 76.95  ? 262 HOH A O   1 
HETATM 6764 O O   . HOH I 4 .   ? 30.885 52.308  55.470  1.00 50.53  ? 263 HOH A O   1 
HETATM 6765 O O   . HOH I 4 .   ? 36.071 57.197  67.803  1.00 40.93  ? 264 HOH A O   1 
HETATM 6766 O O   . HOH I 4 .   ? 33.196 49.415  56.011  1.00 41.89  ? 265 HOH A O   1 
HETATM 6767 O O   . HOH I 4 .   ? 48.728 44.477  76.761  1.00 29.72  ? 266 HOH A O   1 
HETATM 6768 O O   . HOH I 4 .   ? 65.114 47.805  68.134  1.00 50.73  ? 267 HOH A O   1 
HETATM 6769 O O   . HOH I 4 .   ? 36.639 56.214  51.073  1.00 45.43  ? 268 HOH A O   1 
HETATM 6770 O O   . HOH I 4 .   ? 33.352 51.077  58.121  1.00 38.30  ? 269 HOH A O   1 
HETATM 6771 O O   . HOH I 4 .   ? 34.232 45.942  52.540  1.00 36.66  ? 270 HOH A O   1 
HETATM 6772 O O   . HOH I 4 .   ? 67.437 20.645  57.063  1.00 62.97  ? 271 HOH A O   1 
HETATM 6773 O O   . HOH I 4 .   ? 37.134 43.584  73.570  1.00 38.15  ? 272 HOH A O   1 
HETATM 6774 O O   . HOH I 4 .   ? 67.906 38.882  66.683  1.00 57.26  ? 273 HOH A O   1 
HETATM 6775 O O   . HOH I 4 .   ? 48.284 59.071  67.215  1.00 33.89  ? 274 HOH A O   1 
HETATM 6776 O O   . HOH I 4 .   ? 57.425 39.378  60.376  1.00 41.86  ? 275 HOH A O   1 
HETATM 6777 O O   . HOH I 4 .   ? 32.318 53.363  58.711  1.00 50.88  ? 276 HOH A O   1 
HETATM 6778 O O   . HOH I 4 .   ? 52.516 54.091  50.950  1.00 49.51  ? 277 HOH A O   1 
HETATM 6779 O O   . HOH I 4 .   ? 54.182 33.784  64.124  1.00 52.23  ? 278 HOH A O   1 
HETATM 6780 O O   . HOH I 4 .   ? 49.054 40.489  45.016  1.00 40.63  ? 279 HOH A O   1 
HETATM 6781 O O   . HOH I 4 .   ? 44.209 45.690  81.259  1.00 53.37  ? 280 HOH A O   1 
HETATM 6782 O O   . HOH I 4 .   ? 51.507 51.244  81.476  1.00 42.03  ? 281 HOH A O   1 
HETATM 6783 O O   . HOH I 4 .   ? 70.840 12.103  65.258  1.00 45.75  ? 282 HOH A O   1 
HETATM 6784 O O   . HOH I 4 .   ? 67.466 29.032  62.449  1.00 46.42  ? 283 HOH A O   1 
HETATM 6785 O O   . HOH I 4 .   ? 71.677 31.023  78.243  1.00 44.06  ? 284 HOH A O   1 
HETATM 6786 O O   . HOH I 4 .   ? 82.097 30.189  65.825  1.00 68.93  ? 285 HOH A O   1 
HETATM 6787 O O   . HOH I 4 .   ? 71.875 21.046  61.103  1.00 81.22  ? 286 HOH A O   1 
HETATM 6788 O O   . HOH I 4 .   ? 48.830 34.283  67.169  1.00 55.00  ? 287 HOH A O   1 
HETATM 6789 O O   . HOH I 4 .   ? 47.816 64.646  57.602  1.00 43.48  ? 288 HOH A O   1 
HETATM 6790 O O   . HOH I 4 .   ? 54.516 59.391  72.689  1.00 57.17  ? 289 HOH A O   1 
HETATM 6791 O O   . HOH I 4 .   ? 71.209 25.395  57.251  1.00 43.67  ? 290 HOH A O   1 
HETATM 6792 O O   . HOH I 4 .   ? 73.872 12.773  62.343  1.00 70.81  ? 291 HOH A O   1 
HETATM 6793 O O   . HOH I 4 .   ? 41.348 57.619  50.357  1.00 79.52  ? 292 HOH A O   1 
HETATM 6794 O O   . HOH I 4 .   ? 36.091 43.656  49.614  1.00 42.27  ? 293 HOH A O   1 
HETATM 6795 O O   . HOH I 4 .   ? 59.533 45.079  61.233  1.00 40.52  ? 294 HOH A O   1 
HETATM 6796 O O   . HOH I 4 .   ? 80.995 27.834  56.447  1.00 50.11  ? 295 HOH A O   1 
HETATM 6797 O O   . HOH I 4 .   ? 41.984 41.797  72.396  1.00 41.10  ? 296 HOH A O   1 
HETATM 6798 O O   . HOH I 4 .   ? 40.463 55.262  73.493  1.00 36.11  ? 297 HOH A O   1 
HETATM 6799 O O   . HOH I 4 .   ? 45.460 50.512  81.844  1.00 43.89  ? 298 HOH A O   1 
HETATM 6800 O O   . HOH I 4 .   ? 75.083 27.545  73.983  1.00 72.73  ? 299 HOH A O   1 
HETATM 6801 O O   . HOH I 4 .   ? 62.533 41.076  78.831  1.00 52.19  ? 300 HOH A O   1 
HETATM 6802 O O   . HOH I 4 .   ? 52.794 39.563  53.243  1.00 54.22  ? 301 HOH A O   1 
HETATM 6803 O O   . HOH I 4 .   ? 84.111 21.306  66.476  1.00 67.50  ? 302 HOH A O   1 
HETATM 6804 O O   . HOH I 4 .   ? 46.486 67.266  51.784  1.00 44.95  ? 303 HOH A O   1 
HETATM 6805 O O   . HOH I 4 .   ? 85.179 8.895   76.536  1.00 44.25  ? 304 HOH A O   1 
HETATM 6806 O O   . HOH I 4 .   ? 50.453 38.185  54.507  1.00 46.24  ? 305 HOH A O   1 
HETATM 6807 O O   . HOH I 4 .   ? 53.763 39.828  75.438  1.00 43.81  ? 306 HOH A O   1 
HETATM 6808 O O   . HOH I 4 .   ? 34.155 59.906  63.042  1.00 47.79  ? 307 HOH A O   1 
HETATM 6809 O O   . HOH I 4 .   ? 32.230 42.225  53.449  1.00 33.14  ? 308 HOH A O   1 
HETATM 6810 O O   . HOH I 4 .   ? 75.580 35.729  78.190  1.00 46.96  ? 309 HOH A O   1 
HETATM 6811 O O   . HOH I 4 .   ? 58.609 38.302  56.324  1.00 43.30  ? 310 HOH A O   1 
HETATM 6812 O O   . HOH I 4 .   ? 79.490 20.901  55.862  1.00 72.34  ? 311 HOH A O   1 
HETATM 6813 O O   . HOH I 4 .   ? 49.442 51.614  83.167  1.00 45.28  ? 312 HOH A O   1 
HETATM 6814 O O   . HOH I 4 .   ? 46.803 42.481  82.075  1.00 55.88  ? 313 HOH A O   1 
HETATM 6815 O O   . HOH I 4 .   ? 41.787 54.217  45.436  1.00 50.26  ? 314 HOH A O   1 
HETATM 6816 O O   . HOH I 4 .   ? 56.166 53.918  62.061  1.00 39.37  ? 315 HOH A O   1 
HETATM 6817 O O   . HOH I 4 .   ? 51.154 59.432  66.966  1.00 50.36  ? 316 HOH A O   1 
HETATM 6818 O O   . HOH I 4 .   ? 84.823 21.163  59.161  1.00 47.75  ? 317 HOH A O   1 
HETATM 6819 O O   . HOH I 4 .   ? 62.844 29.199  69.422  1.00 55.81  ? 318 HOH A O   1 
HETATM 6820 O O   . HOH I 4 .   ? 78.110 21.981  64.935  1.00 72.85  ? 319 HOH A O   1 
HETATM 6821 O O   . HOH I 4 .   ? 80.650 13.431  70.770  1.00 69.84  ? 320 HOH A O   1 
HETATM 6822 O O   . HOH I 4 .   ? 57.610 51.527  82.963  1.00 38.26  ? 321 HOH A O   1 
HETATM 6823 O O   . HOH I 4 .   ? 54.239 57.871  57.611  1.00 40.70  ? 322 HOH A O   1 
HETATM 6824 O O   . HOH I 4 .   ? 61.521 43.589  68.461  1.00 52.69  ? 323 HOH A O   1 
HETATM 6825 O O   . HOH I 4 .   ? 37.429 45.252  47.742  1.00 41.66  ? 324 HOH A O   1 
HETATM 6826 O O   . HOH I 4 .   ? 67.175 44.326  75.017  1.00 36.25  ? 325 HOH A O   1 
HETATM 6827 O O   . HOH I 4 .   ? 88.433 15.835  68.600  1.00 66.97  ? 326 HOH A O   1 
HETATM 6828 O O   . HOH I 4 .   ? 55.152 59.235  67.479  1.00 39.54  ? 327 HOH A O   1 
HETATM 6829 O O   . HOH I 4 .   ? 40.322 57.301  71.814  1.00 36.20  ? 328 HOH A O   1 
HETATM 6830 O O   . HOH I 4 .   ? 48.078 59.732  62.655  1.00 40.60  ? 329 HOH A O   1 
HETATM 6831 O O   . HOH I 4 .   ? 69.848 22.004  62.460  1.00 69.63  ? 330 HOH A O   1 
HETATM 6832 O O   . HOH I 4 .   ? 51.118 47.868  55.569  1.00 71.41  ? 331 HOH A O   1 
HETATM 6833 O O   . HOH I 4 .   ? 37.303 48.280  75.433  1.00 38.24  ? 332 HOH A O   1 
HETATM 6834 O O   . HOH I 4 .   ? 75.324 21.067  69.276  1.00 61.70  ? 333 HOH A O   1 
HETATM 6835 O O   . HOH I 4 .   ? 81.340 15.550  72.113  1.00 54.73  ? 334 HOH A O   1 
HETATM 6836 O O   . HOH I 4 .   ? 55.166 55.621  58.216  1.00 47.77  ? 335 HOH A O   1 
HETATM 6837 O O   . HOH I 4 .   ? 47.960 59.590  69.833  1.00 45.60  ? 336 HOH A O   1 
HETATM 6838 O O   . HOH I 4 .   ? 70.432 46.313  75.861  1.00 40.73  ? 337 HOH A O   1 
HETATM 6839 O O   . HOH I 4 .   ? 51.728 41.432  51.925  1.00 67.53  ? 338 HOH A O   1 
HETATM 6840 O O   . HOH I 4 .   ? 47.939 55.958  79.498  1.00 45.53  ? 339 HOH A O   1 
HETATM 6841 O O   . HOH I 4 .   ? 41.597 58.979  67.977  1.00 43.18  ? 340 HOH A O   1 
HETATM 6842 O O   . HOH I 4 .   ? 82.889 20.223  60.519  1.00 68.39  ? 341 HOH A O   1 
HETATM 6843 O O   . HOH I 4 .   ? 62.892 52.851  74.676  1.00 41.68  ? 342 HOH A O   1 
HETATM 6844 O O   . HOH I 4 .   ? 42.415 34.344  70.056  1.00 51.96  ? 343 HOH A O   1 
HETATM 6845 O O   . HOH I 4 .   ? 53.691 49.242  50.398  1.00 47.56  ? 344 HOH A O   1 
HETATM 6846 O O   . HOH I 4 .   ? 80.197 18.980  65.544  1.00 68.68  ? 345 HOH A O   1 
HETATM 6847 O O   . HOH I 4 .   ? 51.974 56.837  50.947  1.00 52.05  ? 346 HOH A O   1 
HETATM 6848 O O   . HOH I 4 .   ? 30.777 48.562  65.179  1.00 53.56  ? 347 HOH A O   1 
HETATM 6849 O O   . HOH I 4 .   ? 50.032 56.308  77.954  1.00 36.69  ? 348 HOH A O   1 
HETATM 6850 O O   . HOH I 4 .   ? 74.349 10.506  56.745  1.00 49.70  ? 349 HOH A O   1 
HETATM 6851 O O   . HOH I 4 .   ? 86.499 14.937  59.480  1.00 69.26  ? 350 HOH A O   1 
HETATM 6852 O O   . HOH I 4 .   ? 53.660 41.916  53.928  1.00 48.66  ? 351 HOH A O   1 
HETATM 6853 O O   . HOH I 4 .   ? 45.756 51.716  47.598  1.00 46.35  ? 352 HOH A O   1 
HETATM 6854 O O   . HOH I 4 .   ? 33.103 52.267  52.344  1.00 48.12  ? 353 HOH A O   1 
HETATM 6855 O O   . HOH I 4 .   ? 54.069 57.722  74.455  1.00 81.07  ? 354 HOH A O   1 
HETATM 6856 O O   . HOH I 4 .   ? 61.773 46.790  62.381  1.00 50.03  ? 355 HOH A O   1 
HETATM 6857 O O   . HOH I 4 .   ? 45.825 60.142  66.073  1.00 43.85  ? 356 HOH A O   1 
HETATM 6858 O O   . HOH I 4 .   ? 88.852 8.092   72.229  1.00 64.10  ? 357 HOH A O   1 
HETATM 6859 O O   . HOH I 4 .   ? 59.617 34.089  73.876  1.00 57.65  ? 358 HOH A O   1 
HETATM 6860 O O   . HOH I 4 .   ? 54.714 55.127  55.567  1.00 47.91  ? 359 HOH A O   1 
HETATM 6861 O O   . HOH J 4 .   ? 35.685 39.985  62.961  1.00 23.76  ? 702 HOH B O   1 
HETATM 6862 O O   . HOH J 4 .   ? 39.609 35.514  69.739  1.00 20.79  ? 703 HOH B O   1 
HETATM 6863 O O   . HOH J 4 .   ? 31.216 32.247  46.070  1.00 23.00  ? 704 HOH B O   1 
HETATM 6864 O O   . HOH J 4 .   ? 38.723 37.067  63.141  1.00 17.79  ? 705 HOH B O   1 
HETATM 6865 O O   . HOH J 4 .   ? 25.923 29.208  57.573  1.00 24.34  ? 706 HOH B O   1 
HETATM 6866 O O   . HOH J 4 .   ? 29.161 32.292  52.512  1.00 16.76  ? 707 HOH B O   1 
HETATM 6867 O O   . HOH J 4 .   ? 38.300 18.699  50.950  1.00 22.69  ? 708 HOH B O   1 
HETATM 6868 O O   . HOH J 4 .   ? 37.316 32.713  70.005  1.00 27.05  ? 709 HOH B O   1 
HETATM 6869 O O   . HOH J 4 .   ? 24.563 35.804  62.504  1.00 30.71  ? 710 HOH B O   1 
HETATM 6870 O O   . HOH J 4 .   ? 26.015 31.103  53.616  1.00 19.20  ? 711 HOH B O   1 
HETATM 6871 O O   . HOH J 4 .   ? 32.580 28.342  70.733  1.00 28.18  ? 712 HOH B O   1 
HETATM 6872 O O   . HOH J 4 .   ? 33.551 40.877  56.728  1.00 23.65  ? 713 HOH B O   1 
HETATM 6873 O O   . HOH J 4 .   ? 35.298 35.496  55.464  1.00 24.09  ? 714 HOH B O   1 
HETATM 6874 O O   . HOH J 4 .   ? 21.037 41.796  54.222  1.00 34.35  ? 715 HOH B O   1 
HETATM 6875 O O   . HOH J 4 .   ? 51.668 17.535  63.899  1.00 28.37  ? 716 HOH B O   1 
HETATM 6876 O O   . HOH J 4 .   ? 35.947 37.463  46.874  1.00 26.86  ? 717 HOH B O   1 
HETATM 6877 O O   . HOH J 4 .   ? 30.720 34.086  49.532  1.00 33.50  ? 718 HOH B O   1 
HETATM 6878 O O   . HOH J 4 .   ? 22.802 39.723  59.633  1.00 36.89  ? 719 HOH B O   1 
HETATM 6879 O O   . HOH J 4 .   ? 38.766 21.163  66.015  1.00 37.19  ? 720 HOH B O   1 
HETATM 6880 O O   . HOH J 4 .   ? 54.959 15.303  58.013  1.00 29.67  ? 721 HOH B O   1 
HETATM 6881 O O   . HOH J 4 .   ? 39.702 9.480   53.324  1.00 30.14  ? 722 HOH B O   1 
HETATM 6882 O O   . HOH J 4 .   ? 47.223 34.736  53.058  1.00 26.30  ? 723 HOH B O   1 
HETATM 6883 O O   . HOH J 4 .   ? 40.545 13.853  60.726  1.00 26.86  ? 724 HOH B O   1 
HETATM 6884 O O   . HOH J 4 .   ? 48.874 22.646  53.964  1.00 28.83  ? 725 HOH B O   1 
HETATM 6885 O O   . HOH J 4 .   ? 34.430 39.145  49.144  1.00 30.36  ? 726 HOH B O   1 
HETATM 6886 O O   . HOH J 4 .   ? 36.201 28.110  46.224  1.00 34.10  ? 727 HOH B O   1 
HETATM 6887 O O   . HOH J 4 .   ? 32.976 39.025  68.469  1.00 26.40  ? 728 HOH B O   1 
HETATM 6888 O O   . HOH J 4 .   ? 44.279 20.374  44.387  1.00 32.84  ? 729 HOH B O   1 
HETATM 6889 O O   . HOH J 4 .   ? 27.692 22.478  54.464  1.00 42.75  ? 730 HOH B O   1 
HETATM 6890 O O   . HOH J 4 .   ? 39.047 12.668  48.524  1.00 44.28  ? 731 HOH B O   1 
HETATM 6891 O O   . HOH J 4 .   ? 30.783 44.610  64.727  1.00 37.28  ? 732 HOH B O   1 
HETATM 6892 O O   . HOH J 4 .   ? 53.635 13.425  51.586  1.00 38.51  ? 733 HOH B O   1 
HETATM 6893 O O   . HOH J 4 .   ? 33.732 19.910  52.496  1.00 35.15  ? 734 HOH B O   1 
HETATM 6894 O O   . HOH J 4 .   ? 85.866 15.019  85.440  1.00 54.80  ? 735 HOH B O   1 
HETATM 6895 O O   . HOH J 4 .   ? 49.513 12.197  49.907  1.00 37.98  ? 736 HOH B O   1 
HETATM 6896 O O   . HOH J 4 .   ? 53.014 22.980  63.937  1.00 43.10  ? 737 HOH B O   1 
HETATM 6897 O O   . HOH J 4 .   ? 30.346 19.953  58.163  1.00 34.56  ? 738 HOH B O   1 
HETATM 6898 O O   . HOH J 4 .   ? 71.081 12.187  67.839  1.00 55.34  ? 739 HOH B O   1 
HETATM 6899 O O   . HOH J 4 .   ? 44.858 31.151  43.519  1.00 33.29  ? 740 HOH B O   1 
HETATM 6900 O O   . HOH J 4 .   ? 56.249 8.358   70.914  1.00 65.73  ? 741 HOH B O   1 
HETATM 6901 O O   . HOH J 4 .   ? 48.086 26.726  68.559  1.00 42.26  ? 742 HOH B O   1 
HETATM 6902 O O   . HOH J 4 .   ? 30.854 40.521  68.638  1.00 34.46  ? 743 HOH B O   1 
HETATM 6903 O O   . HOH J 4 .   ? 63.152 8.638   75.542  1.00 63.60  ? 744 HOH B O   1 
HETATM 6904 O O   . HOH J 4 .   ? 41.370 11.970  50.353  1.00 36.70  ? 745 HOH B O   1 
HETATM 6905 O O   . HOH J 4 .   ? 59.786 8.411   63.724  1.00 83.81  ? 746 HOH B O   1 
HETATM 6906 O O   . HOH J 4 .   ? 23.326 32.944  66.810  1.00 39.81  ? 747 HOH B O   1 
HETATM 6907 O O   . HOH J 4 .   ? 50.358 7.705   56.450  1.00 38.84  ? 748 HOH B O   1 
HETATM 6908 O O   . HOH J 4 .   ? 31.215 40.012  51.666  1.00 34.07  ? 749 HOH B O   1 
HETATM 6909 O O   . HOH J 4 .   ? 49.567 6.199   52.867  1.00 39.47  ? 750 HOH B O   1 
HETATM 6910 O O   . HOH J 4 .   ? 47.652 15.366  47.734  1.00 41.21  ? 751 HOH B O   1 
HETATM 6911 O O   . HOH J 4 .   ? 60.988 13.254  60.301  1.00 54.91  ? 752 HOH B O   1 
HETATM 6912 O O   . HOH J 4 .   ? 56.005 6.516   72.521  1.00 59.61  ? 753 HOH B O   1 
HETATM 6913 O O   . HOH J 4 .   ? 70.165 19.982  92.440  1.00 44.61  ? 754 HOH B O   1 
HETATM 6914 O O   . HOH J 4 .   ? 57.295 15.999  52.934  1.00 40.62  ? 755 HOH B O   1 
HETATM 6915 O O   . HOH J 4 .   ? 78.426 7.244   85.599  1.00 59.00  ? 756 HOH B O   1 
HETATM 6916 O O   . HOH J 4 .   ? 77.810 28.540  80.424  1.00 57.89  ? 757 HOH B O   1 
HETATM 6917 O O   . HOH J 4 .   ? 35.016 22.107  67.379  1.00 48.03  ? 758 HOH B O   1 
HETATM 6918 O O   . HOH J 4 .   ? 81.438 23.578  79.683  1.00 66.21  ? 759 HOH B O   1 
HETATM 6919 O O   . HOH J 4 .   ? 51.985 29.269  57.332  1.00 30.84  ? 760 HOH B O   1 
HETATM 6920 O O   . HOH J 4 .   ? 36.741 23.954  48.141  1.00 34.78  ? 761 HOH B O   1 
HETATM 6921 O O   . HOH J 4 .   ? 54.226 4.927   66.364  1.00 71.16  ? 762 HOH B O   1 
HETATM 6922 O O   . HOH J 4 .   ? 66.180 7.579   65.009  1.00 48.49  ? 763 HOH B O   1 
HETATM 6923 O O   . HOH J 4 .   ? 42.654 28.978  45.108  1.00 34.88  ? 764 HOH B O   1 
HETATM 6924 O O   . HOH J 4 .   ? 28.657 41.336  59.118  1.00 34.50  ? 765 HOH B O   1 
HETATM 6925 O O   . HOH J 4 .   ? 68.258 14.410  75.188  1.00 71.88  ? 766 HOH B O   1 
HETATM 6926 O O   . HOH J 4 .   ? 75.826 8.029   85.004  1.00 42.73  ? 767 HOH B O   1 
HETATM 6927 O O   . HOH J 4 .   ? 21.939 30.332  60.947  1.00 56.40  ? 768 HOH B O   1 
HETATM 6928 O O   . HOH J 4 .   ? 32.383 21.276  67.550  1.00 44.55  ? 769 HOH B O   1 
HETATM 6929 O O   . HOH J 4 .   ? 48.178 31.984  64.095  1.00 43.99  ? 770 HOH B O   1 
HETATM 6930 O O   . HOH J 4 .   ? 52.238 17.062  66.320  1.00 42.15  ? 771 HOH B O   1 
HETATM 6931 O O   . HOH J 4 .   ? 36.090 18.042  67.224  1.00 42.83  ? 772 HOH B O   1 
HETATM 6932 O O   . HOH J 4 .   ? 46.324 32.276  50.556  1.00 41.85  ? 773 HOH B O   1 
HETATM 6933 O O   . HOH J 4 .   ? 83.969 10.688  81.874  1.00 46.43  ? 774 HOH B O   1 
HETATM 6934 O O   . HOH J 4 .   ? 39.811 26.774  70.188  1.00 44.84  ? 775 HOH B O   1 
HETATM 6935 O O   . HOH J 4 .   ? 42.747 17.853  70.852  1.00 43.74  ? 776 HOH B O   1 
HETATM 6936 O O   . HOH J 4 .   ? 31.296 42.743  55.959  1.00 27.67  ? 777 HOH B O   1 
HETATM 6937 O O   . HOH J 4 .   ? 33.678 40.701  47.332  1.00 28.98  ? 778 HOH B O   1 
HETATM 6938 O O   . HOH J 4 .   ? 86.063 12.021  82.001  1.00 53.75  ? 779 HOH B O   1 
HETATM 6939 O O   . HOH J 4 .   ? 28.046 21.591  51.991  1.00 68.31  ? 780 HOH B O   1 
HETATM 6940 O O   . HOH J 4 .   ? 60.527 23.268  73.450  1.00 76.86  ? 781 HOH B O   1 
HETATM 6941 O O   . HOH J 4 .   ? 62.094 14.990  63.820  1.00 48.79  ? 782 HOH B O   1 
HETATM 6942 O O   . HOH J 4 .   ? 26.403 43.798  58.004  1.00 24.63  ? 783 HOH B O   1 
HETATM 6943 O O   . HOH J 4 .   ? 39.804 26.913  72.788  1.00 43.58  ? 784 HOH B O   1 
HETATM 6944 O O   . HOH J 4 .   ? 37.666 34.309  71.964  1.00 38.84  ? 785 HOH B O   1 
HETATM 6945 O O   . HOH J 4 .   ? 76.797 10.643  71.262  1.00 55.84  ? 786 HOH B O   1 
HETATM 6946 O O   . HOH J 4 .   ? 22.106 26.129  60.505  1.00 30.66  ? 787 HOH B O   1 
HETATM 6947 O O   . HOH J 4 .   ? 48.517 24.919  52.115  1.00 47.81  ? 788 HOH B O   1 
HETATM 6948 O O   . HOH J 4 .   ? 40.149 6.232   54.346  1.00 49.58  ? 789 HOH B O   1 
HETATM 6949 O O   . HOH J 4 .   ? 36.274 25.571  46.047  1.00 38.48  ? 790 HOH B O   1 
HETATM 6950 O O   . HOH J 4 .   ? 47.583 20.237  45.715  1.00 47.95  ? 791 HOH B O   1 
HETATM 6951 O O   . HOH J 4 .   ? 20.725 34.931  55.492  1.00 41.77  ? 792 HOH B O   1 
HETATM 6952 O O   . HOH J 4 .   ? 40.615 28.863  43.685  1.00 53.95  ? 793 HOH B O   1 
HETATM 6953 O O   . HOH J 4 .   ? 37.990 31.682  45.228  1.00 35.45  ? 794 HOH B O   1 
HETATM 6954 O O   . HOH J 4 .   ? 67.160 10.772  64.159  1.00 76.50  ? 795 HOH B O   1 
HETATM 6955 O O   . HOH J 4 .   ? 55.652 11.858  52.052  1.00 44.00  ? 796 HOH B O   1 
HETATM 6956 O O   . HOH J 4 .   ? 33.068 18.795  62.626  1.00 43.07  ? 797 HOH B O   1 
HETATM 6957 O O   . HOH J 4 .   ? 29.089 35.208  46.999  1.00 46.67  ? 798 HOH B O   1 
HETATM 6958 O O   . HOH J 4 .   ? 78.224 12.637  69.837  1.00 44.20  ? 799 HOH B O   1 
HETATM 6959 O O   . HOH J 4 .   ? 54.383 22.216  56.715  1.00 39.36  ? 800 HOH B O   1 
HETATM 6960 O O   . HOH J 4 .   ? 45.995 32.218  65.356  1.00 53.68  ? 801 HOH B O   1 
HETATM 6961 O O   . HOH J 4 .   ? 19.292 42.591  57.678  1.00 35.45  ? 802 HOH B O   1 
HETATM 6962 O O   . HOH J 4 .   ? 29.228 40.898  49.698  1.00 42.64  ? 803 HOH B O   1 
HETATM 6963 O O   . HOH J 4 .   ? 70.497 7.416   75.165  1.00 51.25  ? 804 HOH B O   1 
HETATM 6964 O O   . HOH J 4 .   ? 81.838 17.798  95.658  1.00 57.44  ? 805 HOH B O   1 
HETATM 6965 O O   . HOH J 4 .   ? 28.193 34.608  70.715  1.00 42.66  ? 806 HOH B O   1 
HETATM 6966 O O   . HOH J 4 .   ? 60.406 2.532   73.124  1.00 63.19  ? 807 HOH B O   1 
HETATM 6967 O O   . HOH J 4 .   ? 85.647 13.096  87.847  1.00 65.24  ? 808 HOH B O   1 
HETATM 6968 O O   . HOH J 4 .   ? 64.778 6.184   63.231  1.00 49.10  ? 809 HOH B O   1 
HETATM 6969 O O   . HOH J 4 .   ? 51.328 20.431  69.902  1.00 59.42  ? 810 HOH B O   1 
HETATM 6970 O O   . HOH J 4 .   ? 31.377 21.496  64.271  1.00 47.18  ? 811 HOH B O   1 
HETATM 6971 O O   . HOH J 4 .   ? 38.795 18.694  65.191  1.00 35.93  ? 812 HOH B O   1 
HETATM 6972 O O   . HOH J 4 .   ? 67.601 21.281  75.288  1.00 51.49  ? 813 HOH B O   1 
HETATM 6973 O O   . HOH J 4 .   ? 76.290 23.410  88.751  1.00 72.54  ? 814 HOH B O   1 
HETATM 6974 O O   . HOH J 4 .   ? 77.908 19.719  81.172  1.00 93.07  ? 815 HOH B O   1 
HETATM 6975 O O   . HOH J 4 .   ? 61.569 5.918   58.521  1.00 51.31  ? 816 HOH B O   1 
HETATM 6976 O O   . HOH J 4 .   ? 52.235 9.694   71.005  1.00 57.09  ? 817 HOH B O   1 
HETATM 6977 O O   . HOH J 4 .   ? 42.046 24.840  70.069  1.00 38.92  ? 818 HOH B O   1 
HETATM 6978 O O   . HOH J 4 .   ? 18.644 37.363  58.863  1.00 63.38  ? 819 HOH B O   1 
HETATM 6979 O O   . HOH J 4 .   ? 50.301 6.971   64.857  1.00 43.80  ? 820 HOH B O   1 
HETATM 6980 O O   . HOH J 4 .   ? 27.640 21.499  61.168  1.00 33.31  ? 821 HOH B O   1 
HETATM 6981 O O   . HOH J 4 .   ? 68.164 -0.392  78.402  1.00 51.12  ? 822 HOH B O   1 
HETATM 6982 O O   . HOH J 4 .   ? 38.349 12.625  59.623  1.00 50.49  ? 823 HOH B O   1 
HETATM 6983 O O   . HOH J 4 .   ? 79.040 28.104  78.339  1.00 63.88  ? 824 HOH B O   1 
HETATM 6984 O O   . HOH J 4 .   ? 30.104 22.178  67.969  1.00 63.29  ? 825 HOH B O   1 
HETATM 6985 O O   . HOH J 4 .   ? 29.216 42.139  56.899  1.00 51.65  ? 826 HOH B O   1 
HETATM 6986 O O   . HOH J 4 .   ? 75.972 20.123  82.692  1.00 67.48  ? 827 HOH B O   1 
HETATM 6987 O O   . HOH J 4 .   ? 80.514 11.565  81.589  1.00 76.41  ? 828 HOH B O   1 
HETATM 6988 O O   . HOH J 4 .   ? 82.445 22.774  92.808  1.00 58.87  ? 829 HOH B O   1 
HETATM 6989 O O   . HOH J 4 .   ? 31.388 44.930  57.260  1.00 72.55  ? 830 HOH B O   1 
HETATM 6990 O O   . HOH J 4 .   ? 85.430 20.788  77.277  1.00 70.80  ? 831 HOH B O   1 
HETATM 6991 O O   . HOH J 4 .   ? 72.176 11.581  73.207  1.00 70.92  ? 832 HOH B O   1 
HETATM 6992 O O   . HOH J 4 .   ? 80.516 6.079   84.548  1.00 56.55  ? 833 HOH B O   1 
HETATM 6993 O O   . HOH J 4 .   ? 50.194 5.006   56.879  1.00 39.33  ? 834 HOH B O   1 
HETATM 6994 O O   . HOH J 4 .   ? 59.291 16.753  69.579  1.00 57.13  ? 835 HOH B O   1 
HETATM 6995 O O   . HOH J 4 .   ? 26.843 39.416  69.107  1.00 51.08  ? 836 HOH B O   1 
HETATM 6996 O O   . HOH J 4 .   ? 34.312 24.247  49.944  1.00 41.62  ? 837 HOH B O   1 
HETATM 6997 O O   . HOH J 4 .   ? 67.229 23.809  76.185  1.00 42.11  ? 838 HOH B O   1 
HETATM 6998 O O   . HOH J 4 .   ? 48.498 26.615  50.050  1.00 53.50  ? 839 HOH B O   1 
HETATM 6999 O O   . HOH J 4 .   ? 40.798 9.925   57.178  1.00 42.38  ? 840 HOH B O   1 
HETATM 7000 O O   . HOH J 4 .   ? 26.778 27.265  55.160  1.00 40.04  ? 841 HOH B O   1 
HETATM 7001 O O   . HOH J 4 .   ? 33.188 43.117  73.423  1.00 50.62  ? 842 HOH B O   1 
HETATM 7002 O O   . HOH J 4 .   ? 31.061 25.818  64.075  1.00 68.18  ? 843 HOH B O   1 
HETATM 7003 O O   . HOH J 4 .   ? 43.621 8.788   58.536  1.00 48.71  ? 844 HOH B O   1 
HETATM 7004 O O   . HOH J 4 .   ? 58.651 1.320   76.670  1.00 59.20  ? 845 HOH B O   1 
HETATM 7005 O O   . HOH J 4 .   ? 87.483 21.177  83.149  1.00 67.22  ? 846 HOH B O   1 
HETATM 7006 O O   . HOH J 4 .   ? 39.449 37.971  69.773  1.00 56.46  ? 847 HOH B O   1 
HETATM 7007 O O   . HOH J 4 .   ? 66.650 15.736  79.669  1.00 69.11  ? 848 HOH B O   1 
HETATM 7008 O O   . HOH J 4 .   ? 54.017 14.266  59.777  1.00 78.36  ? 849 HOH B O   1 
HETATM 7009 O O   . HOH J 4 .   ? 75.618 25.548  77.315  1.00 65.06  ? 850 HOH B O   1 
HETATM 7010 O O   . HOH J 4 .   ? 33.304 32.730  67.795  1.00 65.93  ? 851 HOH B O   1 
HETATM 7011 O O   . HOH J 4 .   ? 58.135 5.115   78.805  1.00 66.21  ? 852 HOH B O   1 
HETATM 7012 O O   . HOH J 4 .   ? 38.276 22.809  46.871  1.00 60.62  ? 853 HOH B O   1 
HETATM 7013 O O   . HOH J 4 .   ? 24.306 23.820  64.263  1.00 62.67  ? 854 HOH B O   1 
HETATM 7014 O O   . HOH J 4 .   ? 56.542 18.759  52.904  1.00 77.94  ? 855 HOH B O   1 
HETATM 7015 O O   . HOH J 4 .   ? 25.670 22.521  60.327  1.00 54.58  ? 856 HOH B O   1 
HETATM 7016 O O   . HOH J 4 .   ? 53.901 19.308  67.501  1.00 46.12  ? 857 HOH B O   1 
HETATM 7017 O O   . HOH J 4 .   ? 81.019 11.975  91.198  1.00 64.20  ? 858 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU H . n 
A 1 2   VAL 2   2   2   VAL VAL H . n 
A 1 3   LYS 3   3   3   LYS LYS H . n 
A 1 4   LEU 4   4   4   LEU LEU H . n 
A 1 5   LEU 5   5   5   LEU LEU H . n 
A 1 6   GLU 6   6   6   GLU GLU H . n 
A 1 7   SER 7   7   7   SER SER H . n 
A 1 8   GLY 8   8   8   GLY GLY H . n 
A 1 9   GLY 9   9   9   GLY GLY H . n 
A 1 10  GLY 10  10  10  GLY GLY H . n 
A 1 11  LEU 11  11  11  LEU LEU H . n 
A 1 12  VAL 12  12  12  VAL VAL H . n 
A 1 13  LYS 13  13  13  LYS LYS H . n 
A 1 14  PRO 14  14  14  PRO PRO H . n 
A 1 15  GLY 15  15  15  GLY GLY H . n 
A 1 16  GLY 16  16  16  GLY GLY H . n 
A 1 17  SER 17  17  17  SER SER H . n 
A 1 18  LEU 18  18  18  LEU LEU H . n 
A 1 19  LYS 19  19  19  LYS LYS H . n 
A 1 20  LEU 20  20  20  LEU LEU H . n 
A 1 21  SER 21  21  21  SER SER H . n 
A 1 22  CYS 22  22  22  CYS CYS H . n 
A 1 23  THR 23  23  23  THR THR H . n 
A 1 24  ALA 24  24  24  ALA ALA H . n 
A 1 25  SER 25  25  25  SER SER H . n 
A 1 26  GLY 26  26  26  GLY GLY H . n 
A 1 27  ILE 27  27  27  ILE ILE H . n 
A 1 28  THR 28  28  28  THR THR H . n 
A 1 29  PHE 29  29  29  PHE PHE H . n 
A 1 30  SER 30  30  30  SER SER H . n 
A 1 31  ARG 31  32  32  ARG ARG H . n 
A 1 32  TYR 32  34  34  TYR TYR H . n 
A 1 33  ILE 33  35  35  ILE ILE H . n 
A 1 34  MET 34  36  36  MET MET H . n 
A 1 35  SER 35  37  37  SER SER H . n 
A 1 36  TRP 36  38  38  TRP TRP H . n 
A 1 37  VAL 37  39  39  VAL VAL H . n 
A 1 38  ARG 38  40  40  ARG ARG H . n 
A 1 39  GLN 39  41  41  GLN GLN H . n 
A 1 40  ILE 40  42  42  ILE ILE H . n 
A 1 41  PRO 41  43  43  PRO PRO H . n 
A 1 42  GLU 42  44  44  GLU GLU H . n 
A 1 43  LYS 43  45  45  LYS LYS H . n 
A 1 44  ARG 44  46  46  ARG ARG H . n 
A 1 45  LEU 45  47  47  LEU LEU H . n 
A 1 46  GLU 46  48  48  GLU GLU H . n 
A 1 47  TRP 47  49  49  TRP TRP H . n 
A 1 48  VAL 48  50  50  VAL VAL H . n 
A 1 49  ALA 49  51  51  ALA ALA H . n 
A 1 50  SER 50  52  52  SER SER H . n 
A 1 51  ILE 51  53  53  ILE ILE H . n 
A 1 52  SER 52  54  54  SER SER H . n 
A 1 53  SER 53  55  55  SER SER H . n 
A 1 54  GLY 54  56  56  GLY GLY H . n 
A 1 55  GLY 55  57  57  GLY GLY H . n 
A 1 56  ILE 56  58  58  ILE ILE H . n 
A 1 57  THR 57  59  59  THR THR H . n 
A 1 58  TYR 58  60  60  TYR TYR H . n 
A 1 59  TYR 59  61  61  TYR TYR H . n 
A 1 60  PRO 60  62  62  PRO PRO H . n 
A 1 61  ASP 61  63  63  ASP ASP H . n 
A 1 62  SER 62  64  64  SER SER H . n 
A 1 63  VAL 63  65  65  VAL VAL H . n 
A 1 64  ALA 64  66  66  ALA ALA H . n 
A 1 65  GLY 65  67  67  GLY GLY H . n 
A 1 66  ARG 66  68  68  ARG ARG H . n 
A 1 67  PHE 67  69  69  PHE PHE H . n 
A 1 68  THR 68  70  70  THR THR H . n 
A 1 69  ILE 69  71  71  ILE ILE H . n 
A 1 70  SER 70  72  72  SER SER H . n 
A 1 71  ARG 71  73  73  ARG ARG H . n 
A 1 72  ASP 72  74  74  ASP ASP H . n 
A 1 73  ASN 73  75  75  ASN ASN H . n 
A 1 74  VAL 74  76  76  VAL VAL H . n 
A 1 75  ARG 75  77  77  ARG ARG H . n 
A 1 76  ASN 76  78  78  ASN ASN H . n 
A 1 77  ILE 77  79  79  ILE ILE H . n 
A 1 78  LEU 78  80  80  LEU LEU H . n 
A 1 79  TYR 79  81  81  TYR TYR H . n 
A 1 80  LEU 80  82  82  LEU LEU H . n 
A 1 81  GLN 81  83  83  GLN GLN H . n 
A 1 82  MET 82  84  84  MET MET H . n 
A 1 83  SER 83  85  85  SER SER H . n 
A 1 84  SER 84  86  86  SER SER H . n 
A 1 85  LEU 85  87  87  LEU LEU H . n 
A 1 86  ARG 86  88  88  ARG ARG H . n 
A 1 87  SER 87  89  89  SER SER H . n 
A 1 88  GLU 88  90  90  GLU GLU H . n 
A 1 89  ASP 89  91  91  ASP ASP H . n 
A 1 90  THR 90  92  92  THR THR H . n 
A 1 91  ALA 91  93  93  ALA ALA H . n 
A 1 92  LEU 92  94  94  LEU LEU H . n 
A 1 93  TYR 93  95  95  TYR TYR H . n 
A 1 94  TYR 94  96  96  TYR TYR H . n 
A 1 95  CYS 95  97  97  CYS CYS H . n 
A 1 96  ALA 96  98  98  ALA ALA H . n 
A 1 97  ARG 97  99  99  ARG ARG H . n 
A 1 98  GLY 98  100 100 GLY GLY H . n 
A 1 99  GLN 99  101 101 GLN GLN H . n 
A 1 100 GLY 100 102 102 GLY GLY H . n 
A 1 101 ARG 101 103 103 ARG ARG H . n 
A 1 102 PRO 102 104 104 PRO PRO H . n 
A 1 103 TYR 103 105 105 TYR TYR H . n 
A 1 104 TRP 104 106 106 TRP TRP H . n 
A 1 105 GLY 105 107 107 GLY GLY H . n 
A 1 106 GLN 106 108 108 GLN GLN H . n 
A 1 107 GLY 107 109 109 GLY GLY H . n 
A 1 108 THR 108 110 110 THR THR H . n 
A 1 109 LEU 109 111 111 LEU LEU H . n 
A 1 110 VAL 110 112 112 VAL VAL H . n 
A 1 111 THR 111 113 113 THR THR H . n 
A 1 112 VAL 112 114 114 VAL VAL H . n 
A 1 113 SER 113 115 115 SER SER H . n 
A 1 114 SER 114 116 116 SER SER H . n 
A 1 115 ALA 115 117 117 ALA ALA H . n 
A 1 116 LYS 116 118 118 LYS LYS H . n 
A 1 117 THR 117 119 119 THR THR H . n 
A 1 118 THR 118 120 120 THR THR H . n 
A 1 119 PRO 119 121 121 PRO PRO H . n 
A 1 120 PRO 120 122 122 PRO PRO H . n 
A 1 121 SER 121 123 123 SER SER H . n 
A 1 122 VAL 122 124 124 VAL VAL H . n 
A 1 123 TYR 123 125 125 TYR TYR H . n 
A 1 124 PRO 124 126 126 PRO PRO H . n 
A 1 125 ALA 125 127 127 ALA ALA H . n 
A 1 126 ALA 126 128 128 ALA ALA H . n 
A 1 127 PRO 127 129 129 PRO PRO H . n 
A 1 128 GLY 128 130 130 GLY GLY H . n 
A 1 129 CYS 129 131 131 CYS CYS H . n 
A 1 130 GLY 130 132 132 GLY GLY H . n 
A 1 131 ASP 131 133 133 ASP ASP H . n 
A 1 132 THR 132 134 134 THR THR H . n 
A 1 133 THR 133 135 135 THR THR H . n 
A 1 134 GLY 134 136 136 GLY GLY H . n 
A 1 135 SER 135 137 137 SER SER H . n 
A 1 136 SER 136 138 138 SER SER H . n 
A 1 137 VAL 137 139 139 VAL VAL H . n 
A 1 138 THR 138 140 140 THR THR H . n 
A 1 139 LEU 139 141 141 LEU LEU H . n 
A 1 140 GLY 140 142 142 GLY GLY H . n 
A 1 141 CYS 141 143 143 CYS CYS H . n 
A 1 142 LEU 142 144 144 LEU LEU H . n 
A 1 143 VAL 143 145 145 VAL VAL H . n 
A 1 144 LYS 144 146 146 LYS LYS H . n 
A 1 145 GLY 145 147 147 GLY GLY H . n 
A 1 146 TYR 146 148 148 TYR TYR H . n 
A 1 147 PHE 147 149 149 PHE PHE H . n 
A 1 148 PRO 148 150 150 PRO CPR H . n 
A 1 149 GLU 149 151 151 GLU GLU H . n 
A 1 150 PRO 150 152 152 PRO PRO H . n 
A 1 151 VAL 151 153 153 VAL VAL H . n 
A 1 152 THR 152 154 154 THR THR H . n 
A 1 153 VAL 153 155 155 VAL VAL H . n 
A 1 154 THR 154 156 156 THR THR H . n 
A 1 155 TRP 155 157 157 TRP TRP H . n 
A 1 156 ASN 156 158 158 ASN ASN H . n 
A 1 157 SER 157 159 159 SER SER H . n 
A 1 158 GLY 158 160 160 GLY GLY H . n 
A 1 159 GLY 159 161 161 GLY GLY H . n 
A 1 160 SER 160 164 164 SER SER H . n 
A 1 161 SER 161 165 165 SER SER H . n 
A 1 162 VAL 162 166 166 VAL VAL H . n 
A 1 163 HIS 163 167 167 HIS HIS H . n 
A 1 164 THR 164 168 168 THR THR H . n 
A 1 165 PHE 165 169 169 PHE PHE H . n 
A 1 166 PRO 166 170 170 PRO PRO H . n 
A 1 167 ALA 167 171 171 ALA ALA H . n 
A 1 168 LEU 168 172 172 LEU LEU H . n 
A 1 169 LEU 169 173 173 LEU LEU H . n 
A 1 170 GLN 170 174 174 GLN GLN H . n 
A 1 171 SER 171 175 175 SER SER H . n 
A 1 172 GLY 172 176 176 GLY GLY H . n 
A 1 173 LEU 173 177 177 LEU LEU H . n 
A 1 174 TYR 174 178 178 TYR TYR H . n 
A 1 175 THR 175 179 179 THR THR H . n 
A 1 176 MET 176 180 180 MET MET H . n 
A 1 177 SER 177 181 181 SER SER H . n 
A 1 178 SER 178 182 182 SER SER H . n 
A 1 179 SER 179 183 183 SER SER H . n 
A 1 180 VAL 180 184 184 VAL VAL H . n 
A 1 181 THR 181 185 185 THR THR H . n 
A 1 182 VAL 182 186 186 VAL VAL H . n 
A 1 183 PRO 183 187 187 PRO PRO H . n 
A 1 184 SER 184 188 188 SER SER H . n 
A 1 185 SER 185 189 189 SER SER H . n 
A 1 186 THR 186 190 190 THR THR H . n 
A 1 187 TRP 187 191 191 TRP TRP H . n 
A 1 188 PRO 188 192 192 PRO PRO H . n 
A 1 189 SER 189 193 193 SER SER H . n 
A 1 190 THR 190 195 195 THR THR H . n 
A 1 191 VAL 191 196 196 VAL VAL H . n 
A 1 192 THR 192 197 197 THR THR H . n 
A 1 193 CYS 193 198 198 CYS CYS H . n 
A 1 194 SER 194 199 199 SER SER H . n 
A 1 195 VAL 195 200 200 VAL VAL H . n 
A 1 196 ALA 196 201 201 ALA ALA H . n 
A 1 197 HIS 197 202 202 HIS HIS H . n 
A 1 198 PRO 198 203 203 PRO PRO H . n 
A 1 199 ALA 199 204 204 ALA ALA H . n 
A 1 200 SER 200 205 205 SER SER H . n 
A 1 201 SER 201 206 206 SER SER H . n 
A 1 202 THR 202 207 207 THR THR H . n 
A 1 203 THR 203 208 208 THR THR H . n 
A 1 204 VAL 204 209 209 VAL VAL H . n 
A 1 205 ASP 205 210 210 ASP ASP H . n 
A 1 206 LYS 206 211 211 LYS LYS H . n 
A 1 207 LYS 207 212 212 LYS LYS H . n 
A 1 208 LEU 208 213 213 LEU LEU H . n 
A 1 209 GLU 209 214 214 GLU GLU H . n 
B 2 1   ASP 1   1   1   ASP ASP L . n 
B 2 2   ILE 2   2   2   ILE ILE L . n 
B 2 3   VAL 3   3   3   VAL VAL L . n 
B 2 4   MET 4   4   4   MET MET L . n 
B 2 5   THR 5   5   5   THR THR L . n 
B 2 6   GLN 6   6   6   GLN GLN L . n 
B 2 7   ALA 7   7   7   ALA ALA L . n 
B 2 8   ALA 8   8   8   ALA ALA L . n 
B 2 9   PHE 9   9   9   PHE PHE L . n 
B 2 10  SER 10  10  10  SER SER L . n 
B 2 11  ASN 11  11  11  ASN ASN L . n 
B 2 12  PRO 12  12  12  PRO PRO L . n 
B 2 13  VAL 13  13  13  VAL VAL L . n 
B 2 14  THR 14  14  14  THR THR L . n 
B 2 15  LEU 15  15  15  LEU LEU L . n 
B 2 16  GLY 16  16  16  GLY GLY L . n 
B 2 17  THR 17  17  17  THR THR L . n 
B 2 18  SER 18  18  18  SER SER L . n 
B 2 19  ALA 19  19  19  ALA ALA L . n 
B 2 20  SER 20  20  20  SER SER L . n 
B 2 21  ILE 21  21  21  ILE ILE L . n 
B 2 22  SER 22  22  22  SER SER L . n 
B 2 23  CYS 23  23  23  CYS CYS L . n 
B 2 24  ARG 24  24  24  ARG ARG L . n 
B 2 25  SER 25  25  25  SER SER L . n 
B 2 26  THR 26  26  26  THR THR L . n 
B 2 27  LYS 27  27  27  LYS LYS L . n 
B 2 28  SER 28  28  28  SER SER L . n 
B 2 29  LEU 29  29  29  LEU LEU L . n 
B 2 30  LEU 30  30  30  LEU LEU L . n 
B 2 31  HIS 31  31  31  HIS HIS L . n 
B 2 32  SER 32  32  32  SER SER L . n 
B 2 33  ASN 33  33  33  ASN ASN L . n 
B 2 34  GLY 34  34  34  GLY GLY L . n 
B 2 35  ILE 35  35  35  ILE ILE L . n 
B 2 36  THR 36  36  36  THR THR L . n 
B 2 37  TYR 37  37  37  TYR TYR L . n 
B 2 38  LEU 38  38  38  LEU LEU L . n 
B 2 39  TYR 39  39  39  TYR TYR L . n 
B 2 40  TRP 40  40  40  TRP TRP L . n 
B 2 41  TYR 41  41  41  TYR TYR L . n 
B 2 42  LEU 42  42  42  LEU LEU L . n 
B 2 43  GLN 43  43  43  GLN GLN L . n 
B 2 44  LYS 44  44  44  LYS LYS L . n 
B 2 45  PRO 45  45  45  PRO PRO L . n 
B 2 46  GLY 46  46  46  GLY GLY L . n 
B 2 47  GLN 47  47  47  GLN GLN L . n 
B 2 48  SER 48  48  48  SER SER L . n 
B 2 49  PRO 49  49  49  PRO PRO L . n 
B 2 50  GLN 50  50  50  GLN GLN L . n 
B 2 51  LEU 51  51  51  LEU LEU L . n 
B 2 52  LEU 52  52  52  LEU LEU L . n 
B 2 53  ILE 53  53  53  ILE ILE L . n 
B 2 54  TYR 54  54  54  TYR TYR L . n 
B 2 55  GLN 55  55  55  GLN GLN L . n 
B 2 56  MET 56  56  56  MET MET L . n 
B 2 57  SER 57  57  57  SER SER L . n 
B 2 58  ASN 58  58  58  ASN ASN L . n 
B 2 59  LEU 59  59  59  LEU LEU L . n 
B 2 60  ALA 60  60  60  ALA ALA L . n 
B 2 61  SER 61  61  61  SER SER L . n 
B 2 62  GLY 62  62  62  GLY GLY L . n 
B 2 63  VAL 63  63  63  VAL VAL L . n 
B 2 64  PRO 64  64  64  PRO PRO L . n 
B 2 65  ASN 65  65  65  ASN ASN L . n 
B 2 66  ARG 66  66  66  ARG ARG L . n 
B 2 67  PHE 67  67  67  PHE PHE L . n 
B 2 68  SER 68  68  68  SER SER L . n 
B 2 69  SER 69  69  69  SER SER L . n 
B 2 70  SER 70  70  70  SER SER L . n 
B 2 71  GLY 71  71  71  GLY GLY L . n 
B 2 72  SER 72  72  72  SER SER L . n 
B 2 73  GLY 73  73  73  GLY GLY L . n 
B 2 74  THR 74  74  74  THR THR L . n 
B 2 75  ASP 75  75  75  ASP ASP L . n 
B 2 76  PHE 76  76  76  PHE PHE L . n 
B 2 77  THR 77  77  77  THR THR L . n 
B 2 78  LEU 78  78  78  LEU LEU L . n 
B 2 79  ARG 79  79  79  ARG ARG L . n 
B 2 80  ILE 80  80  80  ILE ILE L . n 
B 2 81  SER 81  81  81  SER SER L . n 
B 2 82  ARG 82  82  82  ARG ARG L . n 
B 2 83  VAL 83  83  83  VAL VAL L . n 
B 2 84  GLU 84  84  84  GLU GLU L . n 
B 2 85  ALA 85  85  85  ALA ALA L . n 
B 2 86  GLU 86  86  86  GLU GLU L . n 
B 2 87  ASP 87  87  87  ASP ASP L . n 
B 2 88  VAL 88  88  88  VAL VAL L . n 
B 2 89  GLY 89  89  89  GLY GLY L . n 
B 2 90  VAL 90  90  90  VAL VAL L . n 
B 2 91  TYR 91  91  91  TYR TYR L . n 
B 2 92  TYR 92  92  92  TYR TYR L . n 
B 2 93  CYS 93  93  93  CYS CYS L . n 
B 2 94  ALA 94  94  94  ALA ALA L . n 
B 2 95  GLN 95  95  95  GLN GLN L . n 
B 2 96  ASN 96  96  96  ASN ASN L . n 
B 2 97  LEU 97  97  97  LEU LEU L . n 
B 2 98  GLU 98  98  98  GLU GLU L . n 
B 2 99  LEU 99  99  99  LEU LEU L . n 
B 2 100 PRO 100 100 100 PRO CPR L . n 
B 2 101 PRO 101 101 101 PRO PRO L . n 
B 2 102 THR 102 102 102 THR THR L . n 
B 2 103 PHE 103 103 103 PHE PHE L . n 
B 2 104 GLY 104 104 104 GLY GLY L . n 
B 2 105 GLY 105 105 105 GLY GLY L . n 
B 2 106 GLY 106 106 106 GLY GLY L . n 
B 2 107 THR 107 107 107 THR THR L . n 
B 2 108 LYS 108 108 108 LYS LYS L . n 
B 2 109 LEU 109 109 109 LEU LEU L . n 
B 2 110 GLU 110 110 110 GLU GLU L . n 
B 2 111 ILE 111 111 111 ILE ILE L . n 
B 2 112 LYS 112 112 112 LYS LYS L . n 
B 2 113 ARG 113 113 113 ARG ARG L . n 
B 2 114 ALA 114 114 114 ALA ALA L . n 
B 2 115 ASP 115 115 115 ASP ASP L . n 
B 2 116 ALA 116 116 116 ALA ALA L . n 
B 2 117 ALA 117 117 117 ALA ALA L . n 
B 2 118 PRO 118 118 118 PRO PRO L . n 
B 2 119 THR 119 119 119 THR THR L . n 
B 2 120 VAL 120 120 120 VAL VAL L . n 
B 2 121 SER 121 121 121 SER SER L . n 
B 2 122 ILE 122 122 122 ILE ILE L . n 
B 2 123 PHE 123 123 123 PHE PHE L . n 
B 2 124 PRO 124 124 124 PRO PRO L . n 
B 2 125 PRO 125 125 125 PRO PRO L . n 
B 2 126 SER 126 126 126 SER SER L . n 
B 2 127 SER 127 127 127 SER SER L . n 
B 2 128 GLU 128 128 128 GLU GLU L . n 
B 2 129 GLN 129 129 129 GLN GLN L . n 
B 2 130 LEU 130 130 130 LEU LEU L . n 
B 2 131 THR 131 131 131 THR THR L . n 
B 2 132 SER 132 132 132 SER SER L . n 
B 2 133 GLY 133 133 133 GLY GLY L . n 
B 2 134 GLY 134 134 134 GLY GLY L . n 
B 2 135 ALA 135 135 135 ALA ALA L . n 
B 2 136 SER 136 136 136 SER SER L . n 
B 2 137 VAL 137 137 137 VAL VAL L . n 
B 2 138 VAL 138 138 138 VAL VAL L . n 
B 2 139 CYS 139 139 139 CYS CYS L . n 
B 2 140 PHE 140 140 140 PHE PHE L . n 
B 2 141 LEU 141 141 141 LEU LEU L . n 
B 2 142 ASN 142 142 142 ASN ASN L . n 
B 2 143 ASN 143 143 143 ASN ASN L . n 
B 2 144 PHE 144 144 144 PHE PHE L . n 
B 2 145 TYR 145 145 145 TYR TYR L . n 
B 2 146 PRO 146 146 146 PRO PRO L . n 
B 2 147 LYS 147 147 147 LYS LYS L . n 
B 2 148 ASP 148 148 148 ASP ASP L . n 
B 2 149 ILE 149 149 149 ILE ILE L . n 
B 2 150 ASN 150 150 150 ASN ASN L . n 
B 2 151 VAL 151 151 151 VAL VAL L . n 
B 2 152 LYS 152 152 152 LYS LYS L . n 
B 2 153 TRP 153 153 153 TRP TRP L . n 
B 2 154 LYS 154 154 154 LYS LYS L . n 
B 2 155 ILE 155 155 155 ILE ILE L . n 
B 2 156 ASP 156 156 156 ASP ASP L . n 
B 2 157 GLY 157 157 157 GLY GLY L . n 
B 2 158 SER 158 158 158 SER SER L . n 
B 2 159 GLU 159 159 159 GLU GLU L . n 
B 2 160 ARG 160 160 160 ARG ARG L . n 
B 2 161 GLN 161 161 161 GLN GLN L . n 
B 2 162 ASN 162 162 162 ASN ASN L . n 
B 2 163 GLY 163 163 163 GLY GLY L . n 
B 2 164 VAL 164 164 164 VAL VAL L . n 
B 2 165 LEU 165 165 165 LEU LEU L . n 
B 2 166 ASN 166 166 166 ASN ASN L . n 
B 2 167 SER 167 167 167 SER SER L . n 
B 2 168 TRP 168 168 168 TRP TRP L . n 
B 2 169 THR 169 169 169 THR THR L . n 
B 2 170 ASP 170 170 170 ASP ASP L . n 
B 2 171 GLN 171 171 171 GLN GLN L . n 
B 2 172 ASP 172 172 172 ASP ASP L . n 
B 2 173 SER 173 173 173 SER SER L . n 
B 2 174 LYS 174 174 174 LYS LYS L . n 
B 2 175 ASP 175 175 175 ASP ASP L . n 
B 2 176 SER 176 176 176 SER SER L . n 
B 2 177 THR 177 177 177 THR THR L . n 
B 2 178 TYR 178 178 178 TYR TYR L . n 
B 2 179 SER 179 179 179 SER SER L . n 
B 2 180 MET 180 180 180 MET MET L . n 
B 2 181 SER 181 181 181 SER SER L . n 
B 2 182 SER 182 182 182 SER SER L . n 
B 2 183 THR 183 183 183 THR THR L . n 
B 2 184 LEU 184 184 184 LEU LEU L . n 
B 2 185 THR 185 185 185 THR THR L . n 
B 2 186 LEU 186 186 186 LEU LEU L . n 
B 2 187 THR 187 187 187 THR THR L . n 
B 2 188 LYS 188 188 188 LYS LYS L . n 
B 2 189 ASP 189 189 189 ASP ASP L . n 
B 2 190 GLU 190 190 190 GLU GLU L . n 
B 2 191 TYR 191 191 191 TYR TYR L . n 
B 2 192 GLU 192 192 192 GLU GLU L . n 
B 2 193 ARG 193 193 193 ARG ARG L . n 
B 2 194 HIS 194 194 194 HIS HIS L . n 
B 2 195 ASN 195 195 195 ASN ASN L . n 
B 2 196 GLY 196 196 196 GLY GLY L . n 
B 2 197 TYR 197 197 197 TYR TYR L . n 
B 2 198 THR 198 198 198 THR THR L . n 
B 2 199 CYS 199 199 199 CYS CYS L . n 
B 2 200 GLU 200 200 200 GLU GLU L . n 
B 2 201 ALA 201 201 201 ALA ALA L . n 
B 2 202 THR 202 202 202 THR THR L . n 
B 2 203 HIS 203 203 203 HIS HIS L . n 
B 2 204 LYS 204 204 204 LYS LYS L . n 
B 2 205 THR 205 205 205 THR THR L . n 
B 2 206 SER 206 206 206 SER SER L . n 
B 2 207 THR 207 207 207 THR THR L . n 
B 2 208 SER 208 208 208 SER SER L . n 
B 2 209 PRO 209 209 209 PRO PRO L . n 
B 2 210 ILE 210 210 210 ILE ILE L . n 
B 2 211 VAL 211 211 211 VAL VAL L . n 
B 2 212 LYS 212 212 212 LYS LYS L . n 
B 2 213 SER 213 213 213 SER SER L . n 
B 2 214 PHE 214 214 214 PHE PHE L . n 
C 1 1   GLU 1   1   1   GLU GLU A . n 
C 1 2   VAL 2   2   2   VAL VAL A . n 
C 1 3   LYS 3   3   3   LYS LYS A . n 
C 1 4   LEU 4   4   4   LEU LEU A . n 
C 1 5   LEU 5   5   5   LEU LEU A . n 
C 1 6   GLU 6   6   6   GLU GLU A . n 
C 1 7   SER 7   7   7   SER SER A . n 
C 1 8   GLY 8   8   8   GLY GLY A . n 
C 1 9   GLY 9   9   9   GLY GLY A . n 
C 1 10  GLY 10  10  10  GLY GLY A . n 
C 1 11  LEU 11  11  11  LEU LEU A . n 
C 1 12  VAL 12  12  12  VAL VAL A . n 
C 1 13  LYS 13  13  13  LYS LYS A . n 
C 1 14  PRO 14  14  14  PRO PRO A . n 
C 1 15  GLY 15  15  15  GLY GLY A . n 
C 1 16  GLY 16  16  16  GLY GLY A . n 
C 1 17  SER 17  17  17  SER SER A . n 
C 1 18  LEU 18  18  18  LEU LEU A . n 
C 1 19  LYS 19  19  19  LYS LYS A . n 
C 1 20  LEU 20  20  20  LEU LEU A . n 
C 1 21  SER 21  21  21  SER SER A . n 
C 1 22  CYS 22  22  22  CYS CYS A . n 
C 1 23  THR 23  23  23  THR THR A . n 
C 1 24  ALA 24  24  24  ALA ALA A . n 
C 1 25  SER 25  25  25  SER SER A . n 
C 1 26  GLY 26  26  26  GLY GLY A . n 
C 1 27  ILE 27  27  27  ILE ILE A . n 
C 1 28  THR 28  28  28  THR THR A . n 
C 1 29  PHE 29  29  29  PHE PHE A . n 
C 1 30  SER 30  30  30  SER SER A . n 
C 1 31  ARG 31  32  32  ARG ARG A . n 
C 1 32  TYR 32  34  34  TYR TYR A . n 
C 1 33  ILE 33  35  35  ILE ILE A . n 
C 1 34  MET 34  36  36  MET MET A . n 
C 1 35  SER 35  37  37  SER SER A . n 
C 1 36  TRP 36  38  38  TRP TRP A . n 
C 1 37  VAL 37  39  39  VAL VAL A . n 
C 1 38  ARG 38  40  40  ARG ARG A . n 
C 1 39  GLN 39  41  41  GLN GLN A . n 
C 1 40  ILE 40  42  42  ILE ILE A . n 
C 1 41  PRO 41  43  43  PRO PRO A . n 
C 1 42  GLU 42  44  44  GLU GLU A . n 
C 1 43  LYS 43  45  45  LYS LYS A . n 
C 1 44  ARG 44  46  46  ARG ARG A . n 
C 1 45  LEU 45  47  47  LEU LEU A . n 
C 1 46  GLU 46  48  48  GLU GLU A . n 
C 1 47  TRP 47  49  49  TRP TRP A . n 
C 1 48  VAL 48  50  50  VAL VAL A . n 
C 1 49  ALA 49  51  51  ALA ALA A . n 
C 1 50  SER 50  52  52  SER SER A . n 
C 1 51  ILE 51  53  53  ILE ILE A . n 
C 1 52  SER 52  54  54  SER SER A . n 
C 1 53  SER 53  55  55  SER SER A . n 
C 1 54  GLY 54  56  56  GLY GLY A . n 
C 1 55  GLY 55  57  57  GLY GLY A . n 
C 1 56  ILE 56  58  58  ILE ILE A . n 
C 1 57  THR 57  59  59  THR THR A . n 
C 1 58  TYR 58  60  60  TYR TYR A . n 
C 1 59  TYR 59  61  61  TYR TYR A . n 
C 1 60  PRO 60  62  62  PRO PRO A . n 
C 1 61  ASP 61  63  63  ASP ASP A . n 
C 1 62  SER 62  64  64  SER SER A . n 
C 1 63  VAL 63  65  65  VAL VAL A . n 
C 1 64  ALA 64  66  66  ALA ALA A . n 
C 1 65  GLY 65  67  67  GLY GLY A . n 
C 1 66  ARG 66  68  68  ARG ARG A . n 
C 1 67  PHE 67  69  69  PHE PHE A . n 
C 1 68  THR 68  70  70  THR THR A . n 
C 1 69  ILE 69  71  71  ILE ILE A . n 
C 1 70  SER 70  72  72  SER SER A . n 
C 1 71  ARG 71  73  73  ARG ARG A . n 
C 1 72  ASP 72  74  74  ASP ASP A . n 
C 1 73  ASN 73  75  75  ASN ASN A . n 
C 1 74  VAL 74  76  76  VAL VAL A . n 
C 1 75  ARG 75  77  77  ARG ARG A . n 
C 1 76  ASN 76  78  78  ASN ASN A . n 
C 1 77  ILE 77  79  79  ILE ILE A . n 
C 1 78  LEU 78  80  80  LEU LEU A . n 
C 1 79  TYR 79  81  81  TYR TYR A . n 
C 1 80  LEU 80  82  82  LEU LEU A . n 
C 1 81  GLN 81  83  83  GLN GLN A . n 
C 1 82  MET 82  84  84  MET MET A . n 
C 1 83  SER 83  85  85  SER SER A . n 
C 1 84  SER 84  86  86  SER SER A . n 
C 1 85  LEU 85  87  87  LEU LEU A . n 
C 1 86  ARG 86  88  88  ARG ARG A . n 
C 1 87  SER 87  89  89  SER SER A . n 
C 1 88  GLU 88  90  90  GLU GLU A . n 
C 1 89  ASP 89  91  91  ASP ASP A . n 
C 1 90  THR 90  92  92  THR THR A . n 
C 1 91  ALA 91  93  93  ALA ALA A . n 
C 1 92  LEU 92  94  94  LEU LEU A . n 
C 1 93  TYR 93  95  95  TYR TYR A . n 
C 1 94  TYR 94  96  96  TYR TYR A . n 
C 1 95  CYS 95  97  97  CYS CYS A . n 
C 1 96  ALA 96  98  98  ALA ALA A . n 
C 1 97  ARG 97  99  99  ARG ARG A . n 
C 1 98  GLY 98  100 100 GLY GLY A . n 
C 1 99  GLN 99  101 101 GLN GLN A . n 
C 1 100 GLY 100 102 102 GLY GLY A . n 
C 1 101 ARG 101 103 103 ARG ARG A . n 
C 1 102 PRO 102 104 104 PRO PRO A . n 
C 1 103 TYR 103 105 105 TYR TYR A . n 
C 1 104 TRP 104 106 106 TRP TRP A . n 
C 1 105 GLY 105 107 107 GLY GLY A . n 
C 1 106 GLN 106 108 108 GLN GLN A . n 
C 1 107 GLY 107 109 109 GLY GLY A . n 
C 1 108 THR 108 110 110 THR THR A . n 
C 1 109 LEU 109 111 111 LEU LEU A . n 
C 1 110 VAL 110 112 112 VAL VAL A . n 
C 1 111 THR 111 113 113 THR THR A . n 
C 1 112 VAL 112 114 114 VAL VAL A . n 
C 1 113 SER 113 115 115 SER SER A . n 
C 1 114 SER 114 116 116 SER SER A . n 
C 1 115 ALA 115 117 117 ALA ALA A . n 
C 1 116 LYS 116 118 118 LYS LYS A . n 
C 1 117 THR 117 119 119 THR THR A . n 
C 1 118 THR 118 120 120 THR THR A . n 
C 1 119 PRO 119 121 121 PRO PRO A . n 
C 1 120 PRO 120 122 122 PRO PRO A . n 
C 1 121 SER 121 123 123 SER SER A . n 
C 1 122 VAL 122 124 124 VAL VAL A . n 
C 1 123 TYR 123 125 125 TYR TYR A . n 
C 1 124 PRO 124 126 126 PRO PRO A . n 
C 1 125 ALA 125 127 127 ALA ALA A . n 
C 1 126 ALA 126 128 128 ALA ALA A . n 
C 1 127 PRO 127 129 129 PRO PRO A . n 
C 1 128 GLY 128 130 130 GLY GLY A . n 
C 1 129 CYS 129 131 131 CYS CYS A . n 
C 1 130 GLY 130 132 132 GLY GLY A . n 
C 1 131 ASP 131 133 133 ASP ASP A . n 
C 1 132 THR 132 134 134 THR THR A . n 
C 1 133 THR 133 135 135 THR THR A . n 
C 1 134 GLY 134 136 136 GLY GLY A . n 
C 1 135 SER 135 137 137 SER SER A . n 
C 1 136 SER 136 138 138 SER SER A . n 
C 1 137 VAL 137 139 139 VAL VAL A . n 
C 1 138 THR 138 140 140 THR THR A . n 
C 1 139 LEU 139 141 141 LEU LEU A . n 
C 1 140 GLY 140 142 142 GLY GLY A . n 
C 1 141 CYS 141 143 143 CYS CYS A . n 
C 1 142 LEU 142 144 144 LEU LEU A . n 
C 1 143 VAL 143 145 145 VAL VAL A . n 
C 1 144 LYS 144 146 146 LYS LYS A . n 
C 1 145 GLY 145 147 147 GLY GLY A . n 
C 1 146 TYR 146 148 148 TYR TYR A . n 
C 1 147 PHE 147 149 149 PHE PHE A . n 
C 1 148 PRO 148 150 150 PRO CPR A . n 
C 1 149 GLU 149 151 151 GLU GLU A . n 
C 1 150 PRO 150 152 152 PRO PRO A . n 
C 1 151 VAL 151 153 153 VAL VAL A . n 
C 1 152 THR 152 154 154 THR THR A . n 
C 1 153 VAL 153 155 155 VAL VAL A . n 
C 1 154 THR 154 156 156 THR THR A . n 
C 1 155 TRP 155 157 157 TRP TRP A . n 
C 1 156 ASN 156 158 158 ASN ASN A . n 
C 1 157 SER 157 159 159 SER SER A . n 
C 1 158 GLY 158 160 160 GLY GLY A . n 
C 1 159 GLY 159 161 161 GLY GLY A . n 
C 1 160 SER 160 164 164 SER SER A . n 
C 1 161 SER 161 165 165 SER SER A . n 
C 1 162 VAL 162 166 166 VAL VAL A . n 
C 1 163 HIS 163 167 167 HIS HIS A . n 
C 1 164 THR 164 168 168 THR THR A . n 
C 1 165 PHE 165 169 169 PHE PHE A . n 
C 1 166 PRO 166 170 170 PRO PRO A . n 
C 1 167 ALA 167 171 171 ALA ALA A . n 
C 1 168 LEU 168 172 172 LEU LEU A . n 
C 1 169 LEU 169 173 173 LEU LEU A . n 
C 1 170 GLN 170 174 174 GLN GLN A . n 
C 1 171 SER 171 175 175 SER SER A . n 
C 1 172 GLY 172 176 176 GLY GLY A . n 
C 1 173 LEU 173 177 177 LEU LEU A . n 
C 1 174 TYR 174 178 178 TYR TYR A . n 
C 1 175 THR 175 179 179 THR THR A . n 
C 1 176 MET 176 180 180 MET MET A . n 
C 1 177 SER 177 181 181 SER SER A . n 
C 1 178 SER 178 182 182 SER SER A . n 
C 1 179 SER 179 183 183 SER SER A . n 
C 1 180 VAL 180 184 184 VAL VAL A . n 
C 1 181 THR 181 185 185 THR THR A . n 
C 1 182 VAL 182 186 186 VAL VAL A . n 
C 1 183 PRO 183 187 187 PRO PRO A . n 
C 1 184 SER 184 188 188 SER SER A . n 
C 1 185 SER 185 189 189 SER SER A . n 
C 1 186 THR 186 190 190 THR THR A . n 
C 1 187 TRP 187 191 191 TRP TRP A . n 
C 1 188 PRO 188 192 192 PRO PRO A . n 
C 1 189 SER 189 193 193 SER SER A . n 
C 1 190 THR 190 195 195 THR THR A . n 
C 1 191 VAL 191 196 196 VAL VAL A . n 
C 1 192 THR 192 197 197 THR THR A . n 
C 1 193 CYS 193 198 198 CYS CYS A . n 
C 1 194 SER 194 199 199 SER SER A . n 
C 1 195 VAL 195 200 200 VAL VAL A . n 
C 1 196 ALA 196 201 201 ALA ALA A . n 
C 1 197 HIS 197 202 202 HIS HIS A . n 
C 1 198 PRO 198 203 203 PRO PRO A . n 
C 1 199 ALA 199 204 204 ALA ALA A . n 
C 1 200 SER 200 205 205 SER SER A . n 
C 1 201 SER 201 206 206 SER SER A . n 
C 1 202 THR 202 207 207 THR THR A . n 
C 1 203 THR 203 208 208 THR THR A . n 
C 1 204 VAL 204 209 209 VAL VAL A . n 
C 1 205 ASP 205 210 210 ASP ASP A . n 
C 1 206 LYS 206 211 211 LYS LYS A . n 
C 1 207 LYS 207 212 212 LYS LYS A . n 
C 1 208 LEU 208 213 213 LEU LEU A . n 
C 1 209 GLU 209 214 214 GLU GLU A . n 
D 2 1   ASP 1   1   1   ASP ASP B . n 
D 2 2   ILE 2   2   2   ILE ILE B . n 
D 2 3   VAL 3   3   3   VAL VAL B . n 
D 2 4   MET 4   4   4   MET MET B . n 
D 2 5   THR 5   5   5   THR THR B . n 
D 2 6   GLN 6   6   6   GLN GLN B . n 
D 2 7   ALA 7   7   7   ALA ALA B . n 
D 2 8   ALA 8   8   8   ALA ALA B . n 
D 2 9   PHE 9   9   9   PHE PHE B . n 
D 2 10  SER 10  10  10  SER SER B . n 
D 2 11  ASN 11  11  11  ASN ASN B . n 
D 2 12  PRO 12  12  12  PRO PRO B . n 
D 2 13  VAL 13  13  13  VAL VAL B . n 
D 2 14  THR 14  14  14  THR THR B . n 
D 2 15  LEU 15  15  15  LEU LEU B . n 
D 2 16  GLY 16  16  16  GLY GLY B . n 
D 2 17  THR 17  17  17  THR THR B . n 
D 2 18  SER 18  18  18  SER SER B . n 
D 2 19  ALA 19  19  19  ALA ALA B . n 
D 2 20  SER 20  20  20  SER SER B . n 
D 2 21  ILE 21  21  21  ILE ILE B . n 
D 2 22  SER 22  22  22  SER SER B . n 
D 2 23  CYS 23  23  23  CYS CYS B . n 
D 2 24  ARG 24  24  24  ARG ARG B . n 
D 2 25  SER 25  25  25  SER SER B . n 
D 2 26  THR 26  26  26  THR THR B . n 
D 2 27  LYS 27  27  27  LYS LYS B . n 
D 2 28  SER 28  28  28  SER SER B . n 
D 2 29  LEU 29  29  29  LEU LEU B . n 
D 2 30  LEU 30  30  30  LEU LEU B . n 
D 2 31  HIS 31  31  31  HIS HIS B . n 
D 2 32  SER 32  32  32  SER SER B . n 
D 2 33  ASN 33  33  33  ASN ASN B . n 
D 2 34  GLY 34  34  34  GLY GLY B . n 
D 2 35  ILE 35  35  35  ILE ILE B . n 
D 2 36  THR 36  36  36  THR THR B . n 
D 2 37  TYR 37  37  37  TYR TYR B . n 
D 2 38  LEU 38  38  38  LEU LEU B . n 
D 2 39  TYR 39  39  39  TYR TYR B . n 
D 2 40  TRP 40  40  40  TRP TRP B . n 
D 2 41  TYR 41  41  41  TYR TYR B . n 
D 2 42  LEU 42  42  42  LEU LEU B . n 
D 2 43  GLN 43  43  43  GLN GLN B . n 
D 2 44  LYS 44  44  44  LYS LYS B . n 
D 2 45  PRO 45  45  45  PRO PRO B . n 
D 2 46  GLY 46  46  46  GLY GLY B . n 
D 2 47  GLN 47  47  47  GLN GLN B . n 
D 2 48  SER 48  48  48  SER SER B . n 
D 2 49  PRO 49  49  49  PRO PRO B . n 
D 2 50  GLN 50  50  50  GLN GLN B . n 
D 2 51  LEU 51  51  51  LEU LEU B . n 
D 2 52  LEU 52  52  52  LEU LEU B . n 
D 2 53  ILE 53  53  53  ILE ILE B . n 
D 2 54  TYR 54  54  54  TYR TYR B . n 
D 2 55  GLN 55  55  55  GLN GLN B . n 
D 2 56  MET 56  56  56  MET MET B . n 
D 2 57  SER 57  57  57  SER SER B . n 
D 2 58  ASN 58  58  58  ASN ASN B . n 
D 2 59  LEU 59  59  59  LEU LEU B . n 
D 2 60  ALA 60  60  60  ALA ALA B . n 
D 2 61  SER 61  61  61  SER SER B . n 
D 2 62  GLY 62  62  62  GLY GLY B . n 
D 2 63  VAL 63  63  63  VAL VAL B . n 
D 2 64  PRO 64  64  64  PRO PRO B . n 
D 2 65  ASN 65  65  65  ASN ASN B . n 
D 2 66  ARG 66  66  66  ARG ARG B . n 
D 2 67  PHE 67  67  67  PHE PHE B . n 
D 2 68  SER 68  68  68  SER SER B . n 
D 2 69  SER 69  69  69  SER SER B . n 
D 2 70  SER 70  70  70  SER SER B . n 
D 2 71  GLY 71  71  71  GLY GLY B . n 
D 2 72  SER 72  72  72  SER SER B . n 
D 2 73  GLY 73  73  73  GLY GLY B . n 
D 2 74  THR 74  74  74  THR THR B . n 
D 2 75  ASP 75  75  75  ASP ASP B . n 
D 2 76  PHE 76  76  76  PHE PHE B . n 
D 2 77  THR 77  77  77  THR THR B . n 
D 2 78  LEU 78  78  78  LEU LEU B . n 
D 2 79  ARG 79  79  79  ARG ARG B . n 
D 2 80  ILE 80  80  80  ILE ILE B . n 
D 2 81  SER 81  81  81  SER SER B . n 
D 2 82  ARG 82  82  82  ARG ARG B . n 
D 2 83  VAL 83  83  83  VAL VAL B . n 
D 2 84  GLU 84  84  84  GLU GLU B . n 
D 2 85  ALA 85  85  85  ALA ALA B . n 
D 2 86  GLU 86  86  86  GLU GLU B . n 
D 2 87  ASP 87  87  87  ASP ASP B . n 
D 2 88  VAL 88  88  88  VAL VAL B . n 
D 2 89  GLY 89  89  89  GLY GLY B . n 
D 2 90  VAL 90  90  90  VAL VAL B . n 
D 2 91  TYR 91  91  91  TYR TYR B . n 
D 2 92  TYR 92  92  92  TYR TYR B . n 
D 2 93  CYS 93  93  93  CYS CYS B . n 
D 2 94  ALA 94  94  94  ALA ALA B . n 
D 2 95  GLN 95  95  95  GLN GLN B . n 
D 2 96  ASN 96  96  96  ASN ASN B . n 
D 2 97  LEU 97  97  97  LEU LEU B . n 
D 2 98  GLU 98  98  98  GLU GLU B . n 
D 2 99  LEU 99  99  99  LEU LEU B . n 
D 2 100 PRO 100 100 100 PRO CPR B . n 
D 2 101 PRO 101 101 101 PRO PRO B . n 
D 2 102 THR 102 102 102 THR THR B . n 
D 2 103 PHE 103 103 103 PHE PHE B . n 
D 2 104 GLY 104 104 104 GLY GLY B . n 
D 2 105 GLY 105 105 105 GLY GLY B . n 
D 2 106 GLY 106 106 106 GLY GLY B . n 
D 2 107 THR 107 107 107 THR THR B . n 
D 2 108 LYS 108 108 108 LYS LYS B . n 
D 2 109 LEU 109 109 109 LEU LEU B . n 
D 2 110 GLU 110 110 110 GLU GLU B . n 
D 2 111 ILE 111 111 111 ILE ILE B . n 
D 2 112 LYS 112 112 112 LYS LYS B . n 
D 2 113 ARG 113 113 113 ARG ARG B . n 
D 2 114 ALA 114 114 114 ALA ALA B . n 
D 2 115 ASP 115 115 115 ASP ASP B . n 
D 2 116 ALA 116 116 116 ALA ALA B . n 
D 2 117 ALA 117 117 117 ALA ALA B . n 
D 2 118 PRO 118 118 118 PRO PRO B . n 
D 2 119 THR 119 119 119 THR THR B . n 
D 2 120 VAL 120 120 120 VAL VAL B . n 
D 2 121 SER 121 121 121 SER SER B . n 
D 2 122 ILE 122 122 122 ILE ILE B . n 
D 2 123 PHE 123 123 123 PHE PHE B . n 
D 2 124 PRO 124 124 124 PRO PRO B . n 
D 2 125 PRO 125 125 125 PRO PRO B . n 
D 2 126 SER 126 126 126 SER SER B . n 
D 2 127 SER 127 127 127 SER SER B . n 
D 2 128 GLU 128 128 128 GLU GLU B . n 
D 2 129 GLN 129 129 129 GLN GLN B . n 
D 2 130 LEU 130 130 130 LEU LEU B . n 
D 2 131 THR 131 131 131 THR THR B . n 
D 2 132 SER 132 132 132 SER SER B . n 
D 2 133 GLY 133 133 133 GLY GLY B . n 
D 2 134 GLY 134 134 134 GLY GLY B . n 
D 2 135 ALA 135 135 135 ALA ALA B . n 
D 2 136 SER 136 136 136 SER SER B . n 
D 2 137 VAL 137 137 137 VAL VAL B . n 
D 2 138 VAL 138 138 138 VAL VAL B . n 
D 2 139 CYS 139 139 139 CYS CYS B . n 
D 2 140 PHE 140 140 140 PHE PHE B . n 
D 2 141 LEU 141 141 141 LEU LEU B . n 
D 2 142 ASN 142 142 142 ASN ASN B . n 
D 2 143 ASN 143 143 143 ASN ASN B . n 
D 2 144 PHE 144 144 144 PHE PHE B . n 
D 2 145 TYR 145 145 145 TYR TYR B . n 
D 2 146 PRO 146 146 146 PRO PRO B . n 
D 2 147 LYS 147 147 147 LYS LYS B . n 
D 2 148 ASP 148 148 148 ASP ASP B . n 
D 2 149 ILE 149 149 149 ILE ILE B . n 
D 2 150 ASN 150 150 150 ASN ASN B . n 
D 2 151 VAL 151 151 151 VAL VAL B . n 
D 2 152 LYS 152 152 152 LYS LYS B . n 
D 2 153 TRP 153 153 153 TRP TRP B . n 
D 2 154 LYS 154 154 154 LYS LYS B . n 
D 2 155 ILE 155 155 155 ILE ILE B . n 
D 2 156 ASP 156 156 156 ASP ASP B . n 
D 2 157 GLY 157 157 157 GLY GLY B . n 
D 2 158 SER 158 158 158 SER SER B . n 
D 2 159 GLU 159 159 159 GLU GLU B . n 
D 2 160 ARG 160 160 160 ARG ARG B . n 
D 2 161 GLN 161 161 161 GLN GLN B . n 
D 2 162 ASN 162 162 162 ASN ASN B . n 
D 2 163 GLY 163 163 163 GLY GLY B . n 
D 2 164 VAL 164 164 164 VAL VAL B . n 
D 2 165 LEU 165 165 165 LEU LEU B . n 
D 2 166 ASN 166 166 166 ASN ASN B . n 
D 2 167 SER 167 167 167 SER SER B . n 
D 2 168 TRP 168 168 168 TRP TRP B . n 
D 2 169 THR 169 169 169 THR THR B . n 
D 2 170 ASP 170 170 170 ASP ASP B . n 
D 2 171 GLN 171 171 171 GLN GLN B . n 
D 2 172 ASP 172 172 172 ASP ASP B . n 
D 2 173 SER 173 173 173 SER SER B . n 
D 2 174 LYS 174 174 174 LYS LYS B . n 
D 2 175 ASP 175 175 175 ASP ASP B . n 
D 2 176 SER 176 176 176 SER SER B . n 
D 2 177 THR 177 177 177 THR THR B . n 
D 2 178 TYR 178 178 178 TYR TYR B . n 
D 2 179 SER 179 179 179 SER SER B . n 
D 2 180 MET 180 180 180 MET MET B . n 
D 2 181 SER 181 181 181 SER SER B . n 
D 2 182 SER 182 182 182 SER SER B . n 
D 2 183 THR 183 183 183 THR THR B . n 
D 2 184 LEU 184 184 184 LEU LEU B . n 
D 2 185 THR 185 185 185 THR THR B . n 
D 2 186 LEU 186 186 186 LEU LEU B . n 
D 2 187 THR 187 187 187 THR THR B . n 
D 2 188 LYS 188 188 188 LYS LYS B . n 
D 2 189 ASP 189 189 189 ASP ASP B . n 
D 2 190 GLU 190 190 190 GLU GLU B . n 
D 2 191 TYR 191 191 191 TYR TYR B . n 
D 2 192 GLU 192 192 192 GLU GLU B . n 
D 2 193 ARG 193 193 193 ARG ARG B . n 
D 2 194 HIS 194 194 194 HIS HIS B . n 
D 2 195 ASN 195 195 195 ASN ASN B . n 
D 2 196 GLY 196 196 196 GLY GLY B . n 
D 2 197 TYR 197 197 197 TYR TYR B . n 
D 2 198 THR 198 198 198 THR THR B . n 
D 2 199 CYS 199 199 199 CYS CYS B . n 
D 2 200 GLU 200 200 200 GLU GLU B . n 
D 2 201 ALA 201 201 201 ALA ALA B . n 
D 2 202 THR 202 202 202 THR THR B . n 
D 2 203 HIS 203 203 203 HIS HIS B . n 
D 2 204 LYS 204 204 204 LYS LYS B . n 
D 2 205 THR 205 205 205 THR THR B . n 
D 2 206 SER 206 206 206 SER SER B . n 
D 2 207 THR 207 207 207 THR THR B . n 
D 2 208 SER 208 208 208 SER SER B . n 
D 2 209 PRO 209 209 209 PRO PRO B . n 
D 2 210 ILE 210 210 210 ILE ILE B . n 
D 2 211 VAL 211 211 211 VAL VAL B . n 
D 2 212 LYS 212 212 212 LYS LYS B . n 
D 2 213 SER 213 213 213 SER SER B . n 
D 2 214 PHE 214 214 214 PHE PHE B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H 
2 1 C,D,F,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4280  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  19010 ? 
2 'ABSA (A^2)' 4230  ? 
2 MORE         -20   ? 
2 'SSA (A^2)'  19140 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-04-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.location 
_software.classification 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
CNS       1.0 1998 package 'Axel T. Brunger' axel.brunger@@yale.edu . refinement       Fortran ? 1 
DENZO     .   ?    ?       ?                 ?                      ? 'data reduction' ?       ? 2 
SCALEPACK .   ?    ?       ?                 ?                      ? 'data scaling'   ?       ? 3 
MOLREP    .   ?    ?       ?                 ?                      ? phasing          ?       ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O L HOH 236 ? ? O L HOH 350 ? ? 2.15 
2 1 O B CYS 23  ? ? O B HOH 843 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OG 
_pdbx_validate_symm_contact.auth_asym_id_1    L 
_pdbx_validate_symm_contact.auth_comp_id_1    SER 
_pdbx_validate_symm_contact.auth_seq_id_1     32 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    L 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     345 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_544 
_pdbx_validate_symm_contact.dist              2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN H 78  ? ? 60.17   64.21   
2  1 ALA H 93  ? ? 177.45  177.83  
3  1 ALA H 117 ? ? -47.73  162.41  
4  1 THR H 135 ? ? -59.66  86.79   
5  1 SER H 138 ? ? 63.30   105.36  
6  1 PHE H 149 ? ? -174.95 134.07  
7  1 PRO H 150 ? ? -65.44  -176.02 
8  1 PRO H 152 ? ? -47.55  107.99  
9  1 ASN H 158 ? ? 47.40   15.63   
10 1 SER H 159 ? ? 72.07   -36.42  
11 1 SER H 189 ? ? -66.86  5.13    
12 1 THR H 195 ? ? 79.35   105.25  
13 1 MET L 56  ? ? 70.86   -48.92  
14 1 ASN L 65  ? ? -69.57  11.44   
15 1 SER L 72  ? ? -93.33  -149.17 
16 1 ALA L 135 ? ? -167.30 97.60   
17 1 PRO L 146 ? ? -63.33  -173.75 
18 1 ARG L 193 ? ? -62.32  13.82   
19 1 ASN A 78  ? ? 60.48   64.28   
20 1 ALA A 93  ? ? 175.19  176.74  
21 1 THR A 135 ? ? -59.06  85.82   
22 1 SER A 138 ? ? 63.23   105.56  
23 1 PHE A 149 ? ? -173.40 133.90  
24 1 PRO A 150 ? ? -65.27  -176.46 
25 1 PRO A 152 ? ? -49.23  107.24  
26 1 ASN A 158 ? ? 47.99   15.13   
27 1 SER A 159 ? ? 72.39   -35.92  
28 1 SER A 189 ? ? -67.36  4.49    
29 1 THR A 195 ? ? 79.15   104.19  
30 1 MET B 56  ? ? 72.38   -49.01  
31 1 ASN B 65  ? ? -69.46  12.41   
32 1 SER B 72  ? ? -91.16  -146.79 
33 1 ALA B 116 ? ? -171.09 128.09  
34 1 ALA B 135 ? ? -166.96 96.83   
35 1 PRO B 146 ? ? -63.15  -173.06 
36 1 ARG B 193 ? ? -62.35  13.73   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '4-(4-STYRYL-PHENYLCARBAMOYL)-BUTYRIC ACID' SPB 
4 water                                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 SPB 1   601 1   SPB FRA H . 
F 3 SPB 1   701 1   SPB FRA B . 
G 4 HOH 1   602 3   HOH HOH H . 
G 4 HOH 2   603 6   HOH HOH H . 
G 4 HOH 3   604 7   HOH HOH H . 
G 4 HOH 4   605 26  HOH HOH H . 
G 4 HOH 5   606 34  HOH HOH H . 
G 4 HOH 6   607 54  HOH HOH H . 
G 4 HOH 7   608 64  HOH HOH H . 
G 4 HOH 8   609 71  HOH HOH H . 
G 4 HOH 9   610 80  HOH HOH H . 
G 4 HOH 10  611 84  HOH HOH H . 
G 4 HOH 11  612 86  HOH HOH H . 
G 4 HOH 12  613 90  HOH HOH H . 
G 4 HOH 13  614 93  HOH HOH H . 
G 4 HOH 14  615 95  HOH HOH H . 
G 4 HOH 15  616 97  HOH HOH H . 
G 4 HOH 16  617 105 HOH HOH H . 
G 4 HOH 17  618 115 HOH HOH H . 
G 4 HOH 18  619 120 HOH HOH H . 
G 4 HOH 19  620 122 HOH HOH H . 
G 4 HOH 20  621 123 HOH HOH H . 
G 4 HOH 21  622 146 HOH HOH H . 
G 4 HOH 22  623 162 HOH HOH H . 
G 4 HOH 23  624 166 HOH HOH H . 
G 4 HOH 24  625 172 HOH HOH H . 
G 4 HOH 25  626 175 HOH HOH H . 
G 4 HOH 26  627 183 HOH HOH H . 
G 4 HOH 27  628 189 HOH HOH H . 
G 4 HOH 28  629 190 HOH HOH H . 
G 4 HOH 29  630 205 HOH HOH H . 
G 4 HOH 30  631 206 HOH HOH H . 
G 4 HOH 31  632 209 HOH HOH H . 
G 4 HOH 32  633 213 HOH HOH H . 
G 4 HOH 33  634 217 HOH HOH H . 
G 4 HOH 34  635 224 HOH HOH H . 
G 4 HOH 35  636 239 HOH HOH H . 
G 4 HOH 36  637 247 HOH HOH H . 
G 4 HOH 37  638 250 HOH HOH H . 
G 4 HOH 38  639 252 HOH HOH H . 
G 4 HOH 39  640 261 HOH HOH H . 
G 4 HOH 40  641 267 HOH HOH H . 
G 4 HOH 41  642 270 HOH HOH H . 
G 4 HOH 42  643 275 HOH HOH H . 
G 4 HOH 43  644 282 HOH HOH H . 
G 4 HOH 44  645 284 HOH HOH H . 
G 4 HOH 45  646 287 HOH HOH H . 
G 4 HOH 46  647 289 HOH HOH H . 
G 4 HOH 47  648 291 HOH HOH H . 
G 4 HOH 48  649 292 HOH HOH H . 
G 4 HOH 49  650 300 HOH HOH H . 
G 4 HOH 50  651 312 HOH HOH H . 
G 4 HOH 51  652 322 HOH HOH H . 
G 4 HOH 52  653 325 HOH HOH H . 
G 4 HOH 53  654 326 HOH HOH H . 
G 4 HOH 54  655 329 HOH HOH H . 
G 4 HOH 55  656 352 HOH HOH H . 
G 4 HOH 56  657 359 HOH HOH H . 
G 4 HOH 57  658 380 HOH HOH H . 
G 4 HOH 58  659 386 HOH HOH H . 
G 4 HOH 59  660 389 HOH HOH H . 
G 4 HOH 60  661 391 HOH HOH H . 
G 4 HOH 61  662 395 HOH HOH H . 
G 4 HOH 62  663 397 HOH HOH H . 
G 4 HOH 63  664 399 HOH HOH H . 
G 4 HOH 64  665 409 HOH HOH H . 
G 4 HOH 65  666 428 HOH HOH H . 
G 4 HOH 66  667 443 HOH HOH H . 
G 4 HOH 67  668 455 HOH HOH H . 
G 4 HOH 68  669 463 HOH HOH H . 
G 4 HOH 69  670 465 HOH HOH H . 
G 4 HOH 70  671 469 HOH HOH H . 
G 4 HOH 71  672 473 HOH HOH H . 
G 4 HOH 72  673 474 HOH HOH H . 
G 4 HOH 73  674 486 HOH HOH H . 
G 4 HOH 74  675 492 HOH HOH H . 
G 4 HOH 75  676 494 HOH HOH H . 
G 4 HOH 76  677 496 HOH HOH H . 
G 4 HOH 77  678 498 HOH HOH H . 
G 4 HOH 78  679 502 HOH HOH H . 
G 4 HOH 79  680 513 HOH HOH H . 
G 4 HOH 80  681 519 HOH HOH H . 
G 4 HOH 81  682 520 HOH HOH H . 
G 4 HOH 82  683 521 HOH HOH H . 
G 4 HOH 83  684 527 HOH HOH H . 
G 4 HOH 84  685 529 HOH HOH H . 
G 4 HOH 85  686 539 HOH HOH H . 
G 4 HOH 86  687 540 HOH HOH H . 
G 4 HOH 87  688 551 HOH HOH H . 
G 4 HOH 88  689 553 HOH HOH H . 
G 4 HOH 89  690 554 HOH HOH H . 
G 4 HOH 90  691 558 HOH HOH H . 
G 4 HOH 91  692 560 HOH HOH H . 
G 4 HOH 92  693 562 HOH HOH H . 
H 4 HOH 1   215 5   HOH HOH L . 
H 4 HOH 2   216 8   HOH HOH L . 
H 4 HOH 3   217 9   HOH HOH L . 
H 4 HOH 4   218 12  HOH HOH L . 
H 4 HOH 5   219 13  HOH HOH L . 
H 4 HOH 6   220 20  HOH HOH L . 
H 4 HOH 7   221 21  HOH HOH L . 
H 4 HOH 8   222 22  HOH HOH L . 
H 4 HOH 9   223 23  HOH HOH L . 
H 4 HOH 10  224 24  HOH HOH L . 
H 4 HOH 11  225 27  HOH HOH L . 
H 4 HOH 12  226 28  HOH HOH L . 
H 4 HOH 13  227 30  HOH HOH L . 
H 4 HOH 14  228 32  HOH HOH L . 
H 4 HOH 15  229 35  HOH HOH L . 
H 4 HOH 16  230 36  HOH HOH L . 
H 4 HOH 17  231 37  HOH HOH L . 
H 4 HOH 18  232 38  HOH HOH L . 
H 4 HOH 19  233 39  HOH HOH L . 
H 4 HOH 20  234 41  HOH HOH L . 
H 4 HOH 21  235 44  HOH HOH L . 
H 4 HOH 22  236 49  HOH HOH L . 
H 4 HOH 23  237 50  HOH HOH L . 
H 4 HOH 24  238 53  HOH HOH L . 
H 4 HOH 25  239 55  HOH HOH L . 
H 4 HOH 26  240 61  HOH HOH L . 
H 4 HOH 27  241 66  HOH HOH L . 
H 4 HOH 28  242 72  HOH HOH L . 
H 4 HOH 29  243 73  HOH HOH L . 
H 4 HOH 30  244 74  HOH HOH L . 
H 4 HOH 31  245 77  HOH HOH L . 
H 4 HOH 32  246 79  HOH HOH L . 
H 4 HOH 33  247 82  HOH HOH L . 
H 4 HOH 34  248 85  HOH HOH L . 
H 4 HOH 35  249 87  HOH HOH L . 
H 4 HOH 36  250 88  HOH HOH L . 
H 4 HOH 37  251 89  HOH HOH L . 
H 4 HOH 38  252 96  HOH HOH L . 
H 4 HOH 39  253 99  HOH HOH L . 
H 4 HOH 40  254 100 HOH HOH L . 
H 4 HOH 41  255 107 HOH HOH L . 
H 4 HOH 42  256 111 HOH HOH L . 
H 4 HOH 43  257 113 HOH HOH L . 
H 4 HOH 44  258 114 HOH HOH L . 
H 4 HOH 45  259 117 HOH HOH L . 
H 4 HOH 46  260 118 HOH HOH L . 
H 4 HOH 47  261 125 HOH HOH L . 
H 4 HOH 48  262 126 HOH HOH L . 
H 4 HOH 49  263 127 HOH HOH L . 
H 4 HOH 50  264 128 HOH HOH L . 
H 4 HOH 51  265 130 HOH HOH L . 
H 4 HOH 52  266 134 HOH HOH L . 
H 4 HOH 53  267 135 HOH HOH L . 
H 4 HOH 54  268 137 HOH HOH L . 
H 4 HOH 55  269 138 HOH HOH L . 
H 4 HOH 56  270 140 HOH HOH L . 
H 4 HOH 57  271 144 HOH HOH L . 
H 4 HOH 58  272 145 HOH HOH L . 
H 4 HOH 59  273 161 HOH HOH L . 
H 4 HOH 60  274 163 HOH HOH L . 
H 4 HOH 61  275 165 HOH HOH L . 
H 4 HOH 62  276 167 HOH HOH L . 
H 4 HOH 63  277 174 HOH HOH L . 
H 4 HOH 64  278 176 HOH HOH L . 
H 4 HOH 65  279 178 HOH HOH L . 
H 4 HOH 66  280 179 HOH HOH L . 
H 4 HOH 67  281 186 HOH HOH L . 
H 4 HOH 68  282 192 HOH HOH L . 
H 4 HOH 69  283 193 HOH HOH L . 
H 4 HOH 70  284 195 HOH HOH L . 
H 4 HOH 71  285 197 HOH HOH L . 
H 4 HOH 72  286 221 HOH HOH L . 
H 4 HOH 73  287 225 HOH HOH L . 
H 4 HOH 74  288 227 HOH HOH L . 
H 4 HOH 75  289 230 HOH HOH L . 
H 4 HOH 76  290 234 HOH HOH L . 
H 4 HOH 77  291 235 HOH HOH L . 
H 4 HOH 78  292 243 HOH HOH L . 
H 4 HOH 79  293 256 HOH HOH L . 
H 4 HOH 80  294 257 HOH HOH L . 
H 4 HOH 81  295 258 HOH HOH L . 
H 4 HOH 82  296 259 HOH HOH L . 
H 4 HOH 83  297 260 HOH HOH L . 
H 4 HOH 84  298 263 HOH HOH L . 
H 4 HOH 85  299 264 HOH HOH L . 
H 4 HOH 86  300 265 HOH HOH L . 
H 4 HOH 87  301 269 HOH HOH L . 
H 4 HOH 88  302 272 HOH HOH L . 
H 4 HOH 89  303 276 HOH HOH L . 
H 4 HOH 90  304 279 HOH HOH L . 
H 4 HOH 91  305 288 HOH HOH L . 
H 4 HOH 92  306 293 HOH HOH L . 
H 4 HOH 93  307 297 HOH HOH L . 
H 4 HOH 94  308 298 HOH HOH L . 
H 4 HOH 95  309 303 HOH HOH L . 
H 4 HOH 96  310 305 HOH HOH L . 
H 4 HOH 97  311 307 HOH HOH L . 
H 4 HOH 98  312 308 HOH HOH L . 
H 4 HOH 99  313 317 HOH HOH L . 
H 4 HOH 100 314 328 HOH HOH L . 
H 4 HOH 101 315 332 HOH HOH L . 
H 4 HOH 102 316 336 HOH HOH L . 
H 4 HOH 103 317 338 HOH HOH L . 
H 4 HOH 104 318 340 HOH HOH L . 
H 4 HOH 105 319 347 HOH HOH L . 
H 4 HOH 106 320 348 HOH HOH L . 
H 4 HOH 107 321 353 HOH HOH L . 
H 4 HOH 108 322 354 HOH HOH L . 
H 4 HOH 109 323 358 HOH HOH L . 
H 4 HOH 110 324 361 HOH HOH L . 
H 4 HOH 111 325 364 HOH HOH L . 
H 4 HOH 112 326 370 HOH HOH L . 
H 4 HOH 113 327 378 HOH HOH L . 
H 4 HOH 114 328 383 HOH HOH L . 
H 4 HOH 115 329 406 HOH HOH L . 
H 4 HOH 116 330 407 HOH HOH L . 
H 4 HOH 117 331 410 HOH HOH L . 
H 4 HOH 118 332 412 HOH HOH L . 
H 4 HOH 119 333 416 HOH HOH L . 
H 4 HOH 120 334 418 HOH HOH L . 
H 4 HOH 121 335 423 HOH HOH L . 
H 4 HOH 122 336 424 HOH HOH L . 
H 4 HOH 123 337 426 HOH HOH L . 
H 4 HOH 124 338 432 HOH HOH L . 
H 4 HOH 125 339 435 HOH HOH L . 
H 4 HOH 126 340 436 HOH HOH L . 
H 4 HOH 127 341 438 HOH HOH L . 
H 4 HOH 128 342 439 HOH HOH L . 
H 4 HOH 129 343 440 HOH HOH L . 
H 4 HOH 130 344 447 HOH HOH L . 
H 4 HOH 131 345 449 HOH HOH L . 
H 4 HOH 132 346 450 HOH HOH L . 
H 4 HOH 133 347 456 HOH HOH L . 
H 4 HOH 134 348 458 HOH HOH L . 
H 4 HOH 135 349 461 HOH HOH L . 
H 4 HOH 136 350 467 HOH HOH L . 
H 4 HOH 137 351 477 HOH HOH L . 
H 4 HOH 138 352 478 HOH HOH L . 
H 4 HOH 139 353 482 HOH HOH L . 
H 4 HOH 140 354 483 HOH HOH L . 
H 4 HOH 141 355 485 HOH HOH L . 
H 4 HOH 142 356 488 HOH HOH L . 
H 4 HOH 143 357 489 HOH HOH L . 
H 4 HOH 144 358 490 HOH HOH L . 
H 4 HOH 145 359 500 HOH HOH L . 
H 4 HOH 146 360 501 HOH HOH L . 
H 4 HOH 147 361 505 HOH HOH L . 
H 4 HOH 148 362 509 HOH HOH L . 
H 4 HOH 149 363 510 HOH HOH L . 
H 4 HOH 150 364 511 HOH HOH L . 
H 4 HOH 151 365 512 HOH HOH L . 
H 4 HOH 152 366 514 HOH HOH L . 
H 4 HOH 153 367 524 HOH HOH L . 
H 4 HOH 154 368 530 HOH HOH L . 
H 4 HOH 155 369 536 HOH HOH L . 
H 4 HOH 156 370 537 HOH HOH L . 
H 4 HOH 157 371 542 HOH HOH L . 
H 4 HOH 158 372 543 HOH HOH L . 
H 4 HOH 159 373 545 HOH HOH L . 
H 4 HOH 160 374 548 HOH HOH L . 
H 4 HOH 161 375 561 HOH HOH L . 
H 4 HOH 162 376 564 HOH HOH L . 
H 4 HOH 163 377 565 HOH HOH L . 
I 4 HOH 1   215 1   HOH HOH A . 
I 4 HOH 2   216 2   HOH HOH A . 
I 4 HOH 3   217 4   HOH HOH A . 
I 4 HOH 4   218 10  HOH HOH A . 
I 4 HOH 5   219 15  HOH HOH A . 
I 4 HOH 6   220 18  HOH HOH A . 
I 4 HOH 7   221 29  HOH HOH A . 
I 4 HOH 8   222 33  HOH HOH A . 
I 4 HOH 9   223 42  HOH HOH A . 
I 4 HOH 10  224 45  HOH HOH A . 
I 4 HOH 11  225 46  HOH HOH A . 
I 4 HOH 12  226 51  HOH HOH A . 
I 4 HOH 13  227 52  HOH HOH A . 
I 4 HOH 14  228 58  HOH HOH A . 
I 4 HOH 15  229 59  HOH HOH A . 
I 4 HOH 16  230 60  HOH HOH A . 
I 4 HOH 17  231 62  HOH HOH A . 
I 4 HOH 18  232 65  HOH HOH A . 
I 4 HOH 19  233 68  HOH HOH A . 
I 4 HOH 20  234 76  HOH HOH A . 
I 4 HOH 21  235 78  HOH HOH A . 
I 4 HOH 22  236 81  HOH HOH A . 
I 4 HOH 23  237 91  HOH HOH A . 
I 4 HOH 24  238 101 HOH HOH A . 
I 4 HOH 25  239 103 HOH HOH A . 
I 4 HOH 26  240 109 HOH HOH A . 
I 4 HOH 27  241 116 HOH HOH A . 
I 4 HOH 28  242 119 HOH HOH A . 
I 4 HOH 29  243 121 HOH HOH A . 
I 4 HOH 30  244 131 HOH HOH A . 
I 4 HOH 31  245 132 HOH HOH A . 
I 4 HOH 32  246 133 HOH HOH A . 
I 4 HOH 33  247 142 HOH HOH A . 
I 4 HOH 34  248 151 HOH HOH A . 
I 4 HOH 35  249 157 HOH HOH A . 
I 4 HOH 36  250 158 HOH HOH A . 
I 4 HOH 37  251 160 HOH HOH A . 
I 4 HOH 38  252 168 HOH HOH A . 
I 4 HOH 39  253 169 HOH HOH A . 
I 4 HOH 40  254 170 HOH HOH A . 
I 4 HOH 41  255 180 HOH HOH A . 
I 4 HOH 42  256 182 HOH HOH A . 
I 4 HOH 43  257 188 HOH HOH A . 
I 4 HOH 44  258 191 HOH HOH A . 
I 4 HOH 45  259 194 HOH HOH A . 
I 4 HOH 46  260 198 HOH HOH A . 
I 4 HOH 47  261 211 HOH HOH A . 
I 4 HOH 48  262 220 HOH HOH A . 
I 4 HOH 49  263 223 HOH HOH A . 
I 4 HOH 50  264 233 HOH HOH A . 
I 4 HOH 51  265 236 HOH HOH A . 
I 4 HOH 52  266 237 HOH HOH A . 
I 4 HOH 53  267 240 HOH HOH A . 
I 4 HOH 54  268 241 HOH HOH A . 
I 4 HOH 55  269 242 HOH HOH A . 
I 4 HOH 56  270 262 HOH HOH A . 
I 4 HOH 57  271 271 HOH HOH A . 
I 4 HOH 58  272 273 HOH HOH A . 
I 4 HOH 59  273 278 HOH HOH A . 
I 4 HOH 60  274 280 HOH HOH A . 
I 4 HOH 61  275 285 HOH HOH A . 
I 4 HOH 62  276 294 HOH HOH A . 
I 4 HOH 63  277 301 HOH HOH A . 
I 4 HOH 64  278 302 HOH HOH A . 
I 4 HOH 65  279 304 HOH HOH A . 
I 4 HOH 66  280 309 HOH HOH A . 
I 4 HOH 67  281 310 HOH HOH A . 
I 4 HOH 68  282 313 HOH HOH A . 
I 4 HOH 69  283 315 HOH HOH A . 
I 4 HOH 70  284 318 HOH HOH A . 
I 4 HOH 71  285 319 HOH HOH A . 
I 4 HOH 72  286 327 HOH HOH A . 
I 4 HOH 73  287 330 HOH HOH A . 
I 4 HOH 74  288 334 HOH HOH A . 
I 4 HOH 75  289 337 HOH HOH A . 
I 4 HOH 76  290 339 HOH HOH A . 
I 4 HOH 77  291 341 HOH HOH A . 
I 4 HOH 78  292 342 HOH HOH A . 
I 4 HOH 79  293 345 HOH HOH A . 
I 4 HOH 80  294 349 HOH HOH A . 
I 4 HOH 81  295 350 HOH HOH A . 
I 4 HOH 82  296 351 HOH HOH A . 
I 4 HOH 83  297 355 HOH HOH A . 
I 4 HOH 84  298 357 HOH HOH A . 
I 4 HOH 85  299 360 HOH HOH A . 
I 4 HOH 86  300 367 HOH HOH A . 
I 4 HOH 87  301 368 HOH HOH A . 
I 4 HOH 88  302 369 HOH HOH A . 
I 4 HOH 89  303 371 HOH HOH A . 
I 4 HOH 90  304 372 HOH HOH A . 
I 4 HOH 91  305 373 HOH HOH A . 
I 4 HOH 92  306 374 HOH HOH A . 
I 4 HOH 93  307 376 HOH HOH A . 
I 4 HOH 94  308 381 HOH HOH A . 
I 4 HOH 95  309 384 HOH HOH A . 
I 4 HOH 96  310 385 HOH HOH A . 
I 4 HOH 97  311 387 HOH HOH A . 
I 4 HOH 98  312 390 HOH HOH A . 
I 4 HOH 99  313 392 HOH HOH A . 
I 4 HOH 100 314 394 HOH HOH A . 
I 4 HOH 101 315 396 HOH HOH A . 
I 4 HOH 102 316 400 HOH HOH A . 
I 4 HOH 103 317 401 HOH HOH A . 
I 4 HOH 104 318 404 HOH HOH A . 
I 4 HOH 105 319 408 HOH HOH A . 
I 4 HOH 106 320 411 HOH HOH A . 
I 4 HOH 107 321 413 HOH HOH A . 
I 4 HOH 108 322 414 HOH HOH A . 
I 4 HOH 109 323 417 HOH HOH A . 
I 4 HOH 110 324 419 HOH HOH A . 
I 4 HOH 111 325 420 HOH HOH A . 
I 4 HOH 112 326 421 HOH HOH A . 
I 4 HOH 113 327 425 HOH HOH A . 
I 4 HOH 114 328 427 HOH HOH A . 
I 4 HOH 115 329 429 HOH HOH A . 
I 4 HOH 116 330 430 HOH HOH A . 
I 4 HOH 117 331 441 HOH HOH A . 
I 4 HOH 118 332 442 HOH HOH A . 
I 4 HOH 119 333 446 HOH HOH A . 
I 4 HOH 120 334 452 HOH HOH A . 
I 4 HOH 121 335 457 HOH HOH A . 
I 4 HOH 122 336 459 HOH HOH A . 
I 4 HOH 123 337 464 HOH HOH A . 
I 4 HOH 124 338 468 HOH HOH A . 
I 4 HOH 125 339 471 HOH HOH A . 
I 4 HOH 126 340 472 HOH HOH A . 
I 4 HOH 127 341 475 HOH HOH A . 
I 4 HOH 128 342 476 HOH HOH A . 
I 4 HOH 129 343 484 HOH HOH A . 
I 4 HOH 130 344 487 HOH HOH A . 
I 4 HOH 131 345 495 HOH HOH A . 
I 4 HOH 132 346 497 HOH HOH A . 
I 4 HOH 133 347 503 HOH HOH A . 
I 4 HOH 134 348 508 HOH HOH A . 
I 4 HOH 135 349 517 HOH HOH A . 
I 4 HOH 136 350 518 HOH HOH A . 
I 4 HOH 137 351 526 HOH HOH A . 
I 4 HOH 138 352 528 HOH HOH A . 
I 4 HOH 139 353 533 HOH HOH A . 
I 4 HOH 140 354 534 HOH HOH A . 
I 4 HOH 141 355 544 HOH HOH A . 
I 4 HOH 142 356 546 HOH HOH A . 
I 4 HOH 143 357 549 HOH HOH A . 
I 4 HOH 144 358 552 HOH HOH A . 
I 4 HOH 145 359 556 HOH HOH A . 
J 4 HOH 1   702 11  HOH HOH B . 
J 4 HOH 2   703 14  HOH HOH B . 
J 4 HOH 3   704 16  HOH HOH B . 
J 4 HOH 4   705 17  HOH HOH B . 
J 4 HOH 5   706 19  HOH HOH B . 
J 4 HOH 6   707 25  HOH HOH B . 
J 4 HOH 7   708 31  HOH HOH B . 
J 4 HOH 8   709 40  HOH HOH B . 
J 4 HOH 9   710 43  HOH HOH B . 
J 4 HOH 10  711 47  HOH HOH B . 
J 4 HOH 11  712 48  HOH HOH B . 
J 4 HOH 12  713 56  HOH HOH B . 
J 4 HOH 13  714 57  HOH HOH B . 
J 4 HOH 14  715 63  HOH HOH B . 
J 4 HOH 15  716 67  HOH HOH B . 
J 4 HOH 16  717 69  HOH HOH B . 
J 4 HOH 17  718 70  HOH HOH B . 
J 4 HOH 18  719 75  HOH HOH B . 
J 4 HOH 19  720 83  HOH HOH B . 
J 4 HOH 20  721 92  HOH HOH B . 
J 4 HOH 21  722 94  HOH HOH B . 
J 4 HOH 22  723 98  HOH HOH B . 
J 4 HOH 23  724 102 HOH HOH B . 
J 4 HOH 24  725 104 HOH HOH B . 
J 4 HOH 25  726 106 HOH HOH B . 
J 4 HOH 26  727 108 HOH HOH B . 
J 4 HOH 27  728 112 HOH HOH B . 
J 4 HOH 28  729 129 HOH HOH B . 
J 4 HOH 29  730 136 HOH HOH B . 
J 4 HOH 30  731 139 HOH HOH B . 
J 4 HOH 31  732 141 HOH HOH B . 
J 4 HOH 32  733 143 HOH HOH B . 
J 4 HOH 33  734 147 HOH HOH B . 
J 4 HOH 34  735 148 HOH HOH B . 
J 4 HOH 35  736 149 HOH HOH B . 
J 4 HOH 36  737 150 HOH HOH B . 
J 4 HOH 37  738 152 HOH HOH B . 
J 4 HOH 38  739 153 HOH HOH B . 
J 4 HOH 39  740 154 HOH HOH B . 
J 4 HOH 40  741 156 HOH HOH B . 
J 4 HOH 41  742 159 HOH HOH B . 
J 4 HOH 42  743 164 HOH HOH B . 
J 4 HOH 43  744 173 HOH HOH B . 
J 4 HOH 44  745 177 HOH HOH B . 
J 4 HOH 45  746 181 HOH HOH B . 
J 4 HOH 46  747 184 HOH HOH B . 
J 4 HOH 47  748 185 HOH HOH B . 
J 4 HOH 48  749 187 HOH HOH B . 
J 4 HOH 49  750 196 HOH HOH B . 
J 4 HOH 50  751 199 HOH HOH B . 
J 4 HOH 51  752 200 HOH HOH B . 
J 4 HOH 52  753 201 HOH HOH B . 
J 4 HOH 53  754 202 HOH HOH B . 
J 4 HOH 54  755 203 HOH HOH B . 
J 4 HOH 55  756 204 HOH HOH B . 
J 4 HOH 56  757 207 HOH HOH B . 
J 4 HOH 57  758 208 HOH HOH B . 
J 4 HOH 58  759 210 HOH HOH B . 
J 4 HOH 59  760 212 HOH HOH B . 
J 4 HOH 60  761 215 HOH HOH B . 
J 4 HOH 61  762 216 HOH HOH B . 
J 4 HOH 62  763 218 HOH HOH B . 
J 4 HOH 63  764 219 HOH HOH B . 
J 4 HOH 64  765 226 HOH HOH B . 
J 4 HOH 65  766 228 HOH HOH B . 
J 4 HOH 66  767 229 HOH HOH B . 
J 4 HOH 67  768 231 HOH HOH B . 
J 4 HOH 68  769 232 HOH HOH B . 
J 4 HOH 69  770 238 HOH HOH B . 
J 4 HOH 70  771 244 HOH HOH B . 
J 4 HOH 71  772 245 HOH HOH B . 
J 4 HOH 72  773 246 HOH HOH B . 
J 4 HOH 73  774 249 HOH HOH B . 
J 4 HOH 74  775 253 HOH HOH B . 
J 4 HOH 75  776 254 HOH HOH B . 
J 4 HOH 76  777 255 HOH HOH B . 
J 4 HOH 77  778 266 HOH HOH B . 
J 4 HOH 78  779 268 HOH HOH B . 
J 4 HOH 79  780 274 HOH HOH B . 
J 4 HOH 80  781 277 HOH HOH B . 
J 4 HOH 81  782 281 HOH HOH B . 
J 4 HOH 82  783 283 HOH HOH B . 
J 4 HOH 83  784 286 HOH HOH B . 
J 4 HOH 84  785 290 HOH HOH B . 
J 4 HOH 85  786 295 HOH HOH B . 
J 4 HOH 86  787 296 HOH HOH B . 
J 4 HOH 87  788 299 HOH HOH B . 
J 4 HOH 88  789 306 HOH HOH B . 
J 4 HOH 89  790 311 HOH HOH B . 
J 4 HOH 90  791 314 HOH HOH B . 
J 4 HOH 91  792 316 HOH HOH B . 
J 4 HOH 92  793 320 HOH HOH B . 
J 4 HOH 93  794 321 HOH HOH B . 
J 4 HOH 94  795 323 HOH HOH B . 
J 4 HOH 95  796 324 HOH HOH B . 
J 4 HOH 96  797 331 HOH HOH B . 
J 4 HOH 97  798 333 HOH HOH B . 
J 4 HOH 98  799 335 HOH HOH B . 
J 4 HOH 99  800 343 HOH HOH B . 
J 4 HOH 100 801 344 HOH HOH B . 
J 4 HOH 101 802 346 HOH HOH B . 
J 4 HOH 102 803 356 HOH HOH B . 
J 4 HOH 103 804 362 HOH HOH B . 
J 4 HOH 104 805 363 HOH HOH B . 
J 4 HOH 105 806 365 HOH HOH B . 
J 4 HOH 106 807 366 HOH HOH B . 
J 4 HOH 107 808 375 HOH HOH B . 
J 4 HOH 108 809 377 HOH HOH B . 
J 4 HOH 109 810 379 HOH HOH B . 
J 4 HOH 110 811 382 HOH HOH B . 
J 4 HOH 111 812 388 HOH HOH B . 
J 4 HOH 112 813 393 HOH HOH B . 
J 4 HOH 113 814 398 HOH HOH B . 
J 4 HOH 114 815 402 HOH HOH B . 
J 4 HOH 115 816 403 HOH HOH B . 
J 4 HOH 116 817 405 HOH HOH B . 
J 4 HOH 117 818 415 HOH HOH B . 
J 4 HOH 118 819 422 HOH HOH B . 
J 4 HOH 119 820 431 HOH HOH B . 
J 4 HOH 120 821 433 HOH HOH B . 
J 4 HOH 121 822 434 HOH HOH B . 
J 4 HOH 122 823 437 HOH HOH B . 
J 4 HOH 123 824 444 HOH HOH B . 
J 4 HOH 124 825 445 HOH HOH B . 
J 4 HOH 125 826 448 HOH HOH B . 
J 4 HOH 126 827 451 HOH HOH B . 
J 4 HOH 127 828 453 HOH HOH B . 
J 4 HOH 128 829 454 HOH HOH B . 
J 4 HOH 129 830 460 HOH HOH B . 
J 4 HOH 130 831 462 HOH HOH B . 
J 4 HOH 131 832 466 HOH HOH B . 
J 4 HOH 132 833 470 HOH HOH B . 
J 4 HOH 133 834 479 HOH HOH B . 
J 4 HOH 134 835 480 HOH HOH B . 
J 4 HOH 135 836 481 HOH HOH B . 
J 4 HOH 136 837 491 HOH HOH B . 
J 4 HOH 137 838 493 HOH HOH B . 
J 4 HOH 138 839 499 HOH HOH B . 
J 4 HOH 139 840 504 HOH HOH B . 
J 4 HOH 140 841 506 HOH HOH B . 
J 4 HOH 141 842 507 HOH HOH B . 
J 4 HOH 142 843 515 HOH HOH B . 
J 4 HOH 143 844 516 HOH HOH B . 
J 4 HOH 144 845 522 HOH HOH B . 
J 4 HOH 145 846 523 HOH HOH B . 
J 4 HOH 146 847 525 HOH HOH B . 
J 4 HOH 147 848 531 HOH HOH B . 
J 4 HOH 148 849 532 HOH HOH B . 
J 4 HOH 149 850 535 HOH HOH B . 
J 4 HOH 150 851 538 HOH HOH B . 
J 4 HOH 151 852 541 HOH HOH B . 
J 4 HOH 152 853 547 HOH HOH B . 
J 4 HOH 153 854 550 HOH HOH B . 
J 4 HOH 154 855 555 HOH HOH B . 
J 4 HOH 155 856 557 HOH HOH B . 
J 4 HOH 156 857 559 HOH HOH B . 
J 4 HOH 157 858 563 HOH HOH B . 
#