data_1UEZ
# 
_entry.id   1UEZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1UEZ         pdb_00001uez 10.2210/pdb1uez/pdb 
RCSB  RCSB005750   ?            ?                   
WWPDB D_1000005750 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002001498.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UEZ 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-22 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, H.'                                                 1 
'Kigawa, T.'                                             2 
'Muto, Y.'                                               3 
'Koshiba, S.'                                            4 
'Inoue, M.'                                              5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the first PDZ domain of human KIAA1526 protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, H.'       1 ? 
primary 'Kigawa, T.'   2 ? 
primary 'Muto, Y.'     3 ? 
primary 'Koshiba, S.'  4 ? 
primary 'Inoue, M.'    5 ? 
primary 'Yokoyama, S.' 6 ? 
# 
_cell.entry_id           1UEZ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UEZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'KIAA1526 Protein' 
_entity.formula_weight             10401.824 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKALK
GSKKLVLSVYSAGRISGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKALK
GSKKLVLSVYSAGRISGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002001498.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLU n 
1 9   VAL n 
1 10  ARG n 
1 11  LEU n 
1 12  VAL n 
1 13  SER n 
1 14  LEU n 
1 15  ARG n 
1 16  ARG n 
1 17  ALA n 
1 18  LYS n 
1 19  ALA n 
1 20  HIS n 
1 21  GLU n 
1 22  GLY n 
1 23  LEU n 
1 24  GLY n 
1 25  PHE n 
1 26  SER n 
1 27  ILE n 
1 28  ARG n 
1 29  GLY n 
1 30  GLY n 
1 31  SER n 
1 32  GLU n 
1 33  HIS n 
1 34  GLY n 
1 35  VAL n 
1 36  GLY n 
1 37  ILE n 
1 38  TYR n 
1 39  VAL n 
1 40  SER n 
1 41  LEU n 
1 42  VAL n 
1 43  GLU n 
1 44  PRO n 
1 45  GLY n 
1 46  SER n 
1 47  LEU n 
1 48  ALA n 
1 49  GLU n 
1 50  LYS n 
1 51  GLU n 
1 52  GLY n 
1 53  LEU n 
1 54  ARG n 
1 55  VAL n 
1 56  GLY n 
1 57  ASP n 
1 58  GLN n 
1 59  ILE n 
1 60  LEU n 
1 61  ARG n 
1 62  VAL n 
1 63  ASN n 
1 64  ASP n 
1 65  LYS n 
1 66  SER n 
1 67  LEU n 
1 68  ALA n 
1 69  ARG n 
1 70  VAL n 
1 71  THR n 
1 72  HIS n 
1 73  ALA n 
1 74  GLU n 
1 75  ALA n 
1 76  VAL n 
1 77  LYS n 
1 78  ALA n 
1 79  LEU n 
1 80  LYS n 
1 81  GLY n 
1 82  SER n 
1 83  LYS n 
1 84  LYS n 
1 85  LEU n 
1 86  VAL n 
1 87  LEU n 
1 88  SER n 
1 89  VAL n 
1 90  TYR n 
1 91  SER n 
1 92  ALA n 
1 93  GLY n 
1 94  ARG n 
1 95  ILE n 
1 96  SER n 
1 97  GLY n 
1 98  PRO n 
1 99  SER n 
1 100 SER n 
1 101 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'KAZUSA cDNA fj04743' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P021030-45 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    WHRN_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKALKGSKKLVL
SVYSAGRI
;
_struct_ref.pdbx_align_begin           193 
_struct_ref.pdbx_db_accession          Q9P202 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UEZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 95 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9P202 
_struct_ref_seq.db_align_beg                  193 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  280 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       95 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1UEZ GLY A 1   ? UNP Q9P202 ? ? 'cloning artifact' 1   1  
1 1UEZ SER A 2   ? UNP Q9P202 ? ? 'cloning artifact' 2   2  
1 1UEZ SER A 3   ? UNP Q9P202 ? ? 'cloning artifact' 3   3  
1 1UEZ GLY A 4   ? UNP Q9P202 ? ? 'cloning artifact' 4   4  
1 1UEZ SER A 5   ? UNP Q9P202 ? ? 'cloning artifact' 5   5  
1 1UEZ SER A 6   ? UNP Q9P202 ? ? 'cloning artifact' 6   6  
1 1UEZ GLY A 7   ? UNP Q9P202 ? ? 'cloning artifact' 7   7  
1 1UEZ SER A 96  ? UNP Q9P202 ? ? 'cloning artifact' 96  8  
1 1UEZ GLY A 97  ? UNP Q9P202 ? ? 'cloning artifact' 97  9  
1 1UEZ PRO A 98  ? UNP Q9P202 ? ? 'cloning artifact' 98  10 
1 1UEZ SER A 99  ? UNP Q9P202 ? ? 'cloning artifact' 99  11 
1 1UEZ SER A 100 ? UNP Q9P202 ? ? 'cloning artifact' 100 12 
