data_1UB6
# 
_entry.id   1UB6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UB6         
RCSB  RCSB005641   
WWPDB D_1000005641 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1UB5 
_pdbx_database_related.details        'Antibody 19G2 with hapten' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        1UB6 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-30 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Beuscher, A.B.' 1 
'Wirsching, P.'  2 
'Lerner, R.A.'   3 
'Janda, K.'      4 
'Stevens, R.C.'  5 
# 
_citation.id                        primary 
_citation.title                     
'Structure and Dynamics of Blue Fluorescent Antibody 19G2 at Blue and Violet Fluorescent Temperatures' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Beuscher, A.B.' 1 
primary 'Wirsching, P.'  2 
primary 'Lerner, R.A.'   3 
primary 'Janda, K.'      4 
primary 'Stevens, R.C.'  5 
# 
_cell.entry_id           1UB6 
_cell.length_a           194.429 
_cell.length_b           60.536 
_cell.length_c           92.297 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.30 
_cell.angle_gamma        90.00 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
# 
_symmetry.entry_id                         1UB6 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'antibody 19G2, alpha chain' 21943.752 2   ? ? ? ? 
2 polymer man 'antibody 19G2, beta chain'  23209.752 2   ? ? ? ? 
3 water   nat water                        18.015    438 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;AALLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPDSVAGRFTISRDNVRNILYLQ
MSSLRSEDTALYYCARGQGRPYWGQGTLVTVSAAKTTPPSVYPAAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGGSS
VHTFPALLQSGLYTMSSSVTVPSSTWPSTVTCSVAHPASGTTVDKKLE
;
;AALLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPDSVAGRFTISRDNVRNILYLQ
MSSLRSEDTALYYCARGQGRPYWGQGTLVTVSAAKTTPPSVYPAAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGGSS
VHTFPALLQSGLYTMSSSVTVPSSTWPSTVTCSVAHPASGTTVDKKLE
;
H,A ? 
2 'polypeptide(L)' no no 
;AALTQSPVSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPNRFSSSGSGTDFTLRIN
TVEAEDVGVYYCAQNLELPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ
NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF
;
;AALTQSPVSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPNRFSSSGSGTDFTLRIN
TVEAEDVGVYYCAQNLELPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ
NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF
;
L,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   LEU n 
1 4   LEU n 
1 5   GLU n 
1 6   SER n 
1 7   GLY n 
1 8   GLY n 
1 9   GLY n 
1 10  LEU n 
1 11  VAL n 
1 12  LYS n 
1 13  PRO n 
1 14  GLY n 
1 15  GLY n 
1 16  SER n 
1 17  LEU n 
1 18  LYS n 
1 19  LEU n 
1 20  SER n 
1 21  CYS n 
1 22  THR n 
1 23  ALA n 
1 24  SER n 
1 25  GLY n 
1 26  ILE n 
1 27  THR n 
1 28  PHE n 
1 29  SER n 
1 30  ARG n 
1 31  TYR n 
1 32  ILE n 
1 33  MET n 
1 34  SER n 
1 35  TRP n 
1 36  VAL n 
1 37  ARG n 
1 38  GLN n 
1 39  ILE n 
1 40  PRO n 
1 41  GLU n 
1 42  LYS n 
1 43  ARG n 
1 44  LEU n 
1 45  GLU n 
1 46  TRP n 
1 47  VAL n 
1 48  ALA n 
1 49  SER n 
1 50  ILE n 
1 51  SER n 
1 52  SER n 
1 53  GLY n 
1 54  GLY n 
1 55  ILE n 
1 56  THR n 
1 57  TYR n 
1 58  TYR n 
1 59  PRO n 
1 60  ASP n 
1 61  SER n 
1 62  VAL n 
1 63  ALA n 
1 64  GLY n 
1 65  ARG n 
1 66  PHE n 
1 67  THR n 
1 68  ILE n 
1 69  SER n 
1 70  ARG n 
1 71  ASP n 
1 72  ASN n 
1 73  VAL n 
1 74  ARG n 
1 75  ASN n 
1 76  ILE n 
1 77  LEU n 
1 78  TYR n 
1 79  LEU n 
1 80  GLN n 
1 81  MET n 
1 82  SER n 
1 83  SER n 
1 84  LEU n 
1 85  ARG n 
1 86  SER n 
1 87  GLU n 
1 88  ASP n 
1 89  THR n 
1 90  ALA n 
1 91  LEU n 
1 92  TYR n 
1 93  TYR n 
1 94  CYS n 
1 95  ALA n 
1 96  ARG n 
1 97  GLY n 
1 98  GLN n 
1 99  GLY n 
1 100 ARG n 
1 101 PRO n 
1 102 TYR n 
1 103 TRP n 
1 104 GLY n 
1 105 GLN n 
1 106 GLY n 
1 107 THR n 
1 108 LEU n 
1 109 VAL n 
1 110 THR n 
1 111 VAL n 
1 112 SER n 
1 113 ALA n 
1 114 ALA n 
1 115 LYS n 
1 116 THR n 
1 117 THR n 
1 118 PRO n 
1 119 PRO n 
1 120 SER n 
1 121 VAL n 
1 122 TYR n 
1 123 PRO n 
1 124 ALA n 
1 125 ALA n 
1 126 PRO n 
1 127 GLY n 
1 128 CYS n 
1 129 GLY n 
1 130 ASP n 
1 131 THR n 
1 132 THR n 
1 133 GLY n 
1 134 SER n 
1 135 SER n 
1 136 VAL n 
1 137 THR n 
1 138 LEU n 
1 139 GLY n 
1 140 CYS n 
1 141 LEU n 
1 142 VAL n 
1 143 LYS n 
1 144 GLY n 
1 145 TYR n 
1 146 PHE n 
1 147 PRO n 
1 148 GLU n 
1 149 SER n 
1 150 VAL n 
1 151 THR n 
1 152 VAL n 
1 153 THR n 
1 154 TRP n 
1 155 ASN n 
1 156 SER n 
1 157 GLY n 
1 158 GLY n 
1 159 SER n 
1 160 SER n 
1 161 VAL n 
1 162 HIS n 
1 163 THR n 
1 164 PHE n 
1 165 PRO n 
1 166 ALA n 
1 167 LEU n 
1 168 LEU n 
1 169 GLN n 
1 170 SER n 
1 171 GLY n 
1 172 LEU n 
1 173 TYR n 
1 174 THR n 
1 175 MET n 
1 176 SER n 
1 177 SER n 
1 178 SER n 
1 179 VAL n 
1 180 THR n 
1 181 VAL n 
1 182 PRO n 
1 183 SER n 
1 184 SER n 
1 185 THR n 
1 186 TRP n 
1 187 PRO n 
1 188 SER n 
1 189 THR n 
1 190 VAL n 
1 191 THR n 
1 192 CYS n 
1 193 SER n 
1 194 VAL n 
1 195 ALA n 
1 196 HIS n 
1 197 PRO n 
1 198 ALA n 
1 199 SER n 
1 200 GLY n 
1 201 THR n 
1 202 THR n 
1 203 VAL n 
1 204 ASP n 
1 205 LYS n 
1 206 LYS n 
1 207 LEU n 
1 208 GLU n 
2 1   ALA n 
2 2   ALA n 
2 3   LEU n 
2 4   THR n 
2 5   GLN n 
2 6   SER n 
2 7   PRO n 
2 8   VAL n 
2 9   SER n 
2 10  ASN n 
2 11  PRO n 
2 12  VAL n 
2 13  THR n 
2 14  LEU n 
2 15  GLY n 
2 16  THR n 
2 17  SER n 
2 18  ALA n 
2 19  SER n 
2 20  ILE n 
2 21  SER n 
2 22  CYS n 
2 23  ARG n 
2 24  SER n 
2 25  THR n 
2 26  LYS n 
2 27  SER n 
2 28  LEU n 
2 29  LEU n 
2 30  HIS n 
2 31  SER n 
2 32  ASN n 
2 33  GLY n 
2 34  ILE n 
2 35  THR n 
2 36  TYR n 
2 37  LEU n 
2 38  TYR n 
2 39  TRP n 
2 40  TYR n 
2 41  LEU n 
2 42  GLN n 
2 43  LYS n 
2 44  PRO n 
2 45  GLY n 
2 46  GLN n 
2 47  SER n 
2 48  PRO n 
2 49  GLN n 
2 50  LEU n 
2 51  LEU n 
2 52  ILE n 
2 53  TYR n 
2 54  GLN n 
2 55  MET n 
2 56  SER n 
2 57  ASN n 
2 58  LEU n 
2 59  ALA n 
2 60  SER n 
2 61  GLY n 
2 62  VAL n 
2 63  PRO n 
2 64  ASN n 
2 65  ARG n 
2 66  PHE n 
2 67  SER n 
2 68  SER n 
2 69  SER n 
2 70  GLY n 
2 71  SER n 
2 72  GLY n 
2 73  THR n 
2 74  ASP n 
2 75  PHE n 
2 76  THR n 
2 77  LEU n 
2 78  ARG n 
2 79  ILE n 
2 80  ASN n 
2 81  THR n 
2 82  VAL n 
2 83  GLU n 
2 84  ALA n 
2 85  GLU n 
2 86  ASP n 
2 87  VAL n 
2 88  GLY n 
2 89  VAL n 
2 90  TYR n 
2 91  TYR n 
2 92  CYS n 
2 93  ALA n 
2 94  GLN n 
2 95  ASN n 
2 96  LEU n 
2 97  GLU n 
2 98  LEU n 
2 99  PRO n 
2 100 PRO n 
2 101 THR n 
2 102 PHE n 
2 103 GLY n 
2 104 ALA n 
2 105 GLY n 
2 106 THR n 
2 107 LYS n 
2 108 LEU n 
2 109 GLU n 
2 110 LEU n 
2 111 LYS n 
2 112 ARG n 
2 113 ALA n 
2 114 ASP n 
2 115 ALA n 
2 116 ALA n 
2 117 PRO n 
2 118 THR n 
2 119 VAL n 
2 120 SER n 
2 121 ILE n 
2 122 PHE n 
2 123 PRO n 
2 124 PRO n 
2 125 SER n 
2 126 SER n 
2 127 GLU n 
2 128 GLN n 
2 129 LEU n 
2 130 THR n 
2 131 SER n 
2 132 GLY n 
2 133 GLY n 
2 134 ALA n 
2 135 SER n 
2 136 VAL n 
2 137 VAL n 
2 138 CYS n 
2 139 PHE n 
2 140 LEU n 
2 141 ASN n 
2 142 ASN n 
2 143 PHE n 
2 144 TYR n 
2 145 PRO n 
2 146 LYS n 
2 147 ASP n 
2 148 ILE n 
2 149 ASN n 
2 150 VAL n 
2 151 LYS n 
2 152 TRP n 
2 153 LYS n 
2 154 ILE n 
2 155 ASP n 
2 156 GLY n 
2 157 SER n 
2 158 GLU n 
2 159 ARG n 
2 160 GLN n 
2 161 ASN n 
2 162 GLY n 
2 163 VAL n 
2 164 LEU n 
2 165 ASN n 
2 166 SER n 
2 167 TRP n 
2 168 THR n 
2 169 ASP n 
2 170 GLN n 
2 171 ASP n 
2 172 SER n 
2 173 LYS n 
2 174 ASP n 
2 175 SER n 
2 176 THR n 
2 177 TYR n 
2 178 SER n 
2 179 MET n 
2 180 SER n 
2 181 SER n 
2 182 THR n 
2 183 LEU n 
2 184 THR n 
2 185 LEU n 
2 186 THR n 
2 187 LYS n 
2 188 ASP n 
2 189 GLU n 
2 190 TYR n 
2 191 GLU n 
2 192 ARG n 
2 193 HIS n 
2 194 ASN n 
2 195 GLY n 
2 196 TYR n 
2 197 THR n 
2 198 CYS n 
2 199 GLU n 
2 200 ALA n 
2 201 THR n 
2 202 HIS n 
2 203 LYS n 
2 204 THR n 
2 205 SER n 
2 206 THR n 
2 207 SER n 
2 208 PRO n 
2 209 ILE n 
2 210 VAL n 
2 211 LYS n 
2 212 SER n 
2 213 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? 
? ? ? ? ? ? 'hybridoma cell' ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? 
? ? ? ? ? ? 'hybridoma cell' ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP HV56_MOUSE P18527 1 4 ? ? 
2 PDB 1UB6       1UB6   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UB6 H 3 ? 96  ? P18527 4 ? 97  ? 4 99  
2 1 1UB6 A 3 ? 96  ? P18527 4 ? 97  ? 4 99  
3 2 1UB6 L 1 ? 213 ? 1UB6   2 ? 214 ? 2 214 
4 2 1UB6 B 1 ? 213 ? 1UB6   2 ? 214 ? 2 214 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1UB6 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.21 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    'PEG4000, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
# 
_reflns.entry_id                     1UB6 
_reflns.d_resolution_high            2.12 
_reflns.d_resolution_low             19.43 
_reflns.limit_h_max                  81 
_reflns.limit_h_min                  -91 
_reflns.limit_k_max                  28 
_reflns.limit_k_min                  -91 
_reflns.limit_l_max                  43 
_reflns.limit_l_min                  0 
_reflns.number_all                   50364 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_F_max     613443.39 
_reflns.observed_criterion_F_min     0.320000 
_reflns.B_iso_Wilson_estimate        23.8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_obs                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1UB6 
_refine.ls_number_reflns_all                     54279 
_refine.ls_number_reflns_obs                     48301 
_refine.ls_percent_reflns_obs                    89.0 
_refine.ls_d_res_high                            2.12 
_refine.ls_d_res_low                             19.43 
_refine.B_iso_min                                1.85 
_refine.B_iso_max                                99.96 
_refine.B_iso_mean                               47.56 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            -3.91 
_refine.aniso_B[2][2]                            0.74 
_refine.aniso_B[3][3]                            3.16 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.21 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_param_bsol                 64.5179 
_refine.solvent_model_param_ksol                 0.361169 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.264 
_refine.ls_R_factor_R_free                       0.292 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_number_reflns_R_free                  2350 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.details                                  ? 
_refine.pdbx_ls_sigma_F                          -3.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1UB6 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     2.12 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6346 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             438 
_refine_hist.number_atoms_total               6784 
_refine_hist.d_res_high                       2.12 
_refine_hist.d_res_low                        19.43 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.6  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.81  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
2.12 2.22  6750 4858 4709 72.0 0.32  0.32  0.026 149 2.2 8 . 'X-RAY DIFFRACTION' . 
2.22 2.33  6735 5780 5498 85.8 0.303 0.3   0.018 282 4.2 8 . 'X-RAY DIFFRACTION' . 
2.33 2.48  6745 5980 5707 88.7 0.297 0.295 0.018 273 4.0 8 . 'X-RAY DIFFRACTION' . 
2.48 2.67  6767 6213 5873 91.8 0.302 0.3   0.016 340 5.0 8 . 'X-RAY DIFFRACTION' . 
2.67 2.94  6768 6310 5994 93.2 0.284 0.284 0.016 316 4.7 8 . 'X-RAY DIFFRACTION' . 
2.94 3.36  6795 6419 6068 94.5 0.282 0.284 0.015 351 5.2 8 . 'X-RAY DIFFRACTION' . 
3.36 4.23  6818 6401 6051 93.9 0.25  0.253 0.014 350 5.1 8 . 'X-RAY DIFFRACTION' . 
4.23 19.43 6945 6340 6051 91.3 0.226 0.224 0.013 289 4.2 8 . 'X-RAY DIFFRACTION' . 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param  protein.top      'X-RAY DIFFRACTION' 
2 carbohydrate.param carbohydrate.top 'X-RAY DIFFRACTION' 
3 water_rep.param    water.top        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1UB6 
_struct.title                     'Crystal structure of Antibody 19G2 with sera ligand' 
_struct.pdbx_descriptor           'Antibody 19G2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UB6 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'antibody fluorscence dynamics, sera ligand, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 27  ? TYR A 31  ? THR H 28  TYR H 34  5 ? 5 
HELX_P HELX_P2  2  ARG A 85  ? THR A 89  ? ARG H 88  THR H 92  5 ? 5 
HELX_P HELX_P3  3  PRO A 197 ? GLY A 200 ? PRO H 203 GLY H 206 5 ? 4 
HELX_P HELX_P4  4  GLU B 83  ? VAL B 87  ? GLU L 84  VAL L 88  5 ? 5 
HELX_P HELX_P5  5  SER B 125 ? SER B 131 ? SER L 126 SER L 132 1 ? 7 
HELX_P HELX_P6  6  LYS B 187 ? GLU B 191 ? LYS L 188 GLU L 192 1 ? 5 
HELX_P HELX_P7  7  THR C 27  ? TYR C 31  ? THR A 28  TYR A 34  5 ? 5 
HELX_P HELX_P8  8  ARG C 85  ? THR C 89  ? ARG A 88  THR A 92  5 ? 5 
HELX_P HELX_P9  9  PRO C 197 ? GLY C 200 ? PRO A 203 GLY A 206 5 ? 4 
HELX_P HELX_P10 10 GLU D 83  ? VAL D 87  ? GLU B 84  VAL B 88  5 ? 5 
HELX_P HELX_P11 11 SER D 125 ? SER D 131 ? SER B 126 SER B 132 1 ? 7 
HELX_P HELX_P12 12 LYS D 187 ? GLU D 191 ? LYS B 188 GLU B 192 1 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 21  SG ? ? ? 1_555 A CYS 94  SG ? ? H CYS 22  H CYS 97  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 140 SG ? ? ? 1_555 A CYS 192 SG ? ? H CYS 143 H CYS 198 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf3 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 92  SG ? ? L CYS 23  L CYS 93  1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf4 disulf ? ? B CYS 138 SG ? ? ? 1_555 B CYS 198 SG ? ? L CYS 139 L CYS 199 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf5 disulf ? ? C CYS 21  SG ? ? ? 1_555 C CYS 94  SG ? ? A CYS 22  A CYS 97  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf6 disulf ? ? C CYS 140 SG ? ? ? 1_555 C CYS 192 SG ? ? A CYS 143 A CYS 198 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf7 disulf ? ? D CYS 22  SG ? ? ? 1_555 D CYS 92  SG ? ? B CYS 23  B CYS 93  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf8 disulf ? ? D CYS 138 SG ? ? ? 1_555 D CYS 198 SG ? ? B CYS 139 B CYS 199 1_555 ? ? ? ? ? ? ? 2.029 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 98  B . ? LEU 99  L PRO 99  B ? PRO 100 L 1 -0.41 
2 TYR 144 B . ? TYR 145 L PRO 145 B ? PRO 146 L 1 0.01  
3 LEU 98  D . ? LEU 99  B PRO 99  D ? PRO 100 B 1 -0.33 
4 TYR 144 D . ? TYR 145 B PRO 145 D ? PRO 146 B 1 -0.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 6 ? 
D ? 4 ? 
E ? 4 ? 
F ? 3 ? 
G ? 4 ? 
H ? 2 ? 
I ? 5 ? 
J ? 5 ? 
K ? 4 ? 
L ? 4 ? 
M ? 4 ? 
N ? 5 ? 
O ? 6 ? 
P ? 4 ? 
Q ? 4 ? 
R ? 3 ? 
S ? 4 ? 
T ? 2 ? 
U ? 5 ? 
V ? 5 ? 
W ? 4 ? 
X ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? parallel      
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
U 4 5 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
V 4 5 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
X 1 2 ? anti-parallel 
X 2 3 ? anti-parallel 
X 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 2   ? SER A 6   ? ALA H 3   SER H 7   
A 2 LEU A 17  ? SER A 24  ? LEU H 18  SER H 25  
A 3 ILE A 76  ? MET A 81  ? ILE H 79  MET H 84  
A 4 PHE A 66  ? ASP A 71  ? PHE H 69  ASP H 74  
B 1 THR A 56  ? TYR A 57  ? THR H 59  TYR H 60  
B 2 GLU A 45  ? ILE A 50  ? GLU H 48  ILE H 53  
B 3 MET A 33  ? GLN A 38  ? MET H 36  GLN H 41  
B 4 ALA A 90  ? ARG A 96  ? ALA H 93  ARG H 99  
B 5 TYR A 102 ? TRP A 103 ? TYR H 105 TRP H 106 
C 1 THR A 56  ? TYR A 57  ? THR H 59  TYR H 60  
C 2 GLU A 45  ? ILE A 50  ? GLU H 48  ILE H 53  
C 3 MET A 33  ? GLN A 38  ? MET H 36  GLN H 41  
C 4 ALA A 90  ? ARG A 96  ? ALA H 93  ARG H 99  
C 5 THR A 107 ? VAL A 111 ? THR H 110 VAL H 114 
C 6 GLY A 9   ? VAL A 11  ? GLY H 10  VAL H 12  
D 1 SER A 120 ? ALA A 124 ? SER H 123 ALA H 127 
D 2 VAL A 136 ? TYR A 145 ? VAL H 139 TYR H 148 
D 3 LEU A 172 ? VAL A 181 ? LEU H 177 VAL H 186 
D 4 HIS A 162 ? THR A 163 ? HIS H 167 THR H 168 
E 1 SER A 120 ? ALA A 124 ? SER H 123 ALA H 127 
E 2 VAL A 136 ? TYR A 145 ? VAL H 139 TYR H 148 
E 3 LEU A 172 ? VAL A 181 ? LEU H 177 VAL H 186 
E 4 LEU A 167 ? GLN A 169 ? LEU H 172 GLN H 174 
F 1 THR A 151 ? TRP A 154 ? THR H 154 TRP H 157 
F 2 VAL A 190 ? HIS A 196 ? VAL H 196 HIS H 202 
F 3 THR A 201 ? LEU A 207 ? THR H 207 LEU H 213 
G 1 LEU B 3   ? THR B 4   ? LEU L 4   THR L 5   
G 2 ALA B 18  ? SER B 24  ? ALA L 19  SER L 25  
G 3 ASP B 74  ? ILE B 79  ? ASP L 75  ILE L 80  
G 4 PHE B 66  ? GLY B 70  ? PHE L 67  GLY L 71  
H 1 VAL B 12  ? THR B 13  ? VAL L 13  THR L 14  
H 2 LEU B 110 ? LYS B 111 ? LEU L 111 LYS L 112 
I 1 ASN B 57  ? LEU B 58  ? ASN L 58  LEU L 59  
I 2 GLN B 49  ? TYR B 53  ? GLN L 50  TYR L 54  
I 3 LEU B 37  ? GLN B 42  ? LEU L 38  GLN L 43  
I 4 GLY B 88  ? GLN B 94  ? GLY L 89  GLN L 95  
I 5 THR B 101 ? PHE B 102 ? THR L 102 PHE L 103 
J 1 ASN B 57  ? LEU B 58  ? ASN L 58  LEU L 59  
J 2 GLN B 49  ? TYR B 53  ? GLN L 50  TYR L 54  
J 3 LEU B 37  ? GLN B 42  ? LEU L 38  GLN L 43  
J 4 GLY B 88  ? GLN B 94  ? GLY L 89  GLN L 95  
J 5 THR B 106 ? LEU B 108 ? THR L 107 LEU L 109 
K 1 THR B 118 ? PHE B 122 ? THR L 119 PHE L 123 
K 2 GLY B 133 ? PHE B 143 ? GLY L 134 PHE L 144 
K 3 TYR B 177 ? THR B 186 ? TYR L 178 THR L 187 
K 4 VAL B 163 ? TRP B 167 ? VAL L 164 TRP L 168 
L 1 SER B 157 ? GLU B 158 ? SER L 158 GLU L 159 
L 2 LYS B 151 ? ILE B 154 ? LYS L 152 ILE L 155 
L 3 TYR B 196 ? ALA B 200 ? TYR L 197 ALA L 201 
L 4 ILE B 209 ? PHE B 213 ? ILE L 210 PHE L 214 
M 1 ALA C 2   ? SER C 6   ? ALA A 3   SER A 7   
M 2 LEU C 17  ? SER C 24  ? LEU A 18  SER A 25  
M 3 ILE C 76  ? MET C 81  ? ILE A 79  MET A 84  
M 4 PHE C 66  ? ASP C 71  ? PHE A 69  ASP A 74  
N 1 THR C 56  ? TYR C 57  ? THR A 59  TYR A 60  
N 2 GLU C 45  ? ILE C 50  ? GLU A 48  ILE A 53  
N 3 MET C 33  ? GLN C 38  ? MET A 36  GLN A 41  
N 4 ALA C 90  ? ARG C 96  ? ALA A 93  ARG A 99  
N 5 TYR C 102 ? TRP C 103 ? TYR A 105 TRP A 106 
O 1 THR C 56  ? TYR C 57  ? THR A 59  TYR A 60  
O 2 GLU C 45  ? ILE C 50  ? GLU A 48  ILE A 53  
O 3 MET C 33  ? GLN C 38  ? MET A 36  GLN A 41  
O 4 ALA C 90  ? ARG C 96  ? ALA A 93  ARG A 99  
O 5 THR C 107 ? VAL C 111 ? THR A 110 VAL A 114 
O 6 GLY C 9   ? VAL C 11  ? GLY A 10  VAL A 12  
P 1 SER C 120 ? ALA C 124 ? SER A 123 ALA A 127 
P 2 VAL C 136 ? TYR C 145 ? VAL A 139 TYR A 148 
P 3 LEU C 172 ? VAL C 181 ? LEU A 177 VAL A 186 
P 4 HIS C 162 ? THR C 163 ? HIS A 167 THR A 168 
Q 1 SER C 120 ? ALA C 124 ? SER A 123 ALA A 127 
Q 2 VAL C 136 ? TYR C 145 ? VAL A 139 TYR A 148 
Q 3 LEU C 172 ? VAL C 181 ? LEU A 177 VAL A 186 
Q 4 LEU C 167 ? GLN C 169 ? LEU A 172 GLN A 174 
R 1 THR C 151 ? TRP C 154 ? THR A 154 TRP A 157 
R 2 VAL C 190 ? HIS C 196 ? VAL A 196 HIS A 202 
R 3 THR C 201 ? LEU C 207 ? THR A 207 LEU A 213 
S 1 LEU D 3   ? THR D 4   ? LEU B 4   THR B 5   
S 2 ALA D 18  ? SER D 24  ? ALA B 19  SER B 25  
S 3 ASP D 74  ? ILE D 79  ? ASP B 75  ILE B 80  
S 4 PHE D 66  ? GLY D 70  ? PHE B 67  GLY B 71  
T 1 VAL D 12  ? THR D 13  ? VAL B 13  THR B 14  
T 2 LEU D 110 ? LYS D 111 ? LEU B 111 LYS B 112 
U 1 ASN D 57  ? LEU D 58  ? ASN B 58  LEU B 59  
U 2 GLN D 49  ? TYR D 53  ? GLN B 50  TYR B 54  
U 3 LEU D 37  ? GLN D 42  ? LEU B 38  GLN B 43  
U 4 GLY D 88  ? GLN D 94  ? GLY B 89  GLN B 95  
U 5 THR D 101 ? PHE D 102 ? THR B 102 PHE B 103 
V 1 ASN D 57  ? LEU D 58  ? ASN B 58  LEU B 59  
V 2 GLN D 49  ? TYR D 53  ? GLN B 50  TYR B 54  
V 3 LEU D 37  ? GLN D 42  ? LEU B 38  GLN B 43  
V 4 GLY D 88  ? GLN D 94  ? GLY B 89  GLN B 95  
V 5 THR D 106 ? LEU D 108 ? THR B 107 LEU B 109 
W 1 SER D 120 ? PHE D 122 ? SER B 121 PHE B 123 
W 2 GLY D 133 ? PHE D 143 ? GLY B 134 PHE B 144 
W 3 TYR D 177 ? THR D 186 ? TYR B 178 THR B 187 
W 4 VAL D 163 ? TRP D 167 ? VAL B 164 TRP B 168 
X 1 SER D 157 ? GLU D 158 ? SER B 158 GLU B 159 
X 2 LYS D 151 ? ILE D 154 ? LYS B 152 ILE B 155 
X 3 TYR D 196 ? ALA D 200 ? TYR B 197 ALA B 201 
X 4 ILE D 209 ? PHE D 213 ? ILE B 210 PHE B 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 6   ? N SER H 7   O SER A 20  ? O SER H 21  
A 2 3 N LEU A 17  ? N LEU H 18  O MET A 81  ? O MET H 84  
A 3 4 O TYR A 78  ? O TYR H 81  N SER A 69  ? N SER H 72  
B 1 2 O TYR A 57  ? O TYR H 60  N SER A 49  ? N SER H 52  
B 2 3 O ALA A 48  ? O ALA H 51  N TRP A 35  ? N TRP H 38  
B 3 4 N VAL A 36  ? N VAL H 39  O TYR A 93  ? O TYR H 96  
B 4 5 N ARG A 96  ? N ARG H 99  O TYR A 102 ? O TYR H 105 
C 1 2 O TYR A 57  ? O TYR H 60  N SER A 49  ? N SER H 52  
C 2 3 O ALA A 48  ? O ALA H 51  N TRP A 35  ? N TRP H 38  
C 3 4 N VAL A 36  ? N VAL H 39  O TYR A 93  ? O TYR H 96  
C 4 5 N TYR A 92  ? N TYR H 95  O THR A 107 ? O THR H 110 
C 5 6 O THR A 110 ? O THR H 113 N VAL A 11  ? N VAL H 12  
D 1 2 N TYR A 122 ? N TYR H 125 O LEU A 141 ? O LEU H 144 
D 2 3 N LEU A 138 ? N LEU H 141 O VAL A 179 ? O VAL H 184 
D 3 4 O SER A 178 ? O SER H 183 N HIS A 162 ? N HIS H 167 
E 1 2 N TYR A 122 ? N TYR H 125 O LEU A 141 ? O LEU H 144 
E 2 3 N LEU A 138 ? N LEU H 141 O VAL A 179 ? O VAL H 184 
E 3 4 O LEU A 172 ? O LEU H 177 N GLN A 169 ? N GLN H 174 
F 1 2 N THR A 153 ? N THR H 156 O SER A 193 ? O SER H 199 
F 2 3 N VAL A 194 ? N VAL H 200 O VAL A 203 ? O VAL H 209 
G 1 2 N THR B 4   ? N THR L 5   O ARG B 23  ? O ARG L 24  
G 2 3 N ILE B 20  ? N ILE L 21  O LEU B 77  ? O LEU L 78  
G 3 4 O ARG B 78  ? O ARG L 79  N SER B 67  ? N SER L 68  
H 1 2 N VAL B 12  ? N VAL L 13  O LYS B 111 ? O LYS L 112 
I 1 2 O ASN B 57  ? O ASN L 58  N TYR B 53  ? N TYR L 54  
I 2 3 O LEU B 51  ? O LEU L 52  N TRP B 39  ? N TRP L 40  
I 3 4 N TYR B 40  ? N TYR L 41  O TYR B 91  ? O TYR L 92  
I 4 5 N GLN B 94  ? N GLN L 95  O THR B 101 ? O THR L 102 
J 1 2 O ASN B 57  ? O ASN L 58  N TYR B 53  ? N TYR L 54  
J 2 3 O LEU B 51  ? O LEU L 52  N TRP B 39  ? N TRP L 40  
J 3 4 N TYR B 40  ? N TYR L 41  O TYR B 91  ? O TYR L 92  
J 4 5 N TYR B 90  ? N TYR L 91  O THR B 106 ? O THR L 107 
K 1 2 N PHE B 122 ? N PHE L 123 O VAL B 137 ? O VAL L 138 
K 2 3 N PHE B 143 ? N PHE L 144 O TYR B 177 ? O TYR L 178 
K 3 4 O THR B 182 ? O THR L 183 N LEU B 164 ? N LEU L 165 
L 1 2 O SER B 157 ? O SER L 158 N ILE B 154 ? N ILE L 155 
L 2 3 N LYS B 151 ? N LYS L 152 O GLU B 199 ? O GLU L 200 
L 3 4 N CYS B 198 ? N CYS L 199 O LYS B 211 ? O LYS L 212 
M 1 2 N SER C 6   ? N SER A 7   O SER C 20  ? O SER A 21  
M 2 3 N LEU C 17  ? N LEU A 18  O MET C 81  ? O MET A 84  
M 3 4 O TYR C 78  ? O TYR A 81  N SER C 69  ? N SER A 72  
N 1 2 O TYR C 57  ? O TYR A 60  N SER C 49  ? N SER A 52  
N 2 3 O ALA C 48  ? O ALA A 51  N TRP C 35  ? N TRP A 38  
N 3 4 N VAL C 36  ? N VAL A 39  O TYR C 93  ? O TYR A 96  
N 4 5 N ARG C 96  ? N ARG A 99  O TYR C 102 ? O TYR A 105 
O 1 2 O TYR C 57  ? O TYR A 60  N SER C 49  ? N SER A 52  
O 2 3 O ALA C 48  ? O ALA A 51  N TRP C 35  ? N TRP A 38  
O 3 4 N VAL C 36  ? N VAL A 39  O TYR C 93  ? O TYR A 96  
O 4 5 N TYR C 92  ? N TYR A 95  O THR C 107 ? O THR A 110 
O 5 6 O THR C 110 ? O THR A 113 N VAL C 11  ? N VAL A 12  
P 1 2 N TYR C 122 ? N TYR A 125 O LEU C 141 ? O LEU A 144 
P 2 3 N LEU C 138 ? N LEU A 141 O VAL C 179 ? O VAL A 184 
P 3 4 O SER C 178 ? O SER A 183 N HIS C 162 ? N HIS A 167 
Q 1 2 N TYR C 122 ? N TYR A 125 O LEU C 141 ? O LEU A 144 
Q 2 3 N LEU C 138 ? N LEU A 141 O VAL C 179 ? O VAL A 184 
Q 3 4 O LEU C 172 ? O LEU A 177 N GLN C 169 ? N GLN A 174 
R 1 2 N THR C 153 ? N THR A 156 O SER C 193 ? O SER A 199 
R 2 3 N VAL C 194 ? N VAL A 200 O VAL C 203 ? O VAL A 209 
S 1 2 N THR D 4   ? N THR B 5   O ARG D 23  ? O ARG B 24  
S 2 3 N CYS D 22  ? N CYS B 23  O PHE D 75  ? O PHE B 76  
S 3 4 O ARG D 78  ? O ARG B 79  N SER D 67  ? N SER B 68  
T 1 2 N VAL D 12  ? N VAL B 13  O LYS D 111 ? O LYS B 112 
U 1 2 O ASN D 57  ? O ASN B 58  N TYR D 53  ? N TYR B 54  
U 2 3 O LEU D 51  ? O LEU B 52  N TRP D 39  ? N TRP B 40  
U 3 4 N TYR D 40  ? N TYR B 41  O TYR D 91  ? O TYR B 92  
U 4 5 N GLN D 94  ? N GLN B 95  O THR D 101 ? O THR B 102 
V 1 2 O ASN D 57  ? O ASN B 58  N TYR D 53  ? N TYR B 54  
V 2 3 O LEU D 51  ? O LEU B 52  N TRP D 39  ? N TRP B 40  
V 3 4 N TYR D 40  ? N TYR B 41  O TYR D 91  ? O TYR B 92  
V 4 5 N TYR D 90  ? N TYR B 91  O THR D 106 ? O THR B 107 
W 1 2 N PHE D 122 ? N PHE B 123 O VAL D 137 ? O VAL B 138 
W 2 3 N PHE D 143 ? N PHE B 144 O TYR D 177 ? O TYR B 178 
W 3 4 O THR D 182 ? O THR B 183 N LEU D 164 ? N LEU B 165 
X 1 2 O SER D 157 ? O SER B 158 N ILE D 154 ? N ILE B 155 
X 2 3 N LYS D 151 ? N LYS B 152 O GLU D 199 ? O GLU B 200 
X 3 4 N CYS D 198 ? N CYS B 199 O LYS D 211 ? O LYS B 212 
# 
_atom_sites.entry_id                    1UB6 
_atom_sites.fract_transf_matrix[1][1]   0.005143 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002655 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016519 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012193 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 49.704 -2.977  -42.389 1.00 32.52 ? 2   ALA H N   1 
ATOM   2    C CA  . ALA A 1 1   ? 50.630 -3.386  -41.288 1.00 37.77 ? 2   ALA H CA  1 
ATOM   3    C C   . ALA A 1 1   ? 50.154 -2.863  -39.942 1.00 37.76 ? 2   ALA H C   1 
ATOM   4    O O   . ALA A 1 1   ? 50.060 -1.655  -39.738 1.00 41.76 ? 2   ALA H O   1 
ATOM   5    C CB  . ALA A 1 1   ? 52.049 -2.878  -41.568 1.00 30.60 ? 2   ALA H CB  1 
ATOM   6    N N   . ALA A 1 2   ? 49.850 -3.775  -39.023 1.00 34.57 ? 3   ALA H N   1 
ATOM   7    C CA  . ALA A 1 2   ? 49.402 -3.388  -37.691 1.00 37.89 ? 3   ALA H CA  1 
ATOM   8    C C   . ALA A 1 2   ? 49.768 -4.443  -36.651 1.00 38.10 ? 3   ALA H C   1 
ATOM   9    O O   . ALA A 1 2   ? 49.779 -5.640  -36.940 1.00 40.55 ? 3   ALA H O   1 
ATOM   10   C CB  . ALA A 1 2   ? 47.890 -3.151  -37.683 1.00 37.66 ? 3   ALA H CB  1 
ATOM   11   N N   . LEU A 1 3   ? 50.090 -3.978  -35.448 1.00 36.47 ? 4   LEU H N   1 
ATOM   12   C CA  . LEU A 1 3   ? 50.428 -4.850  -34.332 1.00 33.24 ? 4   LEU H CA  1 
ATOM   13   C C   . LEU A 1 3   ? 49.334 -4.639  -33.286 1.00 33.26 ? 4   LEU H C   1 
ATOM   14   O O   . LEU A 1 3   ? 48.929 -3.511  -33.026 1.00 32.58 ? 4   LEU H O   1 
ATOM   15   C CB  . LEU A 1 3   ? 51.795 -4.479  -33.748 1.00 29.97 ? 4   LEU H CB  1 
ATOM   16   C CG  . LEU A 1 3   ? 53.021 -4.650  -34.655 1.00 32.19 ? 4   LEU H CG  1 
ATOM   17   C CD1 . LEU A 1 3   ? 54.281 -4.241  -33.920 1.00 30.26 ? 4   LEU H CD1 1 
ATOM   18   C CD2 . LEU A 1 3   ? 53.130 -6.085  -35.096 1.00 40.05 ? 4   LEU H CD2 1 
ATOM   19   N N   . LEU A 1 4   ? 48.843 -5.723  -32.695 1.00 32.95 ? 5   LEU H N   1 
ATOM   20   C CA  . LEU A 1 4   ? 47.788 -5.607  -31.698 1.00 33.72 ? 5   LEU H CA  1 
ATOM   21   C C   . LEU A 1 4   ? 48.089 -6.364  -30.403 1.00 32.26 ? 5   LEU H C   1 
ATOM   22   O O   . LEU A 1 4   ? 48.128 -7.591  -30.391 1.00 32.05 ? 5   LEU H O   1 
ATOM   23   C CB  . LEU A 1 4   ? 46.472 -6.106  -32.293 1.00 34.57 ? 5   LEU H CB  1 
ATOM   24   C CG  . LEU A 1 4   ? 45.298 -6.208  -31.323 1.00 37.59 ? 5   LEU H CG  1 
ATOM   25   C CD1 . LEU A 1 4   ? 45.010 -4.845  -30.701 1.00 45.67 ? 5   LEU H CD1 1 
ATOM   26   C CD2 . LEU A 1 4   ? 44.079 -6.732  -32.068 1.00 44.68 ? 5   LEU H CD2 1 
ATOM   27   N N   . GLU A 1 5   ? 48.308 -5.626  -29.318 1.00 35.60 ? 6   GLU H N   1 
ATOM   28   C CA  . GLU A 1 5   ? 48.575 -6.242  -28.025 1.00 34.51 ? 6   GLU H CA  1 
ATOM   29   C C   . GLU A 1 5   ? 47.248 -6.604  -27.377 1.00 39.46 ? 6   GLU H C   1 
ATOM   30   O O   . GLU A 1 5   ? 46.223 -5.997  -27.672 1.00 41.62 ? 6   GLU H O   1 
ATOM   31   C CB  . GLU A 1 5   ? 49.311 -5.286  -27.081 1.00 32.51 ? 6   GLU H CB  1 
ATOM   32   C CG  . GLU A 1 5   ? 50.692 -4.834  -27.525 1.00 35.01 ? 6   GLU H CG  1 
ATOM   33   C CD  . GLU A 1 5   ? 50.647 -3.652  -28.474 1.00 39.26 ? 6   GLU H CD  1 
ATOM   34   O OE1 . GLU A 1 5   ? 51.733 -3.152  -28.835 1.00 35.81 ? 6   GLU H OE1 1 
ATOM   35   O OE2 . GLU A 1 5   ? 49.531 -3.223  -28.857 1.00 38.33 ? 6   GLU H OE2 1 
ATOM   36   N N   . SER A 1 6   ? 47.275 -7.593  -26.493 1.00 39.08 ? 7   SER H N   1 
ATOM   37   C CA  . SER A 1 6   ? 46.079 -8.013  -25.775 1.00 40.08 ? 7   SER H CA  1 
ATOM   38   C C   . SER A 1 6   ? 46.490 -8.807  -24.542 1.00 41.19 ? 7   SER H C   1 
ATOM   39   O O   . SER A 1 6   ? 47.634 -9.246  -24.437 1.00 39.36 ? 7   SER H O   1 
ATOM   40   C CB  . SER A 1 6   ? 45.191 -8.875  -26.667 1.00 40.68 ? 7   SER H CB  1 
ATOM   41   O OG  . SER A 1 6   ? 45.863 -10.061 -27.040 1.00 49.50 ? 7   SER H OG  1 
ATOM   42   N N   . GLY A 1 7   ? 45.562 -8.972  -23.604 1.00 42.71 ? 8   GLY H N   1 
ATOM   43   C CA  . GLY A 1 7   ? 45.854 -9.731  -22.401 1.00 42.11 ? 8   GLY H CA  1 
ATOM   44   C C   . GLY A 1 7   ? 46.045 -8.917  -21.132 1.00 43.74 ? 8   GLY H C   1 
ATOM   45   O O   . GLY A 1 7   ? 46.172 -9.483  -20.049 1.00 45.60 ? 8   GLY H O   1 
ATOM   46   N N   . GLY A 1 8   ? 46.071 -7.595  -21.256 1.00 42.33 ? 9   GLY H N   1 
ATOM   47   C CA  . GLY A 1 8   ? 46.259 -6.757  -20.086 1.00 43.13 ? 9   GLY H CA  1 
ATOM   48   C C   . GLY A 1 8   ? 45.077 -6.820  -19.139 1.00 45.06 ? 9   GLY H C   1 
ATOM   49   O O   . GLY A 1 8   ? 44.037 -7.385  -19.475 1.00 44.11 ? 9   GLY H O   1 
ATOM   50   N N   . GLY A 1 9   ? 45.235 -6.246  -17.950 1.00 47.95 ? 10  GLY H N   1 
ATOM   51   C CA  . GLY A 1 9   ? 44.149 -6.247  -16.986 1.00 45.25 ? 10  GLY H CA  1 
ATOM   52   C C   . GLY A 1 9   ? 44.616 -6.046  -15.561 1.00 45.93 ? 10  GLY H C   1 
ATOM   53   O O   . GLY A 1 9   ? 45.787 -5.752  -15.315 1.00 46.37 ? 10  GLY H O   1 
ATOM   54   N N   . LEU A 1 10  ? 43.691 -6.184  -14.618 1.00 46.08 ? 11  LEU H N   1 
ATOM   55   C CA  . LEU A 1 10  ? 44.024 -6.038  -13.212 1.00 46.13 ? 11  LEU H CA  1 
ATOM   56   C C   . LEU A 1 10  ? 44.518 -7.374  -12.690 1.00 46.40 ? 11  LEU H C   1 
ATOM   57   O O   . LEU A 1 10  ? 43.925 -8.415  -12.953 1.00 47.48 ? 11  LEU H O   1 
ATOM   58   C CB  . LEU A 1 10  ? 42.807 -5.600  -12.397 1.00 47.84 ? 11  LEU H CB  1 
ATOM   59   C CG  . LEU A 1 10  ? 42.537 -4.102  -12.260 1.00 44.01 ? 11  LEU H CG  1 
ATOM   60   C CD1 . LEU A 1 10  ? 42.231 -3.494  -13.614 1.00 44.13 ? 11  LEU H CD1 1 
ATOM   61   C CD2 . LEU A 1 10  ? 41.372 -3.904  -11.308 1.00 41.46 ? 11  LEU H CD2 1 
ATOM   62   N N   . VAL A 1 11  ? 45.619 -7.334  -11.957 1.00 46.85 ? 12  VAL H N   1 
ATOM   63   C CA  . VAL A 1 11  ? 46.209 -8.532  -11.392 1.00 46.00 ? 12  VAL H CA  1 
ATOM   64   C C   . VAL A 1 11  ? 46.740 -8.163  -10.015 1.00 47.76 ? 12  VAL H C   1 
ATOM   65   O O   . VAL A 1 11  ? 47.229 -7.051  -9.804  1.00 46.57 ? 12  VAL H O   1 
ATOM   66   C CB  . VAL A 1 11  ? 47.368 -9.043  -12.271 1.00 48.60 ? 12  VAL H CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 47.955 -10.310 -11.679 1.00 45.13 ? 12  VAL H CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 46.868 -9.299  -13.684 1.00 50.93 ? 12  VAL H CG2 1 
ATOM   69   N N   . LYS A 1 12  ? 46.626 -9.092  -9.075  1.00 46.49 ? 13  LYS H N   1 
ATOM   70   C CA  . LYS A 1 12  ? 47.091 -8.857  -7.715  1.00 45.83 ? 13  LYS H CA  1 
ATOM   71   C C   . LYS A 1 12  ? 48.599 -9.023  -7.628  1.00 41.43 ? 13  LYS H C   1 
ATOM   72   O O   . LYS A 1 12  ? 49.198 -9.750  -8.421  1.00 43.15 ? 13  LYS H O   1 
ATOM   73   C CB  . LYS A 1 12  ? 46.403 -9.836  -6.759  1.00 51.43 ? 13  LYS H CB  1 
ATOM   74   C CG  . LYS A 1 12  ? 44.892 -9.639  -6.665  1.00 57.84 ? 13  LYS H CG  1 
ATOM   75   C CD  . LYS A 1 12  ? 44.211 -10.729 -5.843  1.00 64.19 ? 13  LYS H CD  1 
ATOM   76   C CE  . LYS A 1 12  ? 44.198 -12.063 -6.583  1.00 66.73 ? 13  LYS H CE  1 
ATOM   77   N NZ  . LYS A 1 12  ? 43.554 -13.148 -5.787  1.00 68.83 ? 13  LYS H NZ  1 
ATOM   78   N N   . PRO A 1 13  ? 49.239 -8.330  -6.676  1.00 40.03 ? 14  PRO H N   1 
ATOM   79   C CA  . PRO A 1 13  ? 50.691 -8.446  -6.527  1.00 41.24 ? 14  PRO H CA  1 
ATOM   80   C C   . PRO A 1 13  ? 51.061 -9.922  -6.395  1.00 42.81 ? 14  PRO H C   1 
ATOM   81   O O   . PRO A 1 13  ? 50.312 -10.704 -5.803  1.00 41.75 ? 14  PRO H O   1 
ATOM   82   C CB  . PRO A 1 13  ? 50.964 -7.651  -5.255  1.00 40.69 ? 14  PRO H CB  1 
ATOM   83   C CG  . PRO A 1 13  ? 49.945 -6.564  -5.333  1.00 37.22 ? 14  PRO H CG  1 
ATOM   84   C CD  . PRO A 1 13  ? 48.696 -7.305  -5.768  1.00 39.29 ? 14  PRO H CD  1 
ATOM   85   N N   . GLY A 1 14  ? 52.203 -10.300 -6.963  1.00 42.89 ? 15  GLY H N   1 
ATOM   86   C CA  . GLY A 1 14  ? 52.636 -11.684 -6.915  1.00 39.37 ? 15  GLY H CA  1 
ATOM   87   C C   . GLY A 1 14  ? 51.921 -12.531 -7.952  1.00 43.52 ? 15  GLY H C   1 
ATOM   88   O O   . GLY A 1 14  ? 52.269 -13.694 -8.163  1.00 45.29 ? 15  GLY H O   1 
ATOM   89   N N   . GLY A 1 15  ? 50.914 -11.958 -8.604  1.00 41.96 ? 16  GLY H N   1 
ATOM   90   C CA  . GLY A 1 15  ? 50.182 -12.699 -9.618  1.00 38.80 ? 16  GLY H CA  1 
ATOM   91   C C   . GLY A 1 15  ? 50.944 -12.816 -10.928 1.00 40.85 ? 16  GLY H C   1 
ATOM   92   O O   . GLY A 1 15  ? 52.061 -12.316 -11.052 1.00 38.29 ? 16  GLY H O   1 
ATOM   93   N N   . SER A 1 16  ? 50.342 -13.484 -11.908 1.00 44.24 ? 17  SER H N   1 
ATOM   94   C CA  . SER A 1 16  ? 50.973 -13.652 -13.210 1.00 47.95 ? 17  SER H CA  1 
ATOM   95   C C   . SER A 1 16  ? 49.977 -13.324 -14.314 1.00 49.15 ? 17  SER H C   1 
ATOM   96   O O   . SER A 1 16  ? 48.761 -13.436 -14.129 1.00 48.84 ? 17  SER H O   1 
ATOM   97   C CB  . SER A 1 16  ? 51.495 -15.083 -13.384 1.00 48.86 ? 17  SER H CB  1 
ATOM   98   O OG  . SER A 1 16  ? 50.434 -16.014 -13.474 1.00 54.99 ? 17  SER H OG  1 
ATOM   99   N N   . LEU A 1 17  ? 50.500 -12.921 -15.466 1.00 46.97 ? 18  LEU H N   1 
ATOM   100  C CA  . LEU A 1 17  ? 49.654 -12.554 -16.588 1.00 46.61 ? 18  LEU H CA  1 
ATOM   101  C C   . LEU A 1 17  ? 50.410 -12.807 -17.881 1.00 43.48 ? 18  LEU H C   1 
ATOM   102  O O   . LEU A 1 17  ? 51.635 -12.688 -17.921 1.00 45.15 ? 18  LEU H O   1 
ATOM   103  C CB  . LEU A 1 17  ? 49.292 -11.073 -16.474 1.00 46.31 ? 18  LEU H CB  1 
ATOM   104  C CG  . LEU A 1 17  ? 48.149 -10.540 -17.332 1.00 47.86 ? 18  LEU H CG  1 
ATOM   105  C CD1 . LEU A 1 17  ? 46.862 -11.280 -16.984 1.00 45.10 ? 18  LEU H CD1 1 
ATOM   106  C CD2 . LEU A 1 17  ? 47.994 -9.040  -17.080 1.00 42.47 ? 18  LEU H CD2 1 
ATOM   107  N N   . LYS A 1 18  ? 49.692 -13.170 -18.935 1.00 42.99 ? 19  LYS H N   1 
ATOM   108  C CA  . LYS A 1 18  ? 50.349 -13.411 -20.210 1.00 42.48 ? 19  LYS H CA  1 
ATOM   109  C C   . LYS A 1 18  ? 49.816 -12.482 -21.285 1.00 39.86 ? 19  LYS H C   1 
ATOM   110  O O   . LYS A 1 18  ? 48.635 -12.516 -21.617 1.00 44.88 ? 19  LYS H O   1 
ATOM   111  C CB  . LYS A 1 18  ? 50.165 -14.858 -20.668 1.00 40.23 ? 19  LYS H CB  1 
ATOM   112  C CG  . LYS A 1 18  ? 51.073 -15.203 -21.839 1.00 43.98 ? 19  LYS H CG  1 
ATOM   113  C CD  . LYS A 1 18  ? 50.879 -16.618 -22.359 1.00 48.95 ? 19  LYS H CD  1 
ATOM   114  C CE  . LYS A 1 18  ? 49.586 -16.763 -23.146 1.00 48.04 ? 19  LYS H CE  1 
ATOM   115  N NZ  . LYS A 1 18  ? 49.495 -18.084 -23.841 1.00 53.49 ? 19  LYS H NZ  1 
ATOM   116  N N   . LEU A 1 19  ? 50.697 -11.654 -21.831 1.00 41.92 ? 20  LEU H N   1 
ATOM   117  C CA  . LEU A 1 19  ? 50.303 -10.735 -22.885 1.00 35.81 ? 20  LEU H CA  1 
ATOM   118  C C   . LEU A 1 19  ? 50.596 -11.382 -24.227 1.00 33.46 ? 20  LEU H C   1 
ATOM   119  O O   . LEU A 1 19  ? 51.566 -12.119 -24.374 1.00 30.72 ? 20  LEU H O   1 
ATOM   120  C CB  . LEU A 1 19  ? 51.090 -9.433  -22.785 1.00 32.04 ? 20  LEU H CB  1 
ATOM   121  C CG  . LEU A 1 19  ? 51.095 -8.744  -21.433 1.00 29.69 ? 20  LEU H CG  1 
ATOM   122  C CD1 . LEU A 1 19  ? 51.858 -7.449  -21.543 1.00 35.16 ? 20  LEU H CD1 1 
ATOM   123  C CD2 . LEU A 1 19  ? 49.672 -8.482  -20.975 1.00 37.03 ? 20  LEU H CD2 1 
ATOM   124  N N   . SER A 1 20  ? 49.751 -11.108 -25.210 1.00 35.67 ? 21  SER H N   1 
ATOM   125  C CA  . SER A 1 20  ? 49.968 -11.661 -26.531 1.00 36.96 ? 21  SER H CA  1 
ATOM   126  C C   . SER A 1 20  ? 49.993 -10.513 -27.519 1.00 32.24 ? 21  SER H C   1 
ATOM   127  O O   . SER A 1 20  ? 49.611 -9.396  -27.191 1.00 33.97 ? 21  SER H O   1 
ATOM   128  C CB  . SER A 1 20  ? 48.861 -12.649 -26.881 1.00 33.53 ? 21  SER H CB  1 
ATOM   129  O OG  . SER A 1 20  ? 47.592 -12.059 -26.701 1.00 48.70 ? 21  SER H OG  1 
ATOM   130  N N   . CYS A 1 21  ? 50.469 -10.785 -28.724 1.00 33.90 ? 22  CYS H N   1 
ATOM   131  C CA  . CYS A 1 21  ? 50.531 -9.761  -29.754 1.00 35.88 ? 22  CYS H CA  1 
ATOM   132  C C   . CYS A 1 21  ? 50.425 -10.397 -31.120 1.00 33.61 ? 22  CYS H C   1 
ATOM   133  O O   . CYS A 1 21  ? 51.206 -11.284 -31.456 1.00 32.04 ? 22  CYS H O   1 
ATOM   134  C CB  . CYS A 1 21  ? 51.844 -9.002  -29.659 1.00 38.23 ? 22  CYS H CB  1 
ATOM   135  S SG  . CYS A 1 21  ? 52.113 -7.791  -30.993 1.00 42.00 ? 22  CYS H SG  1 
ATOM   136  N N   . THR A 1 22  ? 49.449 -9.950  -31.899 1.00 30.85 ? 23  THR H N   1 
ATOM   137  C CA  . THR A 1 22  ? 49.251 -10.468 -33.242 1.00 34.76 ? 23  THR H CA  1 
ATOM   138  C C   . THR A 1 22  ? 49.704 -9.392  -34.200 1.00 33.46 ? 23  THR H C   1 
ATOM   139  O O   . THR A 1 22  ? 49.935 -8.256  -33.799 1.00 34.22 ? 23  THR H O   1 
ATOM   140  C CB  . THR A 1 22  ? 47.771 -10.809 -33.506 1.00 33.48 ? 23  THR H CB  1 
ATOM   141  O OG1 . THR A 1 22  ? 46.950 -9.689  -33.147 1.00 39.53 ? 23  THR H OG1 1 
ATOM   142  C CG2 . THR A 1 22  ? 47.360 -12.015 -32.689 1.00 38.19 ? 23  THR H CG2 1 
ATOM   143  N N   . ALA A 1 23  ? 49.828 -9.738  -35.472 1.00 34.22 ? 24  ALA H N   1 
ATOM   144  C CA  . ALA A 1 23  ? 50.286 -8.758  -36.433 1.00 37.64 ? 24  ALA H CA  1 
ATOM   145  C C   . ALA A 1 23  ? 49.772 -8.997  -37.833 1.00 40.25 ? 24  ALA H C   1 
ATOM   146  O O   . ALA A 1 23  ? 49.462 -10.123 -38.224 1.00 39.01 ? 24  ALA H O   1 
ATOM   147  C CB  . ALA A 1 23  ? 51.801 -8.733  -36.452 1.00 35.24 ? 24  ALA H CB  1 
ATOM   148  N N   . SER A 1 24  ? 49.691 -7.907  -38.580 1.00 41.08 ? 25  SER H N   1 
ATOM   149  C CA  . SER A 1 24  ? 49.259 -7.938  -39.959 1.00 43.10 ? 25  SER H CA  1 
ATOM   150  C C   . SER A 1 24  ? 50.374 -7.254  -40.758 1.00 39.84 ? 25  SER H C   1 
ATOM   151  O O   . SER A 1 24  ? 50.720 -6.107  -40.483 1.00 40.16 ? 25  SER H O   1 
ATOM   152  C CB  . SER A 1 24  ? 47.943 -7.171  -40.107 1.00 45.35 ? 25  SER H CB  1 
ATOM   153  O OG  . SER A 1 24  ? 47.463 -7.238  -41.434 1.00 58.68 ? 25  SER H OG  1 
ATOM   154  N N   . GLY A 1 25  ? 50.963 -7.976  -41.709 1.00 35.78 ? 26  GLY H N   1 
ATOM   155  C CA  . GLY A 1 25  ? 52.007 -7.401  -42.538 1.00 29.62 ? 26  GLY H CA  1 
ATOM   156  C C   . GLY A 1 25  ? 53.409 -7.446  -41.969 1.00 30.58 ? 26  GLY H C   1 
ATOM   157  O O   . GLY A 1 25  ? 54.342 -6.903  -42.561 1.00 28.01 ? 26  GLY H O   1 
ATOM   158  N N   . ILE A 1 26  ? 53.553 -8.085  -40.814 1.00 26.70 ? 27  ILE H N   1 
ATOM   159  C CA  . ILE A 1 26  ? 54.843 -8.211  -40.153 1.00 26.85 ? 27  ILE H CA  1 
ATOM   160  C C   . ILE A 1 26  ? 55.043 -9.671  -39.759 1.00 28.68 ? 27  ILE H C   1 
ATOM   161  O O   . ILE A 1 26  ? 54.166 -10.269 -39.132 1.00 27.42 ? 27  ILE H O   1 
ATOM   162  C CB  . ILE A 1 26  ? 54.895 -7.323  -38.889 1.00 31.14 ? 27  ILE H CB  1 
ATOM   163  C CG1 . ILE A 1 26  ? 54.844 -5.851  -39.303 1.00 31.17 ? 27  ILE H CG1 1 
ATOM   164  C CG2 . ILE A 1 26  ? 56.155 -7.612  -38.085 1.00 32.01 ? 27  ILE H CG2 1 
ATOM   165  C CD1 . ILE A 1 26  ? 54.833 -4.885  -38.135 1.00 35.58 ? 27  ILE H CD1 1 
ATOM   166  N N   . THR A 1 27  ? 56.182 -10.243 -40.142 1.00 25.49 ? 28  THR H N   1 
ATOM   167  C CA  . THR A 1 27  ? 56.496 -11.635 -39.823 1.00 26.09 ? 28  THR H CA  1 
ATOM   168  C C   . THR A 1 27  ? 57.470 -11.655 -38.645 1.00 23.58 ? 28  THR H C   1 
ATOM   169  O O   . THR A 1 27  ? 58.675 -11.535 -38.830 1.00 23.82 ? 28  THR H O   1 
ATOM   170  C CB  . THR A 1 27  ? 57.144 -12.344 -41.046 1.00 28.77 ? 28  THR H CB  1 
ATOM   171  O OG1 . THR A 1 27  ? 56.349 -12.098 -42.214 1.00 27.92 ? 28  THR H OG1 1 
ATOM   172  C CG2 . THR A 1 27  ? 57.214 -13.867 -40.823 1.00 21.79 ? 28  THR H CG2 1 
ATOM   173  N N   . PHE A 1 28  ? 56.934 -11.803 -37.435 1.00 24.60 ? 29  PHE H N   1 
ATOM   174  C CA  . PHE A 1 28  ? 57.729 -11.803 -36.205 1.00 23.08 ? 29  PHE H CA  1 
ATOM   175  C C   . PHE A 1 28  ? 59.035 -12.597 -36.209 1.00 29.73 ? 29  PHE H C   1 
ATOM   176  O O   . PHE A 1 28  ? 60.063 -12.117 -35.711 1.00 25.32 ? 29  PHE H O   1 
ATOM   177  C CB  . PHE A 1 28  ? 56.861 -12.283 -35.036 1.00 23.85 ? 29  PHE H CB  1 
ATOM   178  C CG  . PHE A 1 28  ? 55.729 -11.350 -34.690 1.00 25.70 ? 29  PHE H CG  1 
ATOM   179  C CD1 . PHE A 1 28  ? 54.568 -11.837 -34.109 1.00 29.51 ? 29  PHE H CD1 1 
ATOM   180  C CD2 . PHE A 1 28  ? 55.839 -9.980  -34.902 1.00 28.46 ? 29  PHE H CD2 1 
ATOM   181  C CE1 . PHE A 1 28  ? 53.539 -10.981 -33.745 1.00 30.64 ? 29  PHE H CE1 1 
ATOM   182  C CE2 . PHE A 1 28  ? 54.810 -9.119  -34.537 1.00 34.73 ? 29  PHE H CE2 1 
ATOM   183  C CZ  . PHE A 1 28  ? 53.659 -9.625  -33.956 1.00 30.19 ? 29  PHE H CZ  1 
ATOM   184  N N   . SER A 1 29  ? 59.000 -13.804 -36.767 1.00 31.84 ? 30  SER H N   1 
ATOM   185  C CA  . SER A 1 29  ? 60.175 -14.676 -36.797 1.00 31.65 ? 30  SER H CA  1 
ATOM   186  C C   . SER A 1 29  ? 61.402 -14.102 -37.490 1.00 33.01 ? 30  SER H C   1 
ATOM   187  O O   . SER A 1 29  ? 62.504 -14.620 -37.329 1.00 31.08 ? 30  SER H O   1 
ATOM   188  C CB  . SER A 1 29  ? 59.825 -16.012 -37.462 1.00 31.69 ? 30  SER H CB  1 
ATOM   189  O OG  . SER A 1 29  ? 59.738 -15.868 -38.868 1.00 36.22 ? 30  SER H OG  1 
ATOM   190  N N   . ARG A 1 30  ? 61.226 -13.034 -38.258 1.00 35.10 ? 32  ARG H N   1 
ATOM   191  C CA  . ARG A 1 30  ? 62.355 -12.458 -38.973 1.00 35.63 ? 32  ARG H CA  1 
ATOM   192  C C   . ARG A 1 30  ? 63.106 -11.347 -38.246 1.00 31.98 ? 32  ARG H C   1 
ATOM   193  O O   . ARG A 1 30  ? 64.202 -10.985 -38.655 1.00 33.86 ? 32  ARG H O   1 
ATOM   194  C CB  . ARG A 1 30  ? 61.893 -11.957 -40.347 1.00 40.26 ? 32  ARG H CB  1 
ATOM   195  C CG  . ARG A 1 30  ? 61.002 -12.961 -41.059 1.00 47.94 ? 32  ARG H CG  1 
ATOM   196  C CD  . ARG A 1 30  ? 61.103 -12.915 -42.583 1.00 54.73 ? 32  ARG H CD  1 
ATOM   197  N NE  . ARG A 1 30  ? 60.617 -11.667 -43.159 1.00 58.20 ? 32  ARG H NE  1 
ATOM   198  C CZ  . ARG A 1 30  ? 59.906 -11.587 -44.279 1.00 58.31 ? 32  ARG H CZ  1 
ATOM   199  N NH1 . ARG A 1 30  ? 59.593 -12.688 -44.948 1.00 60.07 ? 32  ARG H NH1 1 
ATOM   200  N NH2 . ARG A 1 30  ? 59.509 -10.404 -44.729 1.00 54.21 ? 32  ARG H NH2 1 
ATOM   201  N N   . TYR A 1 31  ? 62.540 -10.810 -37.169 1.00 29.92 ? 34  TYR H N   1 
ATOM   202  C CA  . TYR A 1 31  ? 63.217 -9.728  -36.468 1.00 28.04 ? 34  TYR H CA  1 
ATOM   203  C C   . TYR A 1 31  ? 63.457 -9.923  -34.973 1.00 30.61 ? 34  TYR H C   1 
ATOM   204  O O   . TYR A 1 31  ? 63.150 -10.954 -34.374 1.00 23.75 ? 34  TYR H O   1 
ATOM   205  C CB  . TYR A 1 31  ? 62.442 -8.419  -36.614 1.00 34.54 ? 34  TYR H CB  1 
ATOM   206  C CG  . TYR A 1 31  ? 61.730 -8.220  -37.922 1.00 32.14 ? 34  TYR H CG  1 
ATOM   207  C CD1 . TYR A 1 31  ? 60.453 -8.737  -38.126 1.00 35.02 ? 34  TYR H CD1 1 
ATOM   208  C CD2 . TYR A 1 31  ? 62.322 -7.495  -38.949 1.00 34.97 ? 34  TYR H CD2 1 
ATOM   209  C CE1 . TYR A 1 31  ? 59.781 -8.524  -39.328 1.00 30.99 ? 34  TYR H CE1 1 
ATOM   210  C CE2 . TYR A 1 31  ? 61.666 -7.283  -40.149 1.00 35.90 ? 34  TYR H CE2 1 
ATOM   211  C CZ  . TYR A 1 31  ? 60.398 -7.794  -40.333 1.00 33.70 ? 34  TYR H CZ  1 
ATOM   212  O OH  . TYR A 1 31  ? 59.749 -7.558  -41.529 1.00 38.30 ? 34  TYR H OH  1 
ATOM   213  N N   . ILE A 1 32  ? 64.030 -8.881  -34.394 1.00 27.64 ? 35  ILE H N   1 
ATOM   214  C CA  . ILE A 1 32  ? 64.292 -8.812  -32.974 1.00 25.37 ? 35  ILE H CA  1 
ATOM   215  C C   . ILE A 1 32  ? 63.001 -8.163  -32.498 1.00 27.41 ? 35  ILE H C   1 
ATOM   216  O O   . ILE A 1 32  ? 62.801 -6.964  -32.675 1.00 31.12 ? 35  ILE H O   1 
ATOM   217  C CB  . ILE A 1 32  ? 65.479 -7.877  -32.691 1.00 25.72 ? 35  ILE H CB  1 
ATOM   218  C CG1 . ILE A 1 32  ? 66.735 -8.438  -33.372 1.00 25.03 ? 35  ILE H CG1 1 
ATOM   219  C CG2 . ILE A 1 32  ? 65.656 -7.696  -31.190 1.00 26.80 ? 35  ILE H CG2 1 
ATOM   220  C CD1 . ILE A 1 32  ? 67.924 -7.492  -33.375 1.00 34.58 ? 35  ILE H CD1 1 
ATOM   221  N N   . MET A 1 33  ? 62.094 -8.967  -31.965 1.00 22.91 ? 36  MET H N   1 
ATOM   222  C CA  . MET A 1 33  ? 60.836 -8.445  -31.476 1.00 24.29 ? 36  MET H CA  1 
ATOM   223  C C   . MET A 1 33  ? 61.022 -8.047  -30.015 1.00 28.98 ? 36  MET H C   1 
ATOM   224  O O   . MET A 1 33  ? 61.771 -8.688  -29.277 1.00 30.91 ? 36  MET H O   1 
ATOM   225  C CB  . MET A 1 33  ? 59.739 -9.496  -31.633 1.00 27.00 ? 36  MET H CB  1 
ATOM   226  C CG  . MET A 1 33  ? 59.418 -9.810  -33.086 1.00 28.41 ? 36  MET H CG  1 
ATOM   227  S SD  . MET A 1 33  ? 58.968 -8.318  -33.992 1.00 31.53 ? 36  MET H SD  1 
ATOM   228  C CE  . MET A 1 33  ? 57.498 -7.805  -33.097 1.00 12.84 ? 36  MET H CE  1 
ATOM   229  N N   . SER A 1 34  ? 60.344 -6.983  -29.599 1.00 25.49 ? 37  SER H N   1 
ATOM   230  C CA  . SER A 1 34  ? 60.493 -6.499  -28.236 1.00 21.06 ? 37  SER H CA  1 
ATOM   231  C C   . SER A 1 34  ? 59.183 -6.128  -27.567 1.00 27.01 ? 37  SER H C   1 
ATOM   232  O O   . SER A 1 34  ? 58.142 -6.007  -28.208 1.00 28.01 ? 37  SER H O   1 
ATOM   233  C CB  . SER A 1 34  ? 61.382 -5.254  -28.220 1.00 16.63 ? 37  SER H CB  1 
ATOM   234  O OG  . SER A 1 34  ? 62.652 -5.493  -28.803 1.00 25.60 ? 37  SER H OG  1 
ATOM   235  N N   . TRP A 1 35  ? 59.257 -5.961  -26.254 1.00 24.76 ? 38  TRP H N   1 
ATOM   236  C CA  . TRP A 1 35  ? 58.129 -5.513  -25.462 1.00 19.19 ? 38  TRP H CA  1 
ATOM   237  C C   . TRP A 1 35  ? 58.710 -4.309  -24.730 1.00 24.55 ? 38  TRP H C   1 
ATOM   238  O O   . TRP A 1 35  ? 59.877 -4.331  -24.304 1.00 20.41 ? 38  TRP H O   1 
ATOM   239  C CB  . TRP A 1 35  ? 57.679 -6.567  -24.444 1.00 23.50 ? 38  TRP H CB  1 
ATOM   240  C CG  . TRP A 1 35  ? 56.836 -7.686  -25.004 1.00 27.24 ? 38  TRP H CG  1 
ATOM   241  C CD1 . TRP A 1 35  ? 57.257 -8.943  -25.339 1.00 23.20 ? 38  TRP H CD1 1 
ATOM   242  C CD2 . TRP A 1 35  ? 55.418 -7.661  -25.245 1.00 24.11 ? 38  TRP H CD2 1 
ATOM   243  N NE1 . TRP A 1 35  ? 56.189 -9.703  -25.766 1.00 27.28 ? 38  TRP H NE1 1 
ATOM   244  C CE2 . TRP A 1 35  ? 55.051 -8.942  -25.719 1.00 22.02 ? 38  TRP H CE2 1 
ATOM   245  C CE3 . TRP A 1 35  ? 54.422 -6.682  -25.099 1.00 24.77 ? 38  TRP H CE3 1 
ATOM   246  C CZ2 . TRP A 1 35  ? 53.733 -9.271  -26.050 1.00 19.58 ? 38  TRP H CZ2 1 
ATOM   247  C CZ3 . TRP A 1 35  ? 53.102 -7.013  -25.427 1.00 18.13 ? 38  TRP H CZ3 1 
ATOM   248  C CH2 . TRP A 1 35  ? 52.774 -8.297  -25.896 1.00 20.67 ? 38  TRP H CH2 1 
ATOM   249  N N   . VAL A 1 36  ? 57.921 -3.245  -24.623 1.00 22.87 ? 39  VAL H N   1 
ATOM   250  C CA  . VAL A 1 36  ? 58.344 -2.040  -23.919 1.00 22.71 ? 39  VAL H CA  1 
ATOM   251  C C   . VAL A 1 36  ? 57.145 -1.576  -23.117 1.00 24.56 ? 39  VAL H C   1 
ATOM   252  O O   . VAL A 1 36  ? 56.023 -2.010  -23.370 1.00 28.22 ? 39  VAL H O   1 
ATOM   253  C CB  . VAL A 1 36  ? 58.762 -0.920  -24.887 1.00 30.00 ? 39  VAL H CB  1 
ATOM   254  C CG1 . VAL A 1 36  ? 59.929 -1.383  -25.731 1.00 24.59 ? 39  VAL H CG1 1 
ATOM   255  C CG2 . VAL A 1 36  ? 57.591 -0.524  -25.763 1.00 29.17 ? 39  VAL H CG2 1 
ATOM   256  N N   . ARG A 1 37  ? 57.362 -0.696  -22.153 1.00 22.32 ? 40  ARG H N   1 
ATOM   257  C CA  . ARG A 1 37  ? 56.238 -0.257  -21.348 1.00 26.73 ? 40  ARG H CA  1 
ATOM   258  C C   . ARG A 1 37  ? 56.416 1.179   -20.920 1.00 27.40 ? 40  ARG H C   1 
ATOM   259  O O   . ARG A 1 37  ? 57.538 1.684   -20.846 1.00 34.76 ? 40  ARG H O   1 
ATOM   260  C CB  . ARG A 1 37  ? 56.101 -1.157  -20.104 1.00 21.34 ? 40  ARG H CB  1 
ATOM   261  C CG  . ARG A 1 37  ? 57.215 -0.952  -19.077 1.00 20.55 ? 40  ARG H CG  1 
ATOM   262  C CD  . ARG A 1 37  ? 57.073 -1.946  -17.930 1.00 30.75 ? 40  ARG H CD  1 
ATOM   263  N NE  . ARG A 1 37  ? 58.197 -1.883  -17.000 1.00 27.67 ? 40  ARG H NE  1 
ATOM   264  C CZ  . ARG A 1 37  ? 58.377 -2.735  -15.989 1.00 32.79 ? 40  ARG H CZ  1 
ATOM   265  N NH1 . ARG A 1 37  ? 57.507 -3.715  -15.772 1.00 28.51 ? 40  ARG H NH1 1 
ATOM   266  N NH2 . ARG A 1 37  ? 59.433 -2.619  -15.203 1.00 25.44 ? 40  ARG H NH2 1 
ATOM   267  N N   . GLN A 1 38  ? 55.303 1.846   -20.654 1.00 36.47 ? 41  GLN H N   1 
ATOM   268  C CA  . GLN A 1 38  ? 55.371 3.220   -20.201 1.00 39.55 ? 41  GLN H CA  1 
ATOM   269  C C   . GLN A 1 38  ? 54.414 3.455   -19.057 1.00 41.58 ? 41  GLN H C   1 
ATOM   270  O O   . GLN A 1 38  ? 53.243 3.080   -19.116 1.00 41.69 ? 41  GLN H O   1 
ATOM   271  C CB  . GLN A 1 38  ? 55.065 4.206   -21.334 1.00 42.38 ? 41  GLN H CB  1 
ATOM   272  C CG  . GLN A 1 38  ? 53.665 4.123   -21.936 1.00 45.79 ? 41  GLN H CG  1 
ATOM   273  C CD  . GLN A 1 38  ? 53.384 5.262   -22.926 1.00 49.61 ? 41  GLN H CD  1 
ATOM   274  O OE1 . GLN A 1 38  ? 52.418 5.220   -23.690 1.00 45.69 ? 41  GLN H OE1 1 
ATOM   275  N NE2 . GLN A 1 38  ? 54.231 6.288   -22.902 1.00 51.17 ? 41  GLN H NE2 1 
ATOM   276  N N   . ILE A 1 39  ? 54.940 4.051   -17.999 1.00 48.08 ? 42  ILE H N   1 
ATOM   277  C CA  . ILE A 1 39  ? 54.144 4.396   -16.838 1.00 55.78 ? 42  ILE H CA  1 
ATOM   278  C C   . ILE A 1 39  ? 53.640 5.780   -17.220 1.00 64.14 ? 42  ILE H C   1 
ATOM   279  O O   . ILE A 1 39  ? 54.387 6.567   -17.799 1.00 63.11 ? 42  ILE H O   1 
ATOM   280  C CB  . ILE A 1 39  ? 55.021 4.488   -15.564 1.00 55.83 ? 42  ILE H CB  1 
ATOM   281  C CG1 . ILE A 1 39  ? 55.362 3.083   -15.058 1.00 56.94 ? 42  ILE H CG1 1 
ATOM   282  C CG2 . ILE A 1 39  ? 54.307 5.285   -14.487 1.00 58.54 ? 42  ILE H CG2 1 
ATOM   283  C CD1 . ILE A 1 39  ? 56.227 2.263   -15.999 1.00 51.75 ? 42  ILE H CD1 1 
ATOM   284  N N   . PRO A 1 40  ? 52.366 6.091   -16.927 1.00 69.64 ? 43  PRO H N   1 
ATOM   285  C CA  . PRO A 1 40  ? 51.826 7.410   -17.272 1.00 72.77 ? 43  PRO H CA  1 
ATOM   286  C C   . PRO A 1 40  ? 52.831 8.542   -17.058 1.00 75.52 ? 43  PRO H C   1 
ATOM   287  O O   . PRO A 1 40  ? 52.805 9.545   -17.773 1.00 77.07 ? 43  PRO H O   1 
ATOM   288  C CB  . PRO A 1 40  ? 50.604 7.518   -16.371 1.00 73.39 ? 43  PRO H CB  1 
ATOM   289  C CG  . PRO A 1 40  ? 50.091 6.105   -16.385 1.00 72.62 ? 43  PRO H CG  1 
ATOM   290  C CD  . PRO A 1 40  ? 51.367 5.295   -16.187 1.00 71.79 ? 43  PRO H CD  1 
ATOM   291  N N   . GLU A 1 41  ? 53.719 8.374   -16.080 1.00 73.89 ? 44  GLU H N   1 
ATOM   292  C CA  . GLU A 1 41  ? 54.745 9.372   -15.798 1.00 73.63 ? 44  GLU H CA  1 
ATOM   293  C C   . GLU A 1 41  ? 55.550 9.673   -17.066 1.00 72.38 ? 44  GLU H C   1 
ATOM   294  O O   . GLU A 1 41  ? 56.247 10.686  -17.149 1.00 72.64 ? 44  GLU H O   1 
ATOM   295  C CB  . GLU A 1 41  ? 55.670 8.869   -14.684 1.00 76.05 ? 44  GLU H CB  1 
ATOM   296  C CG  . GLU A 1 41  ? 56.898 9.734   -14.458 1.00 79.26 ? 44  GLU H CG  1 
ATOM   297  C CD  . GLU A 1 41  ? 58.018 9.416   -15.429 1.00 82.26 ? 44  GLU H CD  1 
ATOM   298  O OE1 . GLU A 1 41  ? 58.792 10.341  -15.767 1.00 81.07 ? 44  GLU H OE1 1 
ATOM   299  O OE2 . GLU A 1 41  ? 58.128 8.239   -15.843 1.00 80.77 ? 44  GLU H OE2 1 
ATOM   300  N N   . LYS A 1 42  ? 55.438 8.770   -18.039 1.00 71.33 ? 45  LYS H N   1 
ATOM   301  C CA  . LYS A 1 42  ? 56.098 8.857   -19.345 1.00 67.21 ? 45  LYS H CA  1 
ATOM   302  C C   . LYS A 1 42  ? 57.540 8.358   -19.414 1.00 64.54 ? 45  LYS H C   1 
ATOM   303  O O   . LYS A 1 42  ? 58.186 8.128   -18.389 1.00 65.71 ? 45  LYS H O   1 
ATOM   304  C CB  . LYS A 1 42  ? 55.995 10.283  -19.902 1.00 66.03 ? 45  LYS H CB  1 
ATOM   305  C CG  . LYS A 1 42  ? 54.555 10.739  -20.084 1.00 61.62 ? 45  LYS H CG  1 
ATOM   306  C CD  . LYS A 1 42  ? 53.729 9.633   -20.722 1.00 63.63 ? 45  LYS H CD  1 
ATOM   307  C CE  . LYS A 1 42  ? 52.255 9.952   -20.703 1.00 61.19 ? 45  LYS H CE  1 
ATOM   308  N NZ  . LYS A 1 42  ? 51.466 8.730   -20.997 1.00 61.44 ? 45  LYS H NZ  1 
ATOM   309  N N   . ARG A 1 43  ? 58.020 8.190   -20.644 1.00 59.20 ? 46  ARG H N   1 
ATOM   310  C CA  . ARG A 1 43  ? 59.362 7.684   -20.939 1.00 50.84 ? 46  ARG H CA  1 
ATOM   311  C C   . ARG A 1 43  ? 59.329 6.164   -20.996 1.00 47.08 ? 46  ARG H C   1 
ATOM   312  O O   . ARG A 1 43  ? 59.153 5.490   -19.978 1.00 45.75 ? 46  ARG H O   1 
ATOM   313  C CB  . ARG A 1 43  ? 60.394 8.126   -19.898 1.00 49.85 ? 46  ARG H CB  1 
ATOM   314  C CG  . ARG A 1 43  ? 61.788 7.621   -20.225 1.00 44.55 ? 46  ARG H CG  1 
ATOM   315  C CD  . ARG A 1 43  ? 62.862 8.363   -19.460 1.00 46.17 ? 46  ARG H CD  1 
ATOM   316  N NE  . ARG A 1 43  ? 64.148 8.269   -20.147 1.00 39.22 ? 46  ARG H NE  1 
ATOM   317  C CZ  . ARG A 1 43  ? 65.224 8.974   -19.821 1.00 35.74 ? 46  ARG H CZ  1 
ATOM   318  N NH1 . ARG A 1 43  ? 65.179 9.830   -18.812 1.00 37.63 ? 46  ARG H NH1 1 
ATOM   319  N NH2 . ARG A 1 43  ? 66.341 8.833   -20.512 1.00 34.94 ? 46  ARG H NH2 1 
ATOM   320  N N   . LEU A 1 44  ? 59.498 5.632   -22.199 1.00 41.46 ? 47  LEU H N   1 
ATOM   321  C CA  . LEU A 1 44  ? 59.472 4.197   -22.406 1.00 37.89 ? 47  LEU H CA  1 
ATOM   322  C C   . LEU A 1 44  ? 60.547 3.430   -21.654 1.00 31.87 ? 47  LEU H C   1 
ATOM   323  O O   . LEU A 1 44  ? 61.657 3.911   -21.451 1.00 29.66 ? 47  LEU H O   1 
ATOM   324  C CB  . LEU A 1 44  ? 59.596 3.879   -23.895 1.00 39.52 ? 47  LEU H CB  1 
ATOM   325  C CG  . LEU A 1 44  ? 58.395 4.272   -24.746 1.00 40.24 ? 47  LEU H CG  1 
ATOM   326  C CD1 . LEU A 1 44  ? 58.652 3.881   -26.191 1.00 41.77 ? 47  LEU H CD1 1 
ATOM   327  C CD2 . LEU A 1 44  ? 57.152 3.575   -24.216 1.00 40.87 ? 47  LEU H CD2 1 
ATOM   328  N N   . GLU A 1 45  ? 60.193 2.216   -21.259 1.00 31.06 ? 48  GLU H N   1 
ATOM   329  C CA  . GLU A 1 45  ? 61.104 1.335   -20.552 1.00 32.55 ? 48  GLU H CA  1 
ATOM   330  C C   . GLU A 1 45  ? 61.173 0.007   -21.301 1.00 25.84 ? 48  GLU H C   1 
ATOM   331  O O   . GLU A 1 45  ? 60.150 -0.625  -21.533 1.00 30.05 ? 48  GLU H O   1 
ATOM   332  C CB  . GLU A 1 45  ? 60.586 1.090   -19.136 1.00 35.79 ? 48  GLU H CB  1 
ATOM   333  C CG  . GLU A 1 45  ? 61.609 0.490   -18.197 1.00 49.91 ? 48  GLU H CG  1 
ATOM   334  C CD  . GLU A 1 45  ? 61.025 0.173   -16.831 1.00 54.68 ? 48  GLU H CD  1 
ATOM   335  O OE1 . GLU A 1 45  ? 60.165 0.952   -16.360 1.00 55.88 ? 48  GLU H OE1 1 
ATOM   336  O OE2 . GLU A 1 45  ? 61.437 -0.846  -16.230 1.00 57.32 ? 48  GLU H OE2 1 
ATOM   337  N N   . TRP A 1 46  ? 62.373 -0.419  -21.681 1.00 28.60 ? 49  TRP H N   1 
ATOM   338  C CA  . TRP A 1 46  ? 62.525 -1.696  -22.381 1.00 26.17 ? 49  TRP H CA  1 
ATOM   339  C C   . TRP A 1 46  ? 62.165 -2.806  -21.404 1.00 28.84 ? 49  TRP H C   1 
ATOM   340  O O   . TRP A 1 46  ? 62.561 -2.762  -20.240 1.00 29.70 ? 49  TRP H O   1 
ATOM   341  C CB  . TRP A 1 46  ? 63.970 -1.859  -22.857 1.00 29.21 ? 49  TRP H CB  1 
ATOM   342  C CG  . TRP A 1 46  ? 64.316 -3.218  -23.383 1.00 32.31 ? 49  TRP H CG  1 
ATOM   343  C CD1 . TRP A 1 46  ? 63.709 -3.888  -24.406 1.00 34.44 ? 49  TRP H CD1 1 
ATOM   344  C CD2 . TRP A 1 46  ? 65.394 -4.053  -22.940 1.00 33.35 ? 49  TRP H CD2 1 
ATOM   345  N NE1 . TRP A 1 46  ? 64.344 -5.088  -24.631 1.00 28.14 ? 49  TRP H NE1 1 
ATOM   346  C CE2 . TRP A 1 46  ? 65.381 -5.214  -23.745 1.00 32.42 ? 49  TRP H CE2 1 
ATOM   347  C CE3 . TRP A 1 46  ? 66.373 -3.930  -21.939 1.00 32.07 ? 49  TRP H CE3 1 
ATOM   348  C CZ2 . TRP A 1 46  ? 66.308 -6.248  -23.584 1.00 33.55 ? 49  TRP H CZ2 1 
ATOM   349  C CZ3 . TRP A 1 46  ? 67.299 -4.958  -21.777 1.00 31.88 ? 49  TRP H CZ3 1 
ATOM   350  C CH2 . TRP A 1 46  ? 67.258 -6.102  -22.598 1.00 35.49 ? 49  TRP H CH2 1 
ATOM   351  N N   . VAL A 1 47  ? 61.426 -3.805  -21.874 1.00 25.70 ? 50  VAL H N   1 
ATOM   352  C CA  . VAL A 1 47  ? 61.002 -4.899  -21.014 1.00 29.63 ? 50  VAL H CA  1 
ATOM   353  C C   . VAL A 1 47  ? 61.591 -6.249  -21.410 1.00 32.87 ? 50  VAL H C   1 
ATOM   354  O O   . VAL A 1 47  ? 61.924 -7.060  -20.542 1.00 30.51 ? 50  VAL H O   1 
ATOM   355  C CB  . VAL A 1 47  ? 59.466 -5.011  -20.996 1.00 30.28 ? 50  VAL H CB  1 
ATOM   356  C CG1 . VAL A 1 47  ? 59.033 -6.175  -20.135 1.00 34.85 ? 50  VAL H CG1 1 
ATOM   357  C CG2 . VAL A 1 47  ? 58.869 -3.720  -20.482 1.00 33.86 ? 50  VAL H CG2 1 
ATOM   358  N N   . ALA A 1 48  ? 61.710 -6.490  -22.713 1.00 28.28 ? 51  ALA H N   1 
ATOM   359  C CA  . ALA A 1 48  ? 62.265 -7.741  -23.213 1.00 29.44 ? 51  ALA H CA  1 
ATOM   360  C C   . ALA A 1 48  ? 62.383 -7.743  -24.738 1.00 33.09 ? 51  ALA H C   1 
ATOM   361  O O   . ALA A 1 48  ? 61.663 -7.013  -25.436 1.00 29.77 ? 51  ALA H O   1 
ATOM   362  C CB  . ALA A 1 48  ? 61.398 -8.914  -22.760 1.00 25.31 ? 51  ALA H CB  1 
ATOM   363  N N   . SER A 1 49  ? 63.307 -8.557  -25.242 1.00 30.59 ? 52  SER H N   1 
ATOM   364  C CA  . SER A 1 49  ? 63.527 -8.708  -26.677 1.00 28.98 ? 52  SER H CA  1 
ATOM   365  C C   . SER A 1 49  ? 63.881 -10.166 -26.970 1.00 33.99 ? 52  SER H C   1 
ATOM   366  O O   . SER A 1 49  ? 64.379 -10.882 -26.100 1.00 32.63 ? 52  SER H O   1 
ATOM   367  C CB  . SER A 1 49  ? 64.681 -7.821  -27.164 1.00 26.59 ? 52  SER H CB  1 
ATOM   368  O OG  . SER A 1 49  ? 64.326 -6.451  -27.205 1.00 29.54 ? 52  SER H OG  1 
ATOM   369  N N   . ILE A 1 50  ? 63.605 -10.598 -28.194 1.00 30.49 ? 53  ILE H N   1 
ATOM   370  C CA  . ILE A 1 50  ? 63.927 -11.949 -28.631 1.00 29.60 ? 53  ILE H CA  1 
ATOM   371  C C   . ILE A 1 50  ? 64.413 -11.825 -30.063 1.00 31.35 ? 53  ILE H C   1 
ATOM   372  O O   . ILE A 1 50  ? 63.725 -11.251 -30.915 1.00 31.42 ? 53  ILE H O   1 
ATOM   373  C CB  . ILE A 1 50  ? 62.715 -12.901 -28.566 1.00 29.34 ? 53  ILE H CB  1 
ATOM   374  C CG1 . ILE A 1 50  ? 63.149 -14.309 -29.005 1.00 30.66 ? 53  ILE H CG1 1 
ATOM   375  C CG2 . ILE A 1 50  ? 61.568 -12.367 -29.411 1.00 28.65 ? 53  ILE H CG2 1 
ATOM   376  C CD1 . ILE A 1 50  ? 62.069 -15.377 -28.826 1.00 29.55 ? 53  ILE H CD1 1 
ATOM   377  N N   . SER A 1 51  ? 65.610 -12.335 -30.319 1.00 25.75 ? 54  SER H N   1 
ATOM   378  C CA  . SER A 1 51  ? 66.199 -12.247 -31.647 1.00 29.76 ? 54  SER H CA  1 
ATOM   379  C C   . SER A 1 51  ? 65.538 -13.180 -32.638 1.00 29.42 ? 54  SER H C   1 
ATOM   380  O O   . SER A 1 51  ? 64.668 -13.975 -32.288 1.00 28.45 ? 54  SER H O   1 
ATOM   381  C CB  . SER A 1 51  ? 67.698 -12.562 -31.587 1.00 32.91 ? 54  SER H CB  1 
ATOM   382  O OG  . SER A 1 51  ? 67.917 -13.920 -31.239 1.00 32.53 ? 54  SER H OG  1 
ATOM   383  N N   . SER A 1 52  ? 65.969 -13.082 -33.888 1.00 32.42 ? 55  SER H N   1 
ATOM   384  C CA  . SER A 1 52  ? 65.425 -13.932 -34.920 1.00 33.96 ? 55  SER H CA  1 
ATOM   385  C C   . SER A 1 52  ? 65.815 -15.366 -34.575 1.00 34.21 ? 55  SER H C   1 
ATOM   386  O O   . SER A 1 52  ? 65.046 -16.297 -34.804 1.00 35.21 ? 55  SER H O   1 
ATOM   387  C CB  . SER A 1 52  ? 65.998 -13.530 -36.277 1.00 34.49 ? 55  SER H CB  1 
ATOM   388  O OG  . SER A 1 52  ? 65.143 -13.965 -37.311 1.00 38.22 ? 55  SER H OG  1 
ATOM   389  N N   . GLY A 1 53  ? 67.007 -15.529 -34.004 1.00 35.23 ? 56  GLY H N   1 
ATOM   390  C CA  . GLY A 1 53  ? 67.482 -16.848 -33.632 1.00 38.03 ? 56  GLY H CA  1 
ATOM   391  C C   . GLY A 1 53  ? 66.905 -17.373 -32.328 1.00 39.53 ? 56  GLY H C   1 
ATOM   392  O O   . GLY A 1 53  ? 67.326 -18.421 -31.833 1.00 39.58 ? 56  GLY H O   1 
ATOM   393  N N   . GLY A 1 54  ? 65.949 -16.643 -31.760 1.00 38.64 ? 57  GLY H N   1 
ATOM   394  C CA  . GLY A 1 54  ? 65.328 -17.078 -30.524 1.00 37.66 ? 57  GLY H CA  1 
ATOM   395  C C   . GLY A 1 54  ? 66.049 -16.714 -29.236 1.00 36.79 ? 57  GLY H C   1 
ATOM   396  O O   . GLY A 1 54  ? 65.634 -17.154 -28.164 1.00 37.57 ? 57  GLY H O   1 
ATOM   397  N N   . ILE A 1 55  ? 67.116 -15.925 -29.320 1.00 33.33 ? 58  ILE H N   1 
ATOM   398  C CA  . ILE A 1 55  ? 67.843 -15.527 -28.114 1.00 37.77 ? 58  ILE H CA  1 
ATOM   399  C C   . ILE A 1 55  ? 67.026 -14.475 -27.360 1.00 40.79 ? 58  ILE H C   1 
ATOM   400  O O   . ILE A 1 55  ? 66.528 -13.515 -27.960 1.00 34.61 ? 58  ILE H O   1 
ATOM   401  C CB  . ILE A 1 55  ? 69.223 -14.922 -28.451 1.00 37.76 ? 58  ILE H CB  1 
ATOM   402  C CG1 . ILE A 1 55  ? 70.007 -15.864 -29.369 1.00 42.11 ? 58  ILE H CG1 1 
ATOM   403  C CG2 . ILE A 1 55  ? 69.997 -14.665 -27.166 1.00 36.82 ? 58  ILE H CG2 1 
ATOM   404  C CD1 . ILE A 1 55  ? 70.319 -17.220 -28.763 1.00 44.51 ? 58  ILE H CD1 1 
ATOM   405  N N   . THR A 1 56  ? 66.892 -14.649 -26.048 1.00 38.34 ? 59  THR H N   1 
ATOM   406  C CA  . THR A 1 56  ? 66.120 -13.709 -25.246 1.00 36.73 ? 59  THR H CA  1 
ATOM   407  C C   . THR A 1 56  ? 66.981 -12.776 -24.419 1.00 37.29 ? 59  THR H C   1 
ATOM   408  O O   . THR A 1 56  ? 68.015 -13.180 -23.886 1.00 39.30 ? 59  THR H O   1 
ATOM   409  C CB  . THR A 1 56  ? 65.161 -14.448 -24.315 1.00 41.77 ? 59  THR H CB  1 
ATOM   410  O OG1 . THR A 1 56  ? 65.905 -15.325 -23.455 1.00 44.00 ? 59  THR H OG1 1 
ATOM   411  C CG2 . THR A 1 56  ? 64.167 -15.253 -25.127 1.00 36.04 ? 59  THR H CG2 1 
ATOM   412  N N   . TYR A 1 57  ? 66.547 -11.519 -24.329 1.00 34.87 ? 60  TYR H N   1 
ATOM   413  C CA  . TYR A 1 57  ? 67.253 -10.497 -23.565 1.00 31.93 ? 60  TYR H CA  1 
ATOM   414  C C   . TYR A 1 57  ? 66.265 -9.855  -22.607 1.00 30.90 ? 60  TYR H C   1 
ATOM   415  O O   . TYR A 1 57  ? 65.111 -9.623  -22.965 1.00 31.38 ? 60  TYR H O   1 
ATOM   416  C CB  . TYR A 1 57  ? 67.838 -9.425  -24.491 1.00 29.00 ? 60  TYR H CB  1 
ATOM   417  C CG  . TYR A 1 57  ? 68.714 -9.973  -25.583 1.00 35.10 ? 60  TYR H CG  1 
ATOM   418  C CD1 . TYR A 1 57  ? 68.153 -10.554 -26.719 1.00 30.72 ? 60  TYR H CD1 1 
ATOM   419  C CD2 . TYR A 1 57  ? 70.103 -9.943  -25.474 1.00 35.05 ? 60  TYR H CD2 1 
ATOM   420  C CE1 . TYR A 1 57  ? 68.942 -11.089 -27.711 1.00 37.71 ? 60  TYR H CE1 1 
ATOM   421  C CE2 . TYR A 1 57  ? 70.909 -10.487 -26.479 1.00 40.99 ? 60  TYR H CE2 1 
ATOM   422  C CZ  . TYR A 1 57  ? 70.316 -11.057 -27.591 1.00 38.58 ? 60  TYR H CZ  1 
ATOM   423  O OH  . TYR A 1 57  ? 71.087 -11.606 -28.588 1.00 46.03 ? 60  TYR H OH  1 
ATOM   424  N N   . TYR A 1 58  ? 66.719 -9.568  -21.390 1.00 31.06 ? 61  TYR H N   1 
ATOM   425  C CA  . TYR A 1 58  ? 65.860 -8.963  -20.379 1.00 27.25 ? 61  TYR H CA  1 
ATOM   426  C C   . TYR A 1 58  ? 66.688 -8.028  -19.520 1.00 27.85 ? 61  TYR H C   1 
ATOM   427  O O   . TYR A 1 58  ? 67.866 -8.286  -19.290 1.00 30.13 ? 61  TYR H O   1 
ATOM   428  C CB  . TYR A 1 58  ? 65.291 -10.026 -19.432 1.00 29.71 ? 61  TYR H CB  1 
ATOM   429  C CG  . TYR A 1 58  ? 64.529 -11.162 -20.064 1.00 27.38 ? 61  TYR H CG  1 
ATOM   430  C CD1 . TYR A 1 58  ? 63.179 -11.035 -20.376 1.00 28.22 ? 61  TYR H CD1 1 
ATOM   431  C CD2 . TYR A 1 58  ? 65.160 -12.376 -20.345 1.00 28.45 ? 61  TYR H CD2 1 
ATOM   432  C CE1 . TYR A 1 58  ? 62.472 -12.087 -20.958 1.00 32.34 ? 61  TYR H CE1 1 
ATOM   433  C CE2 . TYR A 1 58  ? 64.462 -13.435 -20.925 1.00 28.04 ? 61  TYR H CE2 1 
ATOM   434  C CZ  . TYR A 1 58  ? 63.121 -13.282 -21.230 1.00 27.73 ? 61  TYR H CZ  1 
ATOM   435  O OH  . TYR A 1 58  ? 62.431 -14.317 -21.823 1.00 30.82 ? 61  TYR H OH  1 
ATOM   436  N N   . PRO A 1 59  ? 66.095 -6.913  -19.062 1.00 26.77 ? 62  PRO H N   1 
ATOM   437  C CA  . PRO A 1 59  ? 66.853 -5.999  -18.207 1.00 28.22 ? 62  PRO H CA  1 
ATOM   438  C C   . PRO A 1 59  ? 66.696 -6.594  -16.793 1.00 30.16 ? 62  PRO H C   1 
ATOM   439  O O   . PRO A 1 59  ? 65.788 -7.388  -16.554 1.00 26.65 ? 62  PRO H O   1 
ATOM   440  C CB  . PRO A 1 59  ? 66.111 -4.676  -18.378 1.00 25.65 ? 62  PRO H CB  1 
ATOM   441  C CG  . PRO A 1 59  ? 64.694 -5.130  -18.553 1.00 20.94 ? 62  PRO H CG  1 
ATOM   442  C CD  . PRO A 1 59  ? 64.838 -6.285  -19.510 1.00 20.39 ? 62  PRO H CD  1 
ATOM   443  N N   . ASP A 1 60  ? 67.574 -6.231  -15.869 1.00 35.14 ? 63  ASP H N   1 
ATOM   444  C CA  . ASP A 1 60  ? 67.485 -6.776  -14.516 1.00 41.80 ? 63  ASP H CA  1 
ATOM   445  C C   . ASP A 1 60  ? 66.107 -6.650  -13.875 1.00 42.97 ? 63  ASP H C   1 
ATOM   446  O O   . ASP A 1 60  ? 65.669 -7.546  -13.167 1.00 48.48 ? 63  ASP H O   1 
ATOM   447  C CB  . ASP A 1 60  ? 68.522 -6.120  -13.602 1.00 42.44 ? 63  ASP H CB  1 
ATOM   448  C CG  . ASP A 1 60  ? 69.941 -6.445  -14.009 1.00 43.86 ? 63  ASP H CG  1 
ATOM   449  O OD1 . ASP A 1 60  ? 70.199 -7.606  -14.390 1.00 50.65 ? 63  ASP H OD1 1 
ATOM   450  O OD2 . ASP A 1 60  ? 70.803 -5.546  -13.937 1.00 52.32 ? 63  ASP H OD2 1 
ATOM   451  N N   . SER A 1 61  ? 65.422 -5.544  -14.133 1.00 44.15 ? 64  SER H N   1 
ATOM   452  C CA  . SER A 1 61  ? 64.103 -5.300  -13.555 1.00 40.80 ? 64  SER H CA  1 
ATOM   453  C C   . SER A 1 61  ? 63.079 -6.426  -13.694 1.00 41.87 ? 64  SER H C   1 
ATOM   454  O O   . SER A 1 61  ? 62.121 -6.488  -12.924 1.00 44.98 ? 64  SER H O   1 
ATOM   455  C CB  . SER A 1 61  ? 63.498 -4.036  -14.157 1.00 42.26 ? 64  SER H CB  1 
ATOM   456  O OG  . SER A 1 61  ? 63.057 -4.286  -15.480 1.00 37.24 ? 64  SER H OG  1 
ATOM   457  N N   . VAL A 1 62  ? 63.253 -7.304  -14.676 1.00 38.40 ? 65  VAL H N   1 
ATOM   458  C CA  . VAL A 1 62  ? 62.291 -8.385  -14.871 1.00 32.64 ? 65  VAL H CA  1 
ATOM   459  C C   . VAL A 1 62  ? 62.991 -9.715  -15.147 1.00 30.98 ? 65  VAL H C   1 
ATOM   460  O O   . VAL A 1 62  ? 62.347 -10.755 -15.267 1.00 31.64 ? 65  VAL H O   1 
ATOM   461  C CB  . VAL A 1 62  ? 61.323 -8.070  -16.061 1.00 34.12 ? 65  VAL H CB  1 
ATOM   462  C CG1 . VAL A 1 62  ? 60.757 -6.655  -15.919 1.00 29.03 ? 65  VAL H CG1 1 
ATOM   463  C CG2 . VAL A 1 62  ? 62.036 -8.238  -17.412 1.00 29.73 ? 65  VAL H CG2 1 
ATOM   464  N N   . ALA A 1 63  ? 64.316 -9.654  -15.229 1.00 32.71 ? 66  ALA H N   1 
ATOM   465  C CA  . ALA A 1 63  ? 65.185 -10.788 -15.539 1.00 39.16 ? 66  ALA H CA  1 
ATOM   466  C C   . ALA A 1 63  ? 64.712 -12.213 -15.251 1.00 46.41 ? 66  ALA H C   1 
ATOM   467  O O   . ALA A 1 63  ? 64.880 -13.095 -16.100 1.00 52.63 ? 66  ALA H O   1 
ATOM   468  C CB  . ALA A 1 63  ? 66.554 -10.565 -14.901 1.00 42.33 ? 66  ALA H CB  1 
ATOM   469  N N   . GLY A 1 64  ? 64.136 -12.465 -14.081 1.00 44.04 ? 67  GLY H N   1 
ATOM   470  C CA  . GLY A 1 64  ? 63.707 -13.825 -13.800 1.00 46.30 ? 67  GLY H CA  1 
ATOM   471  C C   . GLY A 1 64  ? 62.218 -14.020 -13.614 1.00 46.06 ? 67  GLY H C   1 
ATOM   472  O O   . GLY A 1 64  ? 61.772 -15.108 -13.246 1.00 47.56 ? 67  GLY H O   1 
ATOM   473  N N   . ARG A 1 65  ? 61.445 -12.972 -13.877 1.00 44.10 ? 68  ARG H N   1 
ATOM   474  C CA  . ARG A 1 65  ? 60.002 -13.033 -13.708 1.00 38.99 ? 68  ARG H CA  1 
ATOM   475  C C   . ARG A 1 65  ? 59.249 -12.993 -15.029 1.00 37.39 ? 68  ARG H C   1 
ATOM   476  O O   . ARG A 1 65  ? 58.156 -13.549 -15.136 1.00 36.55 ? 68  ARG H O   1 
ATOM   477  C CB  . ARG A 1 65  ? 59.548 -11.879 -12.814 1.00 39.00 ? 68  ARG H CB  1 
ATOM   478  C CG  . ARG A 1 65  ? 60.255 -11.845 -11.474 1.00 40.17 ? 68  ARG H CG  1 
ATOM   479  C CD  . ARG A 1 65  ? 59.825 -10.649 -10.634 1.00 43.32 ? 68  ARG H CD  1 
ATOM   480  N NE  . ARG A 1 65  ? 60.185 -9.372  -11.248 1.00 40.99 ? 68  ARG H NE  1 
ATOM   481  C CZ  . ARG A 1 65  ? 59.302 -8.488  -11.708 1.00 42.76 ? 68  ARG H CZ  1 
ATOM   482  N NH1 . ARG A 1 65  ? 58.004 -8.738  -11.626 1.00 35.67 ? 68  ARG H NH1 1 
ATOM   483  N NH2 . ARG A 1 65  ? 59.716 -7.349  -12.249 1.00 46.34 ? 68  ARG H NH2 1 
ATOM   484  N N   . PHE A 1 66  ? 59.833 -12.339 -16.030 1.00 35.50 ? 69  PHE H N   1 
ATOM   485  C CA  . PHE A 1 66  ? 59.194 -12.235 -17.342 1.00 34.94 ? 69  PHE H CA  1 
ATOM   486  C C   . PHE A 1 66  ? 59.791 -13.168 -18.387 1.00 32.93 ? 69  PHE H C   1 
ATOM   487  O O   . PHE A 1 66  ? 60.996 -13.398 -18.414 1.00 35.88 ? 69  PHE H O   1 
ATOM   488  C CB  . PHE A 1 66  ? 59.286 -10.797 -17.861 1.00 37.54 ? 69  PHE H CB  1 
ATOM   489  C CG  . PHE A 1 66  ? 58.449 -9.814  -17.090 1.00 36.89 ? 69  PHE H CG  1 
ATOM   490  C CD1 . PHE A 1 66  ? 58.214 -8.543  -17.597 1.00 37.61 ? 69  PHE H CD1 1 
ATOM   491  C CD2 . PHE A 1 66  ? 57.899 -10.154 -15.857 1.00 39.61 ? 69  PHE H CD2 1 
ATOM   492  C CE1 . PHE A 1 66  ? 57.445 -7.626  -16.890 1.00 41.14 ? 69  PHE H CE1 1 
ATOM   493  C CE2 . PHE A 1 66  ? 57.128 -9.244  -15.145 1.00 37.10 ? 69  PHE H CE2 1 
ATOM   494  C CZ  . PHE A 1 66  ? 56.903 -7.975  -15.664 1.00 39.13 ? 69  PHE H CZ  1 
ATOM   495  N N   . THR A 1 67  ? 58.941 -13.705 -19.252 1.00 34.64 ? 70  THR H N   1 
ATOM   496  C CA  . THR A 1 67  ? 59.414 -14.588 -20.307 1.00 35.28 ? 70  THR H CA  1 
ATOM   497  C C   . THR A 1 67  ? 58.826 -14.192 -21.654 1.00 33.81 ? 70  THR H C   1 
ATOM   498  O O   . THR A 1 67  ? 57.612 -14.272 -21.861 1.00 36.21 ? 70  THR H O   1 
ATOM   499  C CB  . THR A 1 67  ? 59.037 -16.061 -20.040 1.00 33.03 ? 70  THR H CB  1 
ATOM   500  O OG1 . THR A 1 67  ? 59.649 -16.494 -18.819 1.00 36.99 ? 70  THR H OG1 1 
ATOM   501  C CG2 . THR A 1 67  ? 59.518 -16.950 -21.199 1.00 36.74 ? 70  THR H CG2 1 
ATOM   502  N N   . ILE A 1 68  ? 59.687 -13.765 -22.568 1.00 30.78 ? 71  ILE H N   1 
ATOM   503  C CA  . ILE A 1 68  ? 59.234 -13.397 -23.896 1.00 29.54 ? 71  ILE H CA  1 
ATOM   504  C C   . ILE A 1 68  ? 59.403 -14.622 -24.780 1.00 32.58 ? 71  ILE H C   1 
ATOM   505  O O   . ILE A 1 68  ? 60.416 -15.307 -24.699 1.00 30.18 ? 71  ILE H O   1 
ATOM   506  C CB  . ILE A 1 68  ? 60.062 -12.225 -24.476 1.00 29.26 ? 71  ILE H CB  1 
ATOM   507  C CG1 . ILE A 1 68  ? 59.484 -11.799 -25.831 1.00 32.69 ? 71  ILE H CG1 1 
ATOM   508  C CG2 . ILE A 1 68  ? 61.513 -12.633 -24.619 1.00 23.02 ? 71  ILE H CG2 1 
ATOM   509  C CD1 . ILE A 1 68  ? 60.127 -10.524 -26.406 1.00 29.72 ? 71  ILE H CD1 1 
ATOM   510  N N   . SER A 1 69  ? 58.402 -14.908 -25.604 1.00 33.31 ? 72  SER H N   1 
ATOM   511  C CA  . SER A 1 69  ? 58.470 -16.047 -26.516 1.00 31.28 ? 72  SER H CA  1 
ATOM   512  C C   . SER A 1 69  ? 57.722 -15.712 -27.803 1.00 36.29 ? 72  SER H C   1 
ATOM   513  O O   . SER A 1 69  ? 56.984 -14.724 -27.868 1.00 39.31 ? 72  SER H O   1 
ATOM   514  C CB  . SER A 1 69  ? 57.854 -17.288 -25.880 1.00 29.32 ? 72  SER H CB  1 
ATOM   515  O OG  . SER A 1 69  ? 56.449 -17.158 -25.813 1.00 36.07 ? 72  SER H OG  1 
ATOM   516  N N   . ARG A 1 70  ? 57.900 -16.554 -28.815 1.00 34.70 ? 73  ARG H N   1 
ATOM   517  C CA  . ARG A 1 70  ? 57.281 -16.332 -30.110 1.00 35.19 ? 73  ARG H CA  1 
ATOM   518  C C   . ARG A 1 70  ? 56.834 -17.626 -30.777 1.00 36.99 ? 73  ARG H C   1 
ATOM   519  O O   . ARG A 1 70  ? 57.548 -18.627 -30.756 1.00 38.33 ? 73  ARG H O   1 
ATOM   520  C CB  . ARG A 1 70  ? 58.283 -15.606 -31.016 1.00 35.85 ? 73  ARG H CB  1 
ATOM   521  C CG  . ARG A 1 70  ? 57.927 -15.571 -32.500 1.00 43.18 ? 73  ARG H CG  1 
ATOM   522  C CD  . ARG A 1 70  ? 58.966 -14.752 -33.270 1.00 42.29 ? 73  ARG H CD  1 
ATOM   523  N NE  . ARG A 1 70  ? 60.312 -15.285 -33.097 1.00 37.24 ? 73  ARG H NE  1 
ATOM   524  C CZ  . ARG A 1 70  ? 61.419 -14.547 -33.077 1.00 44.81 ? 73  ARG H CZ  1 
ATOM   525  N NH1 . ARG A 1 70  ? 61.351 -13.224 -33.223 1.00 38.40 ? 73  ARG H NH1 1 
ATOM   526  N NH2 . ARG A 1 70  ? 62.599 -15.131 -32.889 1.00 40.45 ? 73  ARG H NH2 1 
ATOM   527  N N   . ASP A 1 71  ? 55.636 -17.606 -31.347 1.00 36.85 ? 74  ASP H N   1 
ATOM   528  C CA  . ASP A 1 71  ? 55.115 -18.761 -32.064 1.00 37.04 ? 74  ASP H CA  1 
ATOM   529  C C   . ASP A 1 71  ? 55.297 -18.400 -33.530 1.00 40.46 ? 74  ASP H C   1 
ATOM   530  O O   . ASP A 1 71  ? 54.475 -17.691 -34.105 1.00 38.76 ? 74  ASP H O   1 
ATOM   531  C CB  . ASP A 1 71  ? 53.632 -18.978 -31.751 1.00 36.90 ? 74  ASP H CB  1 
ATOM   532  C CG  . ASP A 1 71  ? 53.004 -20.075 -32.605 1.00 41.60 ? 74  ASP H CG  1 
ATOM   533  O OD1 . ASP A 1 71  ? 51.875 -20.501 -32.270 1.00 41.57 ? 74  ASP H OD1 1 
ATOM   534  O OD2 . ASP A 1 71  ? 53.629 -20.505 -33.612 1.00 33.41 ? 74  ASP H OD2 1 
ATOM   535  N N   . ASN A 1 72  ? 56.388 -18.883 -34.119 1.00 40.22 ? 75  ASN H N   1 
ATOM   536  C CA  . ASN A 1 72  ? 56.712 -18.600 -35.509 1.00 41.73 ? 75  ASN H CA  1 
ATOM   537  C C   . ASN A 1 72  ? 55.676 -19.038 -36.542 1.00 44.08 ? 75  ASN H C   1 
ATOM   538  O O   . ASN A 1 72  ? 55.577 -18.434 -37.606 1.00 47.51 ? 75  ASN H O   1 
ATOM   539  C CB  . ASN A 1 72  ? 58.076 -19.205 -35.859 1.00 41.35 ? 75  ASN H CB  1 
ATOM   540  C CG  . ASN A 1 72  ? 59.200 -18.638 -35.007 1.00 49.56 ? 75  ASN H CG  1 
ATOM   541  O OD1 . ASN A 1 72  ? 59.299 -17.424 -34.809 1.00 51.10 ? 75  ASN H OD1 1 
ATOM   542  N ND2 . ASN A 1 72  ? 60.058 -19.516 -34.501 1.00 53.70 ? 75  ASN H ND2 1 
ATOM   543  N N   . VAL A 1 73  ? 54.903 -20.072 -36.233 1.00 44.35 ? 76  VAL H N   1 
ATOM   544  C CA  . VAL A 1 73  ? 53.896 -20.564 -37.170 1.00 43.69 ? 76  VAL H CA  1 
ATOM   545  C C   . VAL A 1 73  ? 52.637 -19.713 -37.169 1.00 44.03 ? 76  VAL H C   1 
ATOM   546  O O   . VAL A 1 73  ? 52.156 -19.300 -38.222 1.00 46.45 ? 76  VAL H O   1 
ATOM   547  C CB  . VAL A 1 73  ? 53.474 -22.015 -36.858 1.00 48.19 ? 76  VAL H CB  1 
ATOM   548  C CG1 . VAL A 1 73  ? 52.374 -22.450 -37.828 1.00 44.20 ? 76  VAL H CG1 1 
ATOM   549  C CG2 . VAL A 1 73  ? 54.671 -22.940 -36.960 1.00 45.55 ? 76  VAL H CG2 1 
ATOM   550  N N   . ARG A 1 74  ? 52.091 -19.467 -35.986 1.00 43.26 ? 77  ARG H N   1 
ATOM   551  C CA  . ARG A 1 74  ? 50.886 -18.658 -35.875 1.00 41.10 ? 77  ARG H CA  1 
ATOM   552  C C   . ARG A 1 74  ? 51.232 -17.171 -35.924 1.00 36.35 ? 77  ARG H C   1 
ATOM   553  O O   . ARG A 1 74  ? 50.343 -16.324 -35.978 1.00 35.92 ? 77  ARG H O   1 
ATOM   554  C CB  . ARG A 1 74  ? 50.165 -18.957 -34.564 1.00 43.53 ? 77  ARG H CB  1 
ATOM   555  C CG  . ARG A 1 74  ? 48.749 -19.485 -34.725 1.00 51.50 ? 77  ARG H CG  1 
ATOM   556  C CD  . ARG A 1 74  ? 48.711 -20.979 -34.489 1.00 52.23 ? 77  ARG H CD  1 
ATOM   557  N NE  . ARG A 1 74  ? 49.359 -21.320 -33.226 1.00 54.17 ? 77  ARG H NE  1 
ATOM   558  C CZ  . ARG A 1 74  ? 49.432 -22.549 -32.726 1.00 55.52 ? 77  ARG H CZ  1 
ATOM   559  N NH1 . ARG A 1 74  ? 48.893 -23.569 -33.379 1.00 53.93 ? 77  ARG H NH1 1 
ATOM   560  N NH2 . ARG A 1 74  ? 50.051 -22.757 -31.572 1.00 51.79 ? 77  ARG H NH2 1 
ATOM   561  N N   . ASN A 1 75  ? 52.526 -16.866 -35.890 1.00 35.81 ? 78  ASN H N   1 
ATOM   562  C CA  . ASN A 1 75  ? 53.005 -15.482 -35.920 1.00 36.20 ? 78  ASN H CA  1 
ATOM   563  C C   . ASN A 1 75  ? 52.437 -14.695 -34.734 1.00 34.81 ? 78  ASN H C   1 
ATOM   564  O O   . ASN A 1 75  ? 51.727 -13.708 -34.914 1.00 33.38 ? 78  ASN H O   1 
ATOM   565  C CB  . ASN A 1 75  ? 52.607 -14.812 -37.247 1.00 33.94 ? 78  ASN H CB  1 
ATOM   566  C CG  . ASN A 1 75  ? 53.388 -13.533 -37.520 1.00 34.88 ? 78  ASN H CG  1 
ATOM   567  O OD1 . ASN A 1 75  ? 54.612 -13.508 -37.428 1.00 40.08 ? 78  ASN H OD1 1 
ATOM   568  N ND2 . ASN A 1 75  ? 52.681 -12.468 -37.870 1.00 32.30 ? 78  ASN H ND2 1 
ATOM   569  N N   . ILE A 1 76  ? 52.760 -15.148 -33.522 1.00 32.87 ? 79  ILE H N   1 
ATOM   570  C CA  . ILE A 1 76  ? 52.297 -14.508 -32.292 1.00 32.96 ? 79  ILE H CA  1 
ATOM   571  C C   . ILE A 1 76  ? 53.462 -14.268 -31.319 1.00 32.69 ? 79  ILE H C   1 
ATOM   572  O O   . ILE A 1 76  ? 54.327 -15.128 -31.140 1.00 32.11 ? 79  ILE H O   1 
ATOM   573  C CB  . ILE A 1 76  ? 51.232 -15.377 -31.589 1.00 34.70 ? 79  ILE H CB  1 
ATOM   574  C CG1 . ILE A 1 76  ? 50.055 -15.621 -32.537 1.00 35.91 ? 79  ILE H CG1 1 
ATOM   575  C CG2 . ILE A 1 76  ? 50.757 -14.700 -30.311 1.00 33.42 ? 79  ILE H CG2 1 
ATOM   576  C CD1 . ILE A 1 76  ? 48.983 -16.527 -31.986 1.00 40.60 ? 79  ILE H CD1 1 
ATOM   577  N N   . LEU A 1 77  ? 53.478 -13.092 -30.702 1.00 29.41 ? 80  LEU H N   1 
ATOM   578  C CA  . LEU A 1 77  ? 54.529 -12.724 -29.755 1.00 29.08 ? 80  LEU H CA  1 
ATOM   579  C C   . LEU A 1 77  ? 53.902 -12.784 -28.368 1.00 28.95 ? 80  LEU H C   1 
ATOM   580  O O   . LEU A 1 77  ? 52.791 -12.296 -28.176 1.00 32.28 ? 80  LEU H O   1 
ATOM   581  C CB  . LEU A 1 77  ? 55.023 -11.295 -30.041 1.00 28.18 ? 80  LEU H CB  1 
ATOM   582  C CG  . LEU A 1 77  ? 56.483 -10.859 -29.837 1.00 35.16 ? 80  LEU H CG  1 
ATOM   583  C CD1 . LEU A 1 77  ? 56.525 -9.599  -28.985 1.00 30.37 ? 80  LEU H CD1 1 
ATOM   584  C CD2 . LEU A 1 77  ? 57.286 -11.945 -29.197 1.00 29.46 ? 80  LEU H CD2 1 
ATOM   585  N N   . TYR A 1 78  ? 54.606 -13.385 -27.409 1.00 32.17 ? 81  TYR H N   1 
ATOM   586  C CA  . TYR A 1 78  ? 54.084 -13.501 -26.048 1.00 31.45 ? 81  TYR H CA  1 
ATOM   587  C C   . TYR A 1 78  ? 54.981 -12.879 -24.987 1.00 31.16 ? 81  TYR H C   1 
ATOM   588  O O   . TYR A 1 78  ? 56.192 -12.742 -25.158 1.00 34.91 ? 81  TYR H O   1 
ATOM   589  C CB  . TYR A 1 78  ? 53.869 -14.969 -25.666 1.00 31.78 ? 81  TYR H CB  1 
ATOM   590  C CG  . TYR A 1 78  ? 52.848 -15.727 -26.489 1.00 31.85 ? 81  TYR H CG  1 
ATOM   591  C CD1 . TYR A 1 78  ? 53.249 -16.626 -27.474 1.00 29.39 ? 81  TYR H CD1 1 
ATOM   592  C CD2 . TYR A 1 78  ? 51.484 -15.569 -26.257 1.00 31.79 ? 81  TYR H CD2 1 
ATOM   593  C CE1 . TYR A 1 78  ? 52.319 -17.359 -28.209 1.00 32.81 ? 81  TYR H CE1 1 
ATOM   594  C CE2 . TYR A 1 78  ? 50.537 -16.293 -26.986 1.00 30.92 ? 81  TYR H CE2 1 
ATOM   595  C CZ  . TYR A 1 78  ? 50.964 -17.188 -27.960 1.00 34.99 ? 81  TYR H CZ  1 
ATOM   596  O OH  . TYR A 1 78  ? 50.044 -17.912 -28.680 1.00 38.07 ? 81  TYR H OH  1 
ATOM   597  N N   . LEU A 1 79  ? 54.360 -12.524 -23.872 1.00 33.11 ? 82  LEU H N   1 
ATOM   598  C CA  . LEU A 1 79  ? 55.061 -11.947 -22.743 1.00 34.12 ? 82  LEU H CA  1 
ATOM   599  C C   . LEU A 1 79  ? 54.421 -12.558 -21.502 1.00 36.53 ? 82  LEU H C   1 
ATOM   600  O O   . LEU A 1 79  ? 53.343 -12.142 -21.070 1.00 35.60 ? 82  LEU H O   1 
ATOM   601  C CB  . LEU A 1 79  ? 54.895 -10.429 -22.750 1.00 33.95 ? 82  LEU H CB  1 
ATOM   602  C CG  . LEU A 1 79  ? 55.834 -9.526  -21.944 1.00 36.19 ? 82  LEU H CG  1 
ATOM   603  C CD1 . LEU A 1 79  ? 55.166 -9.113  -20.662 1.00 38.53 ? 82  LEU H CD1 1 
ATOM   604  C CD2 . LEU A 1 79  ? 57.164 -10.213 -21.704 1.00 30.66 ? 82  LEU H CD2 1 
ATOM   605  N N   . GLN A 1 80  ? 55.074 -13.577 -20.958 1.00 37.58 ? 83  GLN H N   1 
ATOM   606  C CA  . GLN A 1 80  ? 54.580 -14.246 -19.763 1.00 35.42 ? 83  GLN H CA  1 
ATOM   607  C C   . GLN A 1 80  ? 55.150 -13.519 -18.560 1.00 31.86 ? 83  GLN H C   1 
ATOM   608  O O   . GLN A 1 80  ? 56.359 -13.495 -18.354 1.00 33.64 ? 83  GLN H O   1 
ATOM   609  C CB  . GLN A 1 80  ? 55.019 -15.717 -19.759 1.00 36.34 ? 83  GLN H CB  1 
ATOM   610  C CG  . GLN A 1 80  ? 54.781 -16.457 -18.441 1.00 39.12 ? 83  GLN H CG  1 
ATOM   611  C CD  . GLN A 1 80  ? 53.342 -16.371 -17.961 1.00 41.44 ? 83  GLN H CD  1 
ATOM   612  O OE1 . GLN A 1 80  ? 52.422 -16.861 -18.618 1.00 45.28 ? 83  GLN H OE1 1 
ATOM   613  N NE2 . GLN A 1 80  ? 53.141 -15.738 -16.811 1.00 42.81 ? 83  GLN H NE2 1 
ATOM   614  N N   . MET A 1 81  ? 54.279 -12.897 -17.778 1.00 35.32 ? 84  MET H N   1 
ATOM   615  C CA  . MET A 1 81  ? 54.725 -12.171 -16.596 1.00 35.97 ? 84  MET H CA  1 
ATOM   616  C C   . MET A 1 81  ? 54.386 -12.980 -15.350 1.00 36.25 ? 84  MET H C   1 
ATOM   617  O O   . MET A 1 81  ? 53.347 -13.627 -15.300 1.00 38.66 ? 84  MET H O   1 
ATOM   618  C CB  . MET A 1 81  ? 54.040 -10.806 -16.531 1.00 33.98 ? 84  MET H CB  1 
ATOM   619  C CG  . MET A 1 81  ? 54.275 -9.953  -17.761 1.00 38.60 ? 84  MET H CG  1 
ATOM   620  S SD  . MET A 1 81  ? 53.463 -8.345  -17.652 1.00 39.14 ? 84  MET H SD  1 
ATOM   621  C CE  . MET A 1 81  ? 51.847 -8.785  -18.216 1.00 30.98 ? 84  MET H CE  1 
ATOM   622  N N   . SER A 1 82  ? 55.264 -12.948 -14.352 1.00 38.18 ? 85  SER H N   1 
ATOM   623  C CA  . SER A 1 82  ? 55.030 -13.681 -13.111 1.00 37.53 ? 85  SER H CA  1 
ATOM   624  C C   . SER A 1 82  ? 55.568 -12.893 -11.934 1.00 40.28 ? 85  SER H C   1 
ATOM   625  O O   . SER A 1 82  ? 56.408 -12.000 -12.100 1.00 37.12 ? 85  SER H O   1 
ATOM   626  C CB  . SER A 1 82  ? 55.701 -15.057 -13.159 1.00 42.37 ? 85  SER H CB  1 
ATOM   627  O OG  . SER A 1 82  ? 55.027 -15.918 -14.067 1.00 48.56 ? 85  SER H OG  1 
ATOM   628  N N   . SER A 1 83  ? 55.083 -13.225 -10.740 1.00 39.93 ? 86  SER H N   1 
ATOM   629  C CA  . SER A 1 83  ? 55.515 -12.535 -9.533  1.00 38.94 ? 86  SER H CA  1 
ATOM   630  C C   . SER A 1 83  ? 55.400 -11.045 -9.810  1.00 37.49 ? 86  SER H C   1 
ATOM   631  O O   . SER A 1 83  ? 56.317 -10.273 -9.546  1.00 38.12 ? 86  SER H O   1 
ATOM   632  C CB  . SER A 1 83  ? 56.964 -12.898 -9.202  1.00 38.55 ? 86  SER H CB  1 
ATOM   633  O OG  . SER A 1 83  ? 57.129 -14.303 -9.139  1.00 47.00 ? 86  SER H OG  1 
ATOM   634  N N   . LEU A 1 84  ? 54.259 -10.655 -10.363 1.00 42.62 ? 87  LEU H N   1 
ATOM   635  C CA  . LEU A 1 84  ? 54.011 -9.261  -10.710 1.00 40.01 ? 87  LEU H CA  1 
ATOM   636  C C   . LEU A 1 84  ? 54.126 -8.325  -9.525  1.00 43.10 ? 87  LEU H C   1 
ATOM   637  O O   . LEU A 1 84  ? 53.651 -8.617  -8.430  1.00 43.96 ? 87  LEU H O   1 
ATOM   638  C CB  . LEU A 1 84  ? 52.638 -9.124  -11.370 1.00 39.56 ? 87  LEU H CB  1 
ATOM   639  C CG  . LEU A 1 84  ? 52.646 -9.572  -12.834 1.00 38.18 ? 87  LEU H CG  1 
ATOM   640  C CD1 . LEU A 1 84  ? 51.234 -9.762  -13.342 1.00 41.95 ? 87  LEU H CD1 1 
ATOM   641  C CD2 . LEU A 1 84  ? 53.395 -8.539  -13.663 1.00 35.82 ? 87  LEU H CD2 1 
ATOM   642  N N   . ARG A 1 85  ? 54.778 -7.193  -9.763  1.00 42.87 ? 88  ARG H N   1 
ATOM   643  C CA  . ARG A 1 85  ? 54.997 -6.187  -8.745  1.00 42.92 ? 88  ARG H CA  1 
ATOM   644  C C   . ARG A 1 85  ? 54.267 -4.892  -9.077  1.00 46.74 ? 88  ARG H C   1 
ATOM   645  O O   . ARG A 1 85  ? 53.932 -4.635  -10.229 1.00 46.34 ? 88  ARG H O   1 
ATOM   646  C CB  . ARG A 1 85  ? 56.499 -5.923  -8.597  1.00 42.59 ? 88  ARG H CB  1 
ATOM   647  C CG  . ARG A 1 85  ? 57.198 -6.907  -7.659  1.00 48.61 ? 88  ARG H CG  1 
ATOM   648  C CD  . ARG A 1 85  ? 58.237 -7.792  -8.345  1.00 45.47 ? 88  ARG H CD  1 
ATOM   649  N NE  . ARG A 1 85  ? 59.399 -7.036  -8.805  1.00 47.35 ? 88  ARG H NE  1 
ATOM   650  C CZ  . ARG A 1 85  ? 60.643 -7.507  -8.810  1.00 45.33 ? 88  ARG H CZ  1 
ATOM   651  N NH1 . ARG A 1 85  ? 60.893 -8.734  -8.373  1.00 45.12 ? 88  ARG H NH1 1 
ATOM   652  N NH2 . ARG A 1 85  ? 61.639 -6.754  -9.261  1.00 45.14 ? 88  ARG H NH2 1 
ATOM   653  N N   . SER A 1 86  ? 54.020 -4.081  -8.054  1.00 46.95 ? 89  SER H N   1 
ATOM   654  C CA  . SER A 1 86  ? 53.327 -2.811  -8.226  1.00 45.26 ? 89  SER H CA  1 
ATOM   655  C C   . SER A 1 86  ? 54.006 -1.955  -9.289  1.00 43.70 ? 89  SER H C   1 
ATOM   656  O O   . SER A 1 86  ? 53.338 -1.348  -10.133 1.00 42.58 ? 89  SER H O   1 
ATOM   657  C CB  . SER A 1 86  ? 53.298 -2.058  -6.896  1.00 43.04 ? 89  SER H CB  1 
ATOM   658  O OG  . SER A 1 86  ? 54.595 -2.022  -6.327  1.00 54.64 ? 89  SER H OG  1 
ATOM   659  N N   . GLU A 1 87  ? 55.334 -1.916  -9.240  1.00 43.06 ? 90  GLU H N   1 
ATOM   660  C CA  . GLU A 1 87  ? 56.131 -1.142  -10.185 1.00 42.77 ? 90  GLU H CA  1 
ATOM   661  C C   . GLU A 1 87  ? 56.050 -1.671  -11.623 1.00 41.27 ? 90  GLU H C   1 
ATOM   662  O O   . GLU A 1 87  ? 56.668 -1.102  -12.523 1.00 40.77 ? 90  GLU H O   1 
ATOM   663  C CB  . GLU A 1 87  ? 57.594 -1.130  -9.733  1.00 47.61 ? 90  GLU H CB  1 
ATOM   664  C CG  . GLU A 1 87  ? 58.248 -2.506  -9.746  1.00 57.27 ? 90  GLU H CG  1 
ATOM   665  C CD  . GLU A 1 87  ? 59.599 -2.527  -9.045  1.00 67.83 ? 90  GLU H CD  1 
ATOM   666  O OE1 . GLU A 1 87  ? 60.231 -3.608  -8.991  1.00 64.51 ? 90  GLU H OE1 1 
ATOM   667  O OE2 . GLU A 1 87  ? 60.024 -1.461  -8.543  1.00 72.90 ? 90  GLU H OE2 1 
ATOM   668  N N   . ASP A 1 88  ? 55.310 -2.760  -11.835 1.00 39.00 ? 91  ASP H N   1 
ATOM   669  C CA  . ASP A 1 88  ? 55.160 -3.331  -13.172 1.00 37.75 ? 91  ASP H CA  1 
ATOM   670  C C   . ASP A 1 88  ? 53.937 -2.740  -13.862 1.00 39.99 ? 91  ASP H C   1 
ATOM   671  O O   . ASP A 1 88  ? 53.711 -2.963  -15.055 1.00 35.97 ? 91  ASP H O   1 
ATOM   672  C CB  . ASP A 1 88  ? 54.995 -4.854  -13.119 1.00 35.18 ? 91  ASP H CB  1 
ATOM   673  C CG  . ASP A 1 88  ? 56.281 -5.577  -12.762 1.00 40.08 ? 91  ASP H CG  1 
ATOM   674  O OD1 . ASP A 1 88  ? 57.363 -5.159  -13.230 1.00 33.33 ? 91  ASP H OD1 1 
ATOM   675  O OD2 . ASP A 1 88  ? 56.204 -6.584  -12.025 1.00 41.95 ? 91  ASP H OD2 1 
ATOM   676  N N   . THR A 1 89  ? 53.137 -2.002  -13.102 1.00 38.47 ? 92  THR H N   1 
ATOM   677  C CA  . THR A 1 89  ? 51.930 -1.390  -13.646 1.00 39.63 ? 92  THR H CA  1 
ATOM   678  C C   . THR A 1 89  ? 52.293 -0.400  -14.752 1.00 37.88 ? 92  THR H C   1 
ATOM   679  O O   . THR A 1 89  ? 53.105 0.506   -14.556 1.00 35.56 ? 92  THR H O   1 
ATOM   680  C CB  . THR A 1 89  ? 51.122 -0.675  -12.534 1.00 42.10 ? 92  THR H CB  1 
ATOM   681  O OG1 . THR A 1 89  ? 50.665 -1.647  -11.575 1.00 44.63 ? 92  THR H OG1 1 
ATOM   682  C CG2 . THR A 1 89  ? 49.921 0.051   -13.132 1.00 37.84 ? 92  THR H CG2 1 
ATOM   683  N N   . ALA A 1 90  ? 51.691 -0.583  -15.920 1.00 35.11 ? 93  ALA H N   1 
ATOM   684  C CA  . ALA A 1 90  ? 51.981 0.289   -17.046 1.00 36.70 ? 93  ALA H CA  1 
ATOM   685  C C   . ALA A 1 90  ? 51.254 -0.166  -18.290 1.00 34.31 ? 93  ALA H C   1 
ATOM   686  O O   . ALA A 1 90  ? 50.494 -1.144  -18.269 1.00 32.77 ? 93  ALA H O   1 
ATOM   687  C CB  . ALA A 1 90  ? 53.487 0.308   -17.320 1.00 38.32 ? 93  ALA H CB  1 
ATOM   688  N N   . LEU A 1 91  ? 51.494 0.566   -19.374 1.00 34.76 ? 94  LEU H N   1 
ATOM   689  C CA  . LEU A 1 91  ? 50.915 0.245   -20.669 1.00 28.88 ? 94  LEU H CA  1 
ATOM   690  C C   . LEU A 1 91  ? 52.021 -0.508  -21.395 1.00 25.51 ? 94  LEU H C   1 
ATOM   691  O O   . LEU A 1 91  ? 53.119 0.014   -21.590 1.00 25.83 ? 94  LEU H O   1 
ATOM   692  C CB  . LEU A 1 91  ? 50.551 1.530   -21.424 1.00 35.73 ? 94  LEU H CB  1 
ATOM   693  C CG  . LEU A 1 91  ? 49.159 1.588   -22.059 1.00 40.98 ? 94  LEU H CG  1 
ATOM   694  C CD1 . LEU A 1 91  ? 49.078 2.784   -23.003 1.00 41.54 ? 94  LEU H CD1 1 
ATOM   695  C CD2 . LEU A 1 91  ? 48.893 0.312   -22.825 1.00 41.83 ? 94  LEU H CD2 1 
ATOM   696  N N   . TYR A 1 92  ? 51.745 -1.748  -21.775 1.00 27.29 ? 95  TYR H N   1 
ATOM   697  C CA  . TYR A 1 92  ? 52.748 -2.563  -22.450 1.00 27.88 ? 95  TYR H CA  1 
ATOM   698  C C   . TYR A 1 92  ? 52.587 -2.580  -23.971 1.00 29.72 ? 95  TYR H C   1 
ATOM   699  O O   . TYR A 1 92  ? 51.493 -2.796  -24.490 1.00 28.04 ? 95  TYR H O   1 
ATOM   700  C CB  . TYR A 1 92  ? 52.703 -3.998  -21.905 1.00 27.98 ? 95  TYR H CB  1 
ATOM   701  C CG  . TYR A 1 92  ? 53.296 -4.141  -20.514 1.00 30.42 ? 95  TYR H CG  1 
ATOM   702  C CD1 . TYR A 1 92  ? 52.674 -3.577  -19.400 1.00 24.28 ? 95  TYR H CD1 1 
ATOM   703  C CD2 . TYR A 1 92  ? 54.510 -4.805  -20.325 1.00 27.55 ? 95  TYR H CD2 1 
ATOM   704  C CE1 . TYR A 1 92  ? 53.251 -3.670  -18.128 1.00 23.31 ? 95  TYR H CE1 1 
ATOM   705  C CE2 . TYR A 1 92  ? 55.090 -4.899  -19.070 1.00 26.49 ? 95  TYR H CE2 1 
ATOM   706  C CZ  . TYR A 1 92  ? 54.459 -4.331  -17.973 1.00 30.37 ? 95  TYR H CZ  1 
ATOM   707  O OH  . TYR A 1 92  ? 55.056 -4.436  -16.733 1.00 30.65 ? 95  TYR H OH  1 
ATOM   708  N N   . TYR A 1 93  ? 53.691 -2.370  -24.679 1.00 24.46 ? 96  TYR H N   1 
ATOM   709  C CA  . TYR A 1 93  ? 53.659 -2.367  -26.136 1.00 27.52 ? 96  TYR H CA  1 
ATOM   710  C C   . TYR A 1 93  ? 54.501 -3.464  -26.757 1.00 30.11 ? 96  TYR H C   1 
ATOM   711  O O   . TYR A 1 93  ? 55.570 -3.822  -26.271 1.00 30.05 ? 96  TYR H O   1 
ATOM   712  C CB  . TYR A 1 93  ? 54.163 -1.038  -26.697 1.00 21.33 ? 96  TYR H CB  1 
ATOM   713  C CG  . TYR A 1 93  ? 53.326 0.169   -26.358 1.00 29.76 ? 96  TYR H CG  1 
ATOM   714  C CD1 . TYR A 1 93  ? 52.300 0.592   -27.208 1.00 31.98 ? 96  TYR H CD1 1 
ATOM   715  C CD2 . TYR A 1 93  ? 53.608 0.939   -25.229 1.00 31.15 ? 96  TYR H CD2 1 
ATOM   716  C CE1 . TYR A 1 93  ? 51.582 1.761   -26.946 1.00 34.26 ? 96  TYR H CE1 1 
ATOM   717  C CE2 . TYR A 1 93  ? 52.898 2.104   -24.959 1.00 33.27 ? 96  TYR H CE2 1 
ATOM   718  C CZ  . TYR A 1 93  ? 51.891 2.513   -25.820 1.00 38.40 ? 96  TYR H CZ  1 
ATOM   719  O OH  . TYR A 1 93  ? 51.225 3.694   -25.558 1.00 38.02 ? 96  TYR H OH  1 
ATOM   720  N N   . CYS A 1 94  ? 53.990 -3.957  -27.871 1.00 30.35 ? 97  CYS H N   1 
ATOM   721  C CA  . CYS A 1 94  ? 54.613 -4.977  -28.691 1.00 31.06 ? 97  CYS H CA  1 
ATOM   722  C C   . CYS A 1 94  ? 55.348 -4.131  -29.736 1.00 33.85 ? 97  CYS H C   1 
ATOM   723  O O   . CYS A 1 94  ? 54.746 -3.214  -30.290 1.00 34.15 ? 97  CYS H O   1 
ATOM   724  C CB  . CYS A 1 94  ? 53.492 -5.760  -29.340 1.00 34.51 ? 97  CYS H CB  1 
ATOM   725  S SG  . CYS A 1 94  ? 53.942 -7.053  -30.504 1.00 42.86 ? 97  CYS H SG  1 
ATOM   726  N N   . ALA A 1 95  ? 56.618 -4.416  -30.020 1.00 27.69 ? 98  ALA H N   1 
ATOM   727  C CA  . ALA A 1 95  ? 57.337 -3.596  -30.995 1.00 29.60 ? 98  ALA H CA  1 
ATOM   728  C C   . ALA A 1 95  ? 58.386 -4.248  -31.901 1.00 29.90 ? 98  ALA H C   1 
ATOM   729  O O   . ALA A 1 95  ? 59.198 -5.066  -31.464 1.00 24.75 ? 98  ALA H O   1 
ATOM   730  C CB  . ALA A 1 95  ? 57.980 -2.394  -30.276 1.00 26.32 ? 98  ALA H CB  1 
ATOM   731  N N   . ARG A 1 96  ? 58.351 -3.852  -33.174 1.00 27.74 ? 99  ARG H N   1 
ATOM   732  C CA  . ARG A 1 96  ? 59.307 -4.290  -34.198 1.00 26.90 ? 99  ARG H CA  1 
ATOM   733  C C   . ARG A 1 96  ? 60.192 -3.041  -34.352 1.00 28.98 ? 99  ARG H C   1 
ATOM   734  O O   . ARG A 1 96  ? 59.903 -2.168  -35.170 1.00 23.46 ? 99  ARG H O   1 
ATOM   735  C CB  . ARG A 1 96  ? 58.577 -4.584  -35.521 1.00 25.29 ? 99  ARG H CB  1 
ATOM   736  C CG  . ARG A 1 96  ? 59.423 -5.254  -36.619 1.00 20.43 ? 99  ARG H CG  1 
ATOM   737  C CD  . ARG A 1 96  ? 60.526 -4.349  -37.151 1.00 22.56 ? 99  ARG H CD  1 
ATOM   738  N NE  . ARG A 1 96  ? 60.035 -3.259  -37.989 1.00 24.94 ? 99  ARG H NE  1 
ATOM   739  C CZ  . ARG A 1 96  ? 59.554 -3.415  -39.224 1.00 30.73 ? 99  ARG H CZ  1 
ATOM   740  N NH1 . ARG A 1 96  ? 59.492 -4.621  -39.772 1.00 28.50 ? 99  ARG H NH1 1 
ATOM   741  N NH2 . ARG A 1 96  ? 59.160 -2.357  -39.924 1.00 26.66 ? 99  ARG H NH2 1 
ATOM   742  N N   . GLY A 1 97  ? 61.258 -2.957  -33.557 1.00 27.62 ? 100 GLY H N   1 
ATOM   743  C CA  . GLY A 1 97  ? 62.119 -1.781  -33.583 1.00 23.76 ? 100 GLY H CA  1 
ATOM   744  C C   . GLY A 1 97  ? 63.148 -1.587  -34.680 1.00 23.30 ? 100 GLY H C   1 
ATOM   745  O O   . GLY A 1 97  ? 63.635 -0.470  -34.873 1.00 27.15 ? 100 GLY H O   1 
ATOM   746  N N   . GLN A 1 98  ? 63.494 -2.650  -35.399 1.00 21.26 ? 101 GLN H N   1 
ATOM   747  C CA  . GLN A 1 98  ? 64.490 -2.537  -36.455 1.00 25.91 ? 101 GLN H CA  1 
ATOM   748  C C   . GLN A 1 98  ? 63.970 -1.699  -37.615 1.00 25.19 ? 101 GLN H C   1 
ATOM   749  O O   . GLN A 1 98  ? 62.790 -1.749  -37.936 1.00 21.18 ? 101 GLN H O   1 
ATOM   750  C CB  . GLN A 1 98  ? 64.884 -3.925  -36.965 1.00 26.99 ? 101 GLN H CB  1 
ATOM   751  C CG  . GLN A 1 98  ? 65.681 -4.737  -35.966 1.00 30.50 ? 101 GLN H CG  1 
ATOM   752  C CD  . GLN A 1 98  ? 65.871 -6.173  -36.404 1.00 31.30 ? 101 GLN H CD  1 
ATOM   753  O OE1 . GLN A 1 98  ? 64.918 -6.949  -36.457 1.00 30.14 ? 101 GLN H OE1 1 
ATOM   754  N NE2 . GLN A 1 98  ? 67.105 -6.532  -36.726 1.00 34.54 ? 101 GLN H NE2 1 
ATOM   755  N N   . GLY A 1 99  ? 64.856 -0.921  -38.225 1.00 27.78 ? 102 GLY H N   1 
ATOM   756  C CA  . GLY A 1 99  ? 64.468 -0.094  -39.362 1.00 26.53 ? 102 GLY H CA  1 
ATOM   757  C C   . GLY A 1 99  ? 63.409 0.931   -39.019 1.00 25.65 ? 102 GLY H C   1 
ATOM   758  O O   . GLY A 1 99  ? 63.694 1.903   -38.311 1.00 25.10 ? 102 GLY H O   1 
ATOM   759  N N   . ARG A 1 100 ? 62.200 0.730   -39.539 1.00 26.34 ? 103 ARG H N   1 
ATOM   760  C CA  . ARG A 1 100 ? 61.081 1.625   -39.263 1.00 29.38 ? 103 ARG H CA  1 
ATOM   761  C C   . ARG A 1 100 ? 60.318 0.982   -38.117 1.00 25.47 ? 103 ARG H C   1 
ATOM   762  O O   . ARG A 1 100 ? 59.639 -0.031  -38.304 1.00 26.52 ? 103 ARG H O   1 
ATOM   763  C CB  . ARG A 1 100 ? 60.156 1.759   -40.488 1.00 29.25 ? 103 ARG H CB  1 
ATOM   764  C CG  . ARG A 1 100 ? 59.024 2.782   -40.306 1.00 34.43 ? 103 ARG H CG  1 
ATOM   765  C CD  . ARG A 1 100 ? 57.678 2.109   -40.092 1.00 40.80 ? 103 ARG H CD  1 
ATOM   766  N NE  . ARG A 1 100 ? 56.613 3.018   -39.640 1.00 41.77 ? 103 ARG H NE  1 
ATOM   767  C CZ  . ARG A 1 100 ? 56.113 4.033   -40.351 1.00 43.76 ? 103 ARG H CZ  1 
ATOM   768  N NH1 . ARG A 1 100 ? 56.574 4.304   -41.570 1.00 41.15 ? 103 ARG H NH1 1 
ATOM   769  N NH2 . ARG A 1 100 ? 55.127 4.769   -39.855 1.00 23.68 ? 103 ARG H NH2 1 
ATOM   770  N N   . PRO A 1 101 ? 60.417 1.563   -36.912 1.00 26.96 ? 104 PRO H N   1 
ATOM   771  C CA  . PRO A 1 101 ? 59.719 1.005   -35.750 1.00 22.25 ? 104 PRO H CA  1 
ATOM   772  C C   . PRO A 1 101 ? 58.208 0.978   -35.895 1.00 21.48 ? 104 PRO H C   1 
ATOM   773  O O   . PRO A 1 101 ? 57.603 1.939   -36.368 1.00 26.43 ? 104 PRO H O   1 
ATOM   774  C CB  . PRO A 1 101 ? 60.155 1.923   -34.601 1.00 22.06 ? 104 PRO H CB  1 
ATOM   775  C CG  . PRO A 1 101 ? 61.452 2.522   -35.080 1.00 21.52 ? 104 PRO H CG  1 
ATOM   776  C CD  . PRO A 1 101 ? 61.185 2.764   -36.540 1.00 20.94 ? 104 PRO H CD  1 
ATOM   777  N N   . TYR A 1 102 ? 57.612 -0.142  -35.509 1.00 14.76 ? 105 TYR H N   1 
ATOM   778  C CA  . TYR A 1 102 ? 56.159 -0.312  -35.518 1.00 23.53 ? 105 TYR H CA  1 
ATOM   779  C C   . TYR A 1 102 ? 55.792 -0.787  -34.119 1.00 21.31 ? 105 TYR H C   1 
ATOM   780  O O   . TYR A 1 102 ? 56.540 -1.580  -33.533 1.00 22.29 ? 105 TYR H O   1 
ATOM   781  C CB  . TYR A 1 102 ? 55.728 -1.410  -36.486 1.00 24.67 ? 105 TYR H CB  1 
ATOM   782  C CG  . TYR A 1 102 ? 55.545 -1.002  -37.922 1.00 31.49 ? 105 TYR H CG  1 
ATOM   783  C CD1 . TYR A 1 102 ? 54.526 -0.124  -38.301 1.00 33.50 ? 105 TYR H CD1 1 
ATOM   784  C CD2 . TYR A 1 102 ? 56.354 -1.538  -38.916 1.00 37.23 ? 105 TYR H CD2 1 
ATOM   785  C CE1 . TYR A 1 102 ? 54.320 0.200   -39.636 1.00 33.06 ? 105 TYR H CE1 1 
ATOM   786  C CE2 . TYR A 1 102 ? 56.158 -1.221  -40.252 1.00 38.15 ? 105 TYR H CE2 1 
ATOM   787  C CZ  . TYR A 1 102 ? 55.143 -0.357  -40.607 1.00 37.64 ? 105 TYR H CZ  1 
ATOM   788  O OH  . TYR A 1 102 ? 54.956 -0.072  -41.938 1.00 39.84 ? 105 TYR H OH  1 
ATOM   789  N N   . TRP A 1 103 ? 54.665 -0.321  -33.587 1.00 18.85 ? 106 TRP H N   1 
ATOM   790  C CA  . TRP A 1 103 ? 54.213 -0.764  -32.261 1.00 28.58 ? 106 TRP H CA  1 
ATOM   791  C C   . TRP A 1 103 ? 52.681 -0.795  -32.240 1.00 32.14 ? 106 TRP H C   1 
ATOM   792  O O   . TRP A 1 103 ? 52.039 -0.190  -33.094 1.00 33.27 ? 106 TRP H O   1 
ATOM   793  C CB  . TRP A 1 103 ? 54.777 0.142   -31.147 1.00 21.92 ? 106 TRP H CB  1 
ATOM   794  C CG  . TRP A 1 103 ? 54.484 1.593   -31.292 1.00 27.60 ? 106 TRP H CG  1 
ATOM   795  C CD1 . TRP A 1 103 ? 53.289 2.222   -31.068 1.00 25.02 ? 106 TRP H CD1 1 
ATOM   796  C CD2 . TRP A 1 103 ? 55.398 2.609   -31.713 1.00 31.53 ? 106 TRP H CD2 1 
ATOM   797  N NE1 . TRP A 1 103 ? 53.404 3.563   -31.324 1.00 28.10 ? 106 TRP H NE1 1 
ATOM   798  C CE2 . TRP A 1 103 ? 54.688 3.830   -31.723 1.00 31.82 ? 106 TRP H CE2 1 
ATOM   799  C CE3 . TRP A 1 103 ? 56.752 2.607   -32.085 1.00 27.39 ? 106 TRP H CE3 1 
ATOM   800  C CZ2 . TRP A 1 103 ? 55.284 5.041   -32.094 1.00 28.55 ? 106 TRP H CZ2 1 
ATOM   801  C CZ3 . TRP A 1 103 ? 57.345 3.809   -32.453 1.00 28.56 ? 106 TRP H CZ3 1 
ATOM   802  C CH2 . TRP A 1 103 ? 56.605 5.013   -32.454 1.00 24.32 ? 106 TRP H CH2 1 
ATOM   803  N N   . GLY A 1 104 ? 52.101 -1.523  -31.289 1.00 29.58 ? 107 GLY H N   1 
ATOM   804  C CA  . GLY A 1 104 ? 50.655 -1.624  -31.220 1.00 28.38 ? 107 GLY H CA  1 
ATOM   805  C C   . GLY A 1 104 ? 50.009 -0.477  -30.474 1.00 30.03 ? 107 GLY H C   1 
ATOM   806  O O   . GLY A 1 104 ? 50.663 0.529   -30.183 1.00 31.29 ? 107 GLY H O   1 
ATOM   807  N N   . GLN A 1 105 ? 48.722 -0.623  -30.173 1.00 32.26 ? 108 GLN H N   1 
ATOM   808  C CA  . GLN A 1 105 ? 47.989 0.402   -29.444 1.00 35.17 ? 108 GLN H CA  1 
ATOM   809  C C   . GLN A 1 105 ? 48.292 0.276   -27.959 1.00 32.72 ? 108 GLN H C   1 
ATOM   810  O O   . GLN A 1 105 ? 48.058 1.204   -27.190 1.00 30.89 ? 108 GLN H O   1 
ATOM   811  C CB  . GLN A 1 105 ? 46.477 0.264   -29.670 1.00 39.27 ? 108 GLN H CB  1 
ATOM   812  C CG  . GLN A 1 105 ? 45.963 0.829   -31.000 1.00 47.54 ? 108 GLN H CG  1 
ATOM   813  C CD  . GLN A 1 105 ? 46.325 2.301   -31.209 1.00 52.10 ? 108 GLN H CD  1 
ATOM   814  O OE1 . GLN A 1 105 ? 47.312 2.621   -31.877 1.00 53.34 ? 108 GLN H OE1 1 
ATOM   815  N NE2 . GLN A 1 105 ? 45.530 3.200   -30.629 1.00 50.00 ? 108 GLN H NE2 1 
ATOM   816  N N   . GLY A 1 106 ? 48.795 -0.885  -27.558 1.00 35.99 ? 109 GLY H N   1 
ATOM   817  C CA  . GLY A 1 106 ? 49.139 -1.096  -26.162 1.00 42.00 ? 109 GLY H CA  1 
ATOM   818  C C   . GLY A 1 106 ? 48.053 -1.735  -25.319 1.00 43.08 ? 109 GLY H C   1 
ATOM   819  O O   . GLY A 1 106 ? 46.868 -1.614  -25.617 1.00 46.19 ? 109 GLY H O   1 
ATOM   820  N N   . THR A 1 107 ? 48.466 -2.422  -24.258 1.00 42.22 ? 110 THR H N   1 
ATOM   821  C CA  . THR A 1 107 ? 47.541 -3.092  -23.354 1.00 40.04 ? 110 THR H CA  1 
ATOM   822  C C   . THR A 1 107 ? 47.935 -2.715  -21.928 1.00 42.83 ? 110 THR H C   1 
ATOM   823  O O   . THR A 1 107 ? 49.114 -2.766  -21.553 1.00 40.80 ? 110 THR H O   1 
ATOM   824  C CB  . THR A 1 107 ? 47.591 -4.627  -23.547 1.00 41.89 ? 110 THR H CB  1 
ATOM   825  O OG1 . THR A 1 107 ? 46.530 -5.239  -22.812 1.00 46.74 ? 110 THR H OG1 1 
ATOM   826  C CG2 . THR A 1 107 ? 48.916 -5.190  -23.072 1.00 39.72 ? 110 THR H CG2 1 
ATOM   827  N N   . LEU A 1 108 ? 46.943 -2.319  -21.143 1.00 38.48 ? 111 LEU H N   1 
ATOM   828  C CA  . LEU A 1 108 ? 47.185 -1.887  -19.778 1.00 40.00 ? 111 LEU H CA  1 
ATOM   829  C C   . LEU A 1 108 ? 47.286 -3.046  -18.788 1.00 38.54 ? 111 LEU H C   1 
ATOM   830  O O   . LEU A 1 108 ? 46.495 -3.979  -18.825 1.00 40.29 ? 111 LEU H O   1 
ATOM   831  C CB  . LEU A 1 108 ? 46.078 -0.919  -19.352 1.00 38.23 ? 111 LEU H CB  1 
ATOM   832  C CG  . LEU A 1 108 ? 46.225 -0.238  -17.992 1.00 39.47 ? 111 LEU H CG  1 
ATOM   833  C CD1 . LEU A 1 108 ? 47.554 0.505   -17.916 1.00 39.14 ? 111 LEU H CD1 1 
ATOM   834  C CD2 . LEU A 1 108 ? 45.069 0.720   -17.780 1.00 39.91 ? 111 LEU H CD2 1 
ATOM   835  N N   . VAL A 1 109 ? 48.286 -2.981  -17.919 1.00 36.59 ? 112 VAL H N   1 
ATOM   836  C CA  . VAL A 1 109 ? 48.494 -3.999  -16.894 1.00 37.95 ? 112 VAL H CA  1 
ATOM   837  C C   . VAL A 1 109 ? 48.537 -3.297  -15.539 1.00 35.50 ? 112 VAL H C   1 
ATOM   838  O O   . VAL A 1 109 ? 49.447 -2.510  -15.260 1.00 38.54 ? 112 VAL H O   1 
ATOM   839  C CB  . VAL A 1 109 ? 49.819 -4.770  -17.119 1.00 38.43 ? 112 VAL H CB  1 
ATOM   840  C CG1 . VAL A 1 109 ? 50.122 -5.661  -15.923 1.00 35.51 ? 112 VAL H CG1 1 
ATOM   841  C CG2 . VAL A 1 109 ? 49.714 -5.613  -18.378 1.00 36.76 ? 112 VAL H CG2 1 
ATOM   842  N N   . THR A 1 110 ? 47.541 -3.579  -14.707 1.00 34.80 ? 113 THR H N   1 
ATOM   843  C CA  . THR A 1 110 ? 47.448 -2.962  -13.388 1.00 40.03 ? 113 THR H CA  1 
ATOM   844  C C   . THR A 1 110 ? 47.729 -3.964  -12.271 1.00 39.81 ? 113 THR H C   1 
ATOM   845  O O   . THR A 1 110 ? 47.006 -4.947  -12.107 1.00 38.88 ? 113 THR H O   1 
ATOM   846  C CB  . THR A 1 110 ? 46.042 -2.345  -13.176 1.00 43.69 ? 113 THR H CB  1 
ATOM   847  O OG1 . THR A 1 110 ? 45.800 -1.353  -14.183 1.00 44.37 ? 113 THR H OG1 1 
ATOM   848  C CG2 . THR A 1 110 ? 45.939 -1.691  -11.800 1.00 41.70 ? 113 THR H CG2 1 
ATOM   849  N N   . VAL A 1 111 ? 48.792 -3.714  -11.513 1.00 43.19 ? 114 VAL H N   1 
ATOM   850  C CA  . VAL A 1 111 ? 49.168 -4.595  -10.411 1.00 47.23 ? 114 VAL H CA  1 
ATOM   851  C C   . VAL A 1 111 ? 48.719 -3.940  -9.120  1.00 43.82 ? 114 VAL H C   1 
ATOM   852  O O   . VAL A 1 111 ? 49.445 -3.146  -8.528  1.00 40.77 ? 114 VAL H O   1 
ATOM   853  C CB  . VAL A 1 111 ? 50.691 -4.810  -10.356 1.00 50.85 ? 114 VAL H CB  1 
ATOM   854  C CG1 . VAL A 1 111 ? 51.051 -5.698  -9.167  1.00 53.01 ? 114 VAL H CG1 1 
ATOM   855  C CG2 . VAL A 1 111 ? 51.166 -5.433  -11.656 1.00 52.83 ? 114 VAL H CG2 1 
ATOM   856  N N   . SER A 1 112 ? 47.516 -4.286  -8.684  1.00 43.44 ? 115 SER H N   1 
ATOM   857  C CA  . SER A 1 112 ? 46.962 -3.688  -7.486  1.00 47.28 ? 115 SER H CA  1 
ATOM   858  C C   . SER A 1 112 ? 46.130 -4.661  -6.664  1.00 49.51 ? 115 SER H C   1 
ATOM   859  O O   . SER A 1 112 ? 45.766 -5.740  -7.129  1.00 48.12 ? 115 SER H O   1 
ATOM   860  C CB  . SER A 1 112 ? 46.102 -2.487  -7.884  1.00 46.56 ? 115 SER H CB  1 
ATOM   861  O OG  . SER A 1 112 ? 45.551 -1.841  -6.753  1.00 47.15 ? 115 SER H OG  1 
ATOM   862  N N   . ALA A 1 113 ? 45.831 -4.262  -5.435  1.00 51.88 ? 116 ALA H N   1 
ATOM   863  C CA  . ALA A 1 113 ? 45.024 -5.077  -4.544  1.00 54.51 ? 116 ALA H CA  1 
ATOM   864  C C   . ALA A 1 113 ? 43.619 -4.488  -4.488  1.00 55.43 ? 116 ALA H C   1 
ATOM   865  O O   . ALA A 1 113 ? 42.644 -5.205  -4.283  1.00 56.84 ? 116 ALA H O   1 
ATOM   866  C CB  . ALA A 1 113 ? 45.646 -5.092  -3.151  1.00 53.57 ? 116 ALA H CB  1 
ATOM   867  N N   . ALA A 1 114 ? 43.534 -3.175  -4.691  1.00 58.31 ? 117 ALA H N   1 
ATOM   868  C CA  . ALA A 1 114 ? 42.272 -2.435  -4.650  1.00 61.82 ? 117 ALA H CA  1 
ATOM   869  C C   . ALA A 1 114 ? 41.170 -2.996  -5.542  1.00 65.88 ? 117 ALA H C   1 
ATOM   870  O O   . ALA A 1 114 ? 41.430 -3.482  -6.643  1.00 68.58 ? 117 ALA H O   1 
ATOM   871  C CB  . ALA A 1 114 ? 42.522 -0.977  -5.006  1.00 57.91 ? 117 ALA H CB  1 
ATOM   872  N N   . LYS A 1 115 ? 39.934 -2.909  -5.056  1.00 68.66 ? 118 LYS H N   1 
ATOM   873  C CA  . LYS A 1 115 ? 38.768 -3.395  -5.793  1.00 67.99 ? 118 LYS H CA  1 
ATOM   874  C C   . LYS A 1 115 ? 38.363 -2.415  -6.888  1.00 68.00 ? 118 LYS H C   1 
ATOM   875  O O   . LYS A 1 115 ? 38.247 -1.213  -6.641  1.00 70.16 ? 118 LYS H O   1 
ATOM   876  C CB  . LYS A 1 115 ? 37.572 -3.578  -4.853  1.00 66.64 ? 118 LYS H CB  1 
ATOM   877  C CG  . LYS A 1 115 ? 37.777 -4.573  -3.734  1.00 67.58 ? 118 LYS H CG  1 
ATOM   878  C CD  . LYS A 1 115 ? 36.486 -4.770  -2.952  1.00 69.63 ? 118 LYS H CD  1 
ATOM   879  C CE  . LYS A 1 115 ? 36.640 -5.853  -1.893  1.00 74.61 ? 118 LYS H CE  1 
ATOM   880  N NZ  . LYS A 1 115 ? 35.351 -6.151  -1.212  1.00 74.35 ? 118 LYS H NZ  1 
ATOM   881  N N   . THR A 1 116 ? 38.139 -2.932  -8.092  1.00 64.68 ? 119 THR H N   1 
ATOM   882  C CA  . THR A 1 116 ? 37.724 -2.097  -9.213  1.00 64.15 ? 119 THR H CA  1 
ATOM   883  C C   . THR A 1 116 ? 36.308 -1.569  -8.958  1.00 62.82 ? 119 THR H C   1 
ATOM   884  O O   . THR A 1 116 ? 35.473 -2.290  -8.416  1.00 65.15 ? 119 THR H O   1 
ATOM   885  C CB  . THR A 1 116 ? 37.744 -2.902  -10.527 1.00 64.24 ? 119 THR H CB  1 
ATOM   886  O OG1 . THR A 1 116 ? 37.051 -2.174  -11.548 1.00 69.81 ? 119 THR H OG1 1 
ATOM   887  C CG2 . THR A 1 116 ? 37.092 -4.258  -10.334 1.00 65.43 ? 119 THR H CG2 1 
ATOM   888  N N   . THR A 1 117 ? 36.040 -0.318  -9.336  1.00 58.93 ? 120 THR H N   1 
ATOM   889  C CA  . THR A 1 117 ? 34.715 0.267   -9.120  1.00 56.30 ? 120 THR H CA  1 
ATOM   890  C C   . THR A 1 117 ? 34.293 1.177   -10.277 1.00 54.49 ? 120 THR H C   1 
ATOM   891  O O   . THR A 1 117 ? 35.111 1.918   -10.829 1.00 53.12 ? 120 THR H O   1 
ATOM   892  C CB  . THR A 1 117 ? 34.675 1.087   -7.814  1.00 55.76 ? 120 THR H CB  1 
ATOM   893  O OG1 . THR A 1 117 ? 35.429 2.291   -7.985  1.00 55.27 ? 120 THR H OG1 1 
ATOM   894  C CG2 . THR A 1 117 ? 35.274 0.289   -6.659  1.00 53.00 ? 120 THR H CG2 1 
ATOM   895  N N   . PRO A 1 118 ? 33.006 1.129   -10.662 1.00 53.16 ? 121 PRO H N   1 
ATOM   896  C CA  . PRO A 1 118 ? 32.522 1.970   -11.760 1.00 48.28 ? 121 PRO H CA  1 
ATOM   897  C C   . PRO A 1 118 ? 32.561 3.434   -11.340 1.00 46.36 ? 121 PRO H C   1 
ATOM   898  O O   . PRO A 1 118 ? 32.645 3.745   -10.150 1.00 41.12 ? 121 PRO H O   1 
ATOM   899  C CB  . PRO A 1 118 ? 31.103 1.459   -11.984 1.00 50.71 ? 121 PRO H CB  1 
ATOM   900  C CG  . PRO A 1 118 ? 30.675 1.084   -10.602 1.00 51.98 ? 121 PRO H CG  1 
ATOM   901  C CD  . PRO A 1 118 ? 31.897 0.372   -10.051 1.00 53.51 ? 121 PRO H CD  1 
ATOM   902  N N   . PRO A 1 119 ? 32.496 4.353   -12.312 1.00 44.68 ? 122 PRO H N   1 
ATOM   903  C CA  . PRO A 1 119 ? 32.532 5.782   -11.999 1.00 47.18 ? 122 PRO H CA  1 
ATOM   904  C C   . PRO A 1 119 ? 31.173 6.400   -11.704 1.00 47.58 ? 122 PRO H C   1 
ATOM   905  O O   . PRO A 1 119 ? 30.157 5.990   -12.266 1.00 46.74 ? 122 PRO H O   1 
ATOM   906  C CB  . PRO A 1 119 ? 33.154 6.376   -13.255 1.00 48.47 ? 122 PRO H CB  1 
ATOM   907  C CG  . PRO A 1 119 ? 32.502 5.562   -14.322 1.00 48.50 ? 122 PRO H CG  1 
ATOM   908  C CD  . PRO A 1 119 ? 32.576 4.138   -13.769 1.00 45.97 ? 122 PRO H CD  1 
ATOM   909  N N   . SER A 1 120 ? 31.168 7.383   -10.810 1.00 48.77 ? 123 SER H N   1 
ATOM   910  C CA  . SER A 1 120 ? 29.950 8.112   -10.472 1.00 46.90 ? 123 SER H CA  1 
ATOM   911  C C   . SER A 1 120 ? 30.036 9.390   -11.294 1.00 45.43 ? 123 SER H C   1 
ATOM   912  O O   . SER A 1 120 ? 30.969 10.180  -11.133 1.00 45.52 ? 123 SER H O   1 
ATOM   913  C CB  . SER A 1 120 ? 29.907 8.462   -8.983  1.00 45.92 ? 123 SER H CB  1 
ATOM   914  O OG  . SER A 1 120 ? 29.764 7.305   -8.183  1.00 51.16 ? 123 SER H OG  1 
ATOM   915  N N   . VAL A 1 121 ? 29.077 9.580   -12.188 1.00 45.84 ? 124 VAL H N   1 
ATOM   916  C CA  . VAL A 1 121 ? 29.056 10.753  -13.044 1.00 41.40 ? 124 VAL H CA  1 
ATOM   917  C C   . VAL A 1 121 ? 28.092 11.802  -12.504 1.00 45.53 ? 124 VAL H C   1 
ATOM   918  O O   . VAL A 1 121 ? 26.916 11.522  -12.274 1.00 47.56 ? 124 VAL H O   1 
ATOM   919  C CB  . VAL A 1 121 ? 28.641 10.369  -14.475 1.00 36.87 ? 124 VAL H CB  1 
ATOM   920  C CG1 . VAL A 1 121 ? 28.680 11.585  -15.377 1.00 35.27 ? 124 VAL H CG1 1 
ATOM   921  C CG2 . VAL A 1 121 ? 29.568 9.278   -15.001 1.00 33.72 ? 124 VAL H CG2 1 
ATOM   922  N N   . TYR A 1 122 ? 28.603 13.010  -12.297 1.00 44.90 ? 125 TYR H N   1 
ATOM   923  C CA  . TYR A 1 122 ? 27.794 14.110  -11.795 1.00 46.59 ? 125 TYR H CA  1 
ATOM   924  C C   . TYR A 1 122 ? 27.811 15.253  -12.798 1.00 50.05 ? 125 TYR H C   1 
ATOM   925  O O   . TYR A 1 122 ? 28.873 15.686  -13.244 1.00 53.76 ? 125 TYR H O   1 
ATOM   926  C CB  . TYR A 1 122 ? 28.331 14.603  -10.451 1.00 45.34 ? 125 TYR H CB  1 
ATOM   927  C CG  . TYR A 1 122 ? 28.304 13.554  -9.361  1.00 44.03 ? 125 TYR H CG  1 
ATOM   928  C CD1 . TYR A 1 122 ? 27.111 12.926  -9.001  1.00 40.14 ? 125 TYR H CD1 1 
ATOM   929  C CD2 . TYR A 1 122 ? 29.469 13.188  -8.693  1.00 44.33 ? 125 TYR H CD2 1 
ATOM   930  C CE1 . TYR A 1 122 ? 27.082 11.959  -8.002  1.00 39.66 ? 125 TYR H CE1 1 
ATOM   931  C CE2 . TYR A 1 122 ? 29.450 12.221  -7.689  1.00 45.55 ? 125 TYR H CE2 1 
ATOM   932  C CZ  . TYR A 1 122 ? 28.254 11.612  -7.349  1.00 41.79 ? 125 TYR H CZ  1 
ATOM   933  O OH  . TYR A 1 122 ? 28.234 10.663  -6.354  1.00 37.87 ? 125 TYR H OH  1 
ATOM   934  N N   . PRO A 1 123 ? 26.629 15.754  -13.173 1.00 50.60 ? 126 PRO H N   1 
ATOM   935  C CA  . PRO A 1 123 ? 26.550 16.854  -14.131 1.00 51.20 ? 126 PRO H CA  1 
ATOM   936  C C   . PRO A 1 123 ? 26.910 18.192  -13.505 1.00 51.98 ? 126 PRO H C   1 
ATOM   937  O O   . PRO A 1 123 ? 26.536 18.476  -12.372 1.00 50.13 ? 126 PRO H O   1 
ATOM   938  C CB  . PRO A 1 123 ? 25.097 16.808  -14.575 1.00 49.89 ? 126 PRO H CB  1 
ATOM   939  C CG  . PRO A 1 123 ? 24.401 16.423  -13.316 1.00 52.41 ? 126 PRO H CG  1 
ATOM   940  C CD  . PRO A 1 123 ? 25.280 15.293  -12.799 1.00 52.22 ? 126 PRO H CD  1 
ATOM   941  N N   . ALA A 1 124 ? 27.652 19.001  -14.252 1.00 55.80 ? 127 ALA H N   1 
ATOM   942  C CA  . ALA A 1 124 ? 28.049 20.326  -13.799 1.00 60.42 ? 127 ALA H CA  1 
ATOM   943  C C   . ALA A 1 124 ? 27.374 21.334  -14.727 1.00 62.95 ? 127 ALA H C   1 
ATOM   944  O O   . ALA A 1 124 ? 27.852 21.601  -15.834 1.00 63.90 ? 127 ALA H O   1 
ATOM   945  C CB  . ALA A 1 124 ? 29.569 20.475  -13.855 1.00 58.48 ? 127 ALA H CB  1 
ATOM   946  N N   . ALA A 1 125 ? 26.243 21.869  -14.277 1.00 65.94 ? 128 ALA H N   1 
ATOM   947  C CA  . ALA A 1 125 ? 25.486 22.841  -15.057 1.00 70.23 ? 128 ALA H CA  1 
ATOM   948  C C   . ALA A 1 125 ? 25.320 24.137  -14.269 1.00 73.89 ? 128 ALA H C   1 
ATOM   949  O O   . ALA A 1 125 ? 25.366 24.136  -13.039 1.00 73.14 ? 128 ALA H O   1 
ATOM   950  C CB  . ALA A 1 125 ? 24.119 22.268  -15.420 1.00 68.91 ? 128 ALA H CB  1 
ATOM   951  N N   . PRO A 1 126 ? 25.129 25.266  -14.973 1.00 76.62 ? 129 PRO H N   1 
ATOM   952  C CA  . PRO A 1 126 ? 24.957 26.569  -14.322 1.00 79.47 ? 129 PRO H CA  1 
ATOM   953  C C   . PRO A 1 126 ? 23.738 26.617  -13.392 1.00 81.99 ? 129 PRO H C   1 
ATOM   954  O O   . PRO A 1 126 ? 22.595 26.452  -13.833 1.00 81.11 ? 129 PRO H O   1 
ATOM   955  C CB  . PRO A 1 126 ? 24.836 27.527  -15.507 1.00 79.56 ? 129 PRO H CB  1 
ATOM   956  C CG  . PRO A 1 126 ? 24.208 26.670  -16.567 1.00 79.05 ? 129 PRO H CG  1 
ATOM   957  C CD  . PRO A 1 126 ? 24.984 25.387  -16.434 1.00 76.29 ? 129 PRO H CD  1 
ATOM   958  N N   . GLY A 1 127 ? 23.996 26.845  -12.105 1.00 83.68 ? 130 GLY H N   1 
ATOM   959  C CA  . GLY A 1 127 ? 22.931 26.905  -11.118 1.00 84.88 ? 130 GLY H CA  1 
ATOM   960  C C   . GLY A 1 127 ? 22.091 28.165  -11.183 1.00 86.92 ? 130 GLY H C   1 
ATOM   961  O O   . GLY A 1 127 ? 21.695 28.598  -12.266 1.00 87.64 ? 130 GLY H O   1 
ATOM   962  N N   . CYS A 1 128 ? 21.815 28.758  -10.024 1.00 88.65 ? 131 CYS H N   1 
ATOM   963  C CA  . CYS A 1 128 ? 21.008 29.973  -9.966  1.00 91.60 ? 131 CYS H CA  1 
ATOM   964  C C   . CYS A 1 128 ? 21.855 31.222  -9.740  1.00 93.07 ? 131 CYS H C   1 
ATOM   965  O O   . CYS A 1 128 ? 22.526 31.353  -8.715  1.00 92.18 ? 131 CYS H O   1 
ATOM   966  C CB  . CYS A 1 128 ? 19.951 29.860  -8.862  1.00 92.18 ? 131 CYS H CB  1 
ATOM   967  S SG  . CYS A 1 128 ? 20.599 29.676  -7.180  1.00 92.83 ? 131 CYS H SG  1 
ATOM   968  N N   . GLY A 1 129 ? 21.815 32.134  -10.710 1.00 94.85 ? 132 GLY H N   1 
ATOM   969  C CA  . GLY A 1 129 ? 22.572 33.370  -10.612 1.00 95.50 ? 132 GLY H CA  1 
ATOM   970  C C   . GLY A 1 129 ? 24.004 33.245  -11.101 1.00 96.24 ? 132 GLY H C   1 
ATOM   971  O O   . GLY A 1 129 ? 24.944 33.292  -10.304 1.00 95.74 ? 132 GLY H O   1 
ATOM   972  N N   . ASP A 1 130 ? 24.175 33.092  -12.411 1.00 95.03 ? 133 ASP H N   1 
ATOM   973  C CA  . ASP A 1 130 ? 25.505 32.958  -12.997 1.00 94.64 ? 133 ASP H CA  1 
ATOM   974  C C   . ASP A 1 130 ? 25.553 33.465  -14.434 1.00 94.83 ? 133 ASP H C   1 
ATOM   975  O O   . ASP A 1 130 ? 24.607 33.282  -15.203 1.00 95.00 ? 133 ASP H O   1 
ATOM   976  C CB  . ASP A 1 130 ? 25.951 31.494  -12.962 1.00 94.02 ? 133 ASP H CB  1 
ATOM   977  C CG  . ASP A 1 130 ? 26.041 30.946  -11.554 1.00 93.09 ? 133 ASP H CG  1 
ATOM   978  O OD1 . ASP A 1 130 ? 26.867 31.458  -10.767 1.00 93.52 ? 133 ASP H OD1 1 
ATOM   979  O OD2 . ASP A 1 130 ? 25.284 30.005  -11.234 1.00 92.39 ? 133 ASP H OD2 1 
ATOM   980  N N   . THR A 1 131 ? 26.663 34.103  -14.792 1.00 94.74 ? 134 THR H N   1 
ATOM   981  C CA  . THR A 1 131 ? 26.839 34.631  -16.137 1.00 93.83 ? 134 THR H CA  1 
ATOM   982  C C   . THR A 1 131 ? 26.802 33.508  -17.171 1.00 93.58 ? 134 THR H C   1 
ATOM   983  O O   . THR A 1 131 ? 27.699 32.664  -17.225 1.00 94.08 ? 134 THR H O   1 
ATOM   984  C CB  . THR A 1 131 ? 28.177 35.396  -16.265 1.00 93.78 ? 134 THR H CB  1 
ATOM   985  O OG1 . THR A 1 131 ? 28.390 35.763  -17.635 1.00 94.48 ? 134 THR H OG1 1 
ATOM   986  C CG2 . THR A 1 131 ? 29.336 34.538  -15.779 1.00 93.13 ? 134 THR H CG2 1 
ATOM   987  N N   . THR A 1 132 ? 25.752 33.502  -17.985 1.00 92.02 ? 135 THR H N   1 
ATOM   988  C CA  . THR A 1 132 ? 25.587 32.488  -19.021 1.00 90.21 ? 135 THR H CA  1 
ATOM   989  C C   . THR A 1 132 ? 25.379 33.146  -20.385 1.00 89.58 ? 135 THR H C   1 
ATOM   990  O O   . THR A 1 132 ? 26.008 34.161  -20.697 1.00 88.28 ? 135 THR H O   1 
ATOM   991  C CB  . THR A 1 132 ? 24.383 31.573  -18.704 1.00 89.48 ? 135 THR H CB  1 
ATOM   992  O OG1 . THR A 1 132 ? 23.202 32.370  -18.551 1.00 88.70 ? 135 THR H OG1 1 
ATOM   993  C CG2 . THR A 1 132 ? 24.630 30.796  -17.416 1.00 87.04 ? 135 THR H CG2 1 
ATOM   994  N N   . GLY A 1 133 ? 24.500 32.562  -21.195 1.00 88.59 ? 136 GLY H N   1 
ATOM   995  C CA  . GLY A 1 133 ? 24.220 33.113  -22.508 1.00 87.24 ? 136 GLY H CA  1 
ATOM   996  C C   . GLY A 1 133 ? 25.339 32.918  -23.513 1.00 87.62 ? 136 GLY H C   1 
ATOM   997  O O   . GLY A 1 133 ? 25.640 31.789  -23.905 1.00 87.86 ? 136 GLY H O   1 
ATOM   998  N N   . SER A 1 134 ? 25.948 34.023  -23.937 1.00 86.50 ? 137 SER H N   1 
ATOM   999  C CA  . SER A 1 134 ? 27.044 33.983  -24.901 1.00 83.75 ? 137 SER H CA  1 
ATOM   1000 C C   . SER A 1 134 ? 28.088 32.965  -24.471 1.00 81.89 ? 137 SER H C   1 
ATOM   1001 O O   . SER A 1 134 ? 28.948 33.261  -23.639 1.00 83.78 ? 137 SER H O   1 
ATOM   1002 C CB  . SER A 1 134 ? 27.697 35.363  -25.020 1.00 84.16 ? 137 SER H CB  1 
ATOM   1003 O OG  . SER A 1 134 ? 28.833 35.318  -25.867 1.00 84.01 ? 137 SER H OG  1 
ATOM   1004 N N   . SER A 1 135 ? 28.006 31.768  -25.041 1.00 79.42 ? 138 SER H N   1 
ATOM   1005 C CA  . SER A 1 135 ? 28.937 30.694  -24.716 1.00 76.13 ? 138 SER H CA  1 
ATOM   1006 C C   . SER A 1 135 ? 28.914 30.392  -23.220 1.00 73.09 ? 138 SER H C   1 
ATOM   1007 O O   . SER A 1 135 ? 29.303 31.221  -22.399 1.00 71.48 ? 138 SER H O   1 
ATOM   1008 C CB  . SER A 1 135 ? 30.354 31.078  -25.149 1.00 76.29 ? 138 SER H CB  1 
ATOM   1009 O OG  . SER A 1 135 ? 30.402 31.349  -26.540 1.00 76.91 ? 138 SER H OG  1 
ATOM   1010 N N   . VAL A 1 136 ? 28.450 29.198  -22.872 1.00 71.66 ? 139 VAL H N   1 
ATOM   1011 C CA  . VAL A 1 136 ? 28.378 28.786  -21.476 1.00 71.57 ? 139 VAL H CA  1 
ATOM   1012 C C   . VAL A 1 136 ? 29.303 27.599  -21.238 1.00 67.63 ? 139 VAL H C   1 
ATOM   1013 O O   . VAL A 1 136 ? 29.614 26.849  -22.161 1.00 68.46 ? 139 VAL H O   1 
ATOM   1014 C CB  . VAL A 1 136 ? 26.936 28.392  -21.087 1.00 73.28 ? 139 VAL H CB  1 
ATOM   1015 C CG1 . VAL A 1 136 ? 26.458 27.240  -21.961 1.00 72.51 ? 139 VAL H CG1 1 
ATOM   1016 C CG2 . VAL A 1 136 ? 26.875 28.017  -19.610 1.00 73.91 ? 139 VAL H CG2 1 
ATOM   1017 N N   . THR A 1 137 ? 29.745 27.435  -19.999 1.00 66.26 ? 140 THR H N   1 
ATOM   1018 C CA  . THR A 1 137 ? 30.632 26.335  -19.661 1.00 64.27 ? 140 THR H CA  1 
ATOM   1019 C C   . THR A 1 137 ? 29.874 25.218  -18.959 1.00 63.92 ? 140 THR H C   1 
ATOM   1020 O O   . THR A 1 137 ? 29.370 25.395  -17.853 1.00 65.04 ? 140 THR H O   1 
ATOM   1021 C CB  . THR A 1 137 ? 31.777 26.803  -18.740 1.00 65.00 ? 140 THR H CB  1 
ATOM   1022 O OG1 . THR A 1 137 ? 32.487 27.881  -19.365 1.00 65.21 ? 140 THR H OG1 1 
ATOM   1023 C CG2 . THR A 1 137 ? 32.747 25.653  -18.468 1.00 62.21 ? 140 THR H CG2 1 
ATOM   1024 N N   . LEU A 1 138 ? 29.790 24.070  -19.620 1.00 64.08 ? 141 LEU H N   1 
ATOM   1025 C CA  . LEU A 1 138 ? 29.117 22.903  -19.066 1.00 63.37 ? 141 LEU H CA  1 
ATOM   1026 C C   . LEU A 1 138 ? 30.156 21.815  -18.821 1.00 63.17 ? 141 LEU H C   1 
ATOM   1027 O O   . LEU A 1 138 ? 31.222 21.824  -19.434 1.00 63.27 ? 141 LEU H O   1 
ATOM   1028 C CB  . LEU A 1 138 ? 28.060 22.388  -20.040 1.00 65.22 ? 141 LEU H CB  1 
ATOM   1029 C CG  . LEU A 1 138 ? 26.816 23.253  -20.242 1.00 66.68 ? 141 LEU H CG  1 
ATOM   1030 C CD1 . LEU A 1 138 ? 25.941 22.628  -21.318 1.00 68.00 ? 141 LEU H CD1 1 
ATOM   1031 C CD2 . LEU A 1 138 ? 26.058 23.375  -18.926 1.00 67.36 ? 141 LEU H CD2 1 
ATOM   1032 N N   . GLY A 1 139 ? 29.853 20.878  -17.929 1.00 60.45 ? 142 GLY H N   1 
ATOM   1033 C CA  . GLY A 1 139 ? 30.805 19.817  -17.659 1.00 57.56 ? 142 GLY H CA  1 
ATOM   1034 C C   . GLY A 1 139 ? 30.260 18.646  -16.869 1.00 55.50 ? 142 GLY H C   1 
ATOM   1035 O O   . GLY A 1 139 ? 29.149 18.694  -16.346 1.00 58.17 ? 142 GLY H O   1 
ATOM   1036 N N   . CYS A 1 140 ? 31.054 17.584  -16.793 1.00 51.54 ? 143 CYS H N   1 
ATOM   1037 C CA  . CYS A 1 140 ? 30.679 16.387  -16.056 1.00 49.66 ? 143 CYS H CA  1 
ATOM   1038 C C   . CYS A 1 140 ? 31.809 15.976  -15.117 1.00 47.49 ? 143 CYS H C   1 
ATOM   1039 O O   . CYS A 1 140 ? 32.971 15.914  -15.519 1.00 45.65 ? 143 CYS H O   1 
ATOM   1040 C CB  . CYS A 1 140 ? 30.346 15.246  -17.028 1.00 48.76 ? 143 CYS H CB  1 
ATOM   1041 S SG  . CYS A 1 140 ? 28.733 15.451  -17.853 1.00 52.86 ? 143 CYS H SG  1 
ATOM   1042 N N   . LEU A 1 141 ? 31.459 15.727  -13.858 1.00 46.51 ? 144 LEU H N   1 
ATOM   1043 C CA  . LEU A 1 141 ? 32.426 15.311  -12.846 1.00 46.85 ? 144 LEU H CA  1 
ATOM   1044 C C   . LEU A 1 141 ? 32.343 13.800  -12.712 1.00 47.73 ? 144 LEU H C   1 
ATOM   1045 O O   . LEU A 1 141 ? 31.259 13.253  -12.522 1.00 46.47 ? 144 LEU H O   1 
ATOM   1046 C CB  . LEU A 1 141 ? 32.110 15.954  -11.492 1.00 44.00 ? 144 LEU H CB  1 
ATOM   1047 C CG  . LEU A 1 141 ? 32.969 15.506  -10.307 1.00 43.62 ? 144 LEU H CG  1 
ATOM   1048 C CD1 . LEU A 1 141 ? 34.427 15.870  -10.555 1.00 45.04 ? 144 LEU H CD1 1 
ATOM   1049 C CD2 . LEU A 1 141 ? 32.469 16.167  -9.032  1.00 45.49 ? 144 LEU H CD2 1 
ATOM   1050 N N   . VAL A 1 142 ? 33.493 13.137  -12.810 1.00 46.43 ? 145 VAL H N   1 
ATOM   1051 C CA  . VAL A 1 142 ? 33.571 11.682  -12.719 1.00 42.62 ? 145 VAL H CA  1 
ATOM   1052 C C   . VAL A 1 142 ? 34.468 11.279  -11.544 1.00 41.95 ? 145 VAL H C   1 
ATOM   1053 O O   . VAL A 1 142 ? 35.689 11.430  -11.601 1.00 43.42 ? 145 VAL H O   1 
ATOM   1054 C CB  . VAL A 1 142 ? 34.141 11.098  -14.032 1.00 42.46 ? 145 VAL H CB  1 
ATOM   1055 C CG1 . VAL A 1 142 ? 34.106 9.580   -13.997 1.00 43.41 ? 145 VAL H CG1 1 
ATOM   1056 C CG2 . VAL A 1 142 ? 33.337 11.619  -15.221 1.00 41.75 ? 145 VAL H CG2 1 
ATOM   1057 N N   . LYS A 1 143 ? 33.864 10.771  -10.476 1.00 41.43 ? 146 LYS H N   1 
ATOM   1058 C CA  . LYS A 1 143 ? 34.636 10.370  -9.308  1.00 46.33 ? 146 LYS H CA  1 
ATOM   1059 C C   . LYS A 1 143 ? 34.245 8.995   -8.787  1.00 48.41 ? 146 LYS H C   1 
ATOM   1060 O O   . LYS A 1 143 ? 33.210 8.442   -9.160  1.00 50.48 ? 146 LYS H O   1 
ATOM   1061 C CB  . LYS A 1 143 ? 34.479 11.408  -8.190  1.00 46.31 ? 146 LYS H CB  1 
ATOM   1062 C CG  . LYS A 1 143 ? 33.063 11.537  -7.645  1.00 48.88 ? 146 LYS H CG  1 
ATOM   1063 C CD  . LYS A 1 143 ? 32.912 12.705  -6.663  1.00 52.85 ? 146 LYS H CD  1 
ATOM   1064 C CE  . LYS A 1 143 ? 33.642 12.477  -5.338  1.00 49.34 ? 146 LYS H CE  1 
ATOM   1065 N NZ  . LYS A 1 143 ? 35.127 12.509  -5.463  1.00 54.85 ? 146 LYS H NZ  1 
ATOM   1066 N N   . GLY A 1 144 ? 35.097 8.438   -7.933  1.00 51.54 ? 147 GLY H N   1 
ATOM   1067 C CA  . GLY A 1 144 ? 34.820 7.142   -7.347  1.00 52.03 ? 147 GLY H CA  1 
ATOM   1068 C C   . GLY A 1 144 ? 35.133 5.906   -8.169  1.00 51.84 ? 147 GLY H C   1 
ATOM   1069 O O   . GLY A 1 144 ? 34.542 4.855   -7.932  1.00 55.24 ? 147 GLY H O   1 
ATOM   1070 N N   . TYR A 1 145 ? 36.041 6.006   -9.133  1.00 51.43 ? 148 TYR H N   1 
ATOM   1071 C CA  . TYR A 1 145 ? 36.386 4.836   -9.934  1.00 54.85 ? 148 TYR H CA  1 
ATOM   1072 C C   . TYR A 1 145 ? 37.844 4.451   -9.699  1.00 58.09 ? 148 TYR H C   1 
ATOM   1073 O O   . TYR A 1 145 ? 38.627 5.259   -9.190  1.00 57.27 ? 148 TYR H O   1 
ATOM   1074 C CB  . TYR A 1 145 ? 36.144 5.095   -11.427 1.00 50.94 ? 148 TYR H CB  1 
ATOM   1075 C CG  . TYR A 1 145 ? 36.985 6.193   -12.033 1.00 51.86 ? 148 TYR H CG  1 
ATOM   1076 C CD1 . TYR A 1 145 ? 36.693 7.539   -11.799 1.00 49.58 ? 148 TYR H CD1 1 
ATOM   1077 C CD2 . TYR A 1 145 ? 38.066 5.888   -12.858 1.00 51.24 ? 148 TYR H CD2 1 
ATOM   1078 C CE1 . TYR A 1 145 ? 37.456 8.553   -12.378 1.00 48.40 ? 148 TYR H CE1 1 
ATOM   1079 C CE2 . TYR A 1 145 ? 38.834 6.891   -13.437 1.00 51.89 ? 148 TYR H CE2 1 
ATOM   1080 C CZ  . TYR A 1 145 ? 38.523 8.221   -13.195 1.00 50.68 ? 148 TYR H CZ  1 
ATOM   1081 O OH  . TYR A 1 145 ? 39.277 9.210   -13.781 1.00 50.42 ? 148 TYR H OH  1 
ATOM   1082 N N   . PHE A 1 146 ? 38.210 3.219   -10.049 1.00 59.22 ? 149 PHE H N   1 
ATOM   1083 C CA  . PHE A 1 146 ? 39.586 2.795   -9.851  1.00 62.02 ? 149 PHE H CA  1 
ATOM   1084 C C   . PHE A 1 146 ? 40.416 2.651   -11.121 1.00 64.22 ? 149 PHE H C   1 
ATOM   1085 O O   . PHE A 1 146 ? 41.160 3.562   -11.462 1.00 68.75 ? 149 PHE H O   1 
ATOM   1086 C CB  . PHE A 1 146 ? 39.676 1.502   -9.052  1.00 58.43 ? 149 PHE H CB  1 
ATOM   1087 C CG  . PHE A 1 146 ? 41.083 1.015   -8.898  1.00 57.05 ? 149 PHE H CG  1 
ATOM   1088 C CD1 . PHE A 1 146 ? 42.035 1.813   -8.270  1.00 56.77 ? 149 PHE H CD1 1 
ATOM   1089 C CD2 . PHE A 1 146 ? 41.477 -0.205  -9.430  1.00 56.00 ? 149 PHE H CD2 1 
ATOM   1090 C CE1 . PHE A 1 146 ? 43.360 1.404   -8.179  1.00 56.67 ? 149 PHE H CE1 1 
ATOM   1091 C CE2 . PHE A 1 146 ? 42.801 -0.626  -9.344  1.00 55.39 ? 149 PHE H CE2 1 
ATOM   1092 C CZ  . PHE A 1 146 ? 43.745 0.183   -8.716  1.00 55.11 ? 149 PHE H CZ  1 
ATOM   1093 N N   . PRO A 1 147 ? 40.328 1.507   -11.827 1.00 63.53 ? 150 PRO H N   1 
ATOM   1094 C CA  . PRO A 1 147 ? 41.167 1.471   -13.030 1.00 63.09 ? 150 PRO H CA  1 
ATOM   1095 C C   . PRO A 1 147 ? 41.046 2.799   -13.782 1.00 61.67 ? 150 PRO H C   1 
ATOM   1096 O O   . PRO A 1 147 ? 40.072 3.051   -14.486 1.00 58.81 ? 150 PRO H O   1 
ATOM   1097 C CB  . PRO A 1 147 ? 40.623 0.265   -13.799 1.00 61.70 ? 150 PRO H CB  1 
ATOM   1098 C CG  . PRO A 1 147 ? 39.217 0.131   -13.293 1.00 61.85 ? 150 PRO H CG  1 
ATOM   1099 C CD  . PRO A 1 147 ? 39.348 0.409   -11.836 1.00 60.80 ? 150 PRO H CD  1 
ATOM   1100 N N   . GLU A 1 148 ? 42.051 3.648   -13.583 1.00 60.97 ? 151 GLU H N   1 
ATOM   1101 C CA  . GLU A 1 148 ? 42.111 4.982   -14.157 1.00 62.08 ? 151 GLU H CA  1 
ATOM   1102 C C   . GLU A 1 148 ? 41.601 5.101   -15.584 1.00 62.98 ? 151 GLU H C   1 
ATOM   1103 O O   . GLU A 1 148 ? 40.888 6.048   -15.916 1.00 67.77 ? 151 GLU H O   1 
ATOM   1104 C CB  . GLU A 1 148 ? 43.544 5.514   -14.069 1.00 63.47 ? 151 GLU H CB  1 
ATOM   1105 C CG  . GLU A 1 148 ? 43.695 6.956   -14.517 1.00 65.16 ? 151 GLU H CG  1 
ATOM   1106 C CD  . GLU A 1 148 ? 45.026 7.550   -14.110 1.00 67.88 ? 151 GLU H CD  1 
ATOM   1107 O OE1 . GLU A 1 148 ? 45.312 8.703   -14.498 1.00 68.92 ? 151 GLU H OE1 1 
ATOM   1108 O OE2 . GLU A 1 148 ? 45.787 6.863   -13.393 1.00 71.03 ? 151 GLU H OE2 1 
ATOM   1109 N N   . SER A 1 149 ? 41.969 4.150   -16.428 1.00 62.78 ? 152 SER H N   1 
ATOM   1110 C CA  . SER A 1 149 ? 41.537 4.173   -17.814 1.00 61.82 ? 152 SER H CA  1 
ATOM   1111 C C   . SER A 1 149 ? 40.052 4.510   -17.936 1.00 62.59 ? 152 SER H C   1 
ATOM   1112 O O   . SER A 1 149 ? 39.191 3.652   -17.729 1.00 65.51 ? 152 SER H O   1 
ATOM   1113 C CB  . SER A 1 149 ? 41.827 2.818   -18.462 1.00 64.79 ? 152 SER H CB  1 
ATOM   1114 O OG  . SER A 1 149 ? 41.432 1.752   -17.614 1.00 67.15 ? 152 SER H OG  1 
ATOM   1115 N N   . VAL A 1 150 ? 39.758 5.766   -18.264 1.00 58.95 ? 153 VAL H N   1 
ATOM   1116 C CA  . VAL A 1 150 ? 38.381 6.225   -18.425 1.00 56.47 ? 153 VAL H CA  1 
ATOM   1117 C C   . VAL A 1 150 ? 38.338 7.305   -19.500 1.00 52.77 ? 153 VAL H C   1 
ATOM   1118 O O   . VAL A 1 150 ? 39.231 8.144   -19.578 1.00 53.55 ? 153 VAL H O   1 
ATOM   1119 C CB  . VAL A 1 150 ? 37.821 6.797   -17.103 1.00 59.34 ? 153 VAL H CB  1 
ATOM   1120 C CG1 . VAL A 1 150 ? 38.546 8.082   -16.736 1.00 61.58 ? 153 VAL H CG1 1 
ATOM   1121 C CG2 . VAL A 1 150 ? 36.330 7.040   -17.237 1.00 60.67 ? 153 VAL H CG2 1 
ATOM   1122 N N   . THR A 1 151 ? 37.303 7.291   -20.330 1.00 49.55 ? 154 THR H N   1 
ATOM   1123 C CA  . THR A 1 151 ? 37.205 8.274   -21.400 1.00 53.57 ? 154 THR H CA  1 
ATOM   1124 C C   . THR A 1 151 ? 35.840 8.952   -21.499 1.00 56.03 ? 154 THR H C   1 
ATOM   1125 O O   . THR A 1 151 ? 34.804 8.291   -21.477 1.00 61.30 ? 154 THR H O   1 
ATOM   1126 C CB  . THR A 1 151 ? 37.557 7.623   -22.751 1.00 53.22 ? 154 THR H CB  1 
ATOM   1127 O OG1 . THR A 1 151 ? 37.120 8.467   -23.823 1.00 57.36 ? 154 THR H OG1 1 
ATOM   1128 C CG2 . THR A 1 151 ? 36.907 6.256   -22.863 1.00 53.73 ? 154 THR H CG2 1 
ATOM   1129 N N   . VAL A 1 152 ? 35.850 10.277  -21.612 1.00 56.89 ? 155 VAL H N   1 
ATOM   1130 C CA  . VAL A 1 152 ? 34.619 11.058  -21.710 1.00 55.48 ? 155 VAL H CA  1 
ATOM   1131 C C   . VAL A 1 152 ? 34.411 11.593  -23.122 1.00 57.51 ? 155 VAL H C   1 
ATOM   1132 O O   . VAL A 1 152 ? 35.350 12.076  -23.754 1.00 57.09 ? 155 VAL H O   1 
ATOM   1133 C CB  . VAL A 1 152 ? 34.640 12.254  -20.732 1.00 52.97 ? 155 VAL H CB  1 
ATOM   1134 C CG1 . VAL A 1 152 ? 33.335 13.033  -20.825 1.00 49.57 ? 155 VAL H CG1 1 
ATOM   1135 C CG2 . VAL A 1 152 ? 34.863 11.757  -19.321 1.00 49.24 ? 155 VAL H CG2 1 
ATOM   1136 N N   . THR A 1 153 ? 33.173 11.514  -23.606 1.00 57.98 ? 156 THR H N   1 
ATOM   1137 C CA  . THR A 1 153 ? 32.846 11.982  -24.947 1.00 60.82 ? 156 THR H CA  1 
ATOM   1138 C C   . THR A 1 153 ? 31.591 12.843  -24.936 1.00 62.94 ? 156 THR H C   1 
ATOM   1139 O O   . THR A 1 153 ? 30.594 12.480  -24.314 1.00 62.31 ? 156 THR H O   1 
ATOM   1140 C CB  . THR A 1 153 ? 32.590 10.797  -25.895 1.00 62.72 ? 156 THR H CB  1 
ATOM   1141 O OG1 . THR A 1 153 ? 33.581 9.788   -25.677 1.00 63.41 ? 156 THR H OG1 1 
ATOM   1142 C CG2 . THR A 1 153 ? 32.654 11.253  -27.343 1.00 62.29 ? 156 THR H CG2 1 
ATOM   1143 N N   . TRP A 1 154 ? 31.639 13.980  -25.627 1.00 65.55 ? 157 TRP H N   1 
ATOM   1144 C CA  . TRP A 1 154 ? 30.486 14.875  -25.703 1.00 67.74 ? 157 TRP H CA  1 
ATOM   1145 C C   . TRP A 1 154 ? 29.852 14.850  -27.090 1.00 70.46 ? 157 TRP H C   1 
ATOM   1146 O O   . TRP A 1 154 ? 30.325 15.521  -28.007 1.00 72.49 ? 157 TRP H O   1 
ATOM   1147 C CB  . TRP A 1 154 ? 30.887 16.314  -25.366 1.00 65.19 ? 157 TRP H CB  1 
ATOM   1148 C CG  . TRP A 1 154 ? 31.379 16.496  -23.971 1.00 64.07 ? 157 TRP H CG  1 
ATOM   1149 C CD1 . TRP A 1 154 ? 32.599 16.136  -23.480 1.00 65.14 ? 157 TRP H CD1 1 
ATOM   1150 C CD2 . TRP A 1 154 ? 30.650 17.054  -22.872 1.00 62.71 ? 157 TRP H CD2 1 
ATOM   1151 N NE1 . TRP A 1 154 ? 32.677 16.433  -22.142 1.00 67.17 ? 157 TRP H NE1 1 
ATOM   1152 C CE2 . TRP A 1 154 ? 31.494 16.997  -21.741 1.00 65.08 ? 157 TRP H CE2 1 
ATOM   1153 C CE3 . TRP A 1 154 ? 29.365 17.593  -22.731 1.00 61.65 ? 157 TRP H CE3 1 
ATOM   1154 C CZ2 . TRP A 1 154 ? 31.093 17.460  -20.481 1.00 63.20 ? 157 TRP H CZ2 1 
ATOM   1155 C CZ3 . TRP A 1 154 ? 28.966 18.052  -21.479 1.00 60.79 ? 157 TRP H CZ3 1 
ATOM   1156 C CH2 . TRP A 1 154 ? 29.829 17.982  -20.371 1.00 63.16 ? 157 TRP H CH2 1 
ATOM   1157 N N   . ASN A 1 155 ? 28.784 14.071  -27.237 1.00 73.27 ? 158 ASN H N   1 
ATOM   1158 C CA  . ASN A 1 155 ? 28.069 13.961  -28.508 1.00 76.59 ? 158 ASN H CA  1 
ATOM   1159 C C   . ASN A 1 155 ? 28.942 13.435  -29.650 1.00 79.27 ? 158 ASN H C   1 
ATOM   1160 O O   . ASN A 1 155 ? 28.454 13.215  -30.758 1.00 79.92 ? 158 ASN H O   1 
ATOM   1161 C CB  . ASN A 1 155 ? 27.493 15.325  -28.899 1.00 76.45 ? 158 ASN H CB  1 
ATOM   1162 C CG  . ASN A 1 155 ? 26.626 15.928  -27.808 1.00 78.67 ? 158 ASN H CG  1 
ATOM   1163 O OD1 . ASN A 1 155 ? 25.577 15.388  -27.457 1.00 80.98 ? 158 ASN H OD1 1 
ATOM   1164 N ND2 . ASN A 1 155 ? 27.065 17.055  -27.262 1.00 79.49 ? 158 ASN H ND2 1 
ATOM   1165 N N   . SER A 1 156 ? 30.228 13.236  -29.369 1.00 81.93 ? 159 SER H N   1 
ATOM   1166 C CA  . SER A 1 156 ? 31.189 12.744  -30.356 1.00 82.37 ? 159 SER H CA  1 
ATOM   1167 C C   . SER A 1 156 ? 31.619 13.853  -31.314 1.00 83.59 ? 159 SER H C   1 
ATOM   1168 O O   . SER A 1 156 ? 32.175 13.583  -32.378 1.00 85.24 ? 159 SER H O   1 
ATOM   1169 C CB  . SER A 1 156 ? 30.595 11.578  -31.157 1.00 83.00 ? 159 SER H CB  1 
ATOM   1170 O OG  . SER A 1 156 ? 30.219 10.508  -30.308 1.00 83.27 ? 159 SER H OG  1 
ATOM   1171 N N   . GLY A 1 157 ? 31.359 15.099  -30.929 1.00 83.86 ? 160 GLY H N   1 
ATOM   1172 C CA  . GLY A 1 157 ? 31.729 16.227  -31.764 1.00 82.95 ? 160 GLY H CA  1 
ATOM   1173 C C   . GLY A 1 157 ? 32.110 17.437  -30.934 1.00 83.35 ? 160 GLY H C   1 
ATOM   1174 O O   . GLY A 1 157 ? 31.380 18.430  -30.896 1.00 82.91 ? 160 GLY H O   1 
ATOM   1175 N N   . GLY A 1 158 ? 33.260 17.355  -30.270 1.00 83.56 ? 161 GLY H N   1 
ATOM   1176 C CA  . GLY A 1 158 ? 33.717 18.451  -29.435 1.00 83.10 ? 161 GLY H CA  1 
ATOM   1177 C C   . GLY A 1 158 ? 35.089 18.991  -29.793 1.00 82.71 ? 161 GLY H C   1 
ATOM   1178 O O   . GLY A 1 158 ? 36.041 18.234  -29.987 1.00 82.64 ? 161 GLY H O   1 
ATOM   1179 N N   . SER A 1 159 ? 35.183 20.314  -29.877 1.00 82.42 ? 164 SER H N   1 
ATOM   1180 C CA  . SER A 1 159 ? 36.432 20.992  -30.204 1.00 80.10 ? 164 SER H CA  1 
ATOM   1181 C C   . SER A 1 159 ? 36.789 21.919  -29.047 1.00 78.38 ? 164 SER H C   1 
ATOM   1182 O O   . SER A 1 159 ? 37.948 22.288  -28.861 1.00 77.58 ? 164 SER H O   1 
ATOM   1183 C CB  . SER A 1 159 ? 36.268 21.813  -31.486 1.00 81.68 ? 164 SER H CB  1 
ATOM   1184 O OG  . SER A 1 159 ? 35.780 21.014  -32.552 1.00 82.32 ? 164 SER H OG  1 
ATOM   1185 N N   . SER A 1 160 ? 35.773 22.290  -28.276 1.00 75.50 ? 165 SER H N   1 
ATOM   1186 C CA  . SER A 1 160 ? 35.947 23.169  -27.127 1.00 72.23 ? 165 SER H CA  1 
ATOM   1187 C C   . SER A 1 160 ? 35.929 22.349  -25.838 1.00 67.32 ? 165 SER H C   1 
ATOM   1188 O O   . SER A 1 160 ? 35.531 22.834  -24.779 1.00 66.10 ? 165 SER H O   1 
ATOM   1189 C CB  . SER A 1 160 ? 34.831 24.220  -27.107 1.00 74.04 ? 165 SER H CB  1 
ATOM   1190 O OG  . SER A 1 160 ? 33.558 23.616  -27.266 1.00 73.33 ? 165 SER H OG  1 
ATOM   1191 N N   . VAL A 1 161 ? 36.369 21.100  -25.949 1.00 62.82 ? 166 VAL H N   1 
ATOM   1192 C CA  . VAL A 1 161 ? 36.413 20.186  -24.816 1.00 60.46 ? 166 VAL H CA  1 
ATOM   1193 C C   . VAL A 1 161 ? 37.674 20.398  -23.986 1.00 58.64 ? 166 VAL H C   1 
ATOM   1194 O O   . VAL A 1 161 ? 38.701 20.842  -24.499 1.00 58.08 ? 166 VAL H O   1 
ATOM   1195 C CB  . VAL A 1 161 ? 36.371 18.715  -25.295 1.00 59.11 ? 166 VAL H CB  1 
ATOM   1196 C CG1 . VAL A 1 161 ? 36.417 17.767  -24.104 1.00 59.81 ? 166 VAL H CG1 1 
ATOM   1197 C CG2 . VAL A 1 161 ? 35.115 18.478  -26.113 1.00 59.57 ? 166 VAL H CG2 1 
ATOM   1198 N N   . HIS A 1 162 ? 37.579 20.081  -22.698 1.00 58.61 ? 167 HIS H N   1 
ATOM   1199 C CA  . HIS A 1 162 ? 38.694 20.214  -21.766 1.00 55.57 ? 167 HIS H CA  1 
ATOM   1200 C C   . HIS A 1 162 ? 38.654 19.070  -20.767 1.00 52.57 ? 167 HIS H C   1 
ATOM   1201 O O   . HIS A 1 162 ? 38.004 19.165  -19.726 1.00 56.73 ? 167 HIS H O   1 
ATOM   1202 C CB  . HIS A 1 162 ? 38.613 21.549  -21.020 1.00 53.30 ? 167 HIS H CB  1 
ATOM   1203 C CG  . HIS A 1 162 ? 39.255 22.690  -21.745 1.00 53.75 ? 167 HIS H CG  1 
ATOM   1204 N ND1 . HIS A 1 162 ? 38.896 24.002  -21.529 1.00 52.13 ? 167 HIS H ND1 1 
ATOM   1205 C CD2 . HIS A 1 162 ? 40.254 22.717  -22.658 1.00 52.85 ? 167 HIS H CD2 1 
ATOM   1206 C CE1 . HIS A 1 162 ? 39.645 24.790  -22.280 1.00 53.21 ? 167 HIS H CE1 1 
ATOM   1207 N NE2 . HIS A 1 162 ? 40.477 24.036  -22.973 1.00 55.52 ? 167 HIS H NE2 1 
ATOM   1208 N N   . THR A 1 163 ? 39.345 17.985  -21.092 1.00 48.83 ? 168 THR H N   1 
ATOM   1209 C CA  . THR A 1 163 ? 39.394 16.822  -20.218 1.00 47.81 ? 168 THR H CA  1 
ATOM   1210 C C   . THR A 1 163 ? 40.593 16.962  -19.289 1.00 44.75 ? 168 THR H C   1 
ATOM   1211 O O   . THR A 1 163 ? 41.734 16.986  -19.739 1.00 44.53 ? 168 THR H O   1 
ATOM   1212 C CB  . THR A 1 163 ? 39.521 15.525  -21.045 1.00 50.71 ? 168 THR H CB  1 
ATOM   1213 O OG1 . THR A 1 163 ? 38.378 15.396  -21.901 1.00 55.13 ? 168 THR H OG1 1 
ATOM   1214 C CG2 . THR A 1 163 ? 39.597 14.314  -20.138 1.00 49.32 ? 168 THR H CG2 1 
ATOM   1215 N N   . PHE A 1 164 ? 40.328 17.064  -17.990 1.00 42.68 ? 169 PHE H N   1 
ATOM   1216 C CA  . PHE A 1 164 ? 41.387 17.225  -16.999 1.00 40.36 ? 169 PHE H CA  1 
ATOM   1217 C C   . PHE A 1 164 ? 41.941 15.892  -16.508 1.00 39.73 ? 169 PHE H C   1 
ATOM   1218 O O   . PHE A 1 164 ? 41.205 14.920  -16.340 1.00 41.66 ? 169 PHE H O   1 
ATOM   1219 C CB  . PHE A 1 164 ? 40.863 18.052  -15.817 1.00 37.86 ? 169 PHE H CB  1 
ATOM   1220 C CG  . PHE A 1 164 ? 40.438 19.442  -16.203 1.00 34.24 ? 169 PHE H CG  1 
ATOM   1221 C CD1 . PHE A 1 164 ? 41.369 20.472  -16.278 1.00 36.36 ? 169 PHE H CD1 1 
ATOM   1222 C CD2 . PHE A 1 164 ? 39.122 19.705  -16.572 1.00 35.83 ? 169 PHE H CD2 1 
ATOM   1223 C CE1 . PHE A 1 164 ? 41.001 21.738  -16.722 1.00 34.24 ? 169 PHE H CE1 1 
ATOM   1224 C CE2 . PHE A 1 164 ? 38.742 20.973  -17.020 1.00 33.03 ? 169 PHE H CE2 1 
ATOM   1225 C CZ  . PHE A 1 164 ? 39.687 21.991  -17.095 1.00 33.77 ? 169 PHE H CZ  1 
ATOM   1226 N N   . PRO A 1 165 ? 43.259 15.830  -16.280 1.00 35.76 ? 170 PRO H N   1 
ATOM   1227 C CA  . PRO A 1 165 ? 43.902 14.601  -15.806 1.00 36.87 ? 170 PRO H CA  1 
ATOM   1228 C C   . PRO A 1 165 ? 43.241 14.113  -14.520 1.00 39.34 ? 170 PRO H C   1 
ATOM   1229 O O   . PRO A 1 165 ? 42.798 14.914  -13.700 1.00 38.86 ? 170 PRO H O   1 
ATOM   1230 C CB  . PRO A 1 165 ? 45.350 15.035  -15.588 1.00 32.49 ? 170 PRO H CB  1 
ATOM   1231 C CG  . PRO A 1 165 ? 45.526 16.107  -16.616 1.00 37.37 ? 170 PRO H CG  1 
ATOM   1232 C CD  . PRO A 1 165 ? 44.254 16.894  -16.484 1.00 33.20 ? 170 PRO H CD  1 
ATOM   1233 N N   . ALA A 1 166 ? 43.172 12.801  -14.347 1.00 38.31 ? 171 ALA H N   1 
ATOM   1234 C CA  . ALA A 1 166 ? 42.554 12.242  -13.158 1.00 44.23 ? 171 ALA H CA  1 
ATOM   1235 C C   . ALA A 1 166 ? 43.514 12.261  -11.977 1.00 47.94 ? 171 ALA H C   1 
ATOM   1236 O O   . ALA A 1 166 ? 44.695 11.951  -12.113 1.00 47.18 ? 171 ALA H O   1 
ATOM   1237 C CB  . ALA A 1 166 ? 42.088 10.817  -13.430 1.00 47.34 ? 171 ALA H CB  1 
ATOM   1238 N N   . LEU A 1 167 ? 42.997 12.640  -10.815 1.00 50.56 ? 172 LEU H N   1 
ATOM   1239 C CA  . LEU A 1 167 ? 43.795 12.681  -9.599  1.00 52.87 ? 172 LEU H CA  1 
ATOM   1240 C C   . LEU A 1 167 ? 43.304 11.600  -8.653  1.00 54.63 ? 172 LEU H C   1 
ATOM   1241 O O   . LEU A 1 167 ? 42.102 11.361  -8.535  1.00 54.71 ? 172 LEU H O   1 
ATOM   1242 C CB  . LEU A 1 167 ? 43.679 14.050  -8.929  1.00 54.17 ? 172 LEU H CB  1 
ATOM   1243 C CG  . LEU A 1 167 ? 44.381 15.192  -9.664  1.00 56.26 ? 172 LEU H CG  1 
ATOM   1244 C CD1 . LEU A 1 167 ? 44.156 16.497  -8.919  1.00 56.09 ? 172 LEU H CD1 1 
ATOM   1245 C CD2 . LEU A 1 167 ? 45.872 14.887  -9.769  1.00 56.48 ? 172 LEU H CD2 1 
ATOM   1246 N N   . LEU A 1 168 ? 44.238 10.943  -7.980  1.00 56.47 ? 173 LEU H N   1 
ATOM   1247 C CA  . LEU A 1 168 ? 43.885 9.880   -7.058  1.00 60.63 ? 173 LEU H CA  1 
ATOM   1248 C C   . LEU A 1 168 ? 43.585 10.438  -5.675  1.00 63.89 ? 173 LEU H C   1 
ATOM   1249 O O   . LEU A 1 168 ? 44.381 11.185  -5.111  1.00 62.47 ? 173 LEU H O   1 
ATOM   1250 C CB  . LEU A 1 168 ? 45.022 8.862   -6.977  1.00 61.07 ? 173 LEU H CB  1 
ATOM   1251 C CG  . LEU A 1 168 ? 44.723 7.585   -6.195  1.00 61.12 ? 173 LEU H CG  1 
ATOM   1252 C CD1 . LEU A 1 168 ? 43.521 6.872   -6.802  1.00 62.09 ? 173 LEU H CD1 1 
ATOM   1253 C CD2 . LEU A 1 168 ? 45.949 6.688   -6.222  1.00 62.44 ? 173 LEU H CD2 1 
ATOM   1254 N N   . GLN A 1 169 ? 42.425 10.073  -5.138  1.00 67.58 ? 174 GLN H N   1 
ATOM   1255 C CA  . GLN A 1 169 ? 42.014 10.533  -3.820  1.00 71.66 ? 174 GLN H CA  1 
ATOM   1256 C C   . GLN A 1 169 ? 41.449 9.369   -3.014  1.00 73.43 ? 174 GLN H C   1 
ATOM   1257 O O   . GLN A 1 169 ? 40.457 8.750   -3.407  1.00 74.26 ? 174 GLN H O   1 
ATOM   1258 C CB  . GLN A 1 169 ? 40.960 11.635  -3.950  1.00 74.62 ? 174 GLN H CB  1 
ATOM   1259 C CG  . GLN A 1 169 ? 40.627 12.339  -2.643  1.00 79.33 ? 174 GLN H CG  1 
ATOM   1260 C CD  . GLN A 1 169 ? 39.686 13.518  -2.834  1.00 82.19 ? 174 GLN H CD  1 
ATOM   1261 O OE1 . GLN A 1 169 ? 39.345 14.215  -1.877  1.00 83.96 ? 174 GLN H OE1 1 
ATOM   1262 N NE2 . GLN A 1 169 ? 39.260 13.746  -4.074  1.00 80.35 ? 174 GLN H NE2 1 
ATOM   1263 N N   . SER A 1 170 ? 42.096 9.072   -1.890  1.00 72.44 ? 175 SER H N   1 
ATOM   1264 C CA  . SER A 1 170 ? 41.672 7.985   -1.018  1.00 71.15 ? 175 SER H CA  1 
ATOM   1265 C C   . SER A 1 170 ? 41.543 6.671   -1.774  1.00 67.23 ? 175 SER H C   1 
ATOM   1266 O O   . SER A 1 170 ? 40.646 5.879   -1.503  1.00 66.09 ? 175 SER H O   1 
ATOM   1267 C CB  . SER A 1 170 ? 40.334 8.329   -0.357  1.00 75.19 ? 175 SER H CB  1 
ATOM   1268 O OG  . SER A 1 170 ? 40.453 9.466   0.483   1.00 79.27 ? 175 SER H OG  1 
ATOM   1269 N N   . GLY A 1 171 ? 42.440 6.448   -2.727  1.00 66.65 ? 176 GLY H N   1 
ATOM   1270 C CA  . GLY A 1 171 ? 42.406 5.216   -3.493  1.00 63.88 ? 176 GLY H CA  1 
ATOM   1271 C C   . GLY A 1 171 ? 41.506 5.243   -4.714  1.00 61.26 ? 176 GLY H C   1 
ATOM   1272 O O   . GLY A 1 171 ? 41.591 4.359   -5.568  1.00 61.37 ? 176 GLY H O   1 
ATOM   1273 N N   . LEU A 1 172 ? 40.639 6.245   -4.804  1.00 57.17 ? 177 LEU H N   1 
ATOM   1274 C CA  . LEU A 1 172 ? 39.742 6.349   -5.946  1.00 56.15 ? 177 LEU H CA  1 
ATOM   1275 C C   . LEU A 1 172 ? 40.133 7.510   -6.858  1.00 53.34 ? 177 LEU H C   1 
ATOM   1276 O O   . LEU A 1 172 ? 40.618 8.540   -6.393  1.00 51.91 ? 177 LEU H O   1 
ATOM   1277 C CB  . LEU A 1 172 ? 38.296 6.517   -5.470  1.00 55.60 ? 177 LEU H CB  1 
ATOM   1278 C CG  . LEU A 1 172 ? 37.692 5.343   -4.695  1.00 56.84 ? 177 LEU H CG  1 
ATOM   1279 C CD1 . LEU A 1 172 ? 36.236 5.643   -4.379  1.00 56.89 ? 177 LEU H CD1 1 
ATOM   1280 C CD2 . LEU A 1 172 ? 37.803 4.066   -5.514  1.00 54.39 ? 177 LEU H CD2 1 
ATOM   1281 N N   . TYR A 1 173 ? 39.924 7.336   -8.158  1.00 50.05 ? 178 TYR H N   1 
ATOM   1282 C CA  . TYR A 1 173 ? 40.260 8.373   -9.118  1.00 49.06 ? 178 TYR H CA  1 
ATOM   1283 C C   . TYR A 1 173 ? 39.108 9.336   -9.379  1.00 49.27 ? 178 TYR H C   1 
ATOM   1284 O O   . TYR A 1 173 ? 37.938 8.950   -9.371  1.00 46.06 ? 178 TYR H O   1 
ATOM   1285 C CB  . TYR A 1 173 ? 40.715 7.749   -10.435 1.00 48.69 ? 178 TYR H CB  1 
ATOM   1286 C CG  . TYR A 1 173 ? 42.131 7.222   -10.402 1.00 51.43 ? 178 TYR H CG  1 
ATOM   1287 C CD1 . TYR A 1 173 ? 43.204 8.072   -10.145 1.00 50.93 ? 178 TYR H CD1 1 
ATOM   1288 C CD2 . TYR A 1 173 ? 42.402 5.879   -10.652 1.00 53.03 ? 178 TYR H CD2 1 
ATOM   1289 C CE1 . TYR A 1 173 ? 44.514 7.597   -10.142 1.00 55.72 ? 178 TYR H CE1 1 
ATOM   1290 C CE2 . TYR A 1 173 ? 43.708 5.390   -10.653 1.00 53.61 ? 178 TYR H CE2 1 
ATOM   1291 C CZ  . TYR A 1 173 ? 44.759 6.255   -10.399 1.00 56.67 ? 178 TYR H CZ  1 
ATOM   1292 O OH  . TYR A 1 173 ? 46.053 5.786   -10.415 1.00 58.49 ? 178 TYR H OH  1 
ATOM   1293 N N   . THR A 1 174 ? 39.455 10.597  -9.604  1.00 48.45 ? 179 THR H N   1 
ATOM   1294 C CA  . THR A 1 174 ? 38.470 11.628  -9.875  1.00 47.80 ? 179 THR H CA  1 
ATOM   1295 C C   . THR A 1 174 ? 38.984 12.567  -10.947 1.00 46.95 ? 179 THR H C   1 
ATOM   1296 O O   . THR A 1 174 ? 40.086 13.100  -10.845 1.00 47.60 ? 179 THR H O   1 
ATOM   1297 C CB  . THR A 1 174 ? 38.165 12.474  -8.622  1.00 47.78 ? 179 THR H CB  1 
ATOM   1298 O OG1 . THR A 1 174 ? 37.646 11.633  -7.586  1.00 54.62 ? 179 THR H OG1 1 
ATOM   1299 C CG2 . THR A 1 174 ? 37.145 13.548  -8.948  1.00 49.02 ? 179 THR H CG2 1 
ATOM   1300 N N   . MET A 1 175 ? 38.185 12.760  -11.984 1.00 44.28 ? 180 MET H N   1 
ATOM   1301 C CA  . MET A 1 175 ? 38.561 13.668  -13.048 1.00 42.59 ? 180 MET H CA  1 
ATOM   1302 C C   . MET A 1 175 ? 37.313 14.402  -13.503 1.00 42.54 ? 180 MET H C   1 
ATOM   1303 O O   . MET A 1 175 ? 36.191 13.945  -13.273 1.00 42.23 ? 180 MET H O   1 
ATOM   1304 C CB  . MET A 1 175 ? 39.207 12.903  -14.211 1.00 42.70 ? 180 MET H CB  1 
ATOM   1305 C CG  . MET A 1 175 ? 38.311 11.909  -14.916 1.00 44.40 ? 180 MET H CG  1 
ATOM   1306 S SD  . MET A 1 175 ? 37.183 12.681  -16.078 1.00 52.67 ? 180 MET H SD  1 
ATOM   1307 C CE  . MET A 1 175 ? 38.310 13.126  -17.380 1.00 50.98 ? 180 MET H CE  1 
ATOM   1308 N N   . SER A 1 176 ? 37.507 15.558  -14.120 1.00 42.74 ? 181 SER H N   1 
ATOM   1309 C CA  . SER A 1 176 ? 36.391 16.347  -14.612 1.00 43.79 ? 181 SER H CA  1 
ATOM   1310 C C   . SER A 1 176 ? 36.610 16.665  -16.087 1.00 44.64 ? 181 SER H C   1 
ATOM   1311 O O   . SER A 1 176 ? 37.711 16.506  -16.612 1.00 39.40 ? 181 SER H O   1 
ATOM   1312 C CB  . SER A 1 176 ? 36.252 17.636  -13.795 1.00 43.58 ? 181 SER H CB  1 
ATOM   1313 O OG  . SER A 1 176 ? 37.503 18.284  -13.631 1.00 49.41 ? 181 SER H OG  1 
ATOM   1314 N N   . SER A 1 177 ? 35.549 17.102  -16.750 1.00 42.39 ? 182 SER H N   1 
ATOM   1315 C CA  . SER A 1 177 ? 35.618 17.437  -18.161 1.00 44.50 ? 182 SER H CA  1 
ATOM   1316 C C   . SER A 1 177 ? 34.639 18.562  -18.462 1.00 46.37 ? 182 SER H C   1 
ATOM   1317 O O   . SER A 1 177 ? 33.447 18.440  -18.191 1.00 49.18 ? 182 SER H O   1 
ATOM   1318 C CB  . SER A 1 177 ? 35.277 16.206  -19.000 1.00 42.27 ? 182 SER H CB  1 
ATOM   1319 O OG  . SER A 1 177 ? 35.279 16.511  -20.381 1.00 36.80 ? 182 SER H OG  1 
ATOM   1320 N N   . SER A 1 178 ? 35.144 19.655  -19.023 1.00 49.47 ? 183 SER H N   1 
ATOM   1321 C CA  . SER A 1 178 ? 34.295 20.797  -19.350 1.00 51.26 ? 183 SER H CA  1 
ATOM   1322 C C   . SER A 1 178 ? 34.145 21.004  -20.849 1.00 53.99 ? 183 SER H C   1 
ATOM   1323 O O   . SER A 1 178 ? 35.018 20.639  -21.633 1.00 54.41 ? 183 SER H O   1 
ATOM   1324 C CB  . SER A 1 178 ? 34.856 22.074  -18.727 1.00 51.37 ? 183 SER H CB  1 
ATOM   1325 O OG  . SER A 1 178 ? 36.106 22.406  -19.301 1.00 48.11 ? 183 SER H OG  1 
ATOM   1326 N N   . VAL A 1 179 ? 33.021 21.598  -21.232 1.00 56.67 ? 184 VAL H N   1 
ATOM   1327 C CA  . VAL A 1 179 ? 32.721 21.883  -22.628 1.00 57.03 ? 184 VAL H CA  1 
ATOM   1328 C C   . VAL A 1 179 ? 32.131 23.285  -22.678 1.00 59.83 ? 184 VAL H C   1 
ATOM   1329 O O   . VAL A 1 179 ? 31.687 23.815  -21.658 1.00 59.88 ? 184 VAL H O   1 
ATOM   1330 C CB  . VAL A 1 179 ? 31.689 20.882  -23.194 1.00 56.38 ? 184 VAL H CB  1 
ATOM   1331 C CG1 . VAL A 1 179 ? 30.325 21.125  -22.557 1.00 54.61 ? 184 VAL H CG1 1 
ATOM   1332 C CG2 . VAL A 1 179 ? 31.615 21.007  -24.708 1.00 58.38 ? 184 VAL H CG2 1 
ATOM   1333 N N   . THR A 1 180 ? 32.128 23.892  -23.858 1.00 60.88 ? 185 THR H N   1 
ATOM   1334 C CA  . THR A 1 180 ? 31.582 25.233  -23.999 1.00 62.47 ? 185 THR H CA  1 
ATOM   1335 C C   . THR A 1 180 ? 30.875 25.422  -25.331 1.00 65.87 ? 185 THR H C   1 
ATOM   1336 O O   . THR A 1 180 ? 31.390 25.043  -26.382 1.00 64.50 ? 185 THR H O   1 
ATOM   1337 C CB  . THR A 1 180 ? 32.682 26.295  -23.873 1.00 62.51 ? 185 THR H CB  1 
ATOM   1338 O OG1 . THR A 1 180 ? 33.747 25.987  -24.781 1.00 63.40 ? 185 THR H OG1 1 
ATOM   1339 C CG2 . THR A 1 180 ? 33.219 26.335  -22.451 1.00 60.44 ? 185 THR H CG2 1 
ATOM   1340 N N   . VAL A 1 181 ? 29.685 26.010  -25.271 1.00 69.01 ? 186 VAL H N   1 
ATOM   1341 C CA  . VAL A 1 181 ? 28.885 26.272  -26.460 1.00 70.82 ? 186 VAL H CA  1 
ATOM   1342 C C   . VAL A 1 181 ? 28.038 27.519  -26.227 1.00 73.09 ? 186 VAL H C   1 
ATOM   1343 O O   . VAL A 1 181 ? 27.745 27.875  -25.085 1.00 74.59 ? 186 VAL H O   1 
ATOM   1344 C CB  . VAL A 1 181 ? 27.942 25.091  -26.776 1.00 72.01 ? 186 VAL H CB  1 
ATOM   1345 C CG1 . VAL A 1 181 ? 28.747 23.830  -27.036 1.00 72.48 ? 186 VAL H CG1 1 
ATOM   1346 C CG2 . VAL A 1 181 ? 26.980 24.875  -25.624 1.00 72.30 ? 186 VAL H CG2 1 
ATOM   1347 N N   . PRO A 1 182 ? 27.639 28.204  -27.310 1.00 73.69 ? 187 PRO H N   1 
ATOM   1348 C CA  . PRO A 1 182 ? 26.820 29.414  -27.196 1.00 73.55 ? 187 PRO H CA  1 
ATOM   1349 C C   . PRO A 1 182 ? 25.399 29.075  -26.748 1.00 73.56 ? 187 PRO H C   1 
ATOM   1350 O O   . PRO A 1 182 ? 24.863 28.027  -27.110 1.00 72.42 ? 187 PRO H O   1 
ATOM   1351 C CB  . PRO A 1 182 ? 26.868 29.988  -28.608 1.00 73.57 ? 187 PRO H CB  1 
ATOM   1352 C CG  . PRO A 1 182 ? 26.938 28.759  -29.454 1.00 73.44 ? 187 PRO H CG  1 
ATOM   1353 C CD  . PRO A 1 182 ? 27.951 27.913  -28.721 1.00 73.49 ? 187 PRO H CD  1 
ATOM   1354 N N   . SER A 1 183 ? 24.793 29.957  -25.959 1.00 74.38 ? 188 SER H N   1 
ATOM   1355 C CA  . SER A 1 183 ? 23.437 29.724  -25.469 1.00 77.52 ? 188 SER H CA  1 
ATOM   1356 C C   . SER A 1 183 ? 22.447 29.633  -26.623 1.00 79.00 ? 188 SER H C   1 
ATOM   1357 O O   . SER A 1 183 ? 21.393 29.005  -26.502 1.00 79.38 ? 188 SER H O   1 
ATOM   1358 C CB  . SER A 1 183 ? 23.010 30.844  -24.517 1.00 77.08 ? 188 SER H CB  1 
ATOM   1359 O OG  . SER A 1 183 ? 21.769 30.543  -23.901 1.00 76.86 ? 188 SER H OG  1 
ATOM   1360 N N   . SER A 1 184 ? 22.792 30.265  -27.741 1.00 81.07 ? 189 SER H N   1 
ATOM   1361 C CA  . SER A 1 184 ? 21.941 30.256  -28.927 1.00 82.59 ? 189 SER H CA  1 
ATOM   1362 C C   . SER A 1 184 ? 21.629 28.822  -29.341 1.00 83.80 ? 189 SER H C   1 
ATOM   1363 O O   . SER A 1 184 ? 20.645 28.563  -30.035 1.00 84.52 ? 189 SER H O   1 
ATOM   1364 C CB  . SER A 1 184 ? 22.635 30.987  -30.079 1.00 82.62 ? 189 SER H CB  1 
ATOM   1365 O OG  . SER A 1 184 ? 23.872 30.375  -30.398 1.00 86.17 ? 189 SER H OG  1 
ATOM   1366 N N   . THR A 1 185 ? 22.475 27.892  -28.910 1.00 84.20 ? 190 THR H N   1 
ATOM   1367 C CA  . THR A 1 185 ? 22.293 26.483  -29.226 1.00 84.62 ? 190 THR H CA  1 
ATOM   1368 C C   . THR A 1 185 ? 22.160 25.675  -27.938 1.00 85.21 ? 190 THR H C   1 
ATOM   1369 O O   . THR A 1 185 ? 21.951 24.462  -27.973 1.00 84.01 ? 190 THR H O   1 
ATOM   1370 C CB  . THR A 1 185 ? 23.485 25.937  -30.045 1.00 84.77 ? 190 THR H CB  1 
ATOM   1371 O OG1 . THR A 1 185 ? 23.267 24.554  -30.347 1.00 86.40 ? 190 THR H OG1 1 
ATOM   1372 C CG2 . THR A 1 185 ? 24.783 26.080  -29.264 1.00 83.05 ? 190 THR H CG2 1 
ATOM   1373 N N   . TRP A 1 186 ? 22.280 26.360  -26.803 1.00 84.94 ? 191 TRP H N   1 
ATOM   1374 C CA  . TRP A 1 186 ? 22.175 25.715  -25.499 1.00 86.68 ? 191 TRP H CA  1 
ATOM   1375 C C   . TRP A 1 186 ? 20.972 24.781  -25.379 1.00 88.45 ? 191 TRP H C   1 
ATOM   1376 O O   . TRP A 1 186 ? 21.101 23.652  -24.900 1.00 90.53 ? 191 TRP H O   1 
ATOM   1377 C CB  . TRP A 1 186 ? 22.127 26.773  -24.391 1.00 87.23 ? 191 TRP H CB  1 
ATOM   1378 C CG  . TRP A 1 186 ? 21.448 26.308  -23.136 1.00 89.27 ? 191 TRP H CG  1 
ATOM   1379 C CD1 . TRP A 1 186 ? 20.105 26.307  -22.883 1.00 88.62 ? 191 TRP H CD1 1 
ATOM   1380 C CD2 . TRP A 1 186 ? 22.074 25.749  -21.973 1.00 90.30 ? 191 TRP H CD2 1 
ATOM   1381 N NE1 . TRP A 1 186 ? 19.856 25.785  -21.638 1.00 90.90 ? 191 TRP H NE1 1 
ATOM   1382 C CE2 . TRP A 1 186 ? 21.047 25.434  -21.056 1.00 91.07 ? 191 TRP H CE2 1 
ATOM   1383 C CE3 . TRP A 1 186 ? 23.402 25.483  -21.616 1.00 90.41 ? 191 TRP H CE3 1 
ATOM   1384 C CZ2 . TRP A 1 186 ? 21.307 24.866  -19.803 1.00 90.85 ? 191 TRP H CZ2 1 
ATOM   1385 C CZ3 . TRP A 1 186 ? 23.659 24.918  -20.370 1.00 90.86 ? 191 TRP H CZ3 1 
ATOM   1386 C CH2 . TRP A 1 186 ? 22.616 24.617  -19.480 1.00 89.93 ? 191 TRP H CH2 1 
ATOM   1387 N N   . PRO A 1 187 ? 19.780 25.241  -25.799 1.00 88.24 ? 192 PRO H N   1 
ATOM   1388 C CA  . PRO A 1 187 ? 18.590 24.390  -25.710 1.00 87.46 ? 192 PRO H CA  1 
ATOM   1389 C C   . PRO A 1 187 ? 18.531 23.344  -26.822 1.00 87.26 ? 192 PRO H C   1 
ATOM   1390 O O   . PRO A 1 187 ? 17.505 23.190  -27.485 1.00 87.88 ? 192 PRO H O   1 
ATOM   1391 C CB  . PRO A 1 187 ? 17.449 25.396  -25.801 1.00 88.33 ? 192 PRO H CB  1 
ATOM   1392 C CG  . PRO A 1 187 ? 18.001 26.411  -26.748 1.00 89.10 ? 192 PRO H CG  1 
ATOM   1393 C CD  . PRO A 1 187 ? 19.419 26.600  -26.243 1.00 88.21 ? 192 PRO H CD  1 
ATOM   1394 N N   . SER A 1 188 ? 19.636 22.629  -27.020 1.00 86.49 ? 193 SER H N   1 
ATOM   1395 C CA  . SER A 1 188 ? 19.712 21.598  -28.052 1.00 85.57 ? 193 SER H CA  1 
ATOM   1396 C C   . SER A 1 188 ? 20.270 20.285  -27.501 1.00 84.98 ? 193 SER H C   1 
ATOM   1397 O O   . SER A 1 188 ? 20.873 19.501  -28.233 1.00 85.14 ? 193 SER H O   1 
ATOM   1398 C CB  . SER A 1 188 ? 20.585 22.079  -29.214 1.00 86.19 ? 193 SER H CB  1 
ATOM   1399 O OG  . SER A 1 188 ? 20.046 23.249  -29.809 1.00 86.41 ? 193 SER H OG  1 
ATOM   1400 N N   . THR A 1 189 ? 20.062 20.064  -26.205 1.00 83.43 ? 195 THR H N   1 
ATOM   1401 C CA  . THR A 1 189 ? 20.515 18.858  -25.516 1.00 81.05 ? 195 THR H CA  1 
ATOM   1402 C C   . THR A 1 189 ? 22.027 18.612  -25.547 1.00 80.68 ? 195 THR H C   1 
ATOM   1403 O O   . THR A 1 189 ? 22.596 18.247  -26.579 1.00 80.18 ? 195 THR H O   1 
ATOM   1404 C CB  . THR A 1 189 ? 19.796 17.593  -26.059 1.00 80.57 ? 195 THR H CB  1 
ATOM   1405 O OG1 . THR A 1 189 ? 20.118 17.406  -27.443 1.00 78.00 ? 195 THR H OG1 1 
ATOM   1406 C CG2 . THR A 1 189 ? 18.286 17.733  -25.908 1.00 80.41 ? 195 THR H CG2 1 
ATOM   1407 N N   . VAL A 1 190 ? 22.666 18.815  -24.399 1.00 79.15 ? 196 VAL H N   1 
ATOM   1408 C CA  . VAL A 1 190 ? 24.104 18.603  -24.249 1.00 75.96 ? 196 VAL H CA  1 
ATOM   1409 C C   . VAL A 1 190 ? 24.305 17.358  -23.384 1.00 73.78 ? 196 VAL H C   1 
ATOM   1410 O O   . VAL A 1 190 ? 23.860 17.315  -22.235 1.00 74.03 ? 196 VAL H O   1 
ATOM   1411 C CB  . VAL A 1 190 ? 24.781 19.810  -23.552 1.00 76.11 ? 196 VAL H CB  1 
ATOM   1412 C CG1 . VAL A 1 190 ? 26.268 19.548  -23.381 1.00 74.95 ? 196 VAL H CG1 1 
ATOM   1413 C CG2 . VAL A 1 190 ? 24.560 21.073  -24.365 1.00 76.14 ? 196 VAL H CG2 1 
ATOM   1414 N N   . THR A 1 191 ? 24.973 16.346  -23.932 1.00 70.74 ? 197 THR H N   1 
ATOM   1415 C CA  . THR A 1 191 ? 25.199 15.112  -23.188 1.00 67.58 ? 197 THR H CA  1 
ATOM   1416 C C   . THR A 1 191 ? 26.649 14.625  -23.201 1.00 65.18 ? 197 THR H C   1 
ATOM   1417 O O   . THR A 1 191 ? 27.298 14.605  -24.245 1.00 67.46 ? 197 THR H O   1 
ATOM   1418 C CB  . THR A 1 191 ? 24.289 13.979  -23.722 1.00 66.93 ? 197 THR H CB  1 
ATOM   1419 O OG1 . THR A 1 191 ? 24.540 12.775  -22.988 1.00 66.61 ? 197 THR H OG1 1 
ATOM   1420 C CG2 . THR A 1 191 ? 24.552 13.729  -25.199 1.00 66.91 ? 197 THR H CG2 1 
ATOM   1421 N N   . CYS A 1 192 ? 27.148 14.237  -22.028 1.00 61.47 ? 198 CYS H N   1 
ATOM   1422 C CA  . CYS A 1 192 ? 28.510 13.730  -21.889 1.00 57.10 ? 198 CYS H CA  1 
ATOM   1423 C C   . CYS A 1 192 ? 28.444 12.219  -21.706 1.00 56.14 ? 198 CYS H C   1 
ATOM   1424 O O   . CYS A 1 192 ? 27.649 11.722  -20.910 1.00 53.51 ? 198 CYS H O   1 
ATOM   1425 C CB  . CYS A 1 192 ? 29.206 14.352  -20.670 1.00 55.55 ? 198 CYS H CB  1 
ATOM   1426 S SG  . CYS A 1 192 ? 28.531 13.823  -19.055 1.00 54.41 ? 198 CYS H SG  1 
ATOM   1427 N N   . SER A 1 193 ? 29.277 11.491  -22.443 1.00 54.91 ? 199 SER H N   1 
ATOM   1428 C CA  . SER A 1 193 ? 29.304 10.036  -22.347 1.00 55.54 ? 199 SER H CA  1 
ATOM   1429 C C   . SER A 1 193 ? 30.605 9.524   -21.732 1.00 54.73 ? 199 SER H C   1 
ATOM   1430 O O   . SER A 1 193 ? 31.663 9.582   -22.357 1.00 56.49 ? 199 SER H O   1 
ATOM   1431 C CB  . SER A 1 193 ? 29.118 9.409   -23.727 1.00 53.19 ? 199 SER H CB  1 
ATOM   1432 O OG  . SER A 1 193 ? 29.273 8.004   -23.654 1.00 57.19 ? 199 SER H OG  1 
ATOM   1433 N N   . VAL A 1 194 ? 30.513 9.012   -20.509 1.00 53.64 ? 200 VAL H N   1 
ATOM   1434 C CA  . VAL A 1 194 ? 31.671 8.491   -19.795 1.00 52.72 ? 200 VAL H CA  1 
ATOM   1435 C C   . VAL A 1 194 ? 31.794 6.982   -19.957 1.00 53.54 ? 200 VAL H C   1 
ATOM   1436 O O   . VAL A 1 194 ? 30.912 6.232   -19.540 1.00 56.88 ? 200 VAL H O   1 
ATOM   1437 C CB  . VAL A 1 194 ? 31.581 8.817   -18.284 1.00 52.58 ? 200 VAL H CB  1 
ATOM   1438 C CG1 . VAL A 1 194 ? 32.811 8.304   -17.559 1.00 53.13 ? 200 VAL H CG1 1 
ATOM   1439 C CG2 . VAL A 1 194 ? 31.450 10.313  -18.085 1.00 51.35 ? 200 VAL H CG2 1 
ATOM   1440 N N   . ALA A 1 195 ? 32.892 6.542   -20.563 1.00 54.72 ? 201 ALA H N   1 
ATOM   1441 C CA  . ALA A 1 195 ? 33.142 5.120   -20.771 1.00 53.52 ? 201 ALA H CA  1 
ATOM   1442 C C   . ALA A 1 195 ? 34.229 4.671   -19.807 1.00 53.22 ? 201 ALA H C   1 
ATOM   1443 O O   . ALA A 1 195 ? 35.180 5.406   -19.548 1.00 52.50 ? 201 ALA H O   1 
ATOM   1444 C CB  . ALA A 1 195 ? 33.579 4.870   -22.207 1.00 56.08 ? 201 ALA H CB  1 
ATOM   1445 N N   . HIS A 1 196 ? 34.088 3.461   -19.280 1.00 55.03 ? 202 HIS H N   1 
ATOM   1446 C CA  . HIS A 1 196 ? 35.053 2.918   -18.330 1.00 54.71 ? 202 HIS H CA  1 
ATOM   1447 C C   . HIS A 1 196 ? 35.092 1.389   -18.466 1.00 57.84 ? 202 HIS H C   1 
ATOM   1448 O O   . HIS A 1 196 ? 34.624 0.655   -17.590 1.00 54.35 ? 202 HIS H O   1 
ATOM   1449 C CB  . HIS A 1 196 ? 34.643 3.340   -16.918 1.00 50.74 ? 202 HIS H CB  1 
ATOM   1450 C CG  . HIS A 1 196 ? 35.617 2.948   -15.851 1.00 48.09 ? 202 HIS H CG  1 
ATOM   1451 N ND1 . HIS A 1 196 ? 35.420 1.861   -15.029 1.00 40.66 ? 202 HIS H ND1 1 
ATOM   1452 C CD2 . HIS A 1 196 ? 36.773 3.524   -15.443 1.00 50.30 ? 202 HIS H CD2 1 
ATOM   1453 C CE1 . HIS A 1 196 ? 36.409 1.786   -14.157 1.00 46.77 ? 202 HIS H CE1 1 
ATOM   1454 N NE2 . HIS A 1 196 ? 37.244 2.783   -14.386 1.00 47.77 ? 202 HIS H NE2 1 
ATOM   1455 N N   . PRO A 1 197 ? 35.670 0.896   -19.574 1.00 59.35 ? 203 PRO H N   1 
ATOM   1456 C CA  . PRO A 1 197 ? 35.794 -0.533  -19.881 1.00 61.20 ? 203 PRO H CA  1 
ATOM   1457 C C   . PRO A 1 197 ? 36.184 -1.455  -18.726 1.00 63.08 ? 203 PRO H C   1 
ATOM   1458 O O   . PRO A 1 197 ? 35.579 -2.510  -18.541 1.00 64.73 ? 203 PRO H O   1 
ATOM   1459 C CB  . PRO A 1 197 ? 36.814 -0.555  -21.023 1.00 61.08 ? 203 PRO H CB  1 
ATOM   1460 C CG  . PRO A 1 197 ? 37.597 0.706   -20.822 1.00 61.38 ? 203 PRO H CG  1 
ATOM   1461 C CD  . PRO A 1 197 ? 36.508 1.687   -20.489 1.00 59.59 ? 203 PRO H CD  1 
ATOM   1462 N N   . ALA A 1 198 ? 37.184 -1.065  -17.947 1.00 64.14 ? 204 ALA H N   1 
ATOM   1463 C CA  . ALA A 1 198 ? 37.627 -1.888  -16.827 1.00 61.78 ? 204 ALA H CA  1 
ATOM   1464 C C   . ALA A 1 198 ? 36.493 -2.161  -15.845 1.00 62.05 ? 204 ALA H C   1 
ATOM   1465 O O   . ALA A 1 198 ? 36.661 -2.886  -14.861 1.00 62.48 ? 204 ALA H O   1 
ATOM   1466 C CB  . ALA A 1 198 ? 38.782 -1.210  -16.116 1.00 61.45 ? 204 ALA H CB  1 
ATOM   1467 N N   . SER A 1 199 ? 35.337 -1.570  -16.113 1.00 62.76 ? 205 SER H N   1 
ATOM   1468 C CA  . SER A 1 199 ? 34.167 -1.746  -15.265 1.00 61.77 ? 205 SER H CA  1 
ATOM   1469 C C   . SER A 1 199 ? 33.006 -2.182  -16.149 1.00 61.66 ? 205 SER H C   1 
ATOM   1470 O O   . SER A 1 199 ? 31.927 -2.521  -15.660 1.00 58.73 ? 205 SER H O   1 
ATOM   1471 C CB  . SER A 1 199 ? 33.825 -0.426  -14.569 1.00 64.43 ? 205 SER H CB  1 
ATOM   1472 O OG  . SER A 1 199 ? 32.713 -0.561  -13.703 1.00 65.73 ? 205 SER H OG  1 
ATOM   1473 N N   . GLY A 1 200 ? 33.245 -2.174  -17.457 1.00 63.51 ? 206 GLY H N   1 
ATOM   1474 C CA  . GLY A 1 200 ? 32.218 -2.556  -18.405 1.00 65.71 ? 206 GLY H CA  1 
ATOM   1475 C C   . GLY A 1 200 ? 31.036 -1.618  -18.288 1.00 68.07 ? 206 GLY H C   1 
ATOM   1476 O O   . GLY A 1 200 ? 29.896 -1.995  -18.558 1.00 70.63 ? 206 GLY H O   1 
ATOM   1477 N N   . THR A 1 201 ? 31.316 -0.381  -17.893 1.00 66.69 ? 207 THR H N   1 
ATOM   1478 C CA  . THR A 1 201 ? 30.273 0.617   -17.707 1.00 61.57 ? 207 THR H CA  1 
ATOM   1479 C C   . THR A 1 201 ? 30.394 1.817   -18.636 1.00 61.17 ? 207 THR H C   1 
ATOM   1480 O O   . THR A 1 201 ? 31.486 2.200   -19.047 1.00 63.78 ? 207 THR H O   1 
ATOM   1481 C CB  . THR A 1 201 ? 30.283 1.136   -16.258 1.00 58.31 ? 207 THR H CB  1 
ATOM   1482 O OG1 . THR A 1 201 ? 30.212 0.028   -15.355 1.00 59.26 ? 207 THR H OG1 1 
ATOM   1483 C CG2 . THR A 1 201 ? 29.101 2.058   -16.012 1.00 57.57 ? 207 THR H CG2 1 
ATOM   1484 N N   . THR A 1 202 ? 29.249 2.405   -18.959 1.00 58.89 ? 208 THR H N   1 
ATOM   1485 C CA  . THR A 1 202 ? 29.186 3.588   -19.806 1.00 56.18 ? 208 THR H CA  1 
ATOM   1486 C C   . THR A 1 202 ? 28.012 4.421   -19.307 1.00 55.37 ? 208 THR H C   1 
ATOM   1487 O O   . THR A 1 202 ? 26.858 4.011   -19.424 1.00 58.07 ? 208 THR H O   1 
ATOM   1488 C CB  . THR A 1 202 ? 28.963 3.222   -21.283 1.00 56.57 ? 208 THR H CB  1 
ATOM   1489 O OG1 . THR A 1 202 ? 30.071 2.443   -21.751 1.00 60.20 ? 208 THR H OG1 1 
ATOM   1490 C CG2 . THR A 1 202 ? 28.847 4.478   -22.131 1.00 55.40 ? 208 THR H CG2 1 
ATOM   1491 N N   . VAL A 1 203 ? 28.310 5.580   -18.726 1.00 53.73 ? 209 VAL H N   1 
ATOM   1492 C CA  . VAL A 1 203 ? 27.265 6.447   -18.202 1.00 49.00 ? 209 VAL H CA  1 
ATOM   1493 C C   . VAL A 1 203 ? 27.119 7.700   -19.039 1.00 49.29 ? 209 VAL H C   1 
ATOM   1494 O O   . VAL A 1 203 ? 28.106 8.324   -19.418 1.00 47.49 ? 209 VAL H O   1 
ATOM   1495 C CB  . VAL A 1 203 ? 27.553 6.867   -16.755 1.00 47.33 ? 209 VAL H CB  1 
ATOM   1496 C CG1 . VAL A 1 203 ? 26.408 7.708   -16.228 1.00 45.45 ? 209 VAL H CG1 1 
ATOM   1497 C CG2 . VAL A 1 203 ? 27.755 5.640   -15.889 1.00 47.80 ? 209 VAL H CG2 1 
ATOM   1498 N N   . ASP A 1 204 ? 25.875 8.063   -19.325 1.00 52.82 ? 210 ASP H N   1 
ATOM   1499 C CA  . ASP A 1 204 ? 25.589 9.249   -20.120 1.00 57.10 ? 210 ASP H CA  1 
ATOM   1500 C C   . ASP A 1 204 ? 24.581 10.142  -19.412 1.00 58.30 ? 210 ASP H C   1 
ATOM   1501 O O   . ASP A 1 204 ? 23.513 9.686   -18.998 1.00 57.56 ? 210 ASP H O   1 
ATOM   1502 C CB  . ASP A 1 204 ? 25.045 8.847   -21.490 1.00 59.78 ? 210 ASP H CB  1 
ATOM   1503 C CG  . ASP A 1 204 ? 26.061 8.090   -22.314 1.00 63.64 ? 210 ASP H CG  1 
ATOM   1504 O OD1 . ASP A 1 204 ? 26.579 7.063   -21.831 1.00 62.11 ? 210 ASP H OD1 1 
ATOM   1505 O OD2 . ASP A 1 204 ? 26.341 8.522   -23.450 1.00 70.61 ? 210 ASP H OD2 1 
ATOM   1506 N N   . LYS A 1 205 ? 24.931 11.416  -19.269 1.00 58.76 ? 211 LYS H N   1 
ATOM   1507 C CA  . LYS A 1 205 ? 24.052 12.374  -18.619 1.00 59.76 ? 211 LYS H CA  1 
ATOM   1508 C C   . LYS A 1 205 ? 23.871 13.645  -19.444 1.00 62.58 ? 211 LYS H C   1 
ATOM   1509 O O   . LYS A 1 205 ? 24.843 14.328  -19.769 1.00 64.65 ? 211 LYS H O   1 
ATOM   1510 C CB  . LYS A 1 205 ? 24.587 12.735  -17.227 1.00 56.06 ? 211 LYS H CB  1 
ATOM   1511 C CG  . LYS A 1 205 ? 24.243 11.727  -16.139 1.00 54.48 ? 211 LYS H CG  1 
ATOM   1512 C CD  . LYS A 1 205 ? 24.513 12.309  -14.760 1.00 53.33 ? 211 LYS H CD  1 
ATOM   1513 C CE  . LYS A 1 205 ? 23.844 11.499  -13.654 1.00 54.96 ? 211 LYS H CE  1 
ATOM   1514 N NZ  . LYS A 1 205 ? 24.473 10.169  -13.429 1.00 55.41 ? 211 LYS H NZ  1 
ATOM   1515 N N   . LYS A 1 206 ? 22.621 13.948  -19.787 1.00 64.46 ? 212 LYS H N   1 
ATOM   1516 C CA  . LYS A 1 206 ? 22.299 15.150  -20.550 1.00 65.92 ? 212 LYS H CA  1 
ATOM   1517 C C   . LYS A 1 206 ? 22.105 16.286  -19.556 1.00 64.97 ? 212 LYS H C   1 
ATOM   1518 O O   . LYS A 1 206 ? 21.217 16.228  -18.708 1.00 62.37 ? 212 LYS H O   1 
ATOM   1519 C CB  . LYS A 1 206 ? 21.012 14.950  -21.351 1.00 67.82 ? 212 LYS H CB  1 
ATOM   1520 C CG  . LYS A 1 206 ? 21.100 13.880  -22.425 1.00 73.72 ? 212 LYS H CG  1 
ATOM   1521 C CD  . LYS A 1 206 ? 19.762 13.702  -23.136 1.00 76.60 ? 212 LYS H CD  1 
ATOM   1522 C CE  . LYS A 1 206 ? 19.292 15.004  -23.782 1.00 78.99 ? 212 LYS H CE  1 
ATOM   1523 N NZ  . LYS A 1 206 ? 17.945 14.875  -24.407 1.00 78.75 ? 212 LYS H NZ  1 
ATOM   1524 N N   . LEU A 1 207 ? 22.938 17.315  -19.657 1.00 66.43 ? 213 LEU H N   1 
ATOM   1525 C CA  . LEU A 1 207 ? 22.855 18.449  -18.745 1.00 68.65 ? 213 LEU H CA  1 
ATOM   1526 C C   . LEU A 1 207 ? 21.561 19.234  -18.922 1.00 70.65 ? 213 LEU H C   1 
ATOM   1527 O O   . LEU A 1 207 ? 21.101 19.438  -20.045 1.00 70.20 ? 213 LEU H O   1 
ATOM   1528 C CB  . LEU A 1 207 ? 24.059 19.376  -18.943 1.00 67.32 ? 213 LEU H CB  1 
ATOM   1529 C CG  . LEU A 1 207 ? 25.437 18.780  -18.638 1.00 67.12 ? 213 LEU H CG  1 
ATOM   1530 C CD1 . LEU A 1 207 ? 25.801 17.728  -19.673 1.00 65.24 ? 213 LEU H CD1 1 
ATOM   1531 C CD2 . LEU A 1 207 ? 26.467 19.886  -18.635 1.00 67.04 ? 213 LEU H CD2 1 
ATOM   1532 N N   . GLU A 1 208 ? 20.983 19.668  -17.802 1.00 72.71 ? 214 GLU H N   1 
ATOM   1533 C CA  . GLU A 1 208 ? 19.737 20.433  -17.799 1.00 74.46 ? 214 GLU H CA  1 
ATOM   1534 C C   . GLU A 1 208 ? 18.788 19.974  -18.898 1.00 76.60 ? 214 GLU H C   1 
ATOM   1535 O O   . GLU A 1 208 ? 18.486 20.796  -19.790 1.00 79.11 ? 214 GLU H O   1 
ATOM   1536 C CB  . GLU A 1 208 ? 20.031 21.931  -17.959 1.00 74.55 ? 214 GLU H CB  1 
ATOM   1537 C CG  . GLU A 1 208 ? 20.567 22.615  -16.701 1.00 76.37 ? 214 GLU H CG  1 
ATOM   1538 C CD  . GLU A 1 208 ? 19.466 23.111  -15.775 1.00 77.15 ? 214 GLU H CD  1 
ATOM   1539 O OE1 . GLU A 1 208 ? 19.787 23.615  -14.677 1.00 77.69 ? 214 GLU H OE1 1 
ATOM   1540 O OE2 . GLU A 1 208 ? 18.279 23.006  -16.149 1.00 76.32 ? 214 GLU H OE2 1 
ATOM   1541 O OXT . GLU A 1 208 ? 18.363 18.797  -18.856 1.00 76.33 ? 214 GLU H OXT 1 
ATOM   1542 N N   . ALA B 2 1   ? 74.067 3.000   -24.188 1.00 31.23 ? 2   ALA L N   1 
ATOM   1543 C CA  . ALA B 2 1   ? 73.759 4.125   -25.131 1.00 29.08 ? 2   ALA L CA  1 
ATOM   1544 C C   . ALA B 2 1   ? 72.669 4.998   -24.536 1.00 23.86 ? 2   ALA L C   1 
ATOM   1545 O O   . ALA B 2 1   ? 71.485 4.718   -24.686 1.00 30.69 ? 2   ALA L O   1 
ATOM   1546 C CB  . ALA B 2 1   ? 73.321 3.560   -26.489 1.00 26.75 ? 2   ALA L CB  1 
ATOM   1547 N N   . ALA B 2 2   ? 73.071 6.060   -23.849 1.00 22.57 ? 3   ALA L N   1 
ATOM   1548 C CA  . ALA B 2 2   ? 72.106 6.947   -23.220 1.00 20.40 ? 3   ALA L CA  1 
ATOM   1549 C C   . ALA B 2 2   ? 71.820 8.123   -24.141 1.00 24.77 ? 3   ALA L C   1 
ATOM   1550 O O   . ALA B 2 2   ? 72.739 8.753   -24.662 1.00 26.53 ? 3   ALA L O   1 
ATOM   1551 C CB  . ALA B 2 2   ? 72.636 7.449   -21.866 1.00 24.01 ? 3   ALA L CB  1 
ATOM   1552 N N   . LEU B 2 3   ? 70.540 8.401   -24.353 1.00 26.10 ? 4   LEU L N   1 
ATOM   1553 C CA  . LEU B 2 3   ? 70.147 9.508   -25.207 1.00 26.76 ? 4   LEU L CA  1 
ATOM   1554 C C   . LEU B 2 3   ? 69.646 10.605  -24.283 1.00 23.37 ? 4   LEU L C   1 
ATOM   1555 O O   . LEU B 2 3   ? 68.798 10.368  -23.424 1.00 20.18 ? 4   LEU L O   1 
ATOM   1556 C CB  . LEU B 2 3   ? 69.059 9.070   -26.216 1.00 27.29 ? 4   LEU L CB  1 
ATOM   1557 C CG  . LEU B 2 3   ? 69.592 8.977   -27.675 1.00 32.78 ? 4   LEU L CG  1 
ATOM   1558 C CD1 . LEU B 2 3   ? 70.257 7.662   -27.893 1.00 1.85  ? 4   LEU L CD1 1 
ATOM   1559 C CD2 . LEU B 2 3   ? 68.477 9.138   -28.713 1.00 23.06 ? 4   LEU L CD2 1 
ATOM   1560 N N   . THR B 2 4   ? 70.188 11.808  -24.433 1.00 25.07 ? 5   THR L N   1 
ATOM   1561 C CA  . THR B 2 4   ? 69.760 12.890  -23.565 1.00 25.33 ? 5   THR L CA  1 
ATOM   1562 C C   . THR B 2 4   ? 69.189 14.081  -24.317 1.00 20.90 ? 5   THR L C   1 
ATOM   1563 O O   . THR B 2 4   ? 69.774 14.562  -25.291 1.00 23.91 ? 5   THR L O   1 
ATOM   1564 C CB  . THR B 2 4   ? 70.914 13.370  -22.658 1.00 30.34 ? 5   THR L CB  1 
ATOM   1565 O OG1 . THR B 2 4   ? 71.833 14.139  -23.427 1.00 36.93 ? 5   THR L OG1 1 
ATOM   1566 C CG2 . THR B 2 4   ? 71.663 12.190  -22.076 1.00 24.76 ? 5   THR L CG2 1 
ATOM   1567 N N   . GLN B 2 5   ? 68.030 14.535  -23.860 1.00 23.07 ? 6   GLN L N   1 
ATOM   1568 C CA  . GLN B 2 5   ? 67.354 15.687  -24.442 1.00 22.28 ? 6   GLN L CA  1 
ATOM   1569 C C   . GLN B 2 5   ? 66.956 16.550  -23.257 1.00 23.00 ? 6   GLN L C   1 
ATOM   1570 O O   . GLN B 2 5   ? 66.821 16.041  -22.155 1.00 20.23 ? 6   GLN L O   1 
ATOM   1571 C CB  . GLN B 2 5   ? 66.050 15.313  -25.119 1.00 23.11 ? 6   GLN L CB  1 
ATOM   1572 C CG  . GLN B 2 5   ? 65.927 13.953  -25.731 1.00 28.45 ? 6   GLN L CG  1 
ATOM   1573 C CD  . GLN B 2 5   ? 64.484 13.703  -26.152 1.00 21.80 ? 6   GLN L CD  1 
ATOM   1574 O OE1 . GLN B 2 5   ? 63.855 14.572  -26.754 1.00 27.84 ? 6   GLN L OE1 1 
ATOM   1575 N NE2 . GLN B 2 5   ? 63.953 12.528  -25.827 1.00 12.76 ? 6   GLN L NE2 1 
ATOM   1576 N N   . SER B 2 6   ? 66.725 17.838  -23.494 1.00 25.84 ? 7   SER L N   1 
ATOM   1577 C CA  . SER B 2 6   ? 66.299 18.741  -22.431 1.00 29.48 ? 7   SER L CA  1 
ATOM   1578 C C   . SER B 2 6   ? 64.815 18.485  -22.188 1.00 30.80 ? 7   SER L C   1 
ATOM   1579 O O   . SER B 2 6   ? 64.098 18.054  -23.093 1.00 24.55 ? 7   SER L O   1 
ATOM   1580 C CB  . SER B 2 6   ? 66.498 20.187  -22.855 1.00 27.50 ? 7   SER L CB  1 
ATOM   1581 O OG  . SER B 2 6   ? 65.742 20.453  -24.023 1.00 46.29 ? 7   SER L OG  1 
ATOM   1582 N N   . PRO B 2 7   ? 64.326 18.765  -20.967 1.00 27.51 ? 8   PRO L N   1 
ATOM   1583 C CA  . PRO B 2 7   ? 62.912 18.539  -20.657 1.00 26.76 ? 8   PRO L CA  1 
ATOM   1584 C C   . PRO B 2 7   ? 61.931 19.495  -21.355 1.00 23.35 ? 8   PRO L C   1 
ATOM   1585 O O   . PRO B 2 7   ? 60.782 19.132  -21.599 1.00 23.54 ? 8   PRO L O   1 
ATOM   1586 C CB  . PRO B 2 7   ? 62.869 18.704  -19.145 1.00 29.97 ? 8   PRO L CB  1 
ATOM   1587 C CG  . PRO B 2 7   ? 63.870 19.822  -18.935 1.00 41.67 ? 8   PRO L CG  1 
ATOM   1588 C CD  . PRO B 2 7   ? 65.026 19.376  -19.818 1.00 38.16 ? 8   PRO L CD  1 
ATOM   1589 N N   . VAL B 2 8   ? 62.382 20.707  -21.656 1.00 23.88 ? 9   VAL L N   1 
ATOM   1590 C CA  . VAL B 2 8   ? 61.528 21.710  -22.284 1.00 27.37 ? 9   VAL L CA  1 
ATOM   1591 C C   . VAL B 2 8   ? 62.281 22.508  -23.344 1.00 29.02 ? 9   VAL L C   1 
ATOM   1592 O O   . VAL B 2 8   ? 63.470 22.811  -23.192 1.00 24.90 ? 9   VAL L O   1 
ATOM   1593 C CB  . VAL B 2 8   ? 60.974 22.721  -21.236 1.00 28.00 ? 9   VAL L CB  1 
ATOM   1594 C CG1 . VAL B 2 8   ? 60.267 21.994  -20.096 1.00 23.75 ? 9   VAL L CG1 1 
ATOM   1595 C CG2 . VAL B 2 8   ? 62.107 23.570  -20.696 1.00 39.96 ? 9   VAL L CG2 1 
ATOM   1596 N N   . SER B 2 9   ? 61.587 22.852  -24.424 1.00 30.59 ? 10  SER L N   1 
ATOM   1597 C CA  . SER B 2 9   ? 62.202 23.644  -25.489 1.00 28.24 ? 10  SER L CA  1 
ATOM   1598 C C   . SER B 2 9   ? 61.995 25.108  -25.124 1.00 28.44 ? 10  SER L C   1 
ATOM   1599 O O   . SER B 2 9   ? 61.186 25.417  -24.254 1.00 30.39 ? 10  SER L O   1 
ATOM   1600 C CB  . SER B 2 9   ? 61.499 23.382  -26.824 1.00 27.69 ? 10  SER L CB  1 
ATOM   1601 O OG  . SER B 2 9   ? 60.275 24.097  -26.888 1.00 23.39 ? 10  SER L OG  1 
ATOM   1602 N N   . ASN B 2 10  ? 62.715 26.008  -25.786 1.00 33.08 ? 11  ASN L N   1 
ATOM   1603 C CA  . ASN B 2 10  ? 62.500 27.431  -25.539 1.00 40.34 ? 11  ASN L CA  1 
ATOM   1604 C C   . ASN B 2 10  ? 61.146 27.736  -26.172 1.00 40.56 ? 11  ASN L C   1 
ATOM   1605 O O   . ASN B 2 10  ? 60.770 27.106  -27.162 1.00 40.24 ? 11  ASN L O   1 
ATOM   1606 C CB  . ASN B 2 10  ? 63.581 28.273  -26.217 1.00 45.64 ? 11  ASN L CB  1 
ATOM   1607 C CG  . ASN B 2 10  ? 64.885 28.283  -25.443 1.00 49.03 ? 11  ASN L CG  1 
ATOM   1608 O OD1 . ASN B 2 10  ? 65.948 28.004  -25.996 1.00 48.07 ? 11  ASN L OD1 1 
ATOM   1609 N ND2 . ASN B 2 10  ? 64.810 28.614  -24.154 1.00 55.73 ? 11  ASN L ND2 1 
ATOM   1610 N N   . PRO B 2 11  ? 60.397 28.700  -25.617 1.00 41.37 ? 12  PRO L N   1 
ATOM   1611 C CA  . PRO B 2 11  ? 59.086 29.039  -26.179 1.00 36.57 ? 12  PRO L CA  1 
ATOM   1612 C C   . PRO B 2 11  ? 59.199 29.374  -27.670 1.00 38.81 ? 12  PRO L C   1 
ATOM   1613 O O   . PRO B 2 11  ? 60.101 30.097  -28.092 1.00 40.02 ? 12  PRO L O   1 
ATOM   1614 C CB  . PRO B 2 11  ? 58.650 30.229  -25.332 1.00 39.48 ? 12  PRO L CB  1 
ATOM   1615 C CG  . PRO B 2 11  ? 59.953 30.871  -24.962 1.00 43.39 ? 12  PRO L CG  1 
ATOM   1616 C CD  . PRO B 2 11  ? 60.797 29.679  -24.593 1.00 44.72 ? 12  PRO L CD  1 
ATOM   1617 N N   . VAL B 2 12  ? 58.282 28.842  -28.464 1.00 31.14 ? 13  VAL L N   1 
ATOM   1618 C CA  . VAL B 2 12  ? 58.308 29.074  -29.894 1.00 30.01 ? 13  VAL L CA  1 
ATOM   1619 C C   . VAL B 2 12  ? 57.093 29.822  -30.414 1.00 28.69 ? 13  VAL L C   1 
ATOM   1620 O O   . VAL B 2 12  ? 55.948 29.497  -30.085 1.00 21.31 ? 13  VAL L O   1 
ATOM   1621 C CB  . VAL B 2 12  ? 58.414 27.742  -30.661 1.00 31.86 ? 13  VAL L CB  1 
ATOM   1622 C CG1 . VAL B 2 12  ? 58.491 28.011  -32.144 1.00 29.81 ? 13  VAL L CG1 1 
ATOM   1623 C CG2 . VAL B 2 12  ? 59.636 26.962  -30.183 1.00 33.31 ? 13  VAL L CG2 1 
ATOM   1624 N N   . THR B 2 13  ? 57.364 30.828  -31.236 1.00 28.54 ? 14  THR L N   1 
ATOM   1625 C CA  . THR B 2 13  ? 56.327 31.639  -31.847 1.00 30.26 ? 14  THR L CA  1 
ATOM   1626 C C   . THR B 2 13  ? 55.664 30.848  -32.972 1.00 29.26 ? 14  THR L C   1 
ATOM   1627 O O   . THR B 2 13  ? 56.345 30.290  -33.811 1.00 22.36 ? 14  THR L O   1 
ATOM   1628 C CB  . THR B 2 13  ? 56.933 32.911  -32.458 1.00 37.82 ? 14  THR L CB  1 
ATOM   1629 O OG1 . THR B 2 13  ? 57.640 33.639  -31.446 1.00 43.54 ? 14  THR L OG1 1 
ATOM   1630 C CG2 . THR B 2 13  ? 55.846 33.787  -33.050 1.00 37.73 ? 14  THR L CG2 1 
ATOM   1631 N N   . LEU B 2 14  ? 54.339 30.798  -32.986 1.00 28.18 ? 15  LEU L N   1 
ATOM   1632 C CA  . LEU B 2 14  ? 53.631 30.090  -34.044 1.00 33.05 ? 15  LEU L CA  1 
ATOM   1633 C C   . LEU B 2 14  ? 54.077 30.622  -35.408 1.00 32.71 ? 15  LEU L C   1 
ATOM   1634 O O   . LEU B 2 14  ? 54.244 31.821  -35.588 1.00 33.04 ? 15  LEU L O   1 
ATOM   1635 C CB  . LEU B 2 14  ? 52.122 30.283  -33.901 1.00 36.70 ? 15  LEU L CB  1 
ATOM   1636 C CG  . LEU B 2 14  ? 51.414 29.569  -32.755 1.00 40.19 ? 15  LEU L CG  1 
ATOM   1637 C CD1 . LEU B 2 14  ? 49.928 29.882  -32.802 1.00 42.44 ? 15  LEU L CD1 1 
ATOM   1638 C CD2 . LEU B 2 14  ? 51.640 28.071  -32.877 1.00 37.48 ? 15  LEU L CD2 1 
ATOM   1639 N N   . GLY B 2 15  ? 54.273 29.723  -36.364 1.00 33.19 ? 16  GLY L N   1 
ATOM   1640 C CA  . GLY B 2 15  ? 54.703 30.142  -37.682 1.00 30.20 ? 16  GLY L CA  1 
ATOM   1641 C C   . GLY B 2 15  ? 56.208 30.200  -37.830 1.00 32.68 ? 16  GLY L C   1 
ATOM   1642 O O   . GLY B 2 15  ? 56.705 30.372  -38.943 1.00 29.11 ? 16  GLY L O   1 
ATOM   1643 N N   . THR B 2 16  ? 56.943 30.072  -36.724 1.00 27.41 ? 17  THR L N   1 
ATOM   1644 C CA  . THR B 2 16  ? 58.405 30.092  -36.787 1.00 26.62 ? 17  THR L CA  1 
ATOM   1645 C C   . THR B 2 16  ? 58.943 28.696  -36.506 1.00 24.62 ? 17  THR L C   1 
ATOM   1646 O O   . THR B 2 16  ? 58.189 27.824  -36.099 1.00 25.28 ? 17  THR L O   1 
ATOM   1647 C CB  . THR B 2 16  ? 59.005 31.088  -35.776 1.00 26.08 ? 17  THR L CB  1 
ATOM   1648 O OG1 . THR B 2 16  ? 58.836 30.597  -34.446 1.00 27.67 ? 17  THR L OG1 1 
ATOM   1649 C CG2 . THR B 2 16  ? 58.320 32.423  -35.892 1.00 25.73 ? 17  THR L CG2 1 
ATOM   1650 N N   . SER B 2 17  ? 60.239 28.485  -36.733 1.00 21.74 ? 18  SER L N   1 
ATOM   1651 C CA  . SER B 2 17  ? 60.847 27.176  -36.527 1.00 27.53 ? 18  SER L CA  1 
ATOM   1652 C C   . SER B 2 17  ? 61.213 26.885  -35.078 1.00 25.57 ? 18  SER L C   1 
ATOM   1653 O O   . SER B 2 17  ? 61.562 27.793  -34.320 1.00 20.97 ? 18  SER L O   1 
ATOM   1654 C CB  . SER B 2 17  ? 62.109 27.028  -37.383 1.00 31.48 ? 18  SER L CB  1 
ATOM   1655 O OG  . SER B 2 17  ? 61.812 27.024  -38.772 1.00 42.11 ? 18  SER L OG  1 
ATOM   1656 N N   . ALA B 2 18  ? 61.126 25.609  -34.713 1.00 25.23 ? 19  ALA L N   1 
ATOM   1657 C CA  . ALA B 2 18  ? 61.484 25.154  -33.375 1.00 25.49 ? 19  ALA L CA  1 
ATOM   1658 C C   . ALA B 2 18  ? 62.608 24.148  -33.592 1.00 29.25 ? 19  ALA L C   1 
ATOM   1659 O O   . ALA B 2 18  ? 62.687 23.527  -34.660 1.00 22.59 ? 19  ALA L O   1 
ATOM   1660 C CB  . ALA B 2 18  ? 60.286 24.479  -32.702 1.00 16.92 ? 19  ALA L CB  1 
ATOM   1661 N N   . SER B 2 19  ? 63.480 24.007  -32.594 1.00 23.43 ? 20  SER L N   1 
ATOM   1662 C CA  . SER B 2 19  ? 64.599 23.070  -32.654 1.00 24.73 ? 20  SER L CA  1 
ATOM   1663 C C   . SER B 2 19  ? 64.618 22.268  -31.367 1.00 26.56 ? 20  SER L C   1 
ATOM   1664 O O   . SER B 2 19  ? 64.534 22.843  -30.281 1.00 25.82 ? 20  SER L O   1 
ATOM   1665 C CB  . SER B 2 19  ? 65.943 23.806  -32.778 1.00 24.48 ? 20  SER L CB  1 
ATOM   1666 O OG  . SER B 2 19  ? 65.999 24.611  -33.938 1.00 44.18 ? 20  SER L OG  1 
ATOM   1667 N N   . ILE B 2 20  ? 64.724 20.951  -31.492 1.00 24.60 ? 21  ILE L N   1 
ATOM   1668 C CA  . ILE B 2 20  ? 64.788 20.058  -30.342 1.00 23.54 ? 21  ILE L CA  1 
ATOM   1669 C C   . ILE B 2 20  ? 66.057 19.230  -30.480 1.00 24.26 ? 21  ILE L C   1 
ATOM   1670 O O   . ILE B 2 20  ? 66.202 18.445  -31.415 1.00 20.15 ? 21  ILE L O   1 
ATOM   1671 C CB  . ILE B 2 20  ? 63.558 19.139  -30.274 1.00 25.19 ? 21  ILE L CB  1 
ATOM   1672 C CG1 . ILE B 2 20  ? 62.309 20.009  -30.076 1.00 23.42 ? 21  ILE L CG1 1 
ATOM   1673 C CG2 . ILE B 2 20  ? 63.715 18.123  -29.130 1.00 25.53 ? 21  ILE L CG2 1 
ATOM   1674 C CD1 . ILE B 2 20  ? 61.047 19.244  -29.810 1.00 19.35 ? 21  ILE L CD1 1 
ATOM   1675 N N   . SER B 2 21  ? 66.979 19.428  -29.545 1.00 21.29 ? 22  SER L N   1 
ATOM   1676 C CA  . SER B 2 21  ? 68.268 18.738  -29.559 1.00 23.91 ? 22  SER L CA  1 
ATOM   1677 C C   . SER B 2 21  ? 68.213 17.388  -28.877 1.00 16.76 ? 22  SER L C   1 
ATOM   1678 O O   . SER B 2 21  ? 67.316 17.119  -28.088 1.00 21.66 ? 22  SER L O   1 
ATOM   1679 C CB  . SER B 2 21  ? 69.326 19.595  -28.860 1.00 27.60 ? 22  SER L CB  1 
ATOM   1680 O OG  . SER B 2 21  ? 69.183 19.496  -27.450 1.00 33.38 ? 22  SER L OG  1 
ATOM   1681 N N   . CYS B 2 22  ? 69.187 16.547  -29.194 1.00 18.70 ? 23  CYS L N   1 
ATOM   1682 C CA  . CYS B 2 22  ? 69.288 15.213  -28.620 1.00 23.39 ? 23  CYS L CA  1 
ATOM   1683 C C   . CYS B 2 22  ? 70.712 14.773  -28.852 1.00 26.80 ? 23  CYS L C   1 
ATOM   1684 O O   . CYS B 2 22  ? 71.326 15.115  -29.876 1.00 22.98 ? 23  CYS L O   1 
ATOM   1685 C CB  . CYS B 2 22  ? 68.336 14.238  -29.297 1.00 26.62 ? 23  CYS L CB  1 
ATOM   1686 S SG  . CYS B 2 22  ? 68.529 12.515  -28.743 1.00 31.91 ? 23  CYS L SG  1 
ATOM   1687 N N   . ARG B 2 23  ? 71.237 14.019  -27.897 1.00 26.19 ? 24  ARG L N   1 
ATOM   1688 C CA  . ARG B 2 23  ? 72.614 13.565  -27.955 1.00 27.71 ? 24  ARG L CA  1 
ATOM   1689 C C   . ARG B 2 23  ? 72.705 12.126  -27.456 1.00 25.44 ? 24  ARG L C   1 
ATOM   1690 O O   . ARG B 2 23  ? 71.973 11.728  -26.549 1.00 22.99 ? 24  ARG L O   1 
ATOM   1691 C CB  . ARG B 2 23  ? 73.461 14.497  -27.075 1.00 32.17 ? 24  ARG L CB  1 
ATOM   1692 C CG  . ARG B 2 23  ? 74.928 14.159  -26.985 1.00 46.12 ? 24  ARG L CG  1 
ATOM   1693 C CD  . ARG B 2 23  ? 75.579 14.927  -25.833 1.00 47.87 ? 24  ARG L CD  1 
ATOM   1694 N NE  . ARG B 2 23  ? 76.990 14.578  -25.672 1.00 53.02 ? 24  ARG L NE  1 
ATOM   1695 C CZ  . ARG B 2 23  ? 77.947 14.927  -26.523 1.00 46.89 ? 24  ARG L CZ  1 
ATOM   1696 N NH1 . ARG B 2 23  ? 77.651 15.638  -27.597 1.00 50.04 ? 24  ARG L NH1 1 
ATOM   1697 N NH2 . ARG B 2 23  ? 79.197 14.562  -26.302 1.00 50.98 ? 24  ARG L NH2 1 
ATOM   1698 N N   . SER B 2 24  ? 73.614 11.360  -28.052 1.00 24.78 ? 25  SER L N   1 
ATOM   1699 C CA  . SER B 2 24  ? 73.826 9.965   -27.679 1.00 28.45 ? 25  SER L CA  1 
ATOM   1700 C C   . SER B 2 24  ? 75.262 9.803   -27.189 1.00 28.42 ? 25  SER L C   1 
ATOM   1701 O O   . SER B 2 24  ? 76.156 10.497  -27.652 1.00 28.82 ? 25  SER L O   1 
ATOM   1702 C CB  . SER B 2 24  ? 73.627 9.053   -28.890 1.00 30.69 ? 25  SER L CB  1 
ATOM   1703 O OG  . SER B 2 24  ? 74.647 9.284   -29.845 1.00 30.63 ? 25  SER L OG  1 
ATOM   1704 N N   . THR B 2 25  ? 75.481 8.877   -26.264 1.00 29.75 ? 26  THR L N   1 
ATOM   1705 C CA  . THR B 2 25  ? 76.822 8.648   -25.731 1.00 29.83 ? 26  THR L CA  1 
ATOM   1706 C C   . THR B 2 25  ? 77.659 7.912   -26.763 1.00 34.40 ? 26  THR L C   1 
ATOM   1707 O O   . THR B 2 25  ? 78.877 7.875   -26.670 1.00 38.38 ? 26  THR L O   1 
ATOM   1708 C CB  . THR B 2 25  ? 76.776 7.805   -24.431 1.00 31.60 ? 26  THR L CB  1 
ATOM   1709 O OG1 . THR B 2 25  ? 76.042 6.598   -24.670 1.00 27.37 ? 26  THR L OG1 1 
ATOM   1710 C CG2 . THR B 2 25  ? 76.086 8.582   -23.310 1.00 20.55 ? 26  THR L CG2 1 
ATOM   1711 N N   . LYS B 2 26  ? 76.994 7.334   -27.760 1.00 34.94 ? 27  LYS L N   1 
ATOM   1712 C CA  . LYS B 2 26  ? 77.682 6.585   -28.807 1.00 32.22 ? 27  LYS L CA  1 
ATOM   1713 C C   . LYS B 2 26  ? 77.138 6.930   -30.193 1.00 32.55 ? 27  LYS L C   1 
ATOM   1714 O O   . LYS B 2 26  ? 75.949 7.199   -30.353 1.00 33.78 ? 27  LYS L O   1 
ATOM   1715 C CB  . LYS B 2 26  ? 77.518 5.089   -28.545 1.00 29.71 ? 27  LYS L CB  1 
ATOM   1716 C CG  . LYS B 2 26  ? 78.103 4.166   -29.600 1.00 33.28 ? 27  LYS L CG  1 
ATOM   1717 C CD  . LYS B 2 26  ? 77.806 2.717   -29.244 1.00 32.35 ? 27  LYS L CD  1 
ATOM   1718 C CE  . LYS B 2 26  ? 78.250 1.745   -30.323 1.00 34.23 ? 27  LYS L CE  1 
ATOM   1719 N NZ  . LYS B 2 26  ? 79.725 1.610   -30.408 1.00 45.61 ? 27  LYS L NZ  1 
ATOM   1720 N N   . SER B 2 27  ? 78.010 6.928   -31.195 1.00 33.83 ? 28  SER L N   1 
ATOM   1721 C CA  . SER B 2 27  ? 77.579 7.239   -32.558 1.00 35.13 ? 28  SER L CA  1 
ATOM   1722 C C   . SER B 2 27  ? 76.535 6.234   -33.007 1.00 34.53 ? 28  SER L C   1 
ATOM   1723 O O   . SER B 2 27  ? 76.671 5.034   -32.772 1.00 34.07 ? 28  SER L O   1 
ATOM   1724 C CB  . SER B 2 27  ? 78.755 7.197   -33.534 1.00 30.64 ? 28  SER L CB  1 
ATOM   1725 O OG  . SER B 2 27  ? 78.296 7.372   -34.865 1.00 34.44 ? 28  SER L OG  1 
ATOM   1726 N N   . LEU B 2 28  ? 75.493 6.731   -33.655 1.00 33.13 ? 29  LEU L N   1 
ATOM   1727 C CA  . LEU B 2 28  ? 74.414 5.889   -34.149 1.00 27.84 ? 29  LEU L CA  1 
ATOM   1728 C C   . LEU B 2 28  ? 74.625 5.558   -35.629 1.00 30.08 ? 29  LEU L C   1 
ATOM   1729 O O   . LEU B 2 28  ? 73.809 4.872   -36.250 1.00 31.35 ? 29  LEU L O   1 
ATOM   1730 C CB  . LEU B 2 28  ? 73.075 6.604   -33.936 1.00 30.12 ? 29  LEU L CB  1 
ATOM   1731 C CG  . LEU B 2 28  ? 72.292 6.334   -32.632 1.00 30.19 ? 29  LEU L CG  1 
ATOM   1732 C CD1 . LEU B 2 28  ? 73.206 5.905   -31.499 1.00 26.71 ? 29  LEU L CD1 1 
ATOM   1733 C CD2 . LEU B 2 28  ? 71.506 7.570   -32.261 1.00 28.28 ? 29  LEU L CD2 1 
ATOM   1734 N N   . LEU B 2 29  ? 75.729 6.050   -36.184 1.00 30.65 ? 30  LEU L N   1 
ATOM   1735 C CA  . LEU B 2 29  ? 76.076 5.817   -37.589 1.00 32.97 ? 30  LEU L CA  1 
ATOM   1736 C C   . LEU B 2 29  ? 76.623 4.400   -37.779 1.00 31.90 ? 30  LEU L C   1 
ATOM   1737 O O   . LEU B 2 29  ? 77.684 4.050   -37.258 1.00 34.74 ? 30  LEU L O   1 
ATOM   1738 C CB  . LEU B 2 29  ? 77.106 6.859   -38.054 1.00 28.19 ? 30  LEU L CB  1 
ATOM   1739 C CG  . LEU B 2 29  ? 77.761 6.842   -39.451 1.00 40.09 ? 30  LEU L CG  1 
ATOM   1740 C CD1 . LEU B 2 29  ? 78.684 5.658   -39.571 1.00 44.54 ? 30  LEU L CD1 1 
ATOM   1741 C CD2 . LEU B 2 29  ? 76.725 6.803   -40.554 1.00 38.63 ? 30  LEU L CD2 1 
ATOM   1742 N N   . HIS B 2 30  ? 75.880 3.590   -38.527 1.00 34.17 ? 31  HIS L N   1 
ATOM   1743 C CA  . HIS B 2 30  ? 76.261 2.208   -38.805 1.00 37.34 ? 31  HIS L CA  1 
ATOM   1744 C C   . HIS B 2 30  ? 77.112 2.147   -40.074 1.00 34.41 ? 31  HIS L C   1 
ATOM   1745 O O   . HIS B 2 30  ? 77.044 3.040   -40.911 1.00 35.97 ? 31  HIS L O   1 
ATOM   1746 C CB  . HIS B 2 30  ? 75.007 1.358   -38.991 1.00 39.01 ? 31  HIS L CB  1 
ATOM   1747 C CG  . HIS B 2 30  ? 75.279 -0.110  -39.073 1.00 46.78 ? 31  HIS L CG  1 
ATOM   1748 N ND1 . HIS B 2 30  ? 74.350 -1.013  -39.540 1.00 51.06 ? 31  HIS L ND1 1 
ATOM   1749 C CD2 . HIS B 2 30  ? 76.371 -0.835  -38.736 1.00 52.69 ? 31  HIS L CD2 1 
ATOM   1750 C CE1 . HIS B 2 30  ? 74.857 -2.231  -39.489 1.00 45.69 ? 31  HIS L CE1 1 
ATOM   1751 N NE2 . HIS B 2 30  ? 76.083 -2.151  -39.004 1.00 55.81 ? 31  HIS L NE2 1 
ATOM   1752 N N   . SER B 2 31  ? 77.908 1.090   -40.216 1.00 38.19 ? 32  SER L N   1 
ATOM   1753 C CA  . SER B 2 31  ? 78.782 0.932   -41.378 1.00 35.17 ? 32  SER L CA  1 
ATOM   1754 C C   . SER B 2 31  ? 78.022 0.827   -42.699 1.00 33.78 ? 32  SER L C   1 
ATOM   1755 O O   . SER B 2 31  ? 78.610 0.922   -43.777 1.00 32.26 ? 32  SER L O   1 
ATOM   1756 C CB  . SER B 2 31  ? 79.675 -0.297  -41.201 1.00 33.83 ? 32  SER L CB  1 
ATOM   1757 O OG  . SER B 2 31  ? 78.893 -1.454  -41.007 1.00 42.39 ? 32  SER L OG  1 
ATOM   1758 N N   . ASN B 2 32  ? 76.716 0.620   -42.627 1.00 34.62 ? 33  ASN L N   1 
ATOM   1759 C CA  . ASN B 2 32  ? 75.941 0.541   -43.845 1.00 33.05 ? 33  ASN L CA  1 
ATOM   1760 C C   . ASN B 2 32  ? 75.547 1.950   -44.279 1.00 34.40 ? 33  ASN L C   1 
ATOM   1761 O O   . ASN B 2 32  ? 74.812 2.127   -45.246 1.00 32.72 ? 33  ASN L O   1 
ATOM   1762 C CB  . ASN B 2 32  ? 74.705 -0.346  -43.652 1.00 35.83 ? 33  ASN L CB  1 
ATOM   1763 C CG  . ASN B 2 32  ? 73.705 0.227   -42.659 1.00 37.69 ? 33  ASN L CG  1 
ATOM   1764 O OD1 . ASN B 2 32  ? 73.882 1.322   -42.131 1.00 33.83 ? 33  ASN L OD1 1 
ATOM   1765 N ND2 . ASN B 2 32  ? 72.640 -0.527  -42.401 1.00 36.01 ? 33  ASN L ND2 1 
ATOM   1766 N N   . GLY B 2 33  ? 76.046 2.948   -43.550 1.00 27.99 ? 34  GLY L N   1 
ATOM   1767 C CA  . GLY B 2 33  ? 75.769 4.334   -43.892 1.00 29.64 ? 34  GLY L CA  1 
ATOM   1768 C C   . GLY B 2 33  ? 74.505 4.925   -43.298 1.00 31.17 ? 34  GLY L C   1 
ATOM   1769 O O   . GLY B 2 33  ? 74.239 6.118   -43.448 1.00 31.48 ? 34  GLY L O   1 
ATOM   1770 N N   . ILE B 2 34  ? 73.725 4.094   -42.622 1.00 28.69 ? 35  ILE L N   1 
ATOM   1771 C CA  . ILE B 2 34  ? 72.482 4.536   -42.009 1.00 27.10 ? 35  ILE L CA  1 
ATOM   1772 C C   . ILE B 2 34  ? 72.679 4.891   -40.529 1.00 27.18 ? 35  ILE L C   1 
ATOM   1773 O O   . ILE B 2 34  ? 73.434 4.230   -39.825 1.00 24.73 ? 35  ILE L O   1 
ATOM   1774 C CB  . ILE B 2 34  ? 71.424 3.437   -42.133 1.00 28.06 ? 35  ILE L CB  1 
ATOM   1775 C CG1 . ILE B 2 34  ? 71.155 3.154   -43.615 1.00 29.50 ? 35  ILE L CG1 1 
ATOM   1776 C CG2 . ILE B 2 34  ? 70.164 3.839   -41.413 1.00 26.29 ? 35  ILE L CG2 1 
ATOM   1777 C CD1 . ILE B 2 34  ? 70.117 2.092   -43.857 1.00 30.19 ? 35  ILE L CD1 1 
ATOM   1778 N N   . THR B 2 35  ? 72.016 5.951   -40.075 1.00 23.52 ? 36  THR L N   1 
ATOM   1779 C CA  . THR B 2 35  ? 72.092 6.401   -38.682 1.00 24.58 ? 36  THR L CA  1 
ATOM   1780 C C   . THR B 2 35  ? 70.800 5.998   -37.992 1.00 27.15 ? 36  THR L C   1 
ATOM   1781 O O   . THR B 2 35  ? 69.739 6.579   -38.238 1.00 24.18 ? 36  THR L O   1 
ATOM   1782 C CB  . THR B 2 35  ? 72.245 7.920   -38.595 1.00 28.56 ? 36  THR L CB  1 
ATOM   1783 O OG1 . THR B 2 35  ? 73.415 8.319   -39.317 1.00 29.87 ? 36  THR L OG1 1 
ATOM   1784 C CG2 . THR B 2 35  ? 72.390 8.364   -37.129 1.00 27.78 ? 36  THR L CG2 1 
ATOM   1785 N N   . TYR B 2 36  ? 70.899 5.004   -37.118 1.00 22.28 ? 37  TYR L N   1 
ATOM   1786 C CA  . TYR B 2 36  ? 69.734 4.474   -36.429 1.00 23.16 ? 37  TYR L CA  1 
ATOM   1787 C C   . TYR B 2 36  ? 69.204 5.287   -35.250 1.00 26.26 ? 37  TYR L C   1 
ATOM   1788 O O   . TYR B 2 36  ? 69.303 4.889   -34.083 1.00 23.96 ? 37  TYR L O   1 
ATOM   1789 C CB  . TYR B 2 36  ? 70.010 3.020   -36.032 1.00 25.50 ? 37  TYR L CB  1 
ATOM   1790 C CG  . TYR B 2 36  ? 70.164 2.152   -37.260 1.00 24.39 ? 37  TYR L CG  1 
ATOM   1791 C CD1 . TYR B 2 36  ? 71.389 2.046   -37.915 1.00 26.05 ? 37  TYR L CD1 1 
ATOM   1792 C CD2 . TYR B 2 36  ? 69.061 1.514   -37.822 1.00 29.98 ? 37  TYR L CD2 1 
ATOM   1793 C CE1 . TYR B 2 36  ? 71.510 1.331   -39.096 1.00 32.34 ? 37  TYR L CE1 1 
ATOM   1794 C CE2 . TYR B 2 36  ? 69.171 0.797   -39.007 1.00 34.76 ? 37  TYR L CE2 1 
ATOM   1795 C CZ  . TYR B 2 36  ? 70.399 0.710   -39.638 1.00 36.58 ? 37  TYR L CZ  1 
ATOM   1796 O OH  . TYR B 2 36  ? 70.518 -0.002  -40.810 1.00 41.72 ? 37  TYR L OH  1 
ATOM   1797 N N   . LEU B 2 37  ? 68.614 6.423   -35.601 1.00 21.83 ? 38  LEU L N   1 
ATOM   1798 C CA  . LEU B 2 37  ? 68.005 7.360   -34.672 1.00 21.04 ? 38  LEU L CA  1 
ATOM   1799 C C   . LEU B 2 37  ? 66.567 7.548   -35.119 1.00 23.04 ? 38  LEU L C   1 
ATOM   1800 O O   . LEU B 2 37  ? 66.304 7.675   -36.313 1.00 22.81 ? 38  LEU L O   1 
ATOM   1801 C CB  . LEU B 2 37  ? 68.709 8.718   -34.761 1.00 19.86 ? 38  LEU L CB  1 
ATOM   1802 C CG  . LEU B 2 37  ? 68.014 9.918   -34.106 1.00 27.07 ? 38  LEU L CG  1 
ATOM   1803 C CD1 . LEU B 2 37  ? 68.175 9.860   -32.585 1.00 24.08 ? 38  LEU L CD1 1 
ATOM   1804 C CD2 . LEU B 2 37  ? 68.626 11.197  -34.621 1.00 28.83 ? 38  LEU L CD2 1 
ATOM   1805 N N   . TYR B 2 38  ? 65.631 7.543   -34.184 1.00 16.69 ? 39  TYR L N   1 
ATOM   1806 C CA  . TYR B 2 38  ? 64.253 7.797   -34.562 1.00 17.91 ? 39  TYR L CA  1 
ATOM   1807 C C   . TYR B 2 38  ? 63.644 8.763   -33.566 1.00 24.26 ? 39  TYR L C   1 
ATOM   1808 O O   . TYR B 2 38  ? 64.178 8.946   -32.465 1.00 23.56 ? 39  TYR L O   1 
ATOM   1809 C CB  . TYR B 2 38  ? 63.435 6.492   -34.701 1.00 19.71 ? 39  TYR L CB  1 
ATOM   1810 C CG  . TYR B 2 38  ? 63.208 5.662   -33.459 1.00 19.41 ? 39  TYR L CG  1 
ATOM   1811 C CD1 . TYR B 2 38  ? 61.967 5.662   -32.823 1.00 21.99 ? 39  TYR L CD1 1 
ATOM   1812 C CD2 . TYR B 2 38  ? 64.216 4.856   -32.935 1.00 19.09 ? 39  TYR L CD2 1 
ATOM   1813 C CE1 . TYR B 2 38  ? 61.726 4.879   -31.700 1.00 21.92 ? 39  TYR L CE1 1 
ATOM   1814 C CE2 . TYR B 2 38  ? 63.985 4.062   -31.797 1.00 18.25 ? 39  TYR L CE2 1 
ATOM   1815 C CZ  . TYR B 2 38  ? 62.741 4.077   -31.192 1.00 20.39 ? 39  TYR L CZ  1 
ATOM   1816 O OH  . TYR B 2 38  ? 62.495 3.280   -30.097 1.00 23.77 ? 39  TYR L OH  1 
ATOM   1817 N N   . TRP B 2 39  ? 62.566 9.421   -33.985 1.00 21.53 ? 40  TRP L N   1 
ATOM   1818 C CA  . TRP B 2 39  ? 61.845 10.376  -33.166 1.00 19.04 ? 40  TRP L CA  1 
ATOM   1819 C C   . TRP B 2 39  ? 60.375 9.989   -33.158 1.00 24.55 ? 40  TRP L C   1 
ATOM   1820 O O   . TRP B 2 39  ? 59.839 9.533   -34.173 1.00 18.07 ? 40  TRP L O   1 
ATOM   1821 C CB  . TRP B 2 39  ? 61.940 11.800  -33.740 1.00 16.20 ? 40  TRP L CB  1 
ATOM   1822 C CG  . TRP B 2 39  ? 63.308 12.373  -33.841 1.00 12.87 ? 40  TRP L CG  1 
ATOM   1823 C CD1 . TRP B 2 39  ? 64.200 12.207  -34.861 1.00 20.38 ? 40  TRP L CD1 1 
ATOM   1824 C CD2 . TRP B 2 39  ? 63.916 13.275  -32.920 1.00 13.88 ? 40  TRP L CD2 1 
ATOM   1825 N NE1 . TRP B 2 39  ? 65.322 12.968  -34.639 1.00 17.45 ? 40  TRP L NE1 1 
ATOM   1826 C CE2 . TRP B 2 39  ? 65.175 13.630  -33.449 1.00 16.75 ? 40  TRP L CE2 1 
ATOM   1827 C CE3 . TRP B 2 39  ? 63.517 13.827  -31.694 1.00 17.44 ? 40  TRP L CE3 1 
ATOM   1828 C CZ2 . TRP B 2 39  ? 66.043 14.510  -32.794 1.00 20.22 ? 40  TRP L CZ2 1 
ATOM   1829 C CZ3 . TRP B 2 39  ? 64.380 14.708  -31.045 1.00 17.11 ? 40  TRP L CZ3 1 
ATOM   1830 C CH2 . TRP B 2 39  ? 65.628 15.040  -31.603 1.00 8.98  ? 40  TRP L CH2 1 
ATOM   1831 N N   . TYR B 2 40  ? 59.729 10.145  -32.007 1.00 18.46 ? 41  TYR L N   1 
ATOM   1832 C CA  . TYR B 2 40  ? 58.308 9.881   -31.909 1.00 17.54 ? 41  TYR L CA  1 
ATOM   1833 C C   . TYR B 2 40  ? 57.709 11.001  -31.082 1.00 18.11 ? 41  TYR L C   1 
ATOM   1834 O O   . TYR B 2 40  ? 58.420 11.703  -30.359 1.00 18.94 ? 41  TYR L O   1 
ATOM   1835 C CB  . TYR B 2 40  ? 58.013 8.494   -31.318 1.00 22.80 ? 41  TYR L CB  1 
ATOM   1836 C CG  . TYR B 2 40  ? 58.523 8.206   -29.921 1.00 24.21 ? 41  TYR L CG  1 
ATOM   1837 C CD1 . TYR B 2 40  ? 57.765 8.517   -28.797 1.00 26.07 ? 41  TYR L CD1 1 
ATOM   1838 C CD2 . TYR B 2 40  ? 59.734 7.545   -29.734 1.00 24.37 ? 41  TYR L CD2 1 
ATOM   1839 C CE1 . TYR B 2 40  ? 58.204 8.161   -27.504 1.00 26.94 ? 41  TYR L CE1 1 
ATOM   1840 C CE2 . TYR B 2 40  ? 60.179 7.194   -28.474 1.00 31.06 ? 41  TYR L CE2 1 
ATOM   1841 C CZ  . TYR B 2 40  ? 59.414 7.500   -27.365 1.00 32.33 ? 41  TYR L CZ  1 
ATOM   1842 O OH  . TYR B 2 40  ? 59.876 7.132   -26.132 1.00 34.35 ? 41  TYR L OH  1 
ATOM   1843 N N   . LEU B 2 41  ? 56.406 11.179  -31.216 1.00 17.42 ? 42  LEU L N   1 
ATOM   1844 C CA  . LEU B 2 41  ? 55.688 12.244  -30.547 1.00 23.56 ? 42  LEU L CA  1 
ATOM   1845 C C   . LEU B 2 41  ? 54.598 11.708  -29.632 1.00 26.70 ? 42  LEU L C   1 
ATOM   1846 O O   . LEU B 2 41  ? 53.891 10.762  -29.972 1.00 25.22 ? 42  LEU L O   1 
ATOM   1847 C CB  . LEU B 2 41  ? 55.084 13.168  -31.611 1.00 21.84 ? 42  LEU L CB  1 
ATOM   1848 C CG  . LEU B 2 41  ? 54.066 14.254  -31.248 1.00 30.54 ? 42  LEU L CG  1 
ATOM   1849 C CD1 . LEU B 2 41  ? 54.659 15.215  -30.229 1.00 28.88 ? 42  LEU L CD1 1 
ATOM   1850 C CD2 . LEU B 2 41  ? 53.667 15.009  -32.527 1.00 27.55 ? 42  LEU L CD2 1 
ATOM   1851 N N   . GLN B 2 42  ? 54.475 12.329  -28.467 1.00 28.04 ? 43  GLN L N   1 
ATOM   1852 C CA  . GLN B 2 42  ? 53.470 11.960  -27.490 1.00 36.43 ? 43  GLN L CA  1 
ATOM   1853 C C   . GLN B 2 42  ? 52.599 13.182  -27.186 1.00 38.79 ? 43  GLN L C   1 
ATOM   1854 O O   . GLN B 2 42  ? 53.018 14.080  -26.456 1.00 33.91 ? 43  GLN L O   1 
ATOM   1855 C CB  . GLN B 2 42  ? 54.153 11.482  -26.212 1.00 43.11 ? 43  GLN L CB  1 
ATOM   1856 C CG  . GLN B 2 42  ? 53.210 11.216  -25.041 1.00 53.86 ? 43  GLN L CG  1 
ATOM   1857 C CD  . GLN B 2 42  ? 52.669 9.803   -25.025 1.00 52.69 ? 43  GLN L CD  1 
ATOM   1858 O OE1 . GLN B 2 42  ? 53.432 8.840   -24.961 1.00 58.70 ? 43  GLN L OE1 1 
ATOM   1859 N NE2 . GLN B 2 42  ? 51.351 9.670   -25.074 1.00 51.39 ? 43  GLN L NE2 1 
ATOM   1860 N N   . LYS B 2 43  ? 51.398 13.216  -27.758 1.00 45.46 ? 44  LYS L N   1 
ATOM   1861 C CA  . LYS B 2 43  ? 50.460 14.319  -27.538 1.00 49.19 ? 44  LYS L CA  1 
ATOM   1862 C C   . LYS B 2 43  ? 49.621 14.041  -26.295 1.00 50.12 ? 44  LYS L C   1 
ATOM   1863 O O   . LYS B 2 43  ? 49.493 12.898  -25.865 1.00 48.87 ? 44  LYS L O   1 
ATOM   1864 C CB  . LYS B 2 43  ? 49.517 14.489  -28.734 1.00 45.08 ? 44  LYS L CB  1 
ATOM   1865 C CG  . LYS B 2 43  ? 50.164 14.987  -30.009 1.00 46.24 ? 44  LYS L CG  1 
ATOM   1866 C CD  . LYS B 2 43  ? 49.101 15.222  -31.077 1.00 51.88 ? 44  LYS L CD  1 
ATOM   1867 C CE  . LYS B 2 43  ? 49.704 15.538  -32.437 1.00 56.89 ? 44  LYS L CE  1 
ATOM   1868 N NZ  . LYS B 2 43  ? 50.505 16.791  -32.425 1.00 60.91 ? 44  LYS L NZ  1 
ATOM   1869 N N   . PRO B 2 44  ? 49.033 15.091  -25.704 1.00 54.47 ? 45  PRO L N   1 
ATOM   1870 C CA  . PRO B 2 44  ? 48.206 14.933  -24.504 1.00 57.30 ? 45  PRO L CA  1 
ATOM   1871 C C   . PRO B 2 44  ? 47.048 13.955  -24.687 1.00 61.10 ? 45  PRO L C   1 
ATOM   1872 O O   . PRO B 2 44  ? 46.089 14.241  -25.408 1.00 59.06 ? 45  PRO L O   1 
ATOM   1873 C CB  . PRO B 2 44  ? 47.720 16.354  -24.234 1.00 57.46 ? 45  PRO L CB  1 
ATOM   1874 C CG  . PRO B 2 44  ? 48.871 17.187  -24.721 1.00 61.24 ? 45  PRO L CG  1 
ATOM   1875 C CD  . PRO B 2 44  ? 49.203 16.517  -26.036 1.00 56.07 ? 45  PRO L CD  1 
ATOM   1876 N N   . GLY B 2 45  ? 47.152 12.799  -24.038 1.00 61.81 ? 46  GLY L N   1 
ATOM   1877 C CA  . GLY B 2 45  ? 46.101 11.799  -24.118 1.00 63.57 ? 46  GLY L CA  1 
ATOM   1878 C C   . GLY B 2 45  ? 46.005 11.029  -25.421 1.00 66.02 ? 46  GLY L C   1 
ATOM   1879 O O   . GLY B 2 45  ? 44.927 10.925  -26.009 1.00 64.74 ? 46  GLY L O   1 
ATOM   1880 N N   . GLN B 2 46  ? 47.131 10.486  -25.874 1.00 68.66 ? 47  GLN L N   1 
ATOM   1881 C CA  . GLN B 2 46  ? 47.178 9.706   -27.109 1.00 65.92 ? 47  GLN L CA  1 
ATOM   1882 C C   . GLN B 2 46  ? 48.345 8.730   -27.082 1.00 63.97 ? 47  GLN L C   1 
ATOM   1883 O O   . GLN B 2 46  ? 49.202 8.793   -26.200 1.00 67.95 ? 47  GLN L O   1 
ATOM   1884 C CB  . GLN B 2 46  ? 47.314 10.625  -28.323 1.00 66.59 ? 47  GLN L CB  1 
ATOM   1885 C CG  . GLN B 2 46  ? 46.119 11.514  -28.562 1.00 69.22 ? 47  GLN L CG  1 
ATOM   1886 C CD  . GLN B 2 46  ? 46.162 12.177  -29.917 1.00 74.47 ? 47  GLN L CD  1 
ATOM   1887 O OE1 . GLN B 2 46  ? 47.046 12.985  -30.201 1.00 74.84 ? 47  GLN L OE1 1 
ATOM   1888 N NE2 . GLN B 2 46  ? 45.205 11.832  -30.773 1.00 78.16 ? 47  GLN L NE2 1 
ATOM   1889 N N   . SER B 2 47  ? 48.377 7.825   -28.051 1.00 59.83 ? 48  SER L N   1 
ATOM   1890 C CA  . SER B 2 47  ? 49.449 6.845   -28.123 1.00 55.03 ? 48  SER L CA  1 
ATOM   1891 C C   . SER B 2 47  ? 50.653 7.452   -28.839 1.00 47.32 ? 48  SER L C   1 
ATOM   1892 O O   . SER B 2 47  ? 50.499 8.352   -29.651 1.00 45.20 ? 48  SER L O   1 
ATOM   1893 C CB  . SER B 2 47  ? 48.968 5.604   -28.871 1.00 56.61 ? 48  SER L CB  1 
ATOM   1894 O OG  . SER B 2 47  ? 49.956 4.587   -28.855 1.00 60.46 ? 48  SER L OG  1 
ATOM   1895 N N   . PRO B 2 48  ? 51.870 6.976   -28.530 1.00 45.56 ? 49  PRO L N   1 
ATOM   1896 C CA  . PRO B 2 48  ? 53.071 7.510   -29.179 1.00 42.61 ? 49  PRO L CA  1 
ATOM   1897 C C   . PRO B 2 48  ? 52.946 7.397   -30.698 1.00 37.60 ? 49  PRO L C   1 
ATOM   1898 O O   . PRO B 2 48  ? 52.433 6.403   -31.212 1.00 33.87 ? 49  PRO L O   1 
ATOM   1899 C CB  . PRO B 2 48  ? 54.183 6.628   -28.623 1.00 43.15 ? 49  PRO L CB  1 
ATOM   1900 C CG  . PRO B 2 48  ? 53.680 6.285   -27.255 1.00 42.68 ? 49  PRO L CG  1 
ATOM   1901 C CD  . PRO B 2 48  ? 52.227 5.970   -27.514 1.00 41.07 ? 49  PRO L CD  1 
ATOM   1902 N N   . GLN B 2 49  ? 53.435 8.413   -31.400 1.00 33.25 ? 50  GLN L N   1 
ATOM   1903 C CA  . GLN B 2 49  ? 53.358 8.463   -32.850 1.00 28.60 ? 50  GLN L CA  1 
ATOM   1904 C C   . GLN B 2 49  ? 54.743 8.632   -33.451 1.00 23.31 ? 50  GLN L C   1 
ATOM   1905 O O   . GLN B 2 49  ? 55.432 9.608   -33.161 1.00 19.98 ? 50  GLN L O   1 
ATOM   1906 C CB  . GLN B 2 49  ? 52.460 9.642   -33.248 1.00 36.37 ? 50  GLN L CB  1 
ATOM   1907 C CG  . GLN B 2 49  ? 52.228 9.822   -34.732 1.00 47.54 ? 50  GLN L CG  1 
ATOM   1908 C CD  . GLN B 2 49  ? 51.449 11.096  -35.046 1.00 57.02 ? 50  GLN L CD  1 
ATOM   1909 O OE1 . GLN B 2 49  ? 51.103 11.355  -36.199 1.00 60.18 ? 50  GLN L OE1 1 
ATOM   1910 N NE2 . GLN B 2 49  ? 51.174 11.898  -34.019 1.00 56.85 ? 50  GLN L NE2 1 
ATOM   1911 N N   . LEU B 2 50  ? 55.155 7.692   -34.298 1.00 23.49 ? 51  LEU L N   1 
ATOM   1912 C CA  . LEU B 2 50  ? 56.470 7.794   -34.933 1.00 23.81 ? 51  LEU L CA  1 
ATOM   1913 C C   . LEU B 2 50  ? 56.487 9.040   -35.820 1.00 22.00 ? 51  LEU L C   1 
ATOM   1914 O O   . LEU B 2 50  ? 55.493 9.339   -36.469 1.00 20.81 ? 51  LEU L O   1 
ATOM   1915 C CB  . LEU B 2 50  ? 56.761 6.550   -35.786 1.00 18.11 ? 51  LEU L CB  1 
ATOM   1916 C CG  . LEU B 2 50  ? 58.105 6.530   -36.521 1.00 19.39 ? 51  LEU L CG  1 
ATOM   1917 C CD1 . LEU B 2 50  ? 59.231 6.435   -35.510 1.00 19.24 ? 51  LEU L CD1 1 
ATOM   1918 C CD2 . LEU B 2 50  ? 58.165 5.343   -37.494 1.00 12.34 ? 51  LEU L CD2 1 
ATOM   1919 N N   . LEU B 2 51  ? 57.616 9.747   -35.831 1.00 21.51 ? 52  LEU L N   1 
ATOM   1920 C CA  . LEU B 2 51  ? 57.791 10.952  -36.628 1.00 22.09 ? 52  LEU L CA  1 
ATOM   1921 C C   . LEU B 2 51  ? 58.820 10.732  -37.707 1.00 23.11 ? 52  LEU L C   1 
ATOM   1922 O O   . LEU B 2 51  ? 58.559 10.926  -38.885 1.00 22.03 ? 52  LEU L O   1 
ATOM   1923 C CB  . LEU B 2 51  ? 58.302 12.118  -35.790 1.00 21.51 ? 52  LEU L CB  1 
ATOM   1924 C CG  . LEU B 2 51  ? 57.384 13.010  -34.965 1.00 35.27 ? 52  LEU L CG  1 
ATOM   1925 C CD1 . LEU B 2 51  ? 58.214 14.221  -34.506 1.00 31.04 ? 52  LEU L CD1 1 
ATOM   1926 C CD2 . LEU B 2 51  ? 56.176 13.474  -35.779 1.00 34.20 ? 52  LEU L CD2 1 
ATOM   1927 N N   . ILE B 2 52  ? 60.005 10.334  -37.271 1.00 21.05 ? 53  ILE L N   1 
ATOM   1928 C CA  . ILE B 2 52  ? 61.128 10.134  -38.164 1.00 16.01 ? 53  ILE L CA  1 
ATOM   1929 C C   . ILE B 2 52  ? 61.897 8.899   -37.746 1.00 24.82 ? 53  ILE L C   1 
ATOM   1930 O O   . ILE B 2 52  ? 62.002 8.593   -36.551 1.00 20.83 ? 53  ILE L O   1 
ATOM   1931 C CB  . ILE B 2 52  ? 62.059 11.385  -38.107 1.00 21.78 ? 53  ILE L CB  1 
ATOM   1932 C CG1 . ILE B 2 52  ? 61.322 12.594  -38.685 1.00 27.00 ? 53  ILE L CG1 1 
ATOM   1933 C CG2 . ILE B 2 52  ? 63.369 11.122  -38.827 1.00 17.25 ? 53  ILE L CG2 1 
ATOM   1934 C CD1 . ILE B 2 52  ? 62.111 13.858  -38.688 1.00 26.49 ? 53  ILE L CD1 1 
ATOM   1935 N N   . TYR B 2 53  ? 62.401 8.161   -38.727 1.00 19.94 ? 54  TYR L N   1 
ATOM   1936 C CA  . TYR B 2 53  ? 63.190 6.984   -38.422 1.00 22.58 ? 54  TYR L CA  1 
ATOM   1937 C C   . TYR B 2 53  ? 64.425 7.007   -39.306 1.00 23.42 ? 54  TYR L C   1 
ATOM   1938 O O   . TYR B 2 53  ? 64.434 7.637   -40.375 1.00 20.24 ? 54  TYR L O   1 
ATOM   1939 C CB  . TYR B 2 53  ? 62.388 5.691   -38.622 1.00 21.68 ? 54  TYR L CB  1 
ATOM   1940 C CG  . TYR B 2 53  ? 62.003 5.379   -40.047 1.00 27.04 ? 54  TYR L CG  1 
ATOM   1941 C CD1 . TYR B 2 53  ? 60.955 6.048   -40.664 1.00 28.29 ? 54  TYR L CD1 1 
ATOM   1942 C CD2 . TYR B 2 53  ? 62.661 4.380   -40.761 1.00 31.27 ? 54  TYR L CD2 1 
ATOM   1943 C CE1 . TYR B 2 53  ? 60.565 5.729   -41.958 1.00 36.23 ? 54  TYR L CE1 1 
ATOM   1944 C CE2 . TYR B 2 53  ? 62.279 4.051   -42.055 1.00 32.88 ? 54  TYR L CE2 1 
ATOM   1945 C CZ  . TYR B 2 53  ? 61.230 4.729   -42.647 1.00 35.86 ? 54  TYR L CZ  1 
ATOM   1946 O OH  . TYR B 2 53  ? 60.841 4.409   -43.927 1.00 44.30 ? 54  TYR L OH  1 
ATOM   1947 N N   . GLN B 2 54  ? 65.458 6.320   -38.850 1.00 17.31 ? 55  GLN L N   1 
ATOM   1948 C CA  . GLN B 2 54  ? 66.724 6.256   -39.552 1.00 23.24 ? 55  GLN L CA  1 
ATOM   1949 C C   . GLN B 2 54  ? 67.235 7.653   -39.856 1.00 26.58 ? 55  GLN L C   1 
ATOM   1950 O O   . GLN B 2 54  ? 67.731 7.946   -40.945 1.00 27.88 ? 55  GLN L O   1 
ATOM   1951 C CB  . GLN B 2 54  ? 66.596 5.408   -40.817 1.00 23.15 ? 55  GLN L CB  1 
ATOM   1952 C CG  . GLN B 2 54  ? 66.436 3.931   -40.487 1.00 20.91 ? 55  GLN L CG  1 
ATOM   1953 C CD  . GLN B 2 54  ? 66.326 3.055   -41.723 1.00 31.66 ? 55  GLN L CD  1 
ATOM   1954 O OE1 . GLN B 2 54  ? 66.463 3.527   -42.861 1.00 30.22 ? 55  GLN L OE1 1 
ATOM   1955 N NE2 . GLN B 2 54  ? 66.085 1.772   -41.506 1.00 24.78 ? 55  GLN L NE2 1 
ATOM   1956 N N   . MET B 2 55  ? 67.082 8.515   -38.860 1.00 27.01 ? 56  MET L N   1 
ATOM   1957 C CA  . MET B 2 55  ? 67.561 9.884   -38.910 1.00 34.51 ? 56  MET L CA  1 
ATOM   1958 C C   . MET B 2 55  ? 66.861 10.872  -39.838 1.00 39.01 ? 56  MET L C   1 
ATOM   1959 O O   . MET B 2 55  ? 66.555 11.993  -39.424 1.00 41.95 ? 56  MET L O   1 
ATOM   1960 C CB  . MET B 2 55  ? 69.056 9.865   -39.225 1.00 39.50 ? 56  MET L CB  1 
ATOM   1961 C CG  . MET B 2 55  ? 69.914 10.528  -38.174 1.00 49.17 ? 56  MET L CG  1 
ATOM   1962 S SD  . MET B 2 55  ? 69.942 12.296  -38.385 1.00 54.88 ? 56  MET L SD  1 
ATOM   1963 C CE  . MET B 2 55  ? 71.416 12.448  -39.396 1.00 52.83 ? 56  MET L CE  1 
ATOM   1964 N N   . SER B 2 56  ? 66.595 10.472  -41.078 1.00 37.95 ? 57  SER L N   1 
ATOM   1965 C CA  . SER B 2 56  ? 65.974 11.397  -42.016 1.00 41.28 ? 57  SER L CA  1 
ATOM   1966 C C   . SER B 2 56  ? 64.830 10.868  -42.873 1.00 40.17 ? 57  SER L C   1 
ATOM   1967 O O   . SER B 2 56  ? 64.559 11.414  -43.943 1.00 46.02 ? 57  SER L O   1 
ATOM   1968 C CB  . SER B 2 56  ? 67.053 11.976  -42.932 1.00 45.82 ? 57  SER L CB  1 
ATOM   1969 O OG  . SER B 2 56  ? 67.737 10.941  -43.617 1.00 46.40 ? 57  SER L OG  1 
ATOM   1970 N N   . ASN B 2 57  ? 64.162 9.816   -42.421 1.00 34.86 ? 58  ASN L N   1 
ATOM   1971 C CA  . ASN B 2 57  ? 63.038 9.264   -43.168 1.00 31.50 ? 58  ASN L CA  1 
ATOM   1972 C C   . ASN B 2 57  ? 61.763 9.603   -42.420 1.00 34.22 ? 58  ASN L C   1 
ATOM   1973 O O   . ASN B 2 57  ? 61.606 9.242   -41.252 1.00 25.23 ? 58  ASN L O   1 
ATOM   1974 C CB  . ASN B 2 57  ? 63.165 7.745   -43.303 1.00 32.85 ? 58  ASN L CB  1 
ATOM   1975 C CG  . ASN B 2 57  ? 64.319 7.338   -44.191 1.00 41.43 ? 58  ASN L CG  1 
ATOM   1976 O OD1 . ASN B 2 57  ? 64.273 7.528   -45.410 1.00 39.87 ? 58  ASN L OD1 1 
ATOM   1977 N ND2 . ASN B 2 57  ? 65.369 6.784   -43.587 1.00 44.22 ? 58  ASN L ND2 1 
ATOM   1978 N N   . LEU B 2 58  ? 60.863 10.324  -43.078 1.00 28.10 ? 59  LEU L N   1 
ATOM   1979 C CA  . LEU B 2 58  ? 59.601 10.695  -42.457 1.00 28.90 ? 59  LEU L CA  1 
ATOM   1980 C C   . LEU B 2 58  ? 58.668 9.504   -42.490 1.00 30.78 ? 59  LEU L C   1 
ATOM   1981 O O   . LEU B 2 58  ? 58.681 8.717   -43.433 1.00 32.95 ? 59  LEU L O   1 
ATOM   1982 C CB  . LEU B 2 58  ? 58.939 11.861  -43.203 1.00 28.42 ? 59  LEU L CB  1 
ATOM   1983 C CG  . LEU B 2 58  ? 59.550 13.260  -43.097 1.00 29.46 ? 59  LEU L CG  1 
ATOM   1984 C CD1 . LEU B 2 58  ? 61.039 13.189  -43.370 1.00 35.01 ? 59  LEU L CD1 1 
ATOM   1985 C CD2 . LEU B 2 58  ? 58.850 14.224  -44.089 1.00 28.97 ? 59  LEU L CD2 1 
ATOM   1986 N N   . ALA B 2 59  ? 57.861 9.365   -41.449 1.00 31.36 ? 60  ALA L N   1 
ATOM   1987 C CA  . ALA B 2 59  ? 56.905 8.273   -41.409 1.00 41.01 ? 60  ALA L CA  1 
ATOM   1988 C C   . ALA B 2 59  ? 55.697 8.813   -42.162 1.00 43.42 ? 60  ALA L C   1 
ATOM   1989 O O   . ALA B 2 59  ? 55.391 10.001  -42.057 1.00 38.35 ? 60  ALA L O   1 
ATOM   1990 C CB  . ALA B 2 59  ? 56.546 7.949   -39.973 1.00 32.62 ? 60  ALA L CB  1 
ATOM   1991 N N   . SER B 2 60  ? 55.034 7.962   -42.942 1.00 49.69 ? 61  SER L N   1 
ATOM   1992 C CA  . SER B 2 60  ? 53.865 8.403   -43.696 1.00 50.52 ? 61  SER L CA  1 
ATOM   1993 C C   . SER B 2 60  ? 52.903 9.188   -42.795 1.00 47.46 ? 61  SER L C   1 
ATOM   1994 O O   . SER B 2 60  ? 52.733 8.870   -41.614 1.00 45.02 ? 61  SER L O   1 
ATOM   1995 C CB  . SER B 2 60  ? 53.141 7.202   -44.324 1.00 55.89 ? 61  SER L CB  1 
ATOM   1996 O OG  . SER B 2 60  ? 53.870 6.682   -45.425 1.00 59.79 ? 61  SER L OG  1 
ATOM   1997 N N   . GLY B 2 61  ? 52.289 10.225  -43.358 1.00 43.03 ? 62  GLY L N   1 
ATOM   1998 C CA  . GLY B 2 61  ? 51.357 11.029  -42.591 1.00 34.30 ? 62  GLY L CA  1 
ATOM   1999 C C   . GLY B 2 61  ? 52.038 12.202  -41.920 1.00 32.02 ? 62  GLY L C   1 
ATOM   2000 O O   . GLY B 2 61  ? 51.394 13.171  -41.538 1.00 34.49 ? 62  GLY L O   1 
ATOM   2001 N N   . VAL B 2 62  ? 53.351 12.115  -41.775 1.00 26.63 ? 63  VAL L N   1 
ATOM   2002 C CA  . VAL B 2 62  ? 54.108 13.186  -41.144 1.00 31.27 ? 63  VAL L CA  1 
ATOM   2003 C C   . VAL B 2 62  ? 54.406 14.271  -42.173 1.00 24.45 ? 63  VAL L C   1 
ATOM   2004 O O   . VAL B 2 62  ? 55.093 14.015  -43.158 1.00 23.50 ? 63  VAL L O   1 
ATOM   2005 C CB  . VAL B 2 62  ? 55.445 12.658  -40.574 1.00 29.29 ? 63  VAL L CB  1 
ATOM   2006 C CG1 . VAL B 2 62  ? 56.227 13.795  -39.967 1.00 25.39 ? 63  VAL L CG1 1 
ATOM   2007 C CG2 . VAL B 2 62  ? 55.177 11.567  -39.539 1.00 31.87 ? 63  VAL L CG2 1 
ATOM   2008 N N   . PRO B 2 63  ? 53.905 15.499  -41.950 1.00 24.43 ? 64  PRO L N   1 
ATOM   2009 C CA  . PRO B 2 63  ? 54.132 16.614  -42.887 1.00 23.32 ? 64  PRO L CA  1 
ATOM   2010 C C   . PRO B 2 63  ? 55.611 16.969  -43.008 1.00 31.58 ? 64  PRO L C   1 
ATOM   2011 O O   . PRO B 2 63  ? 56.391 16.738  -42.069 1.00 25.87 ? 64  PRO L O   1 
ATOM   2012 C CB  . PRO B 2 63  ? 53.289 17.746  -42.296 1.00 26.44 ? 64  PRO L CB  1 
ATOM   2013 C CG  . PRO B 2 63  ? 53.296 17.439  -40.811 1.00 26.47 ? 64  PRO L CG  1 
ATOM   2014 C CD  . PRO B 2 63  ? 53.123 15.936  -40.780 1.00 21.65 ? 64  PRO L CD  1 
ATOM   2015 N N   . ASN B 2 64  ? 56.012 17.539  -44.148 1.00 25.31 ? 65  ASN L N   1 
ATOM   2016 C CA  . ASN B 2 64  ? 57.420 17.858  -44.328 1.00 19.68 ? 65  ASN L CA  1 
ATOM   2017 C C   . ASN B 2 64  ? 57.922 19.061  -43.551 1.00 20.18 ? 65  ASN L C   1 
ATOM   2018 O O   . ASN B 2 64  ? 59.033 19.507  -43.747 1.00 18.23 ? 65  ASN L O   1 
ATOM   2019 C CB  . ASN B 2 64  ? 57.798 17.953  -45.818 1.00 23.55 ? 65  ASN L CB  1 
ATOM   2020 C CG  . ASN B 2 64  ? 57.035 19.043  -46.583 1.00 25.32 ? 65  ASN L CG  1 
ATOM   2021 O OD1 . ASN B 2 64  ? 57.090 19.085  -47.811 1.00 25.81 ? 65  ASN L OD1 1 
ATOM   2022 N ND2 . ASN B 2 64  ? 56.342 19.924  -45.868 1.00 26.67 ? 65  ASN L ND2 1 
ATOM   2023 N N   . ARG B 2 65  ? 57.106 19.581  -42.649 1.00 23.67 ? 66  ARG L N   1 
ATOM   2024 C CA  . ARG B 2 65  ? 57.568 20.670  -41.793 1.00 28.21 ? 66  ARG L CA  1 
ATOM   2025 C C   . ARG B 2 65  ? 58.594 20.070  -40.814 1.00 24.98 ? 66  ARG L C   1 
ATOM   2026 O O   . ARG B 2 65  ? 59.421 20.782  -40.250 1.00 25.72 ? 66  ARG L O   1 
ATOM   2027 C CB  . ARG B 2 65  ? 56.406 21.268  -40.995 1.00 29.89 ? 66  ARG L CB  1 
ATOM   2028 C CG  . ARG B 2 65  ? 55.378 21.968  -41.855 1.00 35.99 ? 66  ARG L CG  1 
ATOM   2029 C CD  . ARG B 2 65  ? 54.299 22.645  -41.027 1.00 36.20 ? 66  ARG L CD  1 
ATOM   2030 N NE  . ARG B 2 65  ? 53.490 21.706  -40.258 1.00 32.00 ? 66  ARG L NE  1 
ATOM   2031 C CZ  . ARG B 2 65  ? 53.610 21.510  -38.951 1.00 31.36 ? 66  ARG L CZ  1 
ATOM   2032 N NH1 . ARG B 2 65  ? 54.515 22.185  -38.257 1.00 32.13 ? 66  ARG L NH1 1 
ATOM   2033 N NH2 . ARG B 2 65  ? 52.803 20.659  -38.338 1.00 28.01 ? 66  ARG L NH2 1 
ATOM   2034 N N   . PHE B 2 66  ? 58.537 18.753  -40.634 1.00 25.12 ? 67  PHE L N   1 
ATOM   2035 C CA  . PHE B 2 66  ? 59.448 18.036  -39.731 1.00 21.72 ? 67  PHE L CA  1 
ATOM   2036 C C   . PHE B 2 66  ? 60.696 17.544  -40.461 1.00 29.51 ? 67  PHE L C   1 
ATOM   2037 O O   . PHE B 2 66  ? 60.617 17.081  -41.600 1.00 24.04 ? 67  PHE L O   1 
ATOM   2038 C CB  . PHE B 2 66  ? 58.729 16.836  -39.114 1.00 13.81 ? 67  PHE L CB  1 
ATOM   2039 C CG  . PHE B 2 66  ? 57.666 17.214  -38.121 1.00 27.30 ? 67  PHE L CG  1 
ATOM   2040 C CD1 . PHE B 2 66  ? 57.991 17.410  -36.773 1.00 21.26 ? 67  PHE L CD1 1 
ATOM   2041 C CD2 . PHE B 2 66  ? 56.356 17.426  -38.531 1.00 20.87 ? 67  PHE L CD2 1 
ATOM   2042 C CE1 . PHE B 2 66  ? 57.035 17.809  -35.862 1.00 23.68 ? 67  PHE L CE1 1 
ATOM   2043 C CE2 . PHE B 2 66  ? 55.385 17.829  -37.621 1.00 29.23 ? 67  PHE L CE2 1 
ATOM   2044 C CZ  . PHE B 2 66  ? 55.726 18.025  -36.277 1.00 28.72 ? 67  PHE L CZ  1 
ATOM   2045 N N   . SER B 2 67  ? 61.847 17.658  -39.803 1.00 25.48 ? 68  SER L N   1 
ATOM   2046 C CA  . SER B 2 67  ? 63.105 17.193  -40.374 1.00 26.36 ? 68  SER L CA  1 
ATOM   2047 C C   . SER B 2 67  ? 64.108 16.961  -39.259 1.00 26.92 ? 68  SER L C   1 
ATOM   2048 O O   . SER B 2 67  ? 64.004 17.554  -38.180 1.00 22.27 ? 68  SER L O   1 
ATOM   2049 C CB  . SER B 2 67  ? 63.677 18.206  -41.374 1.00 22.26 ? 68  SER L CB  1 
ATOM   2050 O OG  . SER B 2 67  ? 63.984 19.453  -40.754 1.00 29.84 ? 68  SER L OG  1 
ATOM   2051 N N   . SER B 2 68  ? 65.079 16.096  -39.525 1.00 25.34 ? 69  SER L N   1 
ATOM   2052 C CA  . SER B 2 68  ? 66.104 15.774  -38.550 1.00 26.64 ? 69  SER L CA  1 
ATOM   2053 C C   . SER B 2 68  ? 67.438 15.696  -39.236 1.00 26.65 ? 69  SER L C   1 
ATOM   2054 O O   . SER B 2 68  ? 67.552 15.163  -40.336 1.00 29.55 ? 69  SER L O   1 
ATOM   2055 C CB  . SER B 2 68  ? 65.810 14.428  -37.870 1.00 32.70 ? 69  SER L CB  1 
ATOM   2056 O OG  . SER B 2 68  ? 66.891 14.020  -37.036 1.00 28.90 ? 69  SER L OG  1 
ATOM   2057 N N   . SER B 2 69  ? 68.447 16.232  -38.572 1.00 25.47 ? 70  SER L N   1 
ATOM   2058 C CA  . SER B 2 69  ? 69.805 16.236  -39.085 1.00 26.16 ? 70  SER L CA  1 
ATOM   2059 C C   . SER B 2 69  ? 70.751 16.088  -37.901 1.00 29.61 ? 70  SER L C   1 
ATOM   2060 O O   . SER B 2 69  ? 70.335 16.197  -36.734 1.00 25.20 ? 70  SER L O   1 
ATOM   2061 C CB  . SER B 2 69  ? 70.087 17.551  -39.805 1.00 21.89 ? 70  SER L CB  1 
ATOM   2062 O OG  . SER B 2 69  ? 69.667 18.644  -39.010 1.00 27.14 ? 70  SER L OG  1 
ATOM   2063 N N   . GLY B 2 70  ? 72.020 15.845  -38.203 1.00 25.86 ? 71  GLY L N   1 
ATOM   2064 C CA  . GLY B 2 70  ? 73.001 15.693  -37.154 1.00 30.53 ? 71  GLY L CA  1 
ATOM   2065 C C   . GLY B 2 70  ? 74.121 14.761  -37.552 1.00 34.09 ? 71  GLY L C   1 
ATOM   2066 O O   . GLY B 2 70  ? 74.084 14.124  -38.610 1.00 32.87 ? 71  GLY L O   1 
ATOM   2067 N N   . SER B 2 71  ? 75.131 14.700  -36.695 1.00 32.74 ? 72  SER L N   1 
ATOM   2068 C CA  . SER B 2 71  ? 76.277 13.842  -36.910 1.00 30.76 ? 72  SER L CA  1 
ATOM   2069 C C   . SER B 2 71  ? 75.849 12.483  -36.396 1.00 34.33 ? 72  SER L C   1 
ATOM   2070 O O   . SER B 2 71  ? 74.668 12.152  -36.401 1.00 32.06 ? 72  SER L O   1 
ATOM   2071 C CB  . SER B 2 71  ? 77.457 14.337  -36.083 1.00 33.15 ? 72  SER L CB  1 
ATOM   2072 O OG  . SER B 2 71  ? 77.199 14.134  -34.703 1.00 30.11 ? 72  SER L OG  1 
ATOM   2073 N N   . GLY B 2 72  ? 76.814 11.702  -35.929 1.00 35.69 ? 73  GLY L N   1 
ATOM   2074 C CA  . GLY B 2 72  ? 76.497 10.397  -35.400 1.00 29.47 ? 73  GLY L CA  1 
ATOM   2075 C C   . GLY B 2 72  ? 76.135 10.464  -33.932 1.00 29.26 ? 73  GLY L C   1 
ATOM   2076 O O   . GLY B 2 72  ? 75.493 9.548   -33.417 1.00 27.03 ? 73  GLY L O   1 
ATOM   2077 N N   . THR B 2 73  ? 76.505 11.561  -33.269 1.00 29.18 ? 74  THR L N   1 
ATOM   2078 C CA  . THR B 2 73  ? 76.260 11.716  -31.831 1.00 26.10 ? 74  THR L CA  1 
ATOM   2079 C C   . THR B 2 73  ? 75.402 12.893  -31.378 1.00 26.73 ? 74  THR L C   1 
ATOM   2080 O O   . THR B 2 73  ? 74.907 12.888  -30.254 1.00 28.26 ? 74  THR L O   1 
ATOM   2081 C CB  . THR B 2 73  ? 77.582 11.829  -31.088 1.00 24.51 ? 74  THR L CB  1 
ATOM   2082 O OG1 . THR B 2 73  ? 78.348 12.898  -31.663 1.00 28.59 ? 74  THR L OG1 1 
ATOM   2083 C CG2 . THR B 2 73  ? 78.367 10.518  -31.186 1.00 26.14 ? 74  THR L CG2 1 
ATOM   2084 N N   . ASP B 2 74  ? 75.232 13.893  -32.239 1.00 22.72 ? 75  ASP L N   1 
ATOM   2085 C CA  . ASP B 2 74  ? 74.459 15.078  -31.886 1.00 22.95 ? 75  ASP L CA  1 
ATOM   2086 C C   . ASP B 2 74  ? 73.412 15.337  -32.939 1.00 24.11 ? 75  ASP L C   1 
ATOM   2087 O O   . ASP B 2 74  ? 73.737 15.538  -34.111 1.00 21.73 ? 75  ASP L O   1 
ATOM   2088 C CB  . ASP B 2 74  ? 75.393 16.279  -31.770 1.00 17.29 ? 75  ASP L CB  1 
ATOM   2089 C CG  . ASP B 2 74  ? 76.382 16.128  -30.619 1.00 31.99 ? 75  ASP L CG  1 
ATOM   2090 O OD1 . ASP B 2 74  ? 76.092 16.653  -29.527 1.00 27.74 ? 75  ASP L OD1 1 
ATOM   2091 O OD2 . ASP B 2 74  ? 77.430 15.466  -30.806 1.00 22.07 ? 75  ASP L OD2 1 
ATOM   2092 N N   . PHE B 2 75  ? 72.159 15.378  -32.512 1.00 22.14 ? 76  PHE L N   1 
ATOM   2093 C CA  . PHE B 2 75  ? 71.070 15.552  -33.444 1.00 24.56 ? 76  PHE L CA  1 
ATOM   2094 C C   . PHE B 2 75  ? 70.097 16.661  -33.111 1.00 28.43 ? 76  PHE L C   1 
ATOM   2095 O O   . PHE B 2 75  ? 69.983 17.095  -31.965 1.00 23.82 ? 76  PHE L O   1 
ATOM   2096 C CB  . PHE B 2 75  ? 70.313 14.233  -33.566 1.00 29.73 ? 76  PHE L CB  1 
ATOM   2097 C CG  . PHE B 2 75  ? 71.196 13.027  -33.439 1.00 29.58 ? 76  PHE L CG  1 
ATOM   2098 C CD1 . PHE B 2 75  ? 71.429 12.448  -32.190 1.00 29.27 ? 76  PHE L CD1 1 
ATOM   2099 C CD2 . PHE B 2 75  ? 71.818 12.484  -34.560 1.00 26.07 ? 76  PHE L CD2 1 
ATOM   2100 C CE1 . PHE B 2 75  ? 72.271 11.343  -32.064 1.00 27.71 ? 76  PHE L CE1 1 
ATOM   2101 C CE2 . PHE B 2 75  ? 72.658 11.383  -34.444 1.00 29.44 ? 76  PHE L CE2 1 
ATOM   2102 C CZ  . PHE B 2 75  ? 72.883 10.812  -33.197 1.00 30.59 ? 76  PHE L CZ  1 
ATOM   2103 N N   . THR B 2 76  ? 69.391 17.115  -34.140 1.00 18.89 ? 77  THR L N   1 
ATOM   2104 C CA  . THR B 2 76  ? 68.400 18.167  -33.980 1.00 20.46 ? 77  THR L CA  1 
ATOM   2105 C C   . THR B 2 76  ? 67.119 17.860  -34.735 1.00 21.27 ? 77  THR L C   1 
ATOM   2106 O O   . THR B 2 76  ? 67.153 17.565  -35.931 1.00 23.51 ? 77  THR L O   1 
ATOM   2107 C CB  . THR B 2 76  ? 68.931 19.517  -34.509 1.00 23.02 ? 77  THR L CB  1 
ATOM   2108 O OG1 . THR B 2 76  ? 70.182 19.827  -33.885 1.00 23.31 ? 77  THR L OG1 1 
ATOM   2109 C CG2 . THR B 2 76  ? 67.942 20.631  -34.207 1.00 28.19 ? 77  THR L CG2 1 
ATOM   2110 N N   . LEU B 2 77  ? 65.993 17.888  -34.033 1.00 19.90 ? 78  LEU L N   1 
ATOM   2111 C CA  . LEU B 2 77  ? 64.717 17.688  -34.689 1.00 20.01 ? 78  LEU L CA  1 
ATOM   2112 C C   . LEU B 2 77  ? 64.311 19.122  -34.981 1.00 26.13 ? 78  LEU L C   1 
ATOM   2113 O O   . LEU B 2 77  ? 64.389 19.978  -34.090 1.00 23.65 ? 78  LEU L O   1 
ATOM   2114 C CB  . LEU B 2 77  ? 63.682 17.059  -33.761 1.00 23.51 ? 78  LEU L CB  1 
ATOM   2115 C CG  . LEU B 2 77  ? 62.267 16.995  -34.366 1.00 22.29 ? 78  LEU L CG  1 
ATOM   2116 C CD1 . LEU B 2 77  ? 62.255 16.025  -35.525 1.00 23.93 ? 78  LEU L CD1 1 
ATOM   2117 C CD2 . LEU B 2 77  ? 61.261 16.543  -33.322 1.00 23.02 ? 78  LEU L CD2 1 
ATOM   2118 N N   . ARG B 2 78  ? 63.927 19.408  -36.221 1.00 22.49 ? 79  ARG L N   1 
ATOM   2119 C CA  . ARG B 2 78  ? 63.500 20.757  -36.574 1.00 24.71 ? 79  ARG L CA  1 
ATOM   2120 C C   . ARG B 2 78  ? 62.072 20.741  -37.051 1.00 27.25 ? 79  ARG L C   1 
ATOM   2121 O O   . ARG B 2 78  ? 61.671 19.850  -37.803 1.00 25.39 ? 79  ARG L O   1 
ATOM   2122 C CB  . ARG B 2 78  ? 64.399 21.353  -37.646 1.00 28.11 ? 79  ARG L CB  1 
ATOM   2123 C CG  . ARG B 2 78  ? 65.761 21.748  -37.113 1.00 36.15 ? 79  ARG L CG  1 
ATOM   2124 C CD  . ARG B 2 78  ? 66.743 22.001  -38.234 1.00 43.80 ? 79  ARG L CD  1 
ATOM   2125 N NE  . ARG B 2 78  ? 68.115 22.087  -37.738 1.00 50.47 ? 79  ARG L NE  1 
ATOM   2126 C CZ  . ARG B 2 78  ? 69.193 22.027  -38.515 1.00 55.15 ? 79  ARG L CZ  1 
ATOM   2127 N NH1 . ARG B 2 78  ? 69.063 21.879  -39.830 1.00 58.34 ? 79  ARG L NH1 1 
ATOM   2128 N NH2 . ARG B 2 78  ? 70.402 22.115  -37.978 1.00 59.10 ? 79  ARG L NH2 1 
ATOM   2129 N N   . ILE B 2 79  ? 61.301 21.715  -36.571 1.00 26.54 ? 80  ILE L N   1 
ATOM   2130 C CA  . ILE B 2 79  ? 59.901 21.844  -36.937 1.00 26.07 ? 80  ILE L CA  1 
ATOM   2131 C C   . ILE B 2 79  ? 59.719 23.256  -37.453 1.00 31.63 ? 80  ILE L C   1 
ATOM   2132 O O   . ILE B 2 79  ? 59.861 24.216  -36.701 1.00 30.54 ? 80  ILE L O   1 
ATOM   2133 C CB  . ILE B 2 79  ? 58.976 21.656  -35.728 1.00 23.30 ? 80  ILE L CB  1 
ATOM   2134 C CG1 . ILE B 2 79  ? 59.358 20.384  -34.968 1.00 23.26 ? 80  ILE L CG1 1 
ATOM   2135 C CG2 . ILE B 2 79  ? 57.532 21.583  -36.191 1.00 23.03 ? 80  ILE L CG2 1 
ATOM   2136 C CD1 . ILE B 2 79  ? 58.529 20.155  -33.721 1.00 28.27 ? 80  ILE L CD1 1 
ATOM   2137 N N   . ASN B 2 80  ? 59.431 23.403  -38.740 1.00 27.85 ? 81  ASN L N   1 
ATOM   2138 C CA  . ASN B 2 80  ? 59.247 24.749  -39.260 1.00 31.56 ? 81  ASN L CA  1 
ATOM   2139 C C   . ASN B 2 80  ? 57.769 25.106  -39.292 1.00 28.87 ? 81  ASN L C   1 
ATOM   2140 O O   . ASN B 2 80  ? 56.909 24.224  -39.240 1.00 29.99 ? 81  ASN L O   1 
ATOM   2141 C CB  . ASN B 2 80  ? 59.875 24.874  -40.647 1.00 35.15 ? 81  ASN L CB  1 
ATOM   2142 C CG  . ASN B 2 80  ? 59.275 23.919  -41.645 1.00 41.16 ? 81  ASN L CG  1 
ATOM   2143 O OD1 . ASN B 2 80  ? 59.965 23.432  -42.535 1.00 52.62 ? 81  ASN L OD1 1 
ATOM   2144 N ND2 . ASN B 2 80  ? 57.981 23.654  -41.517 1.00 49.37 ? 81  ASN L ND2 1 
ATOM   2145 N N   . THR B 2 81  ? 57.479 26.398  -39.350 1.00 27.79 ? 82  THR L N   1 
ATOM   2146 C CA  . THR B 2 81  ? 56.106 26.876  -39.368 1.00 31.97 ? 82  THR L CA  1 
ATOM   2147 C C   . THR B 2 81  ? 55.291 26.133  -38.315 1.00 28.81 ? 82  THR L C   1 
ATOM   2148 O O   . THR B 2 81  ? 54.283 25.499  -38.626 1.00 30.95 ? 82  THR L O   1 
ATOM   2149 C CB  . THR B 2 81  ? 55.474 26.667  -40.754 1.00 30.15 ? 82  THR L CB  1 
ATOM   2150 O OG1 . THR B 2 81  ? 56.312 27.270  -41.748 1.00 47.84 ? 82  THR L OG1 1 
ATOM   2151 C CG2 . THR B 2 81  ? 54.100 27.323  -40.822 1.00 44.75 ? 82  THR L CG2 1 
ATOM   2152 N N   . VAL B 2 82  ? 55.734 26.218  -37.066 1.00 24.03 ? 83  VAL L N   1 
ATOM   2153 C CA  . VAL B 2 82  ? 55.056 25.546  -35.971 1.00 20.85 ? 83  VAL L CA  1 
ATOM   2154 C C   . VAL B 2 82  ? 53.582 25.893  -35.886 1.00 20.35 ? 83  VAL L C   1 
ATOM   2155 O O   . VAL B 2 82  ? 53.209 27.064  -35.893 1.00 22.49 ? 83  VAL L O   1 
ATOM   2156 C CB  . VAL B 2 82  ? 55.739 25.864  -34.606 1.00 21.52 ? 83  VAL L CB  1 
ATOM   2157 C CG1 . VAL B 2 82  ? 54.778 25.620  -33.453 1.00 12.59 ? 83  VAL L CG1 1 
ATOM   2158 C CG2 . VAL B 2 82  ? 56.972 25.004  -34.438 1.00 17.34 ? 83  VAL L CG2 1 
ATOM   2159 N N   . GLU B 2 83  ? 52.753 24.857  -35.800 1.00 18.81 ? 84  GLU L N   1 
ATOM   2160 C CA  . GLU B 2 83  ? 51.306 25.026  -35.684 1.00 27.98 ? 84  GLU L CA  1 
ATOM   2161 C C   . GLU B 2 83  ? 50.910 24.654  -34.254 1.00 30.95 ? 84  GLU L C   1 
ATOM   2162 O O   . GLU B 2 83  ? 51.604 23.875  -33.607 1.00 25.54 ? 84  GLU L O   1 
ATOM   2163 C CB  . GLU B 2 83  ? 50.587 24.103  -36.661 1.00 26.74 ? 84  GLU L CB  1 
ATOM   2164 C CG  . GLU B 2 83  ? 51.049 24.262  -38.091 1.00 30.42 ? 84  GLU L CG  1 
ATOM   2165 C CD  . GLU B 2 83  ? 50.309 23.351  -39.046 1.00 34.69 ? 84  GLU L CD  1 
ATOM   2166 O OE1 . GLU B 2 83  ? 50.683 23.317  -40.237 1.00 36.70 ? 84  GLU L OE1 1 
ATOM   2167 O OE2 . GLU B 2 83  ? 49.356 22.670  -38.611 1.00 32.18 ? 84  GLU L OE2 1 
ATOM   2168 N N   . ALA B 2 84  ? 49.798 25.208  -33.780 1.00 26.84 ? 85  ALA L N   1 
ATOM   2169 C CA  . ALA B 2 84  ? 49.303 24.958  -32.431 1.00 31.41 ? 85  ALA L CA  1 
ATOM   2170 C C   . ALA B 2 84  ? 49.166 23.463  -32.138 1.00 35.17 ? 85  ALA L C   1 
ATOM   2171 O O   . ALA B 2 84  ? 49.373 23.005  -31.007 1.00 31.94 ? 85  ALA L O   1 
ATOM   2172 C CB  . ALA B 2 84  ? 47.949 25.645  -32.241 1.00 33.48 ? 85  ALA L CB  1 
ATOM   2173 N N   . GLU B 2 85  ? 48.810 22.704  -33.165 1.00 27.64 ? 86  GLU L N   1 
ATOM   2174 C CA  . GLU B 2 85  ? 48.625 21.272  -33.019 1.00 31.80 ? 86  GLU L CA  1 
ATOM   2175 C C   . GLU B 2 85  ? 49.919 20.504  -32.834 1.00 29.06 ? 86  GLU L C   1 
ATOM   2176 O O   . GLU B 2 85  ? 49.892 19.307  -32.578 1.00 26.62 ? 86  GLU L O   1 
ATOM   2177 C CB  . GLU B 2 85  ? 47.886 20.720  -34.229 1.00 40.61 ? 86  GLU L CB  1 
ATOM   2178 C CG  . GLU B 2 85  ? 48.489 21.170  -35.547 1.00 49.07 ? 86  GLU L CG  1 
ATOM   2179 C CD  . GLU B 2 85  ? 47.975 20.371  -36.720 1.00 54.92 ? 86  GLU L CD  1 
ATOM   2180 O OE1 . GLU B 2 85  ? 46.745 20.175  -36.815 1.00 58.03 ? 86  GLU L OE1 1 
ATOM   2181 O OE2 . GLU B 2 85  ? 48.802 19.945  -37.550 1.00 54.76 ? 86  GLU L OE2 1 
ATOM   2182 N N   . ASP B 2 86  ? 51.053 21.179  -32.968 1.00 30.08 ? 87  ASP L N   1 
ATOM   2183 C CA  . ASP B 2 86  ? 52.333 20.510  -32.789 1.00 26.61 ? 87  ASP L CA  1 
ATOM   2184 C C   . ASP B 2 86  ? 52.716 20.326  -31.314 1.00 25.92 ? 87  ASP L C   1 
ATOM   2185 O O   . ASP B 2 86  ? 53.713 19.663  -31.020 1.00 22.99 ? 87  ASP L O   1 
ATOM   2186 C CB  . ASP B 2 86  ? 53.457 21.274  -33.502 1.00 24.61 ? 87  ASP L CB  1 
ATOM   2187 C CG  . ASP B 2 86  ? 53.274 21.324  -35.020 1.00 28.22 ? 87  ASP L CG  1 
ATOM   2188 O OD1 . ASP B 2 86  ? 52.767 20.352  -35.608 1.00 19.26 ? 87  ASP L OD1 1 
ATOM   2189 O OD2 . ASP B 2 86  ? 53.657 22.332  -35.638 1.00 23.03 ? 87  ASP L OD2 1 
ATOM   2190 N N   . VAL B 2 87  ? 51.945 20.899  -30.391 1.00 22.81 ? 88  VAL L N   1 
ATOM   2191 C CA  . VAL B 2 87  ? 52.282 20.758  -28.969 1.00 23.79 ? 88  VAL L CA  1 
ATOM   2192 C C   . VAL B 2 87  ? 52.305 19.300  -28.543 1.00 21.05 ? 88  VAL L C   1 
ATOM   2193 O O   . VAL B 2 87  ? 51.514 18.484  -29.019 1.00 18.71 ? 88  VAL L O   1 
ATOM   2194 C CB  . VAL B 2 87  ? 51.293 21.484  -28.049 1.00 25.37 ? 88  VAL L CB  1 
ATOM   2195 C CG1 . VAL B 2 87  ? 51.360 22.966  -28.277 1.00 38.23 ? 88  VAL L CG1 1 
ATOM   2196 C CG2 . VAL B 2 87  ? 49.904 20.962  -28.288 1.00 20.59 ? 88  VAL L CG2 1 
ATOM   2197 N N   . GLY B 2 88  ? 53.206 18.995  -27.614 1.00 23.88 ? 89  GLY L N   1 
ATOM   2198 C CA  . GLY B 2 88  ? 53.356 17.640  -27.121 1.00 16.98 ? 89  GLY L CA  1 
ATOM   2199 C C   . GLY B 2 88  ? 54.797 17.426  -26.711 1.00 18.01 ? 89  GLY L C   1 
ATOM   2200 O O   . GLY B 2 88  ? 55.580 18.381  -26.619 1.00 20.56 ? 89  GLY L O   1 
ATOM   2201 N N   . VAL B 2 89  ? 55.157 16.170  -26.479 1.00 19.62 ? 90  VAL L N   1 
ATOM   2202 C CA  . VAL B 2 89  ? 56.511 15.836  -26.055 1.00 22.20 ? 90  VAL L CA  1 
ATOM   2203 C C   . VAL B 2 89  ? 57.215 15.008  -27.122 1.00 18.37 ? 90  VAL L C   1 
ATOM   2204 O O   . VAL B 2 89  ? 56.751 13.936  -27.501 1.00 18.43 ? 90  VAL L O   1 
ATOM   2205 C CB  . VAL B 2 89  ? 56.492 15.037  -24.723 1.00 20.48 ? 90  VAL L CB  1 
ATOM   2206 C CG1 . VAL B 2 89  ? 57.900 14.896  -24.187 1.00 21.44 ? 90  VAL L CG1 1 
ATOM   2207 C CG2 . VAL B 2 89  ? 55.602 15.745  -23.700 1.00 13.94 ? 90  VAL L CG2 1 
ATOM   2208 N N   . TYR B 2 90  ? 58.348 15.515  -27.588 1.00 16.70 ? 91  TYR L N   1 
ATOM   2209 C CA  . TYR B 2 90  ? 59.129 14.847  -28.612 1.00 22.17 ? 91  TYR L CA  1 
ATOM   2210 C C   . TYR B 2 90  ? 60.275 14.023  -28.039 1.00 23.23 ? 91  TYR L C   1 
ATOM   2211 O O   . TYR B 2 90  ? 61.142 14.544  -27.335 1.00 18.45 ? 91  TYR L O   1 
ATOM   2212 C CB  . TYR B 2 90  ? 59.658 15.887  -29.588 1.00 18.39 ? 91  TYR L CB  1 
ATOM   2213 C CG  . TYR B 2 90  ? 58.537 16.587  -30.310 1.00 26.07 ? 91  TYR L CG  1 
ATOM   2214 C CD1 . TYR B 2 90  ? 57.723 17.507  -29.652 1.00 25.53 ? 91  TYR L CD1 1 
ATOM   2215 C CD2 . TYR B 2 90  ? 58.244 16.276  -31.636 1.00 23.20 ? 91  TYR L CD2 1 
ATOM   2216 C CE1 . TYR B 2 90  ? 56.639 18.099  -30.296 1.00 22.38 ? 91  TYR L CE1 1 
ATOM   2217 C CE2 . TYR B 2 90  ? 57.158 16.864  -32.289 1.00 23.88 ? 91  TYR L CE2 1 
ATOM   2218 C CZ  . TYR B 2 90  ? 56.369 17.764  -31.618 1.00 26.35 ? 91  TYR L CZ  1 
ATOM   2219 O OH  . TYR B 2 90  ? 55.305 18.305  -32.280 1.00 24.12 ? 91  TYR L OH  1 
ATOM   2220 N N   . TYR B 2 91  ? 60.276 12.734  -28.368 1.00 22.58 ? 92  TYR L N   1 
ATOM   2221 C CA  . TYR B 2 91  ? 61.300 11.818  -27.880 1.00 18.74 ? 92  TYR L CA  1 
ATOM   2222 C C   . TYR B 2 91  ? 62.249 11.330  -28.955 1.00 20.66 ? 92  TYR L C   1 
ATOM   2223 O O   . TYR B 2 91  ? 61.816 10.959  -30.042 1.00 18.11 ? 92  TYR L O   1 
ATOM   2224 C CB  . TYR B 2 91  ? 60.649 10.572  -27.272 1.00 20.55 ? 92  TYR L CB  1 
ATOM   2225 C CG  . TYR B 2 91  ? 59.777 10.808  -26.071 1.00 25.07 ? 92  TYR L CG  1 
ATOM   2226 C CD1 . TYR B 2 91  ? 60.271 10.617  -24.778 1.00 28.63 ? 92  TYR L CD1 1 
ATOM   2227 C CD2 . TYR B 2 91  ? 58.455 11.215  -26.218 1.00 27.41 ? 92  TYR L CD2 1 
ATOM   2228 C CE1 . TYR B 2 91  ? 59.463 10.825  -23.659 1.00 27.60 ? 92  TYR L CE1 1 
ATOM   2229 C CE2 . TYR B 2 91  ? 57.639 11.428  -25.110 1.00 26.54 ? 92  TYR L CE2 1 
ATOM   2230 C CZ  . TYR B 2 91  ? 58.150 11.230  -23.837 1.00 28.72 ? 92  TYR L CZ  1 
ATOM   2231 O OH  . TYR B 2 91  ? 57.345 11.434  -22.751 1.00 32.86 ? 92  TYR L OH  1 
ATOM   2232 N N   . CYS B 2 92  ? 63.545 11.352  -28.665 1.00 13.63 ? 93  CYS L N   1 
ATOM   2233 C CA  . CYS B 2 92  ? 64.511 10.778  -29.588 1.00 16.06 ? 93  CYS L CA  1 
ATOM   2234 C C   . CYS B 2 92  ? 64.787 9.397   -29.006 1.00 19.84 ? 93  CYS L C   1 
ATOM   2235 O O   . CYS B 2 92  ? 64.523 9.151   -27.818 1.00 18.15 ? 93  CYS L O   1 
ATOM   2236 C CB  . CYS B 2 92  ? 65.806 11.596  -29.665 1.00 20.91 ? 93  CYS L CB  1 
ATOM   2237 S SG  . CYS B 2 92  ? 66.681 11.991  -28.097 1.00 22.07 ? 93  CYS L SG  1 
ATOM   2238 N N   . ALA B 2 93  ? 65.295 8.490   -29.827 1.00 17.96 ? 94  ALA L N   1 
ATOM   2239 C CA  . ALA B 2 93  ? 65.591 7.145   -29.364 1.00 21.82 ? 94  ALA L CA  1 
ATOM   2240 C C   . ALA B 2 93  ? 66.519 6.470   -30.357 1.00 25.49 ? 94  ALA L C   1 
ATOM   2241 O O   . ALA B 2 93  ? 66.660 6.931   -31.491 1.00 24.51 ? 94  ALA L O   1 
ATOM   2242 C CB  . ALA B 2 93  ? 64.309 6.350   -29.207 1.00 20.66 ? 94  ALA L CB  1 
ATOM   2243 N N   . GLN B 2 94  ? 67.163 5.384   -29.938 1.00 22.81 ? 95  GLN L N   1 
ATOM   2244 C CA  . GLN B 2 94  ? 68.063 4.685   -30.837 1.00 16.84 ? 95  GLN L CA  1 
ATOM   2245 C C   . GLN B 2 94  ? 67.698 3.236   -31.059 1.00 20.36 ? 95  GLN L C   1 
ATOM   2246 O O   . GLN B 2 94  ? 67.308 2.524   -30.123 1.00 17.46 ? 95  GLN L O   1 
ATOM   2247 C CB  . GLN B 2 94  ? 69.507 4.769   -30.318 1.00 19.35 ? 95  GLN L CB  1 
ATOM   2248 C CG  . GLN B 2 94  ? 69.724 4.083   -28.952 1.00 21.68 ? 95  GLN L CG  1 
ATOM   2249 C CD  . GLN B 2 94  ? 69.933 2.573   -29.047 1.00 25.16 ? 95  GLN L CD  1 
ATOM   2250 O OE1 . GLN B 2 94  ? 69.911 1.867   -28.032 1.00 28.37 ? 95  GLN L OE1 1 
ATOM   2251 N NE2 . GLN B 2 94  ? 70.158 2.076   -30.252 1.00 16.68 ? 95  GLN L NE2 1 
ATOM   2252 N N   . ASN B 2 95  ? 67.802 2.795   -32.309 1.00 17.84 ? 96  ASN L N   1 
ATOM   2253 C CA  . ASN B 2 95  ? 67.557 1.393   -32.593 1.00 19.80 ? 96  ASN L CA  1 
ATOM   2254 C C   . ASN B 2 95  ? 68.741 0.814   -33.332 1.00 21.16 ? 96  ASN L C   1 
ATOM   2255 O O   . ASN B 2 95  ? 68.583 0.044   -34.285 1.00 25.40 ? 96  ASN L O   1 
ATOM   2256 C CB  . ASN B 2 95  ? 66.265 1.159   -33.373 1.00 15.78 ? 96  ASN L CB  1 
ATOM   2257 C CG  . ASN B 2 95  ? 66.213 1.897   -34.697 1.00 25.49 ? 96  ASN L CG  1 
ATOM   2258 O OD1 . ASN B 2 95  ? 65.305 1.654   -35.491 1.00 25.12 ? 96  ASN L OD1 1 
ATOM   2259 N ND2 . ASN B 2 95  ? 67.163 2.800   -34.940 1.00 15.49 ? 96  ASN L ND2 1 
ATOM   2260 N N   . LEU B 2 96  ? 69.930 1.195   -32.871 1.00 22.57 ? 97  LEU L N   1 
ATOM   2261 C CA  . LEU B 2 96  ? 71.186 0.708   -33.439 1.00 27.37 ? 97  LEU L CA  1 
ATOM   2262 C C   . LEU B 2 96  ? 71.577 -0.627  -32.803 1.00 30.94 ? 97  LEU L C   1 
ATOM   2263 O O   . LEU B 2 96  ? 71.970 -1.566  -33.496 1.00 28.22 ? 97  LEU L O   1 
ATOM   2264 C CB  . LEU B 2 96  ? 72.323 1.700   -33.185 1.00 30.13 ? 97  LEU L CB  1 
ATOM   2265 C CG  . LEU B 2 96  ? 73.671 1.191   -33.712 1.00 29.07 ? 97  LEU L CG  1 
ATOM   2266 C CD1 . LEU B 2 96  ? 73.692 1.365   -35.227 1.00 27.58 ? 97  LEU L CD1 1 
ATOM   2267 C CD2 . LEU B 2 96  ? 74.827 1.942   -33.078 1.00 22.54 ? 97  LEU L CD2 1 
ATOM   2268 N N   . GLU B 2 97  ? 71.475 -0.701  -31.478 1.00 32.45 ? 98  GLU L N   1 
ATOM   2269 C CA  . GLU B 2 97  ? 71.844 -1.908  -30.748 1.00 32.89 ? 98  GLU L CA  1 
ATOM   2270 C C   . GLU B 2 97  ? 70.950 -2.174  -29.553 1.00 31.32 ? 98  GLU L C   1 
ATOM   2271 O O   . GLU B 2 97  ? 70.208 -1.301  -29.099 1.00 31.97 ? 98  GLU L O   1 
ATOM   2272 C CB  . GLU B 2 97  ? 73.259 -1.784  -30.188 1.00 36.47 ? 98  GLU L CB  1 
ATOM   2273 C CG  . GLU B 2 97  ? 74.298 -1.235  -31.135 1.00 41.35 ? 98  GLU L CG  1 
ATOM   2274 C CD  . GLU B 2 97  ? 75.514 -0.733  -30.390 1.00 35.78 ? 98  GLU L CD  1 
ATOM   2275 O OE1 . GLU B 2 97  ? 76.509 -0.395  -31.055 1.00 39.56 ? 98  GLU L OE1 1 
ATOM   2276 O OE2 . GLU B 2 97  ? 75.468 -0.673  -29.139 1.00 36.36 ? 98  GLU L OE2 1 
ATOM   2277 N N   . LEU B 2 98  ? 71.053 -3.390  -29.028 1.00 30.86 ? 99  LEU L N   1 
ATOM   2278 C CA  . LEU B 2 98  ? 70.320 -3.765  -27.831 1.00 28.68 ? 99  LEU L CA  1 
ATOM   2279 C C   . LEU B 2 98  ? 71.204 -3.311  -26.666 1.00 27.36 ? 99  LEU L C   1 
ATOM   2280 O O   . LEU B 2 98  ? 72.423 -3.285  -26.785 1.00 31.45 ? 99  LEU L O   1 
ATOM   2281 C CB  . LEU B 2 98  ? 70.120 -5.277  -27.772 1.00 28.84 ? 99  LEU L CB  1 
ATOM   2282 C CG  . LEU B 2 98  ? 69.118 -5.878  -28.753 1.00 30.68 ? 99  LEU L CG  1 
ATOM   2283 C CD1 . LEU B 2 98  ? 69.162 -7.401  -28.678 1.00 29.53 ? 99  LEU L CD1 1 
ATOM   2284 C CD2 . LEU B 2 98  ? 67.731 -5.353  -28.429 1.00 28.56 ? 99  LEU L CD2 1 
ATOM   2285 N N   . PRO B 2 99  ? 70.599 -2.889  -25.550 1.00 26.60 ? 100 PRO L N   1 
ATOM   2286 C CA  . PRO B 2 99  ? 69.149 -2.823  -25.368 1.00 25.12 ? 100 PRO L CA  1 
ATOM   2287 C C   . PRO B 2 99  ? 68.639 -1.504  -25.945 1.00 24.57 ? 100 PRO L C   1 
ATOM   2288 O O   . PRO B 2 99  ? 69.388 -0.531  -26.050 1.00 21.09 ? 100 PRO L O   1 
ATOM   2289 C CB  . PRO B 2 99  ? 68.998 -2.864  -23.860 1.00 26.29 ? 100 PRO L CB  1 
ATOM   2290 C CG  . PRO B 2 99  ? 70.175 -2.037  -23.411 1.00 29.17 ? 100 PRO L CG  1 
ATOM   2291 C CD  . PRO B 2 99  ? 71.298 -2.566  -24.291 1.00 30.27 ? 100 PRO L CD  1 
ATOM   2292 N N   . PRO B 2 100 ? 67.362 -1.459  -26.332 1.00 23.94 ? 101 PRO L N   1 
ATOM   2293 C CA  . PRO B 2 100 ? 66.848 -0.206  -26.878 1.00 24.78 ? 101 PRO L CA  1 
ATOM   2294 C C   . PRO B 2 100 ? 66.825 0.827   -25.774 1.00 28.41 ? 101 PRO L C   1 
ATOM   2295 O O   . PRO B 2 100 ? 66.474 0.514   -24.638 1.00 28.23 ? 101 PRO L O   1 
ATOM   2296 C CB  . PRO B 2 100 ? 65.449 -0.584  -27.355 1.00 27.92 ? 101 PRO L CB  1 
ATOM   2297 C CG  . PRO B 2 100 ? 65.056 -1.679  -26.415 1.00 28.49 ? 101 PRO L CG  1 
ATOM   2298 C CD  . PRO B 2 100 ? 66.322 -2.500  -26.308 1.00 24.33 ? 101 PRO L CD  1 
ATOM   2299 N N   . THR B 2 101 ? 67.219 2.051   -26.097 1.00 26.48 ? 102 THR L N   1 
ATOM   2300 C CA  . THR B 2 101 ? 67.222 3.115   -25.113 1.00 21.45 ? 102 THR L CA  1 
ATOM   2301 C C   . THR B 2 101 ? 66.456 4.322   -25.653 1.00 25.18 ? 102 THR L C   1 
ATOM   2302 O O   . THR B 2 101 ? 66.331 4.507   -26.871 1.00 19.03 ? 102 THR L O   1 
ATOM   2303 C CB  . THR B 2 101 ? 68.647 3.517   -24.751 1.00 30.64 ? 102 THR L CB  1 
ATOM   2304 O OG1 . THR B 2 101 ? 69.405 3.685   -25.948 1.00 19.83 ? 102 THR L OG1 1 
ATOM   2305 C CG2 . THR B 2 101 ? 69.311 2.429   -23.877 1.00 28.80 ? 102 THR L CG2 1 
ATOM   2306 N N   . PHE B 2 102 ? 65.944 5.137   -24.739 1.00 21.93 ? 103 PHE L N   1 
ATOM   2307 C CA  . PHE B 2 102 ? 65.160 6.294   -25.115 1.00 20.75 ? 103 PHE L CA  1 
ATOM   2308 C C   . PHE B 2 102 ? 65.520 7.583   -24.383 1.00 25.31 ? 103 PHE L C   1 
ATOM   2309 O O   . PHE B 2 102 ? 65.998 7.570   -23.236 1.00 20.78 ? 103 PHE L O   1 
ATOM   2310 C CB  . PHE B 2 102 ? 63.684 5.997   -24.876 1.00 24.51 ? 103 PHE L CB  1 
ATOM   2311 C CG  . PHE B 2 102 ? 63.284 4.591   -25.226 1.00 27.90 ? 103 PHE L CG  1 
ATOM   2312 C CD1 . PHE B 2 102 ? 63.476 3.553   -24.318 1.00 26.51 ? 103 PHE L CD1 1 
ATOM   2313 C CD2 . PHE B 2 102 ? 62.756 4.297   -26.474 1.00 19.75 ? 103 PHE L CD2 1 
ATOM   2314 C CE1 . PHE B 2 102 ? 63.149 2.243   -24.653 1.00 25.11 ? 103 PHE L CE1 1 
ATOM   2315 C CE2 . PHE B 2 102 ? 62.425 2.994   -26.814 1.00 25.87 ? 103 PHE L CE2 1 
ATOM   2316 C CZ  . PHE B 2 102 ? 62.626 1.965   -25.902 1.00 24.78 ? 103 PHE L CZ  1 
ATOM   2317 N N   . GLY B 2 103 ? 65.267 8.701   -25.054 1.00 18.09 ? 104 GLY L N   1 
ATOM   2318 C CA  . GLY B 2 103 ? 65.527 10.001  -24.460 1.00 18.16 ? 104 GLY L CA  1 
ATOM   2319 C C   . GLY B 2 103 ? 64.444 10.267  -23.443 1.00 19.52 ? 104 GLY L C   1 
ATOM   2320 O O   . GLY B 2 103 ? 63.475 9.510   -23.343 1.00 17.14 ? 104 GLY L O   1 
ATOM   2321 N N   . ALA B 2 104 ? 64.592 11.325  -22.663 1.00 24.83 ? 105 ALA L N   1 
ATOM   2322 C CA  . ALA B 2 104 ? 63.592 11.617  -21.651 1.00 25.28 ? 105 ALA L CA  1 
ATOM   2323 C C   . ALA B 2 104 ? 62.453 12.463  -22.205 1.00 25.95 ? 105 ALA L C   1 
ATOM   2324 O O   . ALA B 2 104 ? 61.474 12.729  -21.500 1.00 19.15 ? 105 ALA L O   1 
ATOM   2325 C CB  . ALA B 2 104 ? 64.238 12.307  -20.464 1.00 37.94 ? 105 ALA L CB  1 
ATOM   2326 N N   . GLY B 2 105 ? 62.586 12.878  -23.465 1.00 24.04 ? 106 GLY L N   1 
ATOM   2327 C CA  . GLY B 2 105 ? 61.543 13.673  -24.104 1.00 24.50 ? 106 GLY L CA  1 
ATOM   2328 C C   . GLY B 2 105 ? 61.642 15.169  -23.883 1.00 23.83 ? 106 GLY L C   1 
ATOM   2329 O O   . GLY B 2 105 ? 61.993 15.626  -22.795 1.00 27.01 ? 106 GLY L O   1 
ATOM   2330 N N   . THR B 2 106 ? 61.351 15.944  -24.926 1.00 23.85 ? 107 THR L N   1 
ATOM   2331 C CA  . THR B 2 106 ? 61.386 17.399  -24.818 1.00 16.54 ? 107 THR L CA  1 
ATOM   2332 C C   . THR B 2 106 ? 59.994 17.948  -25.103 1.00 22.91 ? 107 THR L C   1 
ATOM   2333 O O   . THR B 2 106 ? 59.418 17.690  -26.152 1.00 19.12 ? 107 THR L O   1 
ATOM   2334 C CB  . THR B 2 106 ? 62.369 18.025  -25.818 1.00 18.76 ? 107 THR L CB  1 
ATOM   2335 O OG1 . THR B 2 106 ? 63.690 17.511  -25.600 1.00 15.07 ? 107 THR L OG1 1 
ATOM   2336 C CG2 . THR B 2 106 ? 62.382 19.549  -25.655 1.00 20.96 ? 107 THR L CG2 1 
ATOM   2337 N N   . LYS B 2 107 ? 59.448 18.704  -24.164 1.00 19.83 ? 108 LYS L N   1 
ATOM   2338 C CA  . LYS B 2 107 ? 58.132 19.281  -24.344 1.00 22.72 ? 108 LYS L CA  1 
ATOM   2339 C C   . LYS B 2 107 ? 58.254 20.554  -25.176 1.00 24.86 ? 108 LYS L C   1 
ATOM   2340 O O   . LYS B 2 107 ? 59.002 21.465  -24.817 1.00 23.16 ? 108 LYS L O   1 
ATOM   2341 C CB  . LYS B 2 107 ? 57.509 19.619  -22.985 1.00 30.45 ? 108 LYS L CB  1 
ATOM   2342 C CG  . LYS B 2 107 ? 56.305 20.550  -23.068 1.00 34.58 ? 108 LYS L CG  1 
ATOM   2343 C CD  . LYS B 2 107 ? 55.021 19.833  -22.688 1.00 44.06 ? 108 LYS L CD  1 
ATOM   2344 C CE  . LYS B 2 107 ? 55.101 19.280  -21.267 1.00 40.55 ? 108 LYS L CE  1 
ATOM   2345 N NZ  . LYS B 2 107 ? 53.895 18.485  -20.925 1.00 43.12 ? 108 LYS L NZ  1 
ATOM   2346 N N   . LEU B 2 108 ? 57.533 20.603  -26.295 1.00 23.98 ? 109 LEU L N   1 
ATOM   2347 C CA  . LEU B 2 108 ? 57.555 21.781  -27.165 1.00 20.59 ? 109 LEU L CA  1 
ATOM   2348 C C   . LEU B 2 108 ? 56.690 22.864  -26.542 1.00 17.63 ? 109 LEU L C   1 
ATOM   2349 O O   . LEU B 2 108 ? 55.486 22.671  -26.358 1.00 21.49 ? 109 LEU L O   1 
ATOM   2350 C CB  . LEU B 2 108 ? 57.016 21.427  -28.554 1.00 10.54 ? 109 LEU L CB  1 
ATOM   2351 C CG  . LEU B 2 108 ? 56.856 22.574  -29.549 1.00 18.96 ? 109 LEU L CG  1 
ATOM   2352 C CD1 . LEU B 2 108 ? 58.240 23.051  -29.974 1.00 16.30 ? 109 LEU L CD1 1 
ATOM   2353 C CD2 . LEU B 2 108 ? 56.042 22.105  -30.753 1.00 16.82 ? 109 LEU L CD2 1 
ATOM   2354 N N   . GLU B 2 109 ? 57.312 23.988  -26.203 1.00 23.15 ? 110 GLU L N   1 
ATOM   2355 C CA  . GLU B 2 109 ? 56.606 25.116  -25.598 1.00 30.34 ? 110 GLU L CA  1 
ATOM   2356 C C   . GLU B 2 109 ? 56.187 26.090  -26.690 1.00 27.51 ? 110 GLU L C   1 
ATOM   2357 O O   . GLU B 2 109 ? 57.016 26.549  -27.476 1.00 26.56 ? 110 GLU L O   1 
ATOM   2358 C CB  . GLU B 2 109 ? 57.518 25.850  -24.612 1.00 32.97 ? 110 GLU L CB  1 
ATOM   2359 C CG  . GLU B 2 109 ? 58.077 24.990  -23.484 1.00 44.79 ? 110 GLU L CG  1 
ATOM   2360 C CD  . GLU B 2 109 ? 57.064 24.703  -22.399 1.00 45.35 ? 110 GLU L CD  1 
ATOM   2361 O OE1 . GLU B 2 109 ? 57.420 24.009  -21.422 1.00 53.68 ? 110 GLU L OE1 1 
ATOM   2362 O OE2 . GLU B 2 109 ? 55.918 25.174  -22.512 1.00 49.62 ? 110 GLU L OE2 1 
ATOM   2363 N N   . LEU B 2 110 ? 54.899 26.399  -26.730 1.00 28.43 ? 111 LEU L N   1 
ATOM   2364 C CA  . LEU B 2 110 ? 54.353 27.311  -27.718 1.00 35.35 ? 111 LEU L CA  1 
ATOM   2365 C C   . LEU B 2 110 ? 54.047 28.638  -27.065 1.00 36.13 ? 111 LEU L C   1 
ATOM   2366 O O   . LEU B 2 110 ? 53.346 28.695  -26.057 1.00 37.80 ? 111 LEU L O   1 
ATOM   2367 C CB  . LEU B 2 110 ? 53.074 26.734  -28.322 1.00 41.25 ? 111 LEU L CB  1 
ATOM   2368 C CG  . LEU B 2 110 ? 53.234 25.548  -29.277 1.00 48.74 ? 111 LEU L CG  1 
ATOM   2369 C CD1 . LEU B 2 110 ? 53.823 26.046  -30.565 1.00 57.15 ? 111 LEU L CD1 1 
ATOM   2370 C CD2 . LEU B 2 110 ? 54.120 24.473  -28.673 1.00 51.29 ? 111 LEU L CD2 1 
ATOM   2371 N N   . LYS B 2 111 ? 54.570 29.708  -27.648 1.00 37.58 ? 112 LYS L N   1 
ATOM   2372 C CA  . LYS B 2 111 ? 54.355 31.039  -27.107 1.00 41.47 ? 112 LYS L CA  1 
ATOM   2373 C C   . LYS B 2 111 ? 53.187 31.725  -27.808 1.00 42.54 ? 112 LYS L C   1 
ATOM   2374 O O   . LYS B 2 111 ? 52.991 31.563  -29.011 1.00 41.28 ? 112 LYS L O   1 
ATOM   2375 C CB  . LYS B 2 111 ? 55.627 31.874  -27.255 1.00 37.30 ? 112 LYS L CB  1 
ATOM   2376 C CG  . LYS B 2 111 ? 55.607 33.151  -26.446 1.00 48.80 ? 112 LYS L CG  1 
ATOM   2377 C CD  . LYS B 2 111 ? 57.006 33.726  -26.274 1.00 52.99 ? 112 LYS L CD  1 
ATOM   2378 C CE  . LYS B 2 111 ? 57.018 34.831  -25.218 1.00 54.66 ? 112 LYS L CE  1 
ATOM   2379 N NZ  . LYS B 2 111 ? 58.401 35.313  -24.927 1.00 55.94 ? 112 LYS L NZ  1 
ATOM   2380 N N   . ARG B 2 112 ? 52.397 32.466  -27.039 1.00 39.53 ? 113 ARG L N   1 
ATOM   2381 C CA  . ARG B 2 112 ? 51.258 33.184  -27.584 1.00 38.79 ? 113 ARG L CA  1 
ATOM   2382 C C   . ARG B 2 112 ? 50.915 34.382  -26.716 1.00 41.84 ? 113 ARG L C   1 
ATOM   2383 O O   . ARG B 2 112 ? 51.586 34.647  -25.719 1.00 41.00 ? 113 ARG L O   1 
ATOM   2384 C CB  . ARG B 2 112 ? 50.041 32.268  -27.704 1.00 37.89 ? 113 ARG L CB  1 
ATOM   2385 C CG  . ARG B 2 112 ? 49.579 31.639  -26.406 1.00 42.70 ? 113 ARG L CG  1 
ATOM   2386 C CD  . ARG B 2 112 ? 48.106 31.298  -26.497 1.00 40.65 ? 113 ARG L CD  1 
ATOM   2387 N NE  . ARG B 2 112 ? 47.280 32.503  -26.449 1.00 38.47 ? 113 ARG L NE  1 
ATOM   2388 C CZ  . ARG B 2 112 ? 46.020 32.569  -26.868 1.00 40.45 ? 113 ARG L CZ  1 
ATOM   2389 N NH1 . ARG B 2 112 ? 45.426 31.501  -27.379 1.00 41.94 ? 113 ARG L NH1 1 
ATOM   2390 N NH2 . ARG B 2 112 ? 45.345 33.705  -26.769 1.00 44.24 ? 113 ARG L NH2 1 
ATOM   2391 N N   . ALA B 2 113 ? 49.874 35.107  -27.110 1.00 43.29 ? 114 ALA L N   1 
ATOM   2392 C CA  . ALA B 2 113 ? 49.435 36.292  -26.385 1.00 46.86 ? 114 ALA L CA  1 
ATOM   2393 C C   . ALA B 2 113 ? 48.796 35.942  -25.046 1.00 48.84 ? 114 ALA L C   1 
ATOM   2394 O O   . ALA B 2 113 ? 48.188 34.884  -24.892 1.00 51.50 ? 114 ALA L O   1 
ATOM   2395 C CB  . ALA B 2 113 ? 48.448 37.075  -27.236 1.00 42.23 ? 114 ALA L CB  1 
ATOM   2396 N N   . ASP B 2 114 ? 48.942 36.834  -24.075 1.00 52.83 ? 115 ASP L N   1 
ATOM   2397 C CA  . ASP B 2 114 ? 48.351 36.615  -22.766 1.00 53.33 ? 115 ASP L CA  1 
ATOM   2398 C C   . ASP B 2 114 ? 46.850 36.457  -22.958 1.00 54.55 ? 115 ASP L C   1 
ATOM   2399 O O   . ASP B 2 114 ? 46.272 37.031  -23.880 1.00 55.77 ? 115 ASP L O   1 
ATOM   2400 C CB  . ASP B 2 114 ? 48.631 37.806  -21.850 1.00 53.17 ? 115 ASP L CB  1 
ATOM   2401 C CG  . ASP B 2 114 ? 50.058 37.836  -21.359 1.00 54.99 ? 115 ASP L CG  1 
ATOM   2402 O OD1 . ASP B 2 114 ? 50.391 37.058  -20.444 1.00 58.46 ? 115 ASP L OD1 1 
ATOM   2403 O OD2 . ASP B 2 114 ? 50.854 38.633  -21.891 1.00 60.62 ? 115 ASP L OD2 1 
ATOM   2404 N N   . ALA B 2 115 ? 46.229 35.665  -22.092 1.00 54.02 ? 116 ALA L N   1 
ATOM   2405 C CA  . ALA B 2 115 ? 44.797 35.431  -22.156 1.00 51.12 ? 116 ALA L CA  1 
ATOM   2406 C C   . ALA B 2 115 ? 44.273 35.263  -20.736 1.00 52.25 ? 116 ALA L C   1 
ATOM   2407 O O   . ALA B 2 115 ? 44.970 34.728  -19.872 1.00 51.27 ? 116 ALA L O   1 
ATOM   2408 C CB  . ALA B 2 115 ? 44.506 34.181  -22.976 1.00 50.44 ? 116 ALA L CB  1 
ATOM   2409 N N   . ALA B 2 116 ? 43.050 35.727  -20.497 1.00 50.08 ? 117 ALA L N   1 
ATOM   2410 C CA  . ALA B 2 116 ? 42.440 35.621  -19.180 1.00 50.26 ? 117 ALA L CA  1 
ATOM   2411 C C   . ALA B 2 116 ? 41.677 34.310  -19.056 1.00 50.00 ? 117 ALA L C   1 
ATOM   2412 O O   . ALA B 2 116 ? 41.206 33.749  -20.047 1.00 47.04 ? 117 ALA L O   1 
ATOM   2413 C CB  . ALA B 2 116 ? 41.498 36.796  -18.939 1.00 52.29 ? 117 ALA L CB  1 
ATOM   2414 N N   . PRO B 2 117 ? 41.552 33.798  -17.827 1.00 50.97 ? 118 PRO L N   1 
ATOM   2415 C CA  . PRO B 2 117 ? 40.834 32.543  -17.616 1.00 52.46 ? 118 PRO L CA  1 
ATOM   2416 C C   . PRO B 2 117 ? 39.329 32.744  -17.592 1.00 53.04 ? 118 PRO L C   1 
ATOM   2417 O O   . PRO B 2 117 ? 38.822 33.617  -16.891 1.00 56.59 ? 118 PRO L O   1 
ATOM   2418 C CB  . PRO B 2 117 ? 41.369 32.071  -16.272 1.00 51.87 ? 118 PRO L CB  1 
ATOM   2419 C CG  . PRO B 2 117 ? 41.542 33.367  -15.536 1.00 54.18 ? 118 PRO L CG  1 
ATOM   2420 C CD  . PRO B 2 117 ? 42.192 34.256  -16.581 1.00 52.10 ? 118 PRO L CD  1 
ATOM   2421 N N   . THR B 2 118 ? 38.621 31.944  -18.376 1.00 55.33 ? 119 THR L N   1 
ATOM   2422 C CA  . THR B 2 118 ? 37.171 32.005  -18.412 1.00 54.73 ? 119 THR L CA  1 
ATOM   2423 C C   . THR B 2 118 ? 36.704 31.095  -17.269 1.00 56.32 ? 119 THR L C   1 
ATOM   2424 O O   . THR B 2 118 ? 36.639 29.875  -17.403 1.00 56.50 ? 119 THR L O   1 
ATOM   2425 C CB  . THR B 2 118 ? 36.630 31.523  -19.788 1.00 56.53 ? 119 THR L CB  1 
ATOM   2426 O OG1 . THR B 2 118 ? 35.199 31.563  -19.790 1.00 60.13 ? 119 THR L OG1 1 
ATOM   2427 C CG2 . THR B 2 118 ? 37.101 30.113  -20.093 1.00 58.98 ? 119 THR L CG2 1 
ATOM   2428 N N   . VAL B 2 119 ? 36.414 31.709  -16.128 1.00 56.99 ? 120 VAL L N   1 
ATOM   2429 C CA  . VAL B 2 119 ? 35.983 30.983  -14.942 1.00 59.14 ? 120 VAL L CA  1 
ATOM   2430 C C   . VAL B 2 119 ? 34.514 30.567  -14.948 1.00 61.13 ? 120 VAL L C   1 
ATOM   2431 O O   . VAL B 2 119 ? 33.645 31.300  -15.422 1.00 63.78 ? 120 VAL L O   1 
ATOM   2432 C CB  . VAL B 2 119 ? 36.247 31.815  -13.676 1.00 57.10 ? 120 VAL L CB  1 
ATOM   2433 C CG1 . VAL B 2 119 ? 35.975 30.978  -12.438 1.00 59.63 ? 120 VAL L CG1 1 
ATOM   2434 C CG2 . VAL B 2 119 ? 37.682 32.319  -13.683 1.00 57.49 ? 120 VAL L CG2 1 
ATOM   2435 N N   . SER B 2 120 ? 34.251 29.379  -14.412 1.00 60.13 ? 121 SER L N   1 
ATOM   2436 C CA  . SER B 2 120 ? 32.898 28.836  -14.326 1.00 57.36 ? 121 SER L CA  1 
ATOM   2437 C C   . SER B 2 120 ? 32.802 27.961  -13.084 1.00 58.28 ? 121 SER L C   1 
ATOM   2438 O O   . SER B 2 120 ? 33.474 26.937  -12.991 1.00 56.47 ? 121 SER L O   1 
ATOM   2439 C CB  . SER B 2 120 ? 32.577 27.995  -15.562 1.00 55.45 ? 121 SER L CB  1 
ATOM   2440 O OG  . SER B 2 120 ? 32.616 28.775  -16.739 1.00 43.78 ? 121 SER L OG  1 
ATOM   2441 N N   . ILE B 2 121 ? 31.969 28.367  -12.131 1.00 59.16 ? 122 ILE L N   1 
ATOM   2442 C CA  . ILE B 2 121 ? 31.803 27.611  -10.895 1.00 58.90 ? 122 ILE L CA  1 
ATOM   2443 C C   . ILE B 2 121 ? 30.487 26.837  -10.915 1.00 58.20 ? 122 ILE L C   1 
ATOM   2444 O O   . ILE B 2 121 ? 29.510 27.275  -11.523 1.00 58.48 ? 122 ILE L O   1 
ATOM   2445 C CB  . ILE B 2 121 ? 31.829 28.550  -9.663  1.00 60.33 ? 122 ILE L CB  1 
ATOM   2446 C CG1 . ILE B 2 121 ? 31.840 27.726  -8.374  1.00 62.48 ? 122 ILE L CG1 1 
ATOM   2447 C CG2 . ILE B 2 121 ? 30.621 29.477  -9.690  1.00 59.11 ? 122 ILE L CG2 1 
ATOM   2448 C CD1 . ILE B 2 121 ? 31.923 28.562  -7.113  1.00 63.08 ? 122 ILE L CD1 1 
ATOM   2449 N N   . PHE B 2 122 ? 30.473 25.679  -10.262 1.00 55.65 ? 123 PHE L N   1 
ATOM   2450 C CA  . PHE B 2 122 ? 29.279 24.845  -10.204 1.00 54.83 ? 123 PHE L CA  1 
ATOM   2451 C C   . PHE B 2 122 ? 29.077 24.300  -8.796  1.00 56.39 ? 123 PHE L C   1 
ATOM   2452 O O   . PHE B 2 122 ? 30.027 23.871  -8.139  1.00 57.36 ? 123 PHE L O   1 
ATOM   2453 C CB  . PHE B 2 122 ? 29.383 23.662  -11.172 1.00 51.08 ? 123 PHE L CB  1 
ATOM   2454 C CG  . PHE B 2 122 ? 29.667 24.053  -12.593 1.00 48.25 ? 123 PHE L CG  1 
ATOM   2455 C CD1 . PHE B 2 122 ? 30.922 24.523  -12.963 1.00 50.16 ? 123 PHE L CD1 1 
ATOM   2456 C CD2 . PHE B 2 122 ? 28.684 23.936  -13.568 1.00 50.96 ? 123 PHE L CD2 1 
ATOM   2457 C CE1 . PHE B 2 122 ? 31.194 24.868  -14.284 1.00 50.19 ? 123 PHE L CE1 1 
ATOM   2458 C CE2 . PHE B 2 122 ? 28.948 24.279  -14.892 1.00 48.71 ? 123 PHE L CE2 1 
ATOM   2459 C CZ  . PHE B 2 122 ? 30.205 24.745  -15.248 1.00 48.01 ? 123 PHE L CZ  1 
ATOM   2460 N N   . PRO B 2 123 ? 27.830 24.317  -8.308  1.00 56.58 ? 124 PRO L N   1 
ATOM   2461 C CA  . PRO B 2 123 ? 27.525 23.814  -6.968  1.00 55.12 ? 124 PRO L CA  1 
ATOM   2462 C C   . PRO B 2 123 ? 27.298 22.307  -7.008  1.00 53.61 ? 124 PRO L C   1 
ATOM   2463 O O   . PRO B 2 123 ? 27.072 21.734  -8.073  1.00 54.03 ? 124 PRO L O   1 
ATOM   2464 C CB  . PRO B 2 123 ? 26.259 24.574  -6.610  1.00 57.51 ? 124 PRO L CB  1 
ATOM   2465 C CG  . PRO B 2 123 ? 25.547 24.619  -7.928  1.00 60.76 ? 124 PRO L CG  1 
ATOM   2466 C CD  . PRO B 2 123 ? 26.657 24.991  -8.895  1.00 57.64 ? 124 PRO L CD  1 
ATOM   2467 N N   . PRO B 2 124 ? 27.369 21.643  -5.847  1.00 52.40 ? 125 PRO L N   1 
ATOM   2468 C CA  . PRO B 2 124 ? 27.157 20.197  -5.805  1.00 53.13 ? 125 PRO L CA  1 
ATOM   2469 C C   . PRO B 2 124 ? 25.884 19.820  -6.553  1.00 53.02 ? 125 PRO L C   1 
ATOM   2470 O O   . PRO B 2 124 ? 24.871 20.508  -6.448  1.00 51.08 ? 125 PRO L O   1 
ATOM   2471 C CB  . PRO B 2 124 ? 27.050 19.913  -4.312  1.00 55.00 ? 125 PRO L CB  1 
ATOM   2472 C CG  . PRO B 2 124 ? 27.995 20.913  -3.726  1.00 58.04 ? 125 PRO L CG  1 
ATOM   2473 C CD  . PRO B 2 124 ? 27.669 22.172  -4.504  1.00 53.09 ? 125 PRO L CD  1 
ATOM   2474 N N   . SER B 2 125 ? 25.940 18.733  -7.314  1.00 53.98 ? 126 SER L N   1 
ATOM   2475 C CA  . SER B 2 125 ? 24.780 18.276  -8.063  1.00 56.20 ? 126 SER L CA  1 
ATOM   2476 C C   . SER B 2 125 ? 23.790 17.653  -7.094  1.00 56.43 ? 126 SER L C   1 
ATOM   2477 O O   . SER B 2 125 ? 24.170 17.217  -6.008  1.00 55.34 ? 126 SER L O   1 
ATOM   2478 C CB  . SER B 2 125 ? 25.192 17.232  -9.099  1.00 59.65 ? 126 SER L CB  1 
ATOM   2479 O OG  . SER B 2 125 ? 25.669 16.057  -8.465  1.00 65.51 ? 126 SER L OG  1 
ATOM   2480 N N   . SER B 2 126 ? 22.522 17.612  -7.484  1.00 57.66 ? 127 SER L N   1 
ATOM   2481 C CA  . SER B 2 126 ? 21.496 17.021  -6.634  1.00 60.36 ? 127 SER L CA  1 
ATOM   2482 C C   . SER B 2 126 ? 21.849 15.556  -6.408  1.00 59.76 ? 127 SER L C   1 
ATOM   2483 O O   . SER B 2 126 ? 21.736 15.042  -5.291  1.00 56.87 ? 127 SER L O   1 
ATOM   2484 C CB  . SER B 2 126 ? 20.120 17.133  -7.299  1.00 62.53 ? 127 SER L CB  1 
ATOM   2485 O OG  . SER B 2 126 ? 20.121 16.523  -8.577  1.00 68.93 ? 127 SER L OG  1 
ATOM   2486 N N   . GLU B 2 127 ? 22.292 14.893  -7.474  1.00 59.67 ? 128 GLU L N   1 
ATOM   2487 C CA  . GLU B 2 127 ? 22.667 13.488  -7.399  1.00 60.28 ? 128 GLU L CA  1 
ATOM   2488 C C   . GLU B 2 127 ? 23.721 13.263  -6.327  1.00 59.64 ? 128 GLU L C   1 
ATOM   2489 O O   . GLU B 2 127 ? 23.511 12.481  -5.400  1.00 60.07 ? 128 GLU L O   1 
ATOM   2490 C CB  . GLU B 2 127 ? 23.196 12.993  -8.750  1.00 61.81 ? 128 GLU L CB  1 
ATOM   2491 C CG  . GLU B 2 127 ? 22.120 12.741  -9.801  1.00 67.74 ? 128 GLU L CG  1 
ATOM   2492 C CD  . GLU B 2 127 ? 21.782 13.968  -10.626 1.00 71.36 ? 128 GLU L CD  1 
ATOM   2493 O OE1 . GLU B 2 127 ? 21.524 15.037  -10.036 1.00 75.09 ? 128 GLU L OE1 1 
ATOM   2494 O OE2 . GLU B 2 127 ? 21.764 13.862  -11.872 1.00 73.05 ? 128 GLU L OE2 1 
ATOM   2495 N N   . GLN B 2 128 ? 24.854 13.949  -6.447  1.00 59.73 ? 129 GLN L N   1 
ATOM   2496 C CA  . GLN B 2 128 ? 25.924 13.800  -5.467  1.00 58.51 ? 129 GLN L CA  1 
ATOM   2497 C C   . GLN B 2 128 ? 25.419 14.076  -4.050  1.00 59.52 ? 129 GLN L C   1 
ATOM   2498 O O   . GLN B 2 128 ? 25.863 13.448  -3.087  1.00 59.24 ? 129 GLN L O   1 
ATOM   2499 C CB  . GLN B 2 128 ? 27.090 14.738  -5.791  1.00 54.00 ? 129 GLN L CB  1 
ATOM   2500 C CG  . GLN B 2 128 ? 28.137 14.784  -4.691  1.00 53.10 ? 129 GLN L CG  1 
ATOM   2501 C CD  . GLN B 2 128 ? 29.312 15.674  -5.022  1.00 48.44 ? 129 GLN L CD  1 
ATOM   2502 O OE1 . GLN B 2 128 ? 29.138 16.801  -5.472  1.00 46.60 ? 129 GLN L OE1 1 
ATOM   2503 N NE2 . GLN B 2 128 ? 30.522 15.172  -4.789  1.00 44.61 ? 129 GLN L NE2 1 
ATOM   2504 N N   . LEU B 2 129 ? 24.489 15.013  -3.923  1.00 60.60 ? 130 LEU L N   1 
ATOM   2505 C CA  . LEU B 2 129 ? 23.937 15.346  -2.618  1.00 62.58 ? 130 LEU L CA  1 
ATOM   2506 C C   . LEU B 2 129 ? 23.150 14.175  -2.038  1.00 64.57 ? 130 LEU L C   1 
ATOM   2507 O O   . LEU B 2 129 ? 23.285 13.851  -0.855  1.00 64.22 ? 130 LEU L O   1 
ATOM   2508 C CB  . LEU B 2 129 ? 23.041 16.578  -2.731  1.00 60.57 ? 130 LEU L CB  1 
ATOM   2509 C CG  . LEU B 2 129 ? 23.809 17.851  -3.078  1.00 59.67 ? 130 LEU L CG  1 
ATOM   2510 C CD1 . LEU B 2 129 ? 22.844 18.993  -3.345  1.00 59.24 ? 130 LEU L CD1 1 
ATOM   2511 C CD2 . LEU B 2 129 ? 24.753 18.182  -1.929  1.00 56.62 ? 130 LEU L CD2 1 
ATOM   2512 N N   . THR B 2 130 ? 22.335 13.538  -2.874  1.00 64.86 ? 131 THR L N   1 
ATOM   2513 C CA  . THR B 2 130 ? 21.531 12.406  -2.434  1.00 66.03 ? 131 THR L CA  1 
ATOM   2514 C C   . THR B 2 130 ? 22.425 11.257  -1.985  1.00 67.60 ? 131 THR L C   1 
ATOM   2515 O O   . THR B 2 130 ? 21.961 10.320  -1.337  1.00 70.06 ? 131 THR L O   1 
ATOM   2516 C CB  . THR B 2 130 ? 20.598 11.892  -3.554  1.00 67.06 ? 131 THR L CB  1 
ATOM   2517 O OG1 . THR B 2 130 ? 21.384 11.372  -4.633  1.00 70.26 ? 131 THR L OG1 1 
ATOM   2518 C CG2 . THR B 2 130 ? 19.711 13.017  -4.074  1.00 66.37 ? 131 THR L CG2 1 
ATOM   2519 N N   . SER B 2 131 ? 23.707 11.332  -2.330  1.00 67.00 ? 132 SER L N   1 
ATOM   2520 C CA  . SER B 2 131 ? 24.652 10.288  -1.947  1.00 68.44 ? 132 SER L CA  1 
ATOM   2521 C C   . SER B 2 131 ? 25.477 10.724  -0.742  1.00 67.09 ? 132 SER L C   1 
ATOM   2522 O O   . SER B 2 131 ? 26.398 10.023  -0.327  1.00 66.98 ? 132 SER L O   1 
ATOM   2523 C CB  . SER B 2 131 ? 25.585 9.949   -3.113  1.00 69.25 ? 132 SER L CB  1 
ATOM   2524 O OG  . SER B 2 131 ? 26.493 11.005  -3.368  1.00 71.06 ? 132 SER L OG  1 
ATOM   2525 N N   . GLY B 2 132 ? 25.147 11.890  -0.194  1.00 67.62 ? 133 GLY L N   1 
ATOM   2526 C CA  . GLY B 2 132 ? 25.858 12.390  0.970   1.00 66.77 ? 133 GLY L CA  1 
ATOM   2527 C C   . GLY B 2 132 ? 27.087 13.233  0.688   1.00 66.64 ? 133 GLY L C   1 
ATOM   2528 O O   . GLY B 2 132 ? 27.596 13.909  1.581   1.00 66.63 ? 133 GLY L O   1 
ATOM   2529 N N   . GLY B 2 133 ? 27.572 13.199  -0.547  1.00 65.21 ? 134 GLY L N   1 
ATOM   2530 C CA  . GLY B 2 133 ? 28.748 13.977  -0.891  1.00 63.88 ? 134 GLY L CA  1 
ATOM   2531 C C   . GLY B 2 133 ? 28.405 15.365  -1.387  1.00 63.98 ? 134 GLY L C   1 
ATOM   2532 O O   . GLY B 2 133 ? 27.291 15.612  -1.844  1.00 65.57 ? 134 GLY L O   1 
ATOM   2533 N N   . ALA B 2 134 ? 29.366 16.277  -1.300  1.00 63.50 ? 135 ALA L N   1 
ATOM   2534 C CA  . ALA B 2 134 ? 29.156 17.647  -1.746  1.00 63.35 ? 135 ALA L CA  1 
ATOM   2535 C C   . ALA B 2 134 ? 30.469 18.299  -2.170  1.00 62.10 ? 135 ALA L C   1 
ATOM   2536 O O   . ALA B 2 134 ? 31.223 18.800  -1.337  1.00 64.38 ? 135 ALA L O   1 
ATOM   2537 C CB  . ALA B 2 134 ? 28.501 18.462  -0.634  1.00 63.45 ? 135 ALA L CB  1 
ATOM   2538 N N   . SER B 2 135 ? 30.739 18.287  -3.469  1.00 58.31 ? 136 SER L N   1 
ATOM   2539 C CA  . SER B 2 135 ? 31.959 18.888  -3.991  1.00 58.07 ? 136 SER L CA  1 
ATOM   2540 C C   . SER B 2 135 ? 31.603 20.053  -4.898  1.00 54.97 ? 136 SER L C   1 
ATOM   2541 O O   . SER B 2 135 ? 30.695 19.948  -5.721  1.00 54.40 ? 136 SER L O   1 
ATOM   2542 C CB  . SER B 2 135 ? 32.763 17.859  -4.782  1.00 58.11 ? 136 SER L CB  1 
ATOM   2543 O OG  . SER B 2 135 ? 32.098 17.516  -5.980  1.00 56.45 ? 136 SER L OG  1 
ATOM   2544 N N   . VAL B 2 136 ? 32.308 21.169  -4.738  1.00 54.08 ? 137 VAL L N   1 
ATOM   2545 C CA  . VAL B 2 136 ? 32.051 22.340  -5.565  1.00 54.95 ? 137 VAL L CA  1 
ATOM   2546 C C   . VAL B 2 136 ? 33.178 22.452  -6.579  1.00 52.49 ? 137 VAL L C   1 
ATOM   2547 O O   . VAL B 2 136 ? 34.355 22.451  -6.218  1.00 51.61 ? 137 VAL L O   1 
ATOM   2548 C CB  . VAL B 2 136 ? 31.953 23.637  -4.713  1.00 55.41 ? 137 VAL L CB  1 
ATOM   2549 C CG1 . VAL B 2 136 ? 33.239 23.865  -3.957  1.00 57.36 ? 137 VAL L CG1 1 
ATOM   2550 C CG2 . VAL B 2 136 ? 31.638 24.825  -5.604  1.00 55.04 ? 137 VAL L CG2 1 
ATOM   2551 N N   . VAL B 2 137 ? 32.806 22.541  -7.850  1.00 51.82 ? 138 VAL L N   1 
ATOM   2552 C CA  . VAL B 2 137 ? 33.781 22.611  -8.932  1.00 53.30 ? 138 VAL L CA  1 
ATOM   2553 C C   . VAL B 2 137 ? 33.732 23.897  -9.740  1.00 52.39 ? 138 VAL L C   1 
ATOM   2554 O O   . VAL B 2 137 ? 32.662 24.432  -10.013 1.00 55.45 ? 138 VAL L O   1 
ATOM   2555 C CB  . VAL B 2 137 ? 33.583 21.444  -9.930  1.00 50.36 ? 138 VAL L CB  1 
ATOM   2556 C CG1 . VAL B 2 137 ? 34.620 21.527  -11.038 1.00 51.97 ? 138 VAL L CG1 1 
ATOM   2557 C CG2 . VAL B 2 137 ? 33.673 20.112  -9.206  1.00 53.51 ? 138 VAL L CG2 1 
ATOM   2558 N N   . CYS B 2 138 ? 34.902 24.389  -10.121 1.00 53.44 ? 139 CYS L N   1 
ATOM   2559 C CA  . CYS B 2 138 ? 34.980 25.580  -10.947 1.00 56.57 ? 139 CYS L CA  1 
ATOM   2560 C C   . CYS B 2 138 ? 36.188 25.514  -11.860 1.00 50.96 ? 139 CYS L C   1 
ATOM   2561 O O   . CYS B 2 138 ? 37.299 25.215  -11.434 1.00 49.27 ? 139 CYS L O   1 
ATOM   2562 C CB  . CYS B 2 138 ? 34.996 26.859  -10.101 1.00 63.00 ? 139 CYS L CB  1 
ATOM   2563 S SG  . CYS B 2 138 ? 36.323 27.046  -8.872  1.00 78.31 ? 139 CYS L SG  1 
ATOM   2564 N N   . PHE B 2 139 ? 35.944 25.773  -13.136 1.00 50.68 ? 140 PHE L N   1 
ATOM   2565 C CA  . PHE B 2 139 ? 36.990 25.739  -14.139 1.00 49.52 ? 140 PHE L CA  1 
ATOM   2566 C C   . PHE B 2 139 ? 37.578 27.119  -14.399 1.00 52.03 ? 140 PHE L C   1 
ATOM   2567 O O   . PHE B 2 139 ? 36.919 28.145  -14.203 1.00 50.91 ? 140 PHE L O   1 
ATOM   2568 C CB  . PHE B 2 139 ? 36.441 25.191  -15.458 1.00 44.07 ? 140 PHE L CB  1 
ATOM   2569 C CG  . PHE B 2 139 ? 35.748 23.866  -15.330 1.00 42.93 ? 140 PHE L CG  1 
ATOM   2570 C CD1 . PHE B 2 139 ? 36.422 22.759  -14.830 1.00 43.65 ? 140 PHE L CD1 1 
ATOM   2571 C CD2 . PHE B 2 139 ? 34.425 23.719  -15.730 1.00 44.50 ? 140 PHE L CD2 1 
ATOM   2572 C CE1 . PHE B 2 139 ? 35.785 21.520  -14.726 1.00 42.89 ? 140 PHE L CE1 1 
ATOM   2573 C CE2 . PHE B 2 139 ? 33.779 22.488  -15.631 1.00 44.16 ? 140 PHE L CE2 1 
ATOM   2574 C CZ  . PHE B 2 139 ? 34.462 21.386  -15.130 1.00 42.85 ? 140 PHE L CZ  1 
ATOM   2575 N N   . LEU B 2 140 ? 38.836 27.115  -14.829 1.00 50.96 ? 141 LEU L N   1 
ATOM   2576 C CA  . LEU B 2 140 ? 39.576 28.316  -15.198 1.00 50.76 ? 141 LEU L CA  1 
ATOM   2577 C C   . LEU B 2 140 ? 40.155 27.873  -16.531 1.00 49.05 ? 141 LEU L C   1 
ATOM   2578 O O   . LEU B 2 140 ? 41.265 27.347  -16.602 1.00 51.19 ? 141 LEU L O   1 
ATOM   2579 C CB  . LEU B 2 140 ? 40.691 28.610  -14.192 1.00 48.46 ? 141 LEU L CB  1 
ATOM   2580 C CG  . LEU B 2 140 ? 40.247 28.987  -12.778 1.00 50.02 ? 141 LEU L CG  1 
ATOM   2581 C CD1 . LEU B 2 140 ? 39.684 27.769  -12.064 1.00 51.73 ? 141 LEU L CD1 1 
ATOM   2582 C CD2 . LEU B 2 140 ? 41.430 29.542  -12.016 1.00 47.79 ? 141 LEU L CD2 1 
ATOM   2583 N N   . ASN B 2 141 ? 39.376 28.071  -17.586 1.00 49.62 ? 142 ASN L N   1 
ATOM   2584 C CA  . ASN B 2 141 ? 39.760 27.630  -18.916 1.00 49.57 ? 142 ASN L CA  1 
ATOM   2585 C C   . ASN B 2 141 ? 40.356 28.653  -19.869 1.00 50.16 ? 142 ASN L C   1 
ATOM   2586 O O   . ASN B 2 141 ? 40.070 29.849  -19.803 1.00 47.98 ? 142 ASN L O   1 
ATOM   2587 C CB  . ASN B 2 141 ? 38.552 26.972  -19.590 1.00 49.04 ? 142 ASN L CB  1 
ATOM   2588 C CG  . ASN B 2 141 ? 38.011 25.788  -18.802 1.00 49.04 ? 142 ASN L CG  1 
ATOM   2589 O OD1 . ASN B 2 141 ? 36.962 25.239  -19.138 1.00 48.12 ? 142 ASN L OD1 1 
ATOM   2590 N ND2 . ASN B 2 141 ? 38.730 25.385  -17.756 1.00 47.04 ? 142 ASN L ND2 1 
ATOM   2591 N N   . ASN B 2 142 ? 41.194 28.136  -20.762 1.00 51.04 ? 143 ASN L N   1 
ATOM   2592 C CA  . ASN B 2 142 ? 41.860 28.901  -21.805 1.00 46.75 ? 143 ASN L CA  1 
ATOM   2593 C C   . ASN B 2 142 ? 42.607 30.166  -21.391 1.00 46.22 ? 143 ASN L C   1 
ATOM   2594 O O   . ASN B 2 142 ? 42.337 31.255  -21.905 1.00 45.25 ? 143 ASN L O   1 
ATOM   2595 C CB  . ASN B 2 142 ? 40.847 29.222  -22.898 1.00 46.63 ? 143 ASN L CB  1 
ATOM   2596 C CG  . ASN B 2 142 ? 39.991 28.022  -23.249 1.00 48.95 ? 143 ASN L CG  1 
ATOM   2597 O OD1 . ASN B 2 142 ? 39.162 27.589  -22.451 1.00 49.48 ? 143 ASN L OD1 1 
ATOM   2598 N ND2 . ASN B 2 142 ? 40.197 27.468  -24.437 1.00 46.08 ? 143 ASN L ND2 1 
ATOM   2599 N N   . PHE B 2 143 ? 43.559 30.015  -20.477 1.00 41.22 ? 144 PHE L N   1 
ATOM   2600 C CA  . PHE B 2 143 ? 44.358 31.140  -20.034 1.00 40.99 ? 144 PHE L CA  1 
ATOM   2601 C C   . PHE B 2 143 ? 45.794 30.974  -20.512 1.00 40.94 ? 144 PHE L C   1 
ATOM   2602 O O   . PHE B 2 143 ? 46.162 29.925  -21.035 1.00 34.15 ? 144 PHE L O   1 
ATOM   2603 C CB  . PHE B 2 143 ? 44.333 31.277  -18.509 1.00 34.39 ? 144 PHE L CB  1 
ATOM   2604 C CG  . PHE B 2 143 ? 44.741 30.030  -17.764 1.00 35.83 ? 144 PHE L CG  1 
ATOM   2605 C CD1 . PHE B 2 143 ? 43.814 29.026  -17.495 1.00 26.83 ? 144 PHE L CD1 1 
ATOM   2606 C CD2 . PHE B 2 143 ? 46.038 29.884  -17.290 1.00 32.28 ? 144 PHE L CD2 1 
ATOM   2607 C CE1 . PHE B 2 143 ? 44.175 27.899  -16.761 1.00 27.16 ? 144 PHE L CE1 1 
ATOM   2608 C CE2 . PHE B 2 143 ? 46.406 28.761  -16.553 1.00 37.02 ? 144 PHE L CE2 1 
ATOM   2609 C CZ  . PHE B 2 143 ? 45.470 27.765  -16.288 1.00 28.17 ? 144 PHE L CZ  1 
ATOM   2610 N N   . TYR B 2 144 ? 46.594 32.023  -20.340 1.00 43.77 ? 145 TYR L N   1 
ATOM   2611 C CA  . TYR B 2 144 ? 47.996 32.007  -20.737 1.00 42.77 ? 145 TYR L CA  1 
ATOM   2612 C C   . TYR B 2 144 ? 48.728 33.171  -20.078 1.00 43.69 ? 145 TYR L C   1 
ATOM   2613 O O   . TYR B 2 144 ? 48.251 34.301  -20.110 1.00 42.07 ? 145 TYR L O   1 
ATOM   2614 C CB  . TYR B 2 144 ? 48.130 32.131  -22.257 1.00 42.88 ? 145 TYR L CB  1 
ATOM   2615 C CG  . TYR B 2 144 ? 49.551 31.944  -22.727 1.00 43.44 ? 145 TYR L CG  1 
ATOM   2616 C CD1 . TYR B 2 144 ? 50.014 30.692  -23.127 1.00 40.80 ? 145 TYR L CD1 1 
ATOM   2617 C CD2 . TYR B 2 144 ? 50.460 33.000  -22.692 1.00 45.09 ? 145 TYR L CD2 1 
ATOM   2618 C CE1 . TYR B 2 144 ? 51.348 30.495  -23.478 1.00 38.68 ? 145 TYR L CE1 1 
ATOM   2619 C CE2 . TYR B 2 144 ? 51.797 32.813  -23.037 1.00 44.10 ? 145 TYR L CE2 1 
ATOM   2620 C CZ  . TYR B 2 144 ? 52.232 31.560  -23.427 1.00 41.16 ? 145 TYR L CZ  1 
ATOM   2621 O OH  . TYR B 2 144 ? 53.552 31.374  -23.754 1.00 42.73 ? 145 TYR L OH  1 
ATOM   2622 N N   . PRO B 2 145 ? 49.912 32.919  -19.495 1.00 47.45 ? 146 PRO L N   1 
ATOM   2623 C CA  . PRO B 2 145 ? 50.648 31.652  -19.384 1.00 48.41 ? 146 PRO L CA  1 
ATOM   2624 C C   . PRO B 2 145 ? 50.006 30.677  -18.402 1.00 50.77 ? 146 PRO L C   1 
ATOM   2625 O O   . PRO B 2 145 ? 49.018 31.008  -17.749 1.00 51.15 ? 146 PRO L O   1 
ATOM   2626 C CB  . PRO B 2 145 ? 52.035 32.095  -18.912 1.00 48.61 ? 146 PRO L CB  1 
ATOM   2627 C CG  . PRO B 2 145 ? 52.121 33.525  -19.341 1.00 48.36 ? 146 PRO L CG  1 
ATOM   2628 C CD  . PRO B 2 145 ? 50.751 34.030  -19.022 1.00 48.16 ? 146 PRO L CD  1 
ATOM   2629 N N   . LYS B 2 146 ? 50.584 29.484  -18.284 1.00 54.53 ? 147 LYS L N   1 
ATOM   2630 C CA  . LYS B 2 146 ? 50.041 28.463  -17.397 1.00 58.74 ? 147 LYS L CA  1 
ATOM   2631 C C   . LYS B 2 146 ? 50.192 28.771  -15.912 1.00 57.80 ? 147 LYS L C   1 
ATOM   2632 O O   . LYS B 2 146 ? 49.832 27.954  -15.072 1.00 57.95 ? 147 LYS L O   1 
ATOM   2633 C CB  . LYS B 2 146 ? 50.666 27.093  -17.698 1.00 59.84 ? 147 LYS L CB  1 
ATOM   2634 C CG  . LYS B 2 146 ? 52.148 26.965  -17.391 1.00 65.78 ? 147 LYS L CG  1 
ATOM   2635 C CD  . LYS B 2 146 ? 53.002 27.661  -18.432 1.00 70.20 ? 147 LYS L CD  1 
ATOM   2636 C CE  . LYS B 2 146 ? 54.474 27.342  -18.232 1.00 70.54 ? 147 LYS L CE  1 
ATOM   2637 N NZ  . LYS B 2 146 ? 55.320 27.944  -19.300 1.00 72.57 ? 147 LYS L NZ  1 
ATOM   2638 N N   . ASP B 2 147 ? 50.715 29.947  -15.589 1.00 58.64 ? 148 ASP L N   1 
ATOM   2639 C CA  . ASP B 2 147 ? 50.894 30.332  -14.193 1.00 62.37 ? 148 ASP L CA  1 
ATOM   2640 C C   . ASP B 2 147 ? 49.631 30.981  -13.635 1.00 60.79 ? 148 ASP L C   1 
ATOM   2641 O O   . ASP B 2 147 ? 49.129 31.965  -14.183 1.00 55.77 ? 148 ASP L O   1 
ATOM   2642 C CB  . ASP B 2 147 ? 52.072 31.297  -14.059 1.00 67.64 ? 148 ASP L CB  1 
ATOM   2643 C CG  . ASP B 2 147 ? 53.366 30.708  -14.583 1.00 76.15 ? 148 ASP L CG  1 
ATOM   2644 O OD1 . ASP B 2 147 ? 53.828 29.691  -14.020 1.00 76.79 ? 148 ASP L OD1 1 
ATOM   2645 O OD2 . ASP B 2 147 ? 53.918 31.262  -15.563 1.00 79.19 ? 148 ASP L OD2 1 
ATOM   2646 N N   . ILE B 2 148 ? 49.131 30.421  -12.538 1.00 63.01 ? 149 ILE L N   1 
ATOM   2647 C CA  . ILE B 2 148 ? 47.927 30.917  -11.878 1.00 64.15 ? 149 ILE L CA  1 
ATOM   2648 C C   . ILE B 2 148 ? 47.882 30.274  -10.485 1.00 65.21 ? 149 ILE L C   1 
ATOM   2649 O O   . ILE B 2 148 ? 48.655 29.355  -10.215 1.00 65.30 ? 149 ILE L O   1 
ATOM   2650 C CB  . ILE B 2 148 ? 46.676 30.546  -12.708 1.00 63.84 ? 149 ILE L CB  1 
ATOM   2651 C CG1 . ILE B 2 148 ? 45.520 31.483  -12.365 1.00 66.22 ? 149 ILE L CG1 1 
ATOM   2652 C CG2 . ILE B 2 148 ? 46.290 29.101  -12.457 1.00 64.67 ? 149 ILE L CG2 1 
ATOM   2653 C CD1 . ILE B 2 148 ? 44.365 31.404  -13.349 1.00 64.62 ? 149 ILE L CD1 1 
ATOM   2654 N N   . ASN B 2 149 ? 46.999 30.736  -9.601  1.00 65.64 ? 150 ASN L N   1 
ATOM   2655 C CA  . ASN B 2 149 ? 46.948 30.165  -8.250  1.00 68.07 ? 150 ASN L CA  1 
ATOM   2656 C C   . ASN B 2 149 ? 45.635 29.522  -7.790  1.00 67.31 ? 150 ASN L C   1 
ATOM   2657 O O   . ASN B 2 149 ? 45.640 28.386  -7.313  1.00 65.73 ? 150 ASN L O   1 
ATOM   2658 C CB  . ASN B 2 149 ? 47.374 31.220  -7.224  1.00 70.50 ? 150 ASN L CB  1 
ATOM   2659 C CG  . ASN B 2 149 ? 46.488 32.447  -7.246  1.00 73.19 ? 150 ASN L CG  1 
ATOM   2660 O OD1 . ASN B 2 149 ? 46.351 33.106  -8.276  1.00 73.18 ? 150 ASN L OD1 1 
ATOM   2661 N ND2 . ASN B 2 149 ? 45.883 32.763  -6.104  1.00 70.50 ? 150 ASN L ND2 1 
ATOM   2662 N N   . VAL B 2 150 ? 44.528 30.252  -7.913  1.00 65.79 ? 151 VAL L N   1 
ATOM   2663 C CA  . VAL B 2 150 ? 43.206 29.768  -7.505  1.00 65.21 ? 151 VAL L CA  1 
ATOM   2664 C C   . VAL B 2 150 ? 43.030 29.773  -5.985  1.00 65.97 ? 151 VAL L C   1 
ATOM   2665 O O   . VAL B 2 150 ? 43.862 29.234  -5.255  1.00 65.42 ? 151 VAL L O   1 
ATOM   2666 C CB  . VAL B 2 150 ? 42.945 28.336  -8.013  1.00 65.17 ? 151 VAL L CB  1 
ATOM   2667 C CG1 . VAL B 2 150 ? 41.548 27.888  -7.623  1.00 63.33 ? 151 VAL L CG1 1 
ATOM   2668 C CG2 . VAL B 2 150 ? 43.120 28.286  -9.510  1.00 65.23 ? 151 VAL L CG2 1 
ATOM   2669 N N   . LYS B 2 151 ? 41.940 30.376  -5.515  1.00 65.82 ? 152 LYS L N   1 
ATOM   2670 C CA  . LYS B 2 151 ? 41.667 30.443  -4.081  1.00 66.54 ? 152 LYS L CA  1 
ATOM   2671 C C   . LYS B 2 151 ? 40.182 30.251  -3.780  1.00 66.00 ? 152 LYS L C   1 
ATOM   2672 O O   . LYS B 2 151 ? 39.324 30.791  -4.479  1.00 64.09 ? 152 LYS L O   1 
ATOM   2673 C CB  . LYS B 2 151 ? 42.142 31.787  -3.518  1.00 66.56 ? 152 LYS L CB  1 
ATOM   2674 C CG  . LYS B 2 151 ? 42.151 31.853  -2.000  1.00 69.07 ? 152 LYS L CG  1 
ATOM   2675 C CD  . LYS B 2 151 ? 42.765 33.153  -1.483  1.00 70.81 ? 152 LYS L CD  1 
ATOM   2676 C CE  . LYS B 2 151 ? 41.901 34.359  -1.810  1.00 71.49 ? 152 LYS L CE  1 
ATOM   2677 N NZ  . LYS B 2 151 ? 42.457 35.608  -1.223  1.00 68.65 ? 152 LYS L NZ  1 
ATOM   2678 N N   . TRP B 2 152 ? 39.887 29.476  -2.738  1.00 67.94 ? 153 TRP L N   1 
ATOM   2679 C CA  . TRP B 2 152 ? 38.507 29.209  -2.331  1.00 67.98 ? 153 TRP L CA  1 
ATOM   2680 C C   . TRP B 2 152 ? 38.104 29.960  -1.064  1.00 68.64 ? 153 TRP L C   1 
ATOM   2681 O O   . TRP B 2 152 ? 38.892 30.095  -0.128  1.00 67.19 ? 153 TRP L O   1 
ATOM   2682 C CB  . TRP B 2 152 ? 38.285 27.712  -2.089  1.00 65.26 ? 153 TRP L CB  1 
ATOM   2683 C CG  . TRP B 2 152 ? 38.202 26.879  -3.329  1.00 61.42 ? 153 TRP L CG  1 
ATOM   2684 C CD1 . TRP B 2 152 ? 39.220 26.199  -3.931  1.00 59.84 ? 153 TRP L CD1 1 
ATOM   2685 C CD2 . TRP B 2 152 ? 37.029 26.621  -4.110  1.00 59.22 ? 153 TRP L CD2 1 
ATOM   2686 N NE1 . TRP B 2 152 ? 38.753 25.530  -5.036  1.00 58.54 ? 153 TRP L NE1 1 
ATOM   2687 C CE2 . TRP B 2 152 ? 37.412 25.772  -5.171  1.00 57.03 ? 153 TRP L CE2 1 
ATOM   2688 C CE3 . TRP B 2 152 ? 35.691 27.026  -4.017  1.00 56.00 ? 153 TRP L CE3 1 
ATOM   2689 C CZ2 . TRP B 2 152 ? 36.505 25.318  -6.132  1.00 55.12 ? 153 TRP L CZ2 1 
ATOM   2690 C CZ3 . TRP B 2 152 ? 34.789 26.575  -4.973  1.00 57.35 ? 153 TRP L CZ3 1 
ATOM   2691 C CH2 . TRP B 2 152 ? 35.202 25.729  -6.017  1.00 54.84 ? 153 TRP L CH2 1 
ATOM   2692 N N   . LYS B 2 153 ? 36.864 30.435  -1.043  1.00 71.28 ? 154 LYS L N   1 
ATOM   2693 C CA  . LYS B 2 153 ? 36.328 31.160  0.104   1.00 73.94 ? 154 LYS L CA  1 
ATOM   2694 C C   . LYS B 2 153 ? 34.941 30.654  0.476   1.00 74.36 ? 154 LYS L C   1 
ATOM   2695 O O   . LYS B 2 153 ? 33.975 30.874  -0.252  1.00 73.94 ? 154 LYS L O   1 
ATOM   2696 C CB  . LYS B 2 153 ? 36.242 32.662  -0.187  1.00 73.20 ? 154 LYS L CB  1 
ATOM   2697 C CG  . LYS B 2 153 ? 37.569 33.397  -0.170  1.00 73.24 ? 154 LYS L CG  1 
ATOM   2698 C CD  . LYS B 2 153 ? 37.355 34.875  -0.438  1.00 69.71 ? 154 LYS L CD  1 
ATOM   2699 C CE  . LYS B 2 153 ? 38.661 35.644  -0.424  1.00 72.28 ? 154 LYS L CE  1 
ATOM   2700 N NZ  . LYS B 2 153 ? 38.439 37.084  -0.746  1.00 74.28 ? 154 LYS L NZ  1 
ATOM   2701 N N   . ILE B 2 154 ? 34.850 29.974  1.612   1.00 76.22 ? 155 ILE L N   1 
ATOM   2702 C CA  . ILE B 2 154 ? 33.577 29.456  2.091   1.00 77.29 ? 155 ILE L CA  1 
ATOM   2703 C C   . ILE B 2 154 ? 32.985 30.458  3.082   1.00 79.18 ? 155 ILE L C   1 
ATOM   2704 O O   . ILE B 2 154 ? 33.525 30.668  4.173   1.00 79.17 ? 155 ILE L O   1 
ATOM   2705 C CB  . ILE B 2 154 ? 33.764 28.086  2.769   1.00 78.45 ? 155 ILE L CB  1 
ATOM   2706 C CG1 . ILE B 2 154 ? 34.896 28.163  3.796   1.00 80.84 ? 155 ILE L CG1 1 
ATOM   2707 C CG2 . ILE B 2 154 ? 34.085 27.032  1.723   1.00 77.73 ? 155 ILE L CG2 1 
ATOM   2708 C CD1 . ILE B 2 154 ? 35.158 26.864  4.527   1.00 80.82 ? 155 ILE L CD1 1 
ATOM   2709 N N   . ASP B 2 155 ? 31.877 31.080  2.691   1.00 79.61 ? 156 ASP L N   1 
ATOM   2710 C CA  . ASP B 2 155 ? 31.222 32.078  3.528   1.00 80.44 ? 156 ASP L CA  1 
ATOM   2711 C C   . ASP B 2 155 ? 32.203 33.191  3.886   1.00 80.44 ? 156 ASP L C   1 
ATOM   2712 O O   . ASP B 2 155 ? 32.284 33.619  5.039   1.00 82.70 ? 156 ASP L O   1 
ATOM   2713 C CB  . ASP B 2 155 ? 30.670 31.434  4.805   1.00 81.01 ? 156 ASP L CB  1 
ATOM   2714 C CG  . ASP B 2 155 ? 29.384 30.665  4.562   1.00 83.84 ? 156 ASP L CG  1 
ATOM   2715 O OD1 . ASP B 2 155 ? 28.875 30.035  5.514   1.00 83.82 ? 156 ASP L OD1 1 
ATOM   2716 O OD2 . ASP B 2 155 ? 28.876 30.694  3.420   1.00 85.13 ? 156 ASP L OD2 1 
ATOM   2717 N N   . GLY B 2 156 ? 32.952 33.647  2.886   1.00 78.54 ? 157 GLY L N   1 
ATOM   2718 C CA  . GLY B 2 156 ? 33.913 34.713  3.101   1.00 76.31 ? 157 GLY L CA  1 
ATOM   2719 C C   . GLY B 2 156 ? 35.199 34.295  3.789   1.00 73.58 ? 157 GLY L C   1 
ATOM   2720 O O   . GLY B 2 156 ? 36.065 35.130  4.038   1.00 73.67 ? 157 GLY L O   1 
ATOM   2721 N N   . SER B 2 157 ? 35.333 33.011  4.100   1.00 73.52 ? 158 SER L N   1 
ATOM   2722 C CA  . SER B 2 157 ? 36.538 32.524  4.762   1.00 75.74 ? 158 SER L CA  1 
ATOM   2723 C C   . SER B 2 157 ? 37.431 31.755  3.795   1.00 77.15 ? 158 SER L C   1 
ATOM   2724 O O   . SER B 2 157 ? 36.957 31.191  2.812   1.00 78.12 ? 158 SER L O   1 
ATOM   2725 C CB  . SER B 2 157 ? 36.168 31.631  5.947   1.00 75.61 ? 158 SER L CB  1 
ATOM   2726 O OG  . SER B 2 157 ? 37.324 31.214  6.654   1.00 77.16 ? 158 SER L OG  1 
ATOM   2727 N N   . GLU B 2 158 ? 38.728 31.735  4.083   1.00 78.99 ? 159 GLU L N   1 
ATOM   2728 C CA  . GLU B 2 158 ? 39.694 31.048  3.234   1.00 80.84 ? 159 GLU L CA  1 
ATOM   2729 C C   . GLU B 2 158 ? 39.767 29.553  3.527   1.00 80.18 ? 159 GLU L C   1 
ATOM   2730 O O   . GLU B 2 158 ? 40.194 29.140  4.607   1.00 81.14 ? 159 GLU L O   1 
ATOM   2731 C CB  . GLU B 2 158 ? 41.082 31.676  3.412   1.00 83.37 ? 159 GLU L CB  1 
ATOM   2732 C CG  . GLU B 2 158 ? 41.117 33.178  3.148   1.00 87.90 ? 159 GLU L CG  1 
ATOM   2733 C CD  . GLU B 2 158 ? 42.496 33.787  3.344   1.00 89.34 ? 159 GLU L CD  1 
ATOM   2734 O OE1 . GLU B 2 158 ? 42.639 35.011  3.134   1.00 89.17 ? 159 GLU L OE1 1 
ATOM   2735 O OE2 . GLU B 2 158 ? 43.434 33.046  3.706   1.00 90.62 ? 159 GLU L OE2 1 
ATOM   2736 N N   . ARG B 2 159 ? 39.348 28.747  2.556   1.00 79.02 ? 160 ARG L N   1 
ATOM   2737 C CA  . ARG B 2 159 ? 39.372 27.294  2.691   1.00 78.04 ? 160 ARG L CA  1 
ATOM   2738 C C   . ARG B 2 159 ? 40.256 26.677  1.611   1.00 76.35 ? 160 ARG L C   1 
ATOM   2739 O O   . ARG B 2 159 ? 39.970 26.791  0.419   1.00 75.68 ? 160 ARG L O   1 
ATOM   2740 C CB  . ARG B 2 159 ? 37.951 26.726  2.585   1.00 78.86 ? 160 ARG L CB  1 
ATOM   2741 C CG  . ARG B 2 159 ? 37.894 25.214  2.400   1.00 79.64 ? 160 ARG L CG  1 
ATOM   2742 C CD  . ARG B 2 159 ? 38.560 24.471  3.551   1.00 83.57 ? 160 ARG L CD  1 
ATOM   2743 N NE  . ARG B 2 159 ? 37.747 24.479  4.765   1.00 86.97 ? 160 ARG L NE  1 
ATOM   2744 C CZ  . ARG B 2 159 ? 36.558 23.892  4.871   1.00 86.45 ? 160 ARG L CZ  1 
ATOM   2745 N NH1 . ARG B 2 159 ? 36.039 23.247  3.835   1.00 86.63 ? 160 ARG L NH1 1 
ATOM   2746 N NH2 . ARG B 2 159 ? 35.889 23.951  6.014   1.00 87.60 ? 160 ARG L NH2 1 
ATOM   2747 N N   . GLN B 2 160 ? 41.334 26.027  2.034   1.00 75.40 ? 161 GLN L N   1 
ATOM   2748 C CA  . GLN B 2 160 ? 42.253 25.391  1.098   1.00 77.84 ? 161 GLN L CA  1 
ATOM   2749 C C   . GLN B 2 160 ? 42.438 23.933  1.486   1.00 77.62 ? 161 GLN L C   1 
ATOM   2750 O O   . GLN B 2 160 ? 43.228 23.208  0.880   1.00 78.49 ? 161 GLN L O   1 
ATOM   2751 C CB  . GLN B 2 160 ? 43.610 26.097  1.120   1.00 79.49 ? 161 GLN L CB  1 
ATOM   2752 C CG  . GLN B 2 160 ? 44.344 25.983  2.449   1.00 82.20 ? 161 GLN L CG  1 
ATOM   2753 C CD  . GLN B 2 160 ? 45.713 26.636  2.419   1.00 84.12 ? 161 GLN L CD  1 
ATOM   2754 O OE1 . GLN B 2 160 ? 45.835 27.834  2.160   1.00 86.12 ? 161 GLN L OE1 1 
ATOM   2755 N NE2 . GLN B 2 160 ? 46.751 25.850  2.686   1.00 83.28 ? 161 GLN L NE2 1 
ATOM   2756 N N   . ASN B 2 161 ? 41.696 23.510  2.502   1.00 76.41 ? 162 ASN L N   1 
ATOM   2757 C CA  . ASN B 2 161 ? 41.781 22.146  2.992   1.00 75.99 ? 162 ASN L CA  1 
ATOM   2758 C C   . ASN B 2 161 ? 41.476 21.090  1.938   1.00 74.24 ? 162 ASN L C   1 
ATOM   2759 O O   . ASN B 2 161 ? 42.390 20.523  1.340   1.00 76.22 ? 162 ASN L O   1 
ATOM   2760 C CB  . ASN B 2 161 ? 40.847 21.963  4.187   1.00 77.87 ? 162 ASN L CB  1 
ATOM   2761 C CG  . ASN B 2 161 ? 40.766 20.524  4.640   1.00 79.74 ? 162 ASN L CG  1 
ATOM   2762 O OD1 . ASN B 2 161 ? 41.785 19.891  4.926   1.00 80.47 ? 162 ASN L OD1 1 
ATOM   2763 N ND2 . ASN B 2 161 ? 39.550 19.994  4.706   1.00 82.53 ? 162 ASN L ND2 1 
ATOM   2764 N N   . GLY B 2 162 ? 40.194 20.828  1.710   1.00 70.92 ? 163 GLY L N   1 
ATOM   2765 C CA  . GLY B 2 162 ? 39.812 19.815  0.744   1.00 70.16 ? 163 GLY L CA  1 
ATOM   2766 C C   . GLY B 2 162 ? 39.763 20.258  -0.706  1.00 70.29 ? 163 GLY L C   1 
ATOM   2767 O O   . GLY B 2 162 ? 38.822 19.911  -1.429  1.00 69.76 ? 163 GLY L O   1 
ATOM   2768 N N   . VAL B 2 163 ? 40.768 21.014  -1.142  1.00 67.50 ? 164 VAL L N   1 
ATOM   2769 C CA  . VAL B 2 163 ? 40.812 21.488  -2.523  1.00 65.15 ? 164 VAL L CA  1 
ATOM   2770 C C   . VAL B 2 163 ? 41.805 20.709  -3.382  1.00 60.78 ? 164 VAL L C   1 
ATOM   2771 O O   . VAL B 2 163 ? 42.955 20.510  -2.997  1.00 60.56 ? 164 VAL L O   1 
ATOM   2772 C CB  . VAL B 2 163 ? 41.179 22.990  -2.594  1.00 65.41 ? 164 VAL L CB  1 
ATOM   2773 C CG1 . VAL B 2 163 ? 42.544 23.229  -1.968  1.00 65.94 ? 164 VAL L CG1 1 
ATOM   2774 C CG2 . VAL B 2 163 ? 41.169 23.457  -4.044  1.00 63.89 ? 164 VAL L CG2 1 
ATOM   2775 N N   . LEU B 2 164 ? 41.342 20.260  -4.545  1.00 56.00 ? 165 LEU L N   1 
ATOM   2776 C CA  . LEU B 2 164 ? 42.189 19.525  -5.474  1.00 55.03 ? 165 LEU L CA  1 
ATOM   2777 C C   . LEU B 2 164 ? 42.192 20.207  -6.842  1.00 53.42 ? 165 LEU L C   1 
ATOM   2778 O O   . LEU B 2 164 ? 41.140 20.535  -7.394  1.00 53.40 ? 165 LEU L O   1 
ATOM   2779 C CB  . LEU B 2 164 ? 41.720 18.074  -5.605  1.00 57.56 ? 165 LEU L CB  1 
ATOM   2780 C CG  . LEU B 2 164 ? 41.984 17.178  -4.392  1.00 62.30 ? 165 LEU L CG  1 
ATOM   2781 C CD1 . LEU B 2 164 ? 41.078 17.585  -3.239  1.00 66.17 ? 165 LEU L CD1 1 
ATOM   2782 C CD2 . LEU B 2 164 ? 41.730 15.728  -4.766  1.00 63.33 ? 165 LEU L CD2 1 
ATOM   2783 N N   . ASN B 2 165 ? 43.387 20.417  -7.382  1.00 50.04 ? 166 ASN L N   1 
ATOM   2784 C CA  . ASN B 2 165 ? 43.542 21.083  -8.665  1.00 47.41 ? 166 ASN L CA  1 
ATOM   2785 C C   . ASN B 2 165 ? 44.170 20.176  -9.716  1.00 44.04 ? 166 ASN L C   1 
ATOM   2786 O O   . ASN B 2 165 ? 45.032 19.355  -9.411  1.00 42.60 ? 166 ASN L O   1 
ATOM   2787 C CB  . ASN B 2 165 ? 44.394 22.336  -8.480  1.00 47.09 ? 166 ASN L CB  1 
ATOM   2788 C CG  . ASN B 2 165 ? 43.772 23.322  -7.512  1.00 47.66 ? 166 ASN L CG  1 
ATOM   2789 O OD1 . ASN B 2 165 ? 44.474 24.101  -6.873  1.00 48.82 ? 166 ASN L OD1 1 
ATOM   2790 N ND2 . ASN B 2 165 ? 42.448 23.302  -7.409  1.00 45.39 ? 166 ASN L ND2 1 
ATOM   2791 N N   . SER B 2 166 ? 43.720 20.331  -10.956 1.00 41.51 ? 167 SER L N   1 
ATOM   2792 C CA  . SER B 2 166 ? 44.223 19.535  -12.070 1.00 37.57 ? 167 SER L CA  1 
ATOM   2793 C C   . SER B 2 166 ? 44.406 20.423  -13.300 1.00 34.80 ? 167 SER L C   1 
ATOM   2794 O O   . SER B 2 166 ? 43.486 21.131  -13.715 1.00 34.40 ? 167 SER L O   1 
ATOM   2795 C CB  . SER B 2 166 ? 43.253 18.393  -12.376 1.00 32.73 ? 167 SER L CB  1 
ATOM   2796 O OG  . SER B 2 166 ? 43.696 17.630  -13.481 1.00 37.17 ? 167 SER L OG  1 
ATOM   2797 N N   . TRP B 2 167 ? 45.603 20.376  -13.870 1.00 33.98 ? 168 TRP L N   1 
ATOM   2798 C CA  . TRP B 2 167 ? 45.952 21.178  -15.035 1.00 38.09 ? 168 TRP L CA  1 
ATOM   2799 C C   . TRP B 2 167 ? 46.102 20.328  -16.293 1.00 38.14 ? 168 TRP L C   1 
ATOM   2800 O O   . TRP B 2 167 ? 46.558 19.186  -16.230 1.00 40.34 ? 168 TRP L O   1 
ATOM   2801 C CB  . TRP B 2 167 ? 47.268 21.912  -14.781 1.00 38.31 ? 168 TRP L CB  1 
ATOM   2802 C CG  . TRP B 2 167 ? 47.231 22.870  -13.622 1.00 47.92 ? 168 TRP L CG  1 
ATOM   2803 C CD1 . TRP B 2 167 ? 46.993 24.213  -13.676 1.00 49.92 ? 168 TRP L CD1 1 
ATOM   2804 C CD2 . TRP B 2 167 ? 47.438 22.554  -12.238 1.00 51.57 ? 168 TRP L CD2 1 
ATOM   2805 N NE1 . TRP B 2 167 ? 47.041 24.756  -12.412 1.00 52.97 ? 168 TRP L NE1 1 
ATOM   2806 C CE2 . TRP B 2 167 ? 47.312 23.760  -11.511 1.00 51.78 ? 168 TRP L CE2 1 
ATOM   2807 C CE3 . TRP B 2 167 ? 47.719 21.369  -11.541 1.00 55.22 ? 168 TRP L CE3 1 
ATOM   2808 C CZ2 . TRP B 2 167 ? 47.459 23.817  -10.119 1.00 52.61 ? 168 TRP L CZ2 1 
ATOM   2809 C CZ3 . TRP B 2 167 ? 47.866 21.426  -10.154 1.00 54.14 ? 168 TRP L CZ3 1 
ATOM   2810 C CH2 . TRP B 2 167 ? 47.735 22.644  -9.460  1.00 55.88 ? 168 TRP L CH2 1 
ATOM   2811 N N   . THR B 2 168 ? 45.720 20.895  -17.433 1.00 36.29 ? 169 THR L N   1 
ATOM   2812 C CA  . THR B 2 168 ? 45.841 20.197  -18.711 1.00 36.38 ? 169 THR L CA  1 
ATOM   2813 C C   . THR B 2 168 ? 47.138 20.623  -19.379 1.00 33.90 ? 169 THR L C   1 
ATOM   2814 O O   . THR B 2 168 ? 47.789 21.576  -18.944 1.00 30.68 ? 169 THR L O   1 
ATOM   2815 C CB  . THR B 2 168 ? 44.695 20.560  -19.672 1.00 37.18 ? 169 THR L CB  1 
ATOM   2816 O OG1 . THR B 2 168 ? 44.681 21.980  -19.876 1.00 40.51 ? 169 THR L OG1 1 
ATOM   2817 C CG2 . THR B 2 168 ? 43.361 20.111  -19.112 1.00 38.80 ? 169 THR L CG2 1 
ATOM   2818 N N   . ASP B 2 169 ? 47.524 19.909  -20.431 1.00 34.29 ? 170 ASP L N   1 
ATOM   2819 C CA  . ASP B 2 169 ? 48.726 20.272  -21.167 1.00 34.88 ? 170 ASP L CA  1 
ATOM   2820 C C   . ASP B 2 169 ? 48.310 21.419  -22.075 1.00 32.58 ? 170 ASP L C   1 
ATOM   2821 O O   . ASP B 2 169 ? 47.127 21.726  -22.173 1.00 30.03 ? 170 ASP L O   1 
ATOM   2822 C CB  . ASP B 2 169 ? 49.251 19.092  -21.990 1.00 35.62 ? 170 ASP L CB  1 
ATOM   2823 C CG  . ASP B 2 169 ? 49.918 18.033  -21.122 1.00 45.56 ? 170 ASP L CG  1 
ATOM   2824 O OD1 . ASP B 2 169 ? 50.698 18.411  -20.224 1.00 42.05 ? 170 ASP L OD1 1 
ATOM   2825 O OD2 . ASP B 2 169 ? 49.669 16.828  -21.337 1.00 50.56 ? 170 ASP L OD2 1 
ATOM   2826 N N   . GLN B 2 170 ? 49.272 22.058  -22.728 1.00 31.88 ? 171 GLN L N   1 
ATOM   2827 C CA  . GLN B 2 170 ? 48.966 23.170  -23.614 1.00 33.50 ? 171 GLN L CA  1 
ATOM   2828 C C   . GLN B 2 170 ? 48.062 22.696  -24.753 1.00 33.17 ? 171 GLN L C   1 
ATOM   2829 O O   . GLN B 2 170 ? 48.369 21.722  -25.428 1.00 28.57 ? 171 GLN L O   1 
ATOM   2830 C CB  . GLN B 2 170 ? 50.261 23.772  -24.167 1.00 27.24 ? 171 GLN L CB  1 
ATOM   2831 C CG  . GLN B 2 170 ? 50.079 25.160  -24.725 1.00 30.66 ? 171 GLN L CG  1 
ATOM   2832 C CD  . GLN B 2 170 ? 51.387 25.860  -25.007 1.00 28.82 ? 171 GLN L CD  1 
ATOM   2833 O OE1 . GLN B 2 170 ? 51.415 27.071  -25.214 1.00 28.64 ? 171 GLN L OE1 1 
ATOM   2834 N NE2 . GLN B 2 170 ? 52.481 25.101  -25.023 1.00 26.35 ? 171 GLN L NE2 1 
ATOM   2835 N N   . ASP B 2 171 ? 46.943 23.395  -24.940 1.00 35.45 ? 172 ASP L N   1 
ATOM   2836 C CA  . ASP B 2 171 ? 45.960 23.068  -25.969 1.00 39.48 ? 172 ASP L CA  1 
ATOM   2837 C C   . ASP B 2 171 ? 46.558 22.988  -27.370 1.00 38.13 ? 172 ASP L C   1 
ATOM   2838 O O   . ASP B 2 171 ? 47.243 23.906  -27.814 1.00 36.99 ? 172 ASP L O   1 
ATOM   2839 C CB  . ASP B 2 171 ? 44.828 24.102  -25.944 1.00 44.94 ? 172 ASP L CB  1 
ATOM   2840 C CG  . ASP B 2 171 ? 43.723 23.788  -26.940 1.00 50.13 ? 172 ASP L CG  1 
ATOM   2841 O OD1 . ASP B 2 171 ? 42.709 24.513  -26.944 1.00 54.58 ? 172 ASP L OD1 1 
ATOM   2842 O OD2 . ASP B 2 171 ? 43.866 22.818  -27.717 1.00 57.31 ? 172 ASP L OD2 1 
ATOM   2843 N N   . SER B 2 172 ? 46.262 21.892  -28.066 1.00 41.54 ? 173 SER L N   1 
ATOM   2844 C CA  . SER B 2 172 ? 46.772 21.638  -29.412 1.00 47.38 ? 173 SER L CA  1 
ATOM   2845 C C   . SER B 2 172 ? 46.143 22.483  -30.516 1.00 47.94 ? 173 SER L C   1 
ATOM   2846 O O   . SER B 2 172 ? 46.446 22.298  -31.693 1.00 48.72 ? 173 SER L O   1 
ATOM   2847 C CB  . SER B 2 172 ? 46.596 20.159  -29.760 1.00 51.58 ? 173 SER L CB  1 
ATOM   2848 O OG  . SER B 2 172 ? 47.355 19.330  -28.891 1.00 63.71 ? 173 SER L OG  1 
ATOM   2849 N N   . LYS B 2 173 ? 45.263 23.400  -30.146 1.00 48.47 ? 174 LYS L N   1 
ATOM   2850 C CA  . LYS B 2 173 ? 44.619 24.255  -31.131 1.00 52.23 ? 174 LYS L CA  1 
ATOM   2851 C C   . LYS B 2 173 ? 44.554 25.698  -30.660 1.00 50.21 ? 174 LYS L C   1 
ATOM   2852 O O   . LYS B 2 173 ? 44.545 26.625  -31.465 1.00 53.58 ? 174 LYS L O   1 
ATOM   2853 C CB  . LYS B 2 173 ? 43.206 23.748  -31.422 1.00 57.28 ? 174 LYS L CB  1 
ATOM   2854 C CG  . LYS B 2 173 ? 43.163 22.390  -32.111 1.00 67.71 ? 174 LYS L CG  1 
ATOM   2855 C CD  . LYS B 2 173 ? 43.911 22.410  -33.448 1.00 72.89 ? 174 LYS L CD  1 
ATOM   2856 C CE  . LYS B 2 173 ? 43.818 21.063  -34.160 1.00 75.69 ? 174 LYS L CE  1 
ATOM   2857 N NZ  . LYS B 2 173 ? 44.374 19.947  -33.337 1.00 75.70 ? 174 LYS L NZ  1 
ATOM   2858 N N   . ASP B 2 174 ? 44.530 25.878  -29.347 1.00 47.70 ? 175 ASP L N   1 
ATOM   2859 C CA  . ASP B 2 174 ? 44.442 27.202  -28.755 1.00 46.14 ? 175 ASP L CA  1 
ATOM   2860 C C   . ASP B 2 174 ? 45.779 27.643  -28.156 1.00 42.32 ? 175 ASP L C   1 
ATOM   2861 O O   . ASP B 2 174 ? 46.031 28.840  -27.972 1.00 38.46 ? 175 ASP L O   1 
ATOM   2862 C CB  . ASP B 2 174 ? 43.357 27.179  -27.674 1.00 50.47 ? 175 ASP L CB  1 
ATOM   2863 C CG  . ASP B 2 174 ? 42.856 28.557  -27.315 1.00 56.08 ? 175 ASP L CG  1 
ATOM   2864 O OD1 . ASP B 2 174 ? 42.719 29.400  -28.225 1.00 62.17 ? 175 ASP L OD1 1 
ATOM   2865 O OD2 . ASP B 2 174 ? 42.573 28.791  -26.122 1.00 59.82 ? 175 ASP L OD2 1 
ATOM   2866 N N   . SER B 2 175 ? 46.634 26.670  -27.858 1.00 35.03 ? 176 SER L N   1 
ATOM   2867 C CA  . SER B 2 175 ? 47.934 26.945  -27.261 1.00 35.87 ? 176 SER L CA  1 
ATOM   2868 C C   . SER B 2 175 ? 47.758 27.524  -25.857 1.00 34.49 ? 176 SER L C   1 
ATOM   2869 O O   . SER B 2 175 ? 48.708 28.030  -25.265 1.00 35.81 ? 176 SER L O   1 
ATOM   2870 C CB  . SER B 2 175 ? 48.742 27.927  -28.125 1.00 35.86 ? 176 SER L CB  1 
ATOM   2871 O OG  . SER B 2 175 ? 49.108 27.355  -29.373 1.00 37.97 ? 176 SER L OG  1 
ATOM   2872 N N   . THR B 2 176 ? 46.539 27.464  -25.329 1.00 33.33 ? 177 THR L N   1 
ATOM   2873 C CA  . THR B 2 176 ? 46.281 27.975  -23.987 1.00 34.78 ? 177 THR L CA  1 
ATOM   2874 C C   . THR B 2 176 ? 46.320 26.840  -22.975 1.00 36.15 ? 177 THR L C   1 
ATOM   2875 O O   . THR B 2 176 ? 46.566 25.681  -23.320 1.00 35.41 ? 177 THR L O   1 
ATOM   2876 C CB  . THR B 2 176 ? 44.895 28.651  -23.869 1.00 37.50 ? 177 THR L CB  1 
ATOM   2877 O OG1 . THR B 2 176 ? 43.873 27.698  -24.181 1.00 43.02 ? 177 THR L OG1 1 
ATOM   2878 C CG2 . THR B 2 176 ? 44.787 29.840  -24.815 1.00 36.96 ? 177 THR L CG2 1 
ATOM   2879 N N   . TYR B 2 177 ? 46.065 27.190  -21.722 1.00 39.02 ? 178 TYR L N   1 
ATOM   2880 C CA  . TYR B 2 177 ? 46.055 26.230  -20.629 1.00 38.65 ? 178 TYR L CA  1 
ATOM   2881 C C   . TYR B 2 177 ? 44.724 26.281  -19.890 1.00 42.18 ? 178 TYR L C   1 
ATOM   2882 O O   . TYR B 2 177 ? 44.044 27.308  -19.875 1.00 42.69 ? 178 TYR L O   1 
ATOM   2883 C CB  . TYR B 2 177 ? 47.196 26.537  -19.662 1.00 37.67 ? 178 TYR L CB  1 
ATOM   2884 C CG  . TYR B 2 177 ? 48.564 26.321  -20.272 1.00 36.63 ? 178 TYR L CG  1 
ATOM   2885 C CD1 . TYR B 2 177 ? 49.127 25.044  -20.340 1.00 34.15 ? 178 TYR L CD1 1 
ATOM   2886 C CD2 . TYR B 2 177 ? 49.280 27.384  -20.816 1.00 35.41 ? 178 TYR L CD2 1 
ATOM   2887 C CE1 . TYR B 2 177 ? 50.367 24.838  -20.935 1.00 37.03 ? 178 TYR L CE1 1 
ATOM   2888 C CE2 . TYR B 2 177 ? 50.523 27.187  -21.416 1.00 36.26 ? 178 TYR L CE2 1 
ATOM   2889 C CZ  . TYR B 2 177 ? 51.060 25.915  -21.471 1.00 38.26 ? 178 TYR L CZ  1 
ATOM   2890 O OH  . TYR B 2 177 ? 52.293 25.724  -22.055 1.00 44.48 ? 178 TYR L OH  1 
ATOM   2891 N N   . SER B 2 178 ? 44.345 25.159  -19.294 1.00 41.63 ? 179 SER L N   1 
ATOM   2892 C CA  . SER B 2 178 ? 43.107 25.090  -18.544 1.00 41.84 ? 179 SER L CA  1 
ATOM   2893 C C   . SER B 2 178 ? 43.360 24.377  -17.227 1.00 44.39 ? 179 SER L C   1 
ATOM   2894 O O   . SER B 2 178 ? 44.273 23.555  -17.111 1.00 41.54 ? 179 SER L O   1 
ATOM   2895 C CB  . SER B 2 178 ? 42.030 24.364  -19.347 1.00 42.17 ? 179 SER L CB  1 
ATOM   2896 O OG  . SER B 2 178 ? 41.627 25.154  -20.452 1.00 41.90 ? 179 SER L OG  1 
ATOM   2897 N N   . MET B 2 179 ? 42.548 24.707  -16.233 1.00 44.69 ? 180 MET L N   1 
ATOM   2898 C CA  . MET B 2 179 ? 42.694 24.113  -14.923 1.00 46.94 ? 180 MET L CA  1 
ATOM   2899 C C   . MET B 2 179 ? 41.341 23.834  -14.298 1.00 46.44 ? 180 MET L C   1 
ATOM   2900 O O   . MET B 2 179 ? 40.357 24.510  -14.586 1.00 48.89 ? 180 MET L O   1 
ATOM   2901 C CB  . MET B 2 179 ? 43.483 25.045  -14.013 1.00 49.23 ? 180 MET L CB  1 
ATOM   2902 C CG  . MET B 2 179 ? 43.864 24.406  -12.703 1.00 58.03 ? 180 MET L CG  1 
ATOM   2903 S SD  . MET B 2 179 ? 44.006 25.603  -11.392 1.00 59.94 ? 180 MET L SD  1 
ATOM   2904 C CE  . MET B 2 179 ? 42.542 25.197  -10.443 1.00 64.85 ? 180 MET L CE  1 
ATOM   2905 N N   . SER B 2 180 ? 41.304 22.830  -13.435 1.00 43.88 ? 181 SER L N   1 
ATOM   2906 C CA  . SER B 2 180 ? 40.084 22.465  -12.752 1.00 44.23 ? 181 SER L CA  1 
ATOM   2907 C C   . SER B 2 180 ? 40.355 22.505  -11.256 1.00 47.62 ? 181 SER L C   1 
ATOM   2908 O O   . SER B 2 180 ? 41.393 22.031  -10.795 1.00 48.06 ? 181 SER L O   1 
ATOM   2909 C CB  . SER B 2 180 ? 39.654 21.067  -13.178 1.00 46.72 ? 181 SER L CB  1 
ATOM   2910 O OG  . SER B 2 180 ? 38.453 20.675  -12.540 1.00 45.18 ? 181 SER L OG  1 
ATOM   2911 N N   . SER B 2 181 ? 39.431 23.093  -10.504 1.00 48.35 ? 182 SER L N   1 
ATOM   2912 C CA  . SER B 2 181 ? 39.568 23.183  -9.056  1.00 50.32 ? 182 SER L CA  1 
ATOM   2913 C C   . SER B 2 181 ? 38.311 22.603  -8.415  1.00 49.44 ? 182 SER L C   1 
ATOM   2914 O O   . SER B 2 181 ? 37.196 23.024  -8.722  1.00 48.63 ? 182 SER L O   1 
ATOM   2915 C CB  . SER B 2 181 ? 39.751 24.639  -8.630  1.00 54.23 ? 182 SER L CB  1 
ATOM   2916 O OG  . SER B 2 181 ? 40.090 24.726  -7.258  1.00 57.27 ? 182 SER L OG  1 
ATOM   2917 N N   . THR B 2 182 ? 38.490 21.630  -7.529  1.00 49.72 ? 183 THR L N   1 
ATOM   2918 C CA  . THR B 2 182 ? 37.350 21.001  -6.878  1.00 50.20 ? 183 THR L CA  1 
ATOM   2919 C C   . THR B 2 182 ? 37.473 20.927  -5.362  1.00 51.23 ? 183 THR L C   1 
ATOM   2920 O O   . THR B 2 182 ? 38.357 20.261  -4.826  1.00 45.34 ? 183 THR L O   1 
ATOM   2921 C CB  . THR B 2 182 ? 37.127 19.581  -7.417  1.00 48.54 ? 183 THR L CB  1 
ATOM   2922 O OG1 . THR B 2 182 ? 36.849 19.646  -8.820  1.00 48.94 ? 183 THR L OG1 1 
ATOM   2923 C CG2 . THR B 2 182 ? 35.965 18.912  -6.699  1.00 48.44 ? 183 THR L CG2 1 
ATOM   2924 N N   . LEU B 2 183 ? 36.570 21.623  -4.679  1.00 55.62 ? 184 LEU L N   1 
ATOM   2925 C CA  . LEU B 2 183 ? 36.543 21.629  -3.222  1.00 56.09 ? 184 LEU L CA  1 
ATOM   2926 C C   . LEU B 2 183 ? 35.557 20.559  -2.784  1.00 57.04 ? 184 LEU L C   1 
ATOM   2927 O O   . LEU B 2 183 ? 34.347 20.757  -2.853  1.00 58.49 ? 184 LEU L O   1 
ATOM   2928 C CB  . LEU B 2 183 ? 36.090 22.994  -2.707  1.00 55.57 ? 184 LEU L CB  1 
ATOM   2929 C CG  . LEU B 2 183 ? 35.829 23.106  -1.205  1.00 55.27 ? 184 LEU L CG  1 
ATOM   2930 C CD1 . LEU B 2 183 ? 37.090 22.790  -0.431  1.00 55.81 ? 184 LEU L CD1 1 
ATOM   2931 C CD2 . LEU B 2 183 ? 35.344 24.501  -0.888  1.00 55.87 ? 184 LEU L CD2 1 
ATOM   2932 N N   . THR B 2 184 ? 36.078 19.421  -2.344  1.00 58.06 ? 185 THR L N   1 
ATOM   2933 C CA  . THR B 2 184 ? 35.230 18.319  -1.914  1.00 63.47 ? 185 THR L CA  1 
ATOM   2934 C C   . THR B 2 184 ? 34.991 18.310  -0.403  1.00 62.67 ? 185 THR L C   1 
ATOM   2935 O O   . THR B 2 184 ? 35.922 18.481  0.385   1.00 62.97 ? 185 THR L O   1 
ATOM   2936 C CB  . THR B 2 184 ? 35.839 16.962  -2.337  1.00 64.29 ? 185 THR L CB  1 
ATOM   2937 O OG1 . THR B 2 184 ? 37.208 16.897  -1.916  1.00 69.49 ? 185 THR L OG1 1 
ATOM   2938 C CG2 . THR B 2 184 ? 35.776 16.800  -3.846  1.00 64.04 ? 185 THR L CG2 1 
ATOM   2939 N N   . LEU B 2 185 ? 33.737 18.112  -0.007  1.00 61.85 ? 186 LEU L N   1 
ATOM   2940 C CA  . LEU B 2 185 ? 33.379 18.072  1.406   1.00 64.98 ? 186 LEU L CA  1 
ATOM   2941 C C   . LEU B 2 185 ? 32.055 17.344  1.648   1.00 66.03 ? 186 LEU L C   1 
ATOM   2942 O O   . LEU B 2 185 ? 31.325 17.036  0.706   1.00 63.08 ? 186 LEU L O   1 
ATOM   2943 C CB  . LEU B 2 185 ? 33.327 19.496  1.974   1.00 61.81 ? 186 LEU L CB  1 
ATOM   2944 C CG  . LEU B 2 185 ? 32.515 20.544  1.212   1.00 59.80 ? 186 LEU L CG  1 
ATOM   2945 C CD1 . LEU B 2 185 ? 31.038 20.216  1.306   1.00 59.24 ? 186 LEU L CD1 1 
ATOM   2946 C CD2 . LEU B 2 185 ? 32.788 21.916  1.793   1.00 53.62 ? 186 LEU L CD2 1 
ATOM   2947 N N   . THR B 2 186 ? 31.759 17.065  2.915   1.00 68.94 ? 187 THR L N   1 
ATOM   2948 C CA  . THR B 2 186 ? 30.532 16.366  3.290   1.00 70.47 ? 187 THR L CA  1 
ATOM   2949 C C   . THR B 2 186 ? 29.300 17.231  3.060   1.00 71.67 ? 187 THR L C   1 
ATOM   2950 O O   . THR B 2 186 ? 29.353 18.456  3.199   1.00 71.21 ? 187 THR L O   1 
ATOM   2951 C CB  . THR B 2 186 ? 30.546 15.943  4.783   1.00 71.29 ? 187 THR L CB  1 
ATOM   2952 O OG1 . THR B 2 186 ? 30.598 17.108  5.619   1.00 70.75 ? 187 THR L OG1 1 
ATOM   2953 C CG2 . THR B 2 186 ? 31.749 15.062  5.076   1.00 70.83 ? 187 THR L CG2 1 
ATOM   2954 N N   . LYS B 2 187 ? 28.193 16.584  2.708   1.00 70.97 ? 188 LYS L N   1 
ATOM   2955 C CA  . LYS B 2 187 ? 26.938 17.288  2.469   1.00 72.84 ? 188 LYS L CA  1 
ATOM   2956 C C   . LYS B 2 187 ? 26.547 18.065  3.716   1.00 72.40 ? 188 LYS L C   1 
ATOM   2957 O O   . LYS B 2 187 ? 26.048 19.188  3.634   1.00 68.85 ? 188 LYS L O   1 
ATOM   2958 C CB  . LYS B 2 187 ? 25.835 16.289  2.119   1.00 73.95 ? 188 LYS L CB  1 
ATOM   2959 C CG  . LYS B 2 187 ? 24.435 16.881  2.073   1.00 74.48 ? 188 LYS L CG  1 
ATOM   2960 C CD  . LYS B 2 187 ? 23.409 15.809  1.731   1.00 77.00 ? 188 LYS L CD  1 
ATOM   2961 C CE  . LYS B 2 187 ? 21.991 16.334  1.855   1.00 78.75 ? 188 LYS L CE  1 
ATOM   2962 N NZ  . LYS B 2 187 ? 21.689 16.773  3.246   1.00 81.78 ? 188 LYS L NZ  1 
ATOM   2963 N N   . ASP B 2 188 ? 26.779 17.455  4.873   1.00 73.39 ? 189 ASP L N   1 
ATOM   2964 C CA  . ASP B 2 188 ? 26.456 18.082  6.146   1.00 77.09 ? 189 ASP L CA  1 
ATOM   2965 C C   . ASP B 2 188 ? 27.223 19.389  6.288   1.00 77.06 ? 189 ASP L C   1 
ATOM   2966 O O   . ASP B 2 188 ? 26.668 20.405  6.708   1.00 76.21 ? 189 ASP L O   1 
ATOM   2967 C CB  . ASP B 2 188 ? 26.806 17.140  7.299   1.00 78.49 ? 189 ASP L CB  1 
ATOM   2968 C CG  . ASP B 2 188 ? 26.059 15.820  7.219   1.00 81.95 ? 189 ASP L CG  1 
ATOM   2969 O OD1 . ASP B 2 188 ? 24.809 15.839  7.232   1.00 80.22 ? 189 ASP L OD1 1 
ATOM   2970 O OD2 . ASP B 2 188 ? 26.722 14.761  7.142   1.00 84.55 ? 189 ASP L OD2 1 
ATOM   2971 N N   . GLU B 2 189 ? 28.504 19.354  5.932   1.00 76.29 ? 190 GLU L N   1 
ATOM   2972 C CA  . GLU B 2 189 ? 29.355 20.533  6.005   1.00 75.55 ? 190 GLU L CA  1 
ATOM   2973 C C   . GLU B 2 189 ? 28.921 21.558  4.966   1.00 73.06 ? 190 GLU L C   1 
ATOM   2974 O O   . GLU B 2 189 ? 28.883 22.757  5.237   1.00 74.82 ? 190 GLU L O   1 
ATOM   2975 C CB  . GLU B 2 189 ? 30.817 20.138  5.775   1.00 76.94 ? 190 GLU L CB  1 
ATOM   2976 C CG  . GLU B 2 189 ? 31.767 21.312  5.585   1.00 81.58 ? 190 GLU L CG  1 
ATOM   2977 C CD  . GLU B 2 189 ? 31.799 22.251  6.777   1.00 85.89 ? 190 GLU L CD  1 
ATOM   2978 O OE1 . GLU B 2 189 ? 32.498 23.282  6.692   1.00 84.94 ? 190 GLU L OE1 1 
ATOM   2979 O OE2 . GLU B 2 189 ? 31.133 21.962  7.796   1.00 88.68 ? 190 GLU L OE2 1 
ATOM   2980 N N   . TYR B 2 190 ? 28.588 21.076  3.774   1.00 71.24 ? 191 TYR L N   1 
ATOM   2981 C CA  . TYR B 2 190 ? 28.160 21.945  2.686   1.00 70.50 ? 191 TYR L CA  1 
ATOM   2982 C C   . TYR B 2 190 ? 26.938 22.777  3.069   1.00 72.29 ? 191 TYR L C   1 
ATOM   2983 O O   . TYR B 2 190 ? 26.889 23.980  2.812   1.00 72.03 ? 191 TYR L O   1 
ATOM   2984 C CB  . TYR B 2 190 ? 27.856 21.102  1.441   1.00 65.76 ? 191 TYR L CB  1 
ATOM   2985 C CG  . TYR B 2 190 ? 27.245 21.876  0.293   1.00 61.92 ? 191 TYR L CG  1 
ATOM   2986 C CD1 . TYR B 2 190 ? 27.880 22.997  -0.237  1.00 60.58 ? 191 TYR L CD1 1 
ATOM   2987 C CD2 . TYR B 2 190 ? 26.019 21.497  -0.248  1.00 61.71 ? 191 TYR L CD2 1 
ATOM   2988 C CE1 . TYR B 2 190 ? 27.306 23.726  -1.274  1.00 57.39 ? 191 TYR L CE1 1 
ATOM   2989 C CE2 . TYR B 2 190 ? 25.438 22.218  -1.284  1.00 58.11 ? 191 TYR L CE2 1 
ATOM   2990 C CZ  . TYR B 2 190 ? 26.086 23.332  -1.789  1.00 57.89 ? 191 TYR L CZ  1 
ATOM   2991 O OH  . TYR B 2 190 ? 25.505 24.062  -2.797  1.00 55.93 ? 191 TYR L OH  1 
ATOM   2992 N N   . GLU B 2 191 ? 25.952 22.132  3.684   1.00 76.44 ? 192 GLU L N   1 
ATOM   2993 C CA  . GLU B 2 191 ? 24.731 22.821  4.093   1.00 78.26 ? 192 GLU L CA  1 
ATOM   2994 C C   . GLU B 2 191 ? 24.983 23.730  5.296   1.00 79.00 ? 192 GLU L C   1 
ATOM   2995 O O   . GLU B 2 191 ? 24.129 24.536  5.668   1.00 79.10 ? 192 GLU L O   1 
ATOM   2996 C CB  . GLU B 2 191 ? 23.640 21.799  4.439   1.00 77.79 ? 192 GLU L CB  1 
ATOM   2997 C CG  . GLU B 2 191 ? 23.260 20.860  3.297   1.00 79.67 ? 192 GLU L CG  1 
ATOM   2998 C CD  . GLU B 2 191 ? 22.658 21.585  2.104   1.00 81.31 ? 192 GLU L CD  1 
ATOM   2999 O OE1 . GLU B 2 191 ? 22.240 20.906  1.142   1.00 80.27 ? 192 GLU L OE1 1 
ATOM   3000 O OE2 . GLU B 2 191 ? 22.603 22.832  2.124   1.00 83.09 ? 192 GLU L OE2 1 
ATOM   3001 N N   . ARG B 2 192 ? 26.165 23.601  5.892   1.00 79.13 ? 193 ARG L N   1 
ATOM   3002 C CA  . ARG B 2 192 ? 26.539 24.393  7.060   1.00 78.07 ? 193 ARG L CA  1 
ATOM   3003 C C   . ARG B 2 192 ? 26.976 25.805  6.664   1.00 77.51 ? 193 ARG L C   1 
ATOM   3004 O O   . ARG B 2 192 ? 27.313 26.624  7.522   1.00 75.19 ? 193 ARG L O   1 
ATOM   3005 C CB  . ARG B 2 192 ? 27.669 23.684  7.814   1.00 78.86 ? 193 ARG L CB  1 
ATOM   3006 C CG  . ARG B 2 192 ? 27.895 24.158  9.241   1.00 82.26 ? 193 ARG L CG  1 
ATOM   3007 C CD  . ARG B 2 192 ? 28.884 23.240  9.949   1.00 83.89 ? 193 ARG L CD  1 
ATOM   3008 N NE  . ARG B 2 192 ? 28.463 21.842  9.870   1.00 86.79 ? 193 ARG L NE  1 
ATOM   3009 C CZ  . ARG B 2 192 ? 29.164 20.814  10.341  1.00 87.60 ? 193 ARG L CZ  1 
ATOM   3010 N NH1 . ARG B 2 192 ? 30.333 21.018  10.935  1.00 88.54 ? 193 ARG L NH1 1 
ATOM   3011 N NH2 . ARG B 2 192 ? 28.698 19.578  10.210  1.00 88.74 ? 193 ARG L NH2 1 
ATOM   3012 N N   . HIS B 2 193 ? 26.966 26.077  5.360   1.00 76.47 ? 194 HIS L N   1 
ATOM   3013 C CA  . HIS B 2 193 ? 27.355 27.378  4.822   1.00 73.57 ? 194 HIS L CA  1 
ATOM   3014 C C   . HIS B 2 193 ? 26.467 27.694  3.627   1.00 74.26 ? 194 HIS L C   1 
ATOM   3015 O O   . HIS B 2 193 ? 25.747 26.819  3.144   1.00 75.96 ? 194 HIS L O   1 
ATOM   3016 C CB  . HIS B 2 193 ? 28.821 27.355  4.388   1.00 71.72 ? 194 HIS L CB  1 
ATOM   3017 C CG  . HIS B 2 193 ? 29.776 27.062  5.502   1.00 71.83 ? 194 HIS L CG  1 
ATOM   3018 N ND1 . HIS B 2 193 ? 29.902 27.875  6.607   1.00 72.23 ? 194 HIS L ND1 1 
ATOM   3019 C CD2 . HIS B 2 193 ? 30.643 26.039  5.688   1.00 73.07 ? 194 HIS L CD2 1 
ATOM   3020 C CE1 . HIS B 2 193 ? 30.806 27.366  7.426   1.00 72.56 ? 194 HIS L CE1 1 
ATOM   3021 N NE2 . HIS B 2 193 ? 31.271 26.252  6.892   1.00 72.87 ? 194 HIS L NE2 1 
ATOM   3022 N N   . ASN B 2 194 ? 26.520 28.935  3.146   1.00 74.57 ? 195 ASN L N   1 
ATOM   3023 C CA  . ASN B 2 194 ? 25.693 29.343  2.009   1.00 76.78 ? 195 ASN L CA  1 
ATOM   3024 C C   . ASN B 2 194 ? 26.457 29.982  0.848   1.00 77.41 ? 195 ASN L C   1 
ATOM   3025 O O   . ASN B 2 194 ? 26.026 29.899  -0.305  1.00 77.25 ? 195 ASN L O   1 
ATOM   3026 C CB  . ASN B 2 194 ? 24.601 30.314  2.473   1.00 79.68 ? 195 ASN L CB  1 
ATOM   3027 C CG  . ASN B 2 194 ? 23.514 29.631  3.287   1.00 85.91 ? 195 ASN L CG  1 
ATOM   3028 O OD1 . ASN B 2 194 ? 22.633 30.292  3.842   1.00 87.26 ? 195 ASN L OD1 1 
ATOM   3029 N ND2 . ASN B 2 194 ? 23.564 28.303  3.356   1.00 88.85 ? 195 ASN L ND2 1 
ATOM   3030 N N   . GLY B 2 195 ? 27.583 30.623  1.149   1.00 76.84 ? 196 GLY L N   1 
ATOM   3031 C CA  . GLY B 2 195 ? 28.356 31.271  0.103   1.00 74.74 ? 196 GLY L CA  1 
ATOM   3032 C C   . GLY B 2 195 ? 29.663 30.584  -0.244  1.00 72.83 ? 196 GLY L C   1 
ATOM   3033 O O   . GLY B 2 195 ? 30.485 30.311  0.633   1.00 72.73 ? 196 GLY L O   1 
ATOM   3034 N N   . TYR B 2 196 ? 29.857 30.308  -1.532  1.00 71.88 ? 197 TYR L N   1 
ATOM   3035 C CA  . TYR B 2 196 ? 31.076 29.655  -2.005  1.00 71.39 ? 197 TYR L CA  1 
ATOM   3036 C C   . TYR B 2 196 ? 31.698 30.425  -3.168  1.00 67.82 ? 197 TYR L C   1 
ATOM   3037 O O   . TYR B 2 196 ? 31.078 30.583  -4.217  1.00 64.38 ? 197 TYR L O   1 
ATOM   3038 C CB  . TYR B 2 196 ? 30.777 28.211  -2.428  1.00 70.70 ? 197 TYR L CB  1 
ATOM   3039 C CG  . TYR B 2 196 ? 30.310 27.332  -1.283  1.00 71.34 ? 197 TYR L CG  1 
ATOM   3040 C CD1 . TYR B 2 196 ? 28.992 27.386  -0.827  1.00 71.15 ? 197 TYR L CD1 1 
ATOM   3041 C CD2 . TYR B 2 196 ? 31.197 26.471  -0.633  1.00 70.86 ? 197 TYR L CD2 1 
ATOM   3042 C CE1 . TYR B 2 196 ? 28.570 26.606  0.246   1.00 71.15 ? 197 TYR L CE1 1 
ATOM   3043 C CE2 . TYR B 2 196 ? 30.787 25.689  0.440   1.00 72.15 ? 197 TYR L CE2 1 
ATOM   3044 C CZ  . TYR B 2 196 ? 29.474 25.761  0.874   1.00 73.36 ? 197 TYR L CZ  1 
ATOM   3045 O OH  . TYR B 2 196 ? 29.071 24.989  1.939   1.00 73.89 ? 197 TYR L OH  1 
ATOM   3046 N N   . THR B 2 197 ? 32.931 30.890  -2.973  1.00 66.91 ? 198 THR L N   1 
ATOM   3047 C CA  . THR B 2 197 ? 33.632 31.666  -3.989  1.00 67.47 ? 198 THR L CA  1 
ATOM   3048 C C   . THR B 2 197 ? 34.882 31.009  -4.569  1.00 66.15 ? 198 THR L C   1 
ATOM   3049 O O   . THR B 2 197 ? 35.702 30.442  -3.848  1.00 63.53 ? 198 THR L O   1 
ATOM   3050 C CB  . THR B 2 197 ? 34.033 33.047  -3.438  1.00 70.32 ? 198 THR L CB  1 
ATOM   3051 O OG1 . THR B 2 197 ? 32.888 33.678  -2.854  1.00 71.70 ? 198 THR L OG1 1 
ATOM   3052 C CG2 . THR B 2 197 ? 34.564 33.932  -4.554  1.00 73.03 ? 198 THR L CG2 1 
ATOM   3053 N N   . CYS B 2 198 ? 35.010 31.119  -5.889  1.00 67.93 ? 199 CYS L N   1 
ATOM   3054 C CA  . CYS B 2 198 ? 36.126 30.574  -6.659  1.00 68.39 ? 199 CYS L CA  1 
ATOM   3055 C C   . CYS B 2 198 ? 36.956 31.758  -7.159  1.00 67.36 ? 199 CYS L C   1 
ATOM   3056 O O   . CYS B 2 198 ? 36.527 32.488  -8.053  1.00 62.09 ? 199 CYS L O   1 
ATOM   3057 C CB  . CYS B 2 198 ? 35.572 29.788  -7.849  1.00 68.59 ? 199 CYS L CB  1 
ATOM   3058 S SG  . CYS B 2 198 ? 36.778 29.025  -8.981  1.00 72.25 ? 199 CYS L SG  1 
ATOM   3059 N N   . GLU B 2 199 ? 38.141 31.947  -6.586  1.00 67.95 ? 200 GLU L N   1 
ATOM   3060 C CA  . GLU B 2 199 ? 38.993 33.067  -6.974  1.00 71.49 ? 200 GLU L CA  1 
ATOM   3061 C C   . GLU B 2 199 ? 40.135 32.676  -7.909  1.00 69.77 ? 200 GLU L C   1 
ATOM   3062 O O   . GLU B 2 199 ? 40.897 31.756  -7.619  1.00 68.74 ? 200 GLU L O   1 
ATOM   3063 C CB  . GLU B 2 199 ? 39.564 33.744  -5.725  1.00 73.70 ? 200 GLU L CB  1 
ATOM   3064 C CG  . GLU B 2 199 ? 40.239 35.076  -6.004  1.00 80.07 ? 200 GLU L CG  1 
ATOM   3065 C CD  . GLU B 2 199 ? 40.752 35.748  -4.748  1.00 83.32 ? 200 GLU L CD  1 
ATOM   3066 O OE1 . GLU B 2 199 ? 39.959 35.917  -3.798  1.00 83.45 ? 200 GLU L OE1 1 
ATOM   3067 O OE2 . GLU B 2 199 ? 41.947 36.111  -4.715  1.00 86.54 ? 200 GLU L OE2 1 
ATOM   3068 N N   . ALA B 2 200 ? 40.253 33.395  -9.022  1.00 68.52 ? 201 ALA L N   1 
ATOM   3069 C CA  . ALA B 2 200 ? 41.295 33.127  -10.006 1.00 70.55 ? 201 ALA L CA  1 
ATOM   3070 C C   . ALA B 2 200 ? 42.227 34.321  -10.209 1.00 73.20 ? 201 ALA L C   1 
ATOM   3071 O O   . ALA B 2 200 ? 41.909 35.249  -10.954 1.00 73.13 ? 201 ALA L O   1 
ATOM   3072 C CB  . ALA B 2 200 ? 40.662 32.738  -11.333 1.00 70.38 ? 201 ALA L CB  1 
ATOM   3073 N N   . THR B 2 201 ? 43.380 34.286  -9.545  1.00 74.11 ? 202 THR L N   1 
ATOM   3074 C CA  . THR B 2 201 ? 44.370 35.350  -9.652  1.00 75.38 ? 202 THR L CA  1 
ATOM   3075 C C   . THR B 2 201 ? 45.409 35.026  -10.723 1.00 76.82 ? 202 THR L C   1 
ATOM   3076 O O   . THR B 2 201 ? 46.368 34.292  -10.481 1.00 77.11 ? 202 THR L O   1 
ATOM   3077 C CB  . THR B 2 201 ? 45.093 35.581  -8.306  1.00 75.15 ? 202 THR L CB  1 
ATOM   3078 O OG1 . THR B 2 201 ? 44.170 36.127  -7.357  1.00 76.31 ? 202 THR L OG1 1 
ATOM   3079 C CG2 . THR B 2 201 ? 46.264 36.540  -8.478  1.00 75.70 ? 202 THR L CG2 1 
ATOM   3080 N N   . HIS B 2 202 ? 45.207 35.580  -11.913 1.00 78.40 ? 203 HIS L N   1 
ATOM   3081 C CA  . HIS B 2 202 ? 46.123 35.365  -13.023 1.00 81.29 ? 203 HIS L CA  1 
ATOM   3082 C C   . HIS B 2 202 ? 47.131 36.508  -13.019 1.00 81.97 ? 203 HIS L C   1 
ATOM   3083 O O   . HIS B 2 202 ? 46.860 37.578  -12.468 1.00 82.14 ? 203 HIS L O   1 
ATOM   3084 C CB  . HIS B 2 202 ? 45.349 35.351  -14.344 1.00 83.26 ? 203 HIS L CB  1 
ATOM   3085 C CG  . HIS B 2 202 ? 46.125 34.796  -15.497 1.00 85.99 ? 203 HIS L CG  1 
ATOM   3086 N ND1 . HIS B 2 202 ? 46.585 33.496  -15.528 1.00 87.44 ? 203 HIS L ND1 1 
ATOM   3087 C CD2 . HIS B 2 202 ? 46.512 35.359  -16.666 1.00 87.04 ? 203 HIS L CD2 1 
ATOM   3088 C CE1 . HIS B 2 202 ? 47.221 33.283  -16.666 1.00 84.75 ? 203 HIS L CE1 1 
ATOM   3089 N NE2 . HIS B 2 202 ? 47.191 34.397  -17.375 1.00 86.60 ? 203 HIS L NE2 1 
ATOM   3090 N N   . LYS B 2 203 ? 48.291 36.283  -13.625 1.00 81.63 ? 204 LYS L N   1 
ATOM   3091 C CA  . LYS B 2 203 ? 49.322 37.312  -13.671 1.00 83.18 ? 204 LYS L CA  1 
ATOM   3092 C C   . LYS B 2 203 ? 48.948 38.393  -14.680 1.00 83.31 ? 204 LYS L C   1 
ATOM   3093 O O   . LYS B 2 203 ? 49.693 38.674  -15.619 1.00 81.59 ? 204 LYS L O   1 
ATOM   3094 C CB  . LYS B 2 203 ? 50.671 36.689  -14.037 1.00 84.79 ? 204 LYS L CB  1 
ATOM   3095 C CG  . LYS B 2 203 ? 51.085 35.499  -13.164 1.00 83.95 ? 204 LYS L CG  1 
ATOM   3096 C CD  . LYS B 2 203 ? 51.147 35.840  -11.673 1.00 84.45 ? 204 LYS L CD  1 
ATOM   3097 C CE  . LYS B 2 203 ? 49.780 35.747  -11.003 1.00 84.03 ? 204 LYS L CE  1 
ATOM   3098 N NZ  . LYS B 2 203 ? 49.840 36.077  -9.552  1.00 82.63 ? 204 LYS L NZ  1 
ATOM   3099 N N   . THR B 2 204 ? 47.781 38.994  -14.468 1.00 84.92 ? 205 THR L N   1 
ATOM   3100 C CA  . THR B 2 204 ? 47.270 40.045  -15.337 1.00 86.43 ? 205 THR L CA  1 
ATOM   3101 C C   . THR B 2 204 ? 46.168 40.814  -14.609 1.00 86.53 ? 205 THR L C   1 
ATOM   3102 O O   . THR B 2 204 ? 45.479 40.260  -13.750 1.00 86.82 ? 205 THR L O   1 
ATOM   3103 C CB  . THR B 2 204 ? 46.681 39.452  -16.634 1.00 86.68 ? 205 THR L CB  1 
ATOM   3104 O OG1 . THR B 2 204 ? 47.632 38.559  -17.226 1.00 88.00 ? 205 THR L OG1 1 
ATOM   3105 C CG2 . THR B 2 204 ? 46.356 40.557  -17.628 1.00 88.52 ? 205 THR L CG2 1 
ATOM   3106 N N   . SER B 2 205 ? 46.013 42.090  -14.951 1.00 86.93 ? 206 SER L N   1 
ATOM   3107 C CA  . SER B 2 205 ? 44.991 42.947  -14.351 1.00 87.07 ? 206 SER L CA  1 
ATOM   3108 C C   . SER B 2 205 ? 45.229 43.264  -12.876 1.00 86.76 ? 206 SER L C   1 
ATOM   3109 O O   . SER B 2 205 ? 44.779 44.301  -12.383 1.00 86.86 ? 206 SER L O   1 
ATOM   3110 C CB  . SER B 2 205 ? 43.607 42.307  -14.503 1.00 87.27 ? 206 SER L CB  1 
ATOM   3111 O OG  . SER B 2 205 ? 43.270 42.106  -15.866 1.00 88.09 ? 206 SER L OG  1 
ATOM   3112 N N   . THR B 2 206 ? 45.924 42.370  -12.175 1.00 85.37 ? 207 THR L N   1 
ATOM   3113 C CA  . THR B 2 206 ? 46.212 42.548  -10.751 1.00 84.37 ? 207 THR L CA  1 
ATOM   3114 C C   . THR B 2 206 ? 44.937 42.330  -9.934  1.00 83.60 ? 207 THR L C   1 
ATOM   3115 O O   . THR B 2 206 ? 44.981 42.192  -8.708  1.00 82.56 ? 207 THR L O   1 
ATOM   3116 C CB  . THR B 2 206 ? 46.770 43.965  -10.459 1.00 84.60 ? 207 THR L CB  1 
ATOM   3117 O OG1 . THR B 2 206 ? 47.919 44.203  -11.281 1.00 84.77 ? 207 THR L OG1 1 
ATOM   3118 C CG2 . THR B 2 206 ? 47.171 44.096  -8.992  1.00 83.17 ? 207 THR L CG2 1 
ATOM   3119 N N   . SER B 2 207 ? 43.805 42.296  -10.632 1.00 83.09 ? 208 SER L N   1 
ATOM   3120 C CA  . SER B 2 207 ? 42.501 42.092  -10.009 1.00 81.48 ? 208 SER L CA  1 
ATOM   3121 C C   . SER B 2 207 ? 41.969 40.687  -10.316 1.00 80.30 ? 208 SER L C   1 
ATOM   3122 O O   . SER B 2 207 ? 41.755 40.331  -11.477 1.00 78.15 ? 208 SER L O   1 
ATOM   3123 C CB  . SER B 2 207 ? 41.513 43.150  -10.512 1.00 82.17 ? 208 SER L CB  1 
ATOM   3124 O OG  . SER B 2 207 ? 41.466 43.177  -11.929 1.00 84.20 ? 208 SER L OG  1 
ATOM   3125 N N   . PRO B 2 208 ? 41.756 39.870  -9.270  1.00 78.86 ? 209 PRO L N   1 
ATOM   3126 C CA  . PRO B 2 208 ? 41.254 38.495  -9.377  1.00 78.20 ? 209 PRO L CA  1 
ATOM   3127 C C   . PRO B 2 208 ? 39.869 38.354  -10.013 1.00 78.07 ? 209 PRO L C   1 
ATOM   3128 O O   . PRO B 2 208 ? 38.979 39.167  -9.768  1.00 78.28 ? 209 PRO L O   1 
ATOM   3129 C CB  . PRO B 2 208 ? 41.263 38.016  -7.926  1.00 77.81 ? 209 PRO L CB  1 
ATOM   3130 C CG  . PRO B 2 208 ? 42.395 38.787  -7.324  1.00 77.24 ? 209 PRO L CG  1 
ATOM   3131 C CD  . PRO B 2 208 ? 42.158 40.165  -7.882  1.00 78.43 ? 209 PRO L CD  1 
ATOM   3132 N N   . ILE B 2 209 ? 39.701 37.316  -10.832 1.00 76.33 ? 210 ILE L N   1 
ATOM   3133 C CA  . ILE B 2 209 ? 38.424 37.042  -11.490 1.00 73.18 ? 210 ILE L CA  1 
ATOM   3134 C C   . ILE B 2 209 ? 37.646 36.090  -10.595 1.00 73.83 ? 210 ILE L C   1 
ATOM   3135 O O   . ILE B 2 209 ? 37.749 34.871  -10.734 1.00 74.68 ? 210 ILE L O   1 
ATOM   3136 C CB  . ILE B 2 209 ? 38.617 36.370  -12.864 1.00 71.97 ? 210 ILE L CB  1 
ATOM   3137 C CG1 . ILE B 2 209 ? 39.375 37.308  -13.803 1.00 71.31 ? 210 ILE L CG1 1 
ATOM   3138 C CG2 . ILE B 2 209 ? 37.263 36.010  -13.461 1.00 71.60 ? 210 ILE L CG2 1 
ATOM   3139 C CD1 . ILE B 2 209 ? 39.550 36.767  -15.207 1.00 70.35 ? 210 ILE L CD1 1 
ATOM   3140 N N   . VAL B 2 210 ? 36.878 36.652  -9.668  1.00 73.84 ? 211 VAL L N   1 
ATOM   3141 C CA  . VAL B 2 210 ? 36.103 35.853  -8.728  1.00 72.20 ? 211 VAL L CA  1 
ATOM   3142 C C   . VAL B 2 210 ? 34.765 35.380  -9.277  1.00 71.79 ? 211 VAL L C   1 
ATOM   3143 O O   . VAL B 2 210 ? 34.179 36.004  -10.160 1.00 74.35 ? 211 VAL L O   1 
ATOM   3144 C CB  . VAL B 2 210 ? 35.837 36.634  -7.420  1.00 72.09 ? 211 VAL L CB  1 
ATOM   3145 C CG1 . VAL B 2 210 ? 37.155 36.982  -6.735  1.00 69.63 ? 211 VAL L CG1 1 
ATOM   3146 C CG2 . VAL B 2 210 ? 35.048 37.898  -7.726  1.00 73.38 ? 211 VAL L CG2 1 
ATOM   3147 N N   . LYS B 2 211 ? 34.299 34.260  -8.736  1.00 69.99 ? 212 LYS L N   1 
ATOM   3148 C CA  . LYS B 2 211 ? 33.022 33.661  -9.108  1.00 67.60 ? 212 LYS L CA  1 
ATOM   3149 C C   . LYS B 2 211 ? 32.504 32.912  -7.886  1.00 67.16 ? 212 LYS L C   1 
ATOM   3150 O O   . LYS B 2 211 ? 33.260 32.209  -7.218  1.00 64.29 ? 212 LYS L O   1 
ATOM   3151 C CB  . LYS B 2 211 ? 33.192 32.689  -10.279 1.00 65.49 ? 212 LYS L CB  1 
ATOM   3152 C CG  . LYS B 2 211 ? 33.338 33.353  -11.635 1.00 65.49 ? 212 LYS L CG  1 
ATOM   3153 C CD  . LYS B 2 211 ? 32.184 34.309  -11.902 1.00 67.43 ? 212 LYS L CD  1 
ATOM   3154 C CE  . LYS B 2 211 ? 32.166 34.779  -13.347 1.00 68.20 ? 212 LYS L CE  1 
ATOM   3155 N NZ  . LYS B 2 211 ? 31.821 33.663  -14.269 1.00 68.43 ? 212 LYS L NZ  1 
ATOM   3156 N N   . SER B 2 212 ? 31.218 33.067  -7.590  1.00 68.98 ? 213 SER L N   1 
ATOM   3157 C CA  . SER B 2 212 ? 30.628 32.406  -6.432  1.00 69.37 ? 213 SER L CA  1 
ATOM   3158 C C   . SER B 2 212 ? 29.121 32.284  -6.558  1.00 67.54 ? 213 SER L C   1 
ATOM   3159 O O   . SER B 2 212 ? 28.512 32.872  -7.451  1.00 67.28 ? 213 SER L O   1 
ATOM   3160 C CB  . SER B 2 212 ? 30.965 33.185  -5.159  1.00 70.68 ? 213 SER L CB  1 
ATOM   3161 O OG  . SER B 2 212 ? 30.476 34.512  -5.230  1.00 69.70 ? 213 SER L OG  1 
ATOM   3162 N N   . PHE B 2 213 ? 28.521 31.516  -5.655  1.00 67.67 ? 214 PHE L N   1 
ATOM   3163 C CA  . PHE B 2 213 ? 27.077 31.329  -5.668  1.00 69.29 ? 214 PHE L CA  1 
ATOM   3164 C C   . PHE B 2 213 ? 26.525 31.286  -4.247  1.00 69.44 ? 214 PHE L C   1 
ATOM   3165 O O   . PHE B 2 213 ? 27.342 31.174  -3.306  1.00 68.23 ? 214 PHE L O   1 
ATOM   3166 C CB  . PHE B 2 213 ? 26.724 30.037  -6.415  1.00 69.80 ? 214 PHE L CB  1 
ATOM   3167 C CG  . PHE B 2 213 ? 27.274 28.791  -5.776  1.00 70.42 ? 214 PHE L CG  1 
ATOM   3168 C CD1 . PHE B 2 213 ? 26.679 28.254  -4.638  1.00 72.12 ? 214 PHE L CD1 1 
ATOM   3169 C CD2 . PHE B 2 213 ? 28.394 28.160  -6.306  1.00 70.84 ? 214 PHE L CD2 1 
ATOM   3170 C CE1 . PHE B 2 213 ? 27.192 27.104  -4.038  1.00 72.14 ? 214 PHE L CE1 1 
ATOM   3171 C CE2 . PHE B 2 213 ? 28.912 27.012  -5.714  1.00 71.42 ? 214 PHE L CE2 1 
ATOM   3172 C CZ  . PHE B 2 213 ? 28.310 26.484  -4.578  1.00 71.51 ? 214 PHE L CZ  1 
ATOM   3173 O OXT . PHE B 2 213 ? 25.284 31.356  -4.097  1.00 70.62 ? 214 PHE L OXT 1 
ATOM   3174 N N   . ALA C 1 1   ? 47.636 43.593  45.012  1.00 31.47 ? 2   ALA A N   1 
ATOM   3175 C CA  . ALA C 1 1   ? 47.065 44.009  46.321  1.00 35.67 ? 2   ALA A CA  1 
ATOM   3176 C C   . ALA C 1 1   ? 47.951 43.495  47.439  1.00 37.78 ? 2   ALA A C   1 
ATOM   3177 O O   . ALA C 1 1   ? 48.129 42.289  47.590  1.00 36.01 ? 2   ALA A O   1 
ATOM   3178 C CB  . ALA C 1 1   ? 45.645 43.462  46.491  1.00 29.56 ? 2   ALA A CB  1 
ATOM   3179 N N   . ALA C 1 2   ? 48.512 44.415  48.215  1.00 35.48 ? 3   ALA A N   1 
ATOM   3180 C CA  . ALA C 1 2   ? 49.374 44.044  49.330  1.00 34.14 ? 3   ALA A CA  1 
ATOM   3181 C C   . ALA C 1 2   ? 49.347 45.104  50.417  1.00 31.92 ? 3   ALA A C   1 
ATOM   3182 O O   . ALA C 1 2   ? 49.231 46.301  50.133  1.00 32.09 ? 3   ALA A O   1 
ATOM   3183 C CB  . ALA C 1 2   ? 50.812 43.838  48.844  1.00 34.20 ? 3   ALA A CB  1 
ATOM   3184 N N   . LEU C 1 3   ? 49.437 44.647  51.663  1.00 31.09 ? 4   LEU A N   1 
ATOM   3185 C CA  . LEU C 1 3   ? 49.465 45.523  52.828  1.00 25.91 ? 4   LEU A CA  1 
ATOM   3186 C C   . LEU C 1 3   ? 50.838 45.320  53.475  1.00 27.39 ? 4   LEU A C   1 
ATOM   3187 O O   . LEU C 1 3   ? 51.302 44.191  53.607  1.00 22.48 ? 4   LEU A O   1 
ATOM   3188 C CB  . LEU C 1 3   ? 48.353 45.151  53.819  1.00 25.03 ? 4   LEU A CB  1 
ATOM   3189 C CG  . LEU C 1 3   ? 46.903 45.300  53.353  1.00 29.67 ? 4   LEU A CG  1 
ATOM   3190 C CD1 . LEU C 1 3   ? 45.940 44.846  54.445  1.00 29.28 ? 4   LEU A CD1 1 
ATOM   3191 C CD2 . LEU C 1 3   ? 46.636 46.731  52.988  1.00 26.55 ? 4   LEU A CD2 1 
ATOM   3192 N N   . LEU C 1 4   ? 51.492 46.412  53.855  1.00 22.97 ? 5   LEU A N   1 
ATOM   3193 C CA  . LEU C 1 4   ? 52.811 46.326  54.462  1.00 29.90 ? 5   LEU A CA  1 
ATOM   3194 C C   . LEU C 1 4   ? 52.920 47.096  55.776  1.00 26.67 ? 5   LEU A C   1 
ATOM   3195 O O   . LEU C 1 4   ? 52.856 48.319  55.775  1.00 27.35 ? 5   LEU A O   1 
ATOM   3196 C CB  . LEU C 1 4   ? 53.851 46.853  53.479  1.00 33.93 ? 5   LEU A CB  1 
ATOM   3197 C CG  . LEU C 1 4   ? 55.270 46.986  54.025  1.00 39.35 ? 5   LEU A CG  1 
ATOM   3198 C CD1 . LEU C 1 4   ? 55.768 45.641  54.534  1.00 44.00 ? 5   LEU A CD1 1 
ATOM   3199 C CD2 . LEU C 1 4   ? 56.174 47.511  52.921  1.00 45.78 ? 5   LEU A CD2 1 
ATOM   3200 N N   . GLU C 1 5   ? 53.073 46.375  56.885  1.00 25.58 ? 6   GLU A N   1 
ATOM   3201 C CA  . GLU C 1 5   ? 53.215 47.002  58.196  1.00 26.71 ? 6   GLU A CA  1 
ATOM   3202 C C   . GLU C 1 5   ? 54.669 47.386  58.382  1.00 31.62 ? 6   GLU A C   1 
ATOM   3203 O O   . GLU C 1 5   ? 55.555 46.783  57.778  1.00 33.36 ? 6   GLU A O   1 
ATOM   3204 C CB  . GLU C 1 5   ? 52.841 46.044  59.335  1.00 20.11 ? 6   GLU A CB  1 
ATOM   3205 C CG  . GLU C 1 5   ? 51.393 45.561  59.369  1.00 26.54 ? 6   GLU A CG  1 
ATOM   3206 C CD  . GLU C 1 5   ? 51.157 44.372  58.462  1.00 20.11 ? 6   GLU A CD  1 
ATOM   3207 O OE1 . GLU C 1 5   ? 50.028 43.837  58.458  1.00 22.25 ? 6   GLU A OE1 1 
ATOM   3208 O OE2 . GLU C 1 5   ? 52.110 43.972  57.760  1.00 26.02 ? 6   GLU A OE2 1 
ATOM   3209 N N   . SER C 1 6   ? 54.913 48.390  59.220  1.00 31.01 ? 7   SER A N   1 
ATOM   3210 C CA  . SER C 1 6   ? 56.273 48.818  59.518  1.00 30.67 ? 7   SER A CA  1 
ATOM   3211 C C   . SER C 1 6   ? 56.265 49.605  60.824  1.00 32.99 ? 7   SER A C   1 
ATOM   3212 O O   . SER C 1 6   ? 55.201 50.008  61.300  1.00 29.80 ? 7   SER A O   1 
ATOM   3213 C CB  . SER C 1 6   ? 56.818 49.683  58.389  1.00 25.30 ? 7   SER A CB  1 
ATOM   3214 O OG  . SER C 1 6   ? 56.026 50.846  58.245  1.00 40.72 ? 7   SER A OG  1 
ATOM   3215 N N   . GLY C 1 7   ? 57.443 49.799  61.412  1.00 33.05 ? 8   GLY A N   1 
ATOM   3216 C CA  . GLY C 1 7   ? 57.536 50.558  62.651  1.00 32.20 ? 8   GLY A CA  1 
ATOM   3217 C C   . GLY C 1 7   ? 57.771 49.759  63.921  1.00 33.26 ? 8   GLY A C   1 
ATOM   3218 O O   . GLY C 1 7   ? 57.987 50.334  64.982  1.00 33.91 ? 8   GLY A O   1 
ATOM   3219 N N   . GLY C 1 8   ? 57.725 48.437  63.824  1.00 32.02 ? 9   GLY A N   1 
ATOM   3220 C CA  . GLY C 1 8   ? 57.940 47.610  64.997  1.00 34.36 ? 9   GLY A CA  1 
ATOM   3221 C C   . GLY C 1 8   ? 59.371 47.680  65.503  1.00 37.63 ? 9   GLY A C   1 
ATOM   3222 O O   . GLY C 1 8   ? 60.249 48.228  64.839  1.00 35.56 ? 9   GLY A O   1 
ATOM   3223 N N   . GLY C 1 9   ? 59.610 47.128  66.686  1.00 38.92 ? 10  GLY A N   1 
ATOM   3224 C CA  . GLY C 1 9   ? 60.950 47.141  67.238  1.00 40.04 ? 10  GLY A CA  1 
ATOM   3225 C C   . GLY C 1 9   ? 60.963 46.934  68.738  1.00 40.41 ? 10  GLY A C   1 
ATOM   3226 O O   . GLY C 1 9   ? 59.938 46.609  69.341  1.00 35.04 ? 10  GLY A O   1 
ATOM   3227 N N   . LEU C 1 10  ? 62.137 47.102  69.337  1.00 38.31 ? 11  LEU A N   1 
ATOM   3228 C CA  . LEU C 1 10  ? 62.277 46.960  70.779  1.00 39.92 ? 11  LEU A CA  1 
ATOM   3229 C C   . LEU C 1 10  ? 61.963 48.291  71.425  1.00 36.55 ? 11  LEU A C   1 
ATOM   3230 O O   . LEU C 1 10  ? 62.443 49.332  70.989  1.00 37.39 ? 11  LEU A O   1 
ATOM   3231 C CB  . LEU C 1 10  ? 63.697 46.549  71.164  1.00 40.36 ? 11  LEU A CB  1 
ATOM   3232 C CG  . LEU C 1 10  ? 64.021 45.058  71.224  1.00 41.71 ? 11  LEU A CG  1 
ATOM   3233 C CD1 . LEU C 1 10  ? 63.894 44.437  69.842  1.00 47.39 ? 11  LEU A CD1 1 
ATOM   3234 C CD2 . LEU C 1 10  ? 65.432 44.890  71.762  1.00 32.85 ? 11  LEU A CD2 1 
ATOM   3235 N N   . VAL C 1 11  ? 61.147 48.246  72.465  1.00 34.44 ? 12  VAL A N   1 
ATOM   3236 C CA  . VAL C 1 11  ? 60.759 49.442  73.182  1.00 35.31 ? 12  VAL A CA  1 
ATOM   3237 C C   . VAL C 1 11  ? 60.711 49.073  74.659  1.00 34.41 ? 12  VAL A C   1 
ATOM   3238 O O   . VAL C 1 11  ? 60.357 47.950  75.009  1.00 33.79 ? 12  VAL A O   1 
ATOM   3239 C CB  . VAL C 1 11  ? 59.369 49.935  72.717  1.00 36.72 ? 12  VAL A CB  1 
ATOM   3240 C CG1 . VAL C 1 11  ? 58.974 51.195  73.459  1.00 36.45 ? 12  VAL A CG1 1 
ATOM   3241 C CG2 . VAL C 1 11  ? 59.392 50.196  71.230  1.00 44.66 ? 12  VAL A CG2 1 
ATOM   3242 N N   . LYS C 1 12  ? 61.087 50.015  75.513  1.00 33.63 ? 13  LYS A N   1 
ATOM   3243 C CA  . LYS C 1 12  ? 61.083 49.796  76.950  1.00 37.50 ? 13  LYS A CA  1 
ATOM   3244 C C   . LYS C 1 12  ? 59.675 49.931  77.521  1.00 33.77 ? 13  LYS A C   1 
ATOM   3245 O O   . LYS C 1 12  ? 58.831 50.635  76.962  1.00 32.57 ? 13  LYS A O   1 
ATOM   3246 C CB  . LYS C 1 12  ? 62.014 50.809  77.622  1.00 36.76 ? 13  LYS A CB  1 
ATOM   3247 C CG  . LYS C 1 12  ? 63.486 50.615  77.252  1.00 50.64 ? 13  LYS A CG  1 
ATOM   3248 C CD  . LYS C 1 12  ? 64.381 51.713  77.807  1.00 57.82 ? 13  LYS A CD  1 
ATOM   3249 C CE  . LYS C 1 12  ? 64.136 53.039  77.102  1.00 63.67 ? 13  LYS A CE  1 
ATOM   3250 N NZ  . LYS C 1 12  ? 64.980 54.137  77.651  1.00 66.81 ? 13  LYS A NZ  1 
ATOM   3251 N N   . PRO C 1 13  ? 59.394 49.233  78.631  1.00 31.71 ? 14  PRO A N   1 
ATOM   3252 C CA  . PRO C 1 13  ? 58.065 49.329  79.238  1.00 31.67 ? 14  PRO A CA  1 
ATOM   3253 C C   . PRO C 1 13  ? 57.741 50.803  79.485  1.00 31.52 ? 14  PRO A C   1 
ATOM   3254 O O   . PRO C 1 13  ? 58.632 51.598  79.798  1.00 26.57 ? 14  PRO A O   1 
ATOM   3255 C CB  . PRO C 1 13  ? 58.223 48.532  80.526  1.00 31.12 ? 14  PRO A CB  1 
ATOM   3256 C CG  . PRO C 1 13  ? 59.184 47.460  80.114  1.00 26.52 ? 14  PRO A CG  1 
ATOM   3257 C CD  . PRO C 1 13  ? 60.216 48.219  79.316  1.00 30.24 ? 14  PRO A CD  1 
ATOM   3258 N N   . GLY C 1 14  ? 56.473 51.163  79.316  1.00 32.73 ? 15  GLY A N   1 
ATOM   3259 C CA  . GLY C 1 14  ? 56.064 52.545  79.493  1.00 27.21 ? 15  GLY A CA  1 
ATOM   3260 C C   . GLY C 1 14  ? 56.389 53.382  78.266  1.00 25.44 ? 15  GLY A C   1 
ATOM   3261 O O   . GLY C 1 14  ? 55.977 54.532  78.158  1.00 26.73 ? 15  GLY A O   1 
ATOM   3262 N N   . GLY C 1 15  ? 57.141 52.814  77.336  1.00 21.51 ? 16  GLY A N   1 
ATOM   3263 C CA  . GLY C 1 15  ? 57.482 53.557  76.136  1.00 27.88 ? 16  GLY A CA  1 
ATOM   3264 C C   . GLY C 1 15  ? 56.333 53.665  75.130  1.00 25.89 ? 16  GLY A C   1 
ATOM   3265 O O   . GLY C 1 15  ? 55.231 53.170  75.367  1.00 22.86 ? 16  GLY A O   1 
ATOM   3266 N N   . SER C 1 16  ? 56.587 54.330  74.009  1.00 27.02 ? 17  SER A N   1 
ATOM   3267 C CA  . SER C 1 16  ? 55.574 54.489  72.978  1.00 35.10 ? 17  SER A CA  1 
ATOM   3268 C C   . SER C 1 16  ? 56.161 54.163  71.610  1.00 33.61 ? 17  SER A C   1 
ATOM   3269 O O   . SER C 1 16  ? 57.366 54.278  71.387  1.00 32.58 ? 17  SER A O   1 
ATOM   3270 C CB  . SER C 1 16  ? 55.001 55.912  72.990  1.00 38.01 ? 17  SER A CB  1 
ATOM   3271 O OG  . SER C 1 16  ? 55.955 56.861  72.558  1.00 51.11 ? 17  SER A OG  1 
ATOM   3272 N N   . LEU C 1 17  ? 55.301 53.754  70.689  1.00 36.18 ? 18  LEU A N   1 
ATOM   3273 C CA  . LEU C 1 17  ? 55.756 53.377  69.361  1.00 34.62 ? 18  LEU A CA  1 
ATOM   3274 C C   . LEU C 1 17  ? 54.624 53.601  68.372  1.00 29.29 ? 18  LEU A C   1 
ATOM   3275 O O   . LEU C 1 17  ? 53.452 53.447  68.717  1.00 30.05 ? 18  LEU A O   1 
ATOM   3276 C CB  . LEU C 1 17  ? 56.162 51.901  69.369  1.00 36.82 ? 18  LEU A CB  1 
ATOM   3277 C CG  . LEU C 1 17  ? 56.982 51.374  68.193  1.00 42.77 ? 18  LEU A CG  1 
ATOM   3278 C CD1 . LEU C 1 17  ? 58.301 52.135  68.113  1.00 44.60 ? 18  LEU A CD1 1 
ATOM   3279 C CD2 . LEU C 1 17  ? 57.237 49.883  68.372  1.00 41.70 ? 18  LEU A CD2 1 
ATOM   3280 N N   . LYS C 1 18  ? 54.963 53.973  67.145  1.00 27.09 ? 19  LYS A N   1 
ATOM   3281 C CA  . LYS C 1 18  ? 53.928 54.193  66.152  1.00 32.11 ? 19  LYS A CA  1 
ATOM   3282 C C   . LYS C 1 18  ? 54.088 53.270  64.956  1.00 24.82 ? 19  LYS A C   1 
ATOM   3283 O O   . LYS C 1 18  ? 55.085 53.318  64.242  1.00 23.48 ? 19  LYS A O   1 
ATOM   3284 C CB  . LYS C 1 18  ? 53.922 55.643  65.667  1.00 34.62 ? 19  LYS A CB  1 
ATOM   3285 C CG  . LYS C 1 18  ? 52.691 55.953  64.824  1.00 37.91 ? 19  LYS A CG  1 
ATOM   3286 C CD  . LYS C 1 18  ? 52.684 57.374  64.276  1.00 47.78 ? 19  LYS A CD  1 
ATOM   3287 C CE  . LYS C 1 18  ? 53.663 57.534  63.128  1.00 48.23 ? 19  LYS A CE  1 
ATOM   3288 N NZ  . LYS C 1 18  ? 53.479 58.841  62.418  1.00 51.07 ? 19  LYS A NZ  1 
ATOM   3289 N N   . LEU C 1 19  ? 53.095 52.423  64.739  1.00 26.70 ? 20  LEU A N   1 
ATOM   3290 C CA  . LEU C 1 19  ? 53.151 51.512  63.612  1.00 22.17 ? 20  LEU A CA  1 
ATOM   3291 C C   . LEU C 1 19  ? 52.444 52.159  62.430  1.00 24.53 ? 20  LEU A C   1 
ATOM   3292 O O   . LEU C 1 19  ? 51.488 52.926  62.596  1.00 20.12 ? 20  LEU A O   1 
ATOM   3293 C CB  . LEU C 1 19  ? 52.458 50.198  63.952  1.00 28.87 ? 20  LEU A CB  1 
ATOM   3294 C CG  . LEU C 1 19  ? 52.909 49.510  65.248  1.00 25.63 ? 20  LEU A CG  1 
ATOM   3295 C CD1 . LEU C 1 19  ? 52.180 48.194  65.379  1.00 19.42 ? 20  LEU A CD1 1 
ATOM   3296 C CD2 . LEU C 1 19  ? 54.405 49.290  65.226  1.00 23.65 ? 20  LEU A CD2 1 
ATOM   3297 N N   . SER C 1 20  ? 52.917 51.855  61.237  1.00 24.63 ? 21  SER A N   1 
ATOM   3298 C CA  . SER C 1 20  ? 52.286 52.395  60.049  1.00 30.18 ? 21  SER A CA  1 
ATOM   3299 C C   . SER C 1 20  ? 51.970 51.242  59.124  1.00 27.66 ? 21  SER A C   1 
ATOM   3300 O O   . SER C 1 20  ? 52.471 50.134  59.304  1.00 24.93 ? 21  SER A O   1 
ATOM   3301 C CB  . SER C 1 20  ? 53.208 53.399  59.359  1.00 25.94 ? 21  SER A CB  1 
ATOM   3302 O OG  . SER C 1 20  ? 54.473 52.828  59.105  1.00 44.49 ? 21  SER A OG  1 
ATOM   3303 N N   . CYS C 1 21  ? 51.115 51.491  58.142  1.00 26.52 ? 22  CYS A N   1 
ATOM   3304 C CA  . CYS C 1 21  ? 50.763 50.449  57.187  1.00 23.69 ? 22  CYS A CA  1 
ATOM   3305 C C   . CYS C 1 21  ? 50.419 51.078  55.848  1.00 23.37 ? 22  CYS A C   1 
ATOM   3306 O O   . CYS C 1 21  ? 49.583 51.974  55.768  1.00 20.12 ? 22  CYS A O   1 
ATOM   3307 C CB  . CYS C 1 21  ? 49.576 49.646  57.698  1.00 26.58 ? 22  CYS A CB  1 
ATOM   3308 S SG  . CYS C 1 21  ? 48.930 48.410  56.515  1.00 33.05 ? 22  CYS A SG  1 
ATOM   3309 N N   . THR C 1 22  ? 51.093 50.627  54.803  1.00 22.70 ? 23  THR A N   1 
ATOM   3310 C CA  . THR C 1 22  ? 50.836 51.152  53.470  1.00 26.15 ? 23  THR A CA  1 
ATOM   3311 C C   . THR C 1 22  ? 50.116 50.068  52.700  1.00 29.11 ? 23  THR A C   1 
ATOM   3312 O O   . THR C 1 22  ? 50.028 48.931  53.154  1.00 25.74 ? 23  THR A O   1 
ATOM   3313 C CB  . THR C 1 22  ? 52.131 51.528  52.751  1.00 28.10 ? 23  THR A CB  1 
ATOM   3314 O OG1 . THR C 1 22  ? 53.037 50.422  52.795  1.00 26.08 ? 23  THR A OG1 1 
ATOM   3315 C CG2 . THR C 1 22  ? 52.763 52.744  53.416  1.00 32.19 ? 23  THR A CG2 1 
ATOM   3316 N N   . ALA C 1 23  ? 49.596 50.407  51.532  1.00 27.62 ? 24  ALA A N   1 
ATOM   3317 C CA  . ALA C 1 23  ? 48.862 49.417  50.785  1.00 26.72 ? 24  ALA A CA  1 
ATOM   3318 C C   . ALA C 1 23  ? 48.901 49.639  49.291  1.00 29.30 ? 24  ALA A C   1 
ATOM   3319 O O   . ALA C 1 23  ? 49.082 50.748  48.812  1.00 33.63 ? 24  ALA A O   1 
ATOM   3320 C CB  . ALA C 1 23  ? 47.431 49.395  51.261  1.00 23.95 ? 24  ALA A CB  1 
ATOM   3321 N N   . SER C 1 24  ? 48.738 48.549  48.562  1.00 35.12 ? 25  SER A N   1 
ATOM   3322 C CA  . SER C 1 24  ? 48.717 48.589  47.118  1.00 36.62 ? 25  SER A CA  1 
ATOM   3323 C C   . SER C 1 24  ? 47.421 47.892  46.710  1.00 34.22 ? 25  SER A C   1 
ATOM   3324 O O   . SER C 1 24  ? 47.199 46.735  47.069  1.00 33.83 ? 25  SER A O   1 
ATOM   3325 C CB  . SER C 1 24  ? 49.932 47.841  46.559  1.00 39.43 ? 25  SER A CB  1 
ATOM   3326 O OG  . SER C 1 24  ? 49.972 47.913  45.144  1.00 52.37 ? 25  SER A OG  1 
ATOM   3327 N N   . GLY C 1 25  ? 46.553 48.610  45.998  1.00 32.80 ? 26  GLY A N   1 
ATOM   3328 C CA  . GLY C 1 25  ? 45.304 48.014  45.540  1.00 26.65 ? 26  GLY A CA  1 
ATOM   3329 C C   . GLY C 1 25  ? 44.150 48.029  46.525  1.00 24.43 ? 26  GLY A C   1 
ATOM   3330 O O   . GLY C 1 25  ? 43.084 47.472  46.245  1.00 18.06 ? 26  GLY A O   1 
ATOM   3331 N N   . ILE C 1 26  ? 44.361 48.666  47.674  1.00 22.04 ? 27  ILE A N   1 
ATOM   3332 C CA  . ILE C 1 26  ? 43.343 48.769  48.707  1.00 18.18 ? 27  ILE A CA  1 
ATOM   3333 C C   . ILE C 1 26  ? 43.270 50.226  49.137  1.00 19.94 ? 27  ILE A C   1 
ATOM   3334 O O   . ILE C 1 26  ? 44.304 50.843  49.408  1.00 21.95 ? 27  ILE A O   1 
ATOM   3335 C CB  . ILE C 1 26  ? 43.711 47.895  49.920  1.00 29.54 ? 27  ILE A CB  1 
ATOM   3336 C CG1 . ILE C 1 26  ? 43.684 46.424  49.510  1.00 31.74 ? 27  ILE A CG1 1 
ATOM   3337 C CG2 . ILE C 1 26  ? 42.748 48.160  51.080  1.00 26.20 ? 27  ILE A CG2 1 
ATOM   3338 C CD1 . ILE C 1 26  ? 44.087 45.475  50.613  1.00 41.81 ? 27  ILE A CD1 1 
ATOM   3339 N N   . THR C 1 27  ? 42.058 50.777  49.185  1.00 19.16 ? 28  THR A N   1 
ATOM   3340 C CA  . THR C 1 27  ? 41.853 52.181  49.573  1.00 20.38 ? 28  THR A CA  1 
ATOM   3341 C C   . THR C 1 27  ? 41.303 52.200  50.999  1.00 21.41 ? 28  THR A C   1 
ATOM   3342 O O   . THR C 1 27  ? 40.096 52.077  51.227  1.00 21.55 ? 28  THR A O   1 
ATOM   3343 C CB  . THR C 1 27  ? 40.841 52.880  48.604  1.00 22.21 ? 28  THR A CB  1 
ATOM   3344 O OG1 . THR C 1 27  ? 41.252 52.644  47.253  1.00 25.68 ? 28  THR A OG1 1 
ATOM   3345 C CG2 . THR C 1 27  ? 40.821 54.395  48.828  1.00 17.10 ? 28  THR A CG2 1 
ATOM   3346 N N   . PHE C 1 28  ? 42.203 52.361  51.962  1.00 20.79 ? 29  PHE A N   1 
ATOM   3347 C CA  . PHE C 1 28  ? 41.840 52.360  53.380  1.00 18.86 ? 29  PHE A CA  1 
ATOM   3348 C C   . PHE C 1 28  ? 40.593 53.145  53.780  1.00 19.31 ? 29  PHE A C   1 
ATOM   3349 O O   . PHE C 1 28  ? 39.792 52.674  54.573  1.00 18.91 ? 29  PHE A O   1 
ATOM   3350 C CB  . PHE C 1 28  ? 43.035 52.866  54.200  1.00 20.14 ? 29  PHE A CB  1 
ATOM   3351 C CG  . PHE C 1 28  ? 44.232 51.951  54.161  1.00 10.35 ? 29  PHE A CG  1 
ATOM   3352 C CD1 . PHE C 1 28  ? 45.515 52.462  54.333  1.00 20.42 ? 29  PHE A CD1 1 
ATOM   3353 C CD2 . PHE C 1 28  ? 44.077 50.576  54.007  1.00 19.02 ? 29  PHE A CD2 1 
ATOM   3354 C CE1 . PHE C 1 28  ? 46.625 51.620  54.359  1.00 17.21 ? 29  PHE A CE1 1 
ATOM   3355 C CE2 . PHE C 1 28  ? 45.186 49.721  54.032  1.00 23.47 ? 29  PHE A CE2 1 
ATOM   3356 C CZ  . PHE C 1 28  ? 46.464 50.246  54.212  1.00 20.33 ? 29  PHE A CZ  1 
ATOM   3357 N N   . SER C 1 29  ? 40.429 54.343  53.233  1.00 19.95 ? 30  SER A N   1 
ATOM   3358 C CA  . SER C 1 29  ? 39.291 55.198  53.589  1.00 27.66 ? 30  SER A CA  1 
ATOM   3359 C C   . SER C 1 29  ? 37.902 54.602  53.347  1.00 28.88 ? 30  SER A C   1 
ATOM   3360 O O   . SER C 1 29  ? 36.905 55.097  53.888  1.00 24.46 ? 30  SER A O   1 
ATOM   3361 C CB  . SER C 1 29  ? 39.391 56.536  52.845  1.00 26.90 ? 30  SER A CB  1 
ATOM   3362 O OG  . SER C 1 29  ? 39.061 56.364  51.478  1.00 34.14 ? 30  SER A OG  1 
ATOM   3363 N N   . ARG C 1 30  ? 37.829 53.537  52.555  1.00 26.76 ? 32  ARG A N   1 
ATOM   3364 C CA  . ARG C 1 30  ? 36.546 52.927  52.240  1.00 26.34 ? 32  ARG A CA  1 
ATOM   3365 C C   . ARG C 1 30  ? 36.104 51.800  53.170  1.00 29.44 ? 32  ARG A C   1 
ATOM   3366 O O   . ARG C 1 30  ? 34.954 51.387  53.128  1.00 29.30 ? 32  ARG A O   1 
ATOM   3367 C CB  . ARG C 1 30  ? 36.570 52.412  50.793  1.00 32.36 ? 32  ARG A CB  1 
ATOM   3368 C CG  . ARG C 1 30  ? 37.182 53.421  49.827  1.00 41.94 ? 32  ARG A CG  1 
ATOM   3369 C CD  . ARG C 1 30  ? 36.600 53.361  48.418  1.00 52.21 ? 32  ARG A CD  1 
ATOM   3370 N NE  . ARG C 1 30  ? 36.893 52.112  47.724  1.00 52.99 ? 32  ARG A NE  1 
ATOM   3371 C CZ  . ARG C 1 30  ? 37.205 52.039  46.432  1.00 58.33 ? 32  ARG A CZ  1 
ATOM   3372 N NH1 . ARG C 1 30  ? 37.272 53.143  45.695  1.00 56.65 ? 32  ARG A NH1 1 
ATOM   3373 N NH2 . ARG C 1 30  ? 37.442 50.863  45.873  1.00 52.00 ? 32  ARG A NH2 1 
ATOM   3374 N N   . TYR C 1 31  ? 36.993 51.297  54.015  1.00 29.14 ? 34  TYR A N   1 
ATOM   3375 C CA  . TYR C 1 31  ? 36.591 50.203  54.889  1.00 29.57 ? 34  TYR A CA  1 
ATOM   3376 C C   . TYR C 1 31  ? 36.839 50.392  56.373  1.00 27.99 ? 34  TYR A C   1 
ATOM   3377 O O   . TYR C 1 31  ? 37.324 51.428  56.841  1.00 25.65 ? 34  TYR A O   1 
ATOM   3378 C CB  . TYR C 1 31  ? 37.298 48.904  54.502  1.00 33.07 ? 34  TYR A CB  1 
ATOM   3379 C CG  . TYR C 1 31  ? 37.555 48.714  53.032  1.00 28.47 ? 34  TYR A CG  1 
ATOM   3380 C CD1 . TYR C 1 31  ? 38.685 49.265  52.426  1.00 28.44 ? 34  TYR A CD1 1 
ATOM   3381 C CD2 . TYR C 1 31  ? 36.684 47.964  52.251  1.00 32.03 ? 34  TYR A CD2 1 
ATOM   3382 C CE1 . TYR C 1 31  ? 38.942 49.065  51.074  1.00 20.77 ? 34  TYR A CE1 1 
ATOM   3383 C CE2 . TYR C 1 31  ? 36.925 47.760  50.902  1.00 28.54 ? 34  TYR A CE2 1 
ATOM   3384 C CZ  . TYR C 1 31  ? 38.055 48.310  50.319  1.00 33.45 ? 34  TYR A CZ  1 
ATOM   3385 O OH  . TYR C 1 31  ? 38.302 48.094  48.982  1.00 32.16 ? 34  TYR A OH  1 
ATOM   3386 N N   . ILE C 1 32  ? 36.475 49.349  57.105  1.00 23.77 ? 35  ILE A N   1 
ATOM   3387 C CA  . ILE C 1 32  ? 36.696 49.294  58.537  1.00 24.28 ? 35  ILE A CA  1 
ATOM   3388 C C   . ILE C 1 32  ? 38.088 48.685  58.576  1.00 16.48 ? 35  ILE A C   1 
ATOM   3389 O O   . ILE C 1 32  ? 38.255 47.491  58.351  1.00 15.83 ? 35  ILE A O   1 
ATOM   3390 C CB  . ILE C 1 32  ? 35.687 48.343  59.203  1.00 27.41 ? 35  ILE A CB  1 
ATOM   3391 C CG1 . ILE C 1 32  ? 34.273 48.893  58.996  1.00 30.69 ? 35  ILE A CG1 1 
ATOM   3392 C CG2 . ILE C 1 32  ? 36.011 48.174  60.685  1.00 26.28 ? 35  ILE A CG2 1 
ATOM   3393 C CD1 . ILE C 1 32  ? 33.163 47.917  59.347  1.00 32.99 ? 35  ILE A CD1 1 
ATOM   3394 N N   . MET C 1 33  ? 39.100 49.515  58.781  1.00 12.92 ? 36  MET A N   1 
ATOM   3395 C CA  . MET C 1 33  ? 40.467 49.016  58.841  1.00 17.81 ? 36  MET A CA  1 
ATOM   3396 C C   . MET C 1 33  ? 40.771 48.629  60.291  1.00 26.18 ? 36  MET A C   1 
ATOM   3397 O O   . MET C 1 33  ? 40.302 49.290  61.224  1.00 25.55 ? 36  MET A O   1 
ATOM   3398 C CB  . MET C 1 33  ? 41.436 50.084  58.351  1.00 12.65 ? 36  MET A CB  1 
ATOM   3399 C CG  . MET C 1 33  ? 41.291 50.381  56.848  1.00 23.96 ? 36  MET A CG  1 
ATOM   3400 S SD  . MET C 1 33  ? 41.425 48.865  55.910  1.00 23.02 ? 36  MET A SD  1 
ATOM   3401 C CE  . MET C 1 33  ? 43.146 48.378  56.264  1.00 20.28 ? 36  MET A CE  1 
ATOM   3402 N N   . SER C 1 34  ? 41.552 47.566  60.474  1.00 23.82 ? 37  SER A N   1 
ATOM   3403 C CA  . SER C 1 34  ? 41.852 47.088  61.813  1.00 18.65 ? 37  SER A CA  1 
ATOM   3404 C C   . SER C 1 34  ? 43.314 46.748  62.037  1.00 25.08 ? 37  SER A C   1 
ATOM   3405 O O   . SER C 1 34  ? 44.108 46.667  61.099  1.00 21.65 ? 37  SER A O   1 
ATOM   3406 C CB  . SER C 1 34  ? 41.038 45.828  62.122  1.00 16.79 ? 37  SER A CB  1 
ATOM   3407 O OG  . SER C 1 34  ? 39.649 46.027  62.014  1.00 21.79 ? 37  SER A OG  1 
ATOM   3408 N N   . TRP C 1 35  ? 43.657 46.578  63.310  1.00 21.66 ? 38  TRP A N   1 
ATOM   3409 C CA  . TRP C 1 35  ? 44.993 46.156  63.707  1.00 15.10 ? 38  TRP A CA  1 
ATOM   3410 C C   . TRP C 1 35  ? 44.707 44.945  64.582  1.00 11.49 ? 38  TRP A C   1 
ATOM   3411 O O   . TRP C 1 35  ? 43.733 44.935  65.347  1.00 12.26 ? 38  TRP A O   1 
ATOM   3412 C CB  . TRP C 1 35  ? 45.725 47.229  64.524  1.00 21.17 ? 38  TRP A CB  1 
ATOM   3413 C CG  . TRP C 1 35  ? 46.342 48.355  63.726  1.00 19.57 ? 38  TRP A CG  1 
ATOM   3414 C CD1 . TRP C 1 35  ? 45.827 49.612  63.545  1.00 16.48 ? 38  TRP A CD1 1 
ATOM   3415 C CD2 . TRP C 1 35  ? 47.604 48.341  63.034  1.00 18.95 ? 38  TRP A CD2 1 
ATOM   3416 N NE1 . TRP C 1 35  ? 46.686 50.376  62.794  1.00 17.75 ? 38  TRP A NE1 1 
ATOM   3417 C CE2 . TRP C 1 35  ? 47.784 49.626  62.469  1.00 10.92 ? 38  TRP A CE2 1 
ATOM   3418 C CE3 . TRP C 1 35  ? 48.600 47.373  62.841  1.00 18.66 ? 38  TRP A CE3 1 
ATOM   3419 C CZ2 . TRP C 1 35  ? 48.922 49.968  61.724  1.00 12.89 ? 38  TRP A CZ2 1 
ATOM   3420 C CZ3 . TRP C 1 35  ? 49.729 47.714  62.102  1.00 16.50 ? 38  TRP A CZ3 1 
ATOM   3421 C CH2 . TRP C 1 35  ? 49.877 49.001  61.555  1.00 18.13 ? 38  TRP A CH2 1 
ATOM   3422 N N   . VAL C 1 36  ? 45.516 43.902  64.442  1.00 12.76 ? 39  VAL A N   1 
ATOM   3423 C CA  . VAL C 1 36  ? 45.347 42.696  65.245  1.00 17.21 ? 39  VAL A CA  1 
ATOM   3424 C C   . VAL C 1 36  ? 46.750 42.256  65.626  1.00 18.80 ? 39  VAL A C   1 
ATOM   3425 O O   . VAL C 1 36  ? 47.725 42.724  65.051  1.00 23.45 ? 39  VAL A O   1 
ATOM   3426 C CB  . VAL C 1 36  ? 44.660 41.552  64.452  1.00 23.62 ? 39  VAL A CB  1 
ATOM   3427 C CG1 . VAL C 1 36  ? 43.269 41.989  64.030  1.00 26.54 ? 39  VAL A CG1 1 
ATOM   3428 C CG2 . VAL C 1 36  ? 45.509 41.182  63.226  1.00 15.85 ? 39  VAL A CG2 1 
ATOM   3429 N N   . ARG C 1 37  ? 46.865 41.357  66.591  1.00 20.52 ? 40  ARG A N   1 
ATOM   3430 C CA  . ARG C 1 37  ? 48.190 40.946  67.003  1.00 20.86 ? 40  ARG A CA  1 
ATOM   3431 C C   . ARG C 1 37  ? 48.189 39.522  67.486  1.00 20.94 ? 40  ARG A C   1 
ATOM   3432 O O   . ARG C 1 37  ? 47.178 39.016  67.968  1.00 22.57 ? 40  ARG A O   1 
ATOM   3433 C CB  . ARG C 1 37  ? 48.693 41.863  68.124  1.00 15.12 ? 40  ARG A CB  1 
ATOM   3434 C CG  . ARG C 1 37  ? 47.966 41.669  69.449  1.00 10.20 ? 40  ARG A CG  1 
ATOM   3435 C CD  . ARG C 1 37  ? 48.470 42.691  70.482  1.00 19.31 ? 40  ARG A CD  1 
ATOM   3436 N NE  . ARG C 1 37  ? 47.694 42.625  71.713  1.00 19.60 ? 40  ARG A NE  1 
ATOM   3437 C CZ  . ARG C 1 37  ? 47.828 43.466  72.727  1.00 26.57 ? 40  ARG A CZ  1 
ATOM   3438 N NH1 . ARG C 1 37  ? 48.711 44.455  72.662  1.00 13.52 ? 40  ARG A NH1 1 
ATOM   3439 N NH2 . ARG C 1 37  ? 47.081 43.305  73.809  1.00 19.47 ? 40  ARG A NH2 1 
ATOM   3440 N N   . GLN C 1 38  ? 49.329 38.865  67.340  1.00 27.59 ? 41  GLN A N   1 
ATOM   3441 C CA  . GLN C 1 38  ? 49.438 37.499  67.806  1.00 30.98 ? 41  GLN A CA  1 
ATOM   3442 C C   . GLN C 1 38  ? 50.711 37.291  68.601  1.00 31.21 ? 41  GLN A C   1 
ATOM   3443 O O   . GLN C 1 38  ? 51.794 37.704  68.194  1.00 27.13 ? 41  GLN A O   1 
ATOM   3444 C CB  . GLN C 1 38  ? 49.379 36.505  66.641  1.00 33.45 ? 41  GLN A CB  1 
ATOM   3445 C CG  . GLN C 1 38  ? 50.510 36.607  65.626  1.00 42.73 ? 41  GLN A CG  1 
ATOM   3446 C CD  . GLN C 1 38  ? 50.483 35.466  64.607  1.00 46.55 ? 41  GLN A CD  1 
ATOM   3447 O OE1 . GLN C 1 38  ? 51.158 35.520  63.572  1.00 41.86 ? 41  GLN A OE1 1 
ATOM   3448 N NE2 . GLN C 1 38  ? 49.710 34.423  64.905  1.00 44.69 ? 41  GLN A NE2 1 
ATOM   3449 N N   . ILE C 1 39  ? 50.552 36.688  69.770  1.00 38.35 ? 42  ILE A N   1 
ATOM   3450 C CA  . ILE C 1 39  ? 51.684 36.361  70.619  1.00 51.50 ? 42  ILE A CA  1 
ATOM   3451 C C   . ILE C 1 39  ? 52.072 34.980  70.104  1.00 58.24 ? 42  ILE A C   1 
ATOM   3452 O O   . ILE C 1 39  ? 51.199 34.173  69.812  1.00 53.52 ? 42  ILE A O   1 
ATOM   3453 C CB  . ILE C 1 39  ? 51.262 36.265  72.105  1.00 49.71 ? 42  ILE A CB  1 
ATOM   3454 C CG1 . ILE C 1 39  ? 51.084 37.667  72.689  1.00 52.27 ? 42  ILE A CG1 1 
ATOM   3455 C CG2 . ILE C 1 39  ? 52.299 35.495  72.899  1.00 55.76 ? 42  ILE A CG2 1 
ATOM   3456 C CD1 . ILE C 1 39  ? 49.956 38.468  72.078  1.00 42.02 ? 42  ILE A CD1 1 
ATOM   3457 N N   . PRO C 1 40  ? 53.378 34.698  69.964  1.00 66.76 ? 43  PRO A N   1 
ATOM   3458 C CA  . PRO C 1 40  ? 53.799 33.383  69.469  1.00 71.63 ? 43  PRO A CA  1 
ATOM   3459 C C   . PRO C 1 40  ? 52.934 32.238  69.994  1.00 72.58 ? 43  PRO A C   1 
ATOM   3460 O O   . PRO C 1 40  ? 52.738 31.234  69.308  1.00 74.32 ? 43  PRO A O   1 
ATOM   3461 C CB  . PRO C 1 40  ? 55.246 33.297  69.932  1.00 72.45 ? 43  PRO A CB  1 
ATOM   3462 C CG  . PRO C 1 40  ? 55.705 34.711  69.757  1.00 72.86 ? 43  PRO A CG  1 
ATOM   3463 C CD  . PRO C 1 40  ? 54.548 35.510  70.345  1.00 69.47 ? 43  PRO A CD  1 
ATOM   3464 N N   . GLU C 1 41  ? 52.408 32.400  71.205  1.00 71.69 ? 44  GLU A N   1 
ATOM   3465 C CA  . GLU C 1 41  ? 51.544 31.388  71.801  1.00 73.07 ? 44  GLU A CA  1 
ATOM   3466 C C   . GLU C 1 41  ? 50.380 31.063  70.859  1.00 72.07 ? 44  GLU A C   1 
ATOM   3467 O O   . GLU C 1 41  ? 49.713 30.037  71.007  1.00 73.28 ? 44  GLU A O   1 
ATOM   3468 C CB  . GLU C 1 41  ? 51.018 31.883  73.152  1.00 74.87 ? 44  GLU A CB  1 
ATOM   3469 C CG  . GLU C 1 41  ? 49.939 31.002  73.759  1.00 79.32 ? 44  GLU A CG  1 
ATOM   3470 C CD  . GLU C 1 41  ? 48.560 31.299  73.197  1.00 81.45 ? 44  GLU A CD  1 
ATOM   3471 O OE1 . GLU C 1 41  ? 47.731 30.365  73.132  1.00 81.42 ? 44  GLU A OE1 1 
ATOM   3472 O OE2 . GLU C 1 41  ? 48.305 32.469  72.833  1.00 77.79 ? 44  GLU A OE2 1 
ATOM   3473 N N   . LYS C 1 42  ? 50.157 31.958  69.897  1.00 71.51 ? 45  LYS A N   1 
ATOM   3474 C CA  . LYS C 1 42  ? 49.114 31.851  68.873  1.00 66.89 ? 45  LYS A CA  1 
ATOM   3475 C C   . LYS C 1 42  ? 47.719 32.326  69.269  1.00 63.15 ? 45  LYS A C   1 
ATOM   3476 O O   . LYS C 1 42  ? 47.426 32.547  70.443  1.00 64.08 ? 45  LYS A O   1 
ATOM   3477 C CB  . LYS C 1 42  ? 49.054 30.425  68.311  1.00 67.97 ? 45  LYS A CB  1 
ATOM   3478 C CG  . LYS C 1 42  ? 50.368 29.988  67.675  1.00 62.10 ? 45  LYS A CG  1 
ATOM   3479 C CD  . LYS C 1 42  ? 50.933 31.109  66.819  1.00 61.19 ? 45  LYS A CD  1 
ATOM   3480 C CE  . LYS C 1 42  ? 52.338 30.805  66.353  1.00 60.89 ? 45  LYS A CE  1 
ATOM   3481 N NZ  . LYS C 1 42  ? 52.979 32.034  65.822  1.00 60.13 ? 45  LYS A NZ  1 
ATOM   3482 N N   . ARG C 1 43  ? 46.873 32.483  68.256  1.00 57.68 ? 46  ARG A N   1 
ATOM   3483 C CA  . ARG C 1 43  ? 45.500 32.966  68.407  1.00 53.18 ? 46  ARG A CA  1 
ATOM   3484 C C   . ARG C 1 43  ? 45.496 34.490  68.339  1.00 47.18 ? 46  ARG A C   1 
ATOM   3485 O O   . ARG C 1 43  ? 45.989 35.172  69.242  1.00 46.09 ? 46  ARG A O   1 
ATOM   3486 C CB  . ARG C 1 43  ? 44.863 32.517  69.731  1.00 52.24 ? 46  ARG A CB  1 
ATOM   3487 C CG  . ARG C 1 43  ? 43.419 32.990  69.856  1.00 49.91 ? 46  ARG A CG  1 
ATOM   3488 C CD  . ARG C 1 43  ? 42.660 32.246  70.919  1.00 51.23 ? 46  ARG A CD  1 
ATOM   3489 N NE  . ARG C 1 43  ? 41.223 32.318  70.687  1.00 43.99 ? 46  ARG A NE  1 
ATOM   3490 C CZ  . ARG C 1 43  ? 40.323 31.601  71.351  1.00 47.91 ? 46  ARG A CZ  1 
ATOM   3491 N NH1 . ARG C 1 43  ? 40.710 30.757  72.299  1.00 44.86 ? 46  ARG A NH1 1 
ATOM   3492 N NH2 . ARG C 1 43  ? 39.035 31.710  71.053  1.00 45.53 ? 46  ARG A NH2 1 
ATOM   3493 N N   . LEU C 1 44  ? 44.931 35.013  67.260  1.00 39.91 ? 47  LEU A N   1 
ATOM   3494 C CA  . LEU C 1 44  ? 44.865 36.441  67.047  1.00 33.67 ? 47  LEU A CA  1 
ATOM   3495 C C   . LEU C 1 44  ? 44.080 37.195  68.097  1.00 30.52 ? 47  LEU A C   1 
ATOM   3496 O O   . LEU C 1 44  ? 43.106 36.693  68.653  1.00 36.57 ? 47  LEU A O   1 
ATOM   3497 C CB  . LEU C 1 44  ? 44.271 36.739  65.676  1.00 39.06 ? 47  LEU A CB  1 
ATOM   3498 C CG  . LEU C 1 44  ? 45.145 36.377  64.483  1.00 39.94 ? 47  LEU A CG  1 
ATOM   3499 C CD1 . LEU C 1 44  ? 44.425 36.766  63.217  1.00 39.06 ? 47  LEU A CD1 1 
ATOM   3500 C CD2 . LEU C 1 44  ? 46.479 37.100  64.575  1.00 41.98 ? 47  LEU A CD2 1 
ATOM   3501 N N   . GLU C 1 45  ? 44.520 38.420  68.354  1.00 27.14 ? 48  GLU A N   1 
ATOM   3502 C CA  . GLU C 1 45  ? 43.871 39.296  69.315  1.00 30.73 ? 48  GLU A CA  1 
ATOM   3503 C C   . GLU C 1 45  ? 43.543 40.616  68.619  1.00 21.70 ? 48  GLU A C   1 
ATOM   3504 O O   . GLU C 1 45  ? 44.433 41.263  68.068  1.00 21.45 ? 48  GLU A O   1 
ATOM   3505 C CB  . GLU C 1 45  ? 44.815 39.568  70.491  1.00 28.47 ? 48  GLU A CB  1 
ATOM   3506 C CG  . GLU C 1 45  ? 44.129 40.129  71.719  1.00 46.59 ? 48  GLU A CG  1 
ATOM   3507 C CD  . GLU C 1 45  ? 45.111 40.475  72.823  1.00 50.21 ? 48  GLU A CD  1 
ATOM   3508 O OE1 . GLU C 1 45  ? 46.091 39.717  72.999  1.00 51.79 ? 48  GLU A OE1 1 
ATOM   3509 O OE2 . GLU C 1 45  ? 44.898 41.496  73.515  1.00 53.84 ? 48  GLU A OE2 1 
ATOM   3510 N N   . TRP C 1 46  ? 42.279 41.018  68.639  1.00 21.02 ? 49  TRP A N   1 
ATOM   3511 C CA  . TRP C 1 46  ? 41.883 42.287  68.018  1.00 23.29 ? 49  TRP A CA  1 
ATOM   3512 C C   . TRP C 1 46  ? 42.518 43.410  68.829  1.00 23.60 ? 49  TRP A C   1 
ATOM   3513 O O   . TRP C 1 46  ? 42.515 43.365  70.053  1.00 19.91 ? 49  TRP A O   1 
ATOM   3514 C CB  . TRP C 1 46  ? 40.364 42.422  68.035  1.00 22.85 ? 49  TRP A CB  1 
ATOM   3515 C CG  . TRP C 1 46  ? 39.836 43.769  67.641  1.00 24.38 ? 49  TRP A CG  1 
ATOM   3516 C CD1 . TRP C 1 46  ? 40.057 44.436  66.460  1.00 25.58 ? 49  TRP A CD1 1 
ATOM   3517 C CD2 . TRP C 1 46  ? 38.953 44.595  68.408  1.00 29.63 ? 49  TRP A CD2 1 
ATOM   3518 N NE1 . TRP C 1 46  ? 39.366 45.620  66.450  1.00 25.75 ? 49  TRP A NE1 1 
ATOM   3519 C CE2 . TRP C 1 46  ? 38.679 45.746  67.633  1.00 26.80 ? 49  TRP A CE2 1 
ATOM   3520 C CE3 . TRP C 1 46  ? 38.360 44.473  69.676  1.00 24.54 ? 49  TRP A CE3 1 
ATOM   3521 C CZ2 . TRP C 1 46  ? 37.840 46.772  68.087  1.00 26.73 ? 49  TRP A CZ2 1 
ATOM   3522 C CZ3 . TRP C 1 46  ? 37.521 45.494  70.124  1.00 26.43 ? 49  TRP A CZ3 1 
ATOM   3523 C CH2 . TRP C 1 46  ? 37.272 46.628  69.330  1.00 26.17 ? 49  TRP A CH2 1 
ATOM   3524 N N   . VAL C 1 47  ? 43.054 44.415  68.148  1.00 22.67 ? 50  VAL A N   1 
ATOM   3525 C CA  . VAL C 1 47  ? 43.708 45.525  68.826  1.00 23.78 ? 50  VAL A CA  1 
ATOM   3526 C C   . VAL C 1 47  ? 42.987 46.854  68.644  1.00 24.50 ? 50  VAL A C   1 
ATOM   3527 O O   . VAL C 1 47  ? 42.907 47.651  69.573  1.00 18.25 ? 50  VAL A O   1 
ATOM   3528 C CB  . VAL C 1 47  ? 45.161 45.667  68.343  1.00 27.37 ? 50  VAL A CB  1 
ATOM   3529 C CG1 . VAL C 1 47  ? 45.825 46.858  69.014  1.00 28.88 ? 50  VAL A CG1 1 
ATOM   3530 C CG2 . VAL C 1 47  ? 45.925 44.391  68.648  1.00 36.83 ? 50  VAL A CG2 1 
ATOM   3531 N N   . ALA C 1 48  ? 42.467 47.093  67.445  1.00 21.33 ? 51  ALA A N   1 
ATOM   3532 C CA  . ALA C 1 48  ? 41.760 48.337  67.158  1.00 21.75 ? 51  ALA A CA  1 
ATOM   3533 C C   . ALA C 1 48  ? 41.170 48.323  65.753  1.00 20.12 ? 51  ALA A C   1 
ATOM   3534 O O   . ALA C 1 48  ? 41.669 47.622  64.875  1.00 15.74 ? 51  ALA A O   1 
ATOM   3535 C CB  . ALA C 1 48  ? 42.712 49.532  67.301  1.00 16.73 ? 51  ALA A CB  1 
ATOM   3536 N N   . SER C 1 49  ? 40.104 49.104  65.566  1.00 24.70 ? 52  SER A N   1 
ATOM   3537 C CA  . SER C 1 49  ? 39.427 49.246  64.268  1.00 26.31 ? 52  SER A CA  1 
ATOM   3538 C C   . SER C 1 49  ? 38.984 50.700  64.106  1.00 26.51 ? 52  SER A C   1 
ATOM   3539 O O   . SER C 1 49  ? 38.786 51.412  65.100  1.00 22.10 ? 52  SER A O   1 
ATOM   3540 C CB  . SER C 1 49  ? 38.177 48.349  64.173  1.00 18.42 ? 52  SER A CB  1 
ATOM   3541 O OG  . SER C 1 49  ? 38.507 46.979  64.017  1.00 23.70 ? 52  SER A OG  1 
ATOM   3542 N N   . ILE C 1 50  ? 38.844 51.132  62.855  1.00 24.37 ? 53  ILE A N   1 
ATOM   3543 C CA  . ILE C 1 50  ? 38.385 52.479  62.544  1.00 21.59 ? 53  ILE A CA  1 
ATOM   3544 C C   . ILE C 1 50  ? 37.471 52.349  61.334  1.00 24.60 ? 53  ILE A C   1 
ATOM   3545 O O   . ILE C 1 50  ? 37.862 51.810  60.303  1.00 24.18 ? 53  ILE A O   1 
ATOM   3546 C CB  . ILE C 1 50  ? 39.551 53.447  62.229  1.00 21.23 ? 53  ILE A CB  1 
ATOM   3547 C CG1 . ILE C 1 50  ? 38.991 54.858  61.983  1.00 23.13 ? 53  ILE A CG1 1 
ATOM   3548 C CG2 . ILE C 1 50  ? 40.364 52.939  61.047  1.00 17.18 ? 53  ILE A CG2 1 
ATOM   3549 C CD1 . ILE C 1 50  ? 40.043 55.939  61.802  1.00 19.30 ? 53  ILE A CD1 1 
ATOM   3550 N N   . SER C 1 51  ? 36.245 52.831  61.477  1.00 25.62 ? 54  SER A N   1 
ATOM   3551 C CA  . SER C 1 51  ? 35.263 52.731  60.410  1.00 28.68 ? 54  SER A CA  1 
ATOM   3552 C C   . SER C 1 51  ? 35.557 53.670  59.260  1.00 25.72 ? 54  SER A C   1 
ATOM   3553 O O   . SER C 1 51  ? 36.489 54.477  59.304  1.00 22.52 ? 54  SER A O   1 
ATOM   3554 C CB  . SER C 1 51  ? 33.860 53.017  60.950  1.00 27.88 ? 54  SER A CB  1 
ATOM   3555 O OG  . SER C 1 51  ? 33.748 54.374  61.334  1.00 26.27 ? 54  SER A OG  1 
ATOM   3556 N N   . SER C 1 52  ? 34.754 53.551  58.217  1.00 20.46 ? 55  SER A N   1 
ATOM   3557 C CA  . SER C 1 52  ? 34.934 54.398  57.056  1.00 25.70 ? 55  SER A CA  1 
ATOM   3558 C C   . SER C 1 52  ? 34.647 55.828  57.519  1.00 22.34 ? 55  SER A C   1 
ATOM   3559 O O   . SER C 1 52  ? 35.294 56.770  57.094  1.00 24.71 ? 55  SER A O   1 
ATOM   3560 C CB  . SER C 1 52  ? 33.955 53.982  55.951  1.00 27.92 ? 55  SER A CB  1 
ATOM   3561 O OG  . SER C 1 52  ? 34.422 54.412  54.694  1.00 37.71 ? 55  SER A OG  1 
ATOM   3562 N N   . GLY C 1 53  ? 33.681 55.975  58.417  1.00 26.40 ? 56  GLY A N   1 
ATOM   3563 C CA  . GLY C 1 53  ? 33.347 57.295  58.921  1.00 33.24 ? 56  GLY A CA  1 
ATOM   3564 C C   . GLY C 1 53  ? 34.302 57.833  59.980  1.00 35.31 ? 56  GLY A C   1 
ATOM   3565 O O   . GLY C 1 53  ? 34.044 58.872  60.590  1.00 34.48 ? 56  GLY A O   1 
ATOM   3566 N N   . GLY C 1 54  ? 35.406 57.128  60.210  1.00 34.98 ? 57  GLY A N   1 
ATOM   3567 C CA  . GLY C 1 54  ? 36.372 57.586  61.193  1.00 30.51 ? 57  GLY A CA  1 
ATOM   3568 C C   . GLY C 1 54  ? 36.092 57.222  62.643  1.00 32.57 ? 57  GLY A C   1 
ATOM   3569 O O   . GLY C 1 54  ? 36.795 57.693  63.534  1.00 30.51 ? 57  GLY A O   1 
ATOM   3570 N N   . ILE C 1 55  ? 35.077 56.404  62.905  1.00 30.73 ? 58  ILE A N   1 
ATOM   3571 C CA  . ILE C 1 55  ? 34.783 56.004  64.281  1.00 35.66 ? 58  ILE A CA  1 
ATOM   3572 C C   . ILE C 1 55  ? 35.812 54.959  64.740  1.00 37.31 ? 58  ILE A C   1 
ATOM   3573 O O   . ILE C 1 55  ? 36.100 53.999  64.018  1.00 31.81 ? 58  ILE A O   1 
ATOM   3574 C CB  . ILE C 1 55  ? 33.389 55.378  64.404  1.00 38.04 ? 58  ILE A CB  1 
ATOM   3575 C CG1 . ILE C 1 55  ? 32.335 56.301  63.792  1.00 41.26 ? 58  ILE A CG1 1 
ATOM   3576 C CG2 . ILE C 1 55  ? 33.078 55.108  65.866  1.00 42.25 ? 58  ILE A CG2 1 
ATOM   3577 C CD1 . ILE C 1 55  ? 32.212 57.652  64.462  1.00 43.64 ? 58  ILE A CD1 1 
ATOM   3578 N N   . THR C 1 56  ? 36.359 55.142  65.941  1.00 34.44 ? 59  THR A N   1 
ATOM   3579 C CA  . THR C 1 56  ? 37.358 54.222  66.465  1.00 30.57 ? 59  THR A CA  1 
ATOM   3580 C C   . THR C 1 56  ? 36.826 53.273  67.532  1.00 33.39 ? 59  THR A C   1 
ATOM   3581 O O   . THR C 1 56  ? 36.022 53.654  68.379  1.00 35.53 ? 59  THR A O   1 
ATOM   3582 C CB  . THR C 1 56  ? 38.564 54.980  67.043  1.00 28.96 ? 59  THR A CB  1 
ATOM   3583 O OG1 . THR C 1 56  ? 38.137 55.831  68.122  1.00 22.71 ? 59  THR A OG1 1 
ATOM   3584 C CG2 . THR C 1 56  ? 39.227 55.803  65.948  1.00 27.23 ? 59  THR A CG2 1 
ATOM   3585 N N   . TYR C 1 57  ? 37.286 52.027  67.475  1.00 33.38 ? 60  TYR A N   1 
ATOM   3586 C CA  . TYR C 1 57  ? 36.876 51.000  68.419  1.00 30.98 ? 60  TYR A CA  1 
ATOM   3587 C C   . TYR C 1 57  ? 38.128 50.367  68.996  1.00 29.27 ? 60  TYR A C   1 
ATOM   3588 O O   . TYR C 1 57  ? 39.088 50.115  68.276  1.00 26.73 ? 60  TYR A O   1 
ATOM   3589 C CB  . TYR C 1 57  ? 36.044 49.917  67.731  1.00 34.71 ? 60  TYR A CB  1 
ATOM   3590 C CG  . TYR C 1 57  ? 34.860 50.451  66.963  1.00 37.08 ? 60  TYR A CG  1 
ATOM   3591 C CD1 . TYR C 1 57  ? 35.025 51.012  65.701  1.00 37.29 ? 60  TYR A CD1 1 
ATOM   3592 C CD2 . TYR C 1 57  ? 33.580 50.421  67.511  1.00 38.79 ? 60  TYR A CD2 1 
ATOM   3593 C CE1 . TYR C 1 57  ? 33.949 51.530  64.999  1.00 42.60 ? 60  TYR A CE1 1 
ATOM   3594 C CE2 . TYR C 1 57  ? 32.492 50.942  66.818  1.00 44.50 ? 60  TYR A CE2 1 
ATOM   3595 C CZ  . TYR C 1 57  ? 32.689 51.494  65.560  1.00 42.97 ? 60  TYR A CZ  1 
ATOM   3596 O OH  . TYR C 1 57  ? 31.628 52.012  64.857  1.00 51.04 ? 60  TYR A OH  1 
ATOM   3597 N N   . TYR C 1 58  ? 38.103 50.103  70.297  1.00 26.14 ? 61  TYR A N   1 
ATOM   3598 C CA  . TYR C 1 58  ? 39.246 49.515  70.979  1.00 24.51 ? 61  TYR A CA  1 
ATOM   3599 C C   . TYR C 1 58  ? 38.759 48.571  72.066  1.00 21.95 ? 61  TYR A C   1 
ATOM   3600 O O   . TYR C 1 58  ? 37.719 48.808  72.685  1.00 19.88 ? 61  TYR A O   1 
ATOM   3601 C CB  . TYR C 1 58  ? 40.074 50.601  71.692  1.00 26.15 ? 61  TYR A CB  1 
ATOM   3602 C CG  . TYR C 1 58  ? 40.574 51.740  70.844  1.00 21.82 ? 61  TYR A CG  1 
ATOM   3603 C CD1 . TYR C 1 58  ? 41.750 51.629  70.122  1.00 16.72 ? 61  TYR A CD1 1 
ATOM   3604 C CD2 . TYR C 1 58  ? 39.877 52.946  70.785  1.00 22.73 ? 61  TYR A CD2 1 
ATOM   3605 C CE1 . TYR C 1 58  ? 42.228 52.690  69.361  1.00 22.96 ? 61  TYR A CE1 1 
ATOM   3606 C CE2 . TYR C 1 58  ? 40.344 54.010  70.030  1.00 19.57 ? 61  TYR A CE2 1 
ATOM   3607 C CZ  . TYR C 1 58  ? 41.520 53.873  69.319  1.00 14.00 ? 61  TYR A CZ  1 
ATOM   3608 O OH  . TYR C 1 58  ? 41.983 54.907  68.552  1.00 24.59 ? 61  TYR A OH  1 
ATOM   3609 N N   . PRO C 1 59  ? 39.486 47.472  72.295  1.00 17.68 ? 62  PRO A N   1 
ATOM   3610 C CA  . PRO C 1 59  ? 39.067 46.557  73.359  1.00 24.35 ? 62  PRO A CA  1 
ATOM   3611 C C   . PRO C 1 59  ? 39.643 47.170  74.651  1.00 23.39 ? 62  PRO A C   1 
ATOM   3612 O O   . PRO C 1 59  ? 40.552 48.005  74.595  1.00 19.27 ? 62  PRO A O   1 
ATOM   3613 C CB  . PRO C 1 59  ? 39.758 45.250  72.985  1.00 23.43 ? 62  PRO A CB  1 
ATOM   3614 C CG  . PRO C 1 59  ? 41.027 45.730  72.345  1.00 19.23 ? 62  PRO A CG  1 
ATOM   3615 C CD  . PRO C 1 59  ? 40.539 46.866  71.464  1.00 18.88 ? 62  PRO A CD  1 
ATOM   3616 N N   . ASP C 1 60  ? 39.124 46.777  75.805  1.00 26.17 ? 63  ASP A N   1 
ATOM   3617 C CA  . ASP C 1 60  ? 39.622 47.341  77.059  1.00 33.75 ? 63  ASP A CA  1 
ATOM   3618 C C   . ASP C 1 60  ? 41.134 47.246  77.232  1.00 32.93 ? 63  ASP A C   1 
ATOM   3619 O O   . ASP C 1 60  ? 41.758 48.158  77.765  1.00 37.40 ? 63  ASP A O   1 
ATOM   3620 C CB  . ASP C 1 60  ? 38.940 46.671  78.250  1.00 35.00 ? 63  ASP A CB  1 
ATOM   3621 C CG  . ASP C 1 60  ? 37.461 46.991  78.328  1.00 40.59 ? 63  ASP A CG  1 
ATOM   3622 O OD1 . ASP C 1 60  ? 37.083 48.151  78.045  1.00 36.88 ? 63  ASP A OD1 1 
ATOM   3623 O OD2 . ASP C 1 60  ? 36.677 46.086  78.684  1.00 45.48 ? 63  ASP A OD2 1 
ATOM   3624 N N   . SER C 1 61  ? 41.720 46.151  76.766  1.00 31.73 ? 64  SER A N   1 
ATOM   3625 C CA  . SER C 1 61  ? 43.159 45.932  76.895  1.00 31.32 ? 64  SER A CA  1 
ATOM   3626 C C   . SER C 1 61  ? 44.056 47.069  76.429  1.00 31.24 ? 64  SER A C   1 
ATOM   3627 O O   . SER C 1 61  ? 45.204 47.158  76.861  1.00 34.08 ? 64  SER A O   1 
ATOM   3628 C CB  . SER C 1 61  ? 43.570 44.679  76.138  1.00 34.55 ? 64  SER A CB  1 
ATOM   3629 O OG  . SER C 1 61  ? 43.563 44.926  74.744  1.00 29.14 ? 64  SER A OG  1 
ATOM   3630 N N   . VAL C 1 62  ? 43.562 47.925  75.538  1.00 24.84 ? 65  VAL A N   1 
ATOM   3631 C CA  . VAL C 1 62  ? 44.394 49.019  75.046  1.00 19.52 ? 65  VAL A CA  1 
ATOM   3632 C C   . VAL C 1 62  ? 43.640 50.333  75.012  1.00 16.13 ? 65  VAL A C   1 
ATOM   3633 O O   . VAL C 1 62  ? 44.212 51.367  74.691  1.00 20.80 ? 65  VAL A O   1 
ATOM   3634 C CB  . VAL C 1 62  ? 44.942 48.711  73.614  1.00 23.40 ? 65  VAL A CB  1 
ATOM   3635 C CG1 . VAL C 1 62  ? 45.532 47.311  73.570  1.00 17.74 ? 65  VAL A CG1 1 
ATOM   3636 C CG2 . VAL C 1 62  ? 43.830 48.865  72.558  1.00 19.99 ? 65  VAL A CG2 1 
ATOM   3637 N N   . ALA C 1 63  ? 42.363 50.268  75.378  1.00 25.01 ? 66  ALA A N   1 
ATOM   3638 C CA  . ALA C 1 63  ? 41.427 51.392  75.361  1.00 31.08 ? 66  ALA A CA  1 
ATOM   3639 C C   . ALA C 1 63  ? 41.941 52.826  75.482  1.00 39.55 ? 66  ALA A C   1 
ATOM   3640 O O   . ALA C 1 63  ? 41.475 53.706  74.753  1.00 49.57 ? 66  ALA A O   1 
ATOM   3641 C CB  . ALA C 1 63  ? 40.327 51.161  76.395  1.00 31.77 ? 66  ALA A CB  1 
ATOM   3642 N N   . GLY C 1 64  ? 42.878 53.093  76.381  1.00 36.23 ? 67  GLY A N   1 
ATOM   3643 C CA  . GLY C 1 64  ? 43.331 54.472  76.491  1.00 34.52 ? 67  GLY A CA  1 
ATOM   3644 C C   . GLY C 1 64  ? 44.794 54.694  76.199  1.00 30.07 ? 67  GLY A C   1 
ATOM   3645 O O   . GLY C 1 64  ? 45.317 55.782  76.408  1.00 32.65 ? 67  GLY A O   1 
ATOM   3646 N N   . ARG C 1 65  ? 45.457 53.662  75.708  1.00 28.56 ? 68  ARG A N   1 
ATOM   3647 C CA  . ARG C 1 65  ? 46.875 53.741  75.407  1.00 29.04 ? 68  ARG A CA  1 
ATOM   3648 C C   . ARG C 1 65  ? 47.164 53.696  73.907  1.00 29.05 ? 68  ARG A C   1 
ATOM   3649 O O   . ARG C 1 65  ? 48.168 54.235  73.445  1.00 27.31 ? 68  ARG A O   1 
ATOM   3650 C CB  . ARG C 1 65  ? 47.599 52.592  76.111  1.00 29.15 ? 68  ARG A CB  1 
ATOM   3651 C CG  . ARG C 1 65  ? 47.357 52.562  77.613  1.00 33.84 ? 68  ARG A CG  1 
ATOM   3652 C CD  . ARG C 1 65  ? 48.050 51.381  78.268  1.00 27.52 ? 68  ARG A CD  1 
ATOM   3653 N NE  . ARG C 1 65  ? 47.536 50.102  77.797  1.00 18.40 ? 68  ARG A NE  1 
ATOM   3654 C CZ  . ARG C 1 65  ? 48.247 49.220  77.102  1.00 20.82 ? 68  ARG A CZ  1 
ATOM   3655 N NH1 . ARG C 1 65  ? 49.503 49.484  76.790  1.00 16.80 ? 68  ARG A NH1 1 
ATOM   3656 N NH2 . ARG C 1 65  ? 47.703 48.062  76.736  1.00 27.36 ? 68  ARG A NH2 1 
ATOM   3657 N N   . PHE C 1 66  ? 46.289 53.044  73.149  1.00 27.27 ? 69  PHE A N   1 
ATOM   3658 C CA  . PHE C 1 66  ? 46.478 52.931  71.704  1.00 27.74 ? 69  PHE A CA  1 
ATOM   3659 C C   . PHE C 1 66  ? 45.567 53.857  70.902  1.00 28.04 ? 69  PHE A C   1 
ATOM   3660 O O   . PHE C 1 66  ? 44.413 54.092  71.263  1.00 28.37 ? 69  PHE A O   1 
ATOM   3661 C CB  . PHE C 1 66  ? 46.247 51.482  71.246  1.00 29.14 ? 69  PHE A CB  1 
ATOM   3662 C CG  . PHE C 1 66  ? 47.303 50.511  71.718  1.00 28.79 ? 69  PHE A CG  1 
ATOM   3663 C CD1 . PHE C 1 66  ? 47.380 49.237  71.166  1.00 28.28 ? 69  PHE A CD1 1 
ATOM   3664 C CD2 . PHE C 1 66  ? 48.221 50.872  72.703  1.00 32.82 ? 69  PHE A CD2 1 
ATOM   3665 C CE1 . PHE C 1 66  ? 48.355 48.333  71.587  1.00 28.17 ? 69  PHE A CE1 1 
ATOM   3666 C CE2 . PHE C 1 66  ? 49.200 49.978  73.131  1.00 33.79 ? 69  PHE A CE2 1 
ATOM   3667 C CZ  . PHE C 1 66  ? 49.269 48.705  72.570  1.00 35.22 ? 69  PHE A CZ  1 
ATOM   3668 N N   . THR C 1 67  ? 46.089 54.392  69.808  1.00 25.66 ? 70  THR A N   1 
ATOM   3669 C CA  . THR C 1 67  ? 45.284 55.269  68.958  1.00 27.23 ? 70  THR A CA  1 
ATOM   3670 C C   . THR C 1 67  ? 45.413 54.866  67.494  1.00 21.91 ? 70  THR A C   1 
ATOM   3671 O O   . THR C 1 67  ? 46.495 54.930  66.912  1.00 20.68 ? 70  THR A O   1 
ATOM   3672 C CB  . THR C 1 67  ? 45.710 56.737  69.084  1.00 23.25 ? 70  THR A CB  1 
ATOM   3673 O OG1 . THR C 1 67  ? 45.530 57.170  70.438  1.00 23.87 ? 70  THR A OG1 1 
ATOM   3674 C CG2 . THR C 1 67  ? 44.856 57.613  68.142  1.00 26.58 ? 70  THR A CG2 1 
ATOM   3675 N N   . ILE C 1 68  ? 44.312 54.427  66.911  1.00 19.90 ? 71  ILE A N   1 
ATOM   3676 C CA  . ILE C 1 68  ? 44.331 54.036  65.512  1.00 23.18 ? 71  ILE A CA  1 
ATOM   3677 C C   . ILE C 1 68  ? 43.864 55.246  64.707  1.00 23.07 ? 71  ILE A C   1 
ATOM   3678 O O   . ILE C 1 68  ? 42.915 55.922  65.092  1.00 22.57 ? 71  ILE A O   1 
ATOM   3679 C CB  . ILE C 1 68  ? 43.381 52.842  65.250  1.00 17.84 ? 71  ILE A CB  1 
ATOM   3680 C CG1 . ILE C 1 68  ? 43.475 52.412  63.774  1.00 25.08 ? 71  ILE A CG1 1 
ATOM   3681 C CG2 . ILE C 1 68  ? 41.963 53.221  65.622  1.00 21.38 ? 71  ILE A CG2 1 
ATOM   3682 C CD1 . ILE C 1 68  ? 42.699 51.139  63.450  1.00 12.79 ? 71  ILE A CD1 1 
ATOM   3683 N N   . SER C 1 69  ? 44.558 55.542  63.617  1.00 22.71 ? 72  SER A N   1 
ATOM   3684 C CA  . SER C 1 69  ? 44.179 56.665  62.778  1.00 23.46 ? 72  SER A CA  1 
ATOM   3685 C C   . SER C 1 69  ? 44.486 56.330  61.322  1.00 29.29 ? 72  SER A C   1 
ATOM   3686 O O   . SER C 1 69  ? 45.186 55.351  61.028  1.00 31.37 ? 72  SER A O   1 
ATOM   3687 C CB  . SER C 1 69  ? 44.930 57.933  63.180  1.00 15.97 ? 72  SER A CB  1 
ATOM   3688 O OG  . SER C 1 69  ? 46.299 57.816  62.861  1.00 21.40 ? 72  SER A OG  1 
ATOM   3689 N N   . ARG C 1 70  ? 43.969 57.156  60.418  1.00 30.84 ? 73  ARG A N   1 
ATOM   3690 C CA  . ARG C 1 70  ? 44.149 56.936  58.992  1.00 28.64 ? 73  ARG A CA  1 
ATOM   3691 C C   . ARG C 1 70  ? 44.339 58.234  58.223  1.00 28.19 ? 73  ARG A C   1 
ATOM   3692 O O   . ARG C 1 70  ? 43.648 59.220  58.473  1.00 25.81 ? 73  ARG A O   1 
ATOM   3693 C CB  . ARG C 1 70  ? 42.921 56.190  58.456  1.00 28.74 ? 73  ARG A CB  1 
ATOM   3694 C CG  . ARG C 1 70  ? 42.773 56.154  56.935  1.00 30.71 ? 73  ARG A CG  1 
ATOM   3695 C CD  . ARG C 1 70  ? 41.560 55.314  56.550  1.00 25.33 ? 73  ARG A CD  1 
ATOM   3696 N NE  . ARG C 1 70  ? 40.332 55.835  57.132  1.00 26.70 ? 73  ARG A NE  1 
ATOM   3697 C CZ  . ARG C 1 70  ? 39.303 55.081  57.515  1.00 35.77 ? 73  ARG A CZ  1 
ATOM   3698 N NH1 . ARG C 1 70  ? 39.336 53.753  57.375  1.00 35.08 ? 73  ARG A NH1 1 
ATOM   3699 N NH2 . ARG C 1 70  ? 38.254 55.653  58.086  1.00 32.33 ? 73  ARG A NH2 1 
ATOM   3700 N N   . ASP C 1 71  ? 45.294 58.226  57.301  1.00 29.75 ? 74  ASP A N   1 
ATOM   3701 C CA  . ASP C 1 71  ? 45.540 59.376  56.445  1.00 29.26 ? 74  ASP A CA  1 
ATOM   3702 C C   . ASP C 1 71  ? 44.895 58.996  55.113  1.00 31.14 ? 74  ASP A C   1 
ATOM   3703 O O   . ASP C 1 71  ? 45.486 58.277  54.305  1.00 25.95 ? 74  ASP A O   1 
ATOM   3704 C CB  . ASP C 1 71  ? 47.042 59.613  56.268  1.00 25.39 ? 74  ASP A CB  1 
ATOM   3705 C CG  . ASP C 1 71  ? 47.347 60.712  55.256  1.00 36.45 ? 74  ASP A CG  1 
ATOM   3706 O OD1 . ASP C 1 71  ? 48.519 61.154  55.194  1.00 34.18 ? 74  ASP A OD1 1 
ATOM   3707 O OD2 . ASP C 1 71  ? 46.420 61.129  54.519  1.00 32.71 ? 74  ASP A OD2 1 
ATOM   3708 N N   . ASN C 1 72  ? 43.672 59.470  54.904  1.00 33.83 ? 75  ASN A N   1 
ATOM   3709 C CA  . ASN C 1 72  ? 42.918 59.172  53.693  1.00 34.15 ? 75  ASN A CA  1 
ATOM   3710 C C   . ASN C 1 72  ? 43.558 59.624  52.382  1.00 34.49 ? 75  ASN A C   1 
ATOM   3711 O O   . ASN C 1 72  ? 43.320 59.016  51.344  1.00 39.53 ? 75  ASN A O   1 
ATOM   3712 C CB  . ASN C 1 72  ? 41.506 59.755  53.802  1.00 36.29 ? 75  ASN A CB  1 
ATOM   3713 C CG  . ASN C 1 72  ? 40.724 59.174  54.967  1.00 38.48 ? 75  ASN A CG  1 
ATOM   3714 O OD1 . ASN C 1 72  ? 40.732 57.966  55.192  1.00 41.26 ? 75  ASN A OD1 1 
ATOM   3715 N ND2 . ASN C 1 72  ? 40.034 60.033  55.707  1.00 43.40 ? 75  ASN A ND2 1 
ATOM   3716 N N   . VAL C 1 73  ? 44.367 60.675  52.423  1.00 35.59 ? 76  VAL A N   1 
ATOM   3717 C CA  . VAL C 1 73  ? 45.016 61.176  51.215  1.00 35.47 ? 76  VAL A CA  1 
ATOM   3718 C C   . VAL C 1 73  ? 46.220 60.343  50.806  1.00 37.02 ? 76  VAL A C   1 
ATOM   3719 O O   . VAL C 1 73  ? 46.342 59.946  49.645  1.00 34.14 ? 76  VAL A O   1 
ATOM   3720 C CB  . VAL C 1 73  ? 45.508 62.630  51.381  1.00 38.06 ? 76  VAL A CB  1 
ATOM   3721 C CG1 . VAL C 1 73  ? 46.242 63.072  50.111  1.00 33.00 ? 76  VAL A CG1 1 
ATOM   3722 C CG2 . VAL C 1 73  ? 44.341 63.544  51.667  1.00 34.71 ? 76  VAL A CG2 1 
ATOM   3723 N N   . ARG C 1 74  ? 47.120 60.103  51.753  1.00 33.62 ? 77  ARG A N   1 
ATOM   3724 C CA  . ARG C 1 74  ? 48.311 59.314  51.472  1.00 30.79 ? 77  ARG A CA  1 
ATOM   3725 C C   . ARG C 1 74  ? 47.986 57.821  51.537  1.00 23.72 ? 77  ARG A C   1 
ATOM   3726 O O   . ARG C 1 74  ? 48.809 56.989  51.189  1.00 22.05 ? 77  ARG A O   1 
ATOM   3727 C CB  . ARG C 1 74  ? 49.406 59.642  52.488  1.00 35.26 ? 77  ARG A CB  1 
ATOM   3728 C CG  . ARG C 1 74  ? 50.691 60.181  51.888  1.00 48.22 ? 77  ARG A CG  1 
ATOM   3729 C CD  . ARG C 1 74  ? 50.796 61.675  52.101  1.00 48.63 ? 77  ARG A CD  1 
ATOM   3730 N NE  . ARG C 1 74  ? 50.582 62.012  53.501  1.00 54.69 ? 77  ARG A NE  1 
ATOM   3731 C CZ  . ARG C 1 74  ? 50.654 63.243  53.995  1.00 53.42 ? 77  ARG A CZ  1 
ATOM   3732 N NH1 . ARG C 1 74  ? 50.942 64.263  53.200  1.00 57.37 ? 77  ARG A NH1 1 
ATOM   3733 N NH2 . ARG C 1 74  ? 50.418 63.455  55.281  1.00 46.00 ? 77  ARG A NH2 1 
ATOM   3734 N N   . ASN C 1 75  ? 46.787 57.499  52.002  1.00 20.15 ? 78  ASN A N   1 
ATOM   3735 C CA  . ASN C 1 75  ? 46.338 56.113  52.126  1.00 25.07 ? 78  ASN A CA  1 
ATOM   3736 C C   . ASN C 1 75  ? 47.262 55.334  53.061  1.00 26.96 ? 78  ASN A C   1 
ATOM   3737 O O   . ASN C 1 75  ? 47.893 54.357  52.651  1.00 26.36 ? 78  ASN A O   1 
ATOM   3738 C CB  . ASN C 1 75  ? 46.304 55.446  50.743  1.00 26.91 ? 78  ASN A CB  1 
ATOM   3739 C CG  . ASN C 1 75  ? 45.515 54.157  50.743  1.00 24.89 ? 78  ASN A CG  1 
ATOM   3740 O OD1 . ASN C 1 75  ? 44.398 54.105  51.256  1.00 27.39 ? 78  ASN A OD1 1 
ATOM   3741 N ND2 . ASN C 1 75  ? 46.087 53.109  50.161  1.00 26.72 ? 78  ASN A ND2 1 
ATOM   3742 N N   . ILE C 1 76  ? 47.339 55.784  54.314  1.00 30.02 ? 79  ILE A N   1 
ATOM   3743 C CA  . ILE C 1 76  ? 48.188 55.158  55.329  1.00 29.25 ? 79  ILE A CA  1 
ATOM   3744 C C   . ILE C 1 76  ? 47.402 54.907  56.621  1.00 27.18 ? 79  ILE A C   1 
ATOM   3745 O O   . ILE C 1 76  ? 46.633 55.754  57.066  1.00 26.19 ? 79  ILE A O   1 
ATOM   3746 C CB  . ILE C 1 76  ? 49.411 56.059  55.652  1.00 29.47 ? 79  ILE A CB  1 
ATOM   3747 C CG1 . ILE C 1 76  ? 50.219 56.307  54.375  1.00 31.40 ? 79  ILE A CG1 1 
ATOM   3748 C CG2 . ILE C 1 76  ? 50.292 55.407  56.720  1.00 33.33 ? 79  ILE A CG2 1 
ATOM   3749 C CD1 . ILE C 1 76  ? 51.402 57.239  54.558  1.00 34.05 ? 79  ILE A CD1 1 
ATOM   3750 N N   . LEU C 1 77  ? 47.598 53.731  57.210  1.00 20.19 ? 80  LEU A N   1 
ATOM   3751 C CA  . LEU C 1 77  ? 46.918 53.363  58.451  1.00 24.43 ? 80  LEU A CA  1 
ATOM   3752 C C   . LEU C 1 77  ? 47.957 53.432  59.572  1.00 20.45 ? 80  LEU A C   1 
ATOM   3753 O O   . LEU C 1 77  ? 49.076 52.947  59.412  1.00 24.00 ? 80  LEU A O   1 
ATOM   3754 C CB  . LEU C 1 77  ? 46.369 51.935  58.349  1.00 17.58 ? 80  LEU A CB  1 
ATOM   3755 C CG  . LEU C 1 77  ? 45.069 51.481  59.012  1.00 25.27 ? 80  LEU A CG  1 
ATOM   3756 C CD1 . LEU C 1 77  ? 45.333 50.229  59.808  1.00 28.36 ? 80  LEU A CD1 1 
ATOM   3757 C CD2 . LEU C 1 77  ? 44.493 52.560  59.872  1.00 24.89 ? 80  LEU A CD2 1 
ATOM   3758 N N   . TYR C 1 78  ? 47.585 54.029  60.696  1.00 24.08 ? 81  TYR A N   1 
ATOM   3759 C CA  . TYR C 1 78  ? 48.514 54.169  61.816  1.00 22.61 ? 81  TYR A CA  1 
ATOM   3760 C C   . TYR C 1 78  ? 48.016 53.546  63.106  1.00 20.43 ? 81  TYR A C   1 
ATOM   3761 O O   . TYR C 1 78  ? 46.818 53.381  63.317  1.00 20.44 ? 81  TYR A O   1 
ATOM   3762 C CB  . TYR C 1 78  ? 48.804 55.647  62.106  1.00 20.96 ? 81  TYR A CB  1 
ATOM   3763 C CG  . TYR C 1 78  ? 49.500 56.412  61.002  1.00 26.20 ? 81  TYR A CG  1 
ATOM   3764 C CD1 . TYR C 1 78  ? 48.796 57.301  60.198  1.00 24.77 ? 81  TYR A CD1 1 
ATOM   3765 C CD2 . TYR C 1 78  ? 50.871 56.275  60.786  1.00 25.89 ? 81  TYR A CD2 1 
ATOM   3766 C CE1 . TYR C 1 78  ? 49.441 58.043  59.201  1.00 28.48 ? 81  TYR A CE1 1 
ATOM   3767 C CE2 . TYR C 1 78  ? 51.522 57.013  59.790  1.00 26.72 ? 81  TYR A CE2 1 
ATOM   3768 C CZ  . TYR C 1 78  ? 50.800 57.890  59.008  1.00 25.64 ? 81  TYR A CZ  1 
ATOM   3769 O OH  . TYR C 1 78  ? 51.438 58.613  58.027  1.00 34.80 ? 81  TYR A OH  1 
ATOM   3770 N N   . LEU C 1 79  ? 48.967 53.218  63.974  1.00 23.68 ? 82  LEU A N   1 
ATOM   3771 C CA  . LEU C 1 79  ? 48.674 52.645  65.268  1.00 24.10 ? 82  LEU A CA  1 
ATOM   3772 C C   . LEU C 1 79  ? 49.667 53.286  66.246  1.00 25.85 ? 82  LEU A C   1 
ATOM   3773 O O   . LEU C 1 79  ? 50.837 52.907  66.318  1.00 28.23 ? 82  LEU A O   1 
ATOM   3774 C CB  . LEU C 1 79  ? 48.846 51.128  65.215  1.00 26.04 ? 82  LEU A CB  1 
ATOM   3775 C CG  . LEU C 1 79  ? 48.232 50.215  66.285  1.00 32.13 ? 82  LEU A CG  1 
ATOM   3776 C CD1 . LEU C 1 79  ? 49.285 49.809  67.266  1.00 38.17 ? 82  LEU A CD1 1 
ATOM   3777 C CD2 . LEU C 1 79  ? 47.059 50.885  66.964  1.00 19.12 ? 82  LEU A CD2 1 
ATOM   3778 N N   . GLN C 1 80  ? 49.204 54.299  66.960  1.00 22.14 ? 83  GLN A N   1 
ATOM   3779 C CA  . GLN C 1 80  ? 50.048 54.978  67.929  1.00 22.99 ? 83  GLN A CA  1 
ATOM   3780 C C   . GLN C 1 80  ? 49.903 54.236  69.257  1.00 19.18 ? 83  GLN A C   1 
ATOM   3781 O O   . GLN C 1 80  ? 48.818 54.168  69.831  1.00 20.75 ? 83  GLN A O   1 
ATOM   3782 C CB  . GLN C 1 80  ? 49.610 56.435  68.069  1.00 21.30 ? 83  GLN A CB  1 
ATOM   3783 C CG  . GLN C 1 80  ? 50.252 57.196  69.243  1.00 31.51 ? 83  GLN A CG  1 
ATOM   3784 C CD  . GLN C 1 80  ? 51.761 57.135  69.233  1.00 33.14 ? 83  GLN A CD  1 
ATOM   3785 O OE1 . GLN C 1 80  ? 52.413 57.625  68.313  1.00 42.52 ? 83  GLN A OE1 1 
ATOM   3786 N NE2 . GLN C 1 80  ? 52.329 56.523  70.265  1.00 49.11 ? 83  GLN A NE2 1 
ATOM   3787 N N   . MET C 1 81  ? 50.992 53.638  69.720  1.00 21.55 ? 84  MET A N   1 
ATOM   3788 C CA  . MET C 1 81  ? 50.958 52.911  70.988  1.00 26.09 ? 84  MET A CA  1 
ATOM   3789 C C   . MET C 1 81  ? 51.668 53.737  72.060  1.00 24.47 ? 84  MET A C   1 
ATOM   3790 O O   . MET C 1 81  ? 52.670 54.387  71.782  1.00 27.28 ? 84  MET A O   1 
ATOM   3791 C CB  . MET C 1 81  ? 51.648 51.558  70.839  1.00 27.02 ? 84  MET A CB  1 
ATOM   3792 C CG  . MET C 1 81  ? 51.068 50.713  69.715  1.00 29.31 ? 84  MET A CG  1 
ATOM   3793 S SD  . MET C 1 81  ? 51.870 49.120  69.547  1.00 31.15 ? 84  MET A SD  1 
ATOM   3794 C CE  . MET C 1 81  ? 53.216 49.544  68.529  1.00 21.04 ? 84  MET A CE  1 
ATOM   3795 N N   . SER C 1 82  ? 51.145 53.715  73.277  1.00 26.22 ? 85  SER A N   1 
ATOM   3796 C CA  . SER C 1 82  ? 51.759 54.468  74.372  1.00 27.06 ? 85  SER A CA  1 
ATOM   3797 C C   . SER C 1 82  ? 51.645 53.686  75.661  1.00 23.34 ? 85  SER A C   1 
ATOM   3798 O O   . SER C 1 82  ? 50.800 52.799  75.780  1.00 18.79 ? 85  SER A O   1 
ATOM   3799 C CB  . SER C 1 82  ? 51.072 55.826  74.541  1.00 28.99 ? 85  SER A CB  1 
ATOM   3800 O OG  . SER C 1 82  ? 51.408 56.702  73.478  1.00 43.81 ? 85  SER A OG  1 
ATOM   3801 N N   . SER C 1 83  ? 52.485 54.026  76.632  1.00 27.81 ? 86  SER A N   1 
ATOM   3802 C CA  . SER C 1 83  ? 52.465 53.340  77.914  1.00 26.05 ? 86  SER A CA  1 
ATOM   3803 C C   . SER C 1 83  ? 52.504 51.849  77.627  1.00 23.11 ? 86  SER A C   1 
ATOM   3804 O O   . SER C 1 83  ? 51.740 51.078  78.188  1.00 25.79 ? 86  SER A O   1 
ATOM   3805 C CB  . SER C 1 83  ? 51.190 53.692  78.674  1.00 25.88 ? 86  SER A CB  1 
ATOM   3806 O OG  . SER C 1 83  ? 51.044 55.090  78.772  1.00 34.91 ? 86  SER A OG  1 
ATOM   3807 N N   . LEU C 1 84  ? 53.401 51.465  76.726  1.00 25.62 ? 87  LEU A N   1 
ATOM   3808 C CA  . LEU C 1 84  ? 53.561 50.077  76.331  1.00 23.20 ? 87  LEU A CA  1 
ATOM   3809 C C   . LEU C 1 84  ? 53.851 49.155  77.507  1.00 31.41 ? 87  LEU A C   1 
ATOM   3810 O O   . LEU C 1 84  ? 54.640 49.484  78.394  1.00 29.48 ? 87  LEU A O   1 
ATOM   3811 C CB  . LEU C 1 84  ? 54.663 49.973  75.282  1.00 28.65 ? 87  LEU A CB  1 
ATOM   3812 C CG  . LEU C 1 84  ? 54.177 50.398  73.896  1.00 23.29 ? 87  LEU A CG  1 
ATOM   3813 C CD1 . LEU C 1 84  ? 55.351 50.597  72.953  1.00 25.76 ? 87  LEU A CD1 1 
ATOM   3814 C CD2 . LEU C 1 84  ? 53.223 49.317  73.375  1.00 29.91 ? 87  LEU A CD2 1 
ATOM   3815 N N   . ARG C 1 85  ? 53.184 48.009  77.503  1.00 26.55 ? 88  ARG A N   1 
ATOM   3816 C CA  . ARG C 1 85  ? 53.318 47.008  78.542  1.00 31.24 ? 88  ARG A CA  1 
ATOM   3817 C C   . ARG C 1 85  ? 53.930 45.721  77.993  1.00 32.28 ? 88  ARG A C   1 
ATOM   3818 O O   . ARG C 1 85  ? 53.889 45.470  76.790  1.00 28.18 ? 88  ARG A O   1 
ATOM   3819 C CB  . ARG C 1 85  ? 51.941 46.722  79.150  1.00 30.81 ? 88  ARG A CB  1 
ATOM   3820 C CG  . ARG C 1 85  ? 51.566 47.689  80.249  1.00 35.36 ? 88  ARG A CG  1 
ATOM   3821 C CD  . ARG C 1 85  ? 50.350 48.542  79.933  1.00 35.18 ? 88  ARG A CD  1 
ATOM   3822 N NE  . ARG C 1 85  ? 49.116 47.770  79.843  1.00 25.60 ? 88  ARG A NE  1 
ATOM   3823 C CZ  . ARG C 1 85  ? 47.933 48.225  80.239  1.00 30.19 ? 88  ARG A CZ  1 
ATOM   3824 N NH1 . ARG C 1 85  ? 47.826 49.441  80.762  1.00 28.36 ? 88  ARG A NH1 1 
ATOM   3825 N NH2 . ARG C 1 85  ? 46.852 47.479  80.085  1.00 24.57 ? 88  ARG A NH2 1 
ATOM   3826 N N   . SER C 1 86  ? 54.496 44.912  78.886  1.00 24.78 ? 89  SER A N   1 
ATOM   3827 C CA  . SER C 1 86  ? 55.115 43.649  78.498  1.00 26.36 ? 89  SER A CA  1 
ATOM   3828 C C   . SER C 1 86  ? 54.141 42.761  77.708  1.00 24.73 ? 89  SER A C   1 
ATOM   3829 O O   . SER C 1 86  ? 54.516 42.149  76.706  1.00 25.15 ? 89  SER A O   1 
ATOM   3830 C CB  . SER C 1 86  ? 55.581 42.901  79.746  1.00 26.03 ? 89  SER A CB  1 
ATOM   3831 O OG  . SER C 1 86  ? 54.519 42.852  80.690  1.00 32.66 ? 89  SER A OG  1 
ATOM   3832 N N   . GLU C 1 87  ? 52.896 42.703  78.175  1.00 21.28 ? 90  GLU A N   1 
ATOM   3833 C CA  . GLU C 1 87  ? 51.859 41.908  77.536  1.00 32.96 ? 90  GLU A CA  1 
ATOM   3834 C C   . GLU C 1 87  ? 51.470 42.440  76.144  1.00 32.10 ? 90  GLU A C   1 
ATOM   3835 O O   . GLU C 1 87  ? 50.604 41.866  75.493  1.00 28.84 ? 90  GLU A O   1 
ATOM   3836 C CB  . GLU C 1 87  ? 50.615 41.875  78.428  1.00 35.85 ? 90  GLU A CB  1 
ATOM   3837 C CG  . GLU C 1 87  ? 49.983 43.245  78.637  1.00 54.18 ? 90  GLU A CG  1 
ATOM   3838 C CD  . GLU C 1 87  ? 48.931 43.257  79.731  1.00 60.60 ? 90  GLU A CD  1 
ATOM   3839 O OE1 . GLU C 1 87  ? 48.334 44.331  79.972  1.00 64.80 ? 90  GLU A OE1 1 
ATOM   3840 O OE2 . GLU C 1 87  ? 48.705 42.194  80.348  1.00 66.13 ? 90  GLU A OE2 1 
ATOM   3841 N N   . ASP C 1 88  ? 52.092 43.533  75.703  1.00 28.76 ? 91  ASP A N   1 
ATOM   3842 C CA  . ASP C 1 88  ? 51.791 44.108  74.388  1.00 29.20 ? 91  ASP A CA  1 
ATOM   3843 C C   . ASP C 1 88  ? 52.735 43.535  73.346  1.00 28.37 ? 91  ASP A C   1 
ATOM   3844 O O   . ASP C 1 88  ? 52.556 43.749  72.150  1.00 29.65 ? 91  ASP A O   1 
ATOM   3845 C CB  . ASP C 1 88  ? 51.938 45.639  74.386  1.00 24.90 ? 91  ASP A CB  1 
ATOM   3846 C CG  . ASP C 1 88  ? 50.827 46.344  75.140  1.00 32.37 ? 91  ASP A CG  1 
ATOM   3847 O OD1 . ASP C 1 88  ? 49.659 45.917  75.050  1.00 27.41 ? 91  ASP A OD1 1 
ATOM   3848 O OD2 . ASP C 1 88  ? 51.120 47.352  75.810  1.00 27.25 ? 91  ASP A OD2 1 
ATOM   3849 N N   . THR C 1 89  ? 53.753 42.817  73.807  1.00 24.02 ? 92  THR A N   1 
ATOM   3850 C CA  . THR C 1 89  ? 54.725 42.216  72.907  1.00 29.04 ? 92  THR A CA  1 
ATOM   3851 C C   . THR C 1 89  ? 54.024 41.216  71.981  1.00 24.51 ? 92  THR A C   1 
ATOM   3852 O O   . THR C 1 89  ? 53.285 40.340  72.424  1.00 21.84 ? 92  THR A O   1 
ATOM   3853 C CB  . THR C 1 89  ? 55.854 41.511  73.702  1.00 32.95 ? 92  THR A CB  1 
ATOM   3854 O OG1 . THR C 1 89  ? 56.573 42.489  74.479  1.00 34.16 ? 92  THR A OG1 1 
ATOM   3855 C CG2 . THR C 1 89  ? 56.814 40.797  72.745  1.00 20.68 ? 92  THR A CG2 1 
ATOM   3856 N N   . ALA C 1 90  ? 54.252 41.360  70.685  1.00 27.11 ? 93  ALA A N   1 
ATOM   3857 C CA  . ALA C 1 90  ? 53.606 40.477  69.720  1.00 24.60 ? 93  ALA A CA  1 
ATOM   3858 C C   . ALA C 1 90  ? 53.885 40.943  68.313  1.00 22.85 ? 93  ALA A C   1 
ATOM   3859 O O   . ALA C 1 90  ? 54.591 41.925  68.107  1.00 24.98 ? 93  ALA A O   1 
ATOM   3860 C CB  . ALA C 1 90  ? 52.106 40.460  69.950  1.00 24.75 ? 93  ALA A CB  1 
ATOM   3861 N N   . LEU C 1 91  ? 53.333 40.204  67.352  1.00 23.00 ? 94  LEU A N   1 
ATOM   3862 C CA  . LEU C 1 91  ? 53.468 40.522  65.943  1.00 21.05 ? 94  LEU A CA  1 
ATOM   3863 C C   . LEU C 1 91  ? 52.171 41.253  65.591  1.00 20.23 ? 94  LEU A C   1 
ATOM   3864 O O   . LEU C 1 91  ? 51.083 40.704  65.740  1.00 22.06 ? 94  LEU A O   1 
ATOM   3865 C CB  . LEU C 1 91  ? 53.599 39.236  65.120  1.00 26.05 ? 94  LEU A CB  1 
ATOM   3866 C CG  . LEU C 1 91  ? 54.711 39.197  64.068  1.00 32.14 ? 94  LEU A CG  1 
ATOM   3867 C CD1 . LEU C 1 91  ? 54.505 37.994  63.150  1.00 36.37 ? 94  LEU A CD1 1 
ATOM   3868 C CD2 . LEU C 1 91  ? 54.703 40.468  63.264  1.00 28.41 ? 94  LEU A CD2 1 
ATOM   3869 N N   . TYR C 1 92  ? 52.288 42.499  65.148  1.00 21.93 ? 95  TYR A N   1 
ATOM   3870 C CA  . TYR C 1 92  ? 51.107 43.300  64.827  1.00 23.60 ? 95  TYR A CA  1 
ATOM   3871 C C   . TYR C 1 92  ? 50.767 43.295  63.342  1.00 22.02 ? 95  TYR A C   1 
ATOM   3872 O O   . TYR C 1 92  ? 51.632 43.462  62.494  1.00 22.21 ? 95  TYR A O   1 
ATOM   3873 C CB  . TYR C 1 92  ? 51.305 44.745  65.318  1.00 16.30 ? 95  TYR A CB  1 
ATOM   3874 C CG  . TYR C 1 92  ? 51.184 44.880  66.830  1.00 24.49 ? 95  TYR A CG  1 
ATOM   3875 C CD1 . TYR C 1 92  ? 52.152 44.340  67.685  1.00 21.89 ? 95  TYR A CD1 1 
ATOM   3876 C CD2 . TYR C 1 92  ? 50.083 45.515  67.401  1.00 19.35 ? 95  TYR A CD2 1 
ATOM   3877 C CE1 . TYR C 1 92  ? 52.016 44.435  69.079  1.00 21.12 ? 95  TYR A CE1 1 
ATOM   3878 C CE2 . TYR C 1 92  ? 49.935 45.614  68.773  1.00 17.03 ? 95  TYR A CE2 1 
ATOM   3879 C CZ  . TYR C 1 92  ? 50.904 45.070  69.614  1.00 24.38 ? 95  TYR A CZ  1 
ATOM   3880 O OH  . TYR C 1 92  ? 50.741 45.149  70.987  1.00 24.08 ? 95  TYR A OH  1 
ATOM   3881 N N   . TYR C 1 93  ? 49.497 43.086  63.038  1.00 22.97 ? 96  TYR A N   1 
ATOM   3882 C CA  . TYR C 1 93  ? 49.066 43.065  61.648  1.00 26.53 ? 96  TYR A CA  1 
ATOM   3883 C C   . TYR C 1 93  ? 48.049 44.144  61.324  1.00 21.38 ? 96  TYR A C   1 
ATOM   3884 O O   . TYR C 1 93  ? 47.182 44.494  62.124  1.00 20.34 ? 96  TYR A O   1 
ATOM   3885 C CB  . TYR C 1 93  ? 48.438 41.720  61.279  1.00 23.37 ? 96  TYR A CB  1 
ATOM   3886 C CG  . TYR C 1 93  ? 49.354 40.517  61.322  1.00 22.96 ? 96  TYR A CG  1 
ATOM   3887 C CD1 . TYR C 1 93  ? 50.054 40.103  60.187  1.00 20.33 ? 96  TYR A CD1 1 
ATOM   3888 C CD2 . TYR C 1 93  ? 49.463 39.751  62.478  1.00 27.90 ? 96  TYR A CD2 1 
ATOM   3889 C CE1 . TYR C 1 93  ? 50.824 38.955  60.197  1.00 20.04 ? 96  TYR A CE1 1 
ATOM   3890 C CE2 . TYR C 1 93  ? 50.237 38.592  62.501  1.00 26.07 ? 96  TYR A CE2 1 
ATOM   3891 C CZ  . TYR C 1 93  ? 50.907 38.201  61.354  1.00 24.08 ? 96  TYR A CZ  1 
ATOM   3892 O OH  . TYR C 1 93  ? 51.633 37.037  61.353  1.00 31.25 ? 96  TYR A OH  1 
ATOM   3893 N N   . CYS C 1 94  ? 48.184 44.645  60.109  1.00 27.23 ? 97  CYS A N   1 
ATOM   3894 C CA  . CYS C 1 94  ? 47.308 45.640  59.517  1.00 26.74 ? 97  CYS A CA  1 
ATOM   3895 C C   . CYS C 1 94  ? 46.286 44.771  58.758  1.00 25.54 ? 97  CYS A C   1 
ATOM   3896 O O   . CYS C 1 94  ? 46.689 43.879  58.020  1.00 26.85 ? 97  CYS A O   1 
ATOM   3897 C CB  . CYS C 1 94  ? 48.153 46.432  58.538  1.00 31.46 ? 97  CYS A CB  1 
ATOM   3898 S SG  . CYS C 1 94  ? 47.331 47.667  57.521  1.00 41.35 ? 97  CYS A SG  1 
ATOM   3899 N N   . ALA C 1 95  ? 44.988 45.015  58.920  1.00 23.70 ? 98  ALA A N   1 
ATOM   3900 C CA  . ALA C 1 95  ? 44.009 44.191  58.221  1.00 26.77 ? 98  ALA A CA  1 
ATOM   3901 C C   . ALA C 1 95  ? 42.721 44.834  57.704  1.00 28.65 ? 98  ALA A C   1 
ATOM   3902 O O   . ALA C 1 95  ? 42.091 45.640  58.391  1.00 24.83 ? 98  ALA A O   1 
ATOM   3903 C CB  . ALA C 1 95  ? 43.638 42.989  59.094  1.00 22.78 ? 98  ALA A CB  1 
ATOM   3904 N N   . ARG C 1 96  ? 42.338 44.425  56.489  1.00 29.34 ? 99  ARG A N   1 
ATOM   3905 C CA  . ARG C 1 96  ? 41.103 44.841  55.818  1.00 23.84 ? 99  ARG A CA  1 
ATOM   3906 C C   . ARG C 1 96  ? 40.255 43.575  55.944  1.00 19.87 ? 99  ARG A C   1 
ATOM   3907 O O   . ARG C 1 96  ? 40.299 42.707  55.074  1.00 16.10 ? 99  ARG A O   1 
ATOM   3908 C CB  . ARG C 1 96  ? 41.372 45.140  54.333  1.00 21.32 ? 99  ARG A CB  1 
ATOM   3909 C CG  . ARG C 1 96  ? 40.200 45.772  53.561  1.00 24.65 ? 99  ARG A CG  1 
ATOM   3910 C CD  . ARG C 1 96  ? 39.008 44.841  53.402  1.00 13.64 ? 99  ARG A CD  1 
ATOM   3911 N NE  . ARG C 1 96  ? 39.227 43.765  52.436  1.00 20.72 ? 99  ARG A NE  1 
ATOM   3912 C CZ  . ARG C 1 96  ? 39.289 43.938  51.111  1.00 25.80 ? 99  ARG A CZ  1 
ATOM   3913 N NH1 . ARG C 1 96  ? 39.156 45.149  50.586  1.00 23.21 ? 99  ARG A NH1 1 
ATOM   3914 N NH2 . ARG C 1 96  ? 39.448 42.894  50.304  1.00 15.69 ? 99  ARG A NH2 1 
ATOM   3915 N N   . GLY C 1 97  ? 39.498 43.470  57.034  1.00 19.84 ? 100 GLY A N   1 
ATOM   3916 C CA  . GLY C 1 97  ? 38.694 42.284  57.295  1.00 24.24 ? 100 GLY A CA  1 
ATOM   3917 C C   . GLY C 1 97  ? 37.364 42.067  56.591  1.00 25.98 ? 100 GLY A C   1 
ATOM   3918 O O   . GLY C 1 97  ? 36.873 40.936  56.562  1.00 29.17 ? 100 GLY A O   1 
ATOM   3919 N N   . GLN C 1 98  ? 36.767 43.123  56.044  1.00 22.76 ? 101 GLN A N   1 
ATOM   3920 C CA  . GLN C 1 98  ? 35.494 42.994  55.346  1.00 27.25 ? 101 GLN A CA  1 
ATOM   3921 C C   . GLN C 1 98  ? 35.642 42.166  54.072  1.00 28.81 ? 101 GLN A C   1 
ATOM   3922 O O   . GLN C 1 98  ? 36.662 42.238  53.390  1.00 27.71 ? 101 GLN A O   1 
ATOM   3923 C CB  . GLN C 1 98  ? 34.950 44.378  54.984  1.00 29.64 ? 101 GLN A CB  1 
ATOM   3924 C CG  . GLN C 1 98  ? 34.498 45.192  56.184  1.00 31.66 ? 101 GLN A CG  1 
ATOM   3925 C CD  . GLN C 1 98  ? 34.143 46.625  55.825  1.00 27.20 ? 101 GLN A CD  1 
ATOM   3926 O OE1 . GLN C 1 98  ? 35.010 47.431  55.475  1.00 27.11 ? 101 GLN A OE1 1 
ATOM   3927 N NE2 . GLN C 1 98  ? 32.864 46.945  55.907  1.00 32.47 ? 101 GLN A NE2 1 
ATOM   3928 N N   . GLY C 1 99  ? 34.619 41.378  53.760  1.00 33.83 ? 102 GLY A N   1 
ATOM   3929 C CA  . GLY C 1 99  ? 34.656 40.568  52.553  1.00 30.38 ? 102 GLY A CA  1 
ATOM   3930 C C   . GLY C 1 99  ? 35.775 39.550  52.545  1.00 22.16 ? 102 GLY A C   1 
ATOM   3931 O O   . GLY C 1 99  ? 35.742 38.573  53.287  1.00 27.75 ? 102 GLY A O   1 
ATOM   3932 N N   . ARG C 1 100 ? 36.752 39.767  51.673  1.00 28.89 ? 103 ARG A N   1 
ATOM   3933 C CA  . ARG C 1 100 ? 37.907 38.876  51.575  1.00 30.36 ? 103 ARG A CA  1 
ATOM   3934 C C   . ARG C 1 100 ? 38.981 39.535  52.422  1.00 27.12 ? 103 ARG A C   1 
ATOM   3935 O O   . ARG C 1 100 ? 39.532 40.574  52.046  1.00 23.17 ? 103 ARG A O   1 
ATOM   3936 C CB  . ARG C 1 100 ? 38.386 38.747  50.122  1.00 23.80 ? 103 ARG A CB  1 
ATOM   3937 C CG  . ARG C 1 100 ? 39.528 37.733  49.922  1.00 36.28 ? 103 ARG A CG  1 
ATOM   3938 C CD  . ARG C 1 100 ? 40.862 38.425  49.755  1.00 34.30 ? 103 ARG A CD  1 
ATOM   3939 N NE  . ARG C 1 100 ? 42.022 37.538  49.831  1.00 37.88 ? 103 ARG A NE  1 
ATOM   3940 C CZ  . ARG C 1 100 ? 42.297 36.549  48.983  1.00 48.92 ? 103 ARG A CZ  1 
ATOM   3941 N NH1 . ARG C 1 100 ? 41.486 36.276  47.956  1.00 51.25 ? 103 ARG A NH1 1 
ATOM   3942 N NH2 . ARG C 1 100 ? 43.416 35.848  49.142  1.00 42.29 ? 103 ARG A NH2 1 
ATOM   3943 N N   . PRO C 1 101 ? 39.282 38.948  53.587  1.00 26.42 ? 104 PRO A N   1 
ATOM   3944 C CA  . PRO C 1 101 ? 40.302 39.528  54.465  1.00 25.89 ? 104 PRO A CA  1 
ATOM   3945 C C   . PRO C 1 101 ? 41.692 39.578  53.849  1.00 23.91 ? 104 PRO A C   1 
ATOM   3946 O O   . PRO C 1 101 ? 42.143 38.620  53.224  1.00 23.02 ? 104 PRO A O   1 
ATOM   3947 C CB  . PRO C 1 101 ? 40.268 38.616  55.701  1.00 20.39 ? 104 PRO A CB  1 
ATOM   3948 C CG  . PRO C 1 101 ? 38.903 37.994  55.661  1.00 26.69 ? 104 PRO A CG  1 
ATOM   3949 C CD  . PRO C 1 101 ? 38.693 37.740  54.189  1.00 20.13 ? 104 PRO A CD  1 
ATOM   3950 N N   . TYR C 1 102 ? 42.359 40.714  54.033  1.00 21.06 ? 105 TYR A N   1 
ATOM   3951 C CA  . TYR C 1 102 ? 43.734 40.915  53.577  1.00 25.21 ? 105 TYR A CA  1 
ATOM   3952 C C   . TYR C 1 102 ? 44.537 41.405  54.791  1.00 25.42 ? 105 TYR A C   1 
ATOM   3953 O O   . TYR C 1 102 ? 44.040 42.197  55.590  1.00 24.91 ? 105 TYR A O   1 
ATOM   3954 C CB  . TYR C 1 102 ? 43.823 42.008  52.506  1.00 26.48 ? 105 TYR A CB  1 
ATOM   3955 C CG  . TYR C 1 102 ? 43.537 41.580  51.082  1.00 32.71 ? 105 TYR A CG  1 
ATOM   3956 C CD1 . TYR C 1 102 ? 44.406 40.735  50.396  1.00 33.55 ? 105 TYR A CD1 1 
ATOM   3957 C CD2 . TYR C 1 102 ? 42.433 42.083  50.401  1.00 35.69 ? 105 TYR A CD2 1 
ATOM   3958 C CE1 . TYR C 1 102 ? 44.183 40.405  49.051  1.00 37.27 ? 105 TYR A CE1 1 
ATOM   3959 C CE2 . TYR C 1 102 ? 42.199 41.763  49.070  1.00 41.12 ? 105 TYR A CE2 1 
ATOM   3960 C CZ  . TYR C 1 102 ? 43.076 40.928  48.400  1.00 40.33 ? 105 TYR A CZ  1 
ATOM   3961 O OH  . TYR C 1 102 ? 42.848 40.640  47.076  1.00 43.31 ? 105 TYR A OH  1 
ATOM   3962 N N   . TRP C 1 103 ? 45.768 40.937  54.933  1.00 23.13 ? 106 TRP A N   1 
ATOM   3963 C CA  . TRP C 1 103 ? 46.626 41.396  56.030  1.00 27.22 ? 106 TRP A CA  1 
ATOM   3964 C C   . TRP C 1 103 ? 48.073 41.448  55.543  1.00 27.51 ? 106 TRP A C   1 
ATOM   3965 O O   . TRP C 1 103 ? 48.414 40.830  54.536  1.00 29.54 ? 106 TRP A O   1 
ATOM   3966 C CB  . TRP C 1 103 ? 46.473 40.491  57.268  1.00 22.70 ? 106 TRP A CB  1 
ATOM   3967 C CG  . TRP C 1 103 ? 46.714 39.043  57.012  1.00 25.62 ? 106 TRP A CG  1 
ATOM   3968 C CD1 . TRP C 1 103 ? 47.919 38.440  56.828  1.00 25.52 ? 106 TRP A CD1 1 
ATOM   3969 C CD2 . TRP C 1 103 ? 45.722 38.008  56.897  1.00 24.89 ? 106 TRP A CD2 1 
ATOM   3970 N NE1 . TRP C 1 103 ? 47.746 37.094  56.610  1.00 27.10 ? 106 TRP A NE1 1 
ATOM   3971 C CE2 . TRP C 1 103 ? 46.407 36.802  56.647  1.00 27.72 ? 106 TRP A CE2 1 
ATOM   3972 C CE3 . TRP C 1 103 ? 44.321 37.986  56.980  1.00 29.12 ? 106 TRP A CE3 1 
ATOM   3973 C CZ2 . TRP C 1 103 ? 45.741 35.577  56.478  1.00 33.55 ? 106 TRP A CZ2 1 
ATOM   3974 C CZ3 . TRP C 1 103 ? 43.657 36.775  56.812  1.00 26.40 ? 106 TRP A CZ3 1 
ATOM   3975 C CH2 . TRP C 1 103 ? 44.371 35.583  56.565  1.00 30.35 ? 106 TRP A CH2 1 
ATOM   3976 N N   . GLY C 1 104 ? 48.915 42.206  56.236  1.00 25.60 ? 107 GLY A N   1 
ATOM   3977 C CA  . GLY C 1 104 ? 50.305 42.320  55.825  1.00 22.22 ? 107 GLY A CA  1 
ATOM   3978 C C   . GLY C 1 104 ? 51.177 41.184  56.323  1.00 26.22 ? 107 GLY A C   1 
ATOM   3979 O O   . GLY C 1 104 ? 50.670 40.161  56.790  1.00 29.18 ? 107 GLY A O   1 
ATOM   3980 N N   . GLN C 1 105 ? 52.491 41.354  56.206  1.00 22.88 ? 108 GLN A N   1 
ATOM   3981 C CA  . GLN C 1 105 ? 53.432 40.346  56.677  1.00 32.45 ? 108 GLN A CA  1 
ATOM   3982 C C   . GLN C 1 105 ? 53.618 40.478  58.190  1.00 29.89 ? 108 GLN A C   1 
ATOM   3983 O O   . GLN C 1 105 ? 54.097 39.557  58.841  1.00 29.98 ? 108 GLN A O   1 
ATOM   3984 C CB  . GLN C 1 105 ? 54.792 40.498  55.991  1.00 33.44 ? 108 GLN A CB  1 
ATOM   3985 C CG  . GLN C 1 105 ? 54.870 39.937  54.564  1.00 46.31 ? 108 GLN A CG  1 
ATOM   3986 C CD  . GLN C 1 105 ? 54.474 38.463  54.475  1.00 49.81 ? 108 GLN A CD  1 
ATOM   3987 O OE1 . GLN C 1 105 ? 53.319 38.134  54.184  1.00 53.19 ? 108 GLN A OE1 1 
ATOM   3988 N NE2 . GLN C 1 105 ? 55.431 37.572  54.734  1.00 45.15 ? 108 GLN A NE2 1 
ATOM   3989 N N   . GLY C 1 106 ? 53.251 41.632  58.735  1.00 30.07 ? 109 GLY A N   1 
ATOM   3990 C CA  . GLY C 1 106 ? 53.363 41.844  60.166  1.00 33.09 ? 109 GLY A CA  1 
ATOM   3991 C C   . GLY C 1 106 ? 54.652 42.506  60.610  1.00 37.25 ? 109 GLY A C   1 
ATOM   3992 O O   . GLY C 1 106 ? 55.677 42.395  59.937  1.00 34.23 ? 109 GLY A O   1 
ATOM   3993 N N   . THR C 1 107 ? 54.593 43.198  61.749  1.00 35.02 ? 110 THR A N   1 
ATOM   3994 C CA  . THR C 1 107 ? 55.750 43.889  62.312  1.00 28.40 ? 110 THR A CA  1 
ATOM   3995 C C   . THR C 1 107 ? 55.833 43.517  63.804  1.00 30.15 ? 110 THR A C   1 
ATOM   3996 O O   . THR C 1 107 ? 54.828 43.551  64.525  1.00 22.56 ? 110 THR A O   1 
ATOM   3997 C CB  . THR C 1 107 ? 55.620 45.424  62.127  1.00 31.90 ? 110 THR A CB  1 
ATOM   3998 O OG1 . THR C 1 107 ? 56.862 46.060  62.462  1.00 29.42 ? 110 THR A OG1 1 
ATOM   3999 C CG2 . THR C 1 107 ? 54.504 45.977  62.996  1.00 33.00 ? 110 THR A CG2 1 
ATOM   4000 N N   . LEU C 1 108 ? 57.024 43.138  64.256  1.00 24.03 ? 111 LEU A N   1 
ATOM   4001 C CA  . LEU C 1 108 ? 57.200 42.708  65.638  1.00 26.40 ? 111 LEU A CA  1 
ATOM   4002 C C   . LEU C 1 108 ? 57.478 43.824  66.636  1.00 23.62 ? 111 LEU A C   1 
ATOM   4003 O O   . LEU C 1 108 ? 58.377 44.638  66.440  1.00 20.32 ? 111 LEU A O   1 
ATOM   4004 C CB  . LEU C 1 108 ? 58.325 41.670  65.737  1.00 28.54 ? 111 LEU A CB  1 
ATOM   4005 C CG  . LEU C 1 108 ? 58.595 41.191  67.178  1.00 28.32 ? 111 LEU A CG  1 
ATOM   4006 C CD1 . LEU C 1 108 ? 57.371 40.486  67.707  1.00 24.02 ? 111 LEU A CD1 1 
ATOM   4007 C CD2 . LEU C 1 108 ? 59.787 40.248  67.212  1.00 32.00 ? 111 LEU A CD2 1 
ATOM   4008 N N   . VAL C 1 109 ? 56.692 43.835  67.706  1.00 25.43 ? 112 VAL A N   1 
ATOM   4009 C CA  . VAL C 1 109 ? 56.826 44.817  68.777  1.00 24.18 ? 112 VAL A CA  1 
ATOM   4010 C C   . VAL C 1 109 ? 57.238 44.072  70.048  1.00 28.24 ? 112 VAL A C   1 
ATOM   4011 O O   . VAL C 1 109 ? 56.515 43.197  70.539  1.00 21.55 ? 112 VAL A O   1 
ATOM   4012 C CB  . VAL C 1 109 ? 55.490 45.549  69.036  1.00 23.62 ? 112 VAL A CB  1 
ATOM   4013 C CG1 . VAL C 1 109 ? 55.623 46.454  70.242  1.00 14.83 ? 112 VAL A CG1 1 
ATOM   4014 C CG2 . VAL C 1 109 ? 55.091 46.377  67.789  1.00 20.00 ? 112 VAL A CG2 1 
ATOM   4015 N N   . THR C 1 110 ? 58.409 44.410  70.575  1.00 25.13 ? 113 THR A N   1 
ATOM   4016 C CA  . THR C 1 110 ? 58.888 43.756  71.777  1.00 27.71 ? 113 THR A CA  1 
ATOM   4017 C C   . THR C 1 110 ? 59.047 44.803  72.870  1.00 25.33 ? 113 THR A C   1 
ATOM   4018 O O   . THR C 1 110 ? 59.885 45.699  72.780  1.00 22.81 ? 113 THR A O   1 
ATOM   4019 C CB  . THR C 1 110 ? 60.242 43.030  71.521  1.00 34.58 ? 113 THR A CB  1 
ATOM   4020 O OG1 . THR C 1 110 ? 61.248 43.991  71.184  1.00 42.48 ? 113 THR A OG1 1 
ATOM   4021 C CG2 . THR C 1 110 ? 60.112 42.045  70.361  1.00 25.86 ? 113 THR A CG2 1 
ATOM   4022 N N   . VAL C 1 111 ? 58.209 44.701  73.892  1.00 23.75 ? 114 VAL A N   1 
ATOM   4023 C CA  . VAL C 1 111 ? 58.255 45.635  74.999  1.00 23.37 ? 114 VAL A CA  1 
ATOM   4024 C C   . VAL C 1 111 ? 59.049 44.961  76.112  1.00 29.76 ? 114 VAL A C   1 
ATOM   4025 O O   . VAL C 1 111 ? 58.545 44.090  76.812  1.00 21.25 ? 114 VAL A O   1 
ATOM   4026 C CB  . VAL C 1 111 ? 56.843 45.969  75.503  1.00 23.54 ? 114 VAL A CB  1 
ATOM   4027 C CG1 . VAL C 1 111 ? 56.921 46.989  76.639  1.00 24.09 ? 114 VAL A CG1 1 
ATOM   4028 C CG2 . VAL C 1 111 ? 56.000 46.489  74.357  1.00 24.95 ? 114 VAL A CG2 1 
ATOM   4029 N N   . SER C 1 112 ? 60.305 45.353  76.254  1.00 29.56 ? 115 SER A N   1 
ATOM   4030 C CA  . SER C 1 112 ? 61.146 44.750  77.274  1.00 35.06 ? 115 SER A CA  1 
ATOM   4031 C C   . SER C 1 112 ? 62.159 45.746  77.818  1.00 32.07 ? 115 SER A C   1 
ATOM   4032 O O   . SER C 1 112 ? 62.506 46.726  77.162  1.00 32.31 ? 115 SER A O   1 
ATOM   4033 C CB  . SER C 1 112 ? 61.871 43.539  76.678  1.00 36.00 ? 115 SER A CB  1 
ATOM   4034 O OG  . SER C 1 112 ? 62.629 42.837  77.650  1.00 37.58 ? 115 SER A OG  1 
ATOM   4035 N N   . ALA C 1 113 ? 62.616 45.498  79.036  1.00 35.06 ? 116 ALA A N   1 
ATOM   4036 C CA  . ALA C 1 113 ? 63.613 46.355  79.654  1.00 39.84 ? 116 ALA A CA  1 
ATOM   4037 C C   . ALA C 1 113 ? 64.945 45.621  79.492  1.00 41.91 ? 116 ALA A C   1 
ATOM   4038 O O   . ALA C 1 113 ? 66.014 46.231  79.502  1.00 40.08 ? 116 ALA A O   1 
ATOM   4039 C CB  . ALA C 1 113 ? 63.285 46.557  81.127  1.00 42.61 ? 116 ALA A CB  1 
ATOM   4040 N N   . ALA C 1 114 ? 64.848 44.302  79.328  1.00 44.36 ? 117 ALA A N   1 
ATOM   4041 C CA  . ALA C 1 114 ? 66.005 43.438  79.142  1.00 45.73 ? 117 ALA A CA  1 
ATOM   4042 C C   . ALA C 1 114 ? 66.888 44.005  78.041  1.00 47.69 ? 117 ALA A C   1 
ATOM   4043 O O   . ALA C 1 114 ? 66.399 44.632  77.099  1.00 46.43 ? 117 ALA A O   1 
ATOM   4044 C CB  . ALA C 1 114 ? 65.552 42.038  78.778  1.00 47.44 ? 117 ALA A CB  1 
ATOM   4045 N N   . LYS C 1 115 ? 68.191 43.779  78.163  1.00 50.30 ? 118 LYS A N   1 
ATOM   4046 C CA  . LYS C 1 115 ? 69.144 44.285  77.189  1.00 50.90 ? 118 LYS A CA  1 
ATOM   4047 C C   . LYS C 1 115 ? 69.476 43.262  76.111  1.00 51.59 ? 118 LYS A C   1 
ATOM   4048 O O   . LYS C 1 115 ? 69.843 42.122  76.404  1.00 52.81 ? 118 LYS A O   1 
ATOM   4049 C CB  . LYS C 1 115 ? 70.416 44.746  77.906  1.00 55.53 ? 118 LYS A CB  1 
ATOM   4050 C CG  . LYS C 1 115 ? 70.222 46.018  78.743  1.00 61.28 ? 118 LYS A CG  1 
ATOM   4051 C CD  . LYS C 1 115 ? 69.117 45.856  79.794  1.00 61.17 ? 118 LYS A CD  1 
ATOM   4052 C CE  . LYS C 1 115 ? 68.790 47.175  80.495  1.00 59.57 ? 118 LYS A CE  1 
ATOM   4053 N NZ  . LYS C 1 115 ? 69.928 47.705  81.300  1.00 56.71 ? 118 LYS A NZ  1 
ATOM   4054 N N   . THR C 1 116 ? 69.333 43.676  74.857  1.00 50.36 ? 119 THR A N   1 
ATOM   4055 C CA  . THR C 1 116 ? 69.616 42.784  73.748  1.00 49.55 ? 119 THR A CA  1 
ATOM   4056 C C   . THR C 1 116 ? 71.065 42.350  73.809  1.00 50.33 ? 119 THR A C   1 
ATOM   4057 O O   . THR C 1 116 ? 71.979 43.166  73.686  1.00 49.77 ? 119 THR A O   1 
ATOM   4058 C CB  . THR C 1 116 ? 69.360 43.442  72.379  1.00 46.71 ? 119 THR A CB  1 
ATOM   4059 O OG1 . THR C 1 116 ? 70.551 43.353  71.586  1.00 46.77 ? 119 THR A OG1 1 
ATOM   4060 C CG2 . THR C 1 116 ? 68.948 44.894  72.537  1.00 51.81 ? 119 THR A CG2 1 
ATOM   4061 N N   . THR C 1 117 ? 71.266 41.057  74.018  1.00 49.86 ? 120 THR A N   1 
ATOM   4062 C CA  . THR C 1 117 ? 72.603 40.501  74.084  1.00 50.23 ? 120 THR A CA  1 
ATOM   4063 C C   . THR C 1 117 ? 72.834 39.539  72.915  1.00 47.73 ? 120 THR A C   1 
ATOM   4064 O O   . THR C 1 117 ? 71.944 38.785  72.530  1.00 46.17 ? 120 THR A O   1 
ATOM   4065 C CB  . THR C 1 117 ? 72.821 39.740  75.403  1.00 51.73 ? 120 THR A CB  1 
ATOM   4066 O OG1 . THR C 1 117 ? 72.026 38.552  75.403  1.00 58.67 ? 120 THR A OG1 1 
ATOM   4067 C CG2 . THR C 1 117 ? 72.412 40.599  76.589  1.00 51.64 ? 120 THR A CG2 1 
ATOM   4068 N N   . PRO C 1 118 ? 74.041 39.558  72.331  1.00 47.01 ? 121 PRO A N   1 
ATOM   4069 C CA  . PRO C 1 118 ? 74.341 38.665  71.209  1.00 41.62 ? 121 PRO A CA  1 
ATOM   4070 C C   . PRO C 1 118 ? 74.351 37.213  71.682  1.00 43.35 ? 121 PRO A C   1 
ATOM   4071 O O   . PRO C 1 118 ? 74.450 36.936  72.880  1.00 36.88 ? 121 PRO A O   1 
ATOM   4072 C CB  . PRO C 1 118 ? 75.711 39.145  70.747  1.00 43.58 ? 121 PRO A CB  1 
ATOM   4073 C CG  . PRO C 1 118 ? 76.351 39.567  72.034  1.00 47.41 ? 121 PRO A CG  1 
ATOM   4074 C CD  . PRO C 1 118 ? 75.234 40.324  72.729  1.00 45.98 ? 121 PRO A CD  1 
ATOM   4075 N N   . PRO C 1 119 ? 74.251 36.261  70.744  1.00 43.59 ? 122 PRO A N   1 
ATOM   4076 C CA  . PRO C 1 119 ? 74.245 34.850  71.124  1.00 44.71 ? 122 PRO A CA  1 
ATOM   4077 C C   . PRO C 1 119 ? 75.623 34.213  71.232  1.00 47.74 ? 122 PRO A C   1 
ATOM   4078 O O   . PRO C 1 119 ? 76.548 34.572  70.502  1.00 47.38 ? 122 PRO A O   1 
ATOM   4079 C CB  . PRO C 1 119 ? 73.424 34.217  70.015  1.00 44.39 ? 122 PRO A CB  1 
ATOM   4080 C CG  . PRO C 1 119 ? 73.915 34.977  68.818  1.00 47.42 ? 122 PRO A CG  1 
ATOM   4081 C CD  . PRO C 1 119 ? 73.950 36.418  69.308  1.00 41.23 ? 122 PRO A CD  1 
ATOM   4082 N N   . SER C 1 120 ? 75.750 33.271  72.160  1.00 48.12 ? 123 SER A N   1 
ATOM   4083 C CA  . SER C 1 120 ? 76.992 32.530  72.336  1.00 49.76 ? 123 SER A CA  1 
ATOM   4084 C C   . SER C 1 120 ? 76.770 31.224  71.578  1.00 47.61 ? 123 SER A C   1 
ATOM   4085 O O   . SER C 1 120 ? 75.870 30.449  71.908  1.00 46.00 ? 123 SER A O   1 
ATOM   4086 C CB  . SER C 1 120 ? 77.258 32.228  73.814  1.00 48.81 ? 123 SER A CB  1 
ATOM   4087 O OG  . SER C 1 120 ? 77.543 33.409  74.541  1.00 55.48 ? 123 SER A OG  1 
ATOM   4088 N N   . VAL C 1 121 ? 77.580 30.994  70.554  1.00 44.56 ? 124 VAL A N   1 
ATOM   4089 C CA  . VAL C 1 121 ? 77.452 29.788  69.758  1.00 46.65 ? 124 VAL A CA  1 
ATOM   4090 C C   . VAL C 1 121 ? 78.468 28.735  70.188  1.00 52.42 ? 124 VAL A C   1 
ATOM   4091 O O   . VAL C 1 121 ? 79.673 28.997  70.223  1.00 53.91 ? 124 VAL A O   1 
ATOM   4092 C CB  . VAL C 1 121 ? 77.645 30.101  68.264  1.00 45.39 ? 124 VAL A CB  1 
ATOM   4093 C CG1 . VAL C 1 121 ? 77.442 28.840  67.430  1.00 39.58 ? 124 VAL A CG1 1 
ATOM   4094 C CG2 . VAL C 1 121 ? 76.666 31.189  67.839  1.00 47.70 ? 124 VAL A CG2 1 
ATOM   4095 N N   . TYR C 1 122 ? 77.974 27.547  70.526  1.00 51.35 ? 125 TYR A N   1 
ATOM   4096 C CA  . TYR C 1 122 ? 78.835 26.449  70.946  1.00 52.41 ? 125 TYR A CA  1 
ATOM   4097 C C   . TYR C 1 122 ? 78.650 25.265  70.004  1.00 55.61 ? 125 TYR A C   1 
ATOM   4098 O O   . TYR C 1 122 ? 77.528 24.830  69.751  1.00 56.28 ? 125 TYR A O   1 
ATOM   4099 C CB  . TYR C 1 122 ? 78.501 26.020  72.376  1.00 47.82 ? 125 TYR A CB  1 
ATOM   4100 C CG  . TYR C 1 122 ? 78.709 27.105  73.400  1.00 49.95 ? 125 TYR A CG  1 
ATOM   4101 C CD1 . TYR C 1 122 ? 79.949 27.729  73.540  1.00 48.26 ? 125 TYR A CD1 1 
ATOM   4102 C CD2 . TYR C 1 122 ? 77.667 27.512  74.232  1.00 47.73 ? 125 TYR A CD2 1 
ATOM   4103 C CE1 . TYR C 1 122 ? 80.145 28.736  74.485  1.00 49.64 ? 125 TYR A CE1 1 
ATOM   4104 C CE2 . TYR C 1 122 ? 77.853 28.516  75.178  1.00 50.92 ? 125 TYR A CE2 1 
ATOM   4105 C CZ  . TYR C 1 122 ? 79.095 29.123  75.299  1.00 49.07 ? 125 TYR A CZ  1 
ATOM   4106 O OH  . TYR C 1 122 ? 79.289 30.111  76.236  1.00 53.78 ? 125 TYR A OH  1 
ATOM   4107 N N   . PRO C 1 123 ? 79.754 24.732  69.467  1.00 56.62 ? 126 PRO A N   1 
ATOM   4108 C CA  . PRO C 1 123 ? 79.671 23.593  68.554  1.00 58.83 ? 126 PRO A CA  1 
ATOM   4109 C C   . PRO C 1 123 ? 79.391 22.286  69.288  1.00 60.00 ? 126 PRO A C   1 
ATOM   4110 O O   . PRO C 1 123 ? 79.920 22.041  70.374  1.00 60.08 ? 126 PRO A O   1 
ATOM   4111 C CB  . PRO C 1 123 ? 81.040 23.596  67.887  1.00 59.12 ? 126 PRO A CB  1 
ATOM   4112 C CG  . PRO C 1 123 ? 81.930 24.020  69.010  1.00 59.29 ? 126 PRO A CG  1 
ATOM   4113 C CD  . PRO C 1 123 ? 81.149 25.183  69.609  1.00 59.27 ? 126 PRO A CD  1 
ATOM   4114 N N   . ALA C 1 124 ? 78.537 21.460  68.696  1.00 64.60 ? 127 ALA A N   1 
ATOM   4115 C CA  . ALA C 1 124 ? 78.200 20.162  69.263  1.00 68.02 ? 127 ALA A CA  1 
ATOM   4116 C C   . ALA C 1 124 ? 78.707 19.107  68.283  1.00 71.72 ? 127 ALA A C   1 
ATOM   4117 O O   . ALA C 1 124 ? 78.053 18.808  67.279  1.00 73.85 ? 127 ALA A O   1 
ATOM   4118 C CB  . ALA C 1 124 ? 76.696 20.036  69.449  1.00 64.50 ? 127 ALA A CB  1 
ATOM   4119 N N   . ALA C 1 125 ? 79.891 18.571  68.570  1.00 73.57 ? 128 ALA A N   1 
ATOM   4120 C CA  . ALA C 1 125 ? 80.508 17.555  67.722  1.00 74.98 ? 128 ALA A CA  1 
ATOM   4121 C C   . ALA C 1 125 ? 80.777 16.290  68.530  1.00 76.04 ? 128 ALA A C   1 
ATOM   4122 O O   . ALA C 1 125 ? 80.924 16.345  69.752  1.00 74.52 ? 128 ALA A O   1 
ATOM   4123 C CB  . ALA C 1 125 ? 81.811 18.089  67.130  1.00 73.36 ? 128 ALA A CB  1 
ATOM   4124 N N   . PRO C 1 126 ? 80.846 15.130  67.854  1.00 78.14 ? 129 PRO A N   1 
ATOM   4125 C CA  . PRO C 1 126 ? 81.101 13.848  68.521  1.00 79.08 ? 129 PRO A CA  1 
ATOM   4126 C C   . PRO C 1 126 ? 82.445 13.808  69.258  1.00 81.66 ? 129 PRO A C   1 
ATOM   4127 O O   . PRO C 1 126 ? 83.510 13.932  68.646  1.00 79.08 ? 129 PRO A O   1 
ATOM   4128 C CB  . PRO C 1 126 ? 81.029 12.845  67.371  1.00 78.80 ? 129 PRO A CB  1 
ATOM   4129 C CG  . PRO C 1 126 ? 81.497 13.652  66.190  1.00 77.79 ? 129 PRO A CG  1 
ATOM   4130 C CD  . PRO C 1 126 ? 80.770 14.956  66.391  1.00 78.00 ? 129 PRO A CD  1 
ATOM   4131 N N   . GLY C 1 127 ? 82.379 13.635  70.576  1.00 84.29 ? 130 GLY A N   1 
ATOM   4132 C CA  . GLY C 1 127 ? 83.580 13.592  71.392  1.00 86.67 ? 130 GLY A CA  1 
ATOM   4133 C C   . GLY C 1 127 ? 84.389 12.317  71.246  1.00 88.70 ? 130 GLY A C   1 
ATOM   4134 O O   . GLY C 1 127 ? 84.611 11.841  70.131  1.00 89.04 ? 130 GLY A O   1 
ATOM   4135 N N   . CYS C 1 128 ? 84.835 11.763  72.372  1.00 89.80 ? 131 CYS A N   1 
ATOM   4136 C CA  . CYS C 1 128 ? 85.630 10.538  72.355  1.00 91.35 ? 131 CYS A CA  1 
ATOM   4137 C C   . CYS C 1 128 ? 84.811 9.316   72.760  1.00 92.60 ? 131 CYS A C   1 
ATOM   4138 O O   . CYS C 1 128 ? 84.306 9.235   73.883  1.00 92.85 ? 131 CYS A O   1 
ATOM   4139 C CB  . CYS C 1 128 ? 86.846 10.674  73.280  1.00 91.05 ? 131 CYS A CB  1 
ATOM   4140 S SG  . CYS C 1 128 ? 86.464 10.938  75.030  1.00 95.52 ? 131 CYS A SG  1 
ATOM   4141 N N   . GLY C 1 129 ? 84.684 8.370   71.833  1.00 94.16 ? 132 GLY A N   1 
ATOM   4142 C CA  . GLY C 1 129 ? 83.936 7.154   72.100  1.00 94.02 ? 132 GLY A CA  1 
ATOM   4143 C C   . GLY C 1 129 ? 82.450 7.288   71.831  1.00 94.51 ? 132 GLY A C   1 
ATOM   4144 O O   . GLY C 1 129 ? 81.643 7.294   72.763  1.00 95.22 ? 132 GLY A O   1 
ATOM   4145 N N   . ASP C 1 130 ? 82.084 7.391   70.556  1.00 93.86 ? 133 ASP A N   1 
ATOM   4146 C CA  . ASP C 1 130 ? 80.683 7.526   70.176  1.00 93.82 ? 133 ASP A CA  1 
ATOM   4147 C C   . ASP C 1 130 ? 80.412 6.963   68.787  1.00 94.26 ? 133 ASP A C   1 
ATOM   4148 O O   . ASP C 1 130 ? 81.237 7.088   67.881  1.00 94.47 ? 133 ASP A O   1 
ATOM   4149 C CB  . ASP C 1 130 ? 80.265 8.998   70.217  1.00 93.81 ? 133 ASP A CB  1 
ATOM   4150 C CG  . ASP C 1 130 ? 80.393 9.601   71.601  1.00 94.21 ? 133 ASP A CG  1 
ATOM   4151 O OD1 . ASP C 1 130 ? 79.696 9.129   72.526  1.00 93.13 ? 133 ASP A OD1 1 
ATOM   4152 O OD2 . ASP C 1 130 ? 81.196 10.545  71.763  1.00 96.46 ? 133 ASP A OD2 1 
ATOM   4153 N N   . THR C 1 131 ? 79.246 6.343   68.627  1.00 94.36 ? 134 THR A N   1 
ATOM   4154 C CA  . THR C 1 131 ? 78.858 5.769   67.347  1.00 94.24 ? 134 THR A CA  1 
ATOM   4155 C C   . THR C 1 131 ? 78.751 6.846   66.271  1.00 94.67 ? 134 THR A C   1 
ATOM   4156 O O   . THR C 1 131 ? 77.863 7.701   66.311  1.00 95.78 ? 134 THR A O   1 
ATOM   4157 C CB  . THR C 1 131 ? 77.508 5.024   67.453  1.00 94.83 ? 134 THR A CB  1 
ATOM   4158 O OG1 . THR C 1 131 ? 77.086 4.613   66.146  1.00 95.25 ? 134 THR A OG1 1 
ATOM   4159 C CG2 . THR C 1 131 ? 76.444 5.919   68.079  1.00 94.88 ? 134 THR A CG2 1 
ATOM   4160 N N   . THR C 1 132 ? 79.668 6.800   65.310  1.00 93.01 ? 135 THR A N   1 
ATOM   4161 C CA  . THR C 1 132 ? 79.687 7.770   64.220  1.00 91.41 ? 135 THR A CA  1 
ATOM   4162 C C   . THR C 1 132 ? 79.678 7.056   62.870  1.00 90.35 ? 135 THR A C   1 
ATOM   4163 O O   . THR C 1 132 ? 78.998 6.040   62.702  1.00 89.91 ? 135 THR A O   1 
ATOM   4164 C CB  . THR C 1 132 ? 80.937 8.674   64.311  1.00 90.91 ? 135 THR A CB  1 
ATOM   4165 O OG1 . THR C 1 132 ? 82.117 7.861   64.308  1.00 90.58 ? 135 THR A OG1 1 
ATOM   4166 C CG2 . THR C 1 132 ? 80.904 9.503   65.587  1.00 88.93 ? 135 THR A CG2 1 
ATOM   4167 N N   . GLY C 1 133 ? 80.428 7.593   61.911  1.00 88.98 ? 136 GLY A N   1 
ATOM   4168 C CA  . GLY C 1 133 ? 80.495 6.986   60.593  1.00 87.48 ? 136 GLY A CA  1 
ATOM   4169 C C   . GLY C 1 133 ? 79.234 7.169   59.768  1.00 87.33 ? 136 GLY A C   1 
ATOM   4170 O O   . GLY C 1 133 ? 78.888 8.292   59.390  1.00 85.07 ? 136 GLY A O   1 
ATOM   4171 N N   . SER C 1 134 ? 78.553 6.060   59.482  1.00 86.92 ? 137 SER A N   1 
ATOM   4172 C CA  . SER C 1 134 ? 77.322 6.083   58.698  1.00 85.03 ? 137 SER A CA  1 
ATOM   4173 C C   . SER C 1 134 ? 76.373 7.133   59.246  1.00 84.53 ? 137 SER A C   1 
ATOM   4174 O O   . SER C 1 134 ? 75.652 6.885   60.214  1.00 84.33 ? 137 SER A O   1 
ATOM   4175 C CB  . SER C 1 134 ? 76.636 4.715   58.735  1.00 85.48 ? 137 SER A CB  1 
ATOM   4176 O OG  . SER C 1 134 ? 75.384 4.751   58.070  1.00 84.66 ? 137 SER A OG  1 
ATOM   4177 N N   . SER C 1 135 ? 76.380 8.306   58.619  1.00 82.92 ? 138 SER A N   1 
ATOM   4178 C CA  . SER C 1 135 ? 75.526 9.409   59.037  1.00 80.81 ? 138 SER A CA  1 
ATOM   4179 C C   . SER C 1 135 ? 75.782 9.767   60.500  1.00 80.39 ? 138 SER A C   1 
ATOM   4180 O O   . SER C 1 135 ? 75.510 8.974   61.408  1.00 81.01 ? 138 SER A O   1 
ATOM   4181 C CB  . SER C 1 135 ? 74.052 9.040   58.843  1.00 80.42 ? 138 SER A CB  1 
ATOM   4182 O OG  . SER C 1 135 ? 73.783 8.718   57.489  1.00 82.18 ? 138 SER A OG  1 
ATOM   4183 N N   . VAL C 1 136 ? 76.309 10.966  60.724  1.00 77.08 ? 139 VAL A N   1 
ATOM   4184 C CA  . VAL C 1 136 ? 76.597 11.428  62.074  1.00 72.85 ? 139 VAL A CA  1 
ATOM   4185 C C   . VAL C 1 136 ? 75.734 12.641  62.405  1.00 70.28 ? 139 VAL A C   1 
ATOM   4186 O O   . VAL C 1 136 ? 75.297 13.366  61.510  1.00 69.97 ? 139 VAL A O   1 
ATOM   4187 C CB  . VAL C 1 136 ? 78.083 11.811  62.220  1.00 73.47 ? 139 VAL A CB  1 
ATOM   4188 C CG1 . VAL C 1 136 ? 78.432 12.916  61.233  1.00 72.35 ? 139 VAL A CG1 1 
ATOM   4189 C CG2 . VAL C 1 136 ? 78.374 12.245  63.655  1.00 73.83 ? 139 VAL A CG2 1 
ATOM   4190 N N   . THR C 1 137 ? 75.487 12.855  63.692  1.00 68.02 ? 140 THR A N   1 
ATOM   4191 C CA  . THR C 1 137 ? 74.676 13.984  64.124  1.00 67.39 ? 140 THR A CA  1 
ATOM   4192 C C   . THR C 1 137 ? 75.542 15.121  64.658  1.00 66.75 ? 140 THR A C   1 
ATOM   4193 O O   . THR C 1 137 ? 76.194 14.988  65.694  1.00 65.14 ? 140 THR A O   1 
ATOM   4194 C CB  . THR C 1 137 ? 73.681 13.573  65.227  1.00 66.55 ? 140 THR A CB  1 
ATOM   4195 O OG1 . THR C 1 137 ? 72.872 12.485  64.763  1.00 62.58 ? 140 THR A OG1 1 
ATOM   4196 C CG2 . THR C 1 137 ? 72.779 14.749  65.592  1.00 63.48 ? 140 THR A CG2 1 
ATOM   4197 N N   . LEU C 1 138 ? 75.545 16.236  63.936  1.00 67.25 ? 141 LEU A N   1 
ATOM   4198 C CA  . LEU C 1 138 ? 76.308 17.413  64.331  1.00 67.75 ? 141 LEU A CA  1 
ATOM   4199 C C   . LEU C 1 138 ? 75.334 18.529  64.683  1.00 68.03 ? 141 LEU A C   1 
ATOM   4200 O O   . LEU C 1 138 ? 74.186 18.517  64.244  1.00 67.23 ? 141 LEU A O   1 
ATOM   4201 C CB  . LEU C 1 138 ? 77.211 17.873  63.186  1.00 68.59 ? 141 LEU A CB  1 
ATOM   4202 C CG  . LEU C 1 138 ? 78.397 16.977  62.827  1.00 69.76 ? 141 LEU A CG  1 
ATOM   4203 C CD1 . LEU C 1 138 ? 79.104 17.549  61.606  1.00 67.77 ? 141 LEU A CD1 1 
ATOM   4204 C CD2 . LEU C 1 138 ? 79.349 16.879  64.017  1.00 68.89 ? 141 LEU A CD2 1 
ATOM   4205 N N   . GLY C 1 139 ? 75.787 19.494  65.474  1.00 67.54 ? 142 GLY A N   1 
ATOM   4206 C CA  . GLY C 1 139 ? 74.903 20.584  65.836  1.00 65.58 ? 142 GLY A CA  1 
ATOM   4207 C C   . GLY C 1 139 ? 75.577 21.767  66.495  1.00 63.23 ? 142 GLY A C   1 
ATOM   4208 O O   . GLY C 1 139 ? 76.750 21.705  66.863  1.00 62.75 ? 142 GLY A O   1 
ATOM   4209 N N   . CYS C 1 140 ? 74.820 22.852  66.638  1.00 61.22 ? 143 CYS A N   1 
ATOM   4210 C CA  . CYS C 1 140 ? 75.311 24.072  67.267  1.00 57.81 ? 143 CYS A CA  1 
ATOM   4211 C C   . CYS C 1 140 ? 74.345 24.536  68.354  1.00 54.24 ? 143 CYS A C   1 
ATOM   4212 O O   . CYS C 1 140 ? 73.137 24.605  68.136  1.00 53.56 ? 143 CYS A O   1 
ATOM   4213 C CB  . CYS C 1 140 ? 75.504 25.173  66.212  1.00 57.48 ? 143 CYS A CB  1 
ATOM   4214 S SG  . CYS C 1 140 ? 76.967 24.910  65.156  1.00 60.52 ? 143 CYS A SG  1 
ATOM   4215 N N   . LEU C 1 141 ? 74.887 24.823  69.534  1.00 52.42 ? 144 LEU A N   1 
ATOM   4216 C CA  . LEU C 1 141 ? 74.089 25.295  70.659  1.00 51.14 ? 144 LEU A CA  1 
ATOM   4217 C C   . LEU C 1 141 ? 74.206 26.812  70.710  1.00 51.40 ? 144 LEU A C   1 
ATOM   4218 O O   . LEU C 1 141 ? 75.310 27.354  70.694  1.00 52.74 ? 144 LEU A O   1 
ATOM   4219 C CB  . LEU C 1 141 ? 74.598 24.693  71.973  1.00 48.77 ? 144 LEU A CB  1 
ATOM   4220 C CG  . LEU C 1 141 ? 73.935 25.204  73.259  1.00 50.13 ? 144 LEU A CG  1 
ATOM   4221 C CD1 . LEU C 1 141 ? 72.449 24.868  73.250  1.00 51.43 ? 144 LEU A CD1 1 
ATOM   4222 C CD2 . LEU C 1 141 ? 74.612 24.580  74.469  1.00 49.37 ? 144 LEU A CD2 1 
ATOM   4223 N N   . VAL C 1 142 ? 73.063 27.489  70.769  1.00 50.62 ? 145 VAL A N   1 
ATOM   4224 C CA  . VAL C 1 142 ? 73.021 28.947  70.809  1.00 45.54 ? 145 VAL A CA  1 
ATOM   4225 C C   . VAL C 1 142 ? 72.322 29.407  72.087  1.00 48.26 ? 145 VAL A C   1 
ATOM   4226 O O   . VAL C 1 142 ? 71.106 29.274  72.219  1.00 49.92 ? 145 VAL A O   1 
ATOM   4227 C CB  . VAL C 1 142 ? 72.260 29.492  69.579  1.00 42.57 ? 145 VAL A CB  1 
ATOM   4228 C CG1 . VAL C 1 142 ? 72.324 31.008  69.544  1.00 41.79 ? 145 VAL A CG1 1 
ATOM   4229 C CG2 . VAL C 1 142 ? 72.856 28.905  68.307  1.00 42.54 ? 145 VAL A CG2 1 
ATOM   4230 N N   . LYS C 1 143 ? 73.088 29.944  73.031  1.00 47.11 ? 146 LYS A N   1 
ATOM   4231 C CA  . LYS C 1 143 ? 72.502 30.403  74.287  1.00 48.69 ? 146 LYS A CA  1 
ATOM   4232 C C   . LYS C 1 143 ? 72.985 31.793  74.683  1.00 48.82 ? 146 LYS A C   1 
ATOM   4233 O O   . LYS C 1 143 ? 73.957 32.314  74.128  1.00 46.99 ? 146 LYS A O   1 
ATOM   4234 C CB  . LYS C 1 143 ? 72.816 29.405  75.414  1.00 48.32 ? 146 LYS A CB  1 
ATOM   4235 C CG  . LYS C 1 143 ? 74.299 29.266  75.740  1.00 48.68 ? 146 LYS A CG  1 
ATOM   4236 C CD  . LYS C 1 143 ? 74.578 28.140  76.732  1.00 51.35 ? 146 LYS A CD  1 
ATOM   4237 C CE  . LYS C 1 143 ? 74.069 28.440  78.142  1.00 50.79 ? 146 LYS A CE  1 
ATOM   4238 N NZ  . LYS C 1 143 ? 72.583 28.437  78.255  1.00 53.48 ? 146 LYS A NZ  1 
ATOM   4239 N N   . GLY C 1 144 ? 72.285 32.394  75.638  1.00 50.54 ? 147 GLY A N   1 
ATOM   4240 C CA  . GLY C 1 144 ? 72.665 33.707  76.120  1.00 53.55 ? 147 GLY A CA  1 
ATOM   4241 C C   . GLY C 1 144 ? 72.249 34.916  75.306  1.00 52.40 ? 147 GLY A C   1 
ATOM   4242 O O   . GLY C 1 144 ? 72.883 35.963  75.411  1.00 52.66 ? 147 GLY A O   1 
ATOM   4243 N N   . TYR C 1 145 ? 71.203 34.796  74.495  1.00 52.38 ? 148 TYR A N   1 
ATOM   4244 C CA  . TYR C 1 145 ? 70.753 35.941  73.711  1.00 53.73 ? 148 TYR A CA  1 
ATOM   4245 C C   . TYR C 1 145 ? 69.353 36.361  74.152  1.00 54.33 ? 148 TYR A C   1 
ATOM   4246 O O   . TYR C 1 145 ? 68.650 35.593  74.813  1.00 52.07 ? 148 TYR A O   1 
ATOM   4247 C CB  . TYR C 1 145 ? 70.766 35.619  72.212  1.00 50.84 ? 148 TYR A CB  1 
ATOM   4248 C CG  . TYR C 1 145 ? 69.830 34.517  71.787  1.00 48.99 ? 148 TYR A CG  1 
ATOM   4249 C CD1 . TYR C 1 145 ? 70.143 33.179  72.018  1.00 50.49 ? 148 TYR A CD1 1 
ATOM   4250 C CD2 . TYR C 1 145 ? 68.634 34.812  71.138  1.00 48.41 ? 148 TYR A CD2 1 
ATOM   4251 C CE1 . TYR C 1 145 ? 69.288 32.159  71.606  1.00 51.18 ? 148 TYR A CE1 1 
ATOM   4252 C CE2 . TYR C 1 145 ? 67.772 33.805  70.725  1.00 50.03 ? 148 TYR A CE2 1 
ATOM   4253 C CZ  . TYR C 1 145 ? 68.104 32.480  70.960  1.00 52.23 ? 148 TYR A CZ  1 
ATOM   4254 O OH  . TYR C 1 145 ? 67.255 31.482  70.540  1.00 55.37 ? 148 TYR A OH  1 
ATOM   4255 N N   . PHE C 1 146 ? 68.954 37.585  73.814  1.00 56.01 ? 149 PHE A N   1 
ATOM   4256 C CA  . PHE C 1 146 ? 67.627 38.047  74.200  1.00 59.71 ? 149 PHE A CA  1 
ATOM   4257 C C   . PHE C 1 146 ? 66.612 38.161  73.066  1.00 64.04 ? 149 PHE A C   1 
ATOM   4258 O O   . PHE C 1 146 ? 65.814 37.246  72.873  1.00 67.68 ? 149 PHE A O   1 
ATOM   4259 C CB  . PHE C 1 146 ? 67.679 39.371  74.950  1.00 55.59 ? 149 PHE A CB  1 
ATOM   4260 C CG  . PHE C 1 146 ? 66.320 39.888  75.297  1.00 54.90 ? 149 PHE A CG  1 
ATOM   4261 C CD1 . PHE C 1 146 ? 65.464 39.128  76.089  1.00 54.56 ? 149 PHE A CD1 1 
ATOM   4262 C CD2 . PHE C 1 146 ? 65.864 41.094  74.782  1.00 54.01 ? 149 PHE A CD2 1 
ATOM   4263 C CE1 . PHE C 1 146 ? 64.175 39.560  76.359  1.00 55.18 ? 149 PHE A CE1 1 
ATOM   4264 C CE2 . PHE C 1 146 ? 64.578 41.535  75.046  1.00 54.32 ? 149 PHE A CE2 1 
ATOM   4265 C CZ  . PHE C 1 146 ? 63.730 40.766  75.836  1.00 55.55 ? 149 PHE A CZ  1 
ATOM   4266 N N   . PRO C 1 147 ? 66.600 39.281  72.315  1.00 60.81 ? 150 PRO A N   1 
ATOM   4267 C CA  . PRO C 1 147 ? 65.588 39.283  71.257  1.00 61.02 ? 150 PRO A CA  1 
ATOM   4268 C C   . PRO C 1 147 ? 65.583 37.920  70.554  1.00 62.02 ? 150 PRO A C   1 
ATOM   4269 O O   . PRO C 1 147 ? 66.445 37.620  69.725  1.00 62.01 ? 150 PRO A O   1 
ATOM   4270 C CB  . PRO C 1 147 ? 66.025 40.445  70.363  1.00 58.14 ? 150 PRO A CB  1 
ATOM   4271 C CG  . PRO C 1 147 ? 67.490 40.567  70.637  1.00 58.71 ? 150 PRO A CG  1 
ATOM   4272 C CD  . PRO C 1 147 ? 67.567 40.370  72.110  1.00 58.98 ? 150 PRO A CD  1 
ATOM   4273 N N   . GLU C 1 148 ? 64.608 37.099  70.936  1.00 61.33 ? 151 GLU A N   1 
ATOM   4274 C CA  . GLU C 1 148 ? 64.445 35.743  70.431  1.00 60.30 ? 151 GLU A CA  1 
ATOM   4275 C C   . GLU C 1 148 ? 64.727 35.560  68.951  1.00 60.51 ? 151 GLU A C   1 
ATOM   4276 O O   . GLU C 1 148 ? 65.366 34.588  68.554  1.00 64.71 ? 151 GLU A O   1 
ATOM   4277 C CB  . GLU C 1 148 ? 63.041 35.242  70.753  1.00 59.86 ? 151 GLU A CB  1 
ATOM   4278 C CG  . GLU C 1 148 ? 62.807 33.790  70.395  1.00 63.97 ? 151 GLU A CG  1 
ATOM   4279 C CD  . GLU C 1 148 ? 61.547 33.238  71.025  1.00 65.84 ? 151 GLU A CD  1 
ATOM   4280 O OE1 . GLU C 1 148 ? 61.190 32.081  70.727  1.00 67.04 ? 151 GLU A OE1 1 
ATOM   4281 O OE2 . GLU C 1 148 ? 60.917 33.961  71.825  1.00 67.30 ? 151 GLU A OE2 1 
ATOM   4282 N N   . SER C 1 149 ? 64.251 36.487  68.134  1.00 61.03 ? 152 SER A N   1 
ATOM   4283 C CA  . SER C 1 149 ? 64.464 36.400  66.697  1.00 62.44 ? 152 SER A CA  1 
ATOM   4284 C C   . SER C 1 149 ? 65.911 36.029  66.363  1.00 60.52 ? 152 SER A C   1 
ATOM   4285 O O   . SER C 1 149 ? 66.806 36.871  66.403  1.00 61.67 ? 152 SER A O   1 
ATOM   4286 C CB  . SER C 1 149 ? 64.085 37.732  66.040  1.00 64.22 ? 152 SER A CB  1 
ATOM   4287 O OG  . SER C 1 149 ? 64.618 38.829  66.769  1.00 73.10 ? 152 SER A OG  1 
ATOM   4288 N N   . VAL C 1 150 ? 66.132 34.757  66.046  1.00 58.67 ? 153 VAL A N   1 
ATOM   4289 C CA  . VAL C 1 150 ? 67.459 34.267  65.692  1.00 57.35 ? 153 VAL A CA  1 
ATOM   4290 C C   . VAL C 1 150 ? 67.321 33.145  64.665  1.00 56.63 ? 153 VAL A C   1 
ATOM   4291 O O   . VAL C 1 150 ? 66.418 32.316  64.758  1.00 57.83 ? 153 VAL A O   1 
ATOM   4292 C CB  . VAL C 1 150 ? 68.209 33.733  66.931  1.00 60.73 ? 153 VAL A CB  1 
ATOM   4293 C CG1 . VAL C 1 150 ? 67.523 32.481  67.456  1.00 64.67 ? 153 VAL A CG1 1 
ATOM   4294 C CG2 . VAL C 1 150 ? 69.664 33.449  66.581  1.00 60.96 ? 153 VAL A CG2 1 
ATOM   4295 N N   . THR C 1 151 ? 68.214 33.113  63.684  1.00 55.00 ? 154 THR A N   1 
ATOM   4296 C CA  . THR C 1 151 ? 68.139 32.087  62.652  1.00 57.24 ? 154 THR A CA  1 
ATOM   4297 C C   . THR C 1 151 ? 69.464 31.382  62.373  1.00 57.76 ? 154 THR A C   1 
ATOM   4298 O O   . THR C 1 151 ? 70.500 32.025  62.205  1.00 60.01 ? 154 THR A O   1 
ATOM   4299 C CB  . THR C 1 151 ? 67.596 32.692  61.343  1.00 57.28 ? 154 THR A CB  1 
ATOM   4300 O OG1 . THR C 1 151 ? 67.863 31.801  60.255  1.00 61.53 ? 154 THR A OG1 1 
ATOM   4301 C CG2 . THR C 1 151 ? 68.241 34.039  61.075  1.00 60.92 ? 154 THR A CG2 1 
ATOM   4302 N N   . VAL C 1 152 ? 69.419 30.053  62.319  1.00 57.14 ? 155 VAL A N   1 
ATOM   4303 C CA  . VAL C 1 152 ? 70.609 29.247  62.068  1.00 57.77 ? 155 VAL A CA  1 
ATOM   4304 C C   . VAL C 1 152 ? 70.594 28.659  60.662  1.00 62.50 ? 155 VAL A C   1 
ATOM   4305 O O   . VAL C 1 152 ? 69.562 28.180  60.194  1.00 66.43 ? 155 VAL A O   1 
ATOM   4306 C CB  . VAL C 1 152 ? 70.719 28.094  63.079  1.00 52.67 ? 155 VAL A CB  1 
ATOM   4307 C CG1 . VAL C 1 152 ? 71.983 27.290  62.818  1.00 57.14 ? 155 VAL A CG1 1 
ATOM   4308 C CG2 . VAL C 1 152 ? 70.727 28.646  64.491  1.00 54.07 ? 155 VAL A CG2 1 
ATOM   4309 N N   . THR C 1 153 ? 71.746 28.688  59.997  1.00 63.00 ? 156 THR A N   1 
ATOM   4310 C CA  . THR C 1 153 ? 71.860 28.168  58.638  1.00 62.56 ? 156 THR A CA  1 
ATOM   4311 C C   . THR C 1 153 ? 73.093 27.285  58.492  1.00 64.96 ? 156 THR A C   1 
ATOM   4312 O O   . THR C 1 153 ? 74.181 27.657  58.935  1.00 62.48 ? 156 THR A O   1 
ATOM   4313 C CB  . THR C 1 153 ? 71.984 29.313  57.616  1.00 61.88 ? 156 THR A CB  1 
ATOM   4314 O OG1 . THR C 1 153 ? 71.043 30.343  57.934  1.00 60.92 ? 156 THR A OG1 1 
ATOM   4315 C CG2 . THR C 1 153 ? 71.704 28.806  56.215  1.00 62.30 ? 156 THR A CG2 1 
ATOM   4316 N N   . TRP C 1 154 ? 72.924 26.121  57.869  1.00 66.17 ? 157 TRP A N   1 
ATOM   4317 C CA  . TRP C 1 154 ? 74.041 25.205  57.655  1.00 68.76 ? 157 TRP A CA  1 
ATOM   4318 C C   . TRP C 1 154 ? 74.450 25.168  56.184  1.00 71.27 ? 157 TRP A C   1 
ATOM   4319 O O   . TRP C 1 154 ? 73.826 24.483  55.376  1.00 71.62 ? 157 TRP A O   1 
ATOM   4320 C CB  . TRP C 1 154 ? 73.682 23.788  58.110  1.00 66.39 ? 157 TRP A CB  1 
ATOM   4321 C CG  . TRP C 1 154 ? 73.409 23.674  59.568  1.00 64.65 ? 157 TRP A CG  1 
ATOM   4322 C CD1 . TRP C 1 154 ? 72.282 24.071  60.223  1.00 68.07 ? 157 TRP A CD1 1 
ATOM   4323 C CD2 . TRP C 1 154 ? 74.291 23.147  60.566  1.00 64.51 ? 157 TRP A CD2 1 
ATOM   4324 N NE1 . TRP C 1 154 ? 72.405 23.826  61.570  1.00 68.25 ? 157 TRP A NE1 1 
ATOM   4325 C CE2 . TRP C 1 154 ? 73.629 23.259  61.809  1.00 66.91 ? 157 TRP A CE2 1 
ATOM   4326 C CE3 . TRP C 1 154 ? 75.576 22.593  60.532  1.00 63.86 ? 157 TRP A CE3 1 
ATOM   4327 C CZ2 . TRP C 1 154 ? 74.211 22.835  63.012  1.00 65.34 ? 157 TRP A CZ2 1 
ATOM   4328 C CZ3 . TRP C 1 154 ? 76.156 22.172  61.728  1.00 63.51 ? 157 TRP A CZ3 1 
ATOM   4329 C CH2 . TRP C 1 154 ? 75.470 22.296  62.951  1.00 65.33 ? 157 TRP A CH2 1 
ATOM   4330 N N   . ASN C 1 155 ? 75.496 25.917  55.846  1.00 73.84 ? 158 ASN A N   1 
ATOM   4331 C CA  . ASN C 1 155 ? 76.011 25.971  54.480  1.00 76.17 ? 158 ASN A CA  1 
ATOM   4332 C C   . ASN C 1 155 ? 74.982 26.473  53.467  1.00 78.84 ? 158 ASN A C   1 
ATOM   4333 O O   . ASN C 1 155 ? 75.304 26.656  52.291  1.00 81.69 ? 158 ASN A O   1 
ATOM   4334 C CB  . ASN C 1 155 ? 76.508 24.584  54.059  1.00 76.86 ? 158 ASN A CB  1 
ATOM   4335 C CG  . ASN C 1 155 ? 77.523 24.005  55.032  1.00 78.71 ? 158 ASN A CG  1 
ATOM   4336 O OD1 . ASN C 1 155 ? 78.626 24.530  55.190  1.00 78.91 ? 158 ASN A OD1 1 
ATOM   4337 N ND2 . ASN C 1 155 ? 77.150 22.916  55.694  1.00 79.92 ? 158 ASN A ND2 1 
ATOM   4338 N N   . SER C 1 156 ? 73.753 26.698  53.931  1.00 79.69 ? 159 SER A N   1 
ATOM   4339 C CA  . SER C 1 156 ? 72.657 27.169  53.084  1.00 81.34 ? 159 SER A CA  1 
ATOM   4340 C C   . SER C 1 156 ? 72.074 26.031  52.247  1.00 83.52 ? 159 SER A C   1 
ATOM   4341 O O   . SER C 1 156 ? 71.372 26.270  51.262  1.00 84.10 ? 159 SER A O   1 
ATOM   4342 C CB  . SER C 1 156 ? 73.132 28.291  52.155  1.00 81.61 ? 159 SER A CB  1 
ATOM   4343 O OG  . SER C 1 156 ? 73.646 29.384  52.891  1.00 83.17 ? 159 SER A OG  1 
ATOM   4344 N N   . GLY C 1 157 ? 72.370 24.795  52.641  1.00 83.42 ? 160 GLY A N   1 
ATOM   4345 C CA  . GLY C 1 157 ? 71.867 23.641  51.917  1.00 82.50 ? 160 GLY A CA  1 
ATOM   4346 C C   . GLY C 1 157 ? 71.604 22.470  52.844  1.00 81.84 ? 160 GLY A C   1 
ATOM   4347 O O   . GLY C 1 157 ? 72.319 21.467  52.811  1.00 81.11 ? 160 GLY A O   1 
ATOM   4348 N N   . GLY C 1 158 ? 70.570 22.597  53.673  1.00 81.72 ? 161 GLY A N   1 
ATOM   4349 C CA  . GLY C 1 158 ? 70.236 21.541  54.612  1.00 81.31 ? 161 GLY A CA  1 
ATOM   4350 C C   . GLY C 1 158 ? 68.819 21.015  54.490  1.00 80.49 ? 161 GLY A C   1 
ATOM   4351 O O   . GLY C 1 158 ? 67.859 21.783  54.411  1.00 80.86 ? 161 GLY A O   1 
ATOM   4352 N N   . SER C 1 159 ? 68.695 19.692  54.475  1.00 80.25 ? 164 SER A N   1 
ATOM   4353 C CA  . SER C 1 159 ? 67.402 19.025  54.367  1.00 77.75 ? 164 SER A CA  1 
ATOM   4354 C C   . SER C 1 159 ? 67.217 18.149  55.598  1.00 76.34 ? 164 SER A C   1 
ATOM   4355 O O   . SER C 1 159 ? 66.097 17.801  55.971  1.00 77.25 ? 164 SER A O   1 
ATOM   4356 C CB  . SER C 1 159 ? 67.357 18.154  53.107  1.00 79.24 ? 164 SER A CB  1 
ATOM   4357 O OG  . SER C 1 159 ? 67.675 18.905  51.947  1.00 78.59 ? 164 SER A OG  1 
ATOM   4358 N N   . SER C 1 160 ? 68.335 17.793  56.220  1.00 73.74 ? 165 SER A N   1 
ATOM   4359 C CA  . SER C 1 160 ? 68.327 16.962  57.417  1.00 71.20 ? 165 SER A CA  1 
ATOM   4360 C C   . SER C 1 160 ? 68.554 17.832  58.654  1.00 69.04 ? 165 SER A C   1 
ATOM   4361 O O   . SER C 1 160 ? 69.113 17.380  59.660  1.00 65.19 ? 165 SER A O   1 
ATOM   4362 C CB  . SER C 1 160 ? 69.417 15.896  57.313  1.00 71.71 ? 165 SER A CB  1 
ATOM   4363 O OG  . SER C 1 160 ? 70.656 16.478  56.944  1.00 73.39 ? 165 SER A OG  1 
ATOM   4364 N N   . VAL C 1 161 ? 68.105 19.082  58.561  1.00 66.39 ? 166 VAL A N   1 
ATOM   4365 C CA  . VAL C 1 161 ? 68.238 20.046  59.647  1.00 62.29 ? 166 VAL A CA  1 
ATOM   4366 C C   . VAL C 1 161 ? 67.118 19.891  60.673  1.00 60.92 ? 166 VAL A C   1 
ATOM   4367 O O   . VAL C 1 161 ? 66.017 19.450  60.350  1.00 61.15 ? 166 VAL A O   1 
ATOM   4368 C CB  . VAL C 1 161 ? 68.233 21.500  59.101  1.00 61.32 ? 166 VAL A CB  1 
ATOM   4369 C CG1 . VAL C 1 161 ? 68.387 22.496  60.239  1.00 60.26 ? 166 VAL A CG1 1 
ATOM   4370 C CG2 . VAL C 1 161 ? 69.357 21.680  58.093  1.00 58.28 ? 166 VAL A CG2 1 
ATOM   4371 N N   . HIS C 1 162 ? 67.420 20.251  61.915  1.00 58.78 ? 167 HIS A N   1 
ATOM   4372 C CA  . HIS C 1 162 ? 66.466 20.169  63.011  1.00 56.27 ? 167 HIS A CA  1 
ATOM   4373 C C   . HIS C 1 162 ? 66.667 21.345  63.958  1.00 54.57 ? 167 HIS A C   1 
ATOM   4374 O O   . HIS C 1 162 ? 67.444 21.263  64.908  1.00 52.46 ? 167 HIS A O   1 
ATOM   4375 C CB  . HIS C 1 162 ? 66.654 18.859  63.781  1.00 57.75 ? 167 HIS A CB  1 
ATOM   4376 C CG  . HIS C 1 162 ? 65.885 17.706  63.216  1.00 62.87 ? 167 HIS A CG  1 
ATOM   4377 N ND1 . HIS C 1 162 ? 66.238 16.395  63.451  1.00 61.51 ? 167 HIS A ND1 1 
ATOM   4378 C CD2 . HIS C 1 162 ? 64.763 17.665  62.459  1.00 64.41 ? 167 HIS A CD2 1 
ATOM   4379 C CE1 . HIS C 1 162 ? 65.366 15.595  62.862  1.00 62.87 ? 167 HIS A CE1 1 
ATOM   4380 N NE2 . HIS C 1 162 ? 64.462 16.340  62.254  1.00 65.39 ? 167 HIS A NE2 1 
ATOM   4381 N N   . THR C 1 163 ? 65.966 22.440  63.688  1.00 53.72 ? 168 THR A N   1 
ATOM   4382 C CA  . THR C 1 163 ? 66.060 23.636  64.511  1.00 52.28 ? 168 THR A CA  1 
ATOM   4383 C C   . THR C 1 163 ? 65.012 23.554  65.611  1.00 48.93 ? 168 THR A C   1 
ATOM   4384 O O   . THR C 1 163 ? 63.815 23.539  65.338  1.00 49.53 ? 168 THR A O   1 
ATOM   4385 C CB  . THR C 1 163 ? 65.826 24.904  63.665  1.00 55.68 ? 168 THR A CB  1 
ATOM   4386 O OG1 . THR C 1 163 ? 66.827 24.987  62.640  1.00 58.67 ? 168 THR A OG1 1 
ATOM   4387 C CG2 . THR C 1 163 ? 65.901 26.147  64.533  1.00 58.56 ? 168 THR A CG2 1 
ATOM   4388 N N   . PHE C 1 164 ? 65.468 23.494  66.857  1.00 45.98 ? 169 PHE A N   1 
ATOM   4389 C CA  . PHE C 1 164 ? 64.566 23.393  67.996  1.00 45.65 ? 169 PHE A CA  1 
ATOM   4390 C C   . PHE C 1 164 ? 64.109 24.760  68.496  1.00 45.65 ? 169 PHE A C   1 
ATOM   4391 O O   . PHE C 1 164 ? 64.861 25.733  68.467  1.00 45.22 ? 169 PHE A O   1 
ATOM   4392 C CB  . PHE C 1 164 ? 65.252 22.605  69.122  1.00 44.30 ? 169 PHE A CB  1 
ATOM   4393 C CG  . PHE C 1 164 ? 65.594 21.193  68.738  1.00 42.57 ? 169 PHE A CG  1 
ATOM   4394 C CD1 . PHE C 1 164 ? 64.648 20.178  68.857  1.00 43.82 ? 169 PHE A CD1 1 
ATOM   4395 C CD2 . PHE C 1 164 ? 66.835 20.890  68.184  1.00 44.37 ? 169 PHE A CD2 1 
ATOM   4396 C CE1 . PHE C 1 164 ? 64.933 18.883  68.423  1.00 47.22 ? 169 PHE A CE1 1 
ATOM   4397 C CE2 . PHE C 1 164 ? 67.130 19.601  67.746  1.00 43.87 ? 169 PHE A CE2 1 
ATOM   4398 C CZ  . PHE C 1 164 ? 66.179 18.597  67.865  1.00 45.96 ? 169 PHE A CZ  1 
ATOM   4399 N N   . PRO C 1 165 ? 62.851 24.852  68.945  1.00 45.13 ? 170 PRO A N   1 
ATOM   4400 C CA  . PRO C 1 165 ? 62.306 26.114  69.452  1.00 45.79 ? 170 PRO A CA  1 
ATOM   4401 C C   . PRO C 1 165 ? 63.156 26.632  70.605  1.00 46.71 ? 170 PRO A C   1 
ATOM   4402 O O   . PRO C 1 165 ? 63.683 25.850  71.395  1.00 47.89 ? 170 PRO A O   1 
ATOM   4403 C CB  . PRO C 1 165 ? 60.900 25.723  69.903  1.00 44.54 ? 170 PRO A CB  1 
ATOM   4404 C CG  . PRO C 1 165 ? 60.543 24.608  68.957  1.00 45.60 ? 170 PRO A CG  1 
ATOM   4405 C CD  . PRO C 1 165 ? 61.819 23.800  68.930  1.00 44.43 ? 170 PRO A CD  1 
ATOM   4406 N N   . ALA C 1 166 ? 63.284 27.948  70.707  1.00 47.66 ? 171 ALA A N   1 
ATOM   4407 C CA  . ALA C 1 166 ? 64.079 28.546  71.773  1.00 47.40 ? 171 ALA A CA  1 
ATOM   4408 C C   . ALA C 1 166 ? 63.313 28.596  73.085  1.00 46.64 ? 171 ALA A C   1 
ATOM   4409 O O   . ALA C 1 166 ? 62.133 28.949  73.121  1.00 48.16 ? 171 ALA A O   1 
ATOM   4410 C CB  . ALA C 1 166 ? 64.513 29.946  71.371  1.00 47.67 ? 171 ALA A CB  1 
ATOM   4411 N N   . LEU C 1 167 ? 63.992 28.236  74.167  1.00 48.10 ? 172 LEU A N   1 
ATOM   4412 C CA  . LEU C 1 167 ? 63.388 28.261  75.489  1.00 49.85 ? 172 LEU A CA  1 
ATOM   4413 C C   . LEU C 1 167 ? 64.032 29.367  76.303  1.00 50.93 ? 172 LEU A C   1 
ATOM   4414 O O   . LEU C 1 167 ? 65.237 29.591  76.219  1.00 51.90 ? 172 LEU A O   1 
ATOM   4415 C CB  . LEU C 1 167 ? 63.581 26.920  76.193  1.00 51.74 ? 172 LEU A CB  1 
ATOM   4416 C CG  . LEU C 1 167 ? 62.756 25.767  75.628  1.00 52.43 ? 172 LEU A CG  1 
ATOM   4417 C CD1 . LEU C 1 167 ? 63.077 24.488  76.381  1.00 53.55 ? 172 LEU A CD1 1 
ATOM   4418 C CD2 . LEU C 1 167 ? 61.279 26.105  75.742  1.00 51.37 ? 172 LEU A CD2 1 
ATOM   4419 N N   . LEU C 1 168 ? 63.223 30.066  77.088  1.00 55.21 ? 173 LEU A N   1 
ATOM   4420 C CA  . LEU C 1 168 ? 63.727 31.158  77.904  1.00 58.28 ? 173 LEU A CA  1 
ATOM   4421 C C   . LEU C 1 168 ? 64.227 30.647  79.245  1.00 61.03 ? 173 LEU A C   1 
ATOM   4422 O O   . LEU C 1 168 ? 63.516 29.941  79.958  1.00 62.21 ? 173 LEU A O   1 
ATOM   4423 C CB  . LEU C 1 168 ? 62.629 32.198  78.122  1.00 57.33 ? 173 LEU A CB  1 
ATOM   4424 C CG  . LEU C 1 168 ? 63.055 33.500  78.799  1.00 56.83 ? 173 LEU A CG  1 
ATOM   4425 C CD1 . LEU C 1 168 ? 64.159 34.168  77.988  1.00 58.94 ? 173 LEU A CD1 1 
ATOM   4426 C CD2 . LEU C 1 168 ? 61.848 34.416  78.924  1.00 59.36 ? 173 LEU A CD2 1 
ATOM   4427 N N   . GLN C 1 169 ? 65.459 31.008  79.581  1.00 65.63 ? 174 GLN A N   1 
ATOM   4428 C CA  . GLN C 1 169 ? 66.058 30.596  80.843  1.00 69.36 ? 174 GLN A CA  1 
ATOM   4429 C C   . GLN C 1 169 ? 66.752 31.782  81.509  1.00 67.91 ? 174 GLN A C   1 
ATOM   4430 O O   . GLN C 1 169 ? 67.678 32.369  80.949  1.00 67.04 ? 174 GLN A O   1 
ATOM   4431 C CB  . GLN C 1 169 ? 67.062 29.465  80.603  1.00 73.61 ? 174 GLN A CB  1 
ATOM   4432 C CG  . GLN C 1 169 ? 67.579 28.803  81.874  1.00 78.68 ? 174 GLN A CG  1 
ATOM   4433 C CD  . GLN C 1 169 ? 68.465 27.603  81.590  1.00 80.70 ? 174 GLN A CD  1 
ATOM   4434 O OE1 . GLN C 1 169 ? 68.944 26.939  82.512  1.00 78.69 ? 174 GLN A OE1 1 
ATOM   4435 N NE2 . GLN C 1 169 ? 68.688 27.319  80.310  1.00 80.87 ? 174 GLN A NE2 1 
ATOM   4436 N N   . SER C 1 170 ? 66.286 32.134  82.704  1.00 67.16 ? 175 SER A N   1 
ATOM   4437 C CA  . SER C 1 170 ? 66.854 33.243  83.455  1.00 67.78 ? 175 SER A CA  1 
ATOM   4438 C C   . SER C 1 170 ? 66.880 34.525  82.635  1.00 66.18 ? 175 SER A C   1 
ATOM   4439 O O   . SER C 1 170 ? 67.816 35.317  82.734  1.00 65.86 ? 175 SER A O   1 
ATOM   4440 C CB  . SER C 1 170 ? 68.273 32.897  83.913  1.00 71.43 ? 175 SER A CB  1 
ATOM   4441 O OG  . SER C 1 170 ? 68.266 31.803  84.814  1.00 74.69 ? 175 SER A OG  1 
ATOM   4442 N N   . GLY C 1 171 ? 65.853 34.723  81.818  1.00 65.32 ? 176 GLY A N   1 
ATOM   4443 C CA  . GLY C 1 171 ? 65.785 35.924  81.008  1.00 62.75 ? 176 GLY A CA  1 
ATOM   4444 C C   . GLY C 1 171 ? 66.494 35.835  79.673  1.00 61.96 ? 176 GLY A C   1 
ATOM   4445 O O   . GLY C 1 171 ? 66.300 36.690  78.811  1.00 63.38 ? 176 GLY A O   1 
ATOM   4446 N N   . LEU C 1 172 ? 67.322 34.814  79.492  1.00 60.24 ? 177 LEU A N   1 
ATOM   4447 C CA  . LEU C 1 172 ? 68.033 34.652  78.230  1.00 58.50 ? 177 LEU A CA  1 
ATOM   4448 C C   . LEU C 1 172 ? 67.492 33.467  77.436  1.00 55.13 ? 177 LEU A C   1 
ATOM   4449 O O   . LEU C 1 172 ? 67.069 32.466  78.013  1.00 55.88 ? 177 LEU A O   1 
ATOM   4450 C CB  . LEU C 1 172 ? 69.532 34.471  78.482  1.00 58.65 ? 177 LEU A CB  1 
ATOM   4451 C CG  . LEU C 1 172 ? 70.258 35.662  79.112  1.00 61.04 ? 177 LEU A CG  1 
ATOM   4452 C CD1 . LEU C 1 172 ? 71.739 35.349  79.211  1.00 61.02 ? 177 LEU A CD1 1 
ATOM   4453 C CD2 . LEU C 1 172 ? 70.041 36.913  78.273  1.00 58.77 ? 177 LEU A CD2 1 
ATOM   4454 N N   . TYR C 1 173 ? 67.502 33.587  76.112  1.00 50.92 ? 178 TYR A N   1 
ATOM   4455 C CA  . TYR C 1 173 ? 67.009 32.518  75.254  1.00 51.08 ? 178 TYR A CA  1 
ATOM   4456 C C   . TYR C 1 173 ? 68.091 31.524  74.855  1.00 50.79 ? 178 TYR A C   1 
ATOM   4457 O O   . TYR C 1 173 ? 69.247 31.890  74.642  1.00 48.93 ? 178 TYR A O   1 
ATOM   4458 C CB  . TYR C 1 173 ? 66.362 33.097  73.996  1.00 50.56 ? 178 TYR A CB  1 
ATOM   4459 C CG  . TYR C 1 173 ? 64.972 33.651  74.219  1.00 50.27 ? 178 TYR A CG  1 
ATOM   4460 C CD1 . TYR C 1 173 ? 63.938 32.830  74.668  1.00 50.24 ? 178 TYR A CD1 1 
ATOM   4461 C CD2 . TYR C 1 173 ? 64.685 34.989  73.962  1.00 49.23 ? 178 TYR A CD2 1 
ATOM   4462 C CE1 . TYR C 1 173 ? 62.652 33.329  74.854  1.00 52.14 ? 178 TYR A CE1 1 
ATOM   4463 C CE2 . TYR C 1 173 ? 63.400 35.502  74.143  1.00 49.47 ? 178 TYR A CE2 1 
ATOM   4464 C CZ  . TYR C 1 173 ? 62.389 34.666  74.588  1.00 51.49 ? 178 TYR A CZ  1 
ATOM   4465 O OH  . TYR C 1 173 ? 61.113 35.157  74.752  1.00 50.87 ? 178 TYR A OH  1 
ATOM   4466 N N   . THR C 1 174 ? 67.699 30.259  74.756  1.00 48.99 ? 179 THR A N   1 
ATOM   4467 C CA  . THR C 1 174 ? 68.619 29.200  74.374  1.00 48.33 ? 179 THR A CA  1 
ATOM   4468 C C   . THR C 1 174 ? 67.936 28.231  73.429  1.00 48.99 ? 179 THR A C   1 
ATOM   4469 O O   . THR C 1 174 ? 66.860 27.715  73.726  1.00 51.71 ? 179 THR A O   1 
ATOM   4470 C CB  . THR C 1 174 ? 69.092 28.394  75.590  1.00 48.27 ? 179 THR A CB  1 
ATOM   4471 O OG1 . THR C 1 174 ? 69.763 29.261  76.509  1.00 58.64 ? 179 THR A OG1 1 
ATOM   4472 C CG2 . THR C 1 174 ? 70.039 27.292  75.156  1.00 49.17 ? 179 THR A CG2 1 
ATOM   4473 N N   . MET C 1 175 ? 68.560 27.991  72.286  1.00 47.50 ? 180 MET A N   1 
ATOM   4474 C CA  . MET C 1 175 ? 68.017 27.051  71.328  1.00 48.66 ? 180 MET A CA  1 
ATOM   4475 C C   . MET C 1 175 ? 69.171 26.279  70.714  1.00 48.66 ? 180 MET A C   1 
ATOM   4476 O O   . MET C 1 175 ? 70.314 26.733  70.730  1.00 48.70 ? 180 MET A O   1 
ATOM   4477 C CB  . MET C 1 175 ? 67.207 27.782  70.249  1.00 50.35 ? 180 MET A CB  1 
ATOM   4478 C CG  . MET C 1 175 ? 67.994 28.732  69.368  1.00 50.41 ? 180 MET A CG  1 
ATOM   4479 S SD  . MET C 1 175 ? 68.925 27.886  68.088  1.00 58.00 ? 180 MET A SD  1 
ATOM   4480 C CE  . MET C 1 175 ? 67.612 27.412  66.982  1.00 51.05 ? 180 MET A CE  1 
ATOM   4481 N N   . SER C 1 176 ? 68.872 25.095  70.198  1.00 48.22 ? 181 SER A N   1 
ATOM   4482 C CA  . SER C 1 176 ? 69.887 24.265  69.573  1.00 50.00 ? 181 SER A CA  1 
ATOM   4483 C C   . SER C 1 176 ? 69.443 23.897  68.169  1.00 48.47 ? 181 SER A C   1 
ATOM   4484 O O   . SER C 1 176 ? 68.275 24.058  67.818  1.00 49.47 ? 181 SER A O   1 
ATOM   4485 C CB  . SER C 1 176 ? 70.133 23.004  70.412  1.00 51.32 ? 181 SER A CB  1 
ATOM   4486 O OG  . SER C 1 176 ? 68.913 22.396  70.805  1.00 55.72 ? 181 SER A OG  1 
ATOM   4487 N N   . SER C 1 177 ? 70.383 23.422  67.364  1.00 47.85 ? 182 SER A N   1 
ATOM   4488 C CA  . SER C 1 177 ? 70.088 23.032  65.992  1.00 48.46 ? 182 SER A CA  1 
ATOM   4489 C C   . SER C 1 177 ? 70.999 21.878  65.589  1.00 53.53 ? 182 SER A C   1 
ATOM   4490 O O   . SER C 1 177 ? 72.224 21.995  65.658  1.00 52.76 ? 182 SER A O   1 
ATOM   4491 C CB  . SER C 1 177 ? 70.307 24.218  65.061  1.00 41.71 ? 182 SER A CB  1 
ATOM   4492 O OG  . SER C 1 177 ? 70.129 23.845  63.714  1.00 42.46 ? 182 SER A OG  1 
ATOM   4493 N N   . SER C 1 178 ? 70.401 20.763  65.171  1.00 54.59 ? 183 SER A N   1 
ATOM   4494 C CA  . SER C 1 178 ? 71.177 19.597  64.763  1.00 54.61 ? 183 SER A CA  1 
ATOM   4495 C C   . SER C 1 178 ? 71.093 19.325  63.265  1.00 55.00 ? 183 SER A C   1 
ATOM   4496 O O   . SER C 1 178 ? 70.111 19.667  62.608  1.00 56.48 ? 183 SER A O   1 
ATOM   4497 C CB  . SER C 1 178 ? 70.710 18.357  65.526  1.00 54.87 ? 183 SER A CB  1 
ATOM   4498 O OG  . SER C 1 178 ? 69.381 18.020  65.179  1.00 56.45 ? 183 SER A OG  1 
ATOM   4499 N N   . VAL C 1 179 ? 72.141 18.710  62.735  1.00 58.74 ? 184 VAL A N   1 
ATOM   4500 C CA  . VAL C 1 179 ? 72.218 18.362  61.323  1.00 60.79 ? 184 VAL A CA  1 
ATOM   4501 C C   . VAL C 1 179 ? 72.764 16.940  61.242  1.00 63.41 ? 184 VAL A C   1 
ATOM   4502 O O   . VAL C 1 179 ? 73.331 16.434  62.210  1.00 62.61 ? 184 VAL A O   1 
ATOM   4503 C CB  . VAL C 1 179 ? 73.166 19.315  60.563  1.00 58.71 ? 184 VAL A CB  1 
ATOM   4504 C CG1 . VAL C 1 179 ? 74.606 19.072  60.995  1.00 60.39 ? 184 VAL A CG1 1 
ATOM   4505 C CG2 . VAL C 1 179 ? 73.003 19.131  59.062  1.00 59.85 ? 184 VAL A CG2 1 
ATOM   4506 N N   . THR C 1 180 ? 72.590 16.294  60.097  1.00 65.55 ? 185 THR A N   1 
ATOM   4507 C CA  . THR C 1 180 ? 73.085 14.935  59.928  1.00 66.04 ? 185 THR A CA  1 
ATOM   4508 C C   . THR C 1 180 ? 73.577 14.681  58.512  1.00 68.25 ? 185 THR A C   1 
ATOM   4509 O O   . THR C 1 180 ? 72.914 15.034  57.534  1.00 66.71 ? 185 THR A O   1 
ATOM   4510 C CB  . THR C 1 180 ? 72.002 13.904  60.267  1.00 64.48 ? 185 THR A CB  1 
ATOM   4511 O OG1 . THR C 1 180 ? 70.815 14.201  59.522  1.00 67.41 ? 185 THR A OG1 1 
ATOM   4512 C CG2 . THR C 1 180 ? 71.690 13.930  61.754  1.00 62.11 ? 185 THR A CG2 1 
ATOM   4513 N N   . VAL C 1 181 ? 74.756 14.075  58.417  1.00 71.42 ? 186 VAL A N   1 
ATOM   4514 C CA  . VAL C 1 181 ? 75.361 13.754  57.131  1.00 74.44 ? 186 VAL A CA  1 
ATOM   4515 C C   . VAL C 1 181 ? 76.220 12.502  57.280  1.00 75.51 ? 186 VAL A C   1 
ATOM   4516 O O   . VAL C 1 181 ? 76.683 12.183  58.376  1.00 75.14 ? 186 VAL A O   1 
ATOM   4517 C CB  . VAL C 1 181 ? 76.261 14.905  56.623  1.00 74.96 ? 186 VAL A CB  1 
ATOM   4518 C CG1 . VAL C 1 181 ? 75.440 16.167  56.431  1.00 73.04 ? 186 VAL A CG1 1 
ATOM   4519 C CG2 . VAL C 1 181 ? 77.394 15.148  57.605  1.00 73.71 ? 186 VAL A CG2 1 
ATOM   4520 N N   . PRO C 1 182 ? 76.435 11.771  56.175  1.00 75.78 ? 187 PRO A N   1 
ATOM   4521 C CA  . PRO C 1 182 ? 77.250 10.552  56.210  1.00 76.29 ? 187 PRO A CA  1 
ATOM   4522 C C   . PRO C 1 182 ? 78.728 10.885  56.425  1.00 76.84 ? 187 PRO A C   1 
ATOM   4523 O O   . PRO C 1 182 ? 79.217 11.912  55.946  1.00 77.52 ? 187 PRO A O   1 
ATOM   4524 C CB  . PRO C 1 182 ? 76.982 9.927   54.845  1.00 75.71 ? 187 PRO A CB  1 
ATOM   4525 C CG  . PRO C 1 182 ? 76.795 11.127  53.967  1.00 74.76 ? 187 PRO A CG  1 
ATOM   4526 C CD  . PRO C 1 182 ? 75.912 12.016  54.818  1.00 74.60 ? 187 PRO A CD  1 
ATOM   4527 N N   . SER C 1 183 ? 79.437 10.024  57.149  1.00 77.29 ? 188 SER A N   1 
ATOM   4528 C CA  . SER C 1 183 ? 80.853 10.253  57.415  1.00 78.62 ? 188 SER A CA  1 
ATOM   4529 C C   . SER C 1 183 ? 81.657 10.278  56.118  1.00 79.45 ? 188 SER A C   1 
ATOM   4530 O O   . SER C 1 183 ? 82.725 10.889  56.051  1.00 77.90 ? 188 SER A O   1 
ATOM   4531 C CB  . SER C 1 183 ? 81.406 9.169   58.343  1.00 78.78 ? 188 SER A CB  1 
ATOM   4532 O OG  . SER C 1 183 ? 82.729 9.475   58.753  1.00 78.42 ? 188 SER A OG  1 
ATOM   4533 N N   . SER C 1 184 ? 81.134 9.614   55.091  1.00 81.23 ? 189 SER A N   1 
ATOM   4534 C CA  . SER C 1 184 ? 81.789 9.556   53.788  1.00 82.99 ? 189 SER A CA  1 
ATOM   4535 C C   . SER C 1 184 ? 82.053 10.964  53.269  1.00 83.84 ? 189 SER A C   1 
ATOM   4536 O O   . SER C 1 184 ? 82.917 11.173  52.416  1.00 84.45 ? 189 SER A O   1 
ATOM   4537 C CB  . SER C 1 184 ? 80.913 8.797   52.790  1.00 82.91 ? 189 SER A CB  1 
ATOM   4538 O OG  . SER C 1 184 ? 79.653 9.427   52.637  1.00 81.27 ? 189 SER A OG  1 
ATOM   4539 N N   . THR C 1 185 ? 81.298 11.926  53.789  1.00 84.80 ? 190 THR A N   1 
ATOM   4540 C CA  . THR C 1 185 ? 81.447 13.319  53.394  1.00 85.02 ? 190 THR A CA  1 
ATOM   4541 C C   . THR C 1 185 ? 81.784 14.174  54.613  1.00 84.76 ? 190 THR A C   1 
ATOM   4542 O O   . THR C 1 185 ? 81.998 15.382  54.497  1.00 81.82 ? 190 THR A O   1 
ATOM   4543 C CB  . THR C 1 185 ? 80.153 13.853  52.746  1.00 85.92 ? 190 THR A CB  1 
ATOM   4544 O OG1 . THR C 1 185 ? 80.342 15.219  52.351  1.00 87.90 ? 190 THR A OG1 1 
ATOM   4545 C CG2 . THR C 1 185 ? 78.989 13.764  53.726  1.00 83.89 ? 190 THR A CG2 1 
ATOM   4546 N N   . TRP C 1 186 ? 81.833 13.537  55.781  1.00 84.90 ? 191 TRP A N   1 
ATOM   4547 C CA  . TRP C 1 186 ? 82.146 14.229  57.026  1.00 86.25 ? 191 TRP A CA  1 
ATOM   4548 C C   . TRP C 1 186 ? 83.368 15.142  56.920  1.00 87.16 ? 191 TRP A C   1 
ATOM   4549 O O   . TRP C 1 186 ? 83.329 16.289  57.361  1.00 87.96 ? 191 TRP A O   1 
ATOM   4550 C CB  . TRP C 1 186 ? 82.348 13.214  58.159  1.00 86.06 ? 191 TRP A CB  1 
ATOM   4551 C CG  . TRP C 1 186 ? 83.218 13.711  59.277  1.00 87.68 ? 191 TRP A CG  1 
ATOM   4552 C CD1 . TRP C 1 186 ? 84.582 13.695  59.321  1.00 88.56 ? 191 TRP A CD1 1 
ATOM   4553 C CD2 . TRP C 1 186 ? 82.785 14.324  60.498  1.00 89.62 ? 191 TRP A CD2 1 
ATOM   4554 N NE1 . TRP C 1 186 ? 85.027 14.258  60.492  1.00 90.04 ? 191 TRP A NE1 1 
ATOM   4555 C CE2 . TRP C 1 186 ? 83.945 14.653  61.235  1.00 90.64 ? 191 TRP A CE2 1 
ATOM   4556 C CE3 . TRP C 1 186 ? 81.530 14.626  61.044  1.00 89.73 ? 191 TRP A CE3 1 
ATOM   4557 C CZ2 . TRP C 1 186 ? 83.888 15.272  62.491  1.00 89.70 ? 191 TRP A CZ2 1 
ATOM   4558 C CZ3 . TRP C 1 186 ? 81.475 15.241  62.294  1.00 89.92 ? 191 TRP A CZ3 1 
ATOM   4559 C CH2 . TRP C 1 186 ? 82.646 15.556  63.002  1.00 89.44 ? 191 TRP A CH2 1 
ATOM   4560 N N   . PRO C 1 187 ? 84.474 14.642  56.345  1.00 86.69 ? 192 PRO A N   1 
ATOM   4561 C CA  . PRO C 1 187 ? 85.673 15.475  56.217  1.00 85.57 ? 192 PRO A CA  1 
ATOM   4562 C C   . PRO C 1 187 ? 85.575 16.479  55.070  1.00 85.65 ? 192 PRO A C   1 
ATOM   4563 O O   . PRO C 1 187 ? 86.490 16.593  54.254  1.00 85.90 ? 192 PRO A O   1 
ATOM   4564 C CB  . PRO C 1 187 ? 86.774 14.446  55.998  1.00 86.08 ? 192 PRO A CB  1 
ATOM   4565 C CG  . PRO C 1 187 ? 86.072 13.399  55.190  1.00 87.24 ? 192 PRO A CG  1 
ATOM   4566 C CD  . PRO C 1 187 ? 84.748 13.259  55.909  1.00 86.26 ? 192 PRO A CD  1 
ATOM   4567 N N   . SER C 1 188 ? 84.461 17.204  55.014  1.00 84.61 ? 193 SER A N   1 
ATOM   4568 C CA  . SER C 1 188 ? 84.243 18.197  53.966  1.00 84.77 ? 193 SER A CA  1 
ATOM   4569 C C   . SER C 1 188 ? 83.794 19.539  54.543  1.00 83.63 ? 193 SER A C   1 
ATOM   4570 O O   . SER C 1 188 ? 83.093 20.305  53.882  1.00 83.07 ? 193 SER A O   1 
ATOM   4571 C CB  . SER C 1 188 ? 83.197 17.691  52.968  1.00 85.25 ? 193 SER A CB  1 
ATOM   4572 O OG  . SER C 1 188 ? 83.624 16.493  52.341  1.00 87.40 ? 193 SER A OG  1 
ATOM   4573 N N   . THR C 1 189 ? 84.204 19.808  55.780  1.00 82.27 ? 195 THR A N   1 
ATOM   4574 C CA  . THR C 1 189 ? 83.877 21.048  56.482  1.00 80.48 ? 195 THR A CA  1 
ATOM   4575 C C   . THR C 1 189 ? 82.384 21.321  56.670  1.00 78.95 ? 195 THR A C   1 
ATOM   4576 O O   . THR C 1 189 ? 81.673 21.660  55.721  1.00 77.94 ? 195 THR A O   1 
ATOM   4577 C CB  . THR C 1 189 ? 84.516 22.275  55.785  1.00 81.98 ? 195 THR A CB  1 
ATOM   4578 O OG1 . THR C 1 189 ? 83.982 22.421  54.463  1.00 83.42 ? 195 THR A OG1 1 
ATOM   4579 C CG2 . THR C 1 189 ? 86.029 22.109  55.704  1.00 82.18 ? 195 THR A CG2 1 
ATOM   4580 N N   . VAL C 1 190 ? 81.923 21.168  57.910  1.00 77.80 ? 196 VAL A N   1 
ATOM   4581 C CA  . VAL C 1 190 ? 80.526 21.411  58.273  1.00 76.96 ? 196 VAL A CA  1 
ATOM   4582 C C   . VAL C 1 190 ? 80.469 22.691  59.105  1.00 75.42 ? 196 VAL A C   1 
ATOM   4583 O O   . VAL C 1 190 ? 81.083 22.766  60.172  1.00 75.72 ? 196 VAL A O   1 
ATOM   4584 C CB  . VAL C 1 190 ? 79.948 20.247  59.117  1.00 77.42 ? 196 VAL A CB  1 
ATOM   4585 C CG1 . VAL C 1 190 ? 78.510 20.548  59.509  1.00 77.50 ? 196 VAL A CG1 1 
ATOM   4586 C CG2 . VAL C 1 190 ? 80.014 18.952  58.331  1.00 78.38 ? 196 VAL A CG2 1 
ATOM   4587 N N   . THR C 1 191 ? 79.738 23.693  58.623  1.00 72.54 ? 197 THR A N   1 
ATOM   4588 C CA  . THR C 1 191 ? 79.642 24.961  59.341  1.00 72.09 ? 197 THR A CA  1 
ATOM   4589 C C   . THR C 1 191 ? 78.215 25.480  59.529  1.00 70.73 ? 197 THR A C   1 
ATOM   4590 O O   . THR C 1 191 ? 77.414 25.482  58.593  1.00 73.34 ? 197 THR A O   1 
ATOM   4591 C CB  . THR C 1 191 ? 80.478 26.057  58.634  1.00 71.79 ? 197 THR A CB  1 
ATOM   4592 O OG1 . THR C 1 191 ? 80.369 27.288  59.361  1.00 73.28 ? 197 THR A OG1 1 
ATOM   4593 C CG2 . THR C 1 191 ? 79.990 26.266  57.205  1.00 70.21 ? 197 THR A CG2 1 
ATOM   4594 N N   . CYS C 1 192 ? 77.907 25.915  60.750  1.00 66.59 ? 198 CYS A N   1 
ATOM   4595 C CA  . CYS C 1 192 ? 76.590 26.455  61.073  1.00 62.29 ? 198 CYS A CA  1 
ATOM   4596 C C   . CYS C 1 192 ? 76.702 27.973  61.189  1.00 62.03 ? 198 CYS A C   1 
ATOM   4597 O O   . CYS C 1 192 ? 77.608 28.482  61.845  1.00 61.45 ? 198 CYS A O   1 
ATOM   4598 C CB  . CYS C 1 192 ? 76.080 25.889  62.402  1.00 60.21 ? 198 CYS A CB  1 
ATOM   4599 S SG  . CYS C 1 192 ? 77.003 26.471  63.860  1.00 60.76 ? 198 CYS A SG  1 
ATOM   4600 N N   . SER C 1 193 ? 75.785 28.692  60.549  1.00 60.87 ? 199 SER A N   1 
ATOM   4601 C CA  . SER C 1 193 ? 75.789 30.153  60.589  1.00 58.87 ? 199 SER A CA  1 
ATOM   4602 C C   . SER C 1 193 ? 74.603 30.714  61.375  1.00 58.38 ? 199 SER A C   1 
ATOM   4603 O O   . SER C 1 193 ? 73.460 30.653  60.922  1.00 58.66 ? 199 SER A O   1 
ATOM   4604 C CB  . SER C 1 193 ? 75.765 30.718  59.172  1.00 58.64 ? 199 SER A CB  1 
ATOM   4605 O OG  . SER C 1 193 ? 75.618 32.127  59.205  1.00 62.37 ? 199 SER A OG  1 
ATOM   4606 N N   . VAL C 1 194 ? 74.888 31.270  62.549  1.00 55.79 ? 200 VAL A N   1 
ATOM   4607 C CA  . VAL C 1 194 ? 73.858 31.838  63.409  1.00 51.15 ? 200 VAL A CA  1 
ATOM   4608 C C   . VAL C 1 194 ? 73.730 33.344  63.210  1.00 52.42 ? 200 VAL A C   1 
ATOM   4609 O O   . VAL C 1 194 ? 74.673 34.096  63.464  1.00 51.52 ? 200 VAL A O   1 
ATOM   4610 C CB  . VAL C 1 194 ? 74.169 31.568  64.895  1.00 47.25 ? 200 VAL A CB  1 
ATOM   4611 C CG1 . VAL C 1 194 ? 73.076 32.144  65.774  1.00 47.66 ? 200 VAL A CG1 1 
ATOM   4612 C CG2 . VAL C 1 194 ? 74.304 30.079  65.132  1.00 47.29 ? 200 VAL A CG2 1 
ATOM   4613 N N   . ALA C 1 195 ? 72.558 33.779  62.754  1.00 50.32 ? 201 ALA A N   1 
ATOM   4614 C CA  . ALA C 1 195 ? 72.294 35.196  62.528  1.00 49.20 ? 201 ALA A CA  1 
ATOM   4615 C C   . ALA C 1 195 ? 71.368 35.706  63.628  1.00 48.59 ? 201 ALA A C   1 
ATOM   4616 O O   . ALA C 1 195 ? 70.456 35.001  64.058  1.00 44.84 ? 201 ALA A O   1 
ATOM   4617 C CB  . ALA C 1 195 ? 71.652 35.396  61.166  1.00 50.89 ? 201 ALA A CB  1 
ATOM   4618 N N   . HIS C 1 196 ? 71.604 36.930  64.082  1.00 48.18 ? 202 HIS A N   1 
ATOM   4619 C CA  . HIS C 1 196 ? 70.800 37.520  65.148  1.00 51.32 ? 202 HIS A CA  1 
ATOM   4620 C C   . HIS C 1 196 ? 70.765 39.037  64.959  1.00 55.56 ? 202 HIS A C   1 
ATOM   4621 O O   . HIS C 1 196 ? 71.379 39.789  65.717  1.00 55.93 ? 202 HIS A O   1 
ATOM   4622 C CB  . HIS C 1 196 ? 71.420 37.141  66.492  1.00 48.89 ? 202 HIS A CB  1 
ATOM   4623 C CG  . HIS C 1 196 ? 70.630 37.583  67.682  1.00 48.10 ? 202 HIS A CG  1 
ATOM   4624 N ND1 . HIS C 1 196 ? 70.961 38.698  68.420  1.00 41.83 ? 202 HIS A ND1 1 
ATOM   4625 C CD2 . HIS C 1 196 ? 69.545 37.041  68.285  1.00 47.18 ? 202 HIS A CD2 1 
ATOM   4626 C CE1 . HIS C 1 196 ? 70.117 38.824  69.426  1.00 44.78 ? 202 HIS A CE1 1 
ATOM   4627 N NE2 . HIS C 1 196 ? 69.247 37.831  69.369  1.00 44.11 ? 202 HIS A NE2 1 
ATOM   4628 N N   . PRO C 1 197 ? 70.027 39.502  63.938  1.00 57.81 ? 203 PRO A N   1 
ATOM   4629 C CA  . PRO C 1 197 ? 69.880 40.922  63.594  1.00 60.53 ? 203 PRO A CA  1 
ATOM   4630 C C   . PRO C 1 197 ? 69.686 41.896  64.753  1.00 60.04 ? 203 PRO A C   1 
ATOM   4631 O O   . PRO C 1 197 ? 70.328 42.945  64.798  1.00 61.79 ? 203 PRO A O   1 
ATOM   4632 C CB  . PRO C 1 197 ? 68.700 40.922  62.616  1.00 60.22 ? 203 PRO A CB  1 
ATOM   4633 C CG  . PRO C 1 197 ? 67.936 39.677  62.984  1.00 60.48 ? 203 PRO A CG  1 
ATOM   4634 C CD  . PRO C 1 197 ? 69.048 38.692  63.194  1.00 59.18 ? 203 PRO A CD  1 
ATOM   4635 N N   . ALA C 1 198 ? 68.811 41.556  65.689  1.00 59.61 ? 204 ALA A N   1 
ATOM   4636 C CA  . ALA C 1 198 ? 68.553 42.428  66.828  1.00 57.38 ? 204 ALA A CA  1 
ATOM   4637 C C   . ALA C 1 198 ? 69.828 42.722  67.616  1.00 58.00 ? 204 ALA A C   1 
ATOM   4638 O O   . ALA C 1 198 ? 69.816 43.490  68.577  1.00 58.34 ? 204 ALA A O   1 
ATOM   4639 C CB  . ALA C 1 198 ? 67.513 41.799  67.731  1.00 60.14 ? 204 ALA A CB  1 
ATOM   4640 N N   . SER C 1 199 ? 70.923 42.098  67.203  1.00 55.93 ? 205 SER A N   1 
ATOM   4641 C CA  . SER C 1 199 ? 72.215 42.282  67.846  1.00 55.23 ? 205 SER A CA  1 
ATOM   4642 C C   . SER C 1 199 ? 73.229 42.657  66.771  1.00 53.31 ? 205 SER A C   1 
ATOM   4643 O O   . SER C 1 199 ? 74.377 42.986  67.069  1.00 51.57 ? 205 SER A O   1 
ATOM   4644 C CB  . SER C 1 199 ? 72.643 40.985  68.535  1.00 57.09 ? 205 SER A CB  1 
ATOM   4645 O OG  . SER C 1 199 ? 73.874 41.138  69.211  1.00 64.32 ? 205 SER A OG  1 
ATOM   4646 N N   . GLY C 1 200 ? 72.786 42.611  65.518  1.00 53.25 ? 206 GLY A N   1 
ATOM   4647 C CA  . GLY C 1 200 ? 73.657 42.935  64.407  1.00 54.54 ? 206 GLY A CA  1 
ATOM   4648 C C   . GLY C 1 200 ? 74.833 41.983  64.385  1.00 56.93 ? 206 GLY A C   1 
ATOM   4649 O O   . GLY C 1 200 ? 75.923 42.336  63.931  1.00 58.88 ? 206 GLY A O   1 
ATOM   4650 N N   . THR C 1 201 ? 74.606 40.766  64.871  1.00 56.23 ? 207 THR A N   1 
ATOM   4651 C CA  . THR C 1 201 ? 75.653 39.757  64.939  1.00 55.39 ? 207 THR A CA  1 
ATOM   4652 C C   . THR C 1 201 ? 75.377 38.521  64.089  1.00 57.54 ? 207 THR A C   1 
ATOM   4653 O O   . THR C 1 201 ? 74.230 38.135  63.875  1.00 60.11 ? 207 THR A O   1 
ATOM   4654 C CB  . THR C 1 201 ? 75.860 39.291  66.393  1.00 55.76 ? 207 THR A CB  1 
ATOM   4655 O OG1 . THR C 1 201 ? 76.084 40.430  67.234  1.00 57.48 ? 207 THR A OG1 1 
ATOM   4656 C CG2 . THR C 1 201 ? 77.052 38.350  66.490  1.00 54.85 ? 207 THR A CG2 1 
ATOM   4657 N N   . THR C 1 202 ? 76.450 37.908  63.609  1.00 57.07 ? 208 THR A N   1 
ATOM   4658 C CA  . THR C 1 202 ? 76.371 36.690  62.815  1.00 54.93 ? 208 THR A CA  1 
ATOM   4659 C C   . THR C 1 202 ? 77.599 35.855  63.173  1.00 52.98 ? 208 THR A C   1 
ATOM   4660 O O   . THR C 1 202 ? 78.728 36.240  62.874  1.00 51.46 ? 208 THR A O   1 
ATOM   4661 C CB  . THR C 1 202 ? 76.377 36.994  61.304  1.00 54.38 ? 208 THR A CB  1 
ATOM   4662 O OG1 . THR C 1 202 ? 75.235 37.788  60.971  1.00 56.31 ? 208 THR A OG1 1 
ATOM   4663 C CG2 . THR C 1 202 ? 76.328 35.706  60.504  1.00 53.71 ? 208 THR A CG2 1 
ATOM   4664 N N   . VAL C 1 203 ? 77.379 34.726  63.838  1.00 51.41 ? 209 VAL A N   1 
ATOM   4665 C CA  . VAL C 1 203 ? 78.480 33.861  64.229  1.00 52.80 ? 209 VAL A CA  1 
ATOM   4666 C C   . VAL C 1 203 ? 78.478 32.572  63.426  1.00 55.81 ? 209 VAL A C   1 
ATOM   4667 O O   . VAL C 1 203 ? 77.432 31.957  63.227  1.00 54.16 ? 209 VAL A O   1 
ATOM   4668 C CB  . VAL C 1 203 ? 78.408 33.498  65.721  1.00 52.39 ? 209 VAL A CB  1 
ATOM   4669 C CG1 . VAL C 1 203 ? 79.605 32.645  66.102  1.00 47.28 ? 209 VAL A CG1 1 
ATOM   4670 C CG2 . VAL C 1 203 ? 78.361 34.764  66.560  1.00 51.92 ? 209 VAL A CG2 1 
ATOM   4671 N N   . ASP C 1 204 ? 79.659 32.168  62.973  1.00 57.30 ? 210 ASP A N   1 
ATOM   4672 C CA  . ASP C 1 204 ? 79.801 30.949  62.192  1.00 59.18 ? 210 ASP A CA  1 
ATOM   4673 C C   . ASP C 1 204 ? 80.892 30.071  62.775  1.00 59.64 ? 210 ASP A C   1 
ATOM   4674 O O   . ASP C 1 204 ? 82.012 30.531  63.001  1.00 59.07 ? 210 ASP A O   1 
ATOM   4675 C CB  . ASP C 1 204 ? 80.141 31.289  60.742  1.00 60.81 ? 210 ASP A CB  1 
ATOM   4676 C CG  . ASP C 1 204 ? 79.029 32.039  60.048  1.00 64.81 ? 210 ASP A CG  1 
ATOM   4677 O OD1 . ASP C 1 204 ? 78.607 33.093  60.566  1.00 67.90 ? 210 ASP A OD1 1 
ATOM   4678 O OD2 . ASP C 1 204 ? 78.574 31.575  58.984  1.00 69.24 ? 210 ASP A OD2 1 
ATOM   4679 N N   . LYS C 1 205 ? 80.556 28.808  63.022  1.00 58.70 ? 211 LYS A N   1 
ATOM   4680 C CA  . LYS C 1 205 ? 81.510 27.855  63.567  1.00 60.43 ? 211 LYS A CA  1 
ATOM   4681 C C   . LYS C 1 205 ? 81.549 26.545  62.778  1.00 64.75 ? 211 LYS A C   1 
ATOM   4682 O O   . LYS C 1 205 ? 80.533 25.858  62.637  1.00 62.58 ? 211 LYS A O   1 
ATOM   4683 C CB  . LYS C 1 205 ? 81.192 27.558  65.036  1.00 59.63 ? 211 LYS A CB  1 
ATOM   4684 C CG  . LYS C 1 205 ? 81.716 28.597  66.014  1.00 58.88 ? 211 LYS A CG  1 
ATOM   4685 C CD  . LYS C 1 205 ? 81.645 28.075  67.440  1.00 57.28 ? 211 LYS A CD  1 
ATOM   4686 C CE  . LYS C 1 205 ? 82.484 28.917  68.401  1.00 59.93 ? 211 LYS A CE  1 
ATOM   4687 N NZ  . LYS C 1 205 ? 81.925 30.279  68.652  1.00 58.06 ? 211 LYS A NZ  1 
ATOM   4688 N N   . LYS C 1 206 ? 82.729 26.211  62.258  1.00 67.16 ? 212 LYS A N   1 
ATOM   4689 C CA  . LYS C 1 206 ? 82.914 24.974  61.505  1.00 69.92 ? 212 LYS A CA  1 
ATOM   4690 C C   . LYS C 1 206 ? 83.246 23.874  62.504  1.00 70.67 ? 212 LYS A C   1 
ATOM   4691 O O   . LYS C 1 206 ? 84.261 23.947  63.198  1.00 72.54 ? 212 LYS A O   1 
ATOM   4692 C CB  . LYS C 1 206 ? 84.062 25.120  60.506  1.00 70.94 ? 212 LYS A CB  1 
ATOM   4693 C CG  . LYS C 1 206 ? 83.822 26.152  59.414  1.00 72.01 ? 212 LYS A CG  1 
ATOM   4694 C CD  . LYS C 1 206 ? 85.037 26.278  58.501  1.00 73.07 ? 212 LYS A CD  1 
ATOM   4695 C CE  . LYS C 1 206 ? 85.391 24.947  57.847  1.00 73.74 ? 212 LYS A CE  1 
ATOM   4696 N NZ  . LYS C 1 206 ? 86.629 25.030  57.016  1.00 75.16 ? 212 LYS A NZ  1 
ATOM   4697 N N   . LEU C 1 207 ? 82.389 22.863  62.583  1.00 70.96 ? 213 LEU A N   1 
ATOM   4698 C CA  . LEU C 1 207 ? 82.600 21.761  63.515  1.00 71.54 ? 213 LEU A CA  1 
ATOM   4699 C C   . LEU C 1 207 ? 83.844 20.947  63.167  1.00 72.13 ? 213 LEU A C   1 
ATOM   4700 O O   . LEU C 1 207 ? 84.126 20.701  61.990  1.00 69.61 ? 213 LEU A O   1 
ATOM   4701 C CB  . LEU C 1 207 ? 81.369 20.850  63.538  1.00 72.23 ? 213 LEU A CB  1 
ATOM   4702 C CG  . LEU C 1 207 ? 80.057 21.483  64.010  1.00 71.51 ? 213 LEU A CG  1 
ATOM   4703 C CD1 . LEU C 1 207 ? 79.566 22.497  62.990  1.00 71.80 ? 213 LEU A CD1 1 
ATOM   4704 C CD2 . LEU C 1 207 ? 79.017 20.397  64.209  1.00 71.30 ? 213 LEU A CD2 1 
ATOM   4705 N N   . GLU C 1 208 ? 84.578 20.537  64.201  1.00 72.52 ? 214 GLU A N   1 
ATOM   4706 C CA  . GLU C 1 208 ? 85.802 19.752  64.040  1.00 75.31 ? 214 GLU A CA  1 
ATOM   4707 C C   . GLU C 1 208 ? 86.581 20.146  62.786  1.00 76.31 ? 214 GLU A C   1 
ATOM   4708 O O   . GLU C 1 208 ? 86.729 19.281  61.895  1.00 76.09 ? 214 GLU A O   1 
ATOM   4709 C CB  . GLU C 1 208 ? 85.471 18.255  63.995  1.00 75.56 ? 214 GLU A CB  1 
ATOM   4710 C CG  . GLU C 1 208 ? 85.127 17.632  65.349  1.00 77.37 ? 214 GLU A CG  1 
ATOM   4711 C CD  . GLU C 1 208 ? 86.352 17.151  66.114  1.00 77.66 ? 214 GLU A CD  1 
ATOM   4712 O OE1 . GLU C 1 208 ? 86.198 16.700  67.271  1.00 77.46 ? 214 GLU A OE1 1 
ATOM   4713 O OE2 . GLU C 1 208 ? 87.467 17.214  65.557  1.00 77.06 ? 214 GLU A OE2 1 
ATOM   4714 O OXT . GLU C 1 208 ? 87.029 21.312  62.710  1.00 74.03 ? 214 GLU A OXT 1 
ATOM   4715 N N   . ALA D 2 1   ? 30.901 37.019  70.196  1.00 39.24 ? 2   ALA B N   1 
ATOM   4716 C CA  . ALA D 2 1   ? 30.937 35.887  69.215  1.00 33.80 ? 2   ALA B CA  1 
ATOM   4717 C C   . ALA D 2 1   ? 32.229 35.098  69.381  1.00 30.57 ? 2   ALA B C   1 
ATOM   4718 O O   . ALA D 2 1   ? 33.254 35.433  68.798  1.00 37.34 ? 2   ALA B O   1 
ATOM   4719 C CB  . ALA D 2 1   ? 30.828 36.425  67.779  1.00 37.57 ? 2   ALA B CB  1 
ATOM   4720 N N   . ALA D 2 2   ? 32.176 34.047  70.183  1.00 25.48 ? 3   ALA B N   1 
ATOM   4721 C CA  . ALA D 2 2   ? 33.351 33.223  70.423  1.00 24.81 ? 3   ALA B CA  1 
ATOM   4722 C C   . ALA D 2 2   ? 33.365 32.041  69.476  1.00 23.34 ? 3   ALA B C   1 
ATOM   4723 O O   . ALA D 2 2   ? 32.367 31.331  69.334  1.00 24.93 ? 3   ALA B O   1 
ATOM   4724 C CB  . ALA D 2 2   ? 33.370 32.723  71.886  1.00 22.16 ? 3   ALA B CB  1 
ATOM   4725 N N   . LEU D 2 3   ? 34.496 31.843  68.814  1.00 28.28 ? 4   LEU B N   1 
ATOM   4726 C CA  . LEU D 2 3   ? 34.636 30.731  67.895  1.00 32.37 ? 4   LEU B CA  1 
ATOM   4727 C C   . LEU D 2 3   ? 35.499 29.690  68.592  1.00 30.00 ? 4   LEU B C   1 
ATOM   4728 O O   . LEU D 2 3   ? 36.575 29.996  69.089  1.00 28.54 ? 4   LEU B O   1 
ATOM   4729 C CB  . LEU D 2 3   ? 35.271 31.188  66.561  1.00 31.87 ? 4   LEU B CB  1 
ATOM   4730 C CG  . LEU D 2 3   ? 34.248 31.212  65.398  1.00 31.78 ? 4   LEU B CG  1 
ATOM   4731 C CD1 . LEU D 2 3   ? 33.472 32.473  65.468  1.00 8.97  ? 4   LEU B CD1 1 
ATOM   4732 C CD2 . LEU D 2 3   ? 34.921 31.093  64.036  1.00 33.19 ? 4   LEU B CD2 1 
ATOM   4733 N N   . THR D 2 4   ? 35.019 28.458  68.656  1.00 27.96 ? 5   THR B N   1 
ATOM   4734 C CA  . THR D 2 4   ? 35.795 27.431  69.319  1.00 28.94 ? 5   THR B CA  1 
ATOM   4735 C C   . THR D 2 4   ? 36.131 26.259  68.422  1.00 26.32 ? 5   THR B C   1 
ATOM   4736 O O   . THR D 2 4   ? 35.267 25.721  67.735  1.00 23.67 ? 5   THR B O   1 
ATOM   4737 C CB  . THR D 2 4   ? 35.062 26.905  70.581  1.00 28.81 ? 5   THR B CB  1 
ATOM   4738 O OG1 . THR D 2 4   ? 33.972 26.068  70.187  1.00 45.35 ? 5   THR B OG1 1 
ATOM   4739 C CG2 . THR D 2 4   ? 34.499 28.061  71.387  1.00 23.49 ? 5   THR B CG2 1 
ATOM   4740 N N   . GLN D 2 5   ? 37.406 25.883  68.434  1.00 27.56 ? 6   GLN B N   1 
ATOM   4741 C CA  . GLN D 2 5   ? 37.906 24.749  67.669  1.00 27.83 ? 6   GLN B CA  1 
ATOM   4742 C C   . GLN D 2 5   ? 38.738 23.919  68.639  1.00 32.12 ? 6   GLN B C   1 
ATOM   4743 O O   . GLN D 2 5   ? 39.196 24.429  69.655  1.00 35.48 ? 6   GLN B O   1 
ATOM   4744 C CB  . GLN D 2 5   ? 38.861 25.181  66.559  1.00 27.62 ? 6   GLN B CB  1 
ATOM   4745 C CG  . GLN D 2 5   ? 38.630 26.514  65.908  1.00 23.01 ? 6   GLN B CG  1 
ATOM   4746 C CD  . GLN D 2 5   ? 39.780 26.844  64.991  1.00 17.77 ? 6   GLN B CD  1 
ATOM   4747 O OE1 . GLN D 2 5   ? 40.164 26.031  64.146  1.00 36.26 ? 6   GLN B OE1 1 
ATOM   4748 N NE2 . GLN D 2 5   ? 40.345 28.018  65.148  1.00 15.33 ? 6   GLN B NE2 1 
ATOM   4749 N N   . SER D 2 6   ? 38.965 22.654  68.315  1.00 32.93 ? 7   SER B N   1 
ATOM   4750 C CA  . SER D 2 6   ? 39.777 21.802  69.168  1.00 36.51 ? 7   SER B CA  1 
ATOM   4751 C C   . SER D 2 6   ? 41.235 22.132  68.872  1.00 37.94 ? 7   SER B C   1 
ATOM   4752 O O   . SER D 2 6   ? 41.569 22.543  67.767  1.00 33.16 ? 7   SER B O   1 
ATOM   4753 C CB  . SER D 2 6   ? 39.511 20.339  68.849  1.00 40.84 ? 7   SER B CB  1 
ATOM   4754 O OG  . SER D 2 6   ? 39.834 20.074  67.498  1.00 53.51 ? 7   SER B OG  1 
ATOM   4755 N N   . PRO D 2 7   ? 42.127 21.938  69.850  1.00 35.54 ? 8   PRO B N   1 
ATOM   4756 C CA  . PRO D 2 7   ? 43.548 22.241  69.633  1.00 37.84 ? 8   PRO B CA  1 
ATOM   4757 C C   . PRO D 2 7   ? 44.271 21.327  68.639  1.00 34.82 ? 8   PRO B C   1 
ATOM   4758 O O   . PRO D 2 7   ? 45.216 21.750  67.977  1.00 38.43 ? 8   PRO B O   1 
ATOM   4759 C CB  . PRO D 2 7   ? 44.134 22.122  71.034  1.00 39.76 ? 8   PRO B CB  1 
ATOM   4760 C CG  . PRO D 2 7   ? 43.351 20.957  71.581  1.00 44.77 ? 8   PRO B CG  1 
ATOM   4761 C CD  . PRO D 2 7   ? 41.921 21.318  71.170  1.00 44.24 ? 8   PRO B CD  1 
ATOM   4762 N N   . VAL D 2 8   ? 43.830 20.077  68.543  1.00 37.14 ? 9   VAL B N   1 
ATOM   4763 C CA  . VAL D 2 8   ? 44.471 19.112  67.651  1.00 35.49 ? 9   VAL B CA  1 
ATOM   4764 C C   . VAL D 2 8   ? 43.453 18.241  66.930  1.00 35.85 ? 9   VAL B C   1 
ATOM   4765 O O   . VAL D 2 8   ? 42.418 17.885  67.493  1.00 34.38 ? 9   VAL B O   1 
ATOM   4766 C CB  . VAL D 2 8   ? 45.414 18.158  68.440  1.00 40.82 ? 9   VAL B CB  1 
ATOM   4767 C CG1 . VAL D 2 8   ? 46.428 18.951  69.269  1.00 33.70 ? 9   VAL B CG1 1 
ATOM   4768 C CG2 . VAL D 2 8   ? 44.589 17.274  69.359  1.00 42.99 ? 9   VAL B CG2 1 
ATOM   4769 N N   . SER D 2 9   ? 43.751 17.894  65.684  1.00 32.73 ? 10  SER B N   1 
ATOM   4770 C CA  . SER D 2 9   ? 42.854 17.040  64.918  1.00 38.81 ? 10  SER B CA  1 
ATOM   4771 C C   . SER D 2 9   ? 43.277 15.606  65.196  1.00 44.26 ? 10  SER B C   1 
ATOM   4772 O O   . SER D 2 9   ? 44.352 15.368  65.749  1.00 45.89 ? 10  SER B O   1 
ATOM   4773 C CB  . SER D 2 9   ? 43.015 17.292  63.420  1.00 42.28 ? 10  SER B CB  1 
ATOM   4774 O OG  . SER D 2 9   ? 44.202 16.660  62.939  1.00 43.91 ? 10  SER B OG  1 
ATOM   4775 N N   . ASN D 2 10  ? 42.437 14.647  64.824  1.00 49.77 ? 11  ASN B N   1 
ATOM   4776 C CA  . ASN D 2 10  ? 42.803 13.247  64.998  1.00 47.43 ? 11  ASN B CA  1 
ATOM   4777 C C   . ASN D 2 10  ? 43.859 13.008  63.925  1.00 46.32 ? 11  ASN B C   1 
ATOM   4778 O O   . ASN D 2 10  ? 43.837 13.639  62.868  1.00 47.28 ? 11  ASN B O   1 
ATOM   4779 C CB  . ASN D 2 10  ? 41.605 12.323  64.748  1.00 50.25 ? 11  ASN B CB  1 
ATOM   4780 C CG  . ASN D 2 10  ? 40.657 12.267  65.919  1.00 53.51 ? 11  ASN B CG  1 
ATOM   4781 O OD1 . ASN D 2 10  ? 39.452 12.473  65.766  1.00 59.01 ? 11  ASN B OD1 1 
ATOM   4782 N ND2 . ASN D 2 10  ? 41.193 11.980  67.101  1.00 51.58 ? 11  ASN B ND2 1 
ATOM   4783 N N   . PRO D 2 11  ? 44.801 12.103  64.181  1.00 46.80 ? 12  PRO B N   1 
ATOM   4784 C CA  . PRO D 2 11  ? 45.847 11.819  63.197  1.00 45.92 ? 12  PRO B CA  1 
ATOM   4785 C C   . PRO D 2 11  ? 45.239 11.434  61.849  1.00 46.27 ? 12  PRO B C   1 
ATOM   4786 O O   . PRO D 2 11  ? 44.303 10.634  61.783  1.00 50.71 ? 12  PRO B O   1 
ATOM   4787 C CB  . PRO D 2 11  ? 46.621 10.677  63.847  1.00 47.79 ? 12  PRO B CB  1 
ATOM   4788 C CG  . PRO D 2 11  ? 45.571 9.981   64.661  1.00 51.88 ? 12  PRO B CG  1 
ATOM   4789 C CD  . PRO D 2 11  ? 44.852 11.142  65.294  1.00 51.02 ? 12  PRO B CD  1 
ATOM   4790 N N   . VAL D 2 12  ? 45.774 12.003  60.774  1.00 43.50 ? 13  VAL B N   1 
ATOM   4791 C CA  . VAL D 2 12  ? 45.246 11.734  59.445  1.00 35.91 ? 13  VAL B CA  1 
ATOM   4792 C C   . VAL D 2 12  ? 46.229 11.032  58.521  1.00 36.45 ? 13  VAL B C   1 
ATOM   4793 O O   . VAL D 2 12  ? 47.387 11.426  58.403  1.00 34.20 ? 13  VAL B O   1 
ATOM   4794 C CB  . VAL D 2 12  ? 44.788 13.037  58.767  1.00 31.36 ? 13  VAL B CB  1 
ATOM   4795 C CG1 . VAL D 2 12  ? 44.197 12.728  57.389  1.00 30.51 ? 13  VAL B CG1 1 
ATOM   4796 C CG2 . VAL D 2 12  ? 43.766 13.750  59.650  1.00 31.59 ? 13  VAL B CG2 1 
ATOM   4797 N N   . THR D 2 13  ? 45.737 9.991   57.859  1.00 36.12 ? 14  THR B N   1 
ATOM   4798 C CA  . THR D 2 13  ? 46.526 9.210   56.916  1.00 33.14 ? 14  THR B CA  1 
ATOM   4799 C C   . THR D 2 13  ? 46.696 9.999   55.625  1.00 33.10 ? 14  THR B C   1 
ATOM   4800 O O   . THR D 2 13  ? 45.717 10.505  55.076  1.00 32.86 ? 14  THR B O   1 
ATOM   4801 C CB  . THR D 2 13  ? 45.811 7.895   56.581  1.00 34.55 ? 14  THR B CB  1 
ATOM   4802 O OG1 . THR D 2 13  ? 45.550 7.172   57.792  1.00 37.46 ? 14  THR B OG1 1 
ATOM   4803 C CG2 . THR D 2 13  ? 46.659 7.054   55.642  1.00 40.83 ? 14  THR B CG2 1 
ATOM   4804 N N   . LEU D 2 14  ? 47.927 10.102  55.135  1.00 32.21 ? 15  LEU B N   1 
ATOM   4805 C CA  . LEU D 2 14  ? 48.178 10.834  53.902  1.00 36.44 ? 15  LEU B CA  1 
ATOM   4806 C C   . LEU D 2 14  ? 47.304 10.261  52.797  1.00 36.28 ? 15  LEU B C   1 
ATOM   4807 O O   . LEU D 2 14  ? 47.129 9.049   52.703  1.00 40.60 ? 15  LEU B O   1 
ATOM   4808 C CB  . LEU D 2 14  ? 49.655 10.727  53.502  1.00 38.61 ? 15  LEU B CB  1 
ATOM   4809 C CG  . LEU D 2 14  ? 50.675 11.520  54.326  1.00 39.64 ? 15  LEU B CG  1 
ATOM   4810 C CD1 . LEU D 2 14  ? 52.073 11.309  53.745  1.00 42.63 ? 15  LEU B CD1 1 
ATOM   4811 C CD2 . LEU D 2 14  ? 50.320 12.999  54.302  1.00 41.78 ? 15  LEU B CD2 1 
ATOM   4812 N N   . GLY D 2 15  ? 46.745 11.134  51.970  1.00 38.31 ? 16  GLY B N   1 
ATOM   4813 C CA  . GLY D 2 15  ? 45.902 10.676  50.887  1.00 31.37 ? 16  GLY B CA  1 
ATOM   4814 C C   . GLY D 2 15  ? 44.443 10.551  51.283  1.00 32.93 ? 16  GLY B C   1 
ATOM   4815 O O   . GLY D 2 15  ? 43.592 10.365  50.423  1.00 34.62 ? 16  GLY B O   1 
ATOM   4816 N N   . THR D 2 16  ? 44.141 10.633  52.575  1.00 35.13 ? 17  THR B N   1 
ATOM   4817 C CA  . THR D 2 16  ? 42.751 10.535  53.022  1.00 33.89 ? 17  THR B CA  1 
ATOM   4818 C C   . THR D 2 16  ? 42.249 11.917  53.455  1.00 34.67 ? 17  THR B C   1 
ATOM   4819 O O   . THR D 2 16  ? 43.035 12.864  53.544  1.00 34.11 ? 17  THR B O   1 
ATOM   4820 C CB  . THR D 2 16  ? 42.590 9.549   54.198  1.00 34.46 ? 17  THR B CB  1 
ATOM   4821 O OG1 . THR D 2 16  ? 43.179 10.105  55.377  1.00 39.98 ? 17  THR B OG1 1 
ATOM   4822 C CG2 . THR D 2 16  ? 43.272 8.218   53.870  1.00 38.72 ? 17  THR B CG2 1 
ATOM   4823 N N   . SER D 2 17  ? 40.951 12.037  53.729  1.00 26.87 ? 18  SER B N   1 
ATOM   4824 C CA  . SER D 2 17  ? 40.396 13.324  54.128  1.00 28.63 ? 18  SER B CA  1 
ATOM   4825 C C   . SER D 2 17  ? 40.526 13.632  55.619  1.00 28.83 ? 18  SER B C   1 
ATOM   4826 O O   . SER D 2 17  ? 40.480 12.743  56.462  1.00 30.21 ? 18  SER B O   1 
ATOM   4827 C CB  . SER D 2 17  ? 38.914 13.422  53.745  1.00 27.79 ? 18  SER B CB  1 
ATOM   4828 O OG  . SER D 2 17  ? 38.728 13.386  52.342  1.00 34.05 ? 18  SER B OG  1 
ATOM   4829 N N   . ALA D 2 18  ? 40.695 14.914  55.918  1.00 29.91 ? 19  ALA B N   1 
ATOM   4830 C CA  . ALA D 2 18  ? 40.793 15.403  57.286  1.00 30.13 ? 19  ALA B CA  1 
ATOM   4831 C C   . ALA D 2 18  ? 39.605 16.339  57.486  1.00 29.14 ? 19  ALA B C   1 
ATOM   4832 O O   . ALA D 2 18  ? 39.126 16.954  56.535  1.00 27.86 ? 19  ALA B O   1 
ATOM   4833 C CB  . ALA D 2 18  ? 42.093 16.164  57.481  1.00 27.04 ? 19  ALA B CB  1 
ATOM   4834 N N   . SER D 2 19  ? 39.122 16.429  58.717  1.00 28.27 ? 20  SER B N   1 
ATOM   4835 C CA  . SER D 2 19  ? 37.999 17.295  59.047  1.00 28.11 ? 20  SER B CA  1 
ATOM   4836 C C   . SER D 2 19  ? 38.388 18.151  60.244  1.00 29.21 ? 20  SER B C   1 
ATOM   4837 O O   . SER D 2 19  ? 38.890 17.636  61.229  1.00 29.84 ? 20  SER B O   1 
ATOM   4838 C CB  . SER D 2 19  ? 36.759 16.474  59.424  1.00 31.52 ? 20  SER B CB  1 
ATOM   4839 O OG  . SER D 2 19  ? 36.332 15.631  58.372  1.00 35.09 ? 20  SER B OG  1 
ATOM   4840 N N   . ILE D 2 20  ? 38.161 19.455  60.146  1.00 25.38 ? 21  ILE B N   1 
ATOM   4841 C CA  . ILE D 2 20  ? 38.465 20.378  61.240  1.00 29.43 ? 21  ILE B CA  1 
ATOM   4842 C C   . ILE D 2 20  ? 37.190 21.152  61.588  1.00 30.13 ? 21  ILE B C   1 
ATOM   4843 O O   . ILE D 2 20  ? 36.690 21.945  60.788  1.00 31.15 ? 21  ILE B O   1 
ATOM   4844 C CB  . ILE D 2 20  ? 39.589 21.355  60.849  1.00 23.20 ? 21  ILE B CB  1 
ATOM   4845 C CG1 . ILE D 2 20  ? 40.866 20.554  60.576  1.00 28.00 ? 21  ILE B CG1 1 
ATOM   4846 C CG2 . ILE D 2 20  ? 39.817 22.378  61.974  1.00 31.53 ? 21  ILE B CG2 1 
ATOM   4847 C CD1 . ILE D 2 20  ? 42.106 21.386  60.387  1.00 31.48 ? 21  ILE B CD1 1 
ATOM   4848 N N   . SER D 2 21  ? 36.666 20.905  62.781  1.00 26.57 ? 22  SER B N   1 
ATOM   4849 C CA  . SER D 2 21  ? 35.428 21.532  63.223  1.00 28.76 ? 22  SER B CA  1 
ATOM   4850 C C   . SER D 2 21  ? 35.632 22.910  63.817  1.00 30.08 ? 22  SER B C   1 
ATOM   4851 O O   . SER D 2 21  ? 36.734 23.278  64.221  1.00 29.94 ? 22  SER B O   1 
ATOM   4852 C CB  . SER D 2 21  ? 34.725 20.653  64.252  1.00 33.05 ? 22  SER B CB  1 
ATOM   4853 O OG  . SER D 2 21  ? 35.349 20.782  65.515  1.00 44.71 ? 22  SER B OG  1 
ATOM   4854 N N   . CYS D 2 22  ? 34.552 23.678  63.857  1.00 26.53 ? 23  CYS B N   1 
ATOM   4855 C CA  . CYS D 2 22  ? 34.576 25.022  64.411  1.00 26.35 ? 23  CYS B CA  1 
ATOM   4856 C C   . CYS D 2 22  ? 33.144 25.367  64.720  1.00 29.99 ? 23  CYS B C   1 
ATOM   4857 O O   . CYS D 2 22  ? 32.229 24.994  63.982  1.00 29.47 ? 23  CYS B O   1 
ATOM   4858 C CB  . CYS D 2 22  ? 35.153 26.018  63.410  1.00 36.11 ? 23  CYS B CB  1 
ATOM   4859 S SG  . CYS D 2 22  ? 35.006 27.795  63.846  1.00 40.78 ? 23  CYS B SG  1 
ATOM   4860 N N   . ARG D 2 23  ? 32.950 26.076  65.821  1.00 27.62 ? 24  ARG B N   1 
ATOM   4861 C CA  . ARG D 2 23  ? 31.620 26.446  66.262  1.00 32.29 ? 24  ARG B CA  1 
ATOM   4862 C C   . ARG D 2 23  ? 31.607 27.894  66.748  1.00 32.64 ? 24  ARG B C   1 
ATOM   4863 O O   . ARG D 2 23  ? 32.588 28.375  67.324  1.00 32.45 ? 24  ARG B O   1 
ATOM   4864 C CB  . ARG D 2 23  ? 31.202 25.498  67.385  1.00 33.39 ? 24  ARG B CB  1 
ATOM   4865 C CG  . ARG D 2 23  ? 29.836 25.763  67.978  1.00 49.33 ? 24  ARG B CG  1 
ATOM   4866 C CD  . ARG D 2 23  ? 29.678 24.999  69.291  1.00 56.31 ? 24  ARG B CD  1 
ATOM   4867 N NE  . ARG D 2 23  ? 28.395 25.256  69.943  1.00 62.51 ? 24  ARG B NE  1 
ATOM   4868 C CZ  . ARG D 2 23  ? 27.221 24.834  69.478  1.00 63.92 ? 24  ARG B CZ  1 
ATOM   4869 N NH1 . ARG D 2 23  ? 27.166 24.132  68.354  1.00 62.21 ? 24  ARG B NH1 1 
ATOM   4870 N NH2 . ARG D 2 23  ? 26.101 25.115  70.136  1.00 61.90 ? 24  ARG B NH2 1 
ATOM   4871 N N   . SER D 2 24  ? 30.498 28.582  66.504  1.00 30.24 ? 25  SER B N   1 
ATOM   4872 C CA  . SER D 2 24  ? 30.347 29.969  66.913  1.00 33.26 ? 25  SER B CA  1 
ATOM   4873 C C   . SER D 2 24  ? 29.182 30.057  67.890  1.00 34.86 ? 25  SER B C   1 
ATOM   4874 O O   . SER D 2 24  ? 28.240 29.278  67.804  1.00 38.70 ? 25  SER B O   1 
ATOM   4875 C CB  . SER D 2 24  ? 30.036 30.844  65.708  1.00 29.96 ? 25  SER B CB  1 
ATOM   4876 O OG  . SER D 2 24  ? 28.745 30.532  65.210  1.00 34.26 ? 25  SER B OG  1 
ATOM   4877 N N   . THR D 2 25  ? 29.241 31.009  68.812  1.00 31.35 ? 26  THR B N   1 
ATOM   4878 C CA  . THR D 2 25  ? 28.163 31.177  69.776  1.00 34.59 ? 26  THR B CA  1 
ATOM   4879 C C   . THR D 2 25  ? 26.956 31.828  69.104  1.00 37.12 ? 26  THR B C   1 
ATOM   4880 O O   . THR D 2 25  ? 25.846 31.795  69.635  1.00 32.70 ? 26  THR B O   1 
ATOM   4881 C CB  . THR D 2 25  ? 28.600 32.072  70.962  1.00 31.78 ? 26  THR B CB  1 
ATOM   4882 O OG1 . THR D 2 25  ? 29.100 33.317  70.465  1.00 30.81 ? 26  THR B OG1 1 
ATOM   4883 C CG2 . THR D 2 25  ? 29.678 31.385  71.784  1.00 26.42 ? 26  THR B CG2 1 
ATOM   4884 N N   . LYS D 2 26  ? 27.182 32.412  67.927  1.00 39.64 ? 27  LYS B N   1 
ATOM   4885 C CA  . LYS D 2 26  ? 26.120 33.091  67.183  1.00 35.79 ? 27  LYS B CA  1 
ATOM   4886 C C   . LYS D 2 26  ? 26.160 32.714  65.704  1.00 37.72 ? 27  LYS B C   1 
ATOM   4887 O O   . LYS D 2 26  ? 27.234 32.473  65.137  1.00 33.65 ? 27  LYS B O   1 
ATOM   4888 C CB  . LYS D 2 26  ? 26.294 34.607  67.337  1.00 39.49 ? 27  LYS B CB  1 
ATOM   4889 C CG  . LYS D 2 26  ? 25.300 35.474  66.576  1.00 44.52 ? 27  LYS B CG  1 
ATOM   4890 C CD  . LYS D 2 26  ? 25.618 36.949  66.800  1.00 47.20 ? 27  LYS B CD  1 
ATOM   4891 C CE  . LYS D 2 26  ? 24.753 37.867  65.954  1.00 52.80 ? 27  LYS B CE  1 
ATOM   4892 N NZ  . LYS D 2 26  ? 23.335 37.885  66.396  1.00 60.12 ? 27  LYS B NZ  1 
ATOM   4893 N N   . SER D 2 27  ? 24.992 32.651  65.076  1.00 37.34 ? 28  SER B N   1 
ATOM   4894 C CA  . SER D 2 27  ? 24.936 32.324  63.653  1.00 35.35 ? 28  SER B CA  1 
ATOM   4895 C C   . SER D 2 27  ? 25.695 33.382  62.863  1.00 31.11 ? 28  SER B C   1 
ATOM   4896 O O   . SER D 2 27  ? 25.594 34.579  63.140  1.00 27.77 ? 28  SER B O   1 
ATOM   4897 C CB  . SER D 2 27  ? 23.491 32.273  63.160  1.00 35.61 ? 28  SER B CB  1 
ATOM   4898 O OG  . SER D 2 27  ? 23.460 32.130  61.747  1.00 42.67 ? 28  SER B OG  1 
ATOM   4899 N N   . LEU D 2 28  ? 26.461 32.929  61.881  1.00 26.45 ? 29  LEU B N   1 
ATOM   4900 C CA  . LEU D 2 28  ? 27.243 33.822  61.043  1.00 23.12 ? 29  LEU B CA  1 
ATOM   4901 C C   . LEU D 2 28  ? 26.508 34.105  59.730  1.00 26.68 ? 29  LEU B C   1 
ATOM   4902 O O   . LEU D 2 28  ? 27.027 34.819  58.863  1.00 23.53 ? 29  LEU B O   1 
ATOM   4903 C CB  . LEU D 2 28  ? 28.608 33.190  60.769  1.00 20.83 ? 29  LEU B CB  1 
ATOM   4904 C CG  . LEU D 2 28  ? 29.788 33.556  61.689  1.00 31.58 ? 29  LEU B CG  1 
ATOM   4905 C CD1 . LEU D 2 28  ? 29.314 33.988  63.070  1.00 31.00 ? 29  LEU B CD1 1 
ATOM   4906 C CD2 . LEU D 2 28  ? 30.730 32.364  61.779  1.00 27.42 ? 29  LEU B CD2 1 
ATOM   4907 N N   . LEU D 2 29  ? 25.300 33.550  59.606  1.00 22.10 ? 30  LEU B N   1 
ATOM   4908 C CA  . LEU D 2 29  ? 24.469 33.714  58.414  1.00 28.34 ? 30  LEU B CA  1 
ATOM   4909 C C   . LEU D 2 29  ? 23.802 35.090  58.414  1.00 26.99 ? 30  LEU B C   1 
ATOM   4910 O O   . LEU D 2 29  ? 22.984 35.397  59.281  1.00 27.98 ? 30  LEU B O   1 
ATOM   4911 C CB  . LEU D 2 29  ? 23.410 32.595  58.352  1.00 29.76 ? 30  LEU B CB  1 
ATOM   4912 C CG  . LEU D 2 29  ? 22.323 32.546  57.263  1.00 32.23 ? 30  LEU B CG  1 
ATOM   4913 C CD1 . LEU D 2 29  ? 21.328 33.669  57.480  1.00 43.79 ? 30  LEU B CD1 1 
ATOM   4914 C CD2 . LEU D 2 29  ? 22.944 32.649  55.878  1.00 35.59 ? 30  LEU B CD2 1 
ATOM   4915 N N   . HIS D 2 30  ? 24.168 35.913  57.433  1.00 30.63 ? 31  HIS B N   1 
ATOM   4916 C CA  . HIS D 2 30  ? 23.623 37.260  57.308  1.00 33.62 ? 31  HIS B CA  1 
ATOM   4917 C C   . HIS D 2 30  ? 22.375 37.222  56.432  1.00 33.39 ? 31  HIS B C   1 
ATOM   4918 O O   . HIS D 2 30  ? 22.200 36.306  55.632  1.00 32.21 ? 31  HIS B O   1 
ATOM   4919 C CB  . HIS D 2 30  ? 24.672 38.181  56.678  1.00 39.71 ? 31  HIS B CB  1 
ATOM   4920 C CG  . HIS D 2 30  ? 24.293 39.627  56.684  1.00 44.02 ? 31  HIS B CG  1 
ATOM   4921 N ND1 . HIS D 2 30  ? 24.927 40.563  55.895  1.00 49.05 ? 31  HIS B ND1 1 
ATOM   4922 C CD2 . HIS D 2 30  ? 23.363 40.303  57.397  1.00 48.20 ? 31  HIS B CD2 1 
ATOM   4923 C CE1 . HIS D 2 30  ? 24.402 41.753  56.121  1.00 47.84 ? 31  HIS B CE1 1 
ATOM   4924 N NE2 . HIS D 2 30  ? 23.450 41.623  57.028  1.00 50.41 ? 31  HIS B NE2 1 
ATOM   4925 N N   . SER D 2 31  ? 21.522 38.231  56.571  1.00 36.33 ? 32  SER B N   1 
ATOM   4926 C CA  . SER D 2 31  ? 20.287 38.315  55.798  1.00 36.94 ? 32  SER B CA  1 
ATOM   4927 C C   . SER D 2 31  ? 20.520 38.427  54.297  1.00 31.50 ? 32  SER B C   1 
ATOM   4928 O O   . SER D 2 31  ? 19.587 38.293  53.513  1.00 33.44 ? 32  SER B O   1 
ATOM   4929 C CB  . SER D 2 31  ? 19.445 39.508  56.271  1.00 34.77 ? 32  SER B CB  1 
ATOM   4930 O OG  . SER D 2 31  ? 20.156 40.726  56.116  1.00 35.72 ? 32  SER B OG  1 
ATOM   4931 N N   . ASN D 2 32  ? 21.755 38.687  53.889  1.00 32.89 ? 33  ASN B N   1 
ATOM   4932 C CA  . ASN D 2 32  ? 22.029 38.786  52.460  1.00 32.73 ? 33  ASN B CA  1 
ATOM   4933 C C   . ASN D 2 32  ? 22.335 37.392  51.916  1.00 31.10 ? 33  ASN B C   1 
ATOM   4934 O O   . ASN D 2 32  ? 22.700 37.233  50.757  1.00 34.67 ? 33  ASN B O   1 
ATOM   4935 C CB  . ASN D 2 32  ? 23.191 39.753  52.186  1.00 32.21 ? 33  ASN B CB  1 
ATOM   4936 C CG  . ASN D 2 32  ? 24.515 39.260  52.725  1.00 29.92 ? 33  ASN B CG  1 
ATOM   4937 O OD1 . ASN D 2 32  ? 24.612 38.169  53.277  1.00 28.78 ? 33  ASN B OD1 1 
ATOM   4938 N ND2 . ASN D 2 32  ? 25.551 40.072  52.560  1.00 32.50 ? 33  ASN B ND2 1 
ATOM   4939 N N   . GLY D 2 33  ? 22.179 36.384  52.772  1.00 28.06 ? 34  GLY B N   1 
ATOM   4940 C CA  . GLY D 2 33  ? 22.415 35.010  52.368  1.00 21.84 ? 34  GLY B CA  1 
ATOM   4941 C C   . GLY D 2 33  ? 23.846 34.523  52.505  1.00 27.25 ? 34  GLY B C   1 
ATOM   4942 O O   . GLY D 2 33  ? 24.119 33.336  52.315  1.00 21.60 ? 34  GLY B O   1 
ATOM   4943 N N   . ILE D 2 34  ? 24.762 35.427  52.841  1.00 21.94 ? 35  ILE B N   1 
ATOM   4944 C CA  . ILE D 2 34  ? 26.165 35.074  52.987  1.00 23.67 ? 35  ILE B CA  1 
ATOM   4945 C C   . ILE D 2 34  ? 26.531 34.747  54.449  1.00 26.89 ? 35  ILE B C   1 
ATOM   4946 O O   . ILE D 2 34  ? 26.036 35.387  55.377  1.00 18.87 ? 35  ILE B O   1 
ATOM   4947 C CB  . ILE D 2 34  ? 27.045 36.226  52.474  1.00 22.51 ? 35  ILE B CB  1 
ATOM   4948 C CG1 . ILE D 2 34  ? 26.751 36.468  50.982  1.00 24.98 ? 35  ILE B CG1 1 
ATOM   4949 C CG2 . ILE D 2 34  ? 28.502 35.898  52.682  1.00 24.30 ? 35  ILE B CG2 1 
ATOM   4950 C CD1 . ILE D 2 34  ? 27.584 37.547  50.355  1.00 18.73 ? 35  ILE B CD1 1 
ATOM   4951 N N   . THR D 2 35  ? 27.378 33.733  54.637  1.00 23.94 ? 36  THR B N   1 
ATOM   4952 C CA  . THR D 2 35  ? 27.824 33.324  55.977  1.00 25.51 ? 36  THR B CA  1 
ATOM   4953 C C   . THR D 2 35  ? 29.252 33.825  56.151  1.00 24.78 ? 36  THR B C   1 
ATOM   4954 O O   . THR D 2 35  ? 30.179 33.307  55.539  1.00 25.35 ? 36  THR B O   1 
ATOM   4955 C CB  . THR D 2 35  ? 27.809 31.799  56.140  1.00 27.24 ? 36  THR B CB  1 
ATOM   4956 O OG1 . THR D 2 35  ? 26.486 31.314  55.925  1.00 25.55 ? 36  THR B OG1 1 
ATOM   4957 C CG2 . THR D 2 35  ? 28.230 31.412  57.549  1.00 27.87 ? 36  THR B CG2 1 
ATOM   4958 N N   . TYR D 2 36  ? 29.416 34.840  56.990  1.00 21.94 ? 37  TYR B N   1 
ATOM   4959 C CA  . TYR D 2 36  ? 30.712 35.454  57.205  1.00 24.97 ? 37  TYR B CA  1 
ATOM   4960 C C   . TYR D 2 36  ? 31.681 34.706  58.111  1.00 25.40 ? 37  TYR B C   1 
ATOM   4961 O O   . TYR D 2 36  ? 31.978 35.121  59.242  1.00 20.53 ? 37  TYR B O   1 
ATOM   4962 C CB  . TYR D 2 36  ? 30.504 36.896  57.678  1.00 26.01 ? 37  TYR B CB  1 
ATOM   4963 C CG  . TYR D 2 36  ? 29.866 37.735  56.596  1.00 24.14 ? 37  TYR B CG  1 
ATOM   4964 C CD1 . TYR D 2 36  ? 28.485 37.764  56.432  1.00 28.38 ? 37  TYR B CD1 1 
ATOM   4965 C CD2 . TYR D 2 36  ? 30.652 38.400  55.659  1.00 33.24 ? 37  TYR B CD2 1 
ATOM   4966 C CE1 . TYR D 2 36  ? 27.903 38.436  55.348  1.00 33.57 ? 37  TYR B CE1 1 
ATOM   4967 C CE2 . TYR D 2 36  ? 30.082 39.067  54.572  1.00 35.32 ? 37  TYR B CE2 1 
ATOM   4968 C CZ  . TYR D 2 36  ? 28.709 39.080  54.426  1.00 33.40 ? 37  TYR B CZ  1 
ATOM   4969 O OH  . TYR D 2 36  ? 28.149 39.747  53.362  1.00 35.48 ? 37  TYR B OH  1 
ATOM   4970 N N   . LEU D 2 37  ? 32.176 33.598  57.568  1.00 23.50 ? 38  LEU B N   1 
ATOM   4971 C CA  . LEU D 2 37  ? 33.130 32.716  58.232  1.00 22.91 ? 38  LEU B CA  1 
ATOM   4972 C C   . LEU D 2 37  ? 34.321 32.596  57.308  1.00 25.20 ? 38  LEU B C   1 
ATOM   4973 O O   . LEU D 2 37  ? 34.158 32.466  56.079  1.00 24.27 ? 38  LEU B O   1 
ATOM   4974 C CB  . LEU D 2 37  ? 32.518 31.321  58.419  1.00 22.16 ? 38  LEU B CB  1 
ATOM   4975 C CG  . LEU D 2 37  ? 33.469 30.182  58.814  1.00 23.57 ? 38  LEU B CG  1 
ATOM   4976 C CD1 . LEU D 2 37  ? 33.848 30.299  60.284  1.00 24.24 ? 38  LEU B CD1 1 
ATOM   4977 C CD2 . LEU D 2 37  ? 32.791 28.853  58.569  1.00 28.95 ? 38  LEU B CD2 1 
ATOM   4978 N N   . TYR D 2 38  ? 35.520 32.675  57.861  1.00 16.68 ? 39  TYR B N   1 
ATOM   4979 C CA  . TYR D 2 38  ? 36.695 32.496  57.027  1.00 20.43 ? 39  TYR B CA  1 
ATOM   4980 C C   . TYR D 2 38  ? 37.691 31.597  57.734  1.00 24.67 ? 39  TYR B C   1 
ATOM   4981 O O   . TYR D 2 38  ? 37.614 31.408  58.951  1.00 23.54 ? 39  TYR B O   1 
ATOM   4982 C CB  . TYR D 2 38  ? 37.314 33.842  56.602  1.00 19.62 ? 39  TYR B CB  1 
ATOM   4983 C CG  . TYR D 2 38  ? 37.930 34.723  57.676  1.00 23.47 ? 39  TYR B CG  1 
ATOM   4984 C CD1 . TYR D 2 38  ? 39.317 34.817  57.816  1.00 21.83 ? 39  TYR B CD1 1 
ATOM   4985 C CD2 . TYR D 2 38  ? 37.131 35.484  58.529  1.00 20.29 ? 39  TYR B CD2 1 
ATOM   4986 C CE1 . TYR D 2 38  ? 39.897 35.646  58.779  1.00 22.19 ? 39  TYR B CE1 1 
ATOM   4987 C CE2 . TYR D 2 38  ? 37.704 36.323  59.501  1.00 26.23 ? 39  TYR B CE2 1 
ATOM   4988 C CZ  . TYR D 2 38  ? 39.085 36.394  59.614  1.00 26.47 ? 39  TYR B CZ  1 
ATOM   4989 O OH  . TYR D 2 38  ? 39.661 37.215  60.553  1.00 28.95 ? 39  TYR B OH  1 
ATOM   4990 N N   . TRP D 2 39  ? 38.580 30.995  56.953  1.00 21.39 ? 40  TRP B N   1 
ATOM   4991 C CA  . TRP D 2 39  ? 39.599 30.100  57.477  1.00 20.21 ? 40  TRP B CA  1 
ATOM   4992 C C   . TRP D 2 39  ? 40.956 30.546  56.963  1.00 25.02 ? 40  TRP B C   1 
ATOM   4993 O O   . TRP D 2 39  ? 41.082 30.966  55.807  1.00 20.99 ? 40  TRP B O   1 
ATOM   4994 C CB  . TRP D 2 39  ? 39.390 28.659  56.993  1.00 23.68 ? 40  TRP B CB  1 
ATOM   4995 C CG  . TRP D 2 39  ? 38.110 27.992  57.384  1.00 23.05 ? 40  TRP B CG  1 
ATOM   4996 C CD1 . TRP D 2 39  ? 36.911 28.074  56.741  1.00 23.79 ? 40  TRP B CD1 1 
ATOM   4997 C CD2 . TRP D 2 39  ? 37.921 27.085  58.478  1.00 22.95 ? 40  TRP B CD2 1 
ATOM   4998 N NE1 . TRP D 2 39  ? 35.984 27.266  57.360  1.00 25.36 ? 40  TRP B NE1 1 
ATOM   4999 C CE2 . TRP D 2 39  ? 36.579 26.645  58.429  1.00 27.91 ? 40  TRP B CE2 1 
ATOM   5000 C CE3 . TRP D 2 39  ? 38.760 26.597  59.493  1.00 28.85 ? 40  TRP B CE3 1 
ATOM   5001 C CZ2 . TRP D 2 39  ? 36.050 25.735  59.361  1.00 28.27 ? 40  TRP B CZ2 1 
ATOM   5002 C CZ3 . TRP D 2 39  ? 38.239 25.694  60.424  1.00 21.70 ? 40  TRP B CZ3 1 
ATOM   5003 C CH2 . TRP D 2 39  ? 36.891 25.271  60.346  1.00 32.13 ? 40  TRP B CH2 1 
ATOM   5004 N N   . TYR D 2 40  ? 41.966 30.472  57.821  1.00 21.69 ? 41  TYR B N   1 
ATOM   5005 C CA  . TYR D 2 40  ? 43.315 30.810  57.408  1.00 24.32 ? 41  TYR B CA  1 
ATOM   5006 C C   . TYR D 2 40  ? 44.244 29.741  57.968  1.00 25.60 ? 41  TYR B C   1 
ATOM   5007 O O   . TYR D 2 40  ? 43.892 29.015  58.896  1.00 27.57 ? 41  TYR B O   1 
ATOM   5008 C CB  . TYR D 2 40  ? 43.721 32.233  57.848  1.00 24.94 ? 41  TYR B CB  1 
ATOM   5009 C CG  . TYR D 2 40  ? 43.713 32.539  59.333  1.00 29.11 ? 41  TYR B CG  1 
ATOM   5010 C CD1 . TYR D 2 40  ? 44.840 32.304  60.124  1.00 33.18 ? 41  TYR B CD1 1 
ATOM   5011 C CD2 . TYR D 2 40  ? 42.600 33.131  59.931  1.00 28.10 ? 41  TYR B CD2 1 
ATOM   5012 C CE1 . TYR D 2 40  ? 44.861 32.665  61.480  1.00 28.82 ? 41  TYR B CE1 1 
ATOM   5013 C CE2 . TYR D 2 40  ? 42.605 33.484  61.280  1.00 28.73 ? 41  TYR B CE2 1 
ATOM   5014 C CZ  . TYR D 2 40  ? 43.735 33.253  62.047  1.00 33.83 ? 41  TYR B CZ  1 
ATOM   5015 O OH  . TYR D 2 40  ? 43.732 33.609  63.376  1.00 32.03 ? 41  TYR B OH  1 
ATOM   5016 N N   . LEU D 2 41  ? 45.422 29.636  57.382  1.00 27.17 ? 42  LEU B N   1 
ATOM   5017 C CA  . LEU D 2 41  ? 46.386 28.627  57.771  1.00 29.43 ? 42  LEU B CA  1 
ATOM   5018 C C   . LEU D 2 41  ? 47.699 29.249  58.219  1.00 30.67 ? 42  LEU B C   1 
ATOM   5019 O O   . LEU D 2 41  ? 48.180 30.210  57.627  1.00 25.40 ? 42  LEU B O   1 
ATOM   5020 C CB  . LEU D 2 41  ? 46.619 27.702  56.573  1.00 24.43 ? 42  LEU B CB  1 
ATOM   5021 C CG  . LEU D 2 41  ? 47.781 26.713  56.555  1.00 37.88 ? 42  LEU B CG  1 
ATOM   5022 C CD1 . LEU D 2 41  ? 47.667 25.756  57.724  1.00 32.93 ? 42  LEU B CD1 1 
ATOM   5023 C CD2 . LEU D 2 41  ? 47.767 25.955  55.220  1.00 35.17 ? 42  LEU B CD2 1 
ATOM   5024 N N   . GLN D 2 42  ? 48.268 28.680  59.275  1.00 36.51 ? 43  GLN B N   1 
ATOM   5025 C CA  . GLN D 2 42  ? 49.532 29.141  59.829  1.00 41.70 ? 43  GLN B CA  1 
ATOM   5026 C C   . GLN D 2 42  ? 50.523 27.983  59.814  1.00 38.53 ? 43  GLN B C   1 
ATOM   5027 O O   . GLN D 2 42  ? 50.444 27.080  60.646  1.00 31.59 ? 43  GLN B O   1 
ATOM   5028 C CB  . GLN D 2 42  ? 49.319 29.627  61.266  1.00 46.49 ? 43  GLN B CB  1 
ATOM   5029 C CG  . GLN D 2 42  ? 50.589 29.982  62.022  1.00 57.45 ? 43  GLN B CG  1 
ATOM   5030 C CD  . GLN D 2 42  ? 51.004 31.425  61.843  1.00 56.88 ? 43  GLN B CD  1 
ATOM   5031 O OE1 . GLN D 2 42  ? 50.257 32.344  62.182  1.00 57.79 ? 43  GLN B OE1 1 
ATOM   5032 N NE2 . GLN D 2 42  ? 52.204 31.633  61.316  1.00 59.58 ? 43  GLN B NE2 1 
ATOM   5033 N N   . LYS D 2 43  ? 51.444 28.005  58.857  1.00 41.53 ? 44  LYS B N   1 
ATOM   5034 C CA  . LYS D 2 43  ? 52.467 26.965  58.743  1.00 48.82 ? 44  LYS B CA  1 
ATOM   5035 C C   . LYS D 2 43  ? 53.666 27.326  59.611  1.00 53.04 ? 44  LYS B C   1 
ATOM   5036 O O   . LYS D 2 43  ? 53.860 28.490  59.965  1.00 54.23 ? 44  LYS B O   1 
ATOM   5037 C CB  . LYS D 2 43  ? 52.943 26.815  57.293  1.00 47.11 ? 44  LYS B CB  1 
ATOM   5038 C CG  . LYS D 2 43  ? 51.922 26.242  56.331  1.00 52.31 ? 44  LYS B CG  1 
ATOM   5039 C CD  . LYS D 2 43  ? 52.546 26.048  54.952  1.00 56.58 ? 44  LYS B CD  1 
ATOM   5040 C CE  . LYS D 2 43  ? 51.516 25.652  53.902  1.00 57.48 ? 44  LYS B CE  1 
ATOM   5041 N NZ  . LYS D 2 43  ? 50.858 24.357  54.218  1.00 56.81 ? 44  LYS B NZ  1 
ATOM   5042 N N   . PRO D 2 44  ? 54.492 26.329  59.962  1.00 57.00 ? 45  PRO B N   1 
ATOM   5043 C CA  . PRO D 2 44  ? 55.675 26.570  60.794  1.00 59.46 ? 45  PRO B CA  1 
ATOM   5044 C C   . PRO D 2 44  ? 56.630 27.608  60.200  1.00 62.43 ? 45  PRO B C   1 
ATOM   5045 O O   . PRO D 2 44  ? 57.286 27.358  59.184  1.00 59.51 ? 45  PRO B O   1 
ATOM   5046 C CB  . PRO D 2 44  ? 56.311 25.187  60.889  1.00 60.42 ? 45  PRO B CB  1 
ATOM   5047 C CG  . PRO D 2 44  ? 55.120 24.279  60.850  1.00 60.88 ? 45  PRO B CG  1 
ATOM   5048 C CD  . PRO D 2 44  ? 54.301 24.887  59.730  1.00 58.94 ? 45  PRO B CD  1 
ATOM   5049 N N   . GLY D 2 45  ? 56.692 28.774  60.840  1.00 62.75 ? 46  GLY B N   1 
ATOM   5050 C CA  . GLY D 2 45  ? 57.579 29.830  60.384  1.00 66.62 ? 46  GLY B CA  1 
ATOM   5051 C C   . GLY D 2 45  ? 57.151 30.558  59.124  1.00 68.14 ? 46  GLY B C   1 
ATOM   5052 O O   . GLY D 2 45  ? 57.938 30.696  58.183  1.00 69.99 ? 46  GLY B O   1 
ATOM   5053 N N   . GLN D 2 46  ? 55.907 31.026  59.102  1.00 67.51 ? 47  GLN B N   1 
ATOM   5054 C CA  . GLN D 2 46  ? 55.377 31.760  57.958  1.00 64.86 ? 47  GLN B CA  1 
ATOM   5055 C C   . GLN D 2 46  ? 54.237 32.666  58.386  1.00 60.72 ? 47  GLN B C   1 
ATOM   5056 O O   . GLN D 2 46  ? 53.751 32.573  59.510  1.00 62.42 ? 47  GLN B O   1 
ATOM   5057 C CB  . GLN D 2 46  ? 54.881 30.800  56.875  1.00 69.39 ? 47  GLN B CB  1 
ATOM   5058 C CG  . GLN D 2 46  ? 55.976 29.985  56.221  1.00 72.72 ? 47  GLN B CG  1 
ATOM   5059 C CD  . GLN D 2 46  ? 55.499 29.284  54.973  1.00 75.55 ? 47  GLN B CD  1 
ATOM   5060 O OE1 . GLN D 2 46  ? 54.626 28.417  55.028  1.00 77.80 ? 47  GLN B OE1 1 
ATOM   5061 N NE2 . GLN D 2 46  ? 56.064 29.660  53.832  1.00 76.04 ? 47  GLN B NE2 1 
ATOM   5062 N N   . SER D 2 47  ? 53.816 33.548  57.491  1.00 56.44 ? 48  SER B N   1 
ATOM   5063 C CA  . SER D 2 47  ? 52.728 34.462  57.798  1.00 54.18 ? 48  SER B CA  1 
ATOM   5064 C C   . SER D 2 47  ? 51.392 33.760  57.559  1.00 51.15 ? 48  SER B C   1 
ATOM   5065 O O   . SER D 2 47  ? 51.306 32.842  56.747  1.00 51.76 ? 48  SER B O   1 
ATOM   5066 C CB  . SER D 2 47  ? 52.835 35.709  56.919  1.00 52.97 ? 48  SER B CB  1 
ATOM   5067 O OG  . SER D 2 47  ? 51.853 36.665  57.279  1.00 57.09 ? 48  SER B OG  1 
ATOM   5068 N N   . PRO D 2 48  ? 50.335 34.175  58.274  1.00 50.41 ? 49  PRO B N   1 
ATOM   5069 C CA  . PRO D 2 48  ? 49.016 33.553  58.097  1.00 46.09 ? 49  PRO B CA  1 
ATOM   5070 C C   . PRO D 2 48  ? 48.598 33.612  56.629  1.00 43.37 ? 49  PRO B C   1 
ATOM   5071 O O   . PRO D 2 48  ? 48.868 34.596  55.937  1.00 42.44 ? 49  PRO B O   1 
ATOM   5072 C CB  . PRO D 2 48  ? 48.117 34.395  58.993  1.00 48.11 ? 49  PRO B CB  1 
ATOM   5073 C CG  . PRO D 2 48  ? 49.050 34.805  60.098  1.00 50.96 ? 49  PRO B CG  1 
ATOM   5074 C CD  . PRO D 2 48  ? 50.298 35.191  59.338  1.00 48.45 ? 49  PRO B CD  1 
ATOM   5075 N N   . GLN D 2 49  ? 47.931 32.559  56.166  1.00 36.39 ? 50  GLN B N   1 
ATOM   5076 C CA  . GLN D 2 49  ? 47.500 32.462  54.773  1.00 35.94 ? 50  GLN B CA  1 
ATOM   5077 C C   . GLN D 2 49  ? 45.998 32.199  54.670  1.00 29.64 ? 50  GLN B C   1 
ATOM   5078 O O   . GLN D 2 49  ? 45.502 31.202  55.188  1.00 29.52 ? 50  GLN B O   1 
ATOM   5079 C CB  . GLN D 2 49  ? 48.278 31.331  54.097  1.00 39.72 ? 50  GLN B CB  1 
ATOM   5080 C CG  . GLN D 2 49  ? 47.992 31.141  52.622  1.00 52.11 ? 50  GLN B CG  1 
ATOM   5081 C CD  . GLN D 2 49  ? 48.690 29.912  52.058  1.00 60.97 ? 50  GLN B CD  1 
ATOM   5082 O OE1 . GLN D 2 49  ? 48.629 29.645  50.854  1.00 67.31 ? 50  GLN B OE1 1 
ATOM   5083 N NE2 . GLN D 2 49  ? 49.354 29.153  52.929  1.00 57.80 ? 50  GLN B NE2 1 
ATOM   5084 N N   . LEU D 2 50  ? 45.266 33.087  54.005  1.00 25.75 ? 51  LEU B N   1 
ATOM   5085 C CA  . LEU D 2 50  ? 43.827 32.893  53.885  1.00 24.44 ? 51  LEU B CA  1 
ATOM   5086 C C   . LEU D 2 50  ? 43.549 31.618  53.071  1.00 26.61 ? 51  LEU B C   1 
ATOM   5087 O O   . LEU D 2 50  ? 44.234 31.334  52.092  1.00 22.50 ? 51  LEU B O   1 
ATOM   5088 C CB  . LEU D 2 50  ? 43.167 34.102  53.204  1.00 22.99 ? 51  LEU B CB  1 
ATOM   5089 C CG  . LEU D 2 50  ? 41.644 34.040  53.013  1.00 21.93 ? 51  LEU B CG  1 
ATOM   5090 C CD1 . LEU D 2 50  ? 40.948 34.080  54.367  1.00 26.19 ? 51  LEU B CD1 1 
ATOM   5091 C CD2 . LEU D 2 50  ? 41.182 35.204  52.156  1.00 23.92 ? 51  LEU B CD2 1 
ATOM   5092 N N   . LEU D 2 51  ? 42.550 30.852  53.494  1.00 25.09 ? 52  LEU B N   1 
ATOM   5093 C CA  . LEU D 2 51  ? 42.175 29.619  52.808  1.00 24.55 ? 52  LEU B CA  1 
ATOM   5094 C C   . LEU D 2 51  ? 40.822 29.771  52.162  1.00 26.25 ? 52  LEU B C   1 
ATOM   5095 O O   . LEU D 2 51  ? 40.659 29.609  50.956  1.00 24.28 ? 52  LEU B O   1 
ATOM   5096 C CB  . LEU D 2 51  ? 42.063 28.448  53.777  1.00 24.22 ? 52  LEU B CB  1 
ATOM   5097 C CG  . LEU D 2 51  ? 43.289 27.676  54.255  1.00 31.50 ? 52  LEU B CG  1 
ATOM   5098 C CD1 . LEU D 2 51  ? 42.804 26.435  54.992  1.00 32.64 ? 52  LEU B CD1 1 
ATOM   5099 C CD2 . LEU D 2 51  ? 44.158 27.276  53.073  1.00 40.62 ? 52  LEU B CD2 1 
ATOM   5100 N N   . ILE D 2 52  ? 39.850 30.106  52.993  1.00 23.66 ? 53  ILE B N   1 
ATOM   5101 C CA  . ILE D 2 52  ? 38.479 30.234  52.562  1.00 19.58 ? 53  ILE B CA  1 
ATOM   5102 C C   . ILE D 2 52  ? 37.824 31.439  53.234  1.00 26.02 ? 53  ILE B C   1 
ATOM   5103 O O   . ILE D 2 52  ? 38.091 31.733  54.409  1.00 26.05 ? 53  ILE B O   1 
ATOM   5104 C CB  . ILE D 2 52  ? 37.720 28.945  52.944  1.00 20.16 ? 53  ILE B CB  1 
ATOM   5105 C CG1 . ILE D 2 52  ? 38.283 27.764  52.137  1.00 25.15 ? 53  ILE B CG1 1 
ATOM   5106 C CG2 . ILE D 2 52  ? 36.237 29.119  52.749  1.00 20.24 ? 53  ILE B CG2 1 
ATOM   5107 C CD1 . ILE D 2 52  ? 37.611 26.435  52.409  1.00 25.93 ? 53  ILE B CD1 1 
ATOM   5108 N N   . TYR D 2 53  ? 36.983 32.146  52.486  1.00 20.03 ? 54  TYR B N   1 
ATOM   5109 C CA  . TYR D 2 53  ? 36.263 33.279  53.047  1.00 23.34 ? 54  TYR B CA  1 
ATOM   5110 C C   . TYR D 2 53  ? 34.803 33.172  52.668  1.00 24.96 ? 54  TYR B C   1 
ATOM   5111 O O   . TYR D 2 53  ? 34.444 32.513  51.692  1.00 25.59 ? 54  TYR B O   1 
ATOM   5112 C CB  . TYR D 2 53  ? 36.848 34.613  52.588  1.00 25.56 ? 54  TYR B CB  1 
ATOM   5113 C CG  . TYR D 2 53  ? 36.713 34.918  51.113  1.00 26.04 ? 54  TYR B CG  1 
ATOM   5114 C CD1 . TYR D 2 53  ? 37.523 34.285  50.168  1.00 24.44 ? 54  TYR B CD1 1 
ATOM   5115 C CD2 . TYR D 2 53  ? 35.786 35.857  50.669  1.00 25.68 ? 54  TYR B CD2 1 
ATOM   5116 C CE1 . TYR D 2 53  ? 37.409 34.585  48.812  1.00 31.30 ? 54  TYR B CE1 1 
ATOM   5117 C CE2 . TYR D 2 53  ? 35.666 36.166  49.320  1.00 31.84 ? 54  TYR B CE2 1 
ATOM   5118 C CZ  . TYR D 2 53  ? 36.478 35.530  48.400  1.00 33.60 ? 54  TYR B CZ  1 
ATOM   5119 O OH  . TYR D 2 53  ? 36.370 35.865  47.078  1.00 37.99 ? 54  TYR B OH  1 
ATOM   5120 N N   . GLN D 2 54  ? 33.961 33.819  53.456  1.00 19.12 ? 55  GLN B N   1 
ATOM   5121 C CA  . GLN D 2 54  ? 32.530 33.772  53.243  1.00 23.53 ? 55  GLN B CA  1 
ATOM   5122 C C   . GLN D 2 54  ? 32.032 32.334  53.152  1.00 31.16 ? 55  GLN B C   1 
ATOM   5123 O O   . GLN D 2 54  ? 31.202 31.984  52.305  1.00 33.04 ? 55  GLN B O   1 
ATOM   5124 C CB  . GLN D 2 54  ? 32.155 34.581  52.004  1.00 26.56 ? 55  GLN B CB  1 
ATOM   5125 C CG  . GLN D 2 54  ? 32.300 36.071  52.250  1.00 25.04 ? 55  GLN B CG  1 
ATOM   5126 C CD  . GLN D 2 54  ? 31.920 36.911  51.045  1.00 34.71 ? 55  GLN B CD  1 
ATOM   5127 O OE1 . GLN D 2 54  ? 31.408 36.392  50.050  1.00 33.82 ? 55  GLN B OE1 1 
ATOM   5128 N NE2 . GLN D 2 54  ? 32.160 38.219  51.133  1.00 30.17 ? 55  GLN B NE2 1 
ATOM   5129 N N   . MET D 2 55  ? 32.573 31.504  54.040  1.00 33.50 ? 56  MET B N   1 
ATOM   5130 C CA  . MET D 2 55  ? 32.193 30.106  54.170  1.00 34.41 ? 56  MET B CA  1 
ATOM   5131 C C   . MET D 2 55  ? 32.577 29.140  53.057  1.00 37.42 ? 56  MET B C   1 
ATOM   5132 O O   . MET D 2 55  ? 33.085 28.053  53.337  1.00 38.76 ? 56  MET B O   1 
ATOM   5133 C CB  . MET D 2 55  ? 30.687 30.030  54.408  1.00 36.44 ? 56  MET B CB  1 
ATOM   5134 C CG  . MET D 2 55  ? 30.306 29.357  55.704  1.00 46.74 ? 56  MET B CG  1 
ATOM   5135 S SD  . MET D 2 55  ? 30.304 27.581  55.541  1.00 54.80 ? 56  MET B SD  1 
ATOM   5136 C CE  . MET D 2 55  ? 28.591 27.316  55.099  1.00 48.19 ? 56  MET B CE  1 
ATOM   5137 N N   . SER D 2 56  ? 32.356 29.520  51.804  1.00 33.99 ? 57  SER B N   1 
ATOM   5138 C CA  . SER D 2 56  ? 32.664 28.606  50.708  1.00 40.28 ? 57  SER B CA  1 
ATOM   5139 C C   . SER D 2 56  ? 33.389 29.181  49.496  1.00 38.63 ? 57  SER B C   1 
ATOM   5140 O O   . SER D 2 56  ? 33.292 28.627  48.403  1.00 42.90 ? 57  SER B O   1 
ATOM   5141 C CB  . SER D 2 56  ? 31.372 27.932  50.245  1.00 43.56 ? 57  SER B CB  1 
ATOM   5142 O OG  . SER D 2 56  ? 30.422 28.908  49.849  1.00 47.44 ? 57  SER B OG  1 
ATOM   5143 N N   . ASN D 2 57  ? 34.107 30.285  49.675  1.00 37.27 ? 58  ASN B N   1 
ATOM   5144 C CA  . ASN D 2 57  ? 34.861 30.876  48.577  1.00 34.59 ? 58  ASN B CA  1 
ATOM   5145 C C   . ASN D 2 57  ? 36.343 30.640  48.805  1.00 37.38 ? 58  ASN B C   1 
ATOM   5146 O O   . ASN D 2 57  ? 36.894 31.083  49.813  1.00 34.76 ? 58  ASN B O   1 
ATOM   5147 C CB  . ASN D 2 57  ? 34.597 32.371  48.491  1.00 38.16 ? 58  ASN B CB  1 
ATOM   5148 C CG  . ASN D 2 57  ? 33.187 32.684  48.066  1.00 42.77 ? 58  ASN B CG  1 
ATOM   5149 O OD1 . ASN D 2 57  ? 32.812 32.467  46.916  1.00 49.95 ? 58  ASN B OD1 1 
ATOM   5150 N ND2 . ASN D 2 57  ? 32.389 33.188  48.996  1.00 52.56 ? 58  ASN B ND2 1 
ATOM   5151 N N   . LEU D 2 58  ? 36.986 29.934  47.879  1.00 31.27 ? 59  LEU B N   1 
ATOM   5152 C CA  . LEU D 2 58  ? 38.409 29.656  48.006  1.00 33.62 ? 59  LEU B CA  1 
ATOM   5153 C C   . LEU D 2 58  ? 39.183 30.896  47.624  1.00 32.92 ? 59  LEU B C   1 
ATOM   5154 O O   . LEU D 2 58  ? 38.764 31.645  46.749  1.00 31.04 ? 59  LEU B O   1 
ATOM   5155 C CB  . LEU D 2 58  ? 38.832 28.505  47.089  1.00 26.98 ? 59  LEU B CB  1 
ATOM   5156 C CG  . LEU D 2 58  ? 38.400 27.080  47.436  1.00 31.49 ? 59  LEU B CG  1 
ATOM   5157 C CD1 . LEU D 2 58  ? 36.914 27.052  47.729  1.00 36.23 ? 59  LEU B CD1 1 
ATOM   5158 C CD2 . LEU D 2 58  ? 38.743 26.138  46.271  1.00 28.39 ? 59  LEU B CD2 1 
ATOM   5159 N N   . ALA D 2 59  ? 40.305 31.119  48.296  1.00 36.54 ? 60  ALA B N   1 
ATOM   5160 C CA  . ALA D 2 59  ? 41.145 32.261  47.998  1.00 40.36 ? 60  ALA B CA  1 
ATOM   5161 C C   . ALA D 2 59  ? 42.039 31.763  46.869  1.00 46.46 ? 60  ALA B C   1 
ATOM   5162 O O   . ALA D 2 59  ? 42.432 30.595  46.861  1.00 49.95 ? 60  ALA B O   1 
ATOM   5163 C CB  . ALA D 2 59  ? 41.981 32.642  49.220  1.00 40.75 ? 60  ALA B CB  1 
ATOM   5164 N N   . SER D 2 60  ? 42.339 32.627  45.906  1.00 48.09 ? 61  SER B N   1 
ATOM   5165 C CA  . SER D 2 60  ? 43.191 32.223  44.794  1.00 48.73 ? 61  SER B CA  1 
ATOM   5166 C C   . SER D 2 60  ? 44.448 31.522  45.294  1.00 48.45 ? 61  SER B C   1 
ATOM   5167 O O   . SER D 2 60  ? 45.006 31.888  46.331  1.00 47.04 ? 61  SER B O   1 
ATOM   5168 C CB  . SER D 2 60  ? 43.583 33.437  43.951  1.00 53.93 ? 61  SER B CB  1 
ATOM   5169 O OG  . SER D 2 60  ? 42.490 33.900  43.187  1.00 48.87 ? 61  SER B OG  1 
ATOM   5170 N N   . GLY D 2 61  ? 44.882 30.506  44.553  1.00 48.79 ? 62  GLY B N   1 
ATOM   5171 C CA  . GLY D 2 61  ? 46.069 29.764  44.930  1.00 40.61 ? 62  GLY B CA  1 
ATOM   5172 C C   . GLY D 2 61  ? 45.745 28.585  45.817  1.00 38.14 ? 62  GLY B C   1 
ATOM   5173 O O   . GLY D 2 61  ? 46.555 27.671  45.977  1.00 42.72 ? 62  GLY B O   1 
ATOM   5174 N N   . VAL D 2 62  ? 44.558 28.603  46.408  1.00 30.76 ? 63  VAL B N   1 
ATOM   5175 C CA  . VAL D 2 62  ? 44.154 27.515  47.282  1.00 33.07 ? 63  VAL B CA  1 
ATOM   5176 C C   . VAL D 2 62  ? 43.596 26.383  46.428  1.00 32.03 ? 63  VAL B C   1 
ATOM   5177 O O   . VAL D 2 62  ? 42.617 26.570  45.709  1.00 26.12 ? 63  VAL B O   1 
ATOM   5178 C CB  . VAL D 2 62  ? 43.083 27.984  48.292  1.00 31.21 ? 63  VAL B CB  1 
ATOM   5179 C CG1 . VAL D 2 62  ? 42.645 26.819  49.162  1.00 27.87 ? 63  VAL B CG1 1 
ATOM   5180 C CG2 . VAL D 2 62  ? 43.643 29.113  49.153  1.00 31.55 ? 63  VAL B CG2 1 
ATOM   5181 N N   . PRO D 2 63  ? 44.222 25.194  46.487  1.00 30.85 ? 64  PRO B N   1 
ATOM   5182 C CA  . PRO D 2 63  ? 43.752 24.050  45.698  1.00 29.77 ? 64  PRO B CA  1 
ATOM   5183 C C   . PRO D 2 63  ? 42.337 23.636  46.101  1.00 30.67 ? 64  PRO B C   1 
ATOM   5184 O O   . PRO D 2 63  ? 41.912 23.901  47.226  1.00 29.50 ? 64  PRO B O   1 
ATOM   5185 C CB  . PRO D 2 63  ? 44.804 22.972  45.985  1.00 29.50 ? 64  PRO B CB  1 
ATOM   5186 C CG  . PRO D 2 63  ? 45.283 23.308  47.362  1.00 33.72 ? 64  PRO B CG  1 
ATOM   5187 C CD  . PRO D 2 63  ? 45.383 24.827  47.316  1.00 33.73 ? 64  PRO B CD  1 
ATOM   5188 N N   . ASN D 2 64  ? 41.603 22.988  45.197  1.00 27.46 ? 65  ASN B N   1 
ATOM   5189 C CA  . ASN D 2 64  ? 40.243 22.594  45.543  1.00 25.44 ? 65  ASN B CA  1 
ATOM   5190 C C   . ASN D 2 64  ? 40.116 21.390  46.466  1.00 23.80 ? 65  ASN B C   1 
ATOM   5191 O O   . ASN D 2 64  ? 39.020 20.886  46.684  1.00 25.86 ? 65  ASN B O   1 
ATOM   5192 C CB  . ASN D 2 64  ? 39.370 22.428  44.287  1.00 26.09 ? 65  ASN B CB  1 
ATOM   5193 C CG  . ASN D 2 64  ? 39.891 21.380  43.307  1.00 27.06 ? 65  ASN B CG  1 
ATOM   5194 O OD1 . ASN D 2 64  ? 39.431 21.325  42.163  1.00 28.49 ? 65  ASN B OD1 1 
ATOM   5195 N ND2 . ASN D 2 64  ? 40.823 20.543  43.740  1.00 26.63 ? 65  ASN B ND2 1 
ATOM   5196 N N   . ARG D 2 65  ? 41.233 20.931  47.023  1.00 26.21 ? 66  ARG B N   1 
ATOM   5197 C CA  . ARG D 2 65  ? 41.177 19.837  47.992  1.00 25.47 ? 66  ARG B CA  1 
ATOM   5198 C C   . ARG D 2 65  ? 40.539 20.417  49.271  1.00 24.48 ? 66  ARG B C   1 
ATOM   5199 O O   . ARG D 2 65  ? 40.050 19.681  50.128  1.00 29.56 ? 66  ARG B O   1 
ATOM   5200 C CB  . ARG D 2 65  ? 42.583 19.333  48.318  1.00 29.82 ? 66  ARG B CB  1 
ATOM   5201 C CG  . ARG D 2 65  ? 43.295 18.695  47.152  1.00 33.79 ? 66  ARG B CG  1 
ATOM   5202 C CD  . ARG D 2 65  ? 44.619 18.089  47.564  1.00 34.93 ? 66  ARG B CD  1 
ATOM   5203 N NE  . ARG D 2 65  ? 45.593 19.087  47.995  1.00 32.98 ? 66  ARG B NE  1 
ATOM   5204 C CZ  . ARG D 2 65  ? 45.943 19.298  49.261  1.00 33.98 ? 66  ARG B CZ  1 
ATOM   5205 N NH1 . ARG D 2 65  ? 45.400 18.586  50.235  1.00 29.73 ? 66  ARG B NH1 1 
ATOM   5206 N NH2 . ARG D 2 65  ? 46.856 20.213  49.550  1.00 30.01 ? 66  ARG B NH2 1 
ATOM   5207 N N   . PHE D 2 66  ? 40.547 21.748  49.378  1.00 23.89 ? 67  PHE B N   1 
ATOM   5208 C CA  . PHE D 2 66  ? 39.985 22.458  50.537  1.00 28.00 ? 67  PHE B CA  1 
ATOM   5209 C C   . PHE D 2 66  ? 38.537 22.867  50.314  1.00 27.83 ? 67  PHE B C   1 
ATOM   5210 O O   . PHE D 2 66  ? 38.178 23.340  49.245  1.00 25.07 ? 67  PHE B O   1 
ATOM   5211 C CB  . PHE D 2 66  ? 40.812 23.716  50.850  1.00 25.32 ? 67  PHE B CB  1 
ATOM   5212 C CG  . PHE D 2 66  ? 42.175 23.423  51.418  1.00 26.67 ? 67  PHE B CG  1 
ATOM   5213 C CD1 . PHE D 2 66  ? 42.350 23.239  52.787  1.00 28.00 ? 67  PHE B CD1 1 
ATOM   5214 C CD2 . PHE D 2 66  ? 43.272 23.274  50.577  1.00 24.36 ? 67  PHE B CD2 1 
ATOM   5215 C CE1 . PHE D 2 66  ? 43.590 22.909  53.303  1.00 25.32 ? 67  PHE B CE1 1 
ATOM   5216 C CE2 . PHE D 2 66  ? 44.523 22.941  51.088  1.00 31.20 ? 67  PHE B CE2 1 
ATOM   5217 C CZ  . PHE D 2 66  ? 44.680 22.757  52.455  1.00 28.71 ? 67  PHE B CZ  1 
ATOM   5218 N N   . SER D 2 67  ? 37.707 22.681  51.330  1.00 28.67 ? 68  SER B N   1 
ATOM   5219 C CA  . SER D 2 67  ? 36.303 23.047  51.239  1.00 24.91 ? 68  SER B CA  1 
ATOM   5220 C C   . SER D 2 67  ? 35.753 23.233  52.644  1.00 29.41 ? 68  SER B C   1 
ATOM   5221 O O   . SER D 2 67  ? 36.275 22.666  53.610  1.00 23.88 ? 68  SER B O   1 
ATOM   5222 C CB  . SER D 2 67  ? 35.504 21.956  50.509  1.00 23.76 ? 68  SER B CB  1 
ATOM   5223 O OG  . SER D 2 67  ? 35.525 20.725  51.217  1.00 26.39 ? 68  SER B OG  1 
ATOM   5224 N N   . SER D 2 68  ? 34.700 24.034  52.744  1.00 27.96 ? 69  SER B N   1 
ATOM   5225 C CA  . SER D 2 68  ? 34.059 24.307  54.014  1.00 29.30 ? 69  SER B CA  1 
ATOM   5226 C C   . SER D 2 68  ? 32.553 24.259  53.851  1.00 32.87 ? 69  SER B C   1 
ATOM   5227 O O   . SER D 2 68  ? 32.004 24.700  52.845  1.00 32.81 ? 69  SER B O   1 
ATOM   5228 C CB  . SER D 2 68  ? 34.465 25.688  54.531  1.00 34.17 ? 69  SER B CB  1 
ATOM   5229 O OG  . SER D 2 68  ? 33.700 26.046  55.674  1.00 28.27 ? 69  SER B OG  1 
ATOM   5230 N N   . SER D 2 69  ? 31.893 23.715  54.858  1.00 32.37 ? 70  SER B N   1 
ATOM   5231 C CA  . SER D 2 69  ? 30.445 23.610  54.866  1.00 32.86 ? 70  SER B CA  1 
ATOM   5232 C C   . SER D 2 69  ? 29.968 23.761  56.299  1.00 33.24 ? 70  SER B C   1 
ATOM   5233 O O   . SER D 2 69  ? 30.769 23.763  57.238  1.00 26.66 ? 70  SER B O   1 
ATOM   5234 C CB  . SER D 2 69  ? 30.016 22.254  54.327  1.00 31.19 ? 70  SER B CB  1 
ATOM   5235 O OG  . SER D 2 69  ? 30.758 21.235  54.961  1.00 34.78 ? 70  SER B OG  1 
ATOM   5236 N N   . GLY D 2 70  ? 28.659 23.889  56.462  1.00 33.77 ? 71  GLY B N   1 
ATOM   5237 C CA  . GLY D 2 70  ? 28.102 24.036  57.786  1.00 32.81 ? 71  GLY B CA  1 
ATOM   5238 C C   . GLY D 2 70  ? 26.865 24.904  57.801  1.00 32.85 ? 71  GLY B C   1 
ATOM   5239 O O   . GLY D 2 70  ? 26.487 25.504  56.796  1.00 30.33 ? 71  GLY B O   1 
ATOM   5240 N N   . SER D 2 71  ? 26.227 24.947  58.960  1.00 28.57 ? 72  SER B N   1 
ATOM   5241 C CA  . SER D 2 71  ? 25.022 25.724  59.157  1.00 37.94 ? 72  SER B CA  1 
ATOM   5242 C C   . SER D 2 71  ? 25.514 27.106  59.481  1.00 44.75 ? 72  SER B C   1 
ATOM   5243 O O   . SER D 2 71  ? 26.594 27.509  59.045  1.00 53.44 ? 72  SER B O   1 
ATOM   5244 C CB  . SER D 2 71  ? 24.257 25.203  60.362  1.00 46.29 ? 72  SER B CB  1 
ATOM   5245 O OG  . SER D 2 71  ? 25.008 25.463  61.547  1.00 31.81 ? 72  SER B OG  1 
ATOM   5246 N N   . GLY D 2 72  ? 24.734 27.828  60.275  1.00 47.33 ? 73  GLY B N   1 
ATOM   5247 C CA  . GLY D 2 72  ? 25.129 29.171  60.654  1.00 42.79 ? 73  GLY B CA  1 
ATOM   5248 C C   . GLY D 2 72  ? 25.991 29.166  61.903  1.00 41.94 ? 73  GLY B C   1 
ATOM   5249 O O   . GLY D 2 72  ? 26.716 30.126  62.161  1.00 47.87 ? 73  GLY B O   1 
ATOM   5250 N N   . THR D 2 73  ? 25.938 28.074  62.664  1.00 38.42 ? 74  THR B N   1 
ATOM   5251 C CA  . THR D 2 73  ? 26.694 27.966  63.916  1.00 42.85 ? 74  THR B CA  1 
ATOM   5252 C C   . THR D 2 73  ? 27.724 26.841  64.053  1.00 42.01 ? 74  THR B C   1 
ATOM   5253 O O   . THR D 2 73  ? 28.572 26.878  64.954  1.00 42.99 ? 74  THR B O   1 
ATOM   5254 C CB  . THR D 2 73  ? 25.737 27.810  65.093  1.00 45.31 ? 74  THR B CB  1 
ATOM   5255 O OG1 . THR D 2 73  ? 24.864 26.703  64.829  1.00 49.85 ? 74  THR B OG1 1 
ATOM   5256 C CG2 . THR D 2 73  ? 24.905 29.073  65.291  1.00 42.97 ? 74  THR B CG2 1 
ATOM   5257 N N   . ASP D 2 74  ? 27.641 25.832  63.193  1.00 38.46 ? 75  ASP B N   1 
ATOM   5258 C CA  . ASP D 2 74  ? 28.570 24.703  63.255  1.00 34.94 ? 75  ASP B CA  1 
ATOM   5259 C C   . ASP D 2 74  ? 29.206 24.479  61.898  1.00 31.93 ? 75  ASP B C   1 
ATOM   5260 O O   . ASP D 2 74  ? 28.511 24.218  60.923  1.00 23.90 ? 75  ASP B O   1 
ATOM   5261 C CB  . ASP D 2 74  ? 27.821 23.452  63.694  1.00 37.73 ? 75  ASP B CB  1 
ATOM   5262 C CG  . ASP D 2 74  ? 27.291 23.567  65.110  1.00 50.89 ? 75  ASP B CG  1 
ATOM   5263 O OD1 . ASP D 2 74  ? 27.986 23.109  66.044  1.00 54.51 ? 75  ASP B OD1 1 
ATOM   5264 O OD2 . ASP D 2 74  ? 26.188 24.131  65.297  1.00 54.46 ? 75  ASP B OD2 1 
ATOM   5265 N N   . PHE D 2 75  ? 30.530 24.548  61.845  1.00 26.98 ? 76  PHE B N   1 
ATOM   5266 C CA  . PHE D 2 75  ? 31.213 24.410  60.571  1.00 27.33 ? 76  PHE B CA  1 
ATOM   5267 C C   . PHE D 2 75  ? 32.319 23.384  60.551  1.00 27.71 ? 76  PHE B C   1 
ATOM   5268 O O   . PHE D 2 75  ? 32.839 22.993  61.597  1.00 28.03 ? 76  PHE B O   1 
ATOM   5269 C CB  . PHE D 2 75  ? 31.766 25.767  60.149  1.00 26.39 ? 76  PHE B CB  1 
ATOM   5270 C CG  . PHE D 2 75  ? 30.900 26.919  60.570  1.00 25.25 ? 76  PHE B CG  1 
ATOM   5271 C CD1 . PHE D 2 75  ? 31.071 27.508  61.812  1.00 25.40 ? 76  PHE B CD1 1 
ATOM   5272 C CD2 . PHE D 2 75  ? 29.899 27.390  59.739  1.00 26.93 ? 76  PHE B CD2 1 
ATOM   5273 C CE1 . PHE D 2 75  ? 30.261 28.549  62.228  1.00 32.77 ? 76  PHE B CE1 1 
ATOM   5274 C CE2 . PHE D 2 75  ? 29.080 28.433  60.141  1.00 31.05 ? 76  PHE B CE2 1 
ATOM   5275 C CZ  . PHE D 2 75  ? 29.263 29.017  61.395  1.00 35.25 ? 76  PHE B CZ  1 
ATOM   5276 N N   . THR D 2 76  ? 32.669 22.959  59.341  1.00 24.46 ? 77  THR B N   1 
ATOM   5277 C CA  . THR D 2 76  ? 33.703 21.969  59.143  1.00 22.95 ? 77  THR B CA  1 
ATOM   5278 C C   . THR D 2 76  ? 34.594 22.324  57.969  1.00 28.54 ? 77  THR B C   1 
ATOM   5279 O O   . THR D 2 76  ? 34.112 22.570  56.860  1.00 32.52 ? 77  THR B O   1 
ATOM   5280 C CB  . THR D 2 76  ? 33.095 20.580  58.856  1.00 21.33 ? 77  THR B CB  1 
ATOM   5281 O OG1 . THR D 2 76  ? 32.156 20.251  59.886  1.00 25.34 ? 77  THR B OG1 1 
ATOM   5282 C CG2 . THR D 2 76  ? 34.186 19.520  58.804  1.00 29.26 ? 77  THR B CG2 1 
ATOM   5283 N N   . LEU D 2 77  ? 35.896 22.366  58.212  1.00 23.69 ? 78  LEU B N   1 
ATOM   5284 C CA  . LEU D 2 77  ? 36.829 22.617  57.132  1.00 25.87 ? 78  LEU B CA  1 
ATOM   5285 C C   . LEU D 2 77  ? 37.203 21.208  56.722  1.00 25.12 ? 78  LEU B C   1 
ATOM   5286 O O   . LEU D 2 77  ? 37.505 20.382  57.571  1.00 22.46 ? 78  LEU B O   1 
ATOM   5287 C CB  . LEU D 2 77  ? 38.082 23.351  57.623  1.00 28.13 ? 78  LEU B CB  1 
ATOM   5288 C CG  . LEU D 2 77  ? 39.200 23.452  56.571  1.00 30.09 ? 78  LEU B CG  1 
ATOM   5289 C CD1 . LEU D 2 77  ? 38.758 24.386  55.468  1.00 29.66 ? 78  LEU B CD1 1 
ATOM   5290 C CD2 . LEU D 2 77  ? 40.497 23.963  57.201  1.00 24.89 ? 78  LEU B CD2 1 
ATOM   5291 N N   . ARG D 2 78  ? 37.154 20.917  55.430  1.00 25.45 ? 79  ARG B N   1 
ATOM   5292 C CA  . ARG D 2 78  ? 37.515 19.589  54.974  1.00 24.63 ? 79  ARG B CA  1 
ATOM   5293 C C   . ARG D 2 78  ? 38.689 19.674  54.031  1.00 21.43 ? 79  ARG B C   1 
ATOM   5294 O O   . ARG D 2 78  ? 38.771 20.581  53.200  1.00 20.63 ? 79  ARG B O   1 
ATOM   5295 C CB  . ARG D 2 78  ? 36.319 18.908  54.303  1.00 25.06 ? 79  ARG B CB  1 
ATOM   5296 C CG  . ARG D 2 78  ? 35.274 18.422  55.291  1.00 28.15 ? 79  ARG B CG  1 
ATOM   5297 C CD  . ARG D 2 78  ? 33.964 18.141  54.599  1.00 44.41 ? 79  ARG B CD  1 
ATOM   5298 N NE  . ARG D 2 78  ? 32.859 17.963  55.538  1.00 57.23 ? 79  ARG B NE  1 
ATOM   5299 C CZ  . ARG D 2 78  ? 31.577 17.915  55.184  1.00 53.93 ? 79  ARG B CZ  1 
ATOM   5300 N NH1 . ARG D 2 78  ? 31.231 18.029  53.907  1.00 52.50 ? 79  ARG B NH1 1 
ATOM   5301 N NH2 . ARG D 2 78  ? 30.642 17.767  56.112  1.00 57.20 ? 79  ARG B NH2 1 
ATOM   5302 N N   . ILE D 2 79  ? 39.620 18.744  54.201  1.00 21.85 ? 80  ILE B N   1 
ATOM   5303 C CA  . ILE D 2 79  ? 40.809 18.674  53.372  1.00 23.60 ? 80  ILE B CA  1 
ATOM   5304 C C   . ILE D 2 79  ? 40.902 17.253  52.848  1.00 28.52 ? 80  ILE B C   1 
ATOM   5305 O O   . ILE D 2 79  ? 41.117 16.317  53.620  1.00 26.82 ? 80  ILE B O   1 
ATOM   5306 C CB  . ILE D 2 79  ? 42.080 18.954  54.188  1.00 24.19 ? 80  ILE B CB  1 
ATOM   5307 C CG1 . ILE D 2 79  ? 41.891 20.215  55.039  1.00 27.14 ? 80  ILE B CG1 1 
ATOM   5308 C CG2 . ILE D 2 79  ? 43.275 19.116  53.244  1.00 16.06 ? 80  ILE B CG2 1 
ATOM   5309 C CD1 . ILE D 2 79  ? 43.088 20.546  55.926  1.00 24.98 ? 80  ILE B CD1 1 
ATOM   5310 N N   . ASN D 2 80  ? 40.732 17.074  51.545  1.00 32.62 ? 81  ASN B N   1 
ATOM   5311 C CA  . ASN D 2 80  ? 40.804 15.727  51.007  1.00 33.49 ? 81  ASN B CA  1 
ATOM   5312 C C   . ASN D 2 80  ? 42.194 15.454  50.468  1.00 31.16 ? 81  ASN B C   1 
ATOM   5313 O O   . ASN D 2 80  ? 42.975 16.379  50.235  1.00 25.46 ? 81  ASN B O   1 
ATOM   5314 C CB  . ASN D 2 80  ? 39.736 15.522  49.921  1.00 43.06 ? 81  ASN B CB  1 
ATOM   5315 C CG  . ASN D 2 80  ? 39.871 16.494  48.775  1.00 40.42 ? 81  ASN B CG  1 
ATOM   5316 O OD1 . ASN D 2 80  ? 38.876 16.912  48.183  1.00 54.80 ? 81  ASN B OD1 1 
ATOM   5317 N ND2 . ASN D 2 80  ? 41.099 16.843  48.440  1.00 43.30 ? 81  ASN B ND2 1 
ATOM   5318 N N   . THR D 2 81  ? 42.509 14.175  50.293  1.00 32.51 ? 82  THR B N   1 
ATOM   5319 C CA  . THR D 2 81  ? 43.810 13.779  49.784  1.00 36.05 ? 82  THR B CA  1 
ATOM   5320 C C   . THR D 2 81  ? 44.910 14.580  50.482  1.00 34.69 ? 82  THR B C   1 
ATOM   5321 O O   . THR D 2 81  ? 45.734 15.226  49.841  1.00 34.16 ? 82  THR B O   1 
ATOM   5322 C CB  . THR D 2 81  ? 43.879 13.991  48.257  1.00 37.93 ? 82  THR B CB  1 
ATOM   5323 O OG1 . THR D 2 81  ? 42.786 13.301  47.639  1.00 43.59 ? 82  THR B OG1 1 
ATOM   5324 C CG2 . THR D 2 81  ? 45.172 13.423  47.692  1.00 47.49 ? 82  THR B CG2 1 
ATOM   5325 N N   . VAL D 2 82  ? 44.923 14.519  51.810  1.00 32.43 ? 83  VAL B N   1 
ATOM   5326 C CA  . VAL D 2 82  ? 45.904 15.253  52.594  1.00 34.70 ? 83  VAL B CA  1 
ATOM   5327 C C   . VAL D 2 82  ? 47.339 14.982  52.163  1.00 42.25 ? 83  VAL B C   1 
ATOM   5328 O O   . VAL D 2 82  ? 47.758 13.829  52.057  1.00 42.78 ? 83  VAL B O   1 
ATOM   5329 C CB  . VAL D 2 82  ? 45.761 14.931  54.097  1.00 32.67 ? 83  VAL B CB  1 
ATOM   5330 C CG1 . VAL D 2 82  ? 47.044 15.265  54.834  1.00 34.45 ? 83  VAL B CG1 1 
ATOM   5331 C CG2 . VAL D 2 82  ? 44.616 15.724  54.680  1.00 32.76 ? 83  VAL B CG2 1 
ATOM   5332 N N   . GLU D 2 83  ? 48.083 16.059  51.921  1.00 43.75 ? 84  GLU B N   1 
ATOM   5333 C CA  . GLU D 2 83  ? 49.479 15.977  51.515  1.00 40.04 ? 84  GLU B CA  1 
ATOM   5334 C C   . GLU D 2 83  ? 50.324 16.397  52.708  1.00 45.02 ? 84  GLU B C   1 
ATOM   5335 O O   . GLU D 2 83  ? 49.853 17.133  53.576  1.00 49.13 ? 84  GLU B O   1 
ATOM   5336 C CB  . GLU D 2 83  ? 49.747 16.914  50.340  1.00 39.73 ? 84  GLU B CB  1 
ATOM   5337 C CG  . GLU D 2 83  ? 48.824 16.685  49.161  1.00 43.52 ? 84  GLU B CG  1 
ATOM   5338 C CD  . GLU D 2 83  ? 49.113 17.617  48.000  1.00 47.69 ? 84  GLU B CD  1 
ATOM   5339 O OE1 . GLU D 2 83  ? 48.332 17.605  47.022  1.00 51.25 ? 84  GLU B OE1 1 
ATOM   5340 O OE2 . GLU D 2 83  ? 50.120 18.358  48.063  1.00 46.66 ? 84  GLU B OE2 1 
ATOM   5341 N N   . ALA D 2 84  ? 51.567 15.923  52.752  1.00 45.45 ? 85  ALA B N   1 
ATOM   5342 C CA  . ALA D 2 84  ? 52.487 16.241  53.842  1.00 43.18 ? 85  ALA B CA  1 
ATOM   5343 C C   . ALA D 2 84  ? 52.640 17.744  54.061  1.00 40.66 ? 85  ALA B C   1 
ATOM   5344 O O   . ALA D 2 84  ? 52.816 18.196  55.190  1.00 41.44 ? 85  ALA B O   1 
ATOM   5345 C CB  . ALA D 2 84  ? 53.843 15.624  53.560  1.00 44.37 ? 85  ALA B CB  1 
ATOM   5346 N N   . GLU D 2 85  ? 52.573 18.507  52.976  1.00 37.64 ? 86  GLU B N   1 
ATOM   5347 C CA  . GLU D 2 85  ? 52.713 19.951  53.044  1.00 43.83 ? 86  GLU B CA  1 
ATOM   5348 C C   . GLU D 2 85  ? 51.523 20.646  53.699  1.00 44.14 ? 86  GLU B C   1 
ATOM   5349 O O   . GLU D 2 85  ? 51.580 21.850  53.950  1.00 47.66 ? 86  GLU B O   1 
ATOM   5350 C CB  . GLU D 2 85  ? 52.919 20.518  51.638  1.00 47.92 ? 86  GLU B CB  1 
ATOM   5351 C CG  . GLU D 2 85  ? 51.910 20.002  50.615  1.00 58.71 ? 86  GLU B CG  1 
ATOM   5352 C CD  . GLU D 2 85  ? 51.913 20.813  49.334  1.00 61.82 ? 86  GLU B CD  1 
ATOM   5353 O OE1 . GLU D 2 85  ? 53.016 21.091  48.810  1.00 63.63 ? 86  GLU B OE1 1 
ATOM   5354 O OE2 . GLU D 2 85  ? 50.814 21.165  48.852  1.00 63.43 ? 86  GLU B OE2 1 
ATOM   5355 N N   . ASP D 2 86  ? 50.455 19.900  53.982  1.00 41.55 ? 87  ASP B N   1 
ATOM   5356 C CA  . ASP D 2 86  ? 49.275 20.499  54.596  1.00 40.25 ? 87  ASP B CA  1 
ATOM   5357 C C   . ASP D 2 86  ? 49.421 20.703  56.104  1.00 40.84 ? 87  ASP B C   1 
ATOM   5358 O O   . ASP D 2 86  ? 48.563 21.316  56.738  1.00 42.27 ? 87  ASP B O   1 
ATOM   5359 C CB  . ASP D 2 86  ? 48.021 19.661  54.313  1.00 41.08 ? 87  ASP B CB  1 
ATOM   5360 C CG  . ASP D 2 86  ? 47.671 19.599  52.833  1.00 44.80 ? 87  ASP B CG  1 
ATOM   5361 O OD1 . ASP D 2 86  ? 47.864 20.609  52.121  1.00 44.78 ? 87  ASP B OD1 1 
ATOM   5362 O OD2 . ASP D 2 86  ? 47.180 18.539  52.386  1.00 49.71 ? 87  ASP B OD2 1 
ATOM   5363 N N   . VAL D 2 87  ? 50.501 20.197  56.693  1.00 39.80 ? 88  VAL B N   1 
ATOM   5364 C CA  . VAL D 2 87  ? 50.687 20.368  58.138  1.00 39.10 ? 88  VAL B CA  1 
ATOM   5365 C C   . VAL D 2 87  ? 50.724 21.840  58.533  1.00 38.65 ? 88  VAL B C   1 
ATOM   5366 O O   . VAL D 2 87  ? 51.236 22.686  57.797  1.00 43.01 ? 88  VAL B O   1 
ATOM   5367 C CB  . VAL D 2 87  ? 51.983 19.736  58.649  1.00 38.17 ? 88  VAL B CB  1 
ATOM   5368 C CG1 . VAL D 2 87  ? 51.929 18.244  58.479  1.00 47.08 ? 88  VAL B CG1 1 
ATOM   5369 C CG2 . VAL D 2 87  ? 53.166 20.319  57.909  1.00 42.65 ? 88  VAL B CG2 1 
ATOM   5370 N N   . GLY D 2 88  ? 50.190 22.127  59.713  1.00 35.40 ? 89  GLY B N   1 
ATOM   5371 C CA  . GLY D 2 88  ? 50.127 23.491  60.194  1.00 31.08 ? 89  GLY B CA  1 
ATOM   5372 C C   . GLY D 2 88  ? 48.922 23.630  61.104  1.00 28.55 ? 89  GLY B C   1 
ATOM   5373 O O   . GLY D 2 88  ? 48.319 22.631  61.502  1.00 27.86 ? 89  GLY B O   1 
ATOM   5374 N N   . VAL D 2 89  ? 48.570 24.870  61.431  1.00 23.32 ? 90  VAL B N   1 
ATOM   5375 C CA  . VAL D 2 89  ? 47.439 25.136  62.292  1.00 25.84 ? 90  VAL B CA  1 
ATOM   5376 C C   . VAL D 2 89  ? 46.359 25.886  61.524  1.00 24.44 ? 90  VAL B C   1 
ATOM   5377 O O   . VAL D 2 89  ? 46.605 26.948  60.957  1.00 27.60 ? 90  VAL B O   1 
ATOM   5378 C CB  . VAL D 2 89  ? 47.869 25.972  63.520  1.00 21.90 ? 90  VAL B CB  1 
ATOM   5379 C CG1 . VAL D 2 89  ? 46.731 26.052  64.511  1.00 20.65 ? 90  VAL B CG1 1 
ATOM   5380 C CG2 . VAL D 2 89  ? 49.101 25.335  64.165  1.00 23.98 ? 90  VAL B CG2 1 
ATOM   5381 N N   . TYR D 2 90  ? 45.158 25.326  61.524  1.00 25.39 ? 91  TYR B N   1 
ATOM   5382 C CA  . TYR D 2 90  ? 44.033 25.920  60.820  1.00 28.23 ? 91  TYR B CA  1 
ATOM   5383 C C   . TYR D 2 90  ? 43.122 26.687  61.755  1.00 25.01 ? 91  TYR B C   1 
ATOM   5384 O O   . TYR D 2 90  ? 42.625 26.147  62.747  1.00 27.64 ? 91  TYR B O   1 
ATOM   5385 C CB  . TYR D 2 90  ? 43.259 24.825  60.095  1.00 24.07 ? 91  TYR B CB  1 
ATOM   5386 C CG  . TYR D 2 90  ? 44.100 24.166  59.038  1.00 26.20 ? 91  TYR B CG  1 
ATOM   5387 C CD1 . TYR D 2 90  ? 45.145 23.302  59.387  1.00 30.27 ? 91  TYR B CD1 1 
ATOM   5388 C CD2 . TYR D 2 90  ? 43.907 24.461  57.690  1.00 26.04 ? 91  TYR B CD2 1 
ATOM   5389 C CE1 . TYR D 2 90  ? 45.976 22.754  58.418  1.00 27.44 ? 91  TYR B CE1 1 
ATOM   5390 C CE2 . TYR D 2 90  ? 44.733 23.921  56.709  1.00 23.94 ? 91  TYR B CE2 1 
ATOM   5391 C CZ  . TYR D 2 90  ? 45.767 23.072  57.083  1.00 29.82 ? 91  TYR B CZ  1 
ATOM   5392 O OH  . TYR D 2 90  ? 46.616 22.567  56.140  1.00 27.48 ? 91  TYR B OH  1 
ATOM   5393 N N   . TYR D 2 91  ? 42.904 27.954  61.426  1.00 23.81 ? 92  TYR B N   1 
ATOM   5394 C CA  . TYR D 2 91  ? 42.067 28.822  62.248  1.00 23.98 ? 92  TYR B CA  1 
ATOM   5395 C C   . TYR D 2 91  ? 40.780 29.229  61.558  1.00 24.61 ? 92  TYR B C   1 
ATOM   5396 O O   . TYR D 2 91  ? 40.791 29.584  60.376  1.00 23.03 ? 92  TYR B O   1 
ATOM   5397 C CB  . TYR D 2 91  ? 42.815 30.120  62.578  1.00 25.80 ? 92  TYR B CB  1 
ATOM   5398 C CG  . TYR D 2 91  ? 44.073 29.965  63.396  1.00 28.74 ? 92  TYR B CG  1 
ATOM   5399 C CD1 . TYR D 2 91  ? 44.058 30.159  64.778  1.00 30.14 ? 92  TYR B CD1 1 
ATOM   5400 C CD2 . TYR D 2 91  ? 45.284 29.652  62.787  1.00 31.44 ? 92  TYR B CD2 1 
ATOM   5401 C CE1 . TYR D 2 91  ? 45.225 30.048  65.535  1.00 30.78 ? 92  TYR B CE1 1 
ATOM   5402 C CE2 . TYR D 2 91  ? 46.455 29.535  63.531  1.00 37.33 ? 92  TYR B CE2 1 
ATOM   5403 C CZ  . TYR D 2 91  ? 46.416 29.735  64.906  1.00 33.89 ? 92  TYR B CZ  1 
ATOM   5404 O OH  . TYR D 2 91  ? 47.570 29.610  65.641  1.00 34.69 ? 92  TYR B OH  1 
ATOM   5405 N N   . CYS D 2 92  ? 39.675 29.174  62.287  1.00 23.32 ? 93  CYS B N   1 
ATOM   5406 C CA  . CYS D 2 92  ? 38.418 29.664  61.747  1.00 22.82 ? 93  CYS B CA  1 
ATOM   5407 C C   . CYS D 2 92  ? 38.269 31.033  62.402  1.00 27.93 ? 93  CYS B C   1 
ATOM   5408 O O   . CYS D 2 92  ? 38.901 31.308  63.432  1.00 25.51 ? 93  CYS B O   1 
ATOM   5409 C CB  . CYS D 2 92  ? 37.242 28.771  62.118  1.00 26.12 ? 93  CYS B CB  1 
ATOM   5410 S SG  . CYS D 2 92  ? 36.927 28.467  63.882  1.00 31.39 ? 93  CYS B SG  1 
ATOM   5411 N N   . ALA D 2 93  ? 37.448 31.893  61.814  1.00 21.79 ? 94  ALA B N   1 
ATOM   5412 C CA  . ALA D 2 93  ? 37.241 33.230  62.355  1.00 27.06 ? 94  ALA B CA  1 
ATOM   5413 C C   . ALA D 2 93  ? 35.991 33.830  61.743  1.00 28.80 ? 94  ALA B C   1 
ATOM   5414 O O   . ALA D 2 93  ? 35.506 33.348  60.717  1.00 24.65 ? 94  ALA B O   1 
ATOM   5415 C CB  . ALA D 2 93  ? 38.441 34.108  62.055  1.00 27.81 ? 94  ALA B CB  1 
ATOM   5416 N N   . GLN D 2 94  ? 35.472 34.885  62.359  1.00 25.18 ? 95  GLN B N   1 
ATOM   5417 C CA  . GLN D 2 94  ? 34.263 35.499  61.849  1.00 23.05 ? 95  GLN B CA  1 
ATOM   5418 C C   . GLN D 2 94  ? 34.429 36.967  61.512  1.00 25.31 ? 95  GLN B C   1 
ATOM   5419 O O   . GLN D 2 94  ? 35.072 37.717  62.251  1.00 25.57 ? 95  GLN B O   1 
ATOM   5420 C CB  . GLN D 2 94  ? 33.125 35.343  62.859  1.00 25.59 ? 95  GLN B CB  1 
ATOM   5421 C CG  . GLN D 2 94  ? 33.363 36.055  64.202  1.00 18.67 ? 95  GLN B CG  1 
ATOM   5422 C CD  . GLN D 2 94  ? 33.008 37.537  64.176  1.00 27.37 ? 95  GLN B CD  1 
ATOM   5423 O OE1 . GLN D 2 94  ? 33.315 38.276  65.116  1.00 24.24 ? 95  GLN B OE1 1 
ATOM   5424 N NE2 . GLN D 2 94  ? 32.351 37.976  63.108  1.00 21.18 ? 95  GLN B NE2 1 
ATOM   5425 N N   . ASN D 2 95  ? 33.860 37.372  60.382  1.00 22.33 ? 96  ASN B N   1 
ATOM   5426 C CA  . ASN D 2 95  ? 33.899 38.778  60.010  1.00 21.37 ? 96  ASN B CA  1 
ATOM   5427 C C   . ASN D 2 95  ? 32.488 39.258  59.730  1.00 26.36 ? 96  ASN B C   1 
ATOM   5428 O O   . ASN D 2 95  ? 32.234 40.004  58.789  1.00 26.33 ? 96  ASN B O   1 
ATOM   5429 C CB  . ASN D 2 95  ? 34.825 39.055  58.827  1.00 14.46 ? 96  ASN B CB  1 
ATOM   5430 C CG  . ASN D 2 95  ? 34.452 38.280  57.580  1.00 23.44 ? 96  ASN B CG  1 
ATOM   5431 O OD1 . ASN D 2 95  ? 35.025 38.519  56.515  1.00 26.89 ? 96  ASN B OD1 1 
ATOM   5432 N ND2 . ASN D 2 95  ? 33.504 37.348  57.700  1.00 13.59 ? 96  ASN B ND2 1 
ATOM   5433 N N   . LEU D 2 96  ? 31.571 38.817  60.589  1.00 22.81 ? 97  LEU B N   1 
ATOM   5434 C CA  . LEU D 2 96  ? 30.169 39.199  60.512  1.00 26.22 ? 97  LEU B CA  1 
ATOM   5435 C C   . LEU D 2 96  ? 29.946 40.526  61.239  1.00 27.50 ? 97  LEU B C   1 
ATOM   5436 O O   . LEU D 2 96  ? 29.275 41.420  60.729  1.00 24.72 ? 97  LEU B O   1 
ATOM   5437 C CB  . LEU D 2 96  ? 29.284 38.144  61.175  1.00 23.92 ? 97  LEU B CB  1 
ATOM   5438 C CG  . LEU D 2 96  ? 27.808 38.559  61.146  1.00 28.41 ? 97  LEU B CG  1 
ATOM   5439 C CD1 . LEU D 2 96  ? 27.273 38.347  59.735  1.00 29.43 ? 97  LEU B CD1 1 
ATOM   5440 C CD2 . LEU D 2 96  ? 26.998 37.769  62.140  1.00 26.13 ? 97  LEU B CD2 1 
ATOM   5441 N N   . GLU D 2 97  ? 30.518 40.648  62.438  1.00 30.90 ? 98  GLU B N   1 
ATOM   5442 C CA  . GLU D 2 97  ? 30.351 41.856  63.240  1.00 33.12 ? 98  GLU B CA  1 
ATOM   5443 C C   . GLU D 2 97  ? 31.587 42.217  64.038  1.00 35.18 ? 98  GLU B C   1 
ATOM   5444 O O   . GLU D 2 97  ? 32.504 41.403  64.199  1.00 36.04 ? 98  GLU B O   1 
ATOM   5445 C CB  . GLU D 2 97  ? 29.236 41.664  64.257  1.00 37.48 ? 98  GLU B CB  1 
ATOM   5446 C CG  . GLU D 2 97  ? 27.975 41.035  63.748  1.00 43.08 ? 98  GLU B CG  1 
ATOM   5447 C CD  . GLU D 2 97  ? 27.136 40.484  64.888  1.00 45.72 ? 98  GLU B CD  1 
ATOM   5448 O OE1 . GLU D 2 97  ? 25.990 40.063  64.632  1.00 50.33 ? 98  GLU B OE1 1 
ATOM   5449 O OE2 . GLU D 2 97  ? 27.629 40.461  66.041  1.00 38.18 ? 98  GLU B OE2 1 
ATOM   5450 N N   . LEU D 2 98  ? 31.594 43.440  64.559  1.00 31.88 ? 99  LEU B N   1 
ATOM   5451 C CA  . LEU D 2 98  ? 32.688 43.887  65.410  1.00 33.14 ? 99  LEU B CA  1 
ATOM   5452 C C   . LEU D 2 98  ? 32.310 43.425  66.821  1.00 33.29 ? 99  LEU B C   1 
ATOM   5453 O O   . LEU D 2 98  ? 31.133 43.348  67.163  1.00 32.61 ? 99  LEU B O   1 
ATOM   5454 C CB  . LEU D 2 98  ? 32.813 45.411  65.386  1.00 31.92 ? 99  LEU B CB  1 
ATOM   5455 C CG  . LEU D 2 98  ? 33.353 46.038  64.099  1.00 35.76 ? 99  LEU B CG  1 
ATOM   5456 C CD1 . LEU D 2 98  ? 33.249 47.555  64.175  1.00 33.00 ? 99  LEU B CD1 1 
ATOM   5457 C CD2 . LEU D 2 98  ? 34.797 45.604  63.893  1.00 34.90 ? 99  LEU B CD2 1 
ATOM   5458 N N   . PRO D 2 99  ? 33.301 43.066  67.641  1.00 35.57 ? 100 PRO B N   1 
ATOM   5459 C CA  . PRO D 2 99  ? 34.719 43.074  67.292  1.00 33.58 ? 100 PRO B CA  1 
ATOM   5460 C C   . PRO D 2 99  ? 35.075 41.782  66.574  1.00 27.68 ? 100 PRO B C   1 
ATOM   5461 O O   . PRO D 2 99  ? 34.404 40.766  66.735  1.00 29.74 ? 100 PRO B O   1 
ATOM   5462 C CB  . PRO D 2 99  ? 35.390 43.161  68.650  1.00 32.79 ? 100 PRO B CB  1 
ATOM   5463 C CG  . PRO D 2 99  ? 34.505 42.280  69.482  1.00 36.23 ? 100 PRO B CG  1 
ATOM   5464 C CD  . PRO D 2 99  ? 33.119 42.748  69.070  1.00 37.15 ? 100 PRO B CD  1 
ATOM   5465 N N   . PRO D 2 100 ? 36.132 41.804  65.764  1.00 29.34 ? 101 PRO B N   1 
ATOM   5466 C CA  . PRO D 2 100 ? 36.491 40.562  65.075  1.00 27.37 ? 101 PRO B CA  1 
ATOM   5467 C C   . PRO D 2 100 ? 36.965 39.552  66.113  1.00 31.72 ? 101 PRO B C   1 
ATOM   5468 O O   . PRO D 2 100 ? 37.657 39.914  67.060  1.00 29.98 ? 101 PRO B O   1 
ATOM   5469 C CB  . PRO D 2 100 ? 37.602 40.994  64.129  1.00 26.85 ? 101 PRO B CB  1 
ATOM   5470 C CG  . PRO D 2 100 ? 38.228 42.161  64.843  1.00 29.71 ? 101 PRO B CG  1 
ATOM   5471 C CD  . PRO D 2 100 ? 37.035 42.908  65.396  1.00 28.77 ? 101 PRO B CD  1 
ATOM   5472 N N   . THR D 2 101 ? 36.564 38.296  65.951  1.00 28.80 ? 102 THR B N   1 
ATOM   5473 C CA  . THR D 2 101 ? 36.971 37.261  66.888  1.00 24.19 ? 102 THR B CA  1 
ATOM   5474 C C   . THR D 2 101 ? 37.559 36.091  66.126  1.00 26.68 ? 102 THR B C   1 
ATOM   5475 O O   . THR D 2 101 ? 37.251 35.883  64.942  1.00 28.39 ? 102 THR B O   1 
ATOM   5476 C CB  . THR D 2 101 ? 35.789 36.805  67.740  1.00 29.34 ? 102 THR B CB  1 
ATOM   5477 O OG1 . THR D 2 101 ? 34.661 36.569  66.893  1.00 22.99 ? 102 THR B OG1 1 
ATOM   5478 C CG2 . THR D 2 101 ? 35.430 37.877  68.772  1.00 25.32 ? 102 THR B CG2 1 
ATOM   5479 N N   . PHE D 2 102 ? 38.408 35.327  66.798  1.00 22.14 ? 103 PHE B N   1 
ATOM   5480 C CA  . PHE D 2 102 ? 39.079 34.214  66.163  1.00 23.67 ? 103 PHE B CA  1 
ATOM   5481 C C   . PHE D 2 102 ? 39.089 32.935  66.982  1.00 28.12 ? 103 PHE B C   1 
ATOM   5482 O O   . PHE D 2 102 ? 39.029 32.961  68.215  1.00 25.09 ? 103 PHE B O   1 
ATOM   5483 C CB  . PHE D 2 102 ? 40.523 34.605  65.847  1.00 31.08 ? 103 PHE B CB  1 
ATOM   5484 C CG  . PHE D 2 102 ? 40.679 36.023  65.380  1.00 31.82 ? 103 PHE B CG  1 
ATOM   5485 C CD1 . PHE D 2 102 ? 40.764 37.070  66.298  1.00 31.25 ? 103 PHE B CD1 1 
ATOM   5486 C CD2 . PHE D 2 102 ? 40.719 36.315  64.022  1.00 24.04 ? 103 PHE B CD2 1 
ATOM   5487 C CE1 . PHE D 2 102 ? 40.882 38.385  65.866  1.00 27.53 ? 103 PHE B CE1 1 
ATOM   5488 C CE2 . PHE D 2 102 ? 40.834 37.622  63.581  1.00 22.70 ? 103 PHE B CE2 1 
ATOM   5489 C CZ  . PHE D 2 102 ? 40.916 38.661  64.498  1.00 31.55 ? 103 PHE B CZ  1 
ATOM   5490 N N   . GLY D 2 103 ? 39.168 31.811  66.275  1.00 22.74 ? 104 GLY B N   1 
ATOM   5491 C CA  . GLY D 2 103 ? 39.215 30.522  66.931  1.00 24.22 ? 104 GLY B CA  1 
ATOM   5492 C C   . GLY D 2 103 ? 40.616 30.337  67.483  1.00 26.55 ? 104 GLY B C   1 
ATOM   5493 O O   . GLY D 2 103 ? 41.513 31.103  67.154  1.00 25.72 ? 104 GLY B O   1 
ATOM   5494 N N   . ALA D 2 104 ? 40.817 29.325  68.312  1.00 29.81 ? 105 ALA B N   1 
ATOM   5495 C CA  . ALA D 2 104 ? 42.133 29.108  68.887  1.00 30.95 ? 105 ALA B CA  1 
ATOM   5496 C C   . ALA D 2 104 ? 43.050 28.321  67.956  1.00 30.95 ? 105 ALA B C   1 
ATOM   5497 O O   . ALA D 2 104 ? 44.239 28.166  68.232  1.00 32.91 ? 105 ALA B O   1 
ATOM   5498 C CB  . ALA D 2 104 ? 41.997 28.404  70.228  1.00 41.44 ? 105 ALA B CB  1 
ATOM   5499 N N   . GLY D 2 105 ? 42.498 27.831  66.847  1.00 27.55 ? 106 GLY B N   1 
ATOM   5500 C CA  . GLY D 2 105 ? 43.294 27.085  65.888  1.00 19.48 ? 106 GLY B CA  1 
ATOM   5501 C C   . GLY D 2 105 ? 43.373 25.591  66.143  1.00 26.53 ? 106 GLY B C   1 
ATOM   5502 O O   . GLY D 2 105 ? 43.441 25.148  67.289  1.00 27.34 ? 106 GLY B O   1 
ATOM   5503 N N   . THR D 2 106 ? 43.348 24.802  65.071  1.00 28.87 ? 107 THR B N   1 
ATOM   5504 C CA  . THR D 2 106 ? 43.445 23.353  65.200  1.00 22.98 ? 107 THR B CA  1 
ATOM   5505 C C   . THR D 2 106 ? 44.673 22.877  64.448  1.00 28.14 ? 107 THR B C   1 
ATOM   5506 O O   . THR D 2 106 ? 44.834 23.153  63.264  1.00 26.09 ? 107 THR B O   1 
ATOM   5507 C CB  . THR D 2 106 ? 42.213 22.635  64.632  1.00 29.15 ? 107 THR B CB  1 
ATOM   5508 O OG1 . THR D 2 106 ? 41.035 23.074  65.322  1.00 22.66 ? 107 THR B OG1 1 
ATOM   5509 C CG2 . THR D 2 106 ? 42.360 21.125  64.806  1.00 26.19 ? 107 THR B CG2 1 
ATOM   5510 N N   . LYS D 2 107 ? 45.548 22.160  65.139  1.00 25.31 ? 108 LYS B N   1 
ATOM   5511 C CA  . LYS D 2 107 ? 46.752 21.656  64.505  1.00 29.61 ? 108 LYS B CA  1 
ATOM   5512 C C   . LYS D 2 107 ? 46.435 20.358  63.779  1.00 27.20 ? 108 LYS B C   1 
ATOM   5513 O O   . LYS D 2 107 ? 45.939 19.415  64.385  1.00 28.54 ? 108 LYS B O   1 
ATOM   5514 C CB  . LYS D 2 107 ? 47.836 21.412  65.554  1.00 36.84 ? 108 LYS B CB  1 
ATOM   5515 C CG  . LYS D 2 107 ? 48.998 20.560  65.052  1.00 42.29 ? 108 LYS B CG  1 
ATOM   5516 C CD  . LYS D 2 107 ? 50.271 21.370  64.941  1.00 50.32 ? 108 LYS B CD  1 
ATOM   5517 C CE  . LYS D 2 107 ? 50.663 21.956  66.290  1.00 47.95 ? 108 LYS B CE  1 
ATOM   5518 N NZ  . LYS D 2 107 ? 51.864 22.828  66.180  1.00 51.91 ? 108 LYS B NZ  1 
ATOM   5519 N N   . LEU D 2 108 ? 46.712 20.321  62.480  1.00 28.32 ? 109 LEU B N   1 
ATOM   5520 C CA  . LEU D 2 108 ? 46.461 19.129  61.682  1.00 29.65 ? 109 LEU B CA  1 
ATOM   5521 C C   . LEU D 2 108 ? 47.553 18.104  61.968  1.00 33.04 ? 109 LEU B C   1 
ATOM   5522 O O   . LEU D 2 108 ? 48.728 18.347  61.694  1.00 35.38 ? 109 LEU B O   1 
ATOM   5523 C CB  . LEU D 2 108 ? 46.470 19.468  60.187  1.00 22.61 ? 109 LEU B CB  1 
ATOM   5524 C CG  . LEU D 2 108 ? 46.325 18.298  59.199  1.00 26.66 ? 109 LEU B CG  1 
ATOM   5525 C CD1 . LEU D 2 108 ? 44.922 17.729  59.283  1.00 28.82 ? 109 LEU B CD1 1 
ATOM   5526 C CD2 . LEU D 2 108 ? 46.601 18.780  57.783  1.00 26.37 ? 109 LEU B CD2 1 
ATOM   5527 N N   . GLU D 2 109 ? 47.163 16.963  62.521  1.00 36.06 ? 110 GLU B N   1 
ATOM   5528 C CA  . GLU D 2 109 ? 48.105 15.890  62.829  1.00 38.61 ? 110 GLU B CA  1 
ATOM   5529 C C   . GLU D 2 109 ? 48.160 14.891  61.682  1.00 40.65 ? 110 GLU B C   1 
ATOM   5530 O O   . GLU D 2 109 ? 47.120 14.417  61.217  1.00 37.75 ? 110 GLU B O   1 
ATOM   5531 C CB  . GLU D 2 109 ? 47.661 15.137  64.081  1.00 41.65 ? 110 GLU B CB  1 
ATOM   5532 C CG  . GLU D 2 109 ? 47.478 16.000  65.317  1.00 53.46 ? 110 GLU B CG  1 
ATOM   5533 C CD  . GLU D 2 109 ? 48.789 16.375  65.967  1.00 59.00 ? 110 GLU B CD  1 
ATOM   5534 O OE1 . GLU D 2 109 ? 48.760 17.063  67.012  1.00 65.81 ? 110 GLU B OE1 1 
ATOM   5535 O OE2 . GLU D 2 109 ? 49.851 15.980  65.439  1.00 64.34 ? 110 GLU B OE2 1 
ATOM   5536 N N   . LEU D 2 110 ? 49.365 14.555  61.235  1.00 43.01 ? 111 LEU B N   1 
ATOM   5537 C CA  . LEU D 2 110 ? 49.522 13.582  60.159  1.00 45.74 ? 111 LEU B CA  1 
ATOM   5538 C C   . LEU D 2 110 ? 49.931 12.233  60.730  1.00 47.99 ? 111 LEU B C   1 
ATOM   5539 O O   . LEU D 2 110 ? 50.739 12.162  61.655  1.00 45.30 ? 111 LEU B O   1 
ATOM   5540 C CB  . LEU D 2 110 ? 50.578 14.038  59.160  1.00 47.56 ? 111 LEU B CB  1 
ATOM   5541 C CG  . LEU D 2 110 ? 50.286 15.324  58.390  1.00 55.48 ? 111 LEU B CG  1 
ATOM   5542 C CD1 . LEU D 2 110 ? 51.197 15.364  57.171  1.00 59.62 ? 111 LEU B CD1 1 
ATOM   5543 C CD2 . LEU D 2 110 ? 48.825 15.368  57.947  1.00 54.87 ? 111 LEU B CD2 1 
ATOM   5544 N N   . LYS D 2 111 ? 49.363 11.164  60.184  1.00 47.11 ? 112 LYS B N   1 
ATOM   5545 C CA  . LYS D 2 111 ? 49.681 9.819   60.644  1.00 49.31 ? 112 LYS B CA  1 
ATOM   5546 C C   . LYS D 2 111 ? 50.779 9.202   59.784  1.00 49.78 ? 112 LYS B C   1 
ATOM   5547 O O   . LYS D 2 111 ? 50.832 9.422   58.572  1.00 47.12 ? 112 LYS B O   1 
ATOM   5548 C CB  . LYS D 2 111 ? 48.436 8.930   60.597  1.00 52.64 ? 112 LYS B CB  1 
ATOM   5549 C CG  . LYS D 2 111 ? 48.727 7.458   60.845  1.00 51.31 ? 112 LYS B CG  1 
ATOM   5550 C CD  . LYS D 2 111 ? 47.522 6.602   60.507  1.00 54.16 ? 112 LYS B CD  1 
ATOM   5551 C CE  . LYS D 2 111 ? 47.910 5.142   60.336  1.00 56.90 ? 112 LYS B CE  1 
ATOM   5552 N NZ  . LYS D 2 111 ? 46.757 4.309   59.886  1.00 59.08 ? 112 LYS B NZ  1 
ATOM   5553 N N   . ARG D 2 112 ? 51.654 8.431   60.424  1.00 51.99 ? 113 ARG B N   1 
ATOM   5554 C CA  . ARG D 2 112 ? 52.760 7.769   59.738  1.00 53.20 ? 113 ARG B CA  1 
ATOM   5555 C C   . ARG D 2 112 ? 53.145 6.522   60.509  1.00 51.65 ? 113 ARG B C   1 
ATOM   5556 O O   . ARG D 2 112 ? 52.508 6.170   61.499  1.00 52.60 ? 113 ARG B O   1 
ATOM   5557 C CB  . ARG D 2 112 ? 53.985 8.685   59.659  1.00 54.88 ? 113 ARG B CB  1 
ATOM   5558 C CG  . ARG D 2 112 ? 54.626 8.954   61.018  1.00 58.46 ? 113 ARG B CG  1 
ATOM   5559 C CD  . ARG D 2 112 ? 56.005 9.603   60.915  1.00 61.82 ? 113 ARG B CD  1 
ATOM   5560 N NE  . ARG D 2 112 ? 57.074 8.658   60.582  1.00 62.43 ? 113 ARG B NE  1 
ATOM   5561 C CZ  . ARG D 2 112 ? 57.300 8.163   59.369  1.00 60.76 ? 113 ARG B CZ  1 
ATOM   5562 N NH1 . ARG D 2 112 ? 56.535 8.513   58.347  1.00 65.04 ? 113 ARG B NH1 1 
ATOM   5563 N NH2 . ARG D 2 112 ? 58.306 7.323   59.174  1.00 61.76 ? 113 ARG B NH2 1 
ATOM   5564 N N   . ALA D 2 113 ? 54.206 5.867   60.053  1.00 54.37 ? 114 ALA B N   1 
ATOM   5565 C CA  . ALA D 2 113 ? 54.700 4.662   60.700  1.00 55.04 ? 114 ALA B CA  1 
ATOM   5566 C C   . ALA D 2 113 ? 55.501 5.039   61.951  1.00 56.44 ? 114 ALA B C   1 
ATOM   5567 O O   . ALA D 2 113 ? 56.290 5.986   61.933  1.00 56.39 ? 114 ALA B O   1 
ATOM   5568 C CB  . ALA D 2 113 ? 55.572 3.874   59.727  1.00 49.87 ? 114 ALA B CB  1 
ATOM   5569 N N   . ASP D 2 114 ? 55.291 4.302   63.038  1.00 55.68 ? 115 ASP B N   1 
ATOM   5570 C CA  . ASP D 2 114 ? 56.009 4.569   64.278  1.00 58.82 ? 115 ASP B CA  1 
ATOM   5571 C C   . ASP D 2 114 ? 57.520 4.549   64.057  1.00 58.81 ? 115 ASP B C   1 
ATOM   5572 O O   . ASP D 2 114 ? 58.011 3.976   63.080  1.00 57.30 ? 115 ASP B O   1 
ATOM   5573 C CB  . ASP D 2 114 ? 55.618 3.543   65.340  1.00 59.33 ? 115 ASP B CB  1 
ATOM   5574 C CG  . ASP D 2 114 ? 54.173 3.677   65.762  1.00 63.25 ? 115 ASP B CG  1 
ATOM   5575 O OD1 . ASP D 2 114 ? 53.302 3.690   64.869  1.00 66.93 ? 115 ASP B OD1 1 
ATOM   5576 O OD2 . ASP D 2 114 ? 53.905 3.768   66.980  1.00 65.51 ? 115 ASP B OD2 1 
ATOM   5577 N N   . ALA D 2 115 ? 58.257 5.183   64.963  1.00 55.88 ? 116 ALA B N   1 
ATOM   5578 C CA  . ALA D 2 115 ? 59.707 5.243   64.840  1.00 56.89 ? 116 ALA B CA  1 
ATOM   5579 C C   . ALA D 2 115 ? 60.367 5.630   66.155  1.00 58.32 ? 116 ALA B C   1 
ATOM   5580 O O   . ALA D 2 115 ? 59.819 6.411   66.933  1.00 60.31 ? 116 ALA B O   1 
ATOM   5581 C CB  . ALA D 2 115 ? 60.095 6.239   63.753  1.00 47.87 ? 116 ALA B CB  1 
ATOM   5582 N N   . ALA D 2 116 ? 61.548 5.071   66.399  1.00 59.73 ? 117 ALA B N   1 
ATOM   5583 C CA  . ALA D 2 116 ? 62.293 5.370   67.613  1.00 59.32 ? 117 ALA B CA  1 
ATOM   5584 C C   . ALA D 2 116 ? 63.259 6.506   67.297  1.00 59.82 ? 117 ALA B C   1 
ATOM   5585 O O   . ALA D 2 116 ? 63.648 6.694   66.144  1.00 56.53 ? 117 ALA B O   1 
ATOM   5586 C CB  . ALA D 2 116 ? 63.055 4.135   68.080  1.00 61.88 ? 117 ALA B CB  1 
ATOM   5587 N N   . PRO D 2 117 ? 63.654 7.283   68.319  1.00 61.43 ? 118 PRO B N   1 
ATOM   5588 C CA  . PRO D 2 117 ? 64.576 8.411   68.157  1.00 60.07 ? 118 PRO B CA  1 
ATOM   5589 C C   . PRO D 2 117 ? 66.038 7.979   68.053  1.00 60.55 ? 118 PRO B C   1 
ATOM   5590 O O   . PRO D 2 117 ? 66.478 7.087   68.777  1.00 60.78 ? 118 PRO B O   1 
ATOM   5591 C CB  . PRO D 2 117 ? 64.312 9.233   69.411  1.00 58.72 ? 118 PRO B CB  1 
ATOM   5592 C CG  . PRO D 2 117 ? 64.109 8.165   70.440  1.00 56.99 ? 118 PRO B CG  1 
ATOM   5593 C CD  . PRO D 2 117 ? 63.201 7.179   69.720  1.00 60.33 ? 118 PRO B CD  1 
ATOM   5594 N N   . THR D 2 118 ? 66.783 8.610   67.148  1.00 62.44 ? 119 THR B N   1 
ATOM   5595 C CA  . THR D 2 118 ? 68.203 8.304   66.968  1.00 64.47 ? 119 THR B CA  1 
ATOM   5596 C C   . THR D 2 118 ? 68.997 9.148   67.960  1.00 65.23 ? 119 THR B C   1 
ATOM   5597 O O   . THR D 2 118 ? 69.796 10.000  67.564  1.00 68.06 ? 119 THR B O   1 
ATOM   5598 C CB  . THR D 2 118 ? 68.685 8.647   65.539  1.00 65.33 ? 119 THR B CB  1 
ATOM   5599 O OG1 . THR D 2 118 ? 68.482 10.043  65.283  1.00 65.58 ? 119 THR B OG1 1 
ATOM   5600 C CG2 . THR D 2 118 ? 67.925 7.827   64.508  1.00 65.50 ? 119 THR B CG2 1 
ATOM   5601 N N   . VAL D 2 119 ? 68.771 8.895   69.249  1.00 64.18 ? 120 VAL B N   1 
ATOM   5602 C CA  . VAL D 2 119 ? 69.413 9.642   70.326  1.00 63.58 ? 120 VAL B CA  1 
ATOM   5603 C C   . VAL D 2 119 ? 70.884 9.975   70.101  1.00 63.45 ? 120 VAL B C   1 
ATOM   5604 O O   . VAL D 2 119 ? 71.648 9.169   69.573  1.00 65.22 ? 120 VAL B O   1 
ATOM   5605 C CB  . VAL D 2 119 ? 69.277 8.905   71.672  1.00 64.01 ? 120 VAL B CB  1 
ATOM   5606 C CG1 . VAL D 2 119 ? 69.749 9.811   72.808  1.00 65.21 ? 120 VAL B CG1 1 
ATOM   5607 C CG2 . VAL D 2 119 ? 67.831 8.485   71.891  1.00 62.17 ? 120 VAL B CG2 1 
ATOM   5608 N N   . SER D 2 120 ? 71.263 11.182  70.511  1.00 62.37 ? 121 SER B N   1 
ATOM   5609 C CA  . SER D 2 120 ? 72.632 11.669  70.381  1.00 60.56 ? 121 SER B CA  1 
ATOM   5610 C C   . SER D 2 120 ? 72.929 12.612  71.542  1.00 62.27 ? 121 SER B C   1 
ATOM   5611 O O   . SER D 2 120 ? 72.318 13.672  71.657  1.00 63.92 ? 121 SER B O   1 
ATOM   5612 C CB  . SER D 2 120 ? 72.813 12.420  69.059  1.00 54.82 ? 121 SER B CB  1 
ATOM   5613 O OG  . SER D 2 120 ? 72.571 11.577  67.951  1.00 54.20 ? 121 SER B OG  1 
ATOM   5614 N N   . ILE D 2 121 ? 73.864 12.223  72.401  1.00 61.49 ? 122 ILE B N   1 
ATOM   5615 C CA  . ILE D 2 121 ? 74.227 13.045  73.548  1.00 63.35 ? 122 ILE B CA  1 
ATOM   5616 C C   . ILE D 2 121 ? 75.558 13.753  73.301  1.00 64.02 ? 122 ILE B C   1 
ATOM   5617 O O   . ILE D 2 121 ? 76.426 13.233  72.598  1.00 65.09 ? 122 ILE B O   1 
ATOM   5618 C CB  . ILE D 2 121 ? 74.331 12.188  74.837  1.00 63.13 ? 122 ILE B CB  1 
ATOM   5619 C CG1 . ILE D 2 121 ? 74.536 13.094  76.054  1.00 64.47 ? 122 ILE B CG1 1 
ATOM   5620 C CG2 . ILE D 2 121 ? 75.477 11.193  74.714  1.00 59.55 ? 122 ILE B CG2 1 
ATOM   5621 C CD1 . ILE D 2 121 ? 74.595 12.350  77.371  1.00 62.31 ? 122 ILE B CD1 1 
ATOM   5622 N N   . PHE D 2 122 ? 75.708 14.947  73.868  1.00 61.69 ? 123 PHE B N   1 
ATOM   5623 C CA  . PHE D 2 122 ? 76.936 15.720  73.711  1.00 59.45 ? 123 PHE B CA  1 
ATOM   5624 C C   . PHE D 2 122 ? 77.347 16.337  75.042  1.00 60.09 ? 123 PHE B C   1 
ATOM   5625 O O   . PHE D 2 122 ? 76.508 16.835  75.797  1.00 61.48 ? 123 PHE B O   1 
ATOM   5626 C CB  . PHE D 2 122 ? 76.754 16.842  72.686  1.00 56.75 ? 123 PHE B CB  1 
ATOM   5627 C CG  . PHE D 2 122 ? 76.264 16.376  71.343  1.00 57.38 ? 123 PHE B CG  1 
ATOM   5628 C CD1 . PHE D 2 122 ? 74.951 15.945  71.176  1.00 53.14 ? 123 PHE B CD1 1 
ATOM   5629 C CD2 . PHE D 2 122 ? 77.111 16.390  70.237  1.00 54.70 ? 123 PHE B CD2 1 
ATOM   5630 C CE1 . PHE D 2 122 ? 74.487 15.539  69.924  1.00 53.59 ? 123 PHE B CE1 1 
ATOM   5631 C CE2 . PHE D 2 122 ? 76.655 15.986  68.982  1.00 54.13 ? 123 PHE B CE2 1 
ATOM   5632 C CZ  . PHE D 2 122 ? 75.339 15.560  68.827  1.00 50.14 ? 123 PHE B CZ  1 
ATOM   5633 N N   . PRO D 2 123 ? 78.649 16.300  75.353  1.00 59.90 ? 124 PRO B N   1 
ATOM   5634 C CA  . PRO D 2 123 ? 79.158 16.866  76.602  1.00 58.74 ? 124 PRO B CA  1 
ATOM   5635 C C   . PRO D 2 123 ? 79.442 18.352  76.431  1.00 57.31 ? 124 PRO B C   1 
ATOM   5636 O O   . PRO D 2 123 ? 79.564 18.843  75.309  1.00 56.12 ? 124 PRO B O   1 
ATOM   5637 C CB  . PRO D 2 123 ? 80.433 16.069  76.835  1.00 59.67 ? 124 PRO B CB  1 
ATOM   5638 C CG  . PRO D 2 123 ? 80.952 15.915  75.441  1.00 63.03 ? 124 PRO B CG  1 
ATOM   5639 C CD  . PRO D 2 123 ? 79.703 15.532  74.664  1.00 61.87 ? 124 PRO B CD  1 
ATOM   5640 N N   . PRO D 2 124 ? 79.547 19.090  77.545  1.00 57.44 ? 125 PRO B N   1 
ATOM   5641 C CA  . PRO D 2 124 ? 79.822 20.525  77.461  1.00 56.81 ? 125 PRO B CA  1 
ATOM   5642 C C   . PRO D 2 124 ? 80.995 20.786  76.524  1.00 56.91 ? 125 PRO B C   1 
ATOM   5643 O O   . PRO D 2 124 ? 81.976 20.044  76.524  1.00 56.31 ? 125 PRO B O   1 
ATOM   5644 C CB  . PRO D 2 124 ? 80.138 20.894  78.905  1.00 57.36 ? 125 PRO B CB  1 
ATOM   5645 C CG  . PRO D 2 124 ? 79.240 19.984  79.672  1.00 58.81 ? 125 PRO B CG  1 
ATOM   5646 C CD  . PRO D 2 124 ? 79.407 18.664  78.948  1.00 56.45 ? 125 PRO B CD  1 
ATOM   5647 N N   . SER D 2 125 ? 80.885 21.831  75.715  1.00 60.72 ? 126 SER B N   1 
ATOM   5648 C CA  . SER D 2 125 ? 81.948 22.180  74.783  1.00 60.57 ? 126 SER B CA  1 
ATOM   5649 C C   . SER D 2 125 ? 83.091 22.812  75.568  1.00 62.50 ? 126 SER B C   1 
ATOM   5650 O O   . SER D 2 125 ? 82.887 23.323  76.676  1.00 58.49 ? 126 SER B O   1 
ATOM   5651 C CB  . SER D 2 125 ? 81.432 23.175  73.743  1.00 63.31 ? 126 SER B CB  1 
ATOM   5652 O OG  . SER D 2 125 ? 81.092 24.415  74.349  1.00 62.34 ? 126 SER B OG  1 
ATOM   5653 N N   . SER D 2 126 ? 84.292 22.771  74.999  1.00 61.71 ? 127 SER B N   1 
ATOM   5654 C CA  . SER D 2 126 ? 85.448 23.357  75.663  1.00 64.90 ? 127 SER B CA  1 
ATOM   5655 C C   . SER D 2 126 ? 85.191 24.849  75.840  1.00 63.70 ? 127 SER B C   1 
ATOM   5656 O O   . SER D 2 126 ? 85.475 25.420  76.893  1.00 62.71 ? 127 SER B O   1 
ATOM   5657 C CB  . SER D 2 126 ? 86.713 23.138  74.827  1.00 66.96 ? 127 SER B CB  1 
ATOM   5658 O OG  . SER D 2 126 ? 86.562 23.675  73.524  1.00 66.83 ? 127 SER B OG  1 
ATOM   5659 N N   . GLU D 2 127 ? 84.640 25.469  74.801  1.00 63.95 ? 128 GLU B N   1 
ATOM   5660 C CA  . GLU D 2 127 ? 84.333 26.891  74.837  1.00 64.09 ? 128 GLU B CA  1 
ATOM   5661 C C   . GLU D 2 127 ? 83.441 27.228  76.025  1.00 63.93 ? 128 GLU B C   1 
ATOM   5662 O O   . GLU D 2 127 ? 83.807 28.049  76.865  1.00 66.53 ? 128 GLU B O   1 
ATOM   5663 C CB  . GLU D 2 127 ? 83.647 27.336  73.539  1.00 65.04 ? 128 GLU B CB  1 
ATOM   5664 C CG  . GLU D 2 127 ? 84.575 27.466  72.335  1.00 67.94 ? 128 GLU B CG  1 
ATOM   5665 C CD  . GLU D 2 127 ? 84.749 26.172  71.564  1.00 71.39 ? 128 GLU B CD  1 
ATOM   5666 O OE1 . GLU D 2 127 ? 85.040 25.131  72.191  1.00 71.49 ? 128 GLU B OE1 1 
ATOM   5667 O OE2 . GLU D 2 127 ? 84.600 26.202  70.322  1.00 73.44 ? 128 GLU B OE2 1 
ATOM   5668 N N   . GLN D 2 128 ? 82.274 26.594  76.100  1.00 63.08 ? 129 GLN B N   1 
ATOM   5669 C CA  . GLN D 2 128 ? 81.352 26.857  77.198  1.00 62.19 ? 129 GLN B CA  1 
ATOM   5670 C C   . GLN D 2 128 ? 82.030 26.641  78.546  1.00 64.45 ? 129 GLN B C   1 
ATOM   5671 O O   . GLN D 2 128 ? 81.741 27.342  79.519  1.00 65.85 ? 129 GLN B O   1 
ATOM   5672 C CB  . GLN D 2 128 ? 80.114 25.962  77.097  1.00 59.52 ? 129 GLN B CB  1 
ATOM   5673 C CG  . GLN D 2 128 ? 79.234 26.026  78.338  1.00 58.62 ? 129 GLN B CG  1 
ATOM   5674 C CD  . GLN D 2 128 ? 77.987 25.174  78.230  1.00 58.56 ? 129 GLN B CD  1 
ATOM   5675 O OE1 . GLN D 2 128 ? 78.049 24.007  77.840  1.00 58.89 ? 129 GLN B OE1 1 
ATOM   5676 N NE2 . GLN D 2 128 ? 76.844 25.750  78.591  1.00 55.61 ? 129 GLN B NE2 1 
ATOM   5677 N N   . LEU D 2 129 ? 82.932 25.669  78.605  1.00 65.38 ? 130 LEU B N   1 
ATOM   5678 C CA  . LEU D 2 129 ? 83.641 25.390  79.845  1.00 66.37 ? 130 LEU B CA  1 
ATOM   5679 C C   . LEU D 2 129 ? 84.547 26.553  80.239  1.00 67.69 ? 130 LEU B C   1 
ATOM   5680 O O   . LEU D 2 129 ? 84.580 26.955  81.404  1.00 67.38 ? 130 LEU B O   1 
ATOM   5681 C CB  . LEU D 2 129 ? 84.461 24.111  79.698  1.00 65.61 ? 130 LEU B CB  1 
ATOM   5682 C CG  . LEU D 2 129 ? 83.601 22.858  79.546  1.00 65.06 ? 130 LEU B CG  1 
ATOM   5683 C CD1 . LEU D 2 129 ? 84.481 21.665  79.229  1.00 65.58 ? 130 LEU B CD1 1 
ATOM   5684 C CD2 . LEU D 2 129 ? 82.803 22.633  80.823  1.00 64.20 ? 130 LEU B CD2 1 
ATOM   5685 N N   . THR D 2 130 ? 85.270 27.096  79.262  1.00 68.13 ? 131 THR B N   1 
ATOM   5686 C CA  . THR D 2 130 ? 86.170 28.214  79.515  1.00 68.93 ? 131 THR B CA  1 
ATOM   5687 C C   . THR D 2 130 ? 85.392 29.431  80.002  1.00 71.93 ? 131 THR B C   1 
ATOM   5688 O O   . THR D 2 130 ? 85.976 30.382  80.521  1.00 73.35 ? 131 THR B O   1 
ATOM   5689 C CB  . THR D 2 130 ? 86.961 28.612  78.247  1.00 68.71 ? 131 THR B CB  1 
ATOM   5690 O OG1 . THR D 2 130 ? 86.057 29.100  77.250  1.00 69.64 ? 131 THR B OG1 1 
ATOM   5691 C CG2 . THR D 2 130 ? 87.723 27.414  77.693  1.00 65.95 ? 131 THR B CG2 1 
ATOM   5692 N N   . SER D 2 131 ? 84.072 29.400  79.835  1.00 72.21 ? 132 SER B N   1 
ATOM   5693 C CA  . SER D 2 131 ? 83.232 30.510  80.269  1.00 72.80 ? 132 SER B CA  1 
ATOM   5694 C C   . SER D 2 131 ? 82.562 30.193  81.602  1.00 72.19 ? 132 SER B C   1 
ATOM   5695 O O   . SER D 2 131 ? 81.737 30.964  82.092  1.00 73.59 ? 132 SER B O   1 
ATOM   5696 C CB  . SER D 2 131 ? 82.167 30.822  79.214  1.00 74.38 ? 132 SER B CB  1 
ATOM   5697 O OG  . SER D 2 131 ? 81.193 29.796  79.147  1.00 76.18 ? 132 SER B OG  1 
ATOM   5698 N N   . GLY D 2 132 ? 82.913 29.048  82.179  1.00 71.83 ? 133 GLY B N   1 
ATOM   5699 C CA  . GLY D 2 132 ? 82.348 28.663  83.460  1.00 72.85 ? 133 GLY B CA  1 
ATOM   5700 C C   . GLY D 2 132 ? 81.057 27.864  83.400  1.00 73.73 ? 133 GLY B C   1 
ATOM   5701 O O   . GLY D 2 132 ? 80.648 27.270  84.401  1.00 73.49 ? 133 GLY B O   1 
ATOM   5702 N N   . GLY D 2 133 ? 80.411 27.846  82.238  1.00 72.04 ? 134 GLY B N   1 
ATOM   5703 C CA  . GLY D 2 133 ? 79.168 27.108  82.103  1.00 68.29 ? 134 GLY B CA  1 
ATOM   5704 C C   . GLY D 2 133 ? 79.389 25.674  81.665  1.00 66.64 ? 134 GLY B C   1 
ATOM   5705 O O   . GLY D 2 133 ? 80.422 25.348  81.078  1.00 65.83 ? 134 GLY B O   1 
ATOM   5706 N N   . ALA D 2 134 ? 78.414 24.815  81.947  1.00 66.33 ? 135 ALA B N   1 
ATOM   5707 C CA  . ALA D 2 134 ? 78.502 23.409  81.576  1.00 65.87 ? 135 ALA B CA  1 
ATOM   5708 C C   . ALA D 2 134 ? 77.119 22.797  81.374  1.00 64.52 ? 135 ALA B C   1 
ATOM   5709 O O   . ALA D 2 134 ? 76.465 22.382  82.330  1.00 65.59 ? 135 ALA B O   1 
ATOM   5710 C CB  . ALA D 2 134 ? 79.262 22.639  82.648  1.00 68.14 ? 135 ALA B CB  1 
ATOM   5711 N N   . SER D 2 135 ? 76.674 22.745  80.124  1.00 61.44 ? 136 SER B N   1 
ATOM   5712 C CA  . SER D 2 135 ? 75.370 22.173  79.811  1.00 59.62 ? 136 SER B CA  1 
ATOM   5713 C C   . SER D 2 135 ? 75.555 20.936  78.944  1.00 57.86 ? 136 SER B C   1 
ATOM   5714 O O   . SER D 2 135 ? 76.348 20.948  78.000  1.00 56.03 ? 136 SER B O   1 
ATOM   5715 C CB  . SER D 2 135 ? 74.504 23.187  79.059  1.00 57.06 ? 136 SER B CB  1 
ATOM   5716 O OG  . SER D 2 135 ? 75.007 23.411  77.755  1.00 58.10 ? 136 SER B OG  1 
ATOM   5717 N N   . VAL D 2 136 ? 74.836 19.868  79.274  1.00 55.52 ? 137 VAL B N   1 
ATOM   5718 C CA  . VAL D 2 136 ? 74.923 18.638  78.499  1.00 55.77 ? 137 VAL B CA  1 
ATOM   5719 C C   . VAL D 2 136 ? 73.664 18.528  77.653  1.00 54.72 ? 137 VAL B C   1 
ATOM   5720 O O   . VAL D 2 136 ? 72.548 18.616  78.168  1.00 53.32 ? 137 VAL B O   1 
ATOM   5721 C CB  . VAL D 2 136 ? 75.077 17.390  79.411  1.00 54.23 ? 137 VAL B CB  1 
ATOM   5722 C CG1 . VAL D 2 136 ? 73.903 17.271  80.350  1.00 57.95 ? 137 VAL B CG1 1 
ATOM   5723 C CG2 . VAL D 2 136 ? 75.211 16.143  78.562  1.00 55.46 ? 137 VAL B CG2 1 
ATOM   5724 N N   . VAL D 2 137 ? 73.854 18.344  76.350  1.00 54.45 ? 138 VAL B N   1 
ATOM   5725 C CA  . VAL D 2 137 ? 72.740 18.256  75.417  1.00 55.78 ? 138 VAL B CA  1 
ATOM   5726 C C   . VAL D 2 137 ? 72.633 16.923  74.698  1.00 60.83 ? 138 VAL B C   1 
ATOM   5727 O O   . VAL D 2 137 ? 73.639 16.326  74.317  1.00 62.40 ? 138 VAL B O   1 
ATOM   5728 C CB  . VAL D 2 137 ? 72.847 19.348  74.332  1.00 54.40 ? 138 VAL B CB  1 
ATOM   5729 C CG1 . VAL D 2 137 ? 71.672 19.250  73.376  1.00 58.46 ? 138 VAL B CG1 1 
ATOM   5730 C CG2 . VAL D 2 137 ? 72.909 20.725  74.977  1.00 54.88 ? 138 VAL B CG2 1 
ATOM   5731 N N   . CYS D 2 138 ? 71.402 16.459  74.513  1.00 61.70 ? 139 CYS B N   1 
ATOM   5732 C CA  . CYS D 2 138 ? 71.167 15.225  73.785  1.00 61.42 ? 139 CYS B CA  1 
ATOM   5733 C C   . CYS D 2 138 ? 69.844 15.295  73.044  1.00 58.76 ? 139 CYS B C   1 
ATOM   5734 O O   . CYS D 2 138 ? 68.810 15.674  73.604  1.00 56.75 ? 139 CYS B O   1 
ATOM   5735 C CB  . CYS D 2 138 ? 71.219 14.006  74.712  1.00 66.01 ? 139 CYS B CB  1 
ATOM   5736 S SG  . CYS D 2 138 ? 70.082 13.964  76.130  1.00 74.93 ? 139 CYS B SG  1 
ATOM   5737 N N   . PHE D 2 139 ? 69.902 14.955  71.762  1.00 55.57 ? 140 PHE B N   1 
ATOM   5738 C CA  . PHE D 2 139 ? 68.731 14.975  70.907  1.00 51.36 ? 140 PHE B CA  1 
ATOM   5739 C C   . PHE D 2 139 ? 68.056 13.611  70.826  1.00 52.01 ? 140 PHE B C   1 
ATOM   5740 O O   . PHE D 2 139 ? 68.692 12.567  71.011  1.00 50.17 ? 140 PHE B O   1 
ATOM   5741 C CB  . PHE D 2 139 ? 69.122 15.406  69.495  1.00 50.99 ? 140 PHE B CB  1 
ATOM   5742 C CG  . PHE D 2 139 ? 69.877 16.698  69.440  1.00 53.17 ? 140 PHE B CG  1 
ATOM   5743 C CD1 . PHE D 2 139 ? 69.328 17.862  69.962  1.00 52.02 ? 140 PHE B CD1 1 
ATOM   5744 C CD2 . PHE D 2 139 ? 71.138 16.753  68.853  1.00 53.73 ? 140 PHE B CD2 1 
ATOM   5745 C CE1 . PHE D 2 139 ? 70.022 19.060  69.906  1.00 52.49 ? 140 PHE B CE1 1 
ATOM   5746 C CE2 . PHE D 2 139 ? 71.841 17.948  68.792  1.00 54.89 ? 140 PHE B CE2 1 
ATOM   5747 C CZ  . PHE D 2 139 ? 71.279 19.105  69.320  1.00 54.86 ? 140 PHE B CZ  1 
ATOM   5748 N N   . LEU D 2 140 ? 66.756 13.648  70.560  1.00 50.94 ? 141 LEU B N   1 
ATOM   5749 C CA  . LEU D 2 140 ? 65.926 12.462  70.377  1.00 49.53 ? 141 LEU B CA  1 
ATOM   5750 C C   . LEU D 2 140 ? 65.184 12.852  69.102  1.00 51.00 ? 141 LEU B C   1 
ATOM   5751 O O   . LEU D 2 140 ? 64.090 13.423  69.147  1.00 49.38 ? 141 LEU B O   1 
ATOM   5752 C CB  . LEU D 2 140 ? 64.948 12.279  71.539  1.00 47.71 ? 141 LEU B CB  1 
ATOM   5753 C CG  . LEU D 2 140 ? 65.561 11.981  72.907  1.00 49.84 ? 141 LEU B CG  1 
ATOM   5754 C CD1 . LEU D 2 140 ? 66.250 13.218  73.446  1.00 48.84 ? 141 LEU B CD1 1 
ATOM   5755 C CD2 . LEU D 2 140 ? 64.475 11.536  73.857  1.00 48.47 ? 141 LEU B CD2 1 
ATOM   5756 N N   . ASN D 2 141 ? 65.811 12.565  67.966  1.00 49.43 ? 142 ASN B N   1 
ATOM   5757 C CA  . ASN D 2 141 ? 65.267 12.938  66.673  1.00 48.80 ? 142 ASN B CA  1 
ATOM   5758 C C   . ASN D 2 141 ? 64.506 11.888  65.881  1.00 51.42 ? 142 ASN B C   1 
ATOM   5759 O O   . ASN D 2 141 ? 64.757 10.687  65.986  1.00 52.41 ? 142 ASN B O   1 
ATOM   5760 C CB  . ASN D 2 141 ? 66.396 13.486  65.804  1.00 50.80 ? 142 ASN B CB  1 
ATOM   5761 C CG  . ASN D 2 141 ? 67.085 14.690  66.431  1.00 52.19 ? 142 ASN B CG  1 
ATOM   5762 O OD1 . ASN D 2 141 ? 68.099 15.168  65.927  1.00 51.96 ? 142 ASN B OD1 1 
ATOM   5763 N ND2 . ASN D 2 141 ? 66.531 15.187  67.531  1.00 47.41 ? 142 ASN B ND2 1 
ATOM   5764 N N   . ASN D 2 142 ? 63.569 12.388  65.079  1.00 52.96 ? 143 ASN B N   1 
ATOM   5765 C CA  . ASN D 2 142 ? 62.733 11.593  64.186  1.00 51.96 ? 143 ASN B CA  1 
ATOM   5766 C C   . ASN D 2 142 ? 62.005 10.397  64.782  1.00 49.31 ? 143 ASN B C   1 
ATOM   5767 O O   . ASN D 2 142 ? 62.170 9.267   64.324  1.00 47.89 ? 143 ASN B O   1 
ATOM   5768 C CB  . ASN D 2 142 ? 63.572 11.148  62.989  1.00 50.81 ? 143 ASN B CB  1 
ATOM   5769 C CG  . ASN D 2 142 ? 64.424 12.271  62.444  1.00 50.98 ? 143 ASN B CG  1 
ATOM   5770 O OD1 . ASN D 2 142 ? 65.370 12.714  63.094  1.00 55.83 ? 143 ASN B OD1 1 
ATOM   5771 N ND2 . ASN D 2 142 ? 64.089 12.747  61.252  1.00 50.06 ? 143 ASN B ND2 1 
ATOM   5772 N N   . PHE D 2 143 ? 61.191 10.653  65.801  1.00 46.68 ? 144 PHE B N   1 
ATOM   5773 C CA  . PHE D 2 143 ? 60.414 9.594   66.422  1.00 49.61 ? 144 PHE B CA  1 
ATOM   5774 C C   . PHE D 2 143 ? 58.931 9.803   66.136  1.00 51.20 ? 144 PHE B C   1 
ATOM   5775 O O   . PHE D 2 143 ? 58.531 10.845  65.618  1.00 52.18 ? 144 PHE B O   1 
ATOM   5776 C CB  . PHE D 2 143 ? 60.645 9.549   67.935  1.00 48.70 ? 144 PHE B CB  1 
ATOM   5777 C CG  . PHE D 2 143 ? 60.392 10.853  68.641  1.00 47.53 ? 144 PHE B CG  1 
ATOM   5778 C CD1 . PHE D 2 143 ? 61.381 11.831  68.704  1.00 43.80 ? 144 PHE B CD1 1 
ATOM   5779 C CD2 . PHE D 2 143 ? 59.179 11.088  69.279  1.00 45.63 ? 144 PHE B CD2 1 
ATOM   5780 C CE1 . PHE D 2 143 ? 61.171 13.019  69.394  1.00 40.59 ? 144 PHE B CE1 1 
ATOM   5781 C CE2 . PHE D 2 143 ? 58.956 12.279  69.973  1.00 48.38 ? 144 PHE B CE2 1 
ATOM   5782 C CZ  . PHE D 2 143 ? 59.957 13.244  70.031  1.00 44.29 ? 144 PHE B CZ  1 
ATOM   5783 N N   . TYR D 2 144 ? 58.123 8.800   66.468  1.00 52.93 ? 145 TYR B N   1 
ATOM   5784 C CA  . TYR D 2 144 ? 56.681 8.864   66.260  1.00 52.27 ? 145 TYR B CA  1 
ATOM   5785 C C   . TYR D 2 144 ? 56.004 7.780   67.093  1.00 55.24 ? 145 TYR B C   1 
ATOM   5786 O O   . TYR D 2 144 ? 56.436 6.627   67.082  1.00 55.54 ? 145 TYR B O   1 
ATOM   5787 C CB  . TYR D 2 144 ? 56.337 8.643   64.789  1.00 51.25 ? 145 TYR B CB  1 
ATOM   5788 C CG  . TYR D 2 144 ? 54.876 8.874   64.504  1.00 53.15 ? 145 TYR B CG  1 
ATOM   5789 C CD1 . TYR D 2 144 ? 54.417 10.120  64.070  1.00 52.27 ? 145 TYR B CD1 1 
ATOM   5790 C CD2 . TYR D 2 144 ? 53.937 7.871   64.739  1.00 53.39 ? 145 TYR B CD2 1 
ATOM   5791 C CE1 . TYR D 2 144 ? 53.057 10.361  63.881  1.00 49.59 ? 145 TYR B CE1 1 
ATOM   5792 C CE2 . TYR D 2 144 ? 52.575 8.102   64.557  1.00 50.49 ? 145 TYR B CE2 1 
ATOM   5793 C CZ  . TYR D 2 144 ? 52.142 9.348   64.129  1.00 51.63 ? 145 TYR B CZ  1 
ATOM   5794 O OH  . TYR D 2 144 ? 50.795 9.583   63.970  1.00 52.83 ? 145 TYR B OH  1 
ATOM   5795 N N   . PRO D 2 145 ? 54.922 8.124   67.812  1.00 56.10 ? 146 PRO B N   1 
ATOM   5796 C CA  . PRO D 2 145 ? 54.264 9.433   67.926  1.00 56.32 ? 146 PRO B CA  1 
ATOM   5797 C C   . PRO D 2 145 ? 55.075 10.440  68.745  1.00 58.73 ? 146 PRO B C   1 
ATOM   5798 O O   . PRO D 2 145 ? 56.134 10.109  69.281  1.00 56.34 ? 146 PRO B O   1 
ATOM   5799 C CB  . PRO D 2 145 ? 52.934 9.095   68.606  1.00 58.14 ? 146 PRO B CB  1 
ATOM   5800 C CG  . PRO D 2 145 ? 52.729 7.638   68.294  1.00 58.90 ? 146 PRO B CG  1 
ATOM   5801 C CD  . PRO D 2 145 ? 54.112 7.089   68.469  1.00 56.69 ? 146 PRO B CD  1 
ATOM   5802 N N   . LYS D 2 146 ? 54.562 11.661  68.863  1.00 60.73 ? 147 LYS B N   1 
ATOM   5803 C CA  . LYS D 2 146 ? 55.263 12.705  69.601  1.00 65.13 ? 147 LYS B CA  1 
ATOM   5804 C C   . LYS D 2 146 ? 55.299 12.494  71.112  1.00 66.24 ? 147 LYS B C   1 
ATOM   5805 O O   . LYS D 2 146 ? 55.806 13.343  71.846  1.00 67.82 ? 147 LYS B O   1 
ATOM   5806 C CB  . LYS D 2 146 ? 54.658 14.082  69.295  1.00 65.41 ? 147 LYS B CB  1 
ATOM   5807 C CG  . LYS D 2 146 ? 53.236 14.299  69.791  1.00 70.67 ? 147 LYS B CG  1 
ATOM   5808 C CD  . LYS D 2 146 ? 52.216 13.594  68.914  1.00 73.95 ? 147 LYS B CD  1 
ATOM   5809 C CE  . LYS D 2 146 ? 50.798 13.992  69.290  1.00 72.14 ? 147 LYS B CE  1 
ATOM   5810 N NZ  . LYS D 2 146 ? 49.795 13.365  68.382  1.00 76.17 ? 147 LYS B NZ  1 
ATOM   5811 N N   . ASP D 2 147 ? 54.775 11.367  71.579  1.00 65.23 ? 148 ASP B N   1 
ATOM   5812 C CA  . ASP D 2 147 ? 54.770 11.080  73.009  1.00 68.01 ? 148 ASP B CA  1 
ATOM   5813 C C   . ASP D 2 147 ? 56.070 10.408  73.440  1.00 67.44 ? 148 ASP B C   1 
ATOM   5814 O O   . ASP D 2 147 ? 56.457 9.375   72.896  1.00 63.86 ? 148 ASP B O   1 
ATOM   5815 C CB  . ASP D 2 147 ? 53.585 10.182  73.363  1.00 72.08 ? 148 ASP B CB  1 
ATOM   5816 C CG  . ASP D 2 147 ? 52.257 10.799  72.980  1.00 77.17 ? 148 ASP B CG  1 
ATOM   5817 O OD1 . ASP D 2 147 ? 51.920 11.873  73.526  1.00 78.04 ? 148 ASP B OD1 1 
ATOM   5818 O OD2 . ASP D 2 147 ? 51.555 10.213  72.128  1.00 78.37 ? 148 ASP B OD2 1 
ATOM   5819 N N   . ILE D 2 148 ? 56.737 11.006  74.423  1.00 68.18 ? 149 ILE B N   1 
ATOM   5820 C CA  . ILE D 2 148 ? 57.998 10.484  74.946  1.00 70.32 ? 149 ILE B CA  1 
ATOM   5821 C C   . ILE D 2 148 ? 58.263 11.210  76.274  1.00 71.72 ? 149 ILE B C   1 
ATOM   5822 O O   . ILE D 2 148 ? 57.575 12.186  76.583  1.00 72.64 ? 149 ILE B O   1 
ATOM   5823 C CB  . ILE D 2 148 ? 59.146 10.736  73.932  1.00 68.00 ? 149 ILE B CB  1 
ATOM   5824 C CG1 . ILE D 2 148 ? 60.294 9.764   74.181  1.00 64.53 ? 149 ILE B CG1 1 
ATOM   5825 C CG2 . ILE D 2 148 ? 59.630 12.175  74.035  1.00 68.46 ? 149 ILE B CG2 1 
ATOM   5826 C CD1 . ILE D 2 148 ? 61.301 9.735   73.055  1.00 65.44 ? 149 ILE B CD1 1 
ATOM   5827 N N   . ASN D 2 149 ? 59.240 10.757  77.060  1.00 70.98 ? 150 ASN B N   1 
ATOM   5828 C CA  . ASN D 2 149 ? 59.496 11.406  78.348  1.00 72.41 ? 150 ASN B CA  1 
ATOM   5829 C C   . ASN D 2 149 ? 60.885 12.006  78.585  1.00 71.49 ? 150 ASN B C   1 
ATOM   5830 O O   . ASN D 2 149 ? 60.994 13.169  78.977  1.00 73.85 ? 150 ASN B O   1 
ATOM   5831 C CB  . ASN D 2 149 ? 59.168 10.439  79.486  1.00 74.62 ? 150 ASN B CB  1 
ATOM   5832 C CG  . ASN D 2 149 ? 59.993 9.175   79.428  1.00 76.66 ? 150 ASN B CG  1 
ATOM   5833 O OD1 . ASN D 2 149 ? 59.964 8.454   78.435  1.00 78.54 ? 150 ASN B OD1 1 
ATOM   5834 N ND2 . ASN D 2 149 ? 60.734 8.898   80.496  1.00 78.76 ? 150 ASN B ND2 1 
ATOM   5835 N N   . VAL D 2 150 ? 61.934 11.214  78.368  1.00 70.78 ? 151 VAL B N   1 
ATOM   5836 C CA  . VAL D 2 150 ? 63.318 11.664  78.563  1.00 69.94 ? 151 VAL B CA  1 
ATOM   5837 C C   . VAL D 2 150 ? 63.697 11.749  80.041  1.00 70.45 ? 151 VAL B C   1 
ATOM   5838 O O   . VAL D 2 150 ? 62.996 12.375  80.836  1.00 70.49 ? 151 VAL B O   1 
ATOM   5839 C CB  . VAL D 2 150 ? 63.561 13.051  77.927  1.00 68.54 ? 151 VAL B CB  1 
ATOM   5840 C CG1 . VAL D 2 150 ? 65.016 13.456  78.101  1.00 68.32 ? 151 VAL B CG1 1 
ATOM   5841 C CG2 . VAL D 2 150 ? 63.187 13.018  76.459  1.00 69.87 ? 151 VAL B CG2 1 
ATOM   5842 N N   . LYS D 2 151 ? 64.814 11.122  80.404  1.00 69.29 ? 152 LYS B N   1 
ATOM   5843 C CA  . LYS D 2 151 ? 65.274 11.129  81.791  1.00 69.63 ? 152 LYS B CA  1 
ATOM   5844 C C   . LYS D 2 151 ? 66.793 11.264  81.883  1.00 68.85 ? 152 LYS B C   1 
ATOM   5845 O O   . LYS D 2 151 ? 67.525 10.633  81.118  1.00 68.20 ? 152 LYS B O   1 
ATOM   5846 C CB  . LYS D 2 151 ? 64.824 9.847   82.501  1.00 68.61 ? 152 LYS B CB  1 
ATOM   5847 C CG  . LYS D 2 151 ? 65.027 9.873   84.005  1.00 71.58 ? 152 LYS B CG  1 
ATOM   5848 C CD  . LYS D 2 151 ? 64.439 8.645   84.686  1.00 74.13 ? 152 LYS B CD  1 
ATOM   5849 C CE  . LYS D 2 151 ? 65.205 7.378   84.329  1.00 77.74 ? 152 LYS B CE  1 
ATOM   5850 N NZ  . LYS D 2 151 ? 64.681 6.188   85.059  1.00 77.68 ? 152 LYS B NZ  1 
ATOM   5851 N N   . TRP D 2 152 ? 67.258 12.093  82.818  1.00 67.81 ? 153 TRP B N   1 
ATOM   5852 C CA  . TRP D 2 152 ? 68.691 12.314  83.018  1.00 67.88 ? 153 TRP B CA  1 
ATOM   5853 C C   . TRP D 2 152 ? 69.233 11.616  84.264  1.00 70.32 ? 153 TRP B C   1 
ATOM   5854 O O   . TRP D 2 152 ? 68.570 11.563  85.300  1.00 71.28 ? 153 TRP B O   1 
ATOM   5855 C CB  . TRP D 2 152 ? 69.006 13.810  83.128  1.00 62.80 ? 153 TRP B CB  1 
ATOM   5856 C CG  . TRP D 2 152 ? 68.954 14.563  81.830  1.00 59.23 ? 153 TRP B CG  1 
ATOM   5857 C CD1 . TRP D 2 152 ? 67.890 15.257  81.322  1.00 56.71 ? 153 TRP B CD1 1 
ATOM   5858 C CD2 . TRP D 2 152 ? 70.021 14.714  80.884  1.00 56.58 ? 153 TRP B CD2 1 
ATOM   5859 N NE1 . TRP D 2 152 ? 68.232 15.836  80.121  1.00 51.96 ? 153 TRP B NE1 1 
ATOM   5860 C CE2 . TRP D 2 152 ? 69.532 15.519  79.828  1.00 51.61 ? 153 TRP B CE2 1 
ATOM   5861 C CE3 . TRP D 2 152 ? 71.343 14.250  80.825  1.00 51.08 ? 153 TRP B CE3 1 
ATOM   5862 C CZ2 . TRP D 2 152 ? 70.320 15.867  78.728  1.00 49.90 ? 153 TRP B CZ2 1 
ATOM   5863 C CZ3 . TRP D 2 152 ? 72.125 14.596  79.730  1.00 49.57 ? 153 TRP B CZ3 1 
ATOM   5864 C CH2 . TRP D 2 152 ? 71.610 15.399  78.697  1.00 51.01 ? 153 TRP B CH2 1 
ATOM   5865 N N   . LYS D 2 153 ? 70.447 11.086  84.154  1.00 71.84 ? 154 LYS B N   1 
ATOM   5866 C CA  . LYS D 2 153 ? 71.096 10.408  85.268  1.00 73.40 ? 154 LYS B CA  1 
ATOM   5867 C C   . LYS D 2 153 ? 72.540 10.869  85.413  1.00 75.75 ? 154 LYS B C   1 
ATOM   5868 O O   . LYS D 2 153 ? 73.385 10.571  84.566  1.00 78.15 ? 154 LYS B O   1 
ATOM   5869 C CB  . LYS D 2 153 ? 71.078 8.890   85.071  1.00 73.28 ? 154 LYS B CB  1 
ATOM   5870 C CG  . LYS D 2 153 ? 69.739 8.229   85.314  1.00 69.02 ? 154 LYS B CG  1 
ATOM   5871 C CD  . LYS D 2 153 ? 69.855 6.729   85.111  1.00 71.02 ? 154 LYS B CD  1 
ATOM   5872 C CE  . LYS D 2 153 ? 68.527 6.025   85.336  1.00 72.89 ? 154 LYS B CE  1 
ATOM   5873 N NZ  . LYS D 2 153 ? 68.646 4.559   85.100  1.00 72.28 ? 154 LYS B NZ  1 
ATOM   5874 N N   . ILE D 2 154 ? 72.818 11.601  86.486  1.00 76.68 ? 155 ILE B N   1 
ATOM   5875 C CA  . ILE D 2 154 ? 74.164 12.088  86.753  1.00 76.78 ? 155 ILE B CA  1 
ATOM   5876 C C   . ILE D 2 154 ? 74.842 11.122  87.719  1.00 77.61 ? 155 ILE B C   1 
ATOM   5877 O O   . ILE D 2 154 ? 74.447 11.003  88.880  1.00 78.21 ? 155 ILE B O   1 
ATOM   5878 C CB  . ILE D 2 154 ? 74.128 13.505  87.357  1.00 77.71 ? 155 ILE B CB  1 
ATOM   5879 C CG1 . ILE D 2 154 ? 73.152 13.547  88.534  1.00 78.35 ? 155 ILE B CG1 1 
ATOM   5880 C CG2 . ILE D 2 154 ? 73.703 14.506  86.293  1.00 78.26 ? 155 ILE B CG2 1 
ATOM   5881 C CD1 . ILE D 2 154 ? 73.052 14.905  89.203  1.00 80.30 ? 155 ILE B CD1 1 
ATOM   5882 N N   . ASP D 2 155 ? 75.859 10.424  87.227  1.00 78.60 ? 156 ASP B N   1 
ATOM   5883 C CA  . ASP D 2 155 ? 76.583 9.449   88.034  1.00 79.42 ? 156 ASP B CA  1 
ATOM   5884 C C   . ASP D 2 155 ? 75.618 8.408   88.593  1.00 79.51 ? 156 ASP B C   1 
ATOM   5885 O O   . ASP D 2 155 ? 75.680 8.054   89.771  1.00 80.84 ? 156 ASP B O   1 
ATOM   5886 C CB  . ASP D 2 155 ? 77.330 10.141  89.179  1.00 79.19 ? 156 ASP B CB  1 
ATOM   5887 C CG  . ASP D 2 155 ? 78.605 10.828  88.715  1.00 81.28 ? 156 ASP B CG  1 
ATOM   5888 O OD1 . ASP D 2 155 ? 79.263 11.487  89.548  1.00 80.62 ? 156 ASP B OD1 1 
ATOM   5889 O OD2 . ASP D 2 155 ? 78.955 10.705  87.522  1.00 80.71 ? 156 ASP B OD2 1 
ATOM   5890 N N   . GLY D 2 156 ? 74.721 7.927   87.736  1.00 78.07 ? 157 GLY B N   1 
ATOM   5891 C CA  . GLY D 2 156 ? 73.757 6.922   88.147  1.00 77.40 ? 157 GLY B CA  1 
ATOM   5892 C C   . GLY D 2 156 ? 72.596 7.446   88.972  1.00 77.29 ? 157 GLY B C   1 
ATOM   5893 O O   . GLY D 2 156 ? 71.744 6.669   89.401  1.00 75.93 ? 157 GLY B O   1 
ATOM   5894 N N   . SER D 2 157 ? 72.552 8.755   89.200  1.00 77.57 ? 158 SER B N   1 
ATOM   5895 C CA  . SER D 2 157 ? 71.472 9.344   89.984  1.00 77.20 ? 158 SER B CA  1 
ATOM   5896 C C   . SER D 2 157 ? 70.487 10.098  89.094  1.00 77.98 ? 158 SER B C   1 
ATOM   5897 O O   . SER D 2 157 ? 70.846 10.581  88.023  1.00 75.58 ? 158 SER B O   1 
ATOM   5898 C CB  . SER D 2 157 ? 72.039 10.290  91.047  1.00 76.34 ? 158 SER B CB  1 
ATOM   5899 O OG  . SER D 2 157 ? 71.009 10.788  91.885  1.00 72.00 ? 158 SER B OG  1 
ATOM   5900 N N   . GLU D 2 158 ? 69.243 10.199  89.550  1.00 80.08 ? 159 GLU B N   1 
ATOM   5901 C CA  . GLU D 2 158 ? 68.200 10.881  88.795  1.00 80.98 ? 159 GLU B CA  1 
ATOM   5902 C C   . GLU D 2 158 ? 68.230 12.392  88.999  1.00 79.64 ? 159 GLU B C   1 
ATOM   5903 O O   . GLU D 2 158 ? 67.977 12.887  90.096  1.00 80.34 ? 159 GLU B O   1 
ATOM   5904 C CB  . GLU D 2 158 ? 66.825 10.335  89.195  1.00 84.05 ? 159 GLU B CB  1 
ATOM   5905 C CG  . GLU D 2 158 ? 66.691 8.823   89.033  1.00 88.45 ? 159 GLU B CG  1 
ATOM   5906 C CD  . GLU D 2 158 ? 65.330 8.295   89.460  1.00 90.61 ? 159 GLU B CD  1 
ATOM   5907 O OE1 . GLU D 2 158 ? 65.111 7.067   89.355  1.00 90.94 ? 159 GLU B OE1 1 
ATOM   5908 O OE2 . GLU D 2 158 ? 64.481 9.102   89.900  1.00 90.24 ? 159 GLU B OE2 1 
ATOM   5909 N N   . ARG D 2 159 ? 68.545 13.116  87.931  1.00 79.08 ? 160 ARG B N   1 
ATOM   5910 C CA  . ARG D 2 159 ? 68.601 14.573  87.968  1.00 79.07 ? 160 ARG B CA  1 
ATOM   5911 C C   . ARG D 2 159 ? 67.608 15.168  86.975  1.00 79.94 ? 160 ARG B C   1 
ATOM   5912 O O   . ARG D 2 159 ? 67.734 14.975  85.763  1.00 80.50 ? 160 ARG B O   1 
ATOM   5913 C CB  . ARG D 2 159 ? 70.014 15.062  87.635  1.00 79.23 ? 160 ARG B CB  1 
ATOM   5914 C CG  . ARG D 2 159 ? 70.101 16.556  87.337  1.00 81.09 ? 160 ARG B CG  1 
ATOM   5915 C CD  . ARG D 2 159 ? 69.634 17.401  88.514  1.00 83.27 ? 160 ARG B CD  1 
ATOM   5916 N NE  . ARG D 2 159 ? 70.607 17.418  89.605  1.00 89.37 ? 160 ARG B NE  1 
ATOM   5917 C CZ  . ARG D 2 159 ? 71.820 17.956  89.515  1.00 89.49 ? 160 ARG B CZ  1 
ATOM   5918 N NH1 . ARG D 2 159 ? 72.215 18.525  88.384  1.00 90.61 ? 160 ARG B NH1 1 
ATOM   5919 N NH2 . ARG D 2 159 ? 72.641 17.926  90.556  1.00 89.99 ? 160 ARG B NH2 1 
ATOM   5920 N N   . GLN D 2 160 ? 66.620 15.891  87.492  1.00 79.79 ? 161 GLN B N   1 
ATOM   5921 C CA  . GLN D 2 160 ? 65.609 16.514  86.645  1.00 80.83 ? 161 GLN B CA  1 
ATOM   5922 C C   . GLN D 2 160 ? 65.538 17.999  86.955  1.00 79.51 ? 161 GLN B C   1 
ATOM   5923 O O   . GLN D 2 160 ? 64.705 18.722  86.412  1.00 79.71 ? 161 GLN B O   1 
ATOM   5924 C CB  . GLN D 2 160 ? 64.238 15.878  86.895  1.00 81.47 ? 161 GLN B CB  1 
ATOM   5925 C CG  . GLN D 2 160 ? 63.698 16.105  88.299  1.00 82.47 ? 161 GLN B CG  1 
ATOM   5926 C CD  . GLN D 2 160 ? 62.312 15.521  88.496  1.00 83.64 ? 161 GLN B CD  1 
ATOM   5927 O OE1 . GLN D 2 160 ? 62.104 14.317  88.336  1.00 84.83 ? 161 GLN B OE1 1 
ATOM   5928 N NE2 . GLN D 2 160 ? 61.355 16.373  88.845  1.00 82.52 ? 161 GLN B NE2 1 
ATOM   5929 N N   . ASN D 2 161 ? 66.424 18.447  87.835  1.00 79.83 ? 162 ASN B N   1 
ATOM   5930 C CA  . ASN D 2 161 ? 66.462 19.841  88.241  1.00 77.51 ? 162 ASN B CA  1 
ATOM   5931 C C   . ASN D 2 161 ? 66.659 20.813  87.084  1.00 76.18 ? 162 ASN B C   1 
ATOM   5932 O O   . ASN D 2 161 ? 65.693 21.379  86.572  1.00 75.90 ? 162 ASN B O   1 
ATOM   5933 C CB  . ASN D 2 161 ? 67.562 20.050  89.281  1.00 77.93 ? 162 ASN B CB  1 
ATOM   5934 C CG  . ASN D 2 161 ? 67.767 21.510  89.621  1.00 81.50 ? 162 ASN B CG  1 
ATOM   5935 O OD1 . ASN D 2 161 ? 66.824 22.213  89.991  1.00 80.89 ? 162 ASN B OD1 1 
ATOM   5936 N ND2 . ASN D 2 161 ? 69.005 21.977  89.497  1.00 83.00 ? 162 ASN B ND2 1 
ATOM   5937 N N   . GLY D 2 162 ? 67.908 21.006  86.674  1.00 74.82 ? 163 GLY B N   1 
ATOM   5938 C CA  . GLY D 2 162 ? 68.194 21.935  85.594  1.00 73.78 ? 163 GLY B CA  1 
ATOM   5939 C C   . GLY D 2 162 ? 68.027 21.397  84.183  1.00 73.06 ? 163 GLY B C   1 
ATOM   5940 O O   . GLY D 2 162 ? 68.867 21.652  83.317  1.00 73.59 ? 163 GLY B O   1 
ATOM   5941 N N   . VAL D 2 163 ? 66.944 20.665  83.939  1.00 70.51 ? 164 VAL B N   1 
ATOM   5942 C CA  . VAL D 2 163 ? 66.696 20.109  82.615  1.00 68.00 ? 164 VAL B CA  1 
ATOM   5943 C C   . VAL D 2 163 ? 65.627 20.877  81.842  1.00 66.19 ? 164 VAL B C   1 
ATOM   5944 O O   . VAL D 2 163 ? 64.541 21.143  82.358  1.00 66.15 ? 164 VAL B O   1 
ATOM   5945 C CB  . VAL D 2 163 ? 66.264 18.626  82.693  1.00 69.45 ? 164 VAL B CB  1 
ATOM   5946 C CG1 . VAL D 2 163 ? 64.989 18.493  83.511  1.00 68.73 ? 164 VAL B CG1 1 
ATOM   5947 C CG2 . VAL D 2 163 ? 66.050 18.075  81.284  1.00 69.35 ? 164 VAL B CG2 1 
ATOM   5948 N N   . LEU D 2 164 ? 65.948 21.235  80.603  1.00 62.57 ? 165 LEU B N   1 
ATOM   5949 C CA  . LEU D 2 164 ? 65.012 21.951  79.750  1.00 60.11 ? 165 LEU B CA  1 
ATOM   5950 C C   . LEU D 2 164 ? 64.795 21.182  78.449  1.00 59.00 ? 165 LEU B C   1 
ATOM   5951 O O   . LEU D 2 164 ? 65.753 20.769  77.791  1.00 59.57 ? 165 LEU B O   1 
ATOM   5952 C CB  . LEU D 2 164 ? 65.520 23.364  79.456  1.00 60.68 ? 165 LEU B CB  1 
ATOM   5953 C CG  . LEU D 2 164 ? 65.460 24.350  80.630  1.00 65.06 ? 165 LEU B CG  1 
ATOM   5954 C CD1 . LEU D 2 164 ? 66.492 23.968  81.687  1.00 66.40 ? 165 LEU B CD1 1 
ATOM   5955 C CD2 . LEU D 2 164 ? 65.722 25.762  80.126  1.00 65.47 ? 165 LEU B CD2 1 
ATOM   5956 N N   . ASN D 2 165 ? 63.529 20.990  78.087  1.00 56.32 ? 166 ASN B N   1 
ATOM   5957 C CA  . ASN D 2 165 ? 63.177 20.257  76.873  1.00 54.22 ? 166 ASN B CA  1 
ATOM   5958 C C   . ASN D 2 165 ? 62.452 21.130  75.849  1.00 53.61 ? 166 ASN B C   1 
ATOM   5959 O O   . ASN D 2 165 ? 61.670 22.015  76.207  1.00 54.65 ? 166 ASN B O   1 
ATOM   5960 C CB  . ASN D 2 165 ? 62.312 19.062  77.246  1.00 52.05 ? 166 ASN B CB  1 
ATOM   5961 C CG  . ASN D 2 165 ? 63.016 18.114  78.192  1.00 56.37 ? 166 ASN B CG  1 
ATOM   5962 O OD1 . ASN D 2 165 ? 62.378 17.403  78.965  1.00 59.72 ? 166 ASN B OD1 1 
ATOM   5963 N ND2 . ASN D 2 165 ? 64.344 18.090  78.127  1.00 56.52 ? 166 ASN B ND2 1 
ATOM   5964 N N   . SER D 2 166 ? 62.727 20.876  74.574  1.00 50.12 ? 167 SER B N   1 
ATOM   5965 C CA  . SER D 2 166 ? 62.117 21.630  73.486  1.00 48.25 ? 167 SER B CA  1 
ATOM   5966 C C   . SER D 2 166 ? 61.732 20.687  72.351  1.00 48.47 ? 167 SER B C   1 
ATOM   5967 O O   . SER D 2 166 ? 62.565 19.932  71.842  1.00 48.25 ? 167 SER B O   1 
ATOM   5968 C CB  . SER D 2 166 ? 63.090 22.698  72.973  1.00 44.43 ? 167 SER B CB  1 
ATOM   5969 O OG  . SER D 2 166 ? 62.536 23.425  71.892  1.00 46.64 ? 167 SER B OG  1 
ATOM   5970 N N   . TRP D 2 167 ? 60.462 20.745  71.959  1.00 48.93 ? 168 TRP B N   1 
ATOM   5971 C CA  . TRP D 2 167 ? 59.925 19.894  70.901  1.00 46.43 ? 168 TRP B CA  1 
ATOM   5972 C C   . TRP D 2 167 ? 59.643 20.671  69.617  1.00 43.08 ? 168 TRP B C   1 
ATOM   5973 O O   . TRP D 2 167 ? 59.255 21.839  69.656  1.00 44.70 ? 168 TRP B O   1 
ATOM   5974 C CB  . TRP D 2 167 ? 58.628 19.251  71.384  1.00 47.97 ? 168 TRP B CB  1 
ATOM   5975 C CG  . TRP D 2 167 ? 58.794 18.373  72.581  1.00 54.48 ? 168 TRP B CG  1 
ATOM   5976 C CD1 . TRP D 2 167 ? 58.980 17.024  72.585  1.00 54.25 ? 168 TRP B CD1 1 
ATOM   5977 C CD2 . TRP D 2 167 ? 58.782 18.781  73.956  1.00 56.53 ? 168 TRP B CD2 1 
ATOM   5978 N NE1 . TRP D 2 167 ? 59.082 16.560  73.876  1.00 55.59 ? 168 TRP B NE1 1 
ATOM   5979 C CE2 . TRP D 2 167 ? 58.965 17.617  74.738  1.00 55.42 ? 168 TRP B CE2 1 
ATOM   5980 C CE3 . TRP D 2 167 ? 58.635 20.016  74.603  1.00 57.40 ? 168 TRP B CE3 1 
ATOM   5981 C CZ2 . TRP D 2 167 ? 59.004 17.651  76.139  1.00 56.79 ? 168 TRP B CZ2 1 
ATOM   5982 C CZ3 . TRP D 2 167 ? 58.674 20.050  75.999  1.00 58.90 ? 168 TRP B CZ3 1 
ATOM   5983 C CH2 . TRP D 2 167 ? 58.859 18.871  76.749  1.00 56.92 ? 168 TRP B CH2 1 
ATOM   5984 N N   . THR D 2 168 ? 59.838 20.015  68.481  1.00 39.23 ? 169 THR B N   1 
ATOM   5985 C CA  . THR D 2 168 ? 59.575 20.642  67.191  1.00 43.86 ? 169 THR B CA  1 
ATOM   5986 C C   . THR D 2 168 ? 58.182 20.241  66.721  1.00 41.61 ? 169 THR B C   1 
ATOM   5987 O O   . THR D 2 168 ? 57.561 19.341  67.291  1.00 37.10 ? 169 THR B O   1 
ATOM   5988 C CB  . THR D 2 168 ? 60.569 20.177  66.109  1.00 41.53 ? 169 THR B CB  1 
ATOM   5989 O OG1 . THR D 2 168 ? 60.499 18.753  65.981  1.00 44.90 ? 169 THR B OG1 1 
ATOM   5990 C CG2 . THR D 2 168 ? 61.980 20.582  66.468  1.00 41.13 ? 169 THR B CG2 1 
ATOM   5991 N N   . ASP D 2 169 ? 57.688 20.920  65.690  1.00 42.48 ? 170 ASP B N   1 
ATOM   5992 C CA  . ASP D 2 169 ? 56.384 20.578  65.135  1.00 42.49 ? 170 ASP B CA  1 
ATOM   5993 C C   . ASP D 2 169 ? 56.621 19.369  64.238  1.00 39.53 ? 170 ASP B C   1 
ATOM   5994 O O   . ASP D 2 169 ? 57.768 19.016  63.964  1.00 39.95 ? 170 ASP B O   1 
ATOM   5995 C CB  . ASP D 2 169 ? 55.805 21.738  64.317  1.00 44.45 ? 170 ASP B CB  1 
ATOM   5996 C CG  . ASP D 2 169 ? 55.298 22.867  65.191  1.00 51.37 ? 170 ASP B CG  1 
ATOM   5997 O OD1 . ASP D 2 169 ? 54.611 22.586  66.199  1.00 56.40 ? 170 ASP B OD1 1 
ATOM   5998 O OD2 . ASP D 2 169 ? 55.572 24.039  64.867  1.00 53.36 ? 170 ASP B OD2 1 
ATOM   5999 N N   . GLN D 2 170 ? 55.550 18.730  63.786  1.00 39.52 ? 171 GLN B N   1 
ATOM   6000 C CA  . GLN D 2 170 ? 55.686 17.555  62.941  1.00 38.28 ? 171 GLN B CA  1 
ATOM   6001 C C   . GLN D 2 170 ? 56.448 17.903  61.664  1.00 38.38 ? 171 GLN B C   1 
ATOM   6002 O O   . GLN D 2 170 ? 56.097 18.844  60.954  1.00 37.34 ? 171 GLN B O   1 
ATOM   6003 C CB  . GLN D 2 170 ? 54.304 16.983  62.612  1.00 37.66 ? 171 GLN B CB  1 
ATOM   6004 C CG  . GLN D 2 170 ? 54.352 15.544  62.137  1.00 36.34 ? 171 GLN B CG  1 
ATOM   6005 C CD  . GLN D 2 170 ? 52.990 14.891  62.080  1.00 43.93 ? 171 GLN B CD  1 
ATOM   6006 O OE1 . GLN D 2 170 ? 52.888 13.671  61.949  1.00 43.93 ? 171 GLN B OE1 1 
ATOM   6007 N NE2 . GLN D 2 170 ? 51.933 15.696  62.171  1.00 37.45 ? 171 GLN B NE2 1 
ATOM   6008 N N   . ASP D 2 171 ? 57.499 17.140  61.387  1.00 42.43 ? 172 ASP B N   1 
ATOM   6009 C CA  . ASP D 2 171 ? 58.338 17.357  60.214  1.00 47.35 ? 172 ASP B CA  1 
ATOM   6010 C C   . ASP D 2 171 ? 57.539 17.388  58.911  1.00 51.33 ? 172 ASP B C   1 
ATOM   6011 O O   . ASP D 2 171 ? 56.740 16.497  58.639  1.00 51.75 ? 172 ASP B O   1 
ATOM   6012 C CB  . ASP D 2 171 ? 59.417 16.270  60.148  1.00 50.83 ? 172 ASP B CB  1 
ATOM   6013 C CG  . ASP D 2 171 ? 60.395 16.475  58.997  1.00 56.89 ? 172 ASP B CG  1 
ATOM   6014 O OD1 . ASP D 2 171 ? 61.374 15.703  58.898  1.00 64.17 ? 172 ASP B OD1 1 
ATOM   6015 O OD2 . ASP D 2 171 ? 60.192 17.403  58.188  1.00 56.38 ? 172 ASP B OD2 1 
ATOM   6016 N N   . SER D 2 172 ? 57.781 18.418  58.105  1.00 55.21 ? 173 SER B N   1 
ATOM   6017 C CA  . SER D 2 172 ? 57.098 18.606  56.825  1.00 57.16 ? 173 SER B CA  1 
ATOM   6018 C C   . SER D 2 172 ? 57.540 17.660  55.707  1.00 59.49 ? 173 SER B C   1 
ATOM   6019 O O   . SER D 2 172 ? 57.077 17.783  54.569  1.00 61.25 ? 173 SER B O   1 
ATOM   6020 C CB  . SER D 2 172 ? 57.282 20.048  56.347  1.00 58.33 ? 173 SER B CB  1 
ATOM   6021 O OG  . SER D 2 172 ? 56.712 20.966  57.264  1.00 65.49 ? 173 SER B OG  1 
ATOM   6022 N N   . LYS D 2 173 ? 58.431 16.726  56.016  1.00 60.09 ? 174 LYS B N   1 
ATOM   6023 C CA  . LYS D 2 173 ? 58.905 15.784  55.008  1.00 59.27 ? 174 LYS B CA  1 
ATOM   6024 C C   . LYS D 2 173 ? 58.979 14.371  55.562  1.00 59.58 ? 174 LYS B C   1 
ATOM   6025 O O   . LYS D 2 173 ? 58.840 13.398  54.826  1.00 57.69 ? 174 LYS B O   1 
ATOM   6026 C CB  . LYS D 2 173 ? 60.286 16.207  54.500  1.00 61.58 ? 174 LYS B CB  1 
ATOM   6027 C CG  . LYS D 2 173 ? 60.295 17.517  53.729  1.00 66.38 ? 174 LYS B CG  1 
ATOM   6028 C CD  . LYS D 2 173 ? 59.391 17.447  52.501  1.00 70.99 ? 174 LYS B CD  1 
ATOM   6029 C CE  . LYS D 2 173 ? 59.443 18.738  51.694  1.00 72.75 ? 174 LYS B CE  1 
ATOM   6030 N NZ  . LYS D 2 173 ? 59.047 19.924  52.506  1.00 76.12 ? 174 LYS B NZ  1 
ATOM   6031 N N   . ASP D 2 174 ? 59.184 14.270  56.869  1.00 59.67 ? 175 ASP B N   1 
ATOM   6032 C CA  . ASP D 2 174 ? 59.304 12.981  57.534  1.00 54.94 ? 175 ASP B CA  1 
ATOM   6033 C C   . ASP D 2 174 ? 58.043 12.645  58.333  1.00 50.87 ? 175 ASP B C   1 
ATOM   6034 O O   . ASP D 2 174 ? 57.767 11.479  58.619  1.00 49.00 ? 175 ASP B O   1 
ATOM   6035 C CB  . ASP D 2 174 ? 60.529 13.019  58.456  1.00 56.43 ? 175 ASP B CB  1 
ATOM   6036 C CG  . ASP D 2 174 ? 61.012 11.645  58.847  1.00 65.59 ? 175 ASP B CG  1 
ATOM   6037 O OD1 . ASP D 2 174 ? 61.005 10.742  57.981  1.00 67.62 ? 175 ASP B OD1 1 
ATOM   6038 O OD2 . ASP D 2 174 ? 61.424 11.471  60.015  1.00 68.92 ? 175 ASP B OD2 1 
ATOM   6039 N N   . SER D 2 175 ? 57.272 13.674  58.672  1.00 44.72 ? 176 SER B N   1 
ATOM   6040 C CA  . SER D 2 175 ? 56.057 13.501  59.461  1.00 39.04 ? 176 SER B CA  1 
ATOM   6041 C C   . SER D 2 175 ? 56.404 13.001  60.864  1.00 43.18 ? 176 SER B C   1 
ATOM   6042 O O   . SER D 2 175 ? 55.524 12.581  61.615  1.00 41.95 ? 176 SER B O   1 
ATOM   6043 C CB  . SER D 2 175 ? 55.102 12.512  58.787  1.00 40.49 ? 176 SER B CB  1 
ATOM   6044 O OG  . SER D 2 175 ? 54.595 13.029  57.570  1.00 38.56 ? 176 SER B OG  1 
ATOM   6045 N N   . THR D 2 176 ? 57.688 13.038  61.215  1.00 40.16 ? 177 THR B N   1 
ATOM   6046 C CA  . THR D 2 176 ? 58.106 12.601  62.542  1.00 44.71 ? 177 THR B CA  1 
ATOM   6047 C C   . THR D 2 176 ? 58.259 13.797  63.474  1.00 44.81 ? 177 THR B C   1 
ATOM   6048 O O   . THR D 2 176 ? 58.037 14.943  63.083  1.00 42.88 ? 177 THR B O   1 
ATOM   6049 C CB  . THR D 2 176 ? 59.457 11.859  62.510  1.00 47.76 ? 177 THR B CB  1 
ATOM   6050 O OG1 . THR D 2 176 ? 60.470 12.739  62.010  1.00 48.17 ? 177 THR B OG1 1 
ATOM   6051 C CG2 . THR D 2 176 ? 59.375 10.621  61.629  1.00 48.99 ? 177 THR B CG2 1 
ATOM   6052 N N   . TYR D 2 177 ? 58.646 13.509  64.711  1.00 46.28 ? 178 TYR B N   1 
ATOM   6053 C CA  . TYR D 2 177 ? 58.848 14.531  65.725  1.00 46.83 ? 178 TYR B CA  1 
ATOM   6054 C C   . TYR D 2 177 ? 60.268 14.464  66.279  1.00 49.19 ? 178 TYR B C   1 
ATOM   6055 O O   . TYR D 2 177 ? 60.901 13.407  66.279  1.00 50.71 ? 178 TYR B O   1 
ATOM   6056 C CB  . TYR D 2 177 ? 57.840 14.336  66.855  1.00 45.10 ? 178 TYR B CB  1 
ATOM   6057 C CG  . TYR D 2 177 ? 56.413 14.584  66.421  1.00 48.49 ? 178 TYR B CG  1 
ATOM   6058 C CD1 . TYR D 2 177 ? 55.905 15.878  66.339  1.00 46.15 ? 178 TYR B CD1 1 
ATOM   6059 C CD2 . TYR D 2 177 ? 55.581 13.526  66.056  1.00 46.49 ? 178 TYR B CD2 1 
ATOM   6060 C CE1 . TYR D 2 177 ? 54.602 16.109  65.905  1.00 50.09 ? 178 TYR B CE1 1 
ATOM   6061 C CE2 . TYR D 2 177 ? 54.281 13.748  65.619  1.00 47.20 ? 178 TYR B CE2 1 
ATOM   6062 C CZ  . TYR D 2 177 ? 53.798 15.039  65.547  1.00 47.50 ? 178 TYR B CZ  1 
ATOM   6063 O OH  . TYR D 2 177 ? 52.512 15.263  65.119  1.00 53.74 ? 178 TYR B OH  1 
ATOM   6064 N N   . SER D 2 178 ? 60.770 15.603  66.737  1.00 49.80 ? 179 SER B N   1 
ATOM   6065 C CA  . SER D 2 178 ? 62.104 15.662  67.305  1.00 50.51 ? 179 SER B CA  1 
ATOM   6066 C C   . SER D 2 178 ? 62.064 16.457  68.599  1.00 53.56 ? 179 SER B C   1 
ATOM   6067 O O   . SER D 2 178 ? 61.212 17.328  68.782  1.00 51.25 ? 179 SER B O   1 
ATOM   6068 C CB  . SER D 2 178 ? 63.082 16.300  66.317  1.00 47.74 ? 179 SER B CB  1 
ATOM   6069 O OG  . SER D 2 178 ? 63.300 15.452  65.204  1.00 42.13 ? 179 SER B OG  1 
ATOM   6070 N N   . MET D 2 179 ? 62.985 16.141  69.501  1.00 55.59 ? 180 MET B N   1 
ATOM   6071 C CA  . MET D 2 179 ? 63.046 16.818  70.781  1.00 57.01 ? 180 MET B CA  1 
ATOM   6072 C C   . MET D 2 179 ? 64.484 17.068  71.198  1.00 58.13 ? 180 MET B C   1 
ATOM   6073 O O   . MET D 2 179 ? 65.393 16.325  70.829  1.00 59.49 ? 180 MET B O   1 
ATOM   6074 C CB  . MET D 2 179 ? 62.358 15.981  71.852  1.00 59.36 ? 180 MET B CB  1 
ATOM   6075 C CG  . MET D 2 179 ? 62.183 16.721  73.154  1.00 62.93 ? 180 MET B CG  1 
ATOM   6076 S SD  . MET D 2 179 ? 62.176 15.618  74.559  1.00 71.40 ? 180 MET B SD  1 
ATOM   6077 C CE  . MET D 2 179 ? 63.760 16.011  75.271  1.00 68.05 ? 180 MET B CE  1 
ATOM   6078 N N   . SER D 2 180 ? 64.677 18.121  71.978  1.00 56.74 ? 181 SER B N   1 
ATOM   6079 C CA  . SER D 2 180 ? 65.995 18.482  72.464  1.00 54.23 ? 181 SER B CA  1 
ATOM   6080 C C   . SER D 2 180 ? 65.928 18.537  73.982  1.00 55.45 ? 181 SER B C   1 
ATOM   6081 O O   . SER D 2 180 ? 64.985 19.088  74.548  1.00 58.61 ? 181 SER B O   1 
ATOM   6082 C CB  . SER D 2 180 ? 66.396 19.847  71.903  1.00 53.74 ? 181 SER B CB  1 
ATOM   6083 O OG  . SER D 2 180 ? 67.687 20.226  72.330  1.00 56.04 ? 181 SER B OG  1 
ATOM   6084 N N   . SER D 2 181 ? 66.918 17.947  74.641  1.00 58.27 ? 182 SER B N   1 
ATOM   6085 C CA  . SER D 2 181 ? 66.969 17.953  76.098  1.00 56.99 ? 182 SER B CA  1 
ATOM   6086 C C   . SER D 2 181 ? 68.324 18.509  76.512  1.00 56.53 ? 182 SER B C   1 
ATOM   6087 O O   . SER D 2 181 ? 69.360 18.022  76.060  1.00 54.67 ? 182 SER B O   1 
ATOM   6088 C CB  . SER D 2 181 ? 66.791 16.533  76.645  1.00 57.73 ? 182 SER B CB  1 
ATOM   6089 O OG  . SER D 2 181 ? 66.643 16.547  78.059  1.00 62.15 ? 182 SER B OG  1 
ATOM   6090 N N   . THR D 2 182 ? 68.316 19.536  77.358  1.00 55.08 ? 183 THR B N   1 
ATOM   6091 C CA  . THR D 2 182 ? 69.561 20.151  77.805  1.00 56.18 ? 183 THR B CA  1 
ATOM   6092 C C   . THR D 2 182 ? 69.652 20.327  79.314  1.00 57.08 ? 183 THR B C   1 
ATOM   6093 O O   . THR D 2 182 ? 68.879 21.072  79.916  1.00 55.76 ? 183 THR B O   1 
ATOM   6094 C CB  . THR D 2 182 ? 69.763 21.529  77.148  1.00 56.84 ? 183 THR B CB  1 
ATOM   6095 O OG1 . THR D 2 182 ? 69.858 21.373  75.727  1.00 55.87 ? 183 THR B OG1 1 
ATOM   6096 C CG2 . THR D 2 182 ? 71.033 22.190  77.673  1.00 54.16 ? 183 THR B CG2 1 
ATOM   6097 N N   . LEU D 2 183 ? 70.605 19.629  79.919  1.00 59.02 ? 184 LEU B N   1 
ATOM   6098 C CA  . LEU D 2 183 ? 70.827 19.718  81.354  1.00 61.41 ? 184 LEU B CA  1 
ATOM   6099 C C   . LEU D 2 183 ? 71.908 20.765  81.582  1.00 63.65 ? 184 LEU B C   1 
ATOM   6100 O O   . LEU D 2 183 ? 73.092 20.507  81.359  1.00 64.75 ? 184 LEU B O   1 
ATOM   6101 C CB  . LEU D 2 183 ? 71.286 18.367  81.903  1.00 62.20 ? 184 LEU B CB  1 
ATOM   6102 C CG  . LEU D 2 183 ? 71.746 18.335  83.361  1.00 61.84 ? 184 LEU B CG  1 
ATOM   6103 C CD1 . LEU D 2 183 ? 70.605 18.760  84.276  1.00 61.11 ? 184 LEU B CD1 1 
ATOM   6104 C CD2 . LEU D 2 183 ? 72.220 16.932  83.705  1.00 62.48 ? 184 LEU B CD2 1 
ATOM   6105 N N   . THR D 2 184 ? 71.499 21.951  82.015  1.00 64.76 ? 185 THR B N   1 
ATOM   6106 C CA  . THR D 2 184 ? 72.442 23.035  82.256  1.00 66.56 ? 185 THR B CA  1 
ATOM   6107 C C   . THR D 2 184 ? 72.879 23.118  83.714  1.00 66.42 ? 185 THR B C   1 
ATOM   6108 O O   . THR D 2 184 ? 72.057 23.027  84.628  1.00 66.42 ? 185 THR B O   1 
ATOM   6109 C CB  . THR D 2 184 ? 71.839 24.392  81.833  1.00 68.71 ? 185 THR B CB  1 
ATOM   6110 O OG1 . THR D 2 184 ? 70.546 24.552  82.431  1.00 72.44 ? 185 THR B OG1 1 
ATOM   6111 C CG2 . THR D 2 184 ? 71.710 24.467  80.318  1.00 67.76 ? 185 THR B CG2 1 
ATOM   6112 N N   . LEU D 2 185 ? 74.182 23.283  83.926  1.00 66.77 ? 186 LEU B N   1 
ATOM   6113 C CA  . LEU D 2 185 ? 74.730 23.388  85.275  1.00 68.17 ? 186 LEU B CA  1 
ATOM   6114 C C   . LEU D 2 185 ? 76.103 24.065  85.292  1.00 70.52 ? 186 LEU B C   1 
ATOM   6115 O O   . LEU D 2 185 ? 76.709 24.292  84.238  1.00 70.42 ? 186 LEU B O   1 
ATOM   6116 C CB  . LEU D 2 185 ? 74.804 21.999  85.920  1.00 64.95 ? 186 LEU B CB  1 
ATOM   6117 C CG  . LEU D 2 185 ? 75.466 20.865  85.133  1.00 64.03 ? 186 LEU B CG  1 
ATOM   6118 C CD1 . LEU D 2 185 ? 76.957 21.116  85.007  1.00 63.79 ? 186 LEU B CD1 1 
ATOM   6119 C CD2 . LEU D 2 185 ? 75.218 19.548  85.845  1.00 60.25 ? 186 LEU B CD2 1 
ATOM   6120 N N   . THR D 2 186 ? 76.583 24.391  86.491  1.00 71.55 ? 187 THR B N   1 
ATOM   6121 C CA  . THR D 2 186 ? 77.877 25.051  86.651  1.00 72.53 ? 187 THR B CA  1 
ATOM   6122 C C   . THR D 2 186 ? 79.031 24.117  86.315  1.00 72.92 ? 187 THR B C   1 
ATOM   6123 O O   . THR D 2 186 ? 78.953 22.910  86.545  1.00 72.17 ? 187 THR B O   1 
ATOM   6124 C CB  . THR D 2 186 ? 78.081 25.570  88.098  1.00 73.34 ? 187 THR B CB  1 
ATOM   6125 O OG1 . THR D 2 186 ? 78.102 24.465  89.012  1.00 72.48 ? 187 THR B OG1 1 
ATOM   6126 C CG2 . THR D 2 186 ? 76.962 26.527  88.486  1.00 73.55 ? 187 THR B CG2 1 
ATOM   6127 N N   . LYS D 2 187 ? 80.100 24.685  85.764  1.00 73.35 ? 188 LYS B N   1 
ATOM   6128 C CA  . LYS D 2 187 ? 81.280 23.913  85.406  1.00 73.86 ? 188 LYS B CA  1 
ATOM   6129 C C   . LYS D 2 187 ? 81.803 23.193  86.641  1.00 74.31 ? 188 LYS B C   1 
ATOM   6130 O O   . LYS D 2 187 ? 82.236 22.041  86.562  1.00 72.39 ? 188 LYS B O   1 
ATOM   6131 C CB  . LYS D 2 187 ? 82.364 24.837  84.848  1.00 74.92 ? 188 LYS B CB  1 
ATOM   6132 C CG  . LYS D 2 187 ? 83.727 24.180  84.661  1.00 76.20 ? 188 LYS B CG  1 
ATOM   6133 C CD  . LYS D 2 187 ? 84.741 25.177  84.118  1.00 77.14 ? 188 LYS B CD  1 
ATOM   6134 C CE  . LYS D 2 187 ? 86.142 24.595  84.086  1.00 78.26 ? 188 LYS B CE  1 
ATOM   6135 N NZ  . LYS D 2 187 ? 86.619 24.221  85.447  1.00 80.56 ? 188 LYS B NZ  1 
ATOM   6136 N N   . ASP D 2 188 ? 81.756 23.883  87.779  1.00 75.58 ? 189 ASP B N   1 
ATOM   6137 C CA  . ASP D 2 188 ? 82.225 23.324  89.041  1.00 77.43 ? 189 ASP B CA  1 
ATOM   6138 C C   . ASP D 2 188 ? 81.431 22.069  89.381  1.00 76.96 ? 189 ASP B C   1 
ATOM   6139 O O   . ASP D 2 188 ? 81.994 21.058  89.805  1.00 74.52 ? 189 ASP B O   1 
ATOM   6140 C CB  . ASP D 2 188 ? 82.079 24.353  90.166  1.00 79.94 ? 189 ASP B CB  1 
ATOM   6141 C CG  . ASP D 2 188 ? 82.866 25.625  89.899  1.00 82.41 ? 189 ASP B CG  1 
ATOM   6142 O OD1 . ASP D 2 188 ? 84.104 25.541  89.749  1.00 80.78 ? 189 ASP B OD1 1 
ATOM   6143 O OD2 . ASP D 2 188 ? 82.243 26.710  89.840  1.00 85.68 ? 189 ASP B OD2 1 
ATOM   6144 N N   . GLU D 2 189 ? 80.118 22.146  89.192  1.00 76.86 ? 190 GLU B N   1 
ATOM   6145 C CA  . GLU D 2 189 ? 79.240 21.017  89.461  1.00 77.08 ? 190 GLU B CA  1 
ATOM   6146 C C   . GLU D 2 189 ? 79.483 19.907  88.438  1.00 75.12 ? 190 GLU B C   1 
ATOM   6147 O O   . GLU D 2 189 ? 79.501 18.726  88.780  1.00 74.26 ? 190 GLU B O   1 
ATOM   6148 C CB  . GLU D 2 189 ? 77.779 21.468  89.407  1.00 79.81 ? 190 GLU B CB  1 
ATOM   6149 C CG  . GLU D 2 189 ? 76.765 20.331  89.423  1.00 82.62 ? 190 GLU B CG  1 
ATOM   6150 C CD  . GLU D 2 189 ? 76.861 19.469  90.670  1.00 84.92 ? 190 GLU B CD  1 
ATOM   6151 O OE1 . GLU D 2 189 ? 76.118 18.466  90.756  1.00 84.94 ? 190 GLU B OE1 1 
ATOM   6152 O OE2 . GLU D 2 189 ? 77.674 19.789  91.564  1.00 84.96 ? 190 GLU B OE2 1 
ATOM   6153 N N   . TYR D 2 190 ? 79.674 20.299  87.184  1.00 72.34 ? 191 TYR B N   1 
ATOM   6154 C CA  . TYR D 2 190 ? 79.915 19.348  86.107  1.00 71.07 ? 191 TYR B CA  1 
ATOM   6155 C C   . TYR D 2 190 ? 81.145 18.482  86.379  1.00 72.43 ? 191 TYR B C   1 
ATOM   6156 O O   . TYR D 2 190 ? 81.109 17.262  86.202  1.00 70.91 ? 191 TYR B O   1 
ATOM   6157 C CB  . TYR D 2 190 ? 80.084 20.099  84.780  1.00 66.16 ? 191 TYR B CB  1 
ATOM   6158 C CG  . TYR D 2 190 ? 80.502 19.225  83.618  1.00 63.25 ? 191 TYR B CG  1 
ATOM   6159 C CD1 . TYR D 2 190 ? 79.755 18.106  83.253  1.00 61.30 ? 191 TYR B CD1 1 
ATOM   6160 C CD2 . TYR D 2 190 ? 81.657 19.511  82.893  1.00 58.68 ? 191 TYR B CD2 1 
ATOM   6161 C CE1 . TYR D 2 190 ? 80.152 17.288  82.193  1.00 58.56 ? 191 TYR B CE1 1 
ATOM   6162 C CE2 . TYR D 2 190 ? 82.062 18.705  81.836  1.00 56.88 ? 191 TYR B CE2 1 
ATOM   6163 C CZ  . TYR D 2 190 ? 81.310 17.596  81.491  1.00 57.42 ? 191 TYR B CZ  1 
ATOM   6164 O OH  . TYR D 2 190 ? 81.727 16.797  80.451  1.00 49.92 ? 191 TYR B OH  1 
ATOM   6165 N N   . GLU D 2 191 ? 82.230 19.115  86.810  1.00 74.55 ? 192 GLU B N   1 
ATOM   6166 C CA  . GLU D 2 191 ? 83.465 18.395  87.102  1.00 76.72 ? 192 GLU B CA  1 
ATOM   6167 C C   . GLU D 2 191 ? 83.344 17.580  88.388  1.00 77.40 ? 192 GLU B C   1 
ATOM   6168 O O   . GLU D 2 191 ? 84.214 16.766  88.700  1.00 80.30 ? 192 GLU B O   1 
ATOM   6169 C CB  . GLU D 2 191 ? 84.632 19.378  87.228  1.00 77.10 ? 192 GLU B CB  1 
ATOM   6170 C CG  . GLU D 2 191 ? 84.886 20.222  85.986  1.00 80.34 ? 192 GLU B CG  1 
ATOM   6171 C CD  . GLU D 2 191 ? 85.292 19.396  84.775  1.00 83.88 ? 192 GLU B CD  1 
ATOM   6172 O OE1 . GLU D 2 191 ? 85.604 19.999  83.724  1.00 84.16 ? 192 GLU B OE1 1 
ATOM   6173 O OE2 . GLU D 2 191 ? 85.300 18.148  84.869  1.00 83.72 ? 192 GLU B OE2 1 
ATOM   6174 N N   . ARG D 2 192 ? 82.261 17.800  89.127  1.00 76.18 ? 193 ARG B N   1 
ATOM   6175 C CA  . ARG D 2 192 ? 82.020 17.099  90.385  1.00 74.81 ? 193 ARG B CA  1 
ATOM   6176 C C   . ARG D 2 192 ? 81.474 15.688  90.146  1.00 74.50 ? 193 ARG B C   1 
ATOM   6177 O O   . ARG D 2 192 ? 81.224 14.940  91.094  1.00 71.60 ? 193 ARG B O   1 
ATOM   6178 C CB  . ARG D 2 192 ? 81.034 17.909  91.232  1.00 78.16 ? 193 ARG B CB  1 
ATOM   6179 C CG  . ARG D 2 192 ? 80.979 17.534  92.703  1.00 81.87 ? 193 ARG B CG  1 
ATOM   6180 C CD  . ARG D 2 192 ? 80.133 18.543  93.472  1.00 84.19 ? 193 ARG B CD  1 
ATOM   6181 N NE  . ARG D 2 192 ? 80.597 19.911  93.241  1.00 87.93 ? 193 ARG B NE  1 
ATOM   6182 C CZ  . ARG D 2 192 ? 80.008 21.000  93.728  1.00 88.80 ? 193 ARG B CZ  1 
ATOM   6183 N NH1 . ARG D 2 192 ? 78.923 20.892  94.483  1.00 91.74 ? 193 ARG B NH1 1 
ATOM   6184 N NH2 . ARG D 2 192 ? 80.504 22.200  93.456  1.00 87.25 ? 193 ARG B NH2 1 
ATOM   6185 N N   . HIS D 2 193 ? 81.292 15.338  88.874  1.00 75.37 ? 194 HIS B N   1 
ATOM   6186 C CA  . HIS D 2 193 ? 80.782 14.026  88.479  1.00 74.73 ? 194 HIS B CA  1 
ATOM   6187 C C   . HIS D 2 193 ? 81.485 13.592  87.196  1.00 74.87 ? 194 HIS B C   1 
ATOM   6188 O O   . HIS D 2 193 ? 82.166 14.396  86.560  1.00 75.69 ? 194 HIS B O   1 
ATOM   6189 C CB  . HIS D 2 193 ? 79.269 14.093  88.245  1.00 74.46 ? 194 HIS B CB  1 
ATOM   6190 C CG  . HIS D 2 193 ? 78.487 14.503  89.455  1.00 74.16 ? 194 HIS B CG  1 
ATOM   6191 N ND1 . HIS D 2 193 ? 78.485 13.772  90.624  1.00 72.97 ? 194 HIS B ND1 1 
ATOM   6192 C CD2 . HIS D 2 193 ? 77.693 15.577  89.682  1.00 73.82 ? 194 HIS B CD2 1 
ATOM   6193 C CE1 . HIS D 2 193 ? 77.724 14.376  91.518  1.00 72.71 ? 194 HIS B CE1 1 
ATOM   6194 N NE2 . HIS D 2 193 ? 77.231 15.474  90.973  1.00 72.91 ? 194 HIS B NE2 1 
ATOM   6195 N N   . ASN D 2 194 ? 81.321 12.328  86.813  1.00 74.33 ? 195 ASN B N   1 
ATOM   6196 C CA  . ASN D 2 194 ? 81.966 11.815  85.606  1.00 74.80 ? 195 ASN B CA  1 
ATOM   6197 C C   . ASN D 2 194 ? 81.024 11.147  84.610  1.00 72.61 ? 195 ASN B C   1 
ATOM   6198 O O   . ASN D 2 194 ? 81.297 11.137  83.410  1.00 71.22 ? 195 ASN B O   1 
ATOM   6199 C CB  . ASN D 2 194 ? 83.073 10.824  85.981  1.00 80.07 ? 195 ASN B CB  1 
ATOM   6200 C CG  . ASN D 2 194 ? 84.282 11.501  86.604  1.00 85.69 ? 195 ASN B CG  1 
ATOM   6201 O OD1 . ASN D 2 194 ? 85.202 10.834  87.081  1.00 88.30 ? 195 ASN B OD1 1 
ATOM   6202 N ND2 . ASN D 2 194 ? 84.291 12.831  86.595  1.00 86.99 ? 195 ASN B ND2 1 
ATOM   6203 N N   . GLY D 2 195 ? 79.925 10.584  85.101  1.00 72.12 ? 196 GLY B N   1 
ATOM   6204 C CA  . GLY D 2 195 ? 78.988 9.914   84.214  1.00 73.48 ? 196 GLY B CA  1 
ATOM   6205 C C   . GLY D 2 195 ? 77.671 10.641  83.997  1.00 73.88 ? 196 GLY B C   1 
ATOM   6206 O O   . GLY D 2 195 ? 76.988 11.012  84.950  1.00 74.27 ? 196 GLY B O   1 
ATOM   6207 N N   . TYR D 2 196 ? 77.312 10.843  82.734  1.00 73.42 ? 197 TYR B N   1 
ATOM   6208 C CA  . TYR D 2 196 ? 76.068 11.524  82.391  1.00 73.02 ? 197 TYR B CA  1 
ATOM   6209 C C   . TYR D 2 196 ? 75.269 10.713  81.374  1.00 73.54 ? 197 TYR B C   1 
ATOM   6210 O O   . TYR D 2 196 ? 75.742 10.461  80.264  1.00 72.93 ? 197 TYR B O   1 
ATOM   6211 C CB  . TYR D 2 196 ? 76.365 12.918  81.834  1.00 71.97 ? 197 TYR B CB  1 
ATOM   6212 C CG  . TYR D 2 196 ? 77.024 13.839  82.835  1.00 72.62 ? 197 TYR B CG  1 
ATOM   6213 C CD1 . TYR D 2 196 ? 78.389 13.748  83.110  1.00 73.52 ? 197 TYR B CD1 1 
ATOM   6214 C CD2 . TYR D 2 196 ? 76.273 14.783  83.536  1.00 73.93 ? 197 TYR B CD2 1 
ATOM   6215 C CE1 . TYR D 2 196 ? 78.991 14.575  84.063  1.00 74.23 ? 197 TYR B CE1 1 
ATOM   6216 C CE2 . TYR D 2 196 ? 76.863 15.613  84.490  1.00 74.94 ? 197 TYR B CE2 1 
ATOM   6217 C CZ  . TYR D 2 196 ? 78.220 15.503  84.749  1.00 74.46 ? 197 TYR B CZ  1 
ATOM   6218 O OH  . TYR D 2 196 ? 78.800 16.316  85.695  1.00 73.72 ? 197 TYR B OH  1 
ATOM   6219 N N   . THR D 2 197 ? 74.053 10.320  81.759  1.00 72.66 ? 198 THR B N   1 
ATOM   6220 C CA  . THR D 2 197 ? 73.188 9.517   80.898  1.00 70.94 ? 198 THR B CA  1 
ATOM   6221 C C   . THR D 2 197 ? 71.896 10.204  80.444  1.00 70.68 ? 198 THR B C   1 
ATOM   6222 O O   . THR D 2 197 ? 71.200 10.856  81.226  1.00 67.50 ? 198 THR B O   1 
ATOM   6223 C CB  . THR D 2 197 ? 72.807 8.193   81.587  1.00 71.66 ? 198 THR B CB  1 
ATOM   6224 O OG1 . THR D 2 197 ? 73.992 7.548   82.067  1.00 72.49 ? 198 THR B OG1 1 
ATOM   6225 C CG2 . THR D 2 197 ? 72.103 7.265   80.606  1.00 69.87 ? 198 THR B CG2 1 
ATOM   6226 N N   . CYS D 2 198 ? 71.592 10.024  79.163  1.00 71.22 ? 199 CYS B N   1 
ATOM   6227 C CA  . CYS D 2 198 ? 70.407 10.575  78.514  1.00 70.09 ? 199 CYS B CA  1 
ATOM   6228 C C   . CYS D 2 198 ? 69.466 9.405   78.211  1.00 70.32 ? 199 CYS B C   1 
ATOM   6229 O O   . CYS D 2 198 ? 69.739 8.600   77.319  1.00 70.05 ? 199 CYS B O   1 
ATOM   6230 C CB  . CYS D 2 198 ? 70.833 11.255  77.213  1.00 70.63 ? 199 CYS B CB  1 
ATOM   6231 S SG  . CYS D 2 198 ? 69.525 12.014  76.203  1.00 74.86 ? 199 CYS B SG  1 
ATOM   6232 N N   . GLU D 2 199 ? 68.363 9.306   78.948  1.00 69.83 ? 200 GLU B N   1 
ATOM   6233 C CA  . GLU D 2 199 ? 67.424 8.206   78.749  1.00 71.82 ? 200 GLU B CA  1 
ATOM   6234 C C   . GLU D 2 199 ? 66.187 8.599   77.947  1.00 71.05 ? 200 GLU B C   1 
ATOM   6235 O O   . GLU D 2 199 ? 65.518 9.581   78.260  1.00 71.30 ? 200 GLU B O   1 
ATOM   6236 C CB  . GLU D 2 199 ? 66.998 7.633   80.102  1.00 72.84 ? 200 GLU B CB  1 
ATOM   6237 C CG  . GLU D 2 199 ? 66.250 6.316   80.005  1.00 78.39 ? 200 GLU B CG  1 
ATOM   6238 C CD  . GLU D 2 199 ? 65.877 5.754   81.360  1.00 80.96 ? 200 GLU B CD  1 
ATOM   6239 O OE1 . GLU D 2 199 ? 66.780 5.606   82.209  1.00 84.79 ? 200 GLU B OE1 1 
ATOM   6240 O OE2 . GLU D 2 199 ? 64.683 5.456   81.574  1.00 83.03 ? 200 GLU B OE2 1 
ATOM   6241 N N   . ALA D 2 200 ? 65.884 7.813   76.918  1.00 72.12 ? 201 ALA B N   1 
ATOM   6242 C CA  . ALA D 2 200 ? 64.731 8.071   76.062  1.00 74.30 ? 201 ALA B CA  1 
ATOM   6243 C C   . ALA D 2 200 ? 63.732 6.916   76.068  1.00 75.47 ? 201 ALA B C   1 
ATOM   6244 O O   . ALA D 2 200 ? 63.909 5.927   75.354  1.00 75.50 ? 201 ALA B O   1 
ATOM   6245 C CB  . ALA D 2 200 ? 65.196 8.345   74.638  1.00 75.40 ? 201 ALA B CB  1 
ATOM   6246 N N   . THR D 2 201 ? 62.681 7.052   76.872  1.00 77.04 ? 202 THR B N   1 
ATOM   6247 C CA  . THR D 2 201 ? 61.642 6.030   76.971  1.00 78.13 ? 202 THR B CA  1 
ATOM   6248 C C   . THR D 2 201 ? 60.479 6.336   76.029  1.00 79.14 ? 202 THR B C   1 
ATOM   6249 O O   . THR D 2 201 ? 59.588 7.128   76.348  1.00 77.69 ? 202 THR B O   1 
ATOM   6250 C CB  . THR D 2 201 ? 61.097 5.918   78.415  1.00 77.86 ? 202 THR B CB  1 
ATOM   6251 O OG1 . THR D 2 201 ? 62.117 5.390   79.272  1.00 81.74 ? 202 THR B OG1 1 
ATOM   6252 C CG2 . THR D 2 201 ? 59.878 5.009   78.462  1.00 75.58 ? 202 THR B CG2 1 
ATOM   6253 N N   . HIS D 2 202 ? 60.499 5.704   74.861  1.00 81.00 ? 203 HIS B N   1 
ATOM   6254 C CA  . HIS D 2 202 ? 59.450 5.893   73.871  1.00 81.70 ? 203 HIS B CA  1 
ATOM   6255 C C   . HIS D 2 202 ? 58.407 4.801   74.089  1.00 82.77 ? 203 HIS B C   1 
ATOM   6256 O O   . HIS D 2 202 ? 58.708 3.754   74.665  1.00 82.73 ? 203 HIS B O   1 
ATOM   6257 C CB  . HIS D 2 202 ? 60.037 5.790   72.462  1.00 82.89 ? 203 HIS B CB  1 
ATOM   6258 C CG  . HIS D 2 202 ? 59.133 6.310   71.388  1.00 84.81 ? 203 HIS B CG  1 
ATOM   6259 N ND1 . HIS D 2 202 ? 58.735 7.629   71.325  1.00 85.67 ? 203 HIS B ND1 1 
ATOM   6260 C CD2 . HIS D 2 202 ? 58.559 5.693   70.328  1.00 85.43 ? 203 HIS B CD2 1 
ATOM   6261 C CE1 . HIS D 2 202 ? 57.957 7.802   70.272  1.00 84.43 ? 203 HIS B CE1 1 
ATOM   6262 N NE2 . HIS D 2 202 ? 57.834 6.643   69.649  1.00 86.05 ? 203 HIS B NE2 1 
ATOM   6263 N N   . LYS D 2 203 ? 57.183 5.045   73.636  1.00 84.00 ? 204 LYS B N   1 
ATOM   6264 C CA  . LYS D 2 203 ? 56.115 4.066   73.798  1.00 85.24 ? 204 LYS B CA  1 
ATOM   6265 C C   . LYS D 2 203 ? 56.304 2.909   72.821  1.00 87.23 ? 204 LYS B C   1 
ATOM   6266 O O   . LYS D 2 203 ? 55.426 2.610   72.009  1.00 86.36 ? 204 LYS B O   1 
ATOM   6267 C CB  . LYS D 2 203 ? 54.751 4.728   73.578  1.00 85.49 ? 204 LYS B CB  1 
ATOM   6268 C CG  . LYS D 2 203 ? 54.505 5.993   74.411  1.00 84.52 ? 204 LYS B CG  1 
ATOM   6269 C CD  . LYS D 2 203 ? 54.638 5.757   75.914  1.00 83.59 ? 204 LYS B CD  1 
ATOM   6270 C CE  . LYS D 2 203 ? 56.088 5.820   76.382  1.00 81.77 ? 204 LYS B CE  1 
ATOM   6271 N NZ  . LYS D 2 203 ? 56.217 5.578   77.846  1.00 79.27 ? 204 LYS B NZ  1 
ATOM   6272 N N   . THR D 2 204 ? 57.464 2.266   72.911  1.00 87.99 ? 205 THR B N   1 
ATOM   6273 C CA  . THR D 2 204 ? 57.804 1.140   72.050  1.00 87.67 ? 205 THR B CA  1 
ATOM   6274 C C   . THR D 2 204 ? 58.964 0.365   72.673  1.00 88.40 ? 205 THR B C   1 
ATOM   6275 O O   . THR D 2 204 ? 59.785 0.939   73.391  1.00 88.45 ? 205 THR B O   1 
ATOM   6276 C CB  . THR D 2 204 ? 58.235 1.622   70.650  1.00 87.92 ? 205 THR B CB  1 
ATOM   6277 O OG1 . THR D 2 204 ? 57.257 2.531   70.132  1.00 89.06 ? 205 THR B OG1 1 
ATOM   6278 C CG2 . THR D 2 204 ? 58.367 0.441   69.700  1.00 87.43 ? 205 THR B CG2 1 
ATOM   6279 N N   . SER D 2 205 ? 59.019 -0.936  72.401  1.00 88.38 ? 206 SER B N   1 
ATOM   6280 C CA  . SER D 2 205 ? 60.081 -1.802  72.917  1.00 87.87 ? 206 SER B CA  1 
ATOM   6281 C C   . SER D 2 205 ? 60.031 -2.019  74.431  1.00 87.98 ? 206 SER B C   1 
ATOM   6282 O O   . SER D 2 205 ? 60.501 -3.045  74.928  1.00 87.66 ? 206 SER B O   1 
ATOM   6283 C CB  . SER D 2 205 ? 61.459 -1.240  72.543  1.00 86.99 ? 206 SER B CB  1 
ATOM   6284 O OG  . SER D 2 205 ? 61.619 -1.146  71.140  1.00 87.81 ? 206 SER B OG  1 
ATOM   6285 N N   . THR D 2 206 ? 59.472 -1.051  75.155  1.00 86.32 ? 207 THR B N   1 
ATOM   6286 C CA  . THR D 2 206 ? 59.374 -1.127  76.613  1.00 83.99 ? 207 THR B CA  1 
ATOM   6287 C C   . THR D 2 206 ? 60.758 -0.921  77.235  1.00 84.07 ? 207 THR B C   1 
ATOM   6288 O O   . THR D 2 206 ? 60.890 -0.708  78.444  1.00 82.90 ? 207 THR B O   1 
ATOM   6289 C CB  . THR D 2 206 ? 58.808 -2.496  77.068  1.00 83.17 ? 207 THR B CB  1 
ATOM   6290 O OG1 . THR D 2 206 ? 57.553 -2.733  76.417  1.00 80.81 ? 207 THR B OG1 1 
ATOM   6291 C CG2 . THR D 2 206 ? 58.601 -2.518  78.581  1.00 81.27 ? 207 THR B CG2 1 
ATOM   6292 N N   . SER D 2 207 ? 61.784 -0.979  76.390  1.00 83.70 ? 208 SER B N   1 
ATOM   6293 C CA  . SER D 2 207 ? 63.166 -0.801  76.820  1.00 83.16 ? 208 SER B CA  1 
ATOM   6294 C C   . SER D 2 207 ? 63.707 0.553   76.354  1.00 81.21 ? 208 SER B C   1 
ATOM   6295 O O   . SER D 2 207 ? 63.769 0.828   75.155  1.00 81.67 ? 208 SER B O   1 
ATOM   6296 C CB  . SER D 2 207 ? 64.036 -1.936  76.264  1.00 84.02 ? 208 SER B CB  1 
ATOM   6297 O OG  . SER D 2 207 ? 63.885 -2.060  74.858  1.00 85.92 ? 208 SER B OG  1 
ATOM   6298 N N   . PRO D 2 208 ? 64.098 1.418   77.307  1.00 79.68 ? 209 PRO B N   1 
ATOM   6299 C CA  . PRO D 2 208 ? 64.638 2.757   77.042  1.00 77.78 ? 209 PRO B CA  1 
ATOM   6300 C C   . PRO D 2 208 ? 65.928 2.789   76.219  1.00 77.19 ? 209 PRO B C   1 
ATOM   6301 O O   . PRO D 2 208 ? 66.812 1.948   76.394  1.00 76.39 ? 209 PRO B O   1 
ATOM   6302 C CB  . PRO D 2 208 ? 64.849 3.324   78.446  1.00 77.02 ? 209 PRO B CB  1 
ATOM   6303 C CG  . PRO D 2 208 ? 63.778 2.646   79.245  1.00 77.55 ? 209 PRO B CG  1 
ATOM   6304 C CD  . PRO D 2 208 ? 63.881 1.227   78.753  1.00 78.49 ? 209 PRO B CD  1 
ATOM   6305 N N   . ILE D 2 209 ? 66.022 3.767   75.319  1.00 76.20 ? 210 ILE B N   1 
ATOM   6306 C CA  . ILE D 2 209 ? 67.207 3.938   74.481  1.00 73.88 ? 210 ILE B CA  1 
ATOM   6307 C C   . ILE D 2 209 ? 68.136 4.904   75.201  1.00 73.13 ? 210 ILE B C   1 
ATOM   6308 O O   . ILE D 2 209 ? 68.063 6.115   74.997  1.00 71.17 ? 210 ILE B O   1 
ATOM   6309 C CB  . ILE D 2 209 ? 66.856 4.534   73.097  1.00 72.18 ? 210 ILE B CB  1 
ATOM   6310 C CG1 . ILE D 2 209 ? 65.941 3.577   72.333  1.00 70.85 ? 210 ILE B CG1 1 
ATOM   6311 C CG2 . ILE D 2 209 ? 68.133 4.793   72.305  1.00 70.02 ? 210 ILE B CG2 1 
ATOM   6312 C CD1 . ILE D 2 209 ? 65.596 4.043   70.931  1.00 72.51 ? 210 ILE B CD1 1 
ATOM   6313 N N   . VAL D 2 210 ? 69.003 4.359   76.047  1.00 73.03 ? 211 VAL B N   1 
ATOM   6314 C CA  . VAL D 2 210 ? 69.934 5.170   76.817  1.00 73.34 ? 211 VAL B CA  1 
ATOM   6315 C C   . VAL D 2 210 ? 71.208 5.543   76.064  1.00 72.88 ? 211 VAL B C   1 
ATOM   6316 O O   . VAL D 2 210 ? 71.643 4.836   75.154  1.00 73.80 ? 211 VAL B O   1 
ATOM   6317 C CB  . VAL D 2 210 ? 70.340 4.455   78.127  1.00 72.91 ? 211 VAL B CB  1 
ATOM   6318 C CG1 . VAL D 2 210 ? 69.114 4.218   78.996  1.00 71.25 ? 211 VAL B CG1 1 
ATOM   6319 C CG2 . VAL D 2 210 ? 71.030 3.138   77.806  1.00 71.97 ? 211 VAL B CG2 1 
ATOM   6320 N N   . LYS D 2 211 ? 71.788 6.673   76.460  1.00 71.24 ? 212 LYS B N   1 
ATOM   6321 C CA  . LYS D 2 211 ? 73.025 7.189   75.885  1.00 67.41 ? 212 LYS B CA  1 
ATOM   6322 C C   . LYS D 2 211 ? 73.736 7.987   76.967  1.00 66.68 ? 212 LYS B C   1 
ATOM   6323 O O   . LYS D 2 211 ? 73.113 8.774   77.676  1.00 64.59 ? 212 LYS B O   1 
ATOM   6324 C CB  . LYS D 2 211 ? 72.737 8.092   74.683  1.00 65.20 ? 212 LYS B CB  1 
ATOM   6325 C CG  . LYS D 2 211 ? 72.380 7.348   73.407  1.00 64.52 ? 212 LYS B CG  1 
ATOM   6326 C CD  . LYS D 2 211 ? 73.445 6.320   73.050  1.00 62.53 ? 212 LYS B CD  1 
ATOM   6327 C CE  . LYS D 2 211 ? 73.236 5.766   71.654  1.00 59.30 ? 212 LYS B CE  1 
ATOM   6328 N NZ  . LYS D 2 211 ? 73.516 6.804   70.627  1.00 60.14 ? 212 LYS B NZ  1 
ATOM   6329 N N   . SER D 2 212 ? 75.040 7.785   77.098  1.00 66.31 ? 213 SER B N   1 
ATOM   6330 C CA  . SER D 2 212 ? 75.801 8.490   78.119  1.00 67.52 ? 213 SER B CA  1 
ATOM   6331 C C   . SER D 2 212 ? 77.280 8.537   77.784  1.00 66.16 ? 213 SER B C   1 
ATOM   6332 O O   . SER D 2 212 ? 77.733 7.883   76.847  1.00 65.99 ? 213 SER B O   1 
ATOM   6333 C CB  . SER D 2 212 ? 75.605 7.808   79.477  1.00 68.96 ? 213 SER B CB  1 
ATOM   6334 O OG  . SER D 2 212 ? 76.024 6.455   79.439  1.00 71.48 ? 213 SER B OG  1 
ATOM   6335 N N   . PHE D 2 213 ? 78.030 9.313   78.556  1.00 65.06 ? 214 PHE B N   1 
ATOM   6336 C CA  . PHE D 2 213 ? 79.465 9.429   78.337  1.00 67.92 ? 214 PHE B CA  1 
ATOM   6337 C C   . PHE D 2 213 ? 80.208 9.533   79.666  1.00 69.20 ? 214 PHE B C   1 
ATOM   6338 O O   . PHE D 2 213 ? 79.530 9.745   80.693  1.00 67.88 ? 214 PHE B O   1 
ATOM   6339 C CB  . PHE D 2 213 ? 79.765 10.654  77.467  1.00 68.62 ? 214 PHE B CB  1 
ATOM   6340 C CG  . PHE D 2 213 ? 79.359 11.957  78.091  1.00 68.41 ? 214 PHE B CG  1 
ATOM   6341 C CD1 . PHE D 2 213 ? 80.123 12.528  79.107  1.00 67.79 ? 214 PHE B CD1 1 
ATOM   6342 C CD2 . PHE D 2 213 ? 78.209 12.610  77.669  1.00 69.60 ? 214 PHE B CD2 1 
ATOM   6343 C CE1 . PHE D 2 213 ? 79.750 13.732  79.689  1.00 69.40 ? 214 PHE B CE1 1 
ATOM   6344 C CE2 . PHE D 2 213 ? 77.824 13.815  78.244  1.00 71.10 ? 214 PHE B CE2 1 
ATOM   6345 C CZ  . PHE D 2 213 ? 78.598 14.378  79.259  1.00 70.63 ? 214 PHE B CZ  1 
ATOM   6346 O OXT . PHE D 2 213 ? 81.453 9.408   79.659  1.00 68.10 ? 214 PHE B OXT 1 
HETATM 6347 O O   . HOH E 3 .   ? 62.789 -5.417  -35.235 1.00 27.95 ? 215 HOH H O   1 
HETATM 6348 O O   . HOH E 3 .   ? 48.179 -3.362  -44.366 1.00 39.55 ? 216 HOH H O   1 
HETATM 6349 O O   . HOH E 3 .   ? 62.072 -4.885  -31.320 1.00 22.86 ? 217 HOH H O   1 
HETATM 6350 O O   . HOH E 3 .   ? 64.624 1.180   -20.623 1.00 36.16 ? 218 HOH H O   1 
HETATM 6351 O O   . HOH E 3 .   ? 53.257 1.740   -35.244 1.00 28.31 ? 219 HOH H O   1 
HETATM 6352 O O   . HOH E 3 .   ? 70.616 11.687  -19.717 1.00 41.08 ? 220 HOH H O   1 
HETATM 6353 O O   . HOH E 3 .   ? 69.770 -14.741 -33.470 1.00 51.72 ? 221 HOH H O   1 
HETATM 6354 O O   . HOH E 3 .   ? 49.659 -12.366 -35.524 1.00 52.55 ? 222 HOH H O   1 
HETATM 6355 O O   . HOH E 3 .   ? 22.614 22.344  -22.436 1.00 42.45 ? 223 HOH H O   1 
HETATM 6356 O O   . HOH E 3 .   ? 63.917 -16.917 -21.970 1.00 27.32 ? 224 HOH H O   1 
HETATM 6357 O O   . HOH E 3 .   ? 47.969 -13.840 -11.057 1.00 44.59 ? 225 HOH H O   1 
HETATM 6358 O O   . HOH E 3 .   ? 57.815 -15.599 -16.700 1.00 42.97 ? 226 HOH H O   1 
HETATM 6359 O O   . HOH E 3 .   ? 32.368 -1.342  -20.919 1.00 61.72 ? 227 HOH H O   1 
HETATM 6360 O O   . HOH E 3 .   ? 46.348 -2.904  -28.657 1.00 57.77 ? 228 HOH H O   1 
HETATM 6361 O O   . HOH E 3 .   ? 60.949 -18.716 -37.064 1.00 66.72 ? 229 HOH H O   1 
HETATM 6362 O O   . HOH E 3 .   ? 47.180 -16.842 -36.252 1.00 67.14 ? 230 HOH H O   1 
HETATM 6363 O O   . HOH E 3 .   ? 39.242 17.278  -12.061 1.00 57.83 ? 231 HOH H O   1 
HETATM 6364 O O   . HOH E 3 .   ? 56.221 -1.523  -44.152 1.00 31.76 ? 232 HOH H O   1 
HETATM 6365 O O   . HOH E 3 .   ? 29.030 29.813  -18.702 1.00 59.22 ? 233 HOH H O   1 
HETATM 6366 O O   . HOH E 3 .   ? 56.875 -15.256 -37.802 1.00 42.43 ? 234 HOH H O   1 
HETATM 6367 O O   . HOH E 3 .   ? 71.011 -2.994  -12.538 1.00 47.19 ? 235 HOH H O   1 
HETATM 6368 O O   . HOH E 3 .   ? 58.452 2.245   -43.210 1.00 47.65 ? 236 HOH H O   1 
HETATM 6369 O O   . HOH E 3 .   ? 70.864 -6.763  -20.229 1.00 60.91 ? 237 HOH H O   1 
HETATM 6370 O O   . HOH E 3 .   ? 68.719 9.751   -20.443 1.00 29.92 ? 238 HOH H O   1 
HETATM 6371 O O   . HOH E 3 .   ? 61.879 -0.923  -41.787 1.00 43.02 ? 239 HOH H O   1 
HETATM 6372 O O   . HOH E 3 .   ? 60.335 -10.138 -41.581 1.00 50.63 ? 240 HOH H O   1 
HETATM 6373 O O   . HOH E 3 .   ? 27.692 3.766   -12.166 1.00 54.55 ? 241 HOH H O   1 
HETATM 6374 O O   . HOH E 3 .   ? 67.901 -11.040 -34.901 1.00 37.92 ? 242 HOH H O   1 
HETATM 6375 O O   . HOH E 3 .   ? 61.697 -8.261  -43.193 1.00 40.87 ? 243 HOH H O   1 
HETATM 6376 O O   . HOH E 3 .   ? 71.987 -8.542  -30.784 1.00 64.07 ? 244 HOH H O   1 
HETATM 6377 O O   . HOH E 3 .   ? 60.158 -16.984 -14.616 1.00 55.97 ? 245 HOH H O   1 
HETATM 6378 O O   . HOH E 3 .   ? 44.125 -4.863  -24.071 1.00 35.28 ? 246 HOH H O   1 
HETATM 6379 O O   . HOH E 3 .   ? 58.215 -21.564 -32.233 1.00 52.03 ? 247 HOH H O   1 
HETATM 6380 O O   . HOH E 3 .   ? 46.925 -2.576  -31.147 1.00 75.01 ? 248 HOH H O   1 
HETATM 6381 O O   . HOH E 3 .   ? 18.648 23.059  -23.230 1.00 78.11 ? 249 HOH H O   1 
HETATM 6382 O O   . HOH E 3 .   ? 67.014 -9.679  -37.564 1.00 41.56 ? 250 HOH H O   1 
HETATM 6383 O O   . HOH E 3 .   ? 49.823 6.680   -19.700 1.00 75.31 ? 251 HOH H O   1 
HETATM 6384 O O   . HOH E 3 .   ? 24.726 12.763  -28.424 1.00 62.83 ? 252 HOH H O   1 
HETATM 6385 O O   . HOH E 3 .   ? 34.012 8.306   -11.410 1.00 82.55 ? 253 HOH H O   1 
HETATM 6386 O O   . HOH E 3 .   ? 28.650 32.385  -20.313 1.00 57.91 ? 254 HOH H O   1 
HETATM 6387 O O   . HOH E 3 .   ? 63.651 -12.432 -44.006 1.00 43.44 ? 255 HOH H O   1 
HETATM 6388 O O   . HOH E 3 .   ? 46.760 -9.639  -29.341 1.00 65.62 ? 256 HOH H O   1 
HETATM 6389 O O   . HOH E 3 .   ? 48.702 -20.505 -24.516 1.00 67.46 ? 257 HOH H O   1 
HETATM 6390 O O   . HOH E 3 .   ? 57.900 4.552   -43.634 1.00 50.12 ? 258 HOH H O   1 
HETATM 6391 O O   . HOH E 3 .   ? 59.103 -1.116  -42.884 1.00 32.16 ? 259 HOH H O   1 
HETATM 6392 O O   . HOH E 3 .   ? 69.557 -11.099 -20.571 1.00 31.90 ? 260 HOH H O   1 
HETATM 6393 O O   . HOH E 3 .   ? 55.097 3.616   -36.514 1.00 36.30 ? 261 HOH H O   1 
HETATM 6394 O O   . HOH E 3 .   ? 41.392 8.612   -16.453 1.00 53.62 ? 262 HOH H O   1 
HETATM 6395 O O   . HOH E 3 .   ? 47.263 -4.048  -42.029 1.00 70.69 ? 263 HOH H O   1 
HETATM 6396 O O   . HOH E 3 .   ? 69.329 -4.099  -16.360 1.00 41.89 ? 264 HOH H O   1 
HETATM 6397 O O   . HOH E 3 .   ? 55.956 -4.410  -42.985 1.00 36.11 ? 265 HOH H O   1 
HETATM 6398 O O   . HOH E 3 .   ? 33.005 21.135  -28.818 1.00 59.89 ? 266 HOH H O   1 
HETATM 6399 O O   . HOH E 3 .   ? 64.138 3.697   -20.685 1.00 53.38 ? 267 HOH H O   1 
HETATM 6400 O O   . HOH E 3 .   ? 31.559 -3.696  -20.739 1.00 68.70 ? 268 HOH H O   1 
HETATM 6401 O O   . HOH E 3 .   ? 34.868 27.380  -20.332 1.00 45.76 ? 269 HOH H O   1 
HETATM 6402 O O   . HOH E 3 .   ? 18.226 24.849  -29.284 1.00 66.93 ? 270 HOH H O   1 
HETATM 6403 O O   . HOH E 3 .   ? 38.874 -3.735  -12.961 1.00 59.34 ? 271 HOH H O   1 
HETATM 6404 O O   . HOH E 3 .   ? 43.241 1.480   -11.355 1.00 67.82 ? 272 HOH H O   1 
HETATM 6405 O O   . HOH E 3 .   ? 58.477 -3.775  -42.703 1.00 30.27 ? 273 HOH H O   1 
HETATM 6406 O O   . HOH E 3 .   ? 63.031 -3.633  -40.108 1.00 47.05 ? 274 HOH H O   1 
HETATM 6407 O O   . HOH E 3 .   ? 54.070 1.804   -12.586 1.00 41.23 ? 275 HOH H O   1 
HETATM 6408 O O   . HOH E 3 .   ? 20.773 19.117  -22.586 1.00 57.61 ? 276 HOH H O   1 
HETATM 6409 O O   . HOH E 3 .   ? 66.361 1.580   -38.361 1.00 67.37 ? 277 HOH H O   1 
HETATM 6410 O O   . HOH E 3 .   ? 64.684 -0.710  -18.410 1.00 54.02 ? 278 HOH H O   1 
HETATM 6411 O O   . HOH E 3 .   ? 64.019 -3.135  -42.603 1.00 49.05 ? 279 HOH H O   1 
HETATM 6412 O O   . HOH E 3 .   ? 70.969 -7.910  -22.962 1.00 51.78 ? 280 HOH H O   1 
HETATM 6413 O O   . HOH E 3 .   ? 28.817 31.329  -15.099 1.00 57.36 ? 281 HOH H O   1 
HETATM 6414 O O   . HOH E 3 .   ? 33.541 -5.159  -17.869 1.00 61.98 ? 282 HOH H O   1 
HETATM 6415 O O   . HOH E 3 .   ? 60.398 -19.532 -19.405 1.00 62.38 ? 283 HOH H O   1 
HETATM 6416 O O   . HOH E 3 .   ? 53.445 -15.241 -10.370 1.00 48.86 ? 284 HOH H O   1 
HETATM 6417 O O   . HOH E 3 .   ? 31.050 19.123  -28.552 1.00 66.93 ? 285 HOH H O   1 
HETATM 6418 O O   . HOH E 3 .   ? 41.787 12.547  -17.866 1.00 60.02 ? 286 HOH H O   1 
HETATM 6419 O O   . HOH E 3 .   ? 31.805 29.412  -21.577 1.00 57.92 ? 287 HOH H O   1 
HETATM 6420 O O   . HOH E 3 .   ? 60.235 -18.562 -28.442 1.00 52.48 ? 288 HOH H O   1 
HETATM 6421 O O   . HOH E 3 .   ? 50.973 7.114   -22.924 1.00 56.86 ? 289 HOH H O   1 
HETATM 6422 O O   . HOH E 3 .   ? 56.998 -16.422 -23.409 1.00 42.42 ? 290 HOH H O   1 
HETATM 6423 O O   . HOH E 3 .   ? 35.631 15.689  -29.882 1.00 60.50 ? 291 HOH H O   1 
HETATM 6424 O O   . HOH E 3 .   ? 67.916 -11.701 -39.354 1.00 59.03 ? 292 HOH H O   1 
HETATM 6425 O O   . HOH E 3 .   ? 72.361 -16.655 -32.579 1.00 50.87 ? 293 HOH H O   1 
HETATM 6426 O O   . HOH F 3 .   ? 60.484 0.470   -29.822 1.00 36.40 ? 215 HOH L O   1 
HETATM 6427 O O   . HOH F 3 .   ? 65.204 2.603   -28.668 1.00 23.62 ? 216 HOH L O   1 
HETATM 6428 O O   . HOH F 3 .   ? 66.191 4.244   -22.103 1.00 21.37 ? 217 HOH L O   1 
HETATM 6429 O O   . HOH F 3 .   ? 59.542 27.458  -39.386 1.00 32.95 ? 218 HOH L O   1 
HETATM 6430 O O   . HOH F 3 .   ? 71.034 21.043  -31.365 1.00 32.15 ? 219 HOH L O   1 
HETATM 6431 O O   . HOH F 3 .   ? 73.423 1.151   -22.483 1.00 31.98 ? 220 HOH L O   1 
HETATM 6432 O O   . HOH F 3 .   ? 68.827 6.988   -22.865 1.00 18.98 ? 221 HOH L O   1 
HETATM 6433 O O   . HOH F 3 .   ? 66.957 12.180  -22.136 1.00 30.87 ? 222 HOH L O   1 
HETATM 6434 O O   . HOH F 3 .   ? 49.203 24.434  -29.182 1.00 23.54 ? 223 HOH L O   1 
HETATM 6435 O O   . HOH F 3 .   ? 58.151 8.677   -45.921 1.00 36.07 ? 224 HOH L O   1 
HETATM 6436 O O   . HOH F 3 .   ? 59.941 31.645  -32.221 1.00 47.28 ? 225 HOH L O   1 
HETATM 6437 O O   . HOH F 3 .   ? 78.911 -0.137  -37.656 1.00 40.76 ? 226 HOH L O   1 
HETATM 6438 O O   . HOH F 3 .   ? 38.977 35.597  -8.473  1.00 63.47 ? 227 HOH L O   1 
HETATM 6439 O O   . HOH F 3 .   ? 43.282 25.250  -22.481 1.00 34.89 ? 228 HOH L O   1 
HETATM 6440 O O   . HOH F 3 .   ? 55.227 11.534  -44.203 1.00 25.63 ? 229 HOH L O   1 
HETATM 6441 O O   . HOH F 3 .   ? 64.661 14.826  -42.100 1.00 30.52 ? 230 HOH L O   1 
HETATM 6442 O O   . HOH F 3 .   ? 52.171 21.113  -20.257 1.00 32.00 ? 231 HOH L O   1 
HETATM 6443 O O   . HOH F 3 .   ? 62.009 21.075  -40.438 1.00 25.59 ? 232 HOH L O   1 
HETATM 6444 O O   . HOH F 3 .   ? 61.519 16.511  -43.980 1.00 42.48 ? 233 HOH L O   1 
HETATM 6445 O O   . HOH F 3 .   ? 48.383 10.084  -23.757 1.00 44.38 ? 234 HOH L O   1 
HETATM 6446 O O   . HOH F 3 .   ? 63.399 30.173  -21.625 1.00 43.33 ? 235 HOH L O   1 
HETATM 6447 O O   . HOH F 3 .   ? 73.648 8.361   -42.155 1.00 22.82 ? 236 HOH L O   1 
HETATM 6448 O O   . HOH F 3 .   ? 44.814 19.813  -26.495 1.00 41.24 ? 237 HOH L O   1 
HETATM 6449 O O   . HOH F 3 .   ? 78.631 11.152  -27.733 1.00 30.12 ? 238 HOH L O   1 
HETATM 6450 O O   . HOH F 3 .   ? 66.482 18.825  -26.117 1.00 32.11 ? 239 HOH L O   1 
HETATM 6451 O O   . HOH F 3 .   ? 65.827 4.498   -37.109 1.00 27.27 ? 240 HOH L O   1 
HETATM 6452 O O   . HOH F 3 .   ? 41.418 40.761  -13.901 1.00 60.47 ? 241 HOH L O   1 
HETATM 6453 O O   . HOH F 3 .   ? 37.738 21.763  2.286   1.00 71.98 ? 242 HOH L O   1 
HETATM 6454 O O   . HOH F 3 .   ? 39.434 19.398  -9.510  1.00 34.01 ? 243 HOH L O   1 
HETATM 6455 O O   . HOH F 3 .   ? 58.592 32.575  -29.015 1.00 41.20 ? 244 HOH L O   1 
HETATM 6456 O O   . HOH F 3 .   ? 52.326 25.197  -40.729 1.00 44.51 ? 245 HOH L O   1 
HETATM 6457 O O   . HOH F 3 .   ? 70.180 7.424   -41.903 1.00 32.92 ? 246 HOH L O   1 
HETATM 6458 O O   . HOH F 3 .   ? 53.359 5.775   -35.373 1.00 35.64 ? 247 HOH L O   1 
HETATM 6459 O O   . HOH F 3 .   ? 52.190 9.586   -45.685 1.00 37.74 ? 248 HOH L O   1 
HETATM 6460 O O   . HOH F 3 .   ? 67.718 19.360  -37.817 1.00 53.27 ? 249 HOH L O   1 
HETATM 6461 O O   . HOH F 3 .   ? 72.397 5.945   -27.155 1.00 50.85 ? 250 HOH L O   1 
HETATM 6462 O O   . HOH F 3 .   ? 48.406 26.969  -35.932 1.00 28.94 ? 251 HOH L O   1 
HETATM 6463 O O   . HOH F 3 .   ? 49.208 18.286  -30.096 1.00 57.82 ? 252 HOH L O   1 
HETATM 6464 O O   . HOH F 3 .   ? 61.367 21.395  -43.658 1.00 59.81 ? 253 HOH L O   1 
HETATM 6465 O O   . HOH F 3 .   ? 73.611 12.058  -24.389 1.00 84.74 ? 254 HOH L O   1 
HETATM 6466 O O   . HOH F 3 .   ? 42.248 18.749  -0.934  1.00 68.83 ? 255 HOH L O   1 
HETATM 6467 O O   . HOH F 3 .   ? 52.033 6.442   -41.722 1.00 37.96 ? 256 HOH L O   1 
HETATM 6468 O O   . HOH F 3 .   ? 44.015 22.382  -22.711 1.00 42.79 ? 257 HOH L O   1 
HETATM 6469 O O   . HOH F 3 .   ? 62.504 31.423  -28.199 1.00 33.86 ? 258 HOH L O   1 
HETATM 6470 O O   . HOH F 3 .   ? 61.152 11.180  -45.697 1.00 28.14 ? 259 HOH L O   1 
HETATM 6471 O O   . HOH F 3 .   ? 61.167 11.629  -18.953 1.00 46.29 ? 260 HOH L O   1 
HETATM 6472 O O   . HOH F 3 .   ? 72.790 18.298  -34.956 1.00 57.00 ? 261 HOH L O   1 
HETATM 6473 O O   . HOH F 3 .   ? 45.009 43.226  -17.500 1.00 50.61 ? 262 HOH L O   1 
HETATM 6474 O O   . HOH F 3 .   ? 33.676 25.386  6.362   1.00 74.01 ? 263 HOH L O   1 
HETATM 6475 O O   . HOH F 3 .   ? 79.720 16.138  -30.336 1.00 28.59 ? 264 HOH L O   1 
HETATM 6476 O O   . HOH F 3 .   ? 74.471 6.424   -39.813 1.00 86.67 ? 265 HOH L O   1 
HETATM 6477 O O   . HOH F 3 .   ? 59.777 14.979  -20.480 1.00 41.54 ? 266 HOH L O   1 
HETATM 6478 O O   . HOH F 3 .   ? 71.999 -1.693  -36.586 1.00 45.18 ? 267 HOH L O   1 
HETATM 6479 O O   . HOH F 3 .   ? 54.098 11.461  -36.242 1.00 83.84 ? 268 HOH L O   1 
HETATM 6480 O O   . HOH F 3 .   ? 40.549 32.289  0.455   1.00 74.40 ? 269 HOH L O   1 
HETATM 6481 O O   . HOH F 3 .   ? 67.536 -0.869  -36.571 1.00 42.27 ? 270 HOH L O   1 
HETATM 6482 O O   . HOH F 3 .   ? 65.873 21.831  -26.721 1.00 41.51 ? 271 HOH L O   1 
HETATM 6483 O O   . HOH F 3 .   ? 64.312 14.970  -21.337 1.00 24.07 ? 272 HOH L O   1 
HETATM 6484 O O   . HOH F 3 .   ? 55.006 32.947  -29.976 1.00 53.67 ? 273 HOH L O   1 
HETATM 6485 O O   . HOH F 3 .   ? 78.834 11.699  -24.686 1.00 26.38 ? 274 HOH L O   1 
HETATM 6486 O O   . HOH F 3 .   ? 54.947 12.136  -22.549 1.00 41.46 ? 275 HOH L O   1 
HETATM 6487 O O   . HOH F 3 .   ? 54.149 7.062   -40.874 1.00 55.56 ? 276 HOH L O   1 
HETATM 6488 O O   . HOH F 3 .   ? 51.229 15.861  -18.038 1.00 33.85 ? 277 HOH L O   1 
HETATM 6489 O O   . HOH F 3 .   ? 72.681 -0.962  -21.574 1.00 46.57 ? 278 HOH L O   1 
HETATM 6490 O O   . HOH F 3 .   ? 78.402 13.536  -28.576 1.00 42.70 ? 279 HOH L O   1 
HETATM 6491 O O   . HOH F 3 .   ? 74.243 -2.758  -34.587 1.00 49.44 ? 280 HOH L O   1 
HETATM 6492 O O   . HOH F 3 .   ? 74.153 -0.999  -26.464 1.00 34.46 ? 281 HOH L O   1 
HETATM 6493 O O   . HOH F 3 .   ? 52.101 32.449  -31.119 1.00 41.30 ? 282 HOH L O   1 
HETATM 6494 O O   . HOH F 3 .   ? 62.008 33.469  -30.912 1.00 45.69 ? 283 HOH L O   1 
HETATM 6495 O O   . HOH F 3 .   ? 62.270 -1.194  -29.569 1.00 44.32 ? 284 HOH L O   1 
HETATM 6496 O O   . HOH F 3 .   ? 67.904 25.762  -40.740 1.00 56.16 ? 285 HOH L O   1 
HETATM 6497 O O   . HOH F 3 .   ? 50.699 20.688  -25.060 1.00 69.79 ? 286 HOH L O   1 
HETATM 6498 O O   . HOH F 3 .   ? 77.480 4.445   -25.162 1.00 36.68 ? 287 HOH L O   1 
HETATM 6499 O O   . HOH F 3 .   ? 68.149 24.116  -36.171 1.00 58.70 ? 288 HOH L O   1 
HETATM 6500 O O   . HOH F 3 .   ? 41.647 25.605  5.073   1.00 49.10 ? 289 HOH L O   1 
HETATM 6501 O O   . HOH F 3 .   ? 55.860 28.421  -35.007 1.00 71.58 ? 290 HOH L O   1 
HETATM 6502 O O   . HOH F 3 .   ? 76.300 -1.120  -33.502 1.00 35.53 ? 291 HOH L O   1 
HETATM 6503 O O   . HOH F 3 .   ? 39.023 16.486  -8.955  1.00 57.26 ? 292 HOH L O   1 
HETATM 6504 O O   . HOH F 3 .   ? 34.613 29.346  6.399   1.00 51.40 ? 293 HOH L O   1 
HETATM 6505 O O   . HOH F 3 .   ? 40.428 27.409  -26.926 1.00 64.41 ? 294 HOH L O   1 
HETATM 6506 O O   . HOH F 3 .   ? 53.547 8.168   -37.974 1.00 41.19 ? 295 HOH L O   1 
HETATM 6507 O O   . HOH F 3 .   ? 72.105 0.550   -25.605 1.00 36.21 ? 296 HOH L O   1 
HETATM 6508 O O   . HOH F 3 .   ? 78.182 3.267   -34.852 1.00 46.69 ? 297 HOH L O   1 
HETATM 6509 O O   . HOH F 3 .   ? 23.951 29.805  -2.633  1.00 48.10 ? 298 HOH L O   1 
HETATM 6510 O O   . HOH F 3 .   ? 68.420 15.791  -20.189 1.00 42.89 ? 299 HOH L O   1 
HETATM 6511 O O   . HOH F 3 .   ? 58.793 11.659  -47.577 1.00 46.69 ? 300 HOH L O   1 
HETATM 6512 O O   . HOH F 3 .   ? 19.504 16.285  -3.704  1.00 41.50 ? 301 HOH L O   1 
HETATM 6513 O O   . HOH F 3 .   ? 51.735 18.149  -35.834 1.00 40.53 ? 302 HOH L O   1 
HETATM 6514 O O   . HOH F 3 .   ? 62.522 30.254  -35.274 1.00 39.69 ? 303 HOH L O   1 
HETATM 6515 O O   . HOH F 3 .   ? 64.645 23.780  -27.699 1.00 37.73 ? 304 HOH L O   1 
HETATM 6516 O O   . HOH F 3 .   ? 71.000 -3.219  -38.335 1.00 49.15 ? 305 HOH L O   1 
HETATM 6517 O O   . HOH F 3 .   ? 28.114 16.992  -7.985  1.00 53.65 ? 306 HOH L O   1 
HETATM 6518 O O   . HOH F 3 .   ? 72.246 18.636  -31.099 1.00 37.49 ? 307 HOH L O   1 
HETATM 6519 O O   . HOH F 3 .   ? 74.915 11.196  -39.252 1.00 46.66 ? 308 HOH L O   1 
HETATM 6520 O O   . HOH F 3 .   ? 76.965 -0.115  -35.893 1.00 63.59 ? 309 HOH L O   1 
HETATM 6521 O O   . HOH F 3 .   ? 73.486 21.702  -30.963 1.00 54.41 ? 310 HOH L O   1 
HETATM 6522 O O   . HOH F 3 .   ? 39.358 39.933  -12.229 1.00 67.30 ? 311 HOH L O   1 
HETATM 6523 O O   . HOH F 3 .   ? 47.317 17.943  -12.988 1.00 52.21 ? 312 HOH L O   1 
HETATM 6524 O O   . HOH F 3 .   ? 72.252 14.714  -41.086 1.00 38.47 ? 313 HOH L O   1 
HETATM 6525 O O   . HOH F 3 .   ? 57.419 13.706  -19.742 1.00 53.13 ? 314 HOH L O   1 
HETATM 6526 O O   . HOH F 3 .   ? 76.080 12.178  -24.390 1.00 51.58 ? 315 HOH L O   1 
HETATM 6527 O O   . HOH F 3 .   ? 40.698 19.149  -11.633 1.00 76.05 ? 316 HOH L O   1 
HETATM 6528 O O   . HOH F 3 .   ? 69.173 23.660  -41.855 1.00 67.03 ? 317 HOH L O   1 
HETATM 6529 O O   . HOH F 3 .   ? 58.423 7.996   -24.314 1.00 41.33 ? 318 HOH L O   1 
HETATM 6530 O O   . HOH F 3 .   ? 47.029 23.665  -35.467 1.00 60.53 ? 319 HOH L O   1 
HETATM 6531 O O   . HOH F 3 .   ? 44.228 32.079  -9.258  1.00 60.92 ? 320 HOH L O   1 
HETATM 6532 O O   . HOH F 3 .   ? 59.504 14.902  -40.977 1.00 67.33 ? 321 HOH L O   1 
HETATM 6533 O O   . HOH F 3 .   ? 41.945 28.439  -1.985  1.00 61.07 ? 322 HOH L O   1 
HETATM 6534 O O   . HOH F 3 .   ? 58.728 17.446  -20.193 1.00 58.79 ? 323 HOH L O   1 
HETATM 6535 O O   . HOH F 3 .   ? 67.084 -0.583  -42.298 1.00 39.20 ? 324 HOH L O   1 
HETATM 6536 O O   . HOH F 3 .   ? 53.747 20.441  -44.715 1.00 53.68 ? 325 HOH L O   1 
HETATM 6537 O O   . HOH F 3 .   ? 78.754 -0.778  -28.671 1.00 64.23 ? 326 HOH L O   1 
HETATM 6538 O O   . HOH F 3 .   ? 53.687 22.843  -24.436 1.00 39.46 ? 327 HOH L O   1 
HETATM 6539 O O   . HOH F 3 .   ? 58.142 25.665  -36.709 1.00 68.69 ? 328 HOH L O   1 
HETATM 6540 O O   . HOH F 3 .   ? 60.904 7.670   -23.838 1.00 43.17 ? 329 HOH L O   1 
HETATM 6541 O O   . HOH F 3 .   ? 22.456 26.457  1.817   1.00 55.63 ? 330 HOH L O   1 
HETATM 6542 O O   . HOH F 3 .   ? 42.865 33.092  -29.018 1.00 58.80 ? 331 HOH L O   1 
HETATM 6543 O O   . HOH F 3 .   ? 29.749 14.393  7.798   1.00 55.07 ? 332 HOH L O   1 
HETATM 6544 O O   . HOH F 3 .   ? 51.520 28.413  -37.920 1.00 46.68 ? 333 HOH L O   1 
HETATM 6545 O O   . HOH F 3 .   ? 38.956 19.760  7.152   1.00 47.24 ? 334 HOH L O   1 
HETATM 6546 O O   . HOH F 3 .   ? 76.877 7.458   -45.046 1.00 49.73 ? 335 HOH L O   1 
HETATM 6547 O O   . HOH F 3 .   ? 50.740 10.957  -29.970 1.00 54.38 ? 336 HOH L O   1 
HETATM 6548 O O   . HOH G 3 .   ? 39.377 45.487  59.140  1.00 27.21 ? 215 HOH A O   1 
HETATM 6549 O O   . HOH G 3 .   ? 41.835 45.286  45.861  1.00 26.39 ? 216 HOH A O   1 
HETATM 6550 O O   . HOH G 3 .   ? 55.500 43.507  56.661  1.00 45.61 ? 217 HOH A O   1 
HETATM 6551 O O   . HOH G 3 .   ? 47.588 44.625  76.111  1.00 21.07 ? 218 HOH A O   1 
HETATM 6552 O O   . HOH G 3 .   ? 42.697 55.786  51.782  1.00 28.46 ? 219 HOH A O   1 
HETATM 6553 O O   . HOH G 3 .   ? 37.313 45.720  56.541  1.00 31.30 ? 220 HOH A O   1 
HETATM 6554 O O   . HOH G 3 .   ? 33.297 38.645  53.895  1.00 47.92 ? 221 HOH A O   1 
HETATM 6555 O O   . HOH G 3 .   ? 44.582 50.272  78.143  1.00 35.38 ? 222 HOH A O   1 
HETATM 6556 O O   . HOH G 3 .   ? 42.519 54.503  72.732  1.00 32.84 ? 223 HOH A O   1 
HETATM 6557 O O   . HOH G 3 .   ? 66.902 20.687  56.779  1.00 51.47 ? 224 HOH A O   1 
HETATM 6558 O O   . HOH G 3 .   ? 35.987 51.626  72.111  1.00 25.53 ? 225 HOH A O   1 
HETATM 6559 O O   . HOH G 3 .   ? 40.348 56.889  69.076  1.00 33.67 ? 226 HOH A O   1 
HETATM 6560 O O   . HOH G 3 .   ? 51.784 43.601  80.776  1.00 44.46 ? 227 HOH A O   1 
HETATM 6561 O O   . HOH G 3 .   ? 53.667 37.078  59.617  1.00 36.27 ? 228 HOH A O   1 
HETATM 6562 O O   . HOH G 3 .   ? 37.158 57.238  55.772  1.00 28.75 ? 229 HOH A O   1 
HETATM 6563 O O   . HOH G 3 .   ? 58.083 41.444  76.620  1.00 35.11 ? 230 HOH A O   1 
HETATM 6564 O O   . HOH G 3 .   ? 40.203 55.497  72.951  1.00 34.78 ? 231 HOH A O   1 
HETATM 6565 O O   . HOH G 3 .   ? 39.786 58.927  58.961  1.00 37.68 ? 232 HOH A O   1 
HETATM 6566 O O   . HOH G 3 .   ? 49.706 44.508  43.734  1.00 60.45 ? 233 HOH A O   1 
HETATM 6567 O O   . HOH G 3 .   ? 39.343 44.612  47.677  1.00 31.49 ? 234 HOH A O   1 
HETATM 6568 O O   . HOH G 3 .   ? 68.113 39.116  66.101  1.00 70.27 ? 235 HOH A O   1 
HETATM 6569 O O   . HOH G 3 .   ? 61.490 43.239  67.913  1.00 58.63 ? 236 HOH A O   1 
HETATM 6570 O O   . HOH G 3 .   ? 63.358 20.057  61.055  1.00 61.65 ? 237 HOH A O   1 
HETATM 6571 O O   . HOH G 3 .   ? 54.611 35.881  67.461  1.00 49.16 ? 238 HOH A O   1 
HETATM 6572 O O   . HOH G 3 .   ? 45.112 47.500  58.986  1.00 71.31 ? 239 HOH A O   1 
HETATM 6573 O O   . HOH G 3 .   ? 71.512 21.944  62.985  1.00 81.29 ? 240 HOH A O   1 
HETATM 6574 O O   . HOH G 3 .   ? 79.210 21.514  55.855  1.00 51.68 ? 241 HOH A O   1 
HETATM 6575 O O   . HOH G 3 .   ? 76.010 40.341  61.443  1.00 45.67 ? 242 HOH A O   1 
HETATM 6576 O O   . HOH G 3 .   ? 70.274 12.827  64.124  1.00 38.34 ? 243 HOH A O   1 
HETATM 6577 O O   . HOH G 3 .   ? 82.403 12.369  73.816  1.00 64.36 ? 244 HOH A O   1 
HETATM 6578 O O   . HOH G 3 .   ? 44.628 51.628  51.498  1.00 91.94 ? 245 HOH A O   1 
HETATM 6579 O O   . HOH G 3 .   ? 40.788 49.970  80.075  1.00 49.59 ? 246 HOH A O   1 
HETATM 6580 O O   . HOH G 3 .   ? 80.122 15.703  71.896  1.00 43.95 ? 247 HOH A O   1 
HETATM 6581 O O   . HOH G 3 .   ? 58.875 45.779  60.860  1.00 44.59 ? 248 HOH A O   1 
HETATM 6582 O O   . HOH G 3 .   ? 31.387 42.473  53.124  1.00 30.43 ? 249 HOH A O   1 
HETATM 6583 O O   . HOH G 3 .   ? 37.013 44.768  75.954  1.00 32.56 ? 250 HOH A O   1 
HETATM 6584 O O   . HOH G 3 .   ? 72.724 20.643  67.621  1.00 73.05 ? 251 HOH A O   1 
HETATM 6585 O O   . HOH G 3 .   ? 32.698 53.754  68.948  1.00 48.07 ? 252 HOH A O   1 
HETATM 6586 O O   . HOH G 3 .   ? 53.185 34.069  64.042  1.00 46.91 ? 253 HOH A O   1 
HETATM 6587 O O   . HOH G 3 .   ? 70.248 25.643  56.402  1.00 52.45 ? 254 HOH A O   1 
HETATM 6588 O O   . HOH G 3 .   ? 54.383 56.346  76.441  1.00 32.58 ? 255 HOH A O   1 
HETATM 6589 O O   . HOH G 3 .   ? 32.944 51.683  57.964  1.00 34.43 ? 256 HOH A O   1 
HETATM 6590 O O   . HOH G 3 .   ? 49.554 53.298  50.977  1.00 30.40 ? 257 HOH A O   1 
HETATM 6591 O O   . HOH G 3 .   ? 47.588 37.561  70.525  1.00 64.75 ? 258 HOH A O   1 
HETATM 6592 O O   . HOH G 3 .   ? 82.786 18.656  57.630  1.00 81.11 ? 259 HOH A O   1 
HETATM 6593 O O   . HOH G 3 .   ? 39.807 52.420  67.496  1.00 99.96 ? 260 HOH A O   1 
HETATM 6594 O O   . HOH G 3 .   ? 44.406 61.033  60.824  1.00 39.11 ? 261 HOH A O   1 
HETATM 6595 O O   . HOH G 3 .   ? 64.738 19.783  65.614  1.00 90.54 ? 262 HOH A O   1 
HETATM 6596 O O   . HOH G 3 .   ? 37.528 61.181  58.002  1.00 53.42 ? 263 HOH A O   1 
HETATM 6597 O O   . HOH G 3 .   ? 70.570 26.511  78.189  1.00 77.31 ? 264 HOH A O   1 
HETATM 6598 O O   . HOH G 3 .   ? 67.413 29.574  77.760  1.00 79.54 ? 265 HOH A O   1 
HETATM 6599 O O   . HOH G 3 .   ? 40.393 43.907  76.320  1.00 37.46 ? 266 HOH A O   1 
HETATM 6600 O O   . HOH G 3 .   ? 61.377 26.212  72.751  1.00 84.87 ? 267 HOH A O   1 
HETATM 6601 O O   . HOH G 3 .   ? 67.587 36.902  76.704  1.00 95.71 ? 268 HOH A O   1 
HETATM 6602 O O   . HOH G 3 .   ? 54.458 50.536  55.959  1.00 38.71 ? 269 HOH A O   1 
HETATM 6603 O O   . HOH G 3 .   ? 80.263 32.223  70.452  1.00 44.60 ? 270 HOH A O   1 
HETATM 6604 O O   . HOH G 3 .   ? 63.007 38.956  68.926  1.00 47.86 ? 271 HOH A O   1 
HETATM 6605 O O   . HOH G 3 .   ? 64.386 47.580  67.985  1.00 41.19 ? 272 HOH A O   1 
HETATM 6606 O O   . HOH G 3 .   ? 60.120 29.726  70.170  1.00 52.89 ? 273 HOH A O   1 
HETATM 6607 O O   . HOH G 3 .   ? 47.424 56.803  65.337  1.00 28.55 ? 274 HOH A O   1 
HETATM 6608 O O   . HOH G 3 .   ? 55.865 56.850  69.167  1.00 39.22 ? 275 HOH A O   1 
HETATM 6609 O O   . HOH G 3 .   ? 35.498 49.707  46.911  1.00 51.23 ? 276 HOH A O   1 
HETATM 6610 O O   . HOH G 3 .   ? 31.196 55.983  60.164  1.00 47.58 ? 277 HOH A O   1 
HETATM 6611 O O   . HOH G 3 .   ? 84.976 20.103  66.739  1.00 59.82 ? 278 HOH A O   1 
HETATM 6612 O O   . HOH G 3 .   ? 48.953 41.444  52.126  1.00 33.68 ? 279 HOH A O   1 
HETATM 6613 O O   . HOH G 3 .   ? 59.670 48.768  60.222  1.00 44.25 ? 280 HOH A O   1 
HETATM 6614 O O   . HOH G 3 .   ? 45.266 50.690  81.063  1.00 56.47 ? 281 HOH A O   1 
HETATM 6615 O O   . HOH G 3 .   ? 36.760 30.633  71.792  1.00 53.66 ? 282 HOH A O   1 
HETATM 6616 O O   . HOH G 3 .   ? 47.598 59.844  62.112  1.00 56.34 ? 283 HOH A O   1 
HETATM 6617 O O   . HOH G 3 .   ? 57.358 39.635  59.945  1.00 47.86 ? 284 HOH A O   1 
HETATM 6618 O O   . HOH G 3 .   ? 42.424 59.113  60.981  1.00 32.87 ? 285 HOH A O   1 
HETATM 6619 O O   . HOH G 3 .   ? 70.790 20.661  60.396  1.00 64.53 ? 286 HOH A O   1 
HETATM 6620 O O   . HOH G 3 .   ? 58.693 43.530  79.449  1.00 37.51 ? 287 HOH A O   1 
HETATM 6621 O O   . HOH G 3 .   ? 50.446 34.102  67.450  1.00 64.41 ? 288 HOH A O   1 
HETATM 6622 O O   . HOH G 3 .   ? 46.120 38.584  53.230  1.00 38.49 ? 289 HOH A O   1 
HETATM 6623 O O   . HOH G 3 .   ? 80.278 20.529  66.628  1.00 73.02 ? 290 HOH A O   1 
HETATM 6624 O O   . HOH G 3 .   ? 61.515 30.478  81.731  1.00 39.59 ? 291 HOH A O   1 
HETATM 6625 O O   . HOH G 3 .   ? 50.153 60.777  57.623  1.00 38.46 ? 292 HOH A O   1 
HETATM 6626 O O   . HOH G 3 .   ? 74.685 21.734  68.984  1.00 56.91 ? 293 HOH A O   1 
HETATM 6627 O O   . HOH G 3 .   ? 43.936 48.186  80.298  1.00 41.03 ? 294 HOH A O   1 
HETATM 6628 O O   . HOH G 3 .   ? 49.970 53.631  53.707  1.00 71.63 ? 295 HOH A O   1 
HETATM 6629 O O   . HOH G 3 .   ? 69.687 46.233  74.957  1.00 50.16 ? 296 HOH A O   1 
HETATM 6630 O O   . HOH G 3 .   ? 47.162 45.807  43.937  1.00 62.45 ? 297 HOH A O   1 
HETATM 6631 O O   . HOH G 3 .   ? 45.127 34.418  47.490  1.00 44.27 ? 298 HOH A O   1 
HETATM 6632 O O   . HOH G 3 .   ? 69.748 38.926  72.104  1.00 81.90 ? 299 HOH A O   1 
HETATM 6633 O O   . HOH G 3 .   ? 53.169 39.084  74.858  1.00 35.12 ? 300 HOH A O   1 
HETATM 6634 O O   . HOH G 3 .   ? 47.685 50.838  56.638  1.00 67.08 ? 301 HOH A O   1 
HETATM 6635 O O   . HOH G 3 .   ? 62.098 29.776  68.572  1.00 47.28 ? 302 HOH A O   1 
HETATM 6636 O O   . HOH G 3 .   ? 32.668 56.329  53.993  1.00 45.43 ? 303 HOH A O   1 
HETATM 6637 O O   . HOH G 3 .   ? 72.716 16.465  55.431  1.00 64.63 ? 304 HOH A O   1 
HETATM 6638 O O   . HOH G 3 .   ? 37.531 55.953  47.027  1.00 54.64 ? 305 HOH A O   1 
HETATM 6639 O O   . HOH G 3 .   ? 82.046 31.603  74.925  1.00 53.40 ? 306 HOH A O   1 
HETATM 6640 O O   . HOH G 3 .   ? 49.087 41.532  44.543  1.00 53.99 ? 307 HOH A O   1 
HETATM 6641 O O   . HOH G 3 .   ? 80.619 7.460   56.105  1.00 60.72 ? 308 HOH A O   1 
HETATM 6642 O O   . HOH G 3 .   ? 53.355 51.485  81.108  1.00 52.77 ? 309 HOH A O   1 
HETATM 6643 O O   . HOH G 3 .   ? 68.955 24.615  79.928  1.00 73.70 ? 310 HOH A O   1 
HETATM 6644 O O   . HOH G 3 .   ? 59.593 53.701  70.618  1.00 44.11 ? 311 HOH A O   1 
HETATM 6645 O O   . HOH G 3 .   ? 40.414 40.973  46.611  1.00 35.85 ? 312 HOH A O   1 
HETATM 6646 O O   . HOH G 3 .   ? 84.120 21.388  59.341  1.00 57.16 ? 313 HOH A O   1 
HETATM 6647 O O   . HOH G 3 .   ? 51.940 54.205  50.613  1.00 42.43 ? 314 HOH A O   1 
HETATM 6648 O O   . HOH G 3 .   ? 57.426 53.532  59.866  1.00 58.80 ? 315 HOH A O   1 
HETATM 6649 O O   . HOH G 3 .   ? 86.742 15.513  58.865  1.00 72.55 ? 316 HOH A O   1 
HETATM 6650 O O   . HOH G 3 .   ? 73.506 9.492   63.566  1.00 60.43 ? 317 HOH A O   1 
HETATM 6651 O O   . HOH G 3 .   ? 50.960 51.928  47.913  1.00 40.40 ? 318 HOH A O   1 
HETATM 6652 O O   . HOH G 3 .   ? 68.968 22.013  62.892  1.00 74.04 ? 319 HOH A O   1 
HETATM 6653 O O   . HOH G 3 .   ? 69.741 21.075  67.978  1.00 77.13 ? 320 HOH A O   1 
HETATM 6654 O O   . HOH G 3 .   ? 40.299 39.679  70.398  1.00 51.45 ? 321 HOH A O   1 
HETATM 6655 O O   . HOH G 3 .   ? 34.724 44.052  73.068  1.00 63.15 ? 322 HOH A O   1 
HETATM 6656 O O   . HOH G 3 .   ? 46.549 61.389  59.560  1.00 53.41 ? 323 HOH A O   1 
HETATM 6657 O O   . HOH G 3 .   ? 53.938 58.192  57.437  1.00 51.67 ? 324 HOH A O   1 
HETATM 6658 O O   . HOH G 3 .   ? 55.906 50.122  54.090  1.00 45.40 ? 325 HOH A O   1 
HETATM 6659 O O   . HOH G 3 .   ? 48.010 56.593  71.282  1.00 57.51 ? 326 HOH A O   1 
HETATM 6660 O O   . HOH H 3 .   ? 32.323 16.237  58.841  1.00 39.39 ? 215 HOH B O   1 
HETATM 6661 O O   . HOH H 3 .   ? 31.968 38.600  71.811  1.00 36.69 ? 216 HOH B O   1 
HETATM 6662 O O   . HOH H 3 .   ? 38.839 36.193  69.352  1.00 23.85 ? 217 HOH B O   1 
HETATM 6663 O O   . HOH H 3 .   ? 31.907 29.113  70.361  1.00 36.36 ? 218 HOH B O   1 
HETATM 6664 O O   . HOH H 3 .   ? 28.247 32.490  52.567  1.00 25.27 ? 219 HOH B O   1 
HETATM 6665 O O   . HOH H 3 .   ? 38.750 10.201  53.346  1.00 32.28 ? 220 HOH B O   1 
HETATM 6666 O O   . HOH H 3 .   ? 76.860 20.595  75.671  1.00 46.25 ? 221 HOH B O   1 
HETATM 6667 O O   . HOH H 3 .   ? 26.197 43.658  57.215  1.00 33.53 ? 222 HOH B O   1 
HETATM 6668 O O   . HOH H 3 .   ? 52.473 13.568  50.954  1.00 35.03 ? 223 HOH B O   1 
HETATM 6669 O O   . HOH H 3 .   ? 25.753 31.228  53.400  1.00 23.47 ? 224 HOH B O   1 
HETATM 6670 O O   . HOH H 3 .   ? 25.507 29.456  57.616  1.00 29.45 ? 225 HOH B O   1 
HETATM 6671 O O   . HOH H 3 .   ? 62.615 10.044  75.909  1.00 84.48 ? 226 HOH B O   1 
HETATM 6672 O O   . HOH H 3 .   ? 40.225 14.757  60.630  1.00 31.94 ? 227 HOH B O   1 
HETATM 6673 O O   . HOH H 3 .   ? 38.459 21.817  65.450  1.00 31.85 ? 228 HOH B O   1 
HETATM 6674 O O   . HOH H 3 .   ? 40.571 12.389  50.489  1.00 40.07 ? 229 HOH B O   1 
HETATM 6675 O O   . HOH H 3 .   ? 46.101 32.783  64.504  1.00 41.43 ? 230 HOH B O   1 
HETATM 6676 O O   . HOH H 3 .   ? 37.805 19.154  50.914  1.00 25.98 ? 231 HOH B O   1 
HETATM 6677 O O   . HOH H 3 .   ? 35.139 28.518  45.695  1.00 34.17 ? 232 HOH B O   1 
HETATM 6678 O O   . HOH H 3 .   ? 27.233 34.771  70.130  1.00 46.91 ? 233 HOH B O   1 
HETATM 6679 O O   . HOH H 3 .   ? 84.495 15.368  85.753  1.00 60.82 ? 234 HOH B O   1 
HETATM 6680 O O   . HOH H 3 .   ? 83.046 16.207  83.683  1.00 58.86 ? 235 HOH B O   1 
HETATM 6681 O O   . HOH H 3 .   ? 43.369 14.094  45.364  1.00 40.72 ? 236 HOH B O   1 
HETATM 6682 O O   . HOH H 3 .   ? 54.876 8.896   71.012  1.00 59.30 ? 237 HOH B O   1 
HETATM 6683 O O   . HOH H 3 .   ? 80.553 21.092  96.631  1.00 43.71 ? 238 HOH B O   1 
HETATM 6684 O O   . HOH H 3 .   ? 48.576 19.571  67.785  1.00 65.30 ? 239 HOH B O   1 
HETATM 6685 O O   . HOH H 3 .   ? 24.199 24.230  63.881  1.00 44.17 ? 240 HOH B O   1 
HETATM 6686 O O   . HOH H 3 .   ? 82.890 10.609  81.412  1.00 44.70 ? 241 HOH B O   1 
HETATM 6687 O O   . HOH H 3 .   ? 66.968 0.357   73.343  1.00 49.17 ? 242 HOH B O   1 
HETATM 6688 O O   . HOH H 3 .   ? 35.963 16.797  63.100  1.00 51.42 ? 243 HOH B O   1 
HETATM 6689 O O   . HOH H 3 .   ? 46.462 15.852  47.564  1.00 46.51 ? 244 HOH B O   1 
HETATM 6690 O O   . HOH H 3 .   ? 33.956 35.781  55.354  1.00 29.03 ? 245 HOH B O   1 
HETATM 6691 O O   . HOH H 3 .   ? 77.780 28.427  78.058  1.00 73.09 ? 246 HOH B O   1 
HETATM 6692 O O   . HOH H 3 .   ? 46.458 35.399  52.024  1.00 27.06 ? 247 HOH B O   1 
HETATM 6693 O O   . HOH H 3 .   ? 36.632 33.364  69.575  1.00 31.60 ? 248 HOH B O   1 
HETATM 6694 O O   . HOH H 3 .   ? 68.969 12.905  78.824  1.00 85.99 ? 249 HOH B O   1 
HETATM 6695 O O   . HOH H 3 .   ? 42.310 25.699  69.480  1.00 31.17 ? 250 HOH B O   1 
HETATM 6696 O O   . HOH H 3 .   ? 65.527 12.521  91.782  1.00 62.04 ? 251 HOH B O   1 
HETATM 6697 O O   . HOH H 3 .   ? 56.607 21.992  68.118  1.00 65.87 ? 252 HOH B O   1 
HETATM 6698 O O   . HOH H 3 .   ? 74.579 8.085   85.121  1.00 68.38 ? 253 HOH B O   1 
HETATM 6699 O O   . HOH H 3 .   ? 74.335 18.873  71.816  1.00 81.61 ? 254 HOH B O   1 
HETATM 6700 O O   . HOH H 3 .   ? 48.947 11.646  63.008  1.00 75.14 ? 255 HOH B O   1 
HETATM 6701 O O   . HOH H 3 .   ? 47.243 15.495  68.092  1.00 60.48 ? 256 HOH B O   1 
HETATM 6702 O O   . HOH H 3 .   ? 33.254 20.646  52.328  1.00 37.64 ? 257 HOH B O   1 
HETATM 6703 O O   . HOH H 3 .   ? 53.572 22.629  55.488  1.00 50.66 ? 258 HOH B O   1 
HETATM 6704 O O   . HOH H 3 .   ? 77.569 7.602   73.996  1.00 64.34 ? 259 HOH B O   1 
HETATM 6705 O O   . HOH H 3 .   ? 75.559 23.499  88.917  1.00 82.77 ? 260 HOH B O   1 
HETATM 6706 O O   . HOH H 3 .   ? 79.015 27.864  86.311  1.00 59.40 ? 261 HOH B O   1 
HETATM 6707 O O   . HOH H 3 .   ? 45.186 10.643  47.557  1.00 47.50 ? 262 HOH B O   1 
HETATM 6708 O O   . HOH H 3 .   ? 62.738 4.852   63.480  1.00 49.86 ? 263 HOH B O   1 
HETATM 6709 O O   . HOH H 3 .   ? 30.119 27.098  71.811  1.00 72.66 ? 264 HOH B O   1 
HETATM 6710 O O   . HOH H 3 .   ? 47.324 3.813   57.417  1.00 63.16 ? 265 HOH B O   1 
HETATM 6711 O O   . HOH H 3 .   ? 66.725 20.863  75.239  1.00 44.13 ? 266 HOH B O   1 
HETATM 6712 O O   . HOH H 3 .   ? 81.818 8.127   81.892  1.00 46.36 ? 267 HOH B O   1 
HETATM 6713 O O   . HOH H 3 .   ? 85.058 22.390  82.624  1.00 64.73 ? 268 HOH B O   1 
HETATM 6714 O O   . HOH H 3 .   ? 54.704 -0.077  69.927  1.00 56.35 ? 269 HOH B O   1 
HETATM 6715 O O   . HOH H 3 .   ? 27.385 23.826  53.628  1.00 67.65 ? 270 HOH B O   1 
HETATM 6716 O O   . HOH H 3 .   ? 22.198 32.626  66.220  1.00 40.45 ? 271 HOH B O   1 
HETATM 6717 O O   . HOH H 3 .   ? 35.783 18.421  67.059  1.00 43.40 ? 272 HOH B O   1 
HETATM 6718 O O   . HOH H 3 .   ? 69.043 6.787   81.872  1.00 75.61 ? 273 HOH B O   1 
HETATM 6719 O O   . HOH H 3 .   ? 38.400 13.416  47.791  1.00 39.82 ? 274 HOH B O   1 
HETATM 6720 O O   . HOH H 3 .   ? 60.063 23.677  71.823  1.00 60.56 ? 275 HOH B O   1 
HETATM 6721 O O   . HOH H 3 .   ? 57.902 16.867  69.861  1.00 81.21 ? 276 HOH B O   1 
HETATM 6722 O O   . HOH H 3 .   ? 58.580 21.041  59.235  1.00 64.80 ? 277 HOH B O   1 
HETATM 6723 O O   . HOH H 3 .   ? 28.230 17.245  55.814  1.00 36.03 ? 278 HOH B O   1 
HETATM 6724 O O   . HOH H 3 .   ? 55.987 7.035   72.263  1.00 62.82 ? 279 HOH B O   1 
HETATM 6725 O O   . HOH H 3 .   ? 39.257 27.598  70.400  1.00 51.88 ? 280 HOH B O   1 
HETATM 6726 O O   . HOH H 3 .   ? 77.236 7.875   84.790  1.00 59.77 ? 281 HOH B O   1 
HETATM 6727 O O   . HOH H 3 .   ? 67.160 10.710  68.830  1.00 63.90 ? 282 HOH B O   1 
HETATM 6728 O O   . HOH H 3 .   ? 23.520 27.203  62.383  1.00 42.54 ? 283 HOH B O   1 
HETATM 6729 O O   . HOH H 3 .   ? 86.103 11.947  81.987  1.00 48.69 ? 284 HOH B O   1 
HETATM 6730 O O   . HOH H 3 .   ? 33.759 25.166  49.797  1.00 30.20 ? 285 HOH B O   1 
HETATM 6731 O O   . HOH H 3 .   ? 65.070 7.774   64.476  1.00 42.10 ? 286 HOH B O   1 
HETATM 6732 O O   . HOH H 3 .   ? 46.341 3.307   54.881  1.00 46.08 ? 287 HOH B O   1 
HETATM 6733 O O   . HOH H 3 .   ? 38.462 19.409  64.701  1.00 42.02 ? 288 HOH B O   1 
HETATM 6734 O O   . HOH H 3 .   ? 37.740 37.852  62.578  1.00 35.32 ? 289 HOH B O   1 
HETATM 6735 O O   . HOH H 3 .   ? 25.777 26.169  67.350  1.00 55.85 ? 290 HOH B O   1 
HETATM 6736 O O   . HOH H 3 .   ? 37.110 35.424  71.749  1.00 30.67 ? 291 HOH B O   1 
HETATM 6737 O O   . HOH H 3 .   ? 39.930 40.496  60.405  1.00 45.11 ? 292 HOH B O   1 
HETATM 6738 O O   . HOH H 3 .   ? 29.052 41.962  56.926  1.00 55.36 ? 293 HOH B O   1 
HETATM 6739 O O   . HOH H 3 .   ? 32.837 40.902  56.198  1.00 48.77 ? 294 HOH B O   1 
HETATM 6740 O O   . HOH H 3 .   ? 32.112 39.622  67.947  1.00 29.98 ? 295 HOH B O   1 
HETATM 6741 O O   . HOH H 3 .   ? 41.463 20.703  51.882  1.00 80.47 ? 296 HOH B O   1 
HETATM 6742 O O   . HOH H 3 .   ? 40.907 26.393  67.725  1.00 84.01 ? 297 HOH B O   1 
HETATM 6743 O O   . HOH H 3 .   ? 31.076 22.134  63.836  1.00 53.53 ? 298 HOH B O   1 
HETATM 6744 O O   . HOH H 3 .   ? 29.217 45.065  63.804  1.00 34.49 ? 299 HOH B O   1 
HETATM 6745 O O   . HOH H 3 .   ? 48.454 19.761  70.868  1.00 54.65 ? 300 HOH B O   1 
HETATM 6746 O O   . HOH H 3 .   ? 79.365 30.205  80.872  1.00 58.41 ? 301 HOH B O   1 
HETATM 6747 O O   . HOH H 3 .   ? 49.660 29.672  64.624  1.00 46.44 ? 302 HOH B O   1 
HETATM 6748 O O   . HOH H 3 .   ? 82.209 25.262  72.210  1.00 69.32 ? 303 HOH B O   1 
HETATM 6749 O O   . HOH H 3 .   ? 43.693 20.670  44.382  1.00 56.00 ? 304 HOH B O   1 
HETATM 6750 O O   . HOH H 3 .   ? 48.518 12.815  49.849  1.00 40.56 ? 305 HOH B O   1 
HETATM 6751 O O   . HOH H 3 .   ? 83.496 18.806  79.160  1.00 56.46 ? 306 HOH B O   1 
HETATM 6752 O O   . HOH H 3 .   ? 26.361 31.317  59.952  1.00 60.99 ? 307 HOH B O   1 
HETATM 6753 O O   . HOH H 3 .   ? 47.423 20.689  46.088  1.00 47.51 ? 308 HOH B O   1 
HETATM 6754 O O   . HOH H 3 .   ? 45.609 6.665   51.574  1.00 36.65 ? 309 HOH B O   1 
HETATM 6755 O O   . HOH H 3 .   ? 73.996 17.113  87.272  1.00 77.12 ? 310 HOH B O   1 
HETATM 6756 O O   . HOH H 3 .   ? 48.076 23.015  53.491  1.00 44.40 ? 311 HOH B O   1 
HETATM 6757 O O   . HOH H 3 .   ? 47.386 27.524  68.235  1.00 47.44 ? 312 HOH B O   1 
HETATM 6758 O O   . HOH H 3 .   ? 51.228 18.388  63.063  1.00 39.10 ? 313 HOH B O   1 
HETATM 6759 O O   . HOH H 3 .   ? 56.795 11.994  56.035  1.00 69.20 ? 314 HOH B O   1 
HETATM 6760 O O   . HOH H 3 .   ? 30.761 43.512  55.574  1.00 45.05 ? 315 HOH B O   1 
HETATM 6761 O O   . HOH H 3 .   ? 35.910 18.090  51.711  1.00 73.73 ? 316 HOH B O   1 
HETATM 6762 O O   . HOH H 3 .   ? 63.818 8.077   79.702  1.00 63.34 ? 317 HOH B O   1 
HETATM 6763 O O   . HOH H 3 .   ? 54.303 23.184  52.611  1.00 55.51 ? 318 HOH B O   1 
HETATM 6764 O O   . HOH H 3 .   ? 86.108 18.614  81.485  1.00 43.04 ? 319 HOH B O   1 
HETATM 6765 O O   . HOH H 3 .   ? 30.074 20.776  57.770  1.00 47.52 ? 320 HOH B O   1 
HETATM 6766 O O   . HOH H 3 .   ? 39.190 31.383  50.349  1.00 61.14 ? 321 HOH B O   1 
HETATM 6767 O O   . HOH H 3 .   ? 20.475 41.886  53.844  1.00 55.42 ? 322 HOH B O   1 
HETATM 6768 O O   . HOH H 3 .   ? 52.712 23.499  63.229  1.00 54.06 ? 323 HOH B O   1 
HETATM 6769 O O   . HOH H 3 .   ? 45.052 14.315  68.980  1.00 43.67 ? 324 HOH B O   1 
HETATM 6770 O O   . HOH H 3 .   ? 42.118 26.360  72.744  1.00 50.02 ? 325 HOH B O   1 
HETATM 6771 O O   . HOH H 3 .   ? 75.557 12.235  70.416  1.00 54.53 ? 326 HOH B O   1 
HETATM 6772 O O   . HOH H 3 .   ? 60.468 11.355  81.844  1.00 55.74 ? 327 HOH B O   1 
HETATM 6773 O O   . HOH H 3 .   ? 50.592 12.966  64.589  1.00 44.65 ? 328 HOH B O   1 
HETATM 6774 O O   . HOH H 3 .   ? 45.493 29.525  70.131  1.00 39.58 ? 329 HOH B O   1 
HETATM 6775 O O   . HOH H 3 .   ? 76.650 29.098  80.318  1.00 50.58 ? 330 HOH B O   1 
HETATM 6776 O O   . HOH H 3 .   ? 36.682 15.744  48.607  1.00 44.77 ? 331 HOH B O   1 
HETATM 6777 O O   . HOH H 3 .   ? 70.095 12.404  66.752  1.00 61.08 ? 332 HOH B O   1 
HETATM 6778 O O   . HOH H 3 .   ? 49.742 7.273   64.043  1.00 49.66 ? 333 HOH B O   1 
HETATM 6779 O O   . HOH H 3 .   ? 61.925 14.217  60.781  1.00 79.61 ? 334 HOH B O   1 
HETATM 6780 O O   . HOH H 3 .   ? 60.319 18.104  63.402  1.00 54.92 ? 335 HOH B O   1 
HETATM 6781 O O   . HOH H 3 .   ? 69.721 7.874   74.893  1.00 58.67 ? 336 HOH B O   1 
HETATM 6782 O O   . HOH H 3 .   ? 58.727 14.352  72.301  1.00 61.68 ? 337 HOH B O   1 
HETATM 6783 O O   . HOH H 3 .   ? 61.674 -0.121  68.940  1.00 51.36 ? 338 HOH B O   1 
HETATM 6784 O O   . HOH H 3 .   ? 32.390 19.585  62.535  1.00 54.66 ? 339 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   2   2   ALA ALA H . n 
A 1 2   ALA 2   3   3   ALA ALA H . n 
A 1 3   LEU 3   4   4   LEU LEU H . n 
A 1 4   LEU 4   5   5   LEU LEU H . n 
A 1 5   GLU 5   6   6   GLU GLU H . n 
A 1 6   SER 6   7   7   SER SER H . n 
A 1 7   GLY 7   8   8   GLY GLY H . n 
A 1 8   GLY 8   9   9   GLY GLY H . n 
A 1 9   GLY 9   10  10  GLY GLY H . n 
A 1 10  LEU 10  11  11  LEU LEU H . n 
A 1 11  VAL 11  12  12  VAL VAL H . n 
A 1 12  LYS 12  13  13  LYS LYS H . n 
A 1 13  PRO 13  14  14  PRO PRO H . n 
A 1 14  GLY 14  15  15  GLY GLY H . n 
A 1 15  GLY 15  16  16  GLY GLY H . n 
A 1 16  SER 16  17  17  SER SER H . n 
A 1 17  LEU 17  18  18  LEU LEU H . n 
A 1 18  LYS 18  19  19  LYS LYS H . n 
A 1 19  LEU 19  20  20  LEU LEU H . n 
A 1 20  SER 20  21  21  SER SER H . n 
A 1 21  CYS 21  22  22  CYS CYS H . n 
A 1 22  THR 22  23  23  THR THR H . n 
A 1 23  ALA 23  24  24  ALA ALA H . n 
A 1 24  SER 24  25  25  SER SER H . n 
A 1 25  GLY 25  26  26  GLY GLY H . n 
A 1 26  ILE 26  27  27  ILE ILE H . n 
A 1 27  THR 27  28  28  THR THR H . n 
A 1 28  PHE 28  29  29  PHE PHE H . n 
A 1 29  SER 29  30  30  SER SER H . n 
A 1 30  ARG 30  32  32  ARG ARG H . n 
A 1 31  TYR 31  34  34  TYR TYR H . n 
A 1 32  ILE 32  35  35  ILE ILE H . n 
A 1 33  MET 33  36  36  MET MET H . n 
A 1 34  SER 34  37  37  SER SER H . n 
A 1 35  TRP 35  38  38  TRP TRP H . n 
A 1 36  VAL 36  39  39  VAL VAL H . n 
A 1 37  ARG 37  40  40  ARG ARG H . n 
A 1 38  GLN 38  41  41  GLN GLN H . n 
A 1 39  ILE 39  42  42  ILE ILE H . n 
A 1 40  PRO 40  43  43  PRO PRO H . n 
A 1 41  GLU 41  44  44  GLU GLU H . n 
A 1 42  LYS 42  45  45  LYS LYS H . n 
A 1 43  ARG 43  46  46  ARG ARG H . n 
A 1 44  LEU 44  47  47  LEU LEU H . n 
A 1 45  GLU 45  48  48  GLU GLU H . n 
A 1 46  TRP 46  49  49  TRP TRP H . n 
A 1 47  VAL 47  50  50  VAL VAL H . n 
A 1 48  ALA 48  51  51  ALA ALA H . n 
A 1 49  SER 49  52  52  SER SER H . n 
A 1 50  ILE 50  53  53  ILE ILE H . n 
A 1 51  SER 51  54  54  SER SER H . n 
A 1 52  SER 52  55  55  SER SER H . n 
A 1 53  GLY 53  56  56  GLY GLY H . n 
A 1 54  GLY 54  57  57  GLY GLY H . n 
A 1 55  ILE 55  58  58  ILE ILE H . n 
A 1 56  THR 56  59  59  THR THR H . n 
A 1 57  TYR 57  60  60  TYR TYR H . n 
A 1 58  TYR 58  61  61  TYR TYR H . n 
A 1 59  PRO 59  62  62  PRO PRO H . n 
A 1 60  ASP 60  63  63  ASP ASP H . n 
A 1 61  SER 61  64  64  SER SER H . n 
A 1 62  VAL 62  65  65  VAL VAL H . n 
A 1 63  ALA 63  66  66  ALA ALA H . n 
A 1 64  GLY 64  67  67  GLY GLY H . n 
A 1 65  ARG 65  68  68  ARG ARG H . n 
A 1 66  PHE 66  69  69  PHE PHE H . n 
A 1 67  THR 67  70  70  THR THR H . n 
A 1 68  ILE 68  71  71  ILE ILE H . n 
A 1 69  SER 69  72  72  SER SER H . n 
A 1 70  ARG 70  73  73  ARG ARG H . n 
A 1 71  ASP 71  74  74  ASP ASP H . n 
A 1 72  ASN 72  75  75  ASN ASN H . n 
A 1 73  VAL 73  76  76  VAL VAL H . n 
A 1 74  ARG 74  77  77  ARG ARG H . n 
A 1 75  ASN 75  78  78  ASN ASN H . n 
A 1 76  ILE 76  79  79  ILE ILE H . n 
A 1 77  LEU 77  80  80  LEU LEU H . n 
A 1 78  TYR 78  81  81  TYR TYR H . n 
A 1 79  LEU 79  82  82  LEU LEU H . n 
A 1 80  GLN 80  83  83  GLN GLN H . n 
A 1 81  MET 81  84  84  MET MET H . n 
A 1 82  SER 82  85  85  SER SER H . n 
A 1 83  SER 83  86  86  SER SER H . n 
A 1 84  LEU 84  87  87  LEU LEU H . n 
A 1 85  ARG 85  88  88  ARG ARG H . n 
A 1 86  SER 86  89  89  SER SER H . n 
A 1 87  GLU 87  90  90  GLU GLU H . n 
A 1 88  ASP 88  91  91  ASP ASP H . n 
A 1 89  THR 89  92  92  THR THR H . n 
A 1 90  ALA 90  93  93  ALA ALA H . n 
A 1 91  LEU 91  94  94  LEU LEU H . n 
A 1 92  TYR 92  95  95  TYR TYR H . n 
A 1 93  TYR 93  96  96  TYR TYR H . n 
A 1 94  CYS 94  97  97  CYS CYS H . n 
A 1 95  ALA 95  98  98  ALA ALA H . n 
A 1 96  ARG 96  99  99  ARG ARG H . n 
A 1 97  GLY 97  100 100 GLY GLY H . n 
A 1 98  GLN 98  101 101 GLN GLN H . n 
A 1 99  GLY 99  102 102 GLY GLY H . n 
A 1 100 ARG 100 103 103 ARG ARG H . n 
A 1 101 PRO 101 104 104 PRO PRO H . n 
A 1 102 TYR 102 105 105 TYR TYR H . n 
A 1 103 TRP 103 106 106 TRP TRP H . n 
A 1 104 GLY 104 107 107 GLY GLY H . n 
A 1 105 GLN 105 108 108 GLN GLN H . n 
A 1 106 GLY 106 109 109 GLY GLY H . n 
A 1 107 THR 107 110 110 THR THR H . n 
A 1 108 LEU 108 111 111 LEU LEU H . n 
A 1 109 VAL 109 112 112 VAL VAL H . n 
A 1 110 THR 110 113 113 THR THR H . n 
A 1 111 VAL 111 114 114 VAL VAL H . n 
A 1 112 SER 112 115 115 SER SER H . n 
A 1 113 ALA 113 116 116 ALA ALA H . n 
A 1 114 ALA 114 117 117 ALA ALA H . n 
A 1 115 LYS 115 118 118 LYS LYS H . n 
A 1 116 THR 116 119 119 THR THR H . n 
A 1 117 THR 117 120 120 THR THR H . n 
A 1 118 PRO 118 121 121 PRO PRO H . n 
A 1 119 PRO 119 122 122 PRO PRO H . n 
A 1 120 SER 120 123 123 SER SER H . n 
A 1 121 VAL 121 124 124 VAL VAL H . n 
A 1 122 TYR 122 125 125 TYR TYR H . n 
A 1 123 PRO 123 126 126 PRO PRO H . n 
A 1 124 ALA 124 127 127 ALA ALA H . n 
A 1 125 ALA 125 128 128 ALA ALA H . n 
A 1 126 PRO 126 129 129 PRO PRO H . n 
A 1 127 GLY 127 130 130 GLY GLY H . n 
A 1 128 CYS 128 131 131 CYS CYS H . n 
A 1 129 GLY 129 132 132 GLY GLY H . n 
A 1 130 ASP 130 133 133 ASP ASP H . n 
A 1 131 THR 131 134 134 THR THR H . n 
A 1 132 THR 132 135 135 THR THR H . n 
A 1 133 GLY 133 136 136 GLY GLY H . n 
A 1 134 SER 134 137 137 SER SER H . n 
A 1 135 SER 135 138 138 SER SER H . n 
A 1 136 VAL 136 139 139 VAL VAL H . n 
A 1 137 THR 137 140 140 THR THR H . n 
A 1 138 LEU 138 141 141 LEU LEU H . n 
A 1 139 GLY 139 142 142 GLY GLY H . n 
A 1 140 CYS 140 143 143 CYS CYS H . n 
A 1 141 LEU 141 144 144 LEU LEU H . n 
A 1 142 VAL 142 145 145 VAL VAL H . n 
A 1 143 LYS 143 146 146 LYS LYS H . n 
A 1 144 GLY 144 147 147 GLY GLY H . n 
A 1 145 TYR 145 148 148 TYR TYR H . n 
A 1 146 PHE 146 149 149 PHE PHE H . n 
A 1 147 PRO 147 150 150 PRO PRO H . n 
A 1 148 GLU 148 151 151 GLU GLU H . n 
A 1 149 SER 149 152 152 SER SER H . n 
A 1 150 VAL 150 153 153 VAL VAL H . n 
A 1 151 THR 151 154 154 THR THR H . n 
A 1 152 VAL 152 155 155 VAL VAL H . n 
A 1 153 THR 153 156 156 THR THR H . n 
A 1 154 TRP 154 157 157 TRP TRP H . n 
A 1 155 ASN 155 158 158 ASN ASN H . n 
A 1 156 SER 156 159 159 SER SER H . n 
A 1 157 GLY 157 160 160 GLY GLY H . n 
A 1 158 GLY 158 161 161 GLY GLY H . n 
A 1 159 SER 159 164 164 SER SER H . n 
A 1 160 SER 160 165 165 SER SER H . n 
A 1 161 VAL 161 166 166 VAL VAL H . n 
A 1 162 HIS 162 167 167 HIS HIS H . n 
A 1 163 THR 163 168 168 THR THR H . n 
A 1 164 PHE 164 169 169 PHE PHE H . n 
A 1 165 PRO 165 170 170 PRO PRO H . n 
A 1 166 ALA 166 171 171 ALA ALA H . n 
A 1 167 LEU 167 172 172 LEU LEU H . n 
A 1 168 LEU 168 173 173 LEU LEU H . n 
A 1 169 GLN 169 174 174 GLN GLN H . n 
A 1 170 SER 170 175 175 SER SER H . n 
A 1 171 GLY 171 176 176 GLY GLY H . n 
A 1 172 LEU 172 177 177 LEU LEU H . n 
A 1 173 TYR 173 178 178 TYR TYR H . n 
A 1 174 THR 174 179 179 THR THR H . n 
A 1 175 MET 175 180 180 MET MET H . n 
A 1 176 SER 176 181 181 SER SER H . n 
A 1 177 SER 177 182 182 SER SER H . n 
A 1 178 SER 178 183 183 SER SER H . n 
A 1 179 VAL 179 184 184 VAL VAL H . n 
A 1 180 THR 180 185 185 THR THR H . n 
A 1 181 VAL 181 186 186 VAL VAL H . n 
A 1 182 PRO 182 187 187 PRO PRO H . n 
A 1 183 SER 183 188 188 SER SER H . n 
A 1 184 SER 184 189 189 SER SER H . n 
A 1 185 THR 185 190 190 THR THR H . n 
A 1 186 TRP 186 191 191 TRP TRP H . n 
A 1 187 PRO 187 192 192 PRO PRO H . n 
A 1 188 SER 188 193 193 SER SER H . n 
A 1 189 THR 189 195 195 THR THR H . n 
A 1 190 VAL 190 196 196 VAL VAL H . n 
A 1 191 THR 191 197 197 THR THR H . n 
A 1 192 CYS 192 198 198 CYS CYS H . n 
A 1 193 SER 193 199 199 SER SER H . n 
A 1 194 VAL 194 200 200 VAL VAL H . n 
A 1 195 ALA 195 201 201 ALA ALA H . n 
A 1 196 HIS 196 202 202 HIS HIS H . n 
A 1 197 PRO 197 203 203 PRO PRO H . n 
A 1 198 ALA 198 204 204 ALA ALA H . n 
A 1 199 SER 199 205 205 SER SER H . n 
A 1 200 GLY 200 206 206 GLY GLY H . n 
A 1 201 THR 201 207 207 THR THR H . n 
A 1 202 THR 202 208 208 THR THR H . n 
A 1 203 VAL 203 209 209 VAL VAL H . n 
A 1 204 ASP 204 210 210 ASP ASP H . n 
A 1 205 LYS 205 211 211 LYS LYS H . n 
A 1 206 LYS 206 212 212 LYS LYS H . n 
A 1 207 LEU 207 213 213 LEU LEU H . n 
A 1 208 GLU 208 214 214 GLU GLU H . n 
B 2 1   ALA 1   2   2   ALA ALA L . n 
B 2 2   ALA 2   3   3   ALA ALA L . n 
B 2 3   LEU 3   4   4   LEU LEU L . n 
B 2 4   THR 4   5   5   THR THR L . n 
B 2 5   GLN 5   6   6   GLN GLN L . n 
B 2 6   SER 6   7   7   SER SER L . n 
B 2 7   PRO 7   8   8   PRO PRO L . n 
B 2 8   VAL 8   9   9   VAL VAL L . n 
B 2 9   SER 9   10  10  SER SER L . n 
B 2 10  ASN 10  11  11  ASN ASN L . n 
B 2 11  PRO 11  12  12  PRO PRO L . n 
B 2 12  VAL 12  13  13  VAL VAL L . n 
B 2 13  THR 13  14  14  THR THR L . n 
B 2 14  LEU 14  15  15  LEU LEU L . n 
B 2 15  GLY 15  16  16  GLY GLY L . n 
B 2 16  THR 16  17  17  THR THR L . n 
B 2 17  SER 17  18  18  SER SER L . n 
B 2 18  ALA 18  19  19  ALA ALA L . n 
B 2 19  SER 19  20  20  SER SER L . n 
B 2 20  ILE 20  21  21  ILE ILE L . n 
B 2 21  SER 21  22  22  SER SER L . n 
B 2 22  CYS 22  23  23  CYS CYS L . n 
B 2 23  ARG 23  24  24  ARG ARG L . n 
B 2 24  SER 24  25  25  SER SER L . n 
B 2 25  THR 25  26  26  THR THR L . n 
B 2 26  LYS 26  27  27  LYS LYS L . n 
B 2 27  SER 27  28  28  SER SER L . n 
B 2 28  LEU 28  29  29  LEU LEU L . n 
B 2 29  LEU 29  30  30  LEU LEU L . n 
B 2 30  HIS 30  31  31  HIS HIS L . n 
B 2 31  SER 31  32  32  SER SER L . n 
B 2 32  ASN 32  33  33  ASN ASN L . n 
B 2 33  GLY 33  34  34  GLY GLY L . n 
B 2 34  ILE 34  35  35  ILE ILE L . n 
B 2 35  THR 35  36  36  THR THR L . n 
B 2 36  TYR 36  37  37  TYR TYR L . n 
B 2 37  LEU 37  38  38  LEU LEU L . n 
B 2 38  TYR 38  39  39  TYR TYR L . n 
B 2 39  TRP 39  40  40  TRP TRP L . n 
B 2 40  TYR 40  41  41  TYR TYR L . n 
B 2 41  LEU 41  42  42  LEU LEU L . n 
B 2 42  GLN 42  43  43  GLN GLN L . n 
B 2 43  LYS 43  44  44  LYS LYS L . n 
B 2 44  PRO 44  45  45  PRO PRO L . n 
B 2 45  GLY 45  46  46  GLY GLY L . n 
B 2 46  GLN 46  47  47  GLN GLN L . n 
B 2 47  SER 47  48  48  SER SER L . n 
B 2 48  PRO 48  49  49  PRO PRO L . n 
B 2 49  GLN 49  50  50  GLN GLN L . n 
B 2 50  LEU 50  51  51  LEU LEU L . n 
B 2 51  LEU 51  52  52  LEU LEU L . n 
B 2 52  ILE 52  53  53  ILE ILE L . n 
B 2 53  TYR 53  54  54  TYR TYR L . n 
B 2 54  GLN 54  55  55  GLN GLN L . n 
B 2 55  MET 55  56  56  MET MET L . n 
B 2 56  SER 56  57  57  SER SER L . n 
B 2 57  ASN 57  58  58  ASN ASN L . n 
B 2 58  LEU 58  59  59  LEU LEU L . n 
B 2 59  ALA 59  60  60  ALA ALA L . n 
B 2 60  SER 60  61  61  SER SER L . n 
B 2 61  GLY 61  62  62  GLY GLY L . n 
B 2 62  VAL 62  63  63  VAL VAL L . n 
B 2 63  PRO 63  64  64  PRO PRO L . n 
B 2 64  ASN 64  65  65  ASN ASN L . n 
B 2 65  ARG 65  66  66  ARG ARG L . n 
B 2 66  PHE 66  67  67  PHE PHE L . n 
B 2 67  SER 67  68  68  SER SER L . n 
B 2 68  SER 68  69  69  SER SER L . n 
B 2 69  SER 69  70  70  SER SER L . n 
B 2 70  GLY 70  71  71  GLY GLY L . n 
B 2 71  SER 71  72  72  SER SER L . n 
B 2 72  GLY 72  73  73  GLY GLY L . n 
B 2 73  THR 73  74  74  THR THR L . n 
B 2 74  ASP 74  75  75  ASP ASP L . n 
B 2 75  PHE 75  76  76  PHE PHE L . n 
B 2 76  THR 76  77  77  THR THR L . n 
B 2 77  LEU 77  78  78  LEU LEU L . n 
B 2 78  ARG 78  79  79  ARG ARG L . n 
B 2 79  ILE 79  80  80  ILE ILE L . n 
B 2 80  ASN 80  81  81  ASN ASN L . n 
B 2 81  THR 81  82  82  THR THR L . n 
B 2 82  VAL 82  83  83  VAL VAL L . n 
B 2 83  GLU 83  84  84  GLU GLU L . n 
B 2 84  ALA 84  85  85  ALA ALA L . n 
B 2 85  GLU 85  86  86  GLU GLU L . n 
B 2 86  ASP 86  87  87  ASP ASP L . n 
B 2 87  VAL 87  88  88  VAL VAL L . n 
B 2 88  GLY 88  89  89  GLY GLY L . n 
B 2 89  VAL 89  90  90  VAL VAL L . n 
B 2 90  TYR 90  91  91  TYR TYR L . n 
B 2 91  TYR 91  92  92  TYR TYR L . n 
B 2 92  CYS 92  93  93  CYS CYS L . n 
B 2 93  ALA 93  94  94  ALA ALA L . n 
B 2 94  GLN 94  95  95  GLN GLN L . n 
B 2 95  ASN 95  96  96  ASN ASN L . n 
B 2 96  LEU 96  97  97  LEU LEU L . n 
B 2 97  GLU 97  98  98  GLU GLU L . n 
B 2 98  LEU 98  99  99  LEU LEU L . n 
B 2 99  PRO 99  100 100 PRO PRO L . n 
B 2 100 PRO 100 101 101 PRO PRO L . n 
B 2 101 THR 101 102 102 THR THR L . n 
B 2 102 PHE 102 103 103 PHE PHE L . n 
B 2 103 GLY 103 104 104 GLY GLY L . n 
B 2 104 ALA 104 105 105 ALA ALA L . n 
B 2 105 GLY 105 106 106 GLY GLY L . n 
B 2 106 THR 106 107 107 THR THR L . n 
B 2 107 LYS 107 108 108 LYS LYS L . n 
B 2 108 LEU 108 109 109 LEU LEU L . n 
B 2 109 GLU 109 110 110 GLU GLU L . n 
B 2 110 LEU 110 111 111 LEU LEU L . n 
B 2 111 LYS 111 112 112 LYS LYS L . n 
B 2 112 ARG 112 113 113 ARG ARG L . n 
B 2 113 ALA 113 114 114 ALA ALA L . n 
B 2 114 ASP 114 115 115 ASP ASP L . n 
B 2 115 ALA 115 116 116 ALA ALA L . n 
B 2 116 ALA 116 117 117 ALA ALA L . n 
B 2 117 PRO 117 118 118 PRO PRO L . n 
B 2 118 THR 118 119 119 THR THR L . n 
B 2 119 VAL 119 120 120 VAL VAL L . n 
B 2 120 SER 120 121 121 SER SER L . n 
B 2 121 ILE 121 122 122 ILE ILE L . n 
B 2 122 PHE 122 123 123 PHE PHE L . n 
B 2 123 PRO 123 124 124 PRO PRO L . n 
B 2 124 PRO 124 125 125 PRO PRO L . n 
B 2 125 SER 125 126 126 SER SER L . n 
B 2 126 SER 126 127 127 SER SER L . n 
B 2 127 GLU 127 128 128 GLU GLU L . n 
B 2 128 GLN 128 129 129 GLN GLN L . n 
B 2 129 LEU 129 130 130 LEU LEU L . n 
B 2 130 THR 130 131 131 THR THR L . n 
B 2 131 SER 131 132 132 SER SER L . n 
B 2 132 GLY 132 133 133 GLY GLY L . n 
B 2 133 GLY 133 134 134 GLY GLY L . n 
B 2 134 ALA 134 135 135 ALA ALA L . n 
B 2 135 SER 135 136 136 SER SER L . n 
B 2 136 VAL 136 137 137 VAL VAL L . n 
B 2 137 VAL 137 138 138 VAL VAL L . n 
B 2 138 CYS 138 139 139 CYS CYS L . n 
B 2 139 PHE 139 140 140 PHE PHE L . n 
B 2 140 LEU 140 141 141 LEU LEU L . n 
B 2 141 ASN 141 142 142 ASN ASN L . n 
B 2 142 ASN 142 143 143 ASN ASN L . n 
B 2 143 PHE 143 144 144 PHE PHE L . n 
B 2 144 TYR 144 145 145 TYR TYR L . n 
B 2 145 PRO 145 146 146 PRO PRO L . n 
B 2 146 LYS 146 147 147 LYS LYS L . n 
B 2 147 ASP 147 148 148 ASP ASP L . n 
B 2 148 ILE 148 149 149 ILE ILE L . n 
B 2 149 ASN 149 150 150 ASN ASN L . n 
B 2 150 VAL 150 151 151 VAL VAL L . n 
B 2 151 LYS 151 152 152 LYS LYS L . n 
B 2 152 TRP 152 153 153 TRP TRP L . n 
B 2 153 LYS 153 154 154 LYS LYS L . n 
B 2 154 ILE 154 155 155 ILE ILE L . n 
B 2 155 ASP 155 156 156 ASP ASP L . n 
B 2 156 GLY 156 157 157 GLY GLY L . n 
B 2 157 SER 157 158 158 SER SER L . n 
B 2 158 GLU 158 159 159 GLU GLU L . n 
B 2 159 ARG 159 160 160 ARG ARG L . n 
B 2 160 GLN 160 161 161 GLN GLN L . n 
B 2 161 ASN 161 162 162 ASN ASN L . n 
B 2 162 GLY 162 163 163 GLY GLY L . n 
B 2 163 VAL 163 164 164 VAL VAL L . n 
B 2 164 LEU 164 165 165 LEU LEU L . n 
B 2 165 ASN 165 166 166 ASN ASN L . n 
B 2 166 SER 166 167 167 SER SER L . n 
B 2 167 TRP 167 168 168 TRP TRP L . n 
B 2 168 THR 168 169 169 THR THR L . n 
B 2 169 ASP 169 170 170 ASP ASP L . n 
B 2 170 GLN 170 171 171 GLN GLN L . n 
B 2 171 ASP 171 172 172 ASP ASP L . n 
B 2 172 SER 172 173 173 SER SER L . n 
B 2 173 LYS 173 174 174 LYS LYS L . n 
B 2 174 ASP 174 175 175 ASP ASP L . n 
B 2 175 SER 175 176 176 SER SER L . n 
B 2 176 THR 176 177 177 THR THR L . n 
B 2 177 TYR 177 178 178 TYR TYR L . n 
B 2 178 SER 178 179 179 SER SER L . n 
B 2 179 MET 179 180 180 MET MET L . n 
B 2 180 SER 180 181 181 SER SER L . n 
B 2 181 SER 181 182 182 SER SER L . n 
B 2 182 THR 182 183 183 THR THR L . n 
B 2 183 LEU 183 184 184 LEU LEU L . n 
B 2 184 THR 184 185 185 THR THR L . n 
B 2 185 LEU 185 186 186 LEU LEU L . n 
B 2 186 THR 186 187 187 THR THR L . n 
B 2 187 LYS 187 188 188 LYS LYS L . n 
B 2 188 ASP 188 189 189 ASP ASP L . n 
B 2 189 GLU 189 190 190 GLU GLU L . n 
B 2 190 TYR 190 191 191 TYR TYR L . n 
B 2 191 GLU 191 192 192 GLU GLU L . n 
B 2 192 ARG 192 193 193 ARG ARG L . n 
B 2 193 HIS 193 194 194 HIS HIS L . n 
B 2 194 ASN 194 195 195 ASN ASN L . n 
B 2 195 GLY 195 196 196 GLY GLY L . n 
B 2 196 TYR 196 197 197 TYR TYR L . n 
B 2 197 THR 197 198 198 THR THR L . n 
B 2 198 CYS 198 199 199 CYS CYS L . n 
B 2 199 GLU 199 200 200 GLU GLU L . n 
B 2 200 ALA 200 201 201 ALA ALA L . n 
B 2 201 THR 201 202 202 THR THR L . n 
B 2 202 HIS 202 203 203 HIS HIS L . n 
B 2 203 LYS 203 204 204 LYS LYS L . n 
B 2 204 THR 204 205 205 THR THR L . n 
B 2 205 SER 205 206 206 SER SER L . n 
B 2 206 THR 206 207 207 THR THR L . n 
B 2 207 SER 207 208 208 SER SER L . n 
B 2 208 PRO 208 209 209 PRO PRO L . n 
B 2 209 ILE 209 210 210 ILE ILE L . n 
B 2 210 VAL 210 211 211 VAL VAL L . n 
B 2 211 LYS 211 212 212 LYS LYS L . n 
B 2 212 SER 212 213 213 SER SER L . n 
B 2 213 PHE 213 214 214 PHE PHE L . n 
C 1 1   ALA 1   2   2   ALA ALA A . n 
C 1 2   ALA 2   3   3   ALA ALA A . n 
C 1 3   LEU 3   4   4   LEU LEU A . n 
C 1 4   LEU 4   5   5   LEU LEU A . n 
C 1 5   GLU 5   6   6   GLU GLU A . n 
C 1 6   SER 6   7   7   SER SER A . n 
C 1 7   GLY 7   8   8   GLY GLY A . n 
C 1 8   GLY 8   9   9   GLY GLY A . n 
C 1 9   GLY 9   10  10  GLY GLY A . n 
C 1 10  LEU 10  11  11  LEU LEU A . n 
C 1 11  VAL 11  12  12  VAL VAL A . n 
C 1 12  LYS 12  13  13  LYS LYS A . n 
C 1 13  PRO 13  14  14  PRO PRO A . n 
C 1 14  GLY 14  15  15  GLY GLY A . n 
C 1 15  GLY 15  16  16  GLY GLY A . n 
C 1 16  SER 16  17  17  SER SER A . n 
C 1 17  LEU 17  18  18  LEU LEU A . n 
C 1 18  LYS 18  19  19  LYS LYS A . n 
C 1 19  LEU 19  20  20  LEU LEU A . n 
C 1 20  SER 20  21  21  SER SER A . n 
C 1 21  CYS 21  22  22  CYS CYS A . n 
C 1 22  THR 22  23  23  THR THR A . n 
C 1 23  ALA 23  24  24  ALA ALA A . n 
C 1 24  SER 24  25  25  SER SER A . n 
C 1 25  GLY 25  26  26  GLY GLY A . n 
C 1 26  ILE 26  27  27  ILE ILE A . n 
C 1 27  THR 27  28  28  THR THR A . n 
C 1 28  PHE 28  29  29  PHE PHE A . n 
C 1 29  SER 29  30  30  SER SER A . n 
C 1 30  ARG 30  32  32  ARG ARG A . n 
C 1 31  TYR 31  34  34  TYR TYR A . n 
C 1 32  ILE 32  35  35  ILE ILE A . n 
C 1 33  MET 33  36  36  MET MET A . n 
C 1 34  SER 34  37  37  SER SER A . n 
C 1 35  TRP 35  38  38  TRP TRP A . n 
C 1 36  VAL 36  39  39  VAL VAL A . n 
C 1 37  ARG 37  40  40  ARG ARG A . n 
C 1 38  GLN 38  41  41  GLN GLN A . n 
C 1 39  ILE 39  42  42  ILE ILE A . n 
C 1 40  PRO 40  43  43  PRO PRO A . n 
C 1 41  GLU 41  44  44  GLU GLU A . n 
C 1 42  LYS 42  45  45  LYS LYS A . n 
C 1 43  ARG 43  46  46  ARG ARG A . n 
C 1 44  LEU 44  47  47  LEU LEU A . n 
C 1 45  GLU 45  48  48  GLU GLU A . n 
C 1 46  TRP 46  49  49  TRP TRP A . n 
C 1 47  VAL 47  50  50  VAL VAL A . n 
C 1 48  ALA 48  51  51  ALA ALA A . n 
C 1 49  SER 49  52  52  SER SER A . n 
C 1 50  ILE 50  53  53  ILE ILE A . n 
C 1 51  SER 51  54  54  SER SER A . n 
C 1 52  SER 52  55  55  SER SER A . n 
C 1 53  GLY 53  56  56  GLY GLY A . n 
C 1 54  GLY 54  57  57  GLY GLY A . n 
C 1 55  ILE 55  58  58  ILE ILE A . n 
C 1 56  THR 56  59  59  THR THR A . n 
C 1 57  TYR 57  60  60  TYR TYR A . n 
C 1 58  TYR 58  61  61  TYR TYR A . n 
C 1 59  PRO 59  62  62  PRO PRO A . n 
C 1 60  ASP 60  63  63  ASP ASP A . n 
C 1 61  SER 61  64  64  SER SER A . n 
C 1 62  VAL 62  65  65  VAL VAL A . n 
C 1 63  ALA 63  66  66  ALA ALA A . n 
C 1 64  GLY 64  67  67  GLY GLY A . n 
C 1 65  ARG 65  68  68  ARG ARG A . n 
C 1 66  PHE 66  69  69  PHE PHE A . n 
C 1 67  THR 67  70  70  THR THR A . n 
C 1 68  ILE 68  71  71  ILE ILE A . n 
C 1 69  SER 69  72  72  SER SER A . n 
C 1 70  ARG 70  73  73  ARG ARG A . n 
C 1 71  ASP 71  74  74  ASP ASP A . n 
C 1 72  ASN 72  75  75  ASN ASN A . n 
C 1 73  VAL 73  76  76  VAL VAL A . n 
C 1 74  ARG 74  77  77  ARG ARG A . n 
C 1 75  ASN 75  78  78  ASN ASN A . n 
C 1 76  ILE 76  79  79  ILE ILE A . n 
C 1 77  LEU 77  80  80  LEU LEU A . n 
C 1 78  TYR 78  81  81  TYR TYR A . n 
C 1 79  LEU 79  82  82  LEU LEU A . n 
C 1 80  GLN 80  83  83  GLN GLN A . n 
C 1 81  MET 81  84  84  MET MET A . n 
C 1 82  SER 82  85  85  SER SER A . n 
C 1 83  SER 83  86  86  SER SER A . n 
C 1 84  LEU 84  87  87  LEU LEU A . n 
C 1 85  ARG 85  88  88  ARG ARG A . n 
C 1 86  SER 86  89  89  SER SER A . n 
C 1 87  GLU 87  90  90  GLU GLU A . n 
C 1 88  ASP 88  91  91  ASP ASP A . n 
C 1 89  THR 89  92  92  THR THR A . n 
C 1 90  ALA 90  93  93  ALA ALA A . n 
C 1 91  LEU 91  94  94  LEU LEU A . n 
C 1 92  TYR 92  95  95  TYR TYR A . n 
C 1 93  TYR 93  96  96  TYR TYR A . n 
C 1 94  CYS 94  97  97  CYS CYS A . n 
C 1 95  ALA 95  98  98  ALA ALA A . n 
C 1 96  ARG 96  99  99  ARG ARG A . n 
C 1 97  GLY 97  100 100 GLY GLY A . n 
C 1 98  GLN 98  101 101 GLN GLN A . n 
C 1 99  GLY 99  102 102 GLY GLY A . n 
C 1 100 ARG 100 103 103 ARG ARG A . n 
C 1 101 PRO 101 104 104 PRO PRO A . n 
C 1 102 TYR 102 105 105 TYR TYR A . n 
C 1 103 TRP 103 106 106 TRP TRP A . n 
C 1 104 GLY 104 107 107 GLY GLY A . n 
C 1 105 GLN 105 108 108 GLN GLN A . n 
C 1 106 GLY 106 109 109 GLY GLY A . n 
C 1 107 THR 107 110 110 THR THR A . n 
C 1 108 LEU 108 111 111 LEU LEU A . n 
C 1 109 VAL 109 112 112 VAL VAL A . n 
C 1 110 THR 110 113 113 THR THR A . n 
C 1 111 VAL 111 114 114 VAL VAL A . n 
C 1 112 SER 112 115 115 SER SER A . n 
C 1 113 ALA 113 116 116 ALA ALA A . n 
C 1 114 ALA 114 117 117 ALA ALA A . n 
C 1 115 LYS 115 118 118 LYS LYS A . n 
C 1 116 THR 116 119 119 THR THR A . n 
C 1 117 THR 117 120 120 THR THR A . n 
C 1 118 PRO 118 121 121 PRO PRO A . n 
C 1 119 PRO 119 122 122 PRO PRO A . n 
C 1 120 SER 120 123 123 SER SER A . n 
C 1 121 VAL 121 124 124 VAL VAL A . n 
C 1 122 TYR 122 125 125 TYR TYR A . n 
C 1 123 PRO 123 126 126 PRO PRO A . n 
C 1 124 ALA 124 127 127 ALA ALA A . n 
C 1 125 ALA 125 128 128 ALA ALA A . n 
C 1 126 PRO 126 129 129 PRO PRO A . n 
C 1 127 GLY 127 130 130 GLY GLY A . n 
C 1 128 CYS 128 131 131 CYS CYS A . n 
C 1 129 GLY 129 132 132 GLY GLY A . n 
C 1 130 ASP 130 133 133 ASP ASP A . n 
C 1 131 THR 131 134 134 THR THR A . n 
C 1 132 THR 132 135 135 THR THR A . n 
C 1 133 GLY 133 136 136 GLY GLY A . n 
C 1 134 SER 134 137 137 SER SER A . n 
C 1 135 SER 135 138 138 SER SER A . n 
C 1 136 VAL 136 139 139 VAL VAL A . n 
C 1 137 THR 137 140 140 THR THR A . n 
C 1 138 LEU 138 141 141 LEU LEU A . n 
C 1 139 GLY 139 142 142 GLY GLY A . n 
C 1 140 CYS 140 143 143 CYS CYS A . n 
C 1 141 LEU 141 144 144 LEU LEU A . n 
C 1 142 VAL 142 145 145 VAL VAL A . n 
C 1 143 LYS 143 146 146 LYS LYS A . n 
C 1 144 GLY 144 147 147 GLY GLY A . n 
C 1 145 TYR 145 148 148 TYR TYR A . n 
C 1 146 PHE 146 149 149 PHE PHE A . n 
C 1 147 PRO 147 150 150 PRO PRO A . n 
C 1 148 GLU 148 151 151 GLU GLU A . n 
C 1 149 SER 149 152 152 SER SER A . n 
C 1 150 VAL 150 153 153 VAL VAL A . n 
C 1 151 THR 151 154 154 THR THR A . n 
C 1 152 VAL 152 155 155 VAL VAL A . n 
C 1 153 THR 153 156 156 THR THR A . n 
C 1 154 TRP 154 157 157 TRP TRP A . n 
C 1 155 ASN 155 158 158 ASN ASN A . n 
C 1 156 SER 156 159 159 SER SER A . n 
C 1 157 GLY 157 160 160 GLY GLY A . n 
C 1 158 GLY 158 161 161 GLY GLY A . n 
C 1 159 SER 159 164 164 SER SER A . n 
C 1 160 SER 160 165 165 SER SER A . n 
C 1 161 VAL 161 166 166 VAL VAL A . n 
C 1 162 HIS 162 167 167 HIS HIS A . n 
C 1 163 THR 163 168 168 THR THR A . n 
C 1 164 PHE 164 169 169 PHE PHE A . n 
C 1 165 PRO 165 170 170 PRO PRO A . n 
C 1 166 ALA 166 171 171 ALA ALA A . n 
C 1 167 LEU 167 172 172 LEU LEU A . n 
C 1 168 LEU 168 173 173 LEU LEU A . n 
C 1 169 GLN 169 174 174 GLN GLN A . n 
C 1 170 SER 170 175 175 SER SER A . n 
C 1 171 GLY 171 176 176 GLY GLY A . n 
C 1 172 LEU 172 177 177 LEU LEU A . n 
C 1 173 TYR 173 178 178 TYR TYR A . n 
C 1 174 THR 174 179 179 THR THR A . n 
C 1 175 MET 175 180 180 MET MET A . n 
C 1 176 SER 176 181 181 SER SER A . n 
C 1 177 SER 177 182 182 SER SER A . n 
C 1 178 SER 178 183 183 SER SER A . n 
C 1 179 VAL 179 184 184 VAL VAL A . n 
C 1 180 THR 180 185 185 THR THR A . n 
C 1 181 VAL 181 186 186 VAL VAL A . n 
C 1 182 PRO 182 187 187 PRO PRO A . n 
C 1 183 SER 183 188 188 SER SER A . n 
C 1 184 SER 184 189 189 SER SER A . n 
C 1 185 THR 185 190 190 THR THR A . n 
C 1 186 TRP 186 191 191 TRP TRP A . n 
C 1 187 PRO 187 192 192 PRO PRO A . n 
C 1 188 SER 188 193 193 SER SER A . n 
C 1 189 THR 189 195 195 THR THR A . n 
C 1 190 VAL 190 196 196 VAL VAL A . n 
C 1 191 THR 191 197 197 THR THR A . n 
C 1 192 CYS 192 198 198 CYS CYS A . n 
C 1 193 SER 193 199 199 SER SER A . n 
C 1 194 VAL 194 200 200 VAL VAL A . n 
C 1 195 ALA 195 201 201 ALA ALA A . n 
C 1 196 HIS 196 202 202 HIS HIS A . n 
C 1 197 PRO 197 203 203 PRO PRO A . n 
C 1 198 ALA 198 204 204 ALA ALA A . n 
C 1 199 SER 199 205 205 SER SER A . n 
C 1 200 GLY 200 206 206 GLY GLY A . n 
C 1 201 THR 201 207 207 THR THR A . n 
C 1 202 THR 202 208 208 THR THR A . n 
C 1 203 VAL 203 209 209 VAL VAL A . n 
C 1 204 ASP 204 210 210 ASP ASP A . n 
C 1 205 LYS 205 211 211 LYS LYS A . n 
C 1 206 LYS 206 212 212 LYS LYS A . n 
C 1 207 LEU 207 213 213 LEU LEU A . n 
C 1 208 GLU 208 214 214 GLU GLU A . n 
D 2 1   ALA 1   2   2   ALA ALA B . n 
D 2 2   ALA 2   3   3   ALA ALA B . n 
D 2 3   LEU 3   4   4   LEU LEU B . n 
D 2 4   THR 4   5   5   THR THR B . n 
D 2 5   GLN 5   6   6   GLN GLN B . n 
D 2 6   SER 6   7   7   SER SER B . n 
D 2 7   PRO 7   8   8   PRO PRO B . n 
D 2 8   VAL 8   9   9   VAL VAL B . n 
D 2 9   SER 9   10  10  SER SER B . n 
D 2 10  ASN 10  11  11  ASN ASN B . n 
D 2 11  PRO 11  12  12  PRO PRO B . n 
D 2 12  VAL 12  13  13  VAL VAL B . n 
D 2 13  THR 13  14  14  THR THR B . n 
D 2 14  LEU 14  15  15  LEU LEU B . n 
D 2 15  GLY 15  16  16  GLY GLY B . n 
D 2 16  THR 16  17  17  THR THR B . n 
D 2 17  SER 17  18  18  SER SER B . n 
D 2 18  ALA 18  19  19  ALA ALA B . n 
D 2 19  SER 19  20  20  SER SER B . n 
D 2 20  ILE 20  21  21  ILE ILE B . n 
D 2 21  SER 21  22  22  SER SER B . n 
D 2 22  CYS 22  23  23  CYS CYS B . n 
D 2 23  ARG 23  24  24  ARG ARG B . n 
D 2 24  SER 24  25  25  SER SER B . n 
D 2 25  THR 25  26  26  THR THR B . n 
D 2 26  LYS 26  27  27  LYS LYS B . n 
D 2 27  SER 27  28  28  SER SER B . n 
D 2 28  LEU 28  29  29  LEU LEU B . n 
D 2 29  LEU 29  30  30  LEU LEU B . n 
D 2 30  HIS 30  31  31  HIS HIS B . n 
D 2 31  SER 31  32  32  SER SER B . n 
D 2 32  ASN 32  33  33  ASN ASN B . n 
D 2 33  GLY 33  34  34  GLY GLY B . n 
D 2 34  ILE 34  35  35  ILE ILE B . n 
D 2 35  THR 35  36  36  THR THR B . n 
D 2 36  TYR 36  37  37  TYR TYR B . n 
D 2 37  LEU 37  38  38  LEU LEU B . n 
D 2 38  TYR 38  39  39  TYR TYR B . n 
D 2 39  TRP 39  40  40  TRP TRP B . n 
D 2 40  TYR 40  41  41  TYR TYR B . n 
D 2 41  LEU 41  42  42  LEU LEU B . n 
D 2 42  GLN 42  43  43  GLN GLN B . n 
D 2 43  LYS 43  44  44  LYS LYS B . n 
D 2 44  PRO 44  45  45  PRO PRO B . n 
D 2 45  GLY 45  46  46  GLY GLY B . n 
D 2 46  GLN 46  47  47  GLN GLN B . n 
D 2 47  SER 47  48  48  SER SER B . n 
D 2 48  PRO 48  49  49  PRO PRO B . n 
D 2 49  GLN 49  50  50  GLN GLN B . n 
D 2 50  LEU 50  51  51  LEU LEU B . n 
D 2 51  LEU 51  52  52  LEU LEU B . n 
D 2 52  ILE 52  53  53  ILE ILE B . n 
D 2 53  TYR 53  54  54  TYR TYR B . n 
D 2 54  GLN 54  55  55  GLN GLN B . n 
D 2 55  MET 55  56  56  MET MET B . n 
D 2 56  SER 56  57  57  SER SER B . n 
D 2 57  ASN 57  58  58  ASN ASN B . n 
D 2 58  LEU 58  59  59  LEU LEU B . n 
D 2 59  ALA 59  60  60  ALA ALA B . n 
D 2 60  SER 60  61  61  SER SER B . n 
D 2 61  GLY 61  62  62  GLY GLY B . n 
D 2 62  VAL 62  63  63  VAL VAL B . n 
D 2 63  PRO 63  64  64  PRO PRO B . n 
D 2 64  ASN 64  65  65  ASN ASN B . n 
D 2 65  ARG 65  66  66  ARG ARG B . n 
D 2 66  PHE 66  67  67  PHE PHE B . n 
D 2 67  SER 67  68  68  SER SER B . n 
D 2 68  SER 68  69  69  SER SER B . n 
D 2 69  SER 69  70  70  SER SER B . n 
D 2 70  GLY 70  71  71  GLY GLY B . n 
D 2 71  SER 71  72  72  SER SER B . n 
D 2 72  GLY 72  73  73  GLY GLY B . n 
D 2 73  THR 73  74  74  THR THR B . n 
D 2 74  ASP 74  75  75  ASP ASP B . n 
D 2 75  PHE 75  76  76  PHE PHE B . n 
D 2 76  THR 76  77  77  THR THR B . n 
D 2 77  LEU 77  78  78  LEU LEU B . n 
D 2 78  ARG 78  79  79  ARG ARG B . n 
D 2 79  ILE 79  80  80  ILE ILE B . n 
D 2 80  ASN 80  81  81  ASN ASN B . n 
D 2 81  THR 81  82  82  THR THR B . n 
D 2 82  VAL 82  83  83  VAL VAL B . n 
D 2 83  GLU 83  84  84  GLU GLU B . n 
D 2 84  ALA 84  85  85  ALA ALA B . n 
D 2 85  GLU 85  86  86  GLU GLU B . n 
D 2 86  ASP 86  87  87  ASP ASP B . n 
D 2 87  VAL 87  88  88  VAL VAL B . n 
D 2 88  GLY 88  89  89  GLY GLY B . n 
D 2 89  VAL 89  90  90  VAL VAL B . n 
D 2 90  TYR 90  91  91  TYR TYR B . n 
D 2 91  TYR 91  92  92  TYR TYR B . n 
D 2 92  CYS 92  93  93  CYS CYS B . n 
D 2 93  ALA 93  94  94  ALA ALA B . n 
D 2 94  GLN 94  95  95  GLN GLN B . n 
D 2 95  ASN 95  96  96  ASN ASN B . n 
D 2 96  LEU 96  97  97  LEU LEU B . n 
D 2 97  GLU 97  98  98  GLU GLU B . n 
D 2 98  LEU 98  99  99  LEU LEU B . n 
D 2 99  PRO 99  100 100 PRO PRO B . n 
D 2 100 PRO 100 101 101 PRO PRO B . n 
D 2 101 THR 101 102 102 THR THR B . n 
D 2 102 PHE 102 103 103 PHE PHE B . n 
D 2 103 GLY 103 104 104 GLY GLY B . n 
D 2 104 ALA 104 105 105 ALA ALA B . n 
D 2 105 GLY 105 106 106 GLY GLY B . n 
D 2 106 THR 106 107 107 THR THR B . n 
D 2 107 LYS 107 108 108 LYS LYS B . n 
D 2 108 LEU 108 109 109 LEU LEU B . n 
D 2 109 GLU 109 110 110 GLU GLU B . n 
D 2 110 LEU 110 111 111 LEU LEU B . n 
D 2 111 LYS 111 112 112 LYS LYS B . n 
D 2 112 ARG 112 113 113 ARG ARG B . n 
D 2 113 ALA 113 114 114 ALA ALA B . n 
D 2 114 ASP 114 115 115 ASP ASP B . n 
D 2 115 ALA 115 116 116 ALA ALA B . n 
D 2 116 ALA 116 117 117 ALA ALA B . n 
D 2 117 PRO 117 118 118 PRO PRO B . n 
D 2 118 THR 118 119 119 THR THR B . n 
D 2 119 VAL 119 120 120 VAL VAL B . n 
D 2 120 SER 120 121 121 SER SER B . n 
D 2 121 ILE 121 122 122 ILE ILE B . n 
D 2 122 PHE 122 123 123 PHE PHE B . n 
D 2 123 PRO 123 124 124 PRO PRO B . n 
D 2 124 PRO 124 125 125 PRO PRO B . n 
D 2 125 SER 125 126 126 SER SER B . n 
D 2 126 SER 126 127 127 SER SER B . n 
D 2 127 GLU 127 128 128 GLU GLU B . n 
D 2 128 GLN 128 129 129 GLN GLN B . n 
D 2 129 LEU 129 130 130 LEU LEU B . n 
D 2 130 THR 130 131 131 THR THR B . n 
D 2 131 SER 131 132 132 SER SER B . n 
D 2 132 GLY 132 133 133 GLY GLY B . n 
D 2 133 GLY 133 134 134 GLY GLY B . n 
D 2 134 ALA 134 135 135 ALA ALA B . n 
D 2 135 SER 135 136 136 SER SER B . n 
D 2 136 VAL 136 137 137 VAL VAL B . n 
D 2 137 VAL 137 138 138 VAL VAL B . n 
D 2 138 CYS 138 139 139 CYS CYS B . n 
D 2 139 PHE 139 140 140 PHE PHE B . n 
D 2 140 LEU 140 141 141 LEU LEU B . n 
D 2 141 ASN 141 142 142 ASN ASN B . n 
D 2 142 ASN 142 143 143 ASN ASN B . n 
D 2 143 PHE 143 144 144 PHE PHE B . n 
D 2 144 TYR 144 145 145 TYR TYR B . n 
D 2 145 PRO 145 146 146 PRO PRO B . n 
D 2 146 LYS 146 147 147 LYS LYS B . n 
D 2 147 ASP 147 148 148 ASP ASP B . n 
D 2 148 ILE 148 149 149 ILE ILE B . n 
D 2 149 ASN 149 150 150 ASN ASN B . n 
D 2 150 VAL 150 151 151 VAL VAL B . n 
D 2 151 LYS 151 152 152 LYS LYS B . n 
D 2 152 TRP 152 153 153 TRP TRP B . n 
D 2 153 LYS 153 154 154 LYS LYS B . n 
D 2 154 ILE 154 155 155 ILE ILE B . n 
D 2 155 ASP 155 156 156 ASP ASP B . n 
D 2 156 GLY 156 157 157 GLY GLY B . n 
D 2 157 SER 157 158 158 SER SER B . n 
D 2 158 GLU 158 159 159 GLU GLU B . n 
D 2 159 ARG 159 160 160 ARG ARG B . n 
D 2 160 GLN 160 161 161 GLN GLN B . n 
D 2 161 ASN 161 162 162 ASN ASN B . n 
D 2 162 GLY 162 163 163 GLY GLY B . n 
D 2 163 VAL 163 164 164 VAL VAL B . n 
D 2 164 LEU 164 165 165 LEU LEU B . n 
D 2 165 ASN 165 166 166 ASN ASN B . n 
D 2 166 SER 166 167 167 SER SER B . n 
D 2 167 TRP 167 168 168 TRP TRP B . n 
D 2 168 THR 168 169 169 THR THR B . n 
D 2 169 ASP 169 170 170 ASP ASP B . n 
D 2 170 GLN 170 171 171 GLN GLN B . n 
D 2 171 ASP 171 172 172 ASP ASP B . n 
D 2 172 SER 172 173 173 SER SER B . n 
D 2 173 LYS 173 174 174 LYS LYS B . n 
D 2 174 ASP 174 175 175 ASP ASP B . n 
D 2 175 SER 175 176 176 SER SER B . n 
D 2 176 THR 176 177 177 THR THR B . n 
D 2 177 TYR 177 178 178 TYR TYR B . n 
D 2 178 SER 178 179 179 SER SER B . n 
D 2 179 MET 179 180 180 MET MET B . n 
D 2 180 SER 180 181 181 SER SER B . n 
D 2 181 SER 181 182 182 SER SER B . n 
D 2 182 THR 182 183 183 THR THR B . n 
D 2 183 LEU 183 184 184 LEU LEU B . n 
D 2 184 THR 184 185 185 THR THR B . n 
D 2 185 LEU 185 186 186 LEU LEU B . n 
D 2 186 THR 186 187 187 THR THR B . n 
D 2 187 LYS 187 188 188 LYS LYS B . n 
D 2 188 ASP 188 189 189 ASP ASP B . n 
D 2 189 GLU 189 190 190 GLU GLU B . n 
D 2 190 TYR 190 191 191 TYR TYR B . n 
D 2 191 GLU 191 192 192 GLU GLU B . n 
D 2 192 ARG 192 193 193 ARG ARG B . n 
D 2 193 HIS 193 194 194 HIS HIS B . n 
D 2 194 ASN 194 195 195 ASN ASN B . n 
D 2 195 GLY 195 196 196 GLY GLY B . n 
D 2 196 TYR 196 197 197 TYR TYR B . n 
D 2 197 THR 197 198 198 THR THR B . n 
D 2 198 CYS 198 199 199 CYS CYS B . n 
D 2 199 GLU 199 200 200 GLU GLU B . n 
D 2 200 ALA 200 201 201 ALA ALA B . n 
D 2 201 THR 201 202 202 THR THR B . n 
D 2 202 HIS 202 203 203 HIS HIS B . n 
D 2 203 LYS 203 204 204 LYS LYS B . n 
D 2 204 THR 204 205 205 THR THR B . n 
D 2 205 SER 205 206 206 SER SER B . n 
D 2 206 THR 206 207 207 THR THR B . n 
D 2 207 SER 207 208 208 SER SER B . n 
D 2 208 PRO 208 209 209 PRO PRO B . n 
D 2 209 ILE 209 210 210 ILE ILE B . n 
D 2 210 VAL 210 211 211 VAL VAL B . n 
D 2 211 LYS 211 212 212 LYS LYS B . n 
D 2 212 SER 212 213 213 SER SER B . n 
D 2 213 PHE 213 214 214 PHE PHE B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3480  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  18940 ? 
2 'ABSA (A^2)' 3340  ? 
2 MORE         -22   ? 
2 'SSA (A^2)'  19150 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-04-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.location 
_software.classification 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
CNS       1.0 1998 package 'Axel T. Brunger' axel.brunger@@yale.edu . refinement       Fortran ? 1 
DENZO     .   ?    ?       ?                 ?                      ? 'data reduction' ?       ? 2 
SCALEPACK .   ?    ?       ?                 ?                      ? 'data scaling'   ?       ? 3 
MOLREP    .   ?    ?       ?                 ?                      ? phasing          ?       ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO H 43  ? ? -38.74  -30.80  
2  1 LYS H 45  ? ? 83.72   166.78  
3  1 ARG H 46  ? ? 87.53   110.25  
4  1 ALA H 66  ? ? -24.56  -45.32  
5  1 ALA H 93  ? ? 176.09  -178.51 
6  1 THR H 135 ? ? -126.00 -141.49 
7  1 SER H 137 ? ? -49.50  97.44   
8  1 SER H 138 ? ? 57.29   114.02  
9  1 PHE H 149 ? ? -108.08 -83.30  
10 1 PRO H 150 ? ? -44.38  100.27  
11 1 SER H 152 ? ? -44.58  100.55  
12 1 ASN H 158 ? ? 60.32   -4.26   
13 1 PRO H 192 ? ? -78.02  49.06   
14 1 THR H 195 ? ? 59.62   107.49  
15 1 HIS H 202 ? ? -150.20 71.75   
16 1 ALA H 204 ? ? -57.76  -3.36   
17 1 PRO L 45  ? ? -56.53  109.42  
18 1 MET L 56  ? ? 70.32   -45.89  
19 1 SER L 72  ? ? -83.51  -151.10 
20 1 LYS L 147 ? ? -69.88  3.98    
21 1 ASN L 150 ? ? -120.41 -52.15  
22 1 VAL L 151 ? ? 75.07   128.71  
23 1 ASN L 162 ? ? -58.18  -82.16  
24 1 SER L 206 ? ? 68.06   -26.96  
25 1 THR L 207 ? ? 72.57   -12.82  
26 1 PRO A 43  ? ? -38.00  -31.07  
27 1 LYS A 45  ? ? 83.59   166.42  
28 1 ARG A 46  ? ? 87.88   110.95  
29 1 ALA A 66  ? ? -25.78  -43.63  
30 1 ALA A 93  ? ? 173.00  -179.75 
31 1 THR A 135 ? ? -125.92 -141.70 
32 1 SER A 137 ? ? -49.36  97.64   
33 1 SER A 138 ? ? 57.06   114.15  
34 1 PHE A 149 ? ? -108.00 -83.86  
35 1 PRO A 150 ? ? -43.99  100.69  
36 1 SER A 152 ? ? -44.91  100.67  
37 1 ASN A 158 ? ? 60.06   -4.59   
38 1 PRO A 192 ? ? -77.77  48.92   
39 1 THR A 195 ? ? 59.28   107.27  
40 1 HIS A 202 ? ? -150.24 72.22   
41 1 ALA A 204 ? ? -57.56  -3.65   
42 1 PRO B 45  ? ? -56.88  109.94  
43 1 MET B 56  ? ? 69.67   -46.08  
44 1 SER B 72  ? ? -84.80  -149.94 
45 1 ASN B 150 ? ? -120.60 -52.15  
46 1 VAL B 151 ? ? 75.18   128.33  
47 1 ASN B 162 ? ? -57.80  -82.76  
48 1 SER B 206 ? ? 68.35   -27.11  
49 1 THR B 207 ? ? 72.46   -12.54  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1   215 10  HOH HOH H . 
E 3 HOH 2   216 15  HOH HOH H . 
E 3 HOH 3   217 17  HOH HOH H . 
E 3 HOH 4   218 29  HOH HOH H . 
E 3 HOH 5   219 40  HOH HOH H . 
E 3 HOH 6   220 55  HOH HOH H . 
E 3 HOH 7   221 58  HOH HOH H . 
E 3 HOH 8   222 59  HOH HOH H . 
E 3 HOH 9   223 71  HOH HOH H . 
E 3 HOH 10  224 72  HOH HOH H . 
E 3 HOH 11  225 81  HOH HOH H . 
E 3 HOH 12  226 91  HOH HOH H . 
E 3 HOH 13  227 93  HOH HOH H . 
E 3 HOH 14  228 99  HOH HOH H . 
E 3 HOH 15  229 102 HOH HOH H . 
E 3 HOH 16  230 109 HOH HOH H . 
E 3 HOH 17  231 113 HOH HOH H . 
E 3 HOH 18  232 114 HOH HOH H . 
E 3 HOH 19  233 119 HOH HOH H . 
E 3 HOH 20  234 120 HOH HOH H . 
E 3 HOH 21  235 124 HOH HOH H . 
E 3 HOH 22  236 131 HOH HOH H . 
E 3 HOH 23  237 135 HOH HOH H . 
E 3 HOH 24  238 137 HOH HOH H . 
E 3 HOH 25  239 138 HOH HOH H . 
E 3 HOH 26  240 142 HOH HOH H . 
E 3 HOH 27  241 144 HOH HOH H . 
E 3 HOH 28  242 157 HOH HOH H . 
E 3 HOH 29  243 162 HOH HOH H . 
E 3 HOH 30  244 164 HOH HOH H . 
E 3 HOH 31  245 165 HOH HOH H . 
E 3 HOH 32  246 167 HOH HOH H . 
E 3 HOH 33  247 169 HOH HOH H . 
E 3 HOH 34  248 182 HOH HOH H . 
E 3 HOH 35  249 186 HOH HOH H . 
E 3 HOH 36  250 192 HOH HOH H . 
E 3 HOH 37  251 198 HOH HOH H . 
E 3 HOH 38  252 209 HOH HOH H . 
E 3 HOH 39  253 211 HOH HOH H . 
E 3 HOH 40  254 216 HOH HOH H . 
E 3 HOH 41  255 217 HOH HOH H . 
E 3 HOH 42  256 219 HOH HOH H . 
E 3 HOH 43  257 221 HOH HOH H . 
E 3 HOH 44  258 224 HOH HOH H . 
E 3 HOH 45  259 226 HOH HOH H . 
E 3 HOH 46  260 227 HOH HOH H . 
E 3 HOH 47  261 244 HOH HOH H . 
E 3 HOH 48  262 258 HOH HOH H . 
E 3 HOH 49  263 260 HOH HOH H . 
E 3 HOH 50  264 261 HOH HOH H . 
E 3 HOH 51  265 264 HOH HOH H . 
E 3 HOH 52  266 278 HOH HOH H . 
E 3 HOH 53  267 284 HOH HOH H . 
E 3 HOH 54  268 286 HOH HOH H . 
E 3 HOH 55  269 293 HOH HOH H . 
E 3 HOH 56  270 296 HOH HOH H . 
E 3 HOH 57  271 297 HOH HOH H . 
E 3 HOH 58  272 306 HOH HOH H . 
E 3 HOH 59  273 316 HOH HOH H . 
E 3 HOH 60  274 320 HOH HOH H . 
E 3 HOH 61  275 332 HOH HOH H . 
E 3 HOH 62  276 335 HOH HOH H . 
E 3 HOH 63  277 342 HOH HOH H . 
E 3 HOH 64  278 353 HOH HOH H . 
E 3 HOH 65  279 365 HOH HOH H . 
E 3 HOH 66  280 376 HOH HOH H . 
E 3 HOH 67  281 381 HOH HOH H . 
E 3 HOH 68  282 387 HOH HOH H . 
E 3 HOH 69  283 395 HOH HOH H . 
E 3 HOH 70  284 401 HOH HOH H . 
E 3 HOH 71  285 403 HOH HOH H . 
E 3 HOH 72  286 411 HOH HOH H . 
E 3 HOH 73  287 415 HOH HOH H . 
E 3 HOH 74  288 417 HOH HOH H . 
E 3 HOH 75  289 419 HOH HOH H . 
E 3 HOH 76  290 422 HOH HOH H . 
E 3 HOH 77  291 429 HOH HOH H . 
E 3 HOH 78  292 437 HOH HOH H . 
E 3 HOH 79  293 438 HOH HOH H . 
F 3 HOH 1   215 2   HOH HOH L . 
F 3 HOH 2   216 5   HOH HOH L . 
F 3 HOH 3   217 6   HOH HOH L . 
F 3 HOH 4   218 8   HOH HOH L . 
F 3 HOH 5   219 11  HOH HOH L . 
F 3 HOH 6   220 14  HOH HOH L . 
F 3 HOH 7   221 21  HOH HOH L . 
F 3 HOH 8   222 23  HOH HOH L . 
F 3 HOH 9   223 26  HOH HOH L . 
F 3 HOH 10  224 27  HOH HOH L . 
F 3 HOH 11  225 33  HOH HOH L . 
F 3 HOH 12  226 35  HOH HOH L . 
F 3 HOH 13  227 44  HOH HOH L . 
F 3 HOH 14  228 45  HOH HOH L . 
F 3 HOH 15  229 47  HOH HOH L . 
F 3 HOH 16  230 50  HOH HOH L . 
F 3 HOH 17  231 52  HOH HOH L . 
F 3 HOH 18  232 67  HOH HOH L . 
F 3 HOH 19  233 69  HOH HOH L . 
F 3 HOH 20  234 75  HOH HOH L . 
F 3 HOH 21  235 76  HOH HOH L . 
F 3 HOH 22  236 82  HOH HOH L . 
F 3 HOH 23  237 84  HOH HOH L . 
F 3 HOH 24  238 85  HOH HOH L . 
F 3 HOH 25  239 87  HOH HOH L . 
F 3 HOH 26  240 90  HOH HOH L . 
F 3 HOH 27  241 96  HOH HOH L . 
F 3 HOH 28  242 97  HOH HOH L . 
F 3 HOH 29  243 98  HOH HOH L . 
F 3 HOH 30  244 101 HOH HOH L . 
F 3 HOH 31  245 103 HOH HOH L . 
F 3 HOH 32  246 104 HOH HOH L . 
F 3 HOH 33  247 111 HOH HOH L . 
F 3 HOH 34  248 112 HOH HOH L . 
F 3 HOH 35  249 117 HOH HOH L . 
F 3 HOH 36  250 123 HOH HOH L . 
F 3 HOH 37  251 125 HOH HOH L . 
F 3 HOH 38  252 132 HOH HOH L . 
F 3 HOH 39  253 134 HOH HOH L . 
F 3 HOH 40  254 140 HOH HOH L . 
F 3 HOH 41  255 143 HOH HOH L . 
F 3 HOH 42  256 145 HOH HOH L . 
F 3 HOH 43  257 146 HOH HOH L . 
F 3 HOH 44  258 150 HOH HOH L . 
F 3 HOH 45  259 163 HOH HOH L . 
F 3 HOH 46  260 170 HOH HOH L . 
F 3 HOH 47  261 177 HOH HOH L . 
F 3 HOH 48  262 179 HOH HOH L . 
F 3 HOH 49  263 185 HOH HOH L . 
F 3 HOH 50  264 188 HOH HOH L . 
F 3 HOH 51  265 190 HOH HOH L . 
F 3 HOH 52  266 193 HOH HOH L . 
F 3 HOH 53  267 200 HOH HOH L . 
F 3 HOH 54  268 203 HOH HOH L . 
F 3 HOH 55  269 213 HOH HOH L . 
F 3 HOH 56  270 220 HOH HOH L . 
F 3 HOH 57  271 228 HOH HOH L . 
F 3 HOH 58  272 230 HOH HOH L . 
F 3 HOH 59  273 231 HOH HOH L . 
F 3 HOH 60  274 233 HOH HOH L . 
F 3 HOH 61  275 236 HOH HOH L . 
F 3 HOH 62  276 239 HOH HOH L . 
F 3 HOH 63  277 241 HOH HOH L . 
F 3 HOH 64  278 243 HOH HOH L . 
F 3 HOH 65  279 245 HOH HOH L . 
F 3 HOH 66  280 246 HOH HOH L . 
F 3 HOH 67  281 253 HOH HOH L . 
F 3 HOH 68  282 265 HOH HOH L . 
F 3 HOH 69  283 266 HOH HOH L . 
F 3 HOH 70  284 267 HOH HOH L . 
F 3 HOH 71  285 272 HOH HOH L . 
F 3 HOH 72  286 274 HOH HOH L . 
F 3 HOH 73  287 277 HOH HOH L . 
F 3 HOH 74  288 280 HOH HOH L . 
F 3 HOH 75  289 281 HOH HOH L . 
F 3 HOH 76  290 287 HOH HOH L . 
F 3 HOH 77  291 288 HOH HOH L . 
F 3 HOH 78  292 291 HOH HOH L . 
F 3 HOH 79  293 298 HOH HOH L . 
F 3 HOH 80  294 304 HOH HOH L . 
F 3 HOH 81  295 308 HOH HOH L . 
F 3 HOH 82  296 311 HOH HOH L . 
F 3 HOH 83  297 315 HOH HOH L . 
F 3 HOH 84  298 317 HOH HOH L . 
F 3 HOH 85  299 318 HOH HOH L . 
F 3 HOH 86  300 322 HOH HOH L . 
F 3 HOH 87  301 323 HOH HOH L . 
F 3 HOH 88  302 325 HOH HOH L . 
F 3 HOH 89  303 327 HOH HOH L . 
F 3 HOH 90  304 328 HOH HOH L . 
F 3 HOH 91  305 330 HOH HOH L . 
F 3 HOH 92  306 333 HOH HOH L . 
F 3 HOH 93  307 336 HOH HOH L . 
F 3 HOH 94  308 338 HOH HOH L . 
F 3 HOH 95  309 346 HOH HOH L . 
F 3 HOH 96  310 349 HOH HOH L . 
F 3 HOH 97  311 351 HOH HOH L . 
F 3 HOH 98  312 355 HOH HOH L . 
F 3 HOH 99  313 357 HOH HOH L . 
F 3 HOH 100 314 363 HOH HOH L . 
F 3 HOH 101 315 367 HOH HOH L . 
F 3 HOH 102 316 368 HOH HOH L . 
F 3 HOH 103 317 369 HOH HOH L . 
F 3 HOH 104 318 371 HOH HOH L . 
F 3 HOH 105 319 379 HOH HOH L . 
F 3 HOH 106 320 380 HOH HOH L . 
F 3 HOH 107 321 383 HOH HOH L . 
F 3 HOH 108 322 385 HOH HOH L . 
F 3 HOH 109 323 386 HOH HOH L . 
F 3 HOH 110 324 388 HOH HOH L . 
F 3 HOH 111 325 390 HOH HOH L . 
F 3 HOH 112 326 394 HOH HOH L . 
F 3 HOH 113 327 397 HOH HOH L . 
F 3 HOH 114 328 399 HOH HOH L . 
F 3 HOH 115 329 405 HOH HOH L . 
F 3 HOH 116 330 406 HOH HOH L . 
F 3 HOH 117 331 407 HOH HOH L . 
F 3 HOH 118 332 412 HOH HOH L . 
F 3 HOH 119 333 413 HOH HOH L . 
F 3 HOH 120 334 414 HOH HOH L . 
F 3 HOH 121 335 425 HOH HOH L . 
F 3 HOH 122 336 427 HOH HOH L . 
G 3 HOH 1   215 3   HOH HOH A . 
G 3 HOH 2   216 4   HOH HOH A . 
G 3 HOH 3   217 9   HOH HOH A . 
G 3 HOH 4   218 12  HOH HOH A . 
G 3 HOH 5   219 13  HOH HOH A . 
G 3 HOH 6   220 18  HOH HOH A . 
G 3 HOH 7   221 20  HOH HOH A . 
G 3 HOH 8   222 24  HOH HOH A . 
G 3 HOH 9   223 34  HOH HOH A . 
G 3 HOH 10  224 36  HOH HOH A . 
G 3 HOH 11  225 37  HOH HOH A . 
G 3 HOH 12  226 43  HOH HOH A . 
G 3 HOH 13  227 48  HOH HOH A . 
G 3 HOH 14  228 49  HOH HOH A . 
G 3 HOH 15  229 51  HOH HOH A . 
G 3 HOH 16  230 53  HOH HOH A . 
G 3 HOH 17  231 54  HOH HOH A . 
G 3 HOH 18  232 57  HOH HOH A . 
G 3 HOH 19  233 60  HOH HOH A . 
G 3 HOH 20  234 61  HOH HOH A . 
G 3 HOH 21  235 63  HOH HOH A . 
G 3 HOH 22  236 65  HOH HOH A . 
G 3 HOH 23  237 73  HOH HOH A . 
G 3 HOH 24  238 74  HOH HOH A . 
G 3 HOH 25  239 88  HOH HOH A . 
G 3 HOH 26  240 92  HOH HOH A . 
G 3 HOH 27  241 95  HOH HOH A . 
G 3 HOH 28  242 100 HOH HOH A . 
G 3 HOH 29  243 122 HOH HOH A . 
G 3 HOH 30  244 128 HOH HOH A . 
G 3 HOH 31  245 130 HOH HOH A . 
G 3 HOH 32  246 133 HOH HOH A . 
G 3 HOH 33  247 136 HOH HOH A . 
G 3 HOH 34  248 139 HOH HOH A . 
G 3 HOH 35  249 141 HOH HOH A . 
G 3 HOH 36  250 147 HOH HOH A . 
G 3 HOH 37  251 151 HOH HOH A . 
G 3 HOH 38  252 152 HOH HOH A . 
G 3 HOH 39  253 154 HOH HOH A . 
G 3 HOH 40  254 155 HOH HOH A . 
G 3 HOH 41  255 156 HOH HOH A . 
G 3 HOH 42  256 159 HOH HOH A . 
G 3 HOH 43  257 161 HOH HOH A . 
G 3 HOH 44  258 168 HOH HOH A . 
G 3 HOH 45  259 172 HOH HOH A . 
G 3 HOH 46  260 175 HOH HOH A . 
G 3 HOH 47  261 176 HOH HOH A . 
G 3 HOH 48  262 178 HOH HOH A . 
G 3 HOH 49  263 180 HOH HOH A . 
G 3 HOH 50  264 181 HOH HOH A . 
G 3 HOH 51  265 183 HOH HOH A . 
G 3 HOH 52  266 184 HOH HOH A . 
G 3 HOH 53  267 189 HOH HOH A . 
G 3 HOH 54  268 194 HOH HOH A . 
G 3 HOH 55  269 195 HOH HOH A . 
G 3 HOH 56  270 197 HOH HOH A . 
G 3 HOH 57  271 205 HOH HOH A . 
G 3 HOH 58  272 206 HOH HOH A . 
G 3 HOH 59  273 210 HOH HOH A . 
G 3 HOH 60  274 232 HOH HOH A . 
G 3 HOH 61  275 247 HOH HOH A . 
G 3 HOH 62  276 250 HOH HOH A . 
G 3 HOH 63  277 254 HOH HOH A . 
G 3 HOH 64  278 263 HOH HOH A . 
G 3 HOH 65  279 268 HOH HOH A . 
G 3 HOH 66  280 273 HOH HOH A . 
G 3 HOH 67  281 276 HOH HOH A . 
G 3 HOH 68  282 282 HOH HOH A . 
G 3 HOH 69  283 289 HOH HOH A . 
G 3 HOH 70  284 295 HOH HOH A . 
G 3 HOH 71  285 301 HOH HOH A . 
G 3 HOH 72  286 303 HOH HOH A . 
G 3 HOH 73  287 305 HOH HOH A . 
G 3 HOH 74  288 307 HOH HOH A . 
G 3 HOH 75  289 309 HOH HOH A . 
G 3 HOH 76  290 310 HOH HOH A . 
G 3 HOH 77  291 313 HOH HOH A . 
G 3 HOH 78  292 314 HOH HOH A . 
G 3 HOH 79  293 334 HOH HOH A . 
G 3 HOH 80  294 337 HOH HOH A . 
G 3 HOH 81  295 339 HOH HOH A . 
G 3 HOH 82  296 340 HOH HOH A . 
G 3 HOH 83  297 341 HOH HOH A . 
G 3 HOH 84  298 343 HOH HOH A . 
G 3 HOH 85  299 344 HOH HOH A . 
G 3 HOH 86  300 347 HOH HOH A . 
G 3 HOH 87  301 352 HOH HOH A . 
G 3 HOH 88  302 358 HOH HOH A . 
G 3 HOH 89  303 360 HOH HOH A . 
G 3 HOH 90  304 361 HOH HOH A . 
G 3 HOH 91  305 364 HOH HOH A . 
G 3 HOH 92  306 370 HOH HOH A . 
G 3 HOH 93  307 374 HOH HOH A . 
G 3 HOH 94  308 375 HOH HOH A . 
G 3 HOH 95  309 389 HOH HOH A . 
G 3 HOH 96  310 391 HOH HOH A . 
G 3 HOH 97  311 392 HOH HOH A . 
G 3 HOH 98  312 398 HOH HOH A . 
G 3 HOH 99  313 402 HOH HOH A . 
G 3 HOH 100 314 409 HOH HOH A . 
G 3 HOH 101 315 416 HOH HOH A . 
G 3 HOH 102 316 418 HOH HOH A . 
G 3 HOH 103 317 420 HOH HOH A . 
G 3 HOH 104 318 421 HOH HOH A . 
G 3 HOH 105 319 423 HOH HOH A . 
G 3 HOH 106 320 426 HOH HOH A . 
G 3 HOH 107 321 428 HOH HOH A . 
G 3 HOH 108 322 430 HOH HOH A . 
G 3 HOH 109 323 431 HOH HOH A . 
G 3 HOH 110 324 432 HOH HOH A . 
G 3 HOH 111 325 433 HOH HOH A . 
G 3 HOH 112 326 436 HOH HOH A . 
H 3 HOH 1   215 1   HOH HOH B . 
H 3 HOH 2   216 7   HOH HOH B . 
H 3 HOH 3   217 16  HOH HOH B . 
H 3 HOH 4   218 19  HOH HOH B . 
H 3 HOH 5   219 22  HOH HOH B . 
H 3 HOH 6   220 25  HOH HOH B . 
H 3 HOH 7   221 28  HOH HOH B . 
H 3 HOH 8   222 30  HOH HOH B . 
H 3 HOH 9   223 31  HOH HOH B . 
H 3 HOH 10  224 32  HOH HOH B . 
H 3 HOH 11  225 38  HOH HOH B . 
H 3 HOH 12  226 39  HOH HOH B . 
H 3 HOH 13  227 41  HOH HOH B . 
H 3 HOH 14  228 42  HOH HOH B . 
H 3 HOH 15  229 46  HOH HOH B . 
H 3 HOH 16  230 56  HOH HOH B . 
H 3 HOH 17  231 62  HOH HOH B . 
H 3 HOH 18  232 64  HOH HOH B . 
H 3 HOH 19  233 66  HOH HOH B . 
H 3 HOH 20  234 68  HOH HOH B . 
H 3 HOH 21  235 70  HOH HOH B . 
H 3 HOH 22  236 77  HOH HOH B . 
H 3 HOH 23  237 78  HOH HOH B . 
H 3 HOH 24  238 79  HOH HOH B . 
H 3 HOH 25  239 80  HOH HOH B . 
H 3 HOH 26  240 83  HOH HOH B . 
H 3 HOH 27  241 86  HOH HOH B . 
H 3 HOH 28  242 89  HOH HOH B . 
H 3 HOH 29  243 94  HOH HOH B . 
H 3 HOH 30  244 105 HOH HOH B . 
H 3 HOH 31  245 106 HOH HOH B . 
H 3 HOH 32  246 107 HOH HOH B . 
H 3 HOH 33  247 108 HOH HOH B . 
H 3 HOH 34  248 110 HOH HOH B . 
H 3 HOH 35  249 115 HOH HOH B . 
H 3 HOH 36  250 116 HOH HOH B . 
H 3 HOH 37  251 118 HOH HOH B . 
H 3 HOH 38  252 121 HOH HOH B . 
H 3 HOH 39  253 126 HOH HOH B . 
H 3 HOH 40  254 127 HOH HOH B . 
H 3 HOH 41  255 129 HOH HOH B . 
H 3 HOH 42  256 148 HOH HOH B . 
H 3 HOH 43  257 149 HOH HOH B . 
H 3 HOH 44  258 153 HOH HOH B . 
H 3 HOH 45  259 158 HOH HOH B . 
H 3 HOH 46  260 160 HOH HOH B . 
H 3 HOH 47  261 166 HOH HOH B . 
H 3 HOH 48  262 171 HOH HOH B . 
H 3 HOH 49  263 173 HOH HOH B . 
H 3 HOH 50  264 174 HOH HOH B . 
H 3 HOH 51  265 187 HOH HOH B . 
H 3 HOH 52  266 191 HOH HOH B . 
H 3 HOH 53  267 196 HOH HOH B . 
H 3 HOH 54  268 199 HOH HOH B . 
H 3 HOH 55  269 201 HOH HOH B . 
H 3 HOH 56  270 202 HOH HOH B . 
H 3 HOH 57  271 204 HOH HOH B . 
H 3 HOH 58  272 207 HOH HOH B . 
H 3 HOH 59  273 208 HOH HOH B . 
H 3 HOH 60  274 212 HOH HOH B . 
H 3 HOH 61  275 214 HOH HOH B . 
H 3 HOH 62  276 215 HOH HOH B . 
H 3 HOH 63  277 218 HOH HOH B . 
H 3 HOH 64  278 222 HOH HOH B . 
H 3 HOH 65  279 223 HOH HOH B . 
H 3 HOH 66  280 225 HOH HOH B . 
H 3 HOH 67  281 229 HOH HOH B . 
H 3 HOH 68  282 234 HOH HOH B . 
H 3 HOH 69  283 235 HOH HOH B . 
H 3 HOH 70  284 237 HOH HOH B . 
H 3 HOH 71  285 238 HOH HOH B . 
H 3 HOH 72  286 240 HOH HOH B . 
H 3 HOH 73  287 242 HOH HOH B . 
H 3 HOH 74  288 248 HOH HOH B . 
H 3 HOH 75  289 249 HOH HOH B . 
H 3 HOH 76  290 251 HOH HOH B . 
H 3 HOH 77  291 252 HOH HOH B . 
H 3 HOH 78  292 255 HOH HOH B . 
H 3 HOH 79  293 256 HOH HOH B . 
H 3 HOH 80  294 257 HOH HOH B . 
H 3 HOH 81  295 259 HOH HOH B . 
H 3 HOH 82  296 262 HOH HOH B . 
H 3 HOH 83  297 269 HOH HOH B . 
H 3 HOH 84  298 270 HOH HOH B . 
H 3 HOH 85  299 271 HOH HOH B . 
H 3 HOH 86  300 275 HOH HOH B . 
H 3 HOH 87  301 279 HOH HOH B . 
H 3 HOH 88  302 283 HOH HOH B . 
H 3 HOH 89  303 285 HOH HOH B . 
H 3 HOH 90  304 290 HOH HOH B . 
H 3 HOH 91  305 292 HOH HOH B . 
H 3 HOH 92  306 294 HOH HOH B . 
H 3 HOH 93  307 299 HOH HOH B . 
H 3 HOH 94  308 300 HOH HOH B . 
H 3 HOH 95  309 302 HOH HOH B . 
H 3 HOH 96  310 312 HOH HOH B . 
H 3 HOH 97  311 319 HOH HOH B . 
H 3 HOH 98  312 321 HOH HOH B . 
H 3 HOH 99  313 324 HOH HOH B . 
H 3 HOH 100 314 326 HOH HOH B . 
H 3 HOH 101 315 329 HOH HOH B . 
H 3 HOH 102 316 331 HOH HOH B . 
H 3 HOH 103 317 345 HOH HOH B . 
H 3 HOH 104 318 348 HOH HOH B . 
H 3 HOH 105 319 350 HOH HOH B . 
H 3 HOH 106 320 354 HOH HOH B . 
H 3 HOH 107 321 356 HOH HOH B . 
H 3 HOH 108 322 359 HOH HOH B . 
H 3 HOH 109 323 362 HOH HOH B . 
H 3 HOH 110 324 366 HOH HOH B . 
H 3 HOH 111 325 372 HOH HOH B . 
H 3 HOH 112 326 373 HOH HOH B . 
H 3 HOH 113 327 377 HOH HOH B . 
H 3 HOH 114 328 378 HOH HOH B . 
H 3 HOH 115 329 382 HOH HOH B . 
H 3 HOH 116 330 384 HOH HOH B . 
H 3 HOH 117 331 393 HOH HOH B . 
H 3 HOH 118 332 396 HOH HOH B . 
H 3 HOH 119 333 400 HOH HOH B . 
H 3 HOH 120 334 404 HOH HOH B . 
H 3 HOH 121 335 408 HOH HOH B . 
H 3 HOH 122 336 410 HOH HOH B . 
H 3 HOH 123 337 424 HOH HOH B . 
H 3 HOH 124 338 434 HOH HOH B . 
H 3 HOH 125 339 435 HOH HOH B . 
#