1 1UEZ GLY A 101 ? UNP Q9P202 ? ? 'cloning artifact' 101 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.6mM PDZ domain U-15N, 13C; 20mM d-Tris HCl(7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_refine.entry_id           1UEZ 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1UEZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1UEZ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6      collection           Bruker           1 
NMRPipe 20020425 processing           'Delaglio, F.'   2 
NMRView 5.0.4    'data analysis'      'Johnson, B. A.' 3 
KUJIRA  0.811    'data analysis'      'Kobayashi, N.'  4 
CYANA   1.0.7    'structure solution' 'Guentert, P.'   5 
CYANA   1.0.7    refinement           'Guentert, P.'   6 
# 
_exptl.entry_id          1UEZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1UEZ 
_struct.title                     'Solution structure of the first PDZ domain of human KIAA1526 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UEZ 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
'PDZ domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 47 ? GLU A 51 ? LEU A 47 GLU A 51 1 ? 5 
HELX_P HELX_P2 2 HIS A 72 ? LEU A 79 ? HIS A 72 LEU A 79 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 9  ? LEU A 14 ? VAL A 9  LEU A 14 
A 2 LEU A 85 ? TYR A 90 ? LEU A 85 TYR A 90 
A 3 ILE A 59 ? VAL A 62 ? ILE A 59 VAL A 62 
A 4 LYS A 65 ? SER A 66 ? LYS A 65 SER A 66 
B 1 PHE A 25 ? GLY A 29 ? PHE A 25 GLY A 29 
B 2 ILE A 37 ? VAL A 42 ? ILE A 37 VAL A 42 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 12 ? N VAL A 12 O LEU A 87 ? O LEU A 87 
A 2 3 O SER A 88 ? O SER A 88 N ARG A 61 ? N ARG A 61 
A 3 4 N VAL A 62 ? N VAL A 62 O LYS A 65 ? O LYS A 65 
B 1 2 N SER A 26 ? N SER A 26 O SER A 40 ? O SER A 40 
# 
_database_PDB_matrix.entry_id          1UEZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UEZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 13.206  -20.358 -18.518 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 12.811  -18.970 -18.689 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 12.999  -18.183 -17.390 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 13.856  -18.519 -16.575 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 12.894  -20.785 -17.669 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 13.403  -18.515 -19.483 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 11.768  -18.921 -19.000 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 12.183  -17.150 -17.238 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 12.248  -16.312 -16.053 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 11.025  -16.561 -15.168 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 9.956   -16.910 -15.666 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 12.339  -14.832 -16.429 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 11.064  -14.284 -16.753 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 11.488  -16.884 -17.906 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 13.161  -16.612 -15.538 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 12.774  -14.274 -15.600 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 13.011  -14.715 -17.279 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 10.558  -14.078 -15.916 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 11.224  -16.373 -13.872 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 10.151  -16.572 -12.913 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 10.240  -15.525 -11.802 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 11.177  -15.538 -11.005 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 10.198  -17.981 -12.319 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 8.911   -18.427 -11.899 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 12.097  -16.089 -13.476 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 9.229   -16.449 -13.482 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 10.597  -18.674 -13.060 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 10.881  -17.994 -11.471 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 8.627   -19.215 -12.444 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 9.253   -14.641 -11.784 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 9.208   -13.589 -10.784 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 7.768   -13.301 -10.354 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 7.129   -12.392 -10.881 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 8.495   -14.637 -12.436 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 9.799   -13.882 -9.916  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 9.660   -12.681 -11.185 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 7.299   -14.094 -9.401  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 5.947   -13.936 -8.895  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 5.978   -13.266 -7.520  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 5.386   -12.204 -7.330  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 5.229   -15.285 -8.812  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 3.836   -15.166 -9.086  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 7.826   -14.831 -8.978  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 5.440   -13.299 -9.620  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 5.680   -15.980 -9.520  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 5.368   -15.708 -7.817  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 3.328   -15.041 -8.234  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 6.674   -13.913 -6.597  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 6.790   -13.392 -5.245  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 7.530   -12.054 -5.262  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 8.702   -11.993 -5.631  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 7.510   -14.386 -4.332  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 7.620   -13.901 -2.997  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 7.152   -14.776 -6.760  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 5.765   -13.258 -4.899  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 6.970   -15.333 -4.330  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 8.505   -14.587 -4.728  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 8.492   -14.188 -2.600  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 6.816   -11.014 -4.857  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 7.391   -9.680  -4.820  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 7.095   -8.919  -6.114  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 7.383   -9.408  -7.205  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 5.864   -11.072 -4.558  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 6.988   -9.129  -3.970  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 8.469   -9.748  -4.673  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . GLU A 1 8   ? 6.523   -7.735  -5.949  1.00 0.00 ? 8   GLU A N    1  
ATOM 67    C CA   . GLU A 1 8   ? 6.184   -6.903  -7.091  1.00 0.00 ? 8   GLU A CA   1  
ATOM 68    C C    . GLU A 1 8   ? 5.772   -5.505  -6.625  1.00 0.00 ? 8   GLU A C    1  
ATOM 69    O O    . GLU A 1 8   ? 4.727   -5.338  -5.999  1.00 0.00 ? 8   GLU A O    1  
ATOM 70    C CB   . GLU A 1 8   ? 5.081   -7.547  -7.932  1.00 0.00 ? 8   GLU A CB   1  
ATOM 71    C CG   . GLU A 1 8   ? 5.626   -8.025  -9.279  1.00 0.00 ? 8   GLU A CG   1  
ATOM 72    C CD   . GLU A 1 8   ? 4.873   -9.263  -9.768  1.00 0.00 ? 8   GLU A CD   1  
ATOM 73    O OE1  . GLU A 1 8   ? 4.790   -10.227 -8.976  1.00 0.00 ? 8   GLU A OE1  1  
ATOM 74    O OE2  . GLU A 1 8   ? 4.397   -9.219  -10.923 1.00 0.00 ? 8   GLU A OE2  1  
ATOM 75    H H    . GLU A 1 8   ? 6.292   -7.345  -5.058  1.00 0.00 ? 8   GLU A H    1  
ATOM 76    H HA   . GLU A 1 8   ? 7.096   -6.841  -7.685  1.00 0.00 ? 8   GLU A HA   1  
ATOM 77    H HB2  . GLU A 1 8   ? 4.651   -8.390  -7.390  1.00 0.00 ? 8   GLU A HB2  1  
ATOM 78    H HB3  . GLU A 1 8   ? 4.276   -6.830  -8.095  1.00 0.00 ? 8   GLU A HB3  1  
ATOM 79    H HG2  . GLU A 1 8   ? 5.536   -7.226  -10.016 1.00 0.00 ? 8   GLU A HG2  1  
ATOM 80    H HG3  . GLU A 1 8   ? 6.688   -8.253  -9.186  1.00 0.00 ? 8   GLU A HG3  1  
ATOM 81    N N    . VAL A 1 9   ? 6.616   -4.536  -6.948  1.00 0.00 ? 9   VAL A N    1  
ATOM 82    C CA   . VAL A 1 9   ? 6.353   -3.158  -6.570  1.00 0.00 ? 9   VAL A CA   1  
ATOM 83    C C    . VAL A 1 9   ? 5.249   -2.590  -7.464  1.00 0.00 ? 9   VAL A C    1  
ATOM 84    O O    . VAL A 1 9   ? 5.355   -2.628  -8.689  1.00 0.00 ? 9   VAL A O    1  
ATOM 85    C CB   . VAL A 1 9   ? 7.647   -2.343  -6.628  1.00 0.00 ? 9   VAL A CB   1  
ATOM 86    C CG1  . VAL A 1 9   ? 7.350   -0.842  -6.616  1.00 0.00 ? 9   VAL A CG1  1  
ATOM 87    C CG2  . VAL A 1 9   ? 8.587   -2.725  -5.483  1.00 0.00 ? 9   VAL A CG2  1  
ATOM 88    H H    . VAL A 1 9   ? 7.464   -4.679  -7.457  1.00 0.00 ? 9   VAL A H    1  
ATOM 89    H HA   . VAL A 1 9   ? 6.002   -3.161  -5.538  1.00 0.00 ? 9   VAL A HA   1  
ATOM 90    H HB   . VAL A 1 9   ? 8.149   -2.578  -7.566  1.00 0.00 ? 9   VAL A HB   1  
ATOM 91    H HG11 . VAL A 1 9   ? 7.611   -0.412  -7.583  1.00 0.00 ? 9   VAL A HG11 1  
ATOM 92    H HG12 . VAL A 1 9   ? 6.289   -0.682  -6.422  1.00 0.00 ? 9   VAL A HG12 1  
ATOM 93    H HG13 . VAL A 1 9   ? 7.939   -0.361  -5.834  1.00 0.00 ? 9   VAL A HG13 1  
ATOM 94    H HG21 . VAL A 1 9   ? 8.148   -2.417  -4.534  1.00 0.00 ? 9   VAL A HG21 1  
ATOM 95    H HG22 . VAL A 1 9   ? 8.736   -3.805  -5.481  1.00 0.00 ? 9   VAL A HG22 1  
ATOM 96    H HG23 . VAL A 1 9   ? 9.546   -2.226  -5.618  1.00 0.00 ? 9   VAL A HG23 1  
ATOM 97    N N    . ARG A 1 10  ? 4.213   -2.077  -6.817  1.00 0.00 ? 10  ARG A N    1  
ATOM 98    C CA   . ARG A 1 10  ? 3.090   -1.502  -7.538  1.00 0.00 ? 10  ARG A CA   1  
ATOM 99    C C    . ARG A 1 10  ? 3.271   0.010   -7.684  1.00 0.00 ? 10  ARG A C    1  
ATOM 100   O O    . ARG A 1 10  ? 4.101   0.608   -7.002  1.00 0.00 ? 10  ARG A O    1  
ATOM 101   C CB   . ARG A 1 10  ? 1.770   -1.784  -6.817  1.00 0.00 ? 10  ARG A CB   1  
ATOM 102   C CG   . ARG A 1 10  ? 1.806   -1.257  -5.381  1.00 0.00 ? 10  ARG A CG   1  
ATOM 103   C CD   . ARG A 1 10  ? 1.501   -2.372  -4.379  1.00 0.00 ? 10  ARG A CD   1  
ATOM 104   N NE   . ARG A 1 10  ? 0.054   -2.685  -4.396  1.00 0.00 ? 10  ARG A NE   1  
ATOM 105   C CZ   . ARG A 1 10  ? -0.605  -3.246  -3.373  1.00 0.00 ? 10  ARG A CZ   1  
ATOM 106   N NH1  . ARG A 1 10  ? 0.049   -3.559  -2.246  1.00 0.00 ? 10  ARG A NH1  1  
ATOM 107   N NH2  . ARG A 1 10  ? -1.917  -3.494  -3.477  1.00 0.00 ? 10  ARG A NH2  1  
ATOM 108   H H    . ARG A 1 10  ? 4.133   -2.049  -5.820  1.00 0.00 ? 10  ARG A H    1  
ATOM 109   H HA   . ARG A 1 10  ? 3.102   -1.994  -8.510  1.00 0.00 ? 10  ARG A HA   1  
ATOM 110   H HB2  . ARG A 1 10  ? 0.948   -1.316  -7.359  1.00 0.00 ? 10  ARG A HB2  1  
ATOM 111   H HB3  . ARG A 1 10  ? 1.577   -2.856  -6.809  1.00 0.00 ? 10  ARG A HB3  1  
ATOM 112   H HG2  . ARG A 1 10  ? 2.788   -0.833  -5.170  1.00 0.00 ? 10  ARG A HG2  1  
ATOM 113   H HG3  . ARG A 1 10  ? 1.080   -0.452  -5.266  1.00 0.00 ? 10  ARG A HG3  1  
ATOM 114   H HD2  . ARG A 1 10  ? 2.077   -3.263  -4.628  1.00 0.00 ? 10  ARG A HD2  1  
ATOM 115   H HD3  . ARG A 1 10  ? 1.804   -2.066  -3.378  1.00 0.00 ? 10  ARG A HD3  1  
ATOM 116   H HE   . ARG A 1 10  ? -0.463  -2.465  -5.223  1.00 0.00 ? 10  ARG A HE   1  
ATOM 117   H HH11 . ARG A 1 10  ? 1.029   -3.374  -2.168  1.00 0.00 ? 10  ARG A HH11 1  
ATOM 118   H HH12 . ARG A 1 10  ? -0.443  -3.977  -1.482  1.00 0.00 ? 10  ARG A HH12 1  
ATOM 119   H HH21 . ARG A 1 10  ? -2.405  -3.261  -4.318  1.00 0.00 ? 10  ARG A HH21 1  
ATOM 120   H HH22 . ARG A 1 10  ? -2.409  -3.912  -2.713  1.00 0.00 ? 10  ARG A HH22 1  
ATOM 121   N N    . LEU A 1 11  ? 2.479   0.585   -8.577  1.00 0.00 ? 11  LEU A N    1  
ATOM 122   C CA   . LEU A 1 11  ? 2.541   2.016   -8.821  1.00 0.00 ? 11  LEU A CA   1  
ATOM 123   C C    . LEU A 1 11  ? 1.183   2.643   -8.502  1.00 0.00 ? 11  LEU A C    1  
ATOM 124   O O    . LEU A 1 11  ? 0.214   2.441   -9.232  1.00 0.00 ? 11  LEU A O    1  
ATOM 125   C CB   . LEU A 1 11  ? 3.028   2.296   -10.245 1.00 0.00 ? 11  LEU A CB   1  
ATOM 126   C CG   . LEU A 1 11  ? 4.488   1.943   -10.536 1.00 0.00 ? 11  LEU A CG   1  
ATOM 127   C CD1  . LEU A 1 11  ? 4.883   2.367   -11.952 1.00 0.00 ? 11  LEU A CD1  1  
ATOM 128   C CD2  . LEU A 1 11  ? 5.418   2.541   -9.478  1.00 0.00 ? 11  LEU A CD2  1  
ATOM 129   H H    . LEU A 1 11  ? 1.806   0.091   -9.128  1.00 0.00 ? 11  LEU A H    1  
ATOM 130   H HA   . LEU A 1 11  ? 3.283   2.432   -8.139  1.00 0.00 ? 11  LEU A HA   1  
ATOM 131   H HB2  . LEU A 1 11  ? 2.396   1.743   -10.939 1.00 0.00 ? 11  LEU A HB2  1  
ATOM 132   H HB3  . LEU A 1 11  ? 2.882   3.355   -10.455 1.00 0.00 ? 11  LEU A HB3  1  
ATOM 133   H HG   . LEU A 1 11  ? 4.595   0.860   -10.482 1.00 0.00 ? 11  LEU A HG   1  
ATOM 134   H HD11 . LEU A 1 11  ? 4.102   2.069   -12.651 1.00 0.00 ? 11  LEU A HD11 1  
ATOM 135   H HD12 . LEU A 1 11  ? 5.007   3.449   -11.986 1.00 0.00 ? 11  LEU A HD12 1  
ATOM 136   H HD13 . LEU A 1 11  ? 5.821   1.884   -12.227 1.00 0.00 ? 11  LEU A HD13 1  
ATOM 137   H HD21 . LEU A 1 11  ? 5.591   1.809   -8.690  1.00 0.00 ? 11  LEU A HD21 1  
ATOM 138   H HD22 . LEU A 1 11  ? 6.369   2.809   -9.940  1.00 0.00 ? 11  LEU A HD22 1  
ATOM 139   H HD23 . LEU A 1 11  ? 4.957   3.432   -9.051  1.00 0.00 ? 11  LEU A HD23 1  
ATOM 140   N N    . VAL A 1 12  ? 1.155   3.393   -7.409  1.00 0.00 ? 12  VAL A N    1  
ATOM 141   C CA   . VAL A 1 12  ? -0.068  4.051   -6.984  1.00 0.00 ? 12  VAL A CA   1  
ATOM 142   C C    . VAL A 1 12  ? -0.005  5.531   -7.365  1.00 0.00 ? 12  VAL A C    1  
ATOM 143   O O    . VAL A 1 12  ? 1.046   6.160   -7.253  1.00 0.00 ? 12  VAL A O    1  
ATOM 144   C CB   . VAL A 1 12  ? -0.289  3.828   -5.486  1.00 0.00 ? 12  VAL A CB   1  
ATOM 145   C CG1  . VAL A 1 12  ? -1.475  4.651   -4.979  1.00 0.00 ? 12  VAL A CG1  1  
ATOM 146   C CG2  . VAL A 1 12  ? -0.479  2.342   -5.176  1.00 0.00 ? 12  VAL A CG2  1  
ATOM 147   H H    . VAL A 1 12  ? 1.948   3.553   -6.821  1.00 0.00 ? 12  VAL A H    1  
ATOM 148   H HA   . VAL A 1 12  ? -0.895  3.585   -7.520  1.00 0.00 ? 12  VAL A HA   1  
ATOM 149   H HB   . VAL A 1 12  ? 0.604   4.168   -4.962  1.00 0.00 ? 12  VAL A HB   1  
ATOM 150   H HG11 . VAL A 1 12  ? -1.852  5.280   -5.785  1.00 0.00 ? 12  VAL A HG11 1  
ATOM 151   H HG12 . VAL A 1 12  ? -2.265  3.980   -4.641  1.00 0.00 ? 12  VAL A HG12 1  
ATOM 152   H HG13 . VAL A 1 12  ? -1.152  5.279   -4.148  1.00 0.00 ? 12  VAL A HG13 1  
ATOM 153   H HG21 . VAL A 1 12  ? -1.544  2.108   -5.157  1.00 0.00 ? 12  VAL A HG21 1  
ATOM 154   H HG22 . VAL A 1 12  ? 0.011   1.744   -5.944  1.00 0.00 ? 12  VAL A HG22 1  
ATOM 155   H HG23 . VAL A 1 12  ? -0.041  2.115   -4.204  1.00 0.00 ? 12  VAL A HG23 1  
ATOM 156   N N    . SER A 1 13  ? -1.143  6.045   -7.808  1.00 0.00 ? 13  SER A N    1  
ATOM 157   C CA   . SER A 1 13  ? -1.231  7.439   -8.206  1.00 0.00 ? 13  SER A CA   1  
ATOM 158   C C    . SER A 1 13  ? -2.415  8.110   -7.508  1.00 0.00 ? 13  SER A C    1  
ATOM 159   O O    . SER A 1 13  ? -3.545  7.631   -7.597  1.00 0.00 ? 13  SER A O    1  
ATOM 160   C CB   . SER A 1 13  ? -1.365  7.571   -9.724  1.00 0.00 ? 13  SER A CB   1  
ATOM 161   O OG   . SER A 1 13  ? -1.644  8.911   -10.121 1.00 0.00 ? 13  SER A OG   1  
ATOM 162   H H    . SER A 1 13  ? -1.994  5.526   -7.896  1.00 0.00 ? 13  SER A H    1  
ATOM 163   H HA   . SER A 1 13  ? -0.292  7.890   -7.885  1.00 0.00 ? 13  SER A HA   1  
ATOM 164   H HB2  . SER A 1 13  ? -0.444  7.236   -10.200 1.00 0.00 ? 13  SER A HB2  1  
ATOM 165   H HB3  . SER A 1 13  ? -2.162  6.915   -10.076 1.00 0.00 ? 13  SER A HB3  1  
ATOM 166   H HG   . SER A 1 13  ? -1.124  9.551   -9.555  1.00 0.00 ? 13  SER A HG   1  
ATOM 167   N N    . LEU A 1 14  ? -2.117  9.207   -6.828  1.00 0.00 ? 14  LEU A N    1  
ATOM 168   C CA   . LEU A 1 14  ? -3.143  9.949   -6.115  1.00 0.00 ? 14  LEU A CA   1  
ATOM 169   C C    . LEU A 1 14  ? -3.151  11.399  -6.604  1.00 0.00 ? 14  LEU A C    1  
ATOM 170   O O    . LEU A 1 14  ? -2.102  12.034  -6.690  1.00 0.00 ? 14  LEU A O    1  
ATOM 171   C CB   . LEU A 1 14  ? -2.951  9.810   -4.603  1.00 0.00 ? 14  LEU A CB   1  
ATOM 172   C CG   . LEU A 1 14  ? -3.517  8.538   -3.969  1.00 0.00 ? 14  LEU A CG   1  
ATOM 173   C CD1  . LEU A 1 14  ? -5.021  8.420   -4.226  1.00 0.00 ? 14  LEU A CD1  1  
ATOM 174   C CD2  . LEU A 1 14  ? -2.755  7.301   -4.448  1.00 0.00 ? 14  LEU A CD2  1  
ATOM 175   H H    . LEU A 1 14  ? -1.195  9.590   -6.761  1.00 0.00 ? 14  LEU A H    1  
ATOM 176   H HA   . LEU A 1 14  ? -4.103  9.496   -6.361  1.00 0.00 ? 14  LEU A HA   1  
ATOM 177   H HB2  . LEU A 1 14  ? -1.884  9.856   -4.387  1.00 0.00 ? 14  LEU A HB2  1  
ATOM 178   H HB3  . LEU A 1 14  ? -3.412  10.670  -4.118  1.00 0.00 ? 14  LEU A HB3  1  
ATOM 179   H HG   . LEU A 1 14  ? -3.379  8.604   -2.890  1.00 0.00 ? 14  LEU A HG   1  
ATOM 180   H HD11 . LEU A 1 14  ? -5.384  9.338   -4.688  1.00 0.00 ? 14  LEU A HD11 1  
ATOM 181   H HD12 . LEU A 1 14  ? -5.211  7.578   -4.891  1.00 0.00 ? 14  LEU A HD12 1  
ATOM 182   H HD13 . LEU A 1 14  ? -5.539  8.260   -3.280  1.00 0.00 ? 14  LEU A HD13 1  
ATOM 183   H HD21 . LEU A 1 14  ? -3.453  6.598   -4.904  1.00 0.00 ? 14  LEU A HD21 1  
ATOM 184   H HD22 . LEU A 1 14  ? -2.006  7.597   -5.182  1.00 0.00 ? 14  LEU A HD22 1  
ATOM 185   H HD23 . LEU A 1 14  ? -2.264  6.826   -3.599  1.00 0.00 ? 14  LEU A HD23 1  
ATOM 186   N N    . ARG A 1 15  ? -4.347  11.879  -6.910  1.00 0.00 ? 15  ARG A N    1  
ATOM 187   C CA   . ARG A 1 15  ? -4.506  13.242  -7.388  1.00 0.00 ? 15  ARG A CA   1  
ATOM 188   C C    . ARG A 1 15  ? -5.643  13.939  -6.637  1.00 0.00 ? 15  ARG A C    1  
ATOM 189   O O    . ARG A 1 15  ? -6.626  13.301  -6.261  1.00 0.00 ? 15  ARG A O    1  
ATOM 190   C CB   . ARG A 1 15  ? -4.803  13.269  -8.888  1.00 0.00 ? 15  ARG A CB   1  
ATOM 191   C CG   . ARG A 1 15  ? -3.784  14.133  -9.634  1.00 0.00 ? 15  ARG A CG   1  
ATOM 192   C CD   . ARG A 1 15  ? -4.480  15.246  -10.420 1.00 0.00 ? 15  ARG A CD   1  
ATOM 193   N NE   . ARG A 1 15  ? -4.300  15.028  -11.873 1.00 0.00 ? 15  ARG A NE   1  
ATOM 194   C CZ   . ARG A 1 15  ? -4.440  15.986  -12.799 1.00 0.00 ? 15  ARG A CZ   1  
ATOM 195   N NH1  . ARG A 1 15  ? -4.764  17.233  -12.430 1.00 0.00 ? 15  ARG A NH1  1  
ATOM 196   N NH2  . ARG A 1 15  ? -4.257  15.697  -14.095 1.00 0.00 ? 15  ARG A NH2  1  
ATOM 197   H H    . ARG A 1 15  ? -5.196  11.355  -6.837  1.00 0.00 ? 15  ARG A H    1  
ATOM 198   H HA   . ARG A 1 15  ? -3.549  13.722  -7.183  1.00 0.00 ? 15  ARG A HA   1  
ATOM 199   H HB2  . ARG A 1 15  ? -4.784  12.254  -9.285  1.00 0.00 ? 15  ARG A HB2  1  
ATOM 200   H HB3  . ARG A 1 15  ? -5.808  13.658  -9.057  1.00 0.00 ? 15  ARG A HB3  1  
ATOM 201   H HG2  . ARG A 1 15  ? -3.083  14.569  -8.923  1.00 0.00 ? 15  ARG A HG2  1  
ATOM 202   H HG3  . ARG A 1 15  ? -3.203  13.511  -10.314 1.00 0.00 ? 15  ARG A HG3  1  
ATOM 203   H HD2  . ARG A 1 15  ? -5.542  15.266  -10.176 1.00 0.00 ? 15  ARG A HD2  1  
ATOM 204   H HD3  . ARG A 1 15  ? -4.070  16.215  -10.136 1.00 0.00 ? 15  ARG A HD3  1  
ATOM 205   H HE   . ARG A 1 15  ? -4.058  14.108  -12.183 1.00 0.00 ? 15  ARG A HE   1  
ATOM 206   H HH11 . ARG A 1 15  ? -4.900  17.449  -11.463 1.00 0.00 ? 15  ARG A HH11 1  
ATOM 207   H HH12 . ARG A 1 15  ? -4.868  17.948  -13.121 1.00 0.00 ? 15  ARG A HH12 1  
ATOM 208   H HH21 . ARG A 1 15  ? -4.016  14.767  -14.370 1.00 0.00 ? 15  ARG A HH21 1  
ATOM 209   H HH22 . ARG A 1 15  ? -4.362  16.412  -14.786 1.00 0.00 ? 15  ARG A HH22 1  
ATOM 210   N N    . ARG A 1 16  ? -5.471  15.238  -6.440  1.00 0.00 ? 16  ARG A N    1  
ATOM 211   C CA   . ARG A 1 16  ? -6.470  16.027  -5.741  1.00 0.00 ? 16  ARG A CA   1  
ATOM 212   C C    . ARG A 1 16  ? -6.065  17.503  -5.725  1.00 0.00 ? 16  ARG A C    1  
ATOM 213   O O    . ARG A 1 16  ? -6.875  18.376  -6.031  1.00 0.00 ? 16  ARG A O    1  
ATOM 214   C CB   . ARG A 1 16  ? -6.650  15.539  -4.302  1.00 0.00 ? 16  ARG A CB   1  
ATOM 215   C CG   . ARG A 1 16  ? -8.133  15.442  -3.938  1.00 0.00 ? 16  ARG A CG   1  
ATOM 216   C CD   . ARG A 1 16  ? -8.447  14.101  -3.271  1.00 0.00 ? 16  ARG A CD   1  
ATOM 217   N NE   . ARG A 1 16  ? -9.553  14.264  -2.302  1.00 0.00 ? 16  ARG A NE   1  
ATOM 218   C CZ   . ARG A 1 16  ? -10.844 14.368  -2.645  1.00 0.00 ? 16  ARG A CZ   1  
ATOM 219   N NH1  . ARG A 1 16  ? -11.199 14.326  -3.936  1.00 0.00 ? 16  ARG A NH1  1  
ATOM 220   N NH2  . ARG A 1 16  ? -11.780 14.514  -1.697  1.00 0.00 ? 16  ARG A NH2  1  
ATOM 221   H H    . ARG A 1 16  ? -4.669  15.749  -6.749  1.00 0.00 ? 16  ARG A H    1  
ATOM 222   H HA   . ARG A 1 16  ? -7.389  15.879  -6.308  1.00 0.00 ? 16  ARG A HA   1  
ATOM 223   H HB2  . ARG A 1 16  ? -6.178  14.564  -4.184  1.00 0.00 ? 16  ARG A HB2  1  
ATOM 224   H HB3  . ARG A 1 16  ? -6.148  16.222  -3.617  1.00 0.00 ? 16  ARG A HB3  1  
ATOM 225   H HG2  . ARG A 1 16  ? -8.400  16.257  -3.266  1.00 0.00 ? 16  ARG A HG2  1  
ATOM 226   H HG3  . ARG A 1 16  ? -8.740  15.557  -4.836  1.00 0.00 ? 16  ARG A HG3  1  
ATOM 227   H HD2  . ARG A 1 16  ? -8.721  13.365  -4.027  1.00 0.00 ? 16  ARG A HD2  1  
ATOM 228   H HD3  . ARG A 1 16  ? -7.560  13.721  -2.764  1.00 0.00 ? 16  ARG A HD3  1  
ATOM 229   H HE   . ARG A 1 16  ? -9.322  14.300  -1.329  1.00 0.00 ? 16  ARG A HE   1  
ATOM 230   H HH11 . ARG A 1 16  ? -10.501 14.217  -4.644  1.00 0.00 ? 16  ARG A HH11 1  
ATOM 231   H HH12 . ARG A 1 16  ? -12.163 14.403  -4.192  1.00 0.00 ? 16  ARG A HH12 1  
ATOM 232   H HH21 . ARG A 1 16  ? -11.515 14.545  -0.733  1.00 0.00 ? 16  ARG A HH21 1  
ATOM 233   H HH22 . ARG A 1 16  ? -12.743 14.591  -1.953  1.00 0.00 ? 16  ARG A HH22 1  
ATOM 234   N N    . ALA A 1 17  ? -4.811  17.735  -5.365  1.00 0.00 ? 17  ALA A N    1  
ATOM 235   C CA   . ALA A 1 17  ? -4.288  19.089  -5.305  1.00 0.00 ? 17  ALA A CA   1  
ATOM 236   C C    . ALA A 1 17  ? -5.188  19.939  -4.405  1.00 0.00 ? 17  ALA A C    1  
ATOM 237   O O    . ALA A 1 17  ? -5.943  20.779  -4.892  1.00 0.00 ? 17  ALA A O    1  
ATOM 238   C CB   . ALA A 1 17  ? -4.177  19.657  -6.721  1.00 0.00 ? 17  ALA A CB   1  
ATOM 239   H H    . ALA A 1 17  ? -4.158  17.019  -5.118  1.00 0.00 ? 17  ALA A H    1  
ATOM 240   H HA   . ALA A 1 17  ? -3.291  19.041  -4.866  1.00 0.00 ? 17  ALA A HA   1  
ATOM 241   H HB1  . ALA A 1 17  ? -3.460  19.068  -7.294  1.00 0.00 ? 17  ALA A HB1  1  
ATOM 242   H HB2  . ALA A 1 17  ? -5.152  19.615  -7.207  1.00 0.00 ? 17  ALA A HB2  1  
ATOM 243   H HB3  . ALA A 1 17  ? -3.839  20.692  -6.672  1.00 0.00 ? 17  ALA A HB3  1  
ATOM 244   N N    . LYS A 1 18  ? -5.077  19.691  -3.108  1.00 0.00 ? 18  LYS A N    1  
ATOM 245   C CA   . LYS A 1 18  ? -5.871  20.423  -2.136  1.00 0.00 ? 18  LYS A CA   1  
ATOM 246   C C    . LYS A 1 18  ? -5.467  19.991  -0.725  1.00 0.00 ? 18  LYS A C    1  
ATOM 247   O O    . LYS A 1 18  ? -5.696  18.848  -0.333  1.00 0.00 ? 18  LYS A O    1  
ATOM 248   C CB   . LYS A 1 18  ? -7.364  20.254  -2.427  1.00 0.00 ? 18  LYS A CB   1  
ATOM 249   C CG   . LYS A 1 18  ? -8.162  21.455  -1.915  1.00 0.00 ? 18  LYS A CG   1  
ATOM 250   C CD   . LYS A 1 18  ? -9.591  21.438  -2.463  1.00 0.00 ? 18  LYS A CD   1  
ATOM 251   C CE   . LYS A 1 18  ? -10.011 22.829  -2.942  1.00 0.00 ? 18  LYS A CE   1  
ATOM 252   N NZ   . LYS A 1 18  ? -9.233  23.222  -4.138  1.00 0.00 ? 18  LYS A NZ   1  
ATOM 253   H H    . LYS A 1 18  ? -4.461  19.006  -2.721  1.00 0.00 ? 18  LYS A H    1  
ATOM 254   H HA   . LYS A 1 18  ? -5.638  21.481  -2.254  1.00 0.00 ? 18  LYS A HA   1  
ATOM 255   H HB2  . LYS A 1 18  ? -7.519  20.141  -3.500  1.00 0.00 ? 18  LYS A HB2  1  
ATOM 256   H HB3  . LYS A 1 18  ? -7.729  19.342  -1.955  1.00 0.00 ? 18  LYS A HB3  1  
ATOM 257   H HG2  . LYS A 1 18  ? -8.186  21.442  -0.826  1.00 0.00 ? 18  LYS A HG2  1  
ATOM 258   H HG3  . LYS A 1 18  ? -7.666  22.379  -2.212  1.00 0.00 ? 18  LYS A HG3  1  
ATOM 259   H HD2  . LYS A 1 18  ? -9.659  20.729  -3.288  1.00 0.00 ? 18  LYS A HD2  1  
ATOM 260   H HD3  . LYS A 1 18  ? -10.276 21.093  -1.688  1.00 0.00 ? 18  LYS A HD3  1  
ATOM 261   H HE2  . LYS A 1 18  ? -11.076 22.833  -3.176  1.00 0.00 ? 18  LYS A HE2  1  
ATOM 262   H HE3  . LYS A 1 18  ? -9.857  23.556  -2.145  1.00 0.00 ? 18  LYS A HE3  1  
ATOM 263   H HZ1  . LYS A 1 18  ? -8.621  23.977  -3.904  1.00 0.00 ? 18  LYS A HZ1  1  
ATOM 264   H HZ2  . LYS A 1 18  ? -8.694  22.442  -4.456  1.00 0.00 ? 18  LYS A HZ2  1  
ATOM 265   H HZ3  . LYS A 1 18  ? -9.859  23.512  -4.862  1.00 0.00 ? 18  LYS A HZ3  1  
ATOM 266   N N    . ALA A 1 19  ? -4.874  20.929  -0.001  1.00 0.00 ? 19  ALA A N    1  
ATOM 267   C CA   . ALA A 1 19  ? -4.436  20.660  1.358   1.00 0.00 ? 19  ALA A CA   1  
ATOM 268   C C    . ALA A 1 19  ? -5.660  20.479  2.257   1.00 0.00 ? 19  ALA A C    1  
ATOM 269   O O    . ALA A 1 19  ? -5.918  21.302  3.133   1.00 0.00 ? 19  ALA A O    1  
ATOM 270   C CB   . ALA A 1 19  ? -3.524  21.792  1.835   1.00 0.00 ? 19  ALA A CB   1  
ATOM 271   H H    . ALA A 1 19  ? -4.692  21.856  -0.328  1.00 0.00 ? 19  ALA A H    1  
ATOM 272   H HA   . ALA A 1 19  ? -3.864  19.731  1.345   1.00 0.00 ? 19  ALA A HA   1  
ATOM 273   H HB1  . ALA A 1 19  ? -2.929  21.448  2.680   1.00 0.00 ? 19  ALA A HB1  1  
ATOM 274   H HB2  . ALA A 1 19  ? -2.863  22.093  1.022   1.00 0.00 ? 19  ALA A HB2  1  
ATOM 275   H HB3  . ALA A 1 19  ? -4.133  22.643  2.141   1.00 0.00 ? 19  ALA A HB3  1  
ATOM 276   N N    . HIS A 1 20  ? -6.382  19.395  2.010   1.00 0.00 ? 20  HIS A N    1  
ATOM 277   C CA   . HIS A 1 20  ? -7.573  19.096  2.786   1.00 0.00 ? 20  HIS A CA   1  
ATOM 278   C C    . HIS A 1 20  ? -7.364  17.795  3.565   1.00 0.00 ? 20  HIS A C    1  
ATOM 279   O O    . HIS A 1 20  ? -7.662  17.726  4.756   1.00 0.00 ? 20  HIS A O    1  
ATOM 280   C CB   . HIS A 1 20  ? -8.811  19.057  1.889   1.00 0.00 ? 20  HIS A CB   1  
ATOM 281   C CG   . HIS A 1 20  ? -9.695  20.275  2.009   1.00 0.00 ? 20  HIS A CG   1  
ATOM 282   N ND1  . HIS A 1 20  ? -9.277  21.544  1.647   1.00 0.00 ? 20  HIS A ND1  1  
ATOM 283   C CD2  . HIS A 1 20  ? -10.978 20.405  2.454   1.00 0.00 ? 20  HIS A CD2  1  
ATOM 284   C CE1  . HIS A 1 20  ? -10.271 22.392  1.869   1.00 0.00 ? 20  HIS A CE1  1  
ATOM 285   N NE2  . HIS A 1 20  ? -11.324 21.684  2.369   1.00 0.00 ? 20  HIS A NE2  1  
ATOM 286   H H    . HIS A 1 20  ? -6.165  18.730  1.295   1.00 0.00 ? 20  HIS A H    1  
ATOM 287   H HA   . HIS A 1 20  ? -7.700  19.916  3.493   1.00 0.00 ? 20  HIS A HA   1  
ATOM 288   H HB2  . HIS A 1 20  ? -8.492  18.953  0.851   1.00 0.00 ? 20  HIS A HB2  1  
ATOM 289   H HB3  . HIS A 1 20  ? -9.396  18.171  2.132   1.00 0.00 ? 20  HIS A HB3  1  
ATOM 290   H HD1  . HIS A 1 20  ? -8.377  21.781  1.280   1.00 0.00 ? 20  HIS A HD1  1  
ATOM 291   H HD2  . HIS A 1 20  ? -11.611 19.596  2.817   1.00 0.00 ? 20  HIS A HD2  1  
ATOM 292   H HE1  . HIS A 1 20  ? -10.250 23.466  1.684   1.00 0.00 ? 20  HIS A HE1  1  
ATOM 293   N N    . GLU A 1 21  ? -6.854  16.796  2.860   1.00 0.00 ? 21  GLU A N    1  
ATOM 294   C CA   . GLU A 1 21  ? -6.602  15.502  3.470   1.00 0.00 ? 21  GLU A CA   1  
ATOM 295   C C    . GLU A 1 21  ? -5.222  14.982  3.062   1.00 0.00 ? 21  GLU A C    1  
ATOM 296   O O    . GLU A 1 21  ? -4.442  14.549  3.909   1.00 0.00 ? 21  GLU A O    1  
ATOM 297   C CB   . GLU A 1 21  ? -7.696  14.499  3.100   1.00 0.00 ? 21  GLU A CB   1  
ATOM 298   C CG   . GLU A 1 21  ? -7.876  14.419  1.582   1.00 0.00 ? 21  GLU A CG   1  
ATOM 299   C CD   . GLU A 1 21  ? -9.147  13.647  1.221   1.00 0.00 ? 21  GLU A CD   1  
ATOM 300   O OE1  . GLU A 1 21  ? -10.208 14.008  1.775   1.00 0.00 ? 21  GLU A OE1  1  
ATOM 301   O OE2  . GLU A 1 21  ? -9.029  12.712  0.399   1.00 0.00 ? 21  GLU A OE2  1  
ATOM 302   H H    . GLU A 1 21  ? -6.614  16.861  1.891   1.00 0.00 ? 21  GLU A H    1  
ATOM 303   H HA   . GLU A 1 21  ? -6.628  15.678  4.545   1.00 0.00 ? 21  GLU A HA   1  
ATOM 304   H HB2  . GLU A 1 21  ? -7.440  13.515  3.491   1.00 0.00 ? 21  GLU A HB2  1  
ATOM 305   H HB3  . GLU A 1 21  ? -8.637  14.793  3.566   1.00 0.00 ? 21  GLU A HB3  1  
ATOM 306   H HG2  . GLU A 1 21  ? -7.926  15.424  1.165   1.00 0.00 ? 21  GLU A HG2  1  
ATOM 307   H HG3  . GLU A 1 21  ? -7.010  13.931  1.135   1.00 0.00 ? 21  GLU A HG3  1  
ATOM 308   N N    . GLY A 1 22  ? -4.961  15.044  1.764   1.00 0.00 ? 22  GLY A N    1  
ATOM 309   C CA   . GLY A 1 22  ? -3.689  14.585  1.234   1.00 0.00 ? 22  GLY A CA   1  
ATOM 310   C C    . GLY A 1 22  ? -3.886  13.804  -0.067  1.00 0.00 ? 22  GLY A C    1  
ATOM 311   O O    . GLY A 1 22  ? -4.367  14.353  -1.058  1.00 0.00 ? 22  GLY A O    1  
ATOM 312   H H    . GLY A 1 22  ? -5.601  15.398  1.082   1.00 0.00 ? 22  GLY A H    1  
ATOM 313   H HA2  . GLY A 1 22  ? -3.036  15.439  1.054   1.00 0.00 ? 22  GLY A HA2  1  
ATOM 314   H HA3  . GLY A 1 22  ? -3.191  13.953  1.969   1.00 0.00 ? 22  GLY A HA3  1  
ATOM 315   N N    . LEU A 1 23  ? -3.505  12.536  -0.023  1.00 0.00 ? 23  LEU A N    1  
ATOM 316   C CA   . LEU A 1 23  ? -3.635  11.675  -1.186  1.00 0.00 ? 23  LEU A CA   1  
ATOM 317   C C    . LEU A 1 23  ? -4.662  10.580  -0.892  1.00 0.00 ? 23  LEU A C    1  
ATOM 318   O O    . LEU A 1 23  ? -4.877  9.689   -1.713  1.00 0.00 ? 23  LEU A O    1  
ATOM 319   C CB   . LEU A 1 23  ? -2.266  11.137  -1.609  1.00 0.00 ? 23  LEU A CB   1  
ATOM 320   C CG   . LEU A 1 23  ? -1.054  11.787  -0.940  1.00 0.00 ? 23  LEU A CG   1  
ATOM 321   C CD1  . LEU A 1 23  ? 0.205   10.944  -1.148  1.00 0.00 ? 23  LEU A CD1  1  
ATOM 322   C CD2  . LEU A 1 23  ? -0.866  13.226  -1.425  1.00 0.00 ? 23  LEU A CD2  1  
ATOM 323   H H    . LEU A 1 23  ? -3.115  12.098  0.787   1.00 0.00 ? 23  LEU A H    1  
ATOM 324   H HA   . LEU A 1 23  ? -4.008  12.288  -2.007  1.00 0.00 ? 23  LEU A HA   1  
ATOM 325   H HB2  . LEU A 1 23  ? -2.239  10.067  -1.402  1.00 0.00 ? 23  LEU A HB2  1  
ATOM 326   H HB3  . LEU A 1 23  ? -2.169  11.256  -2.688  1.00 0.00 ? 23  LEU A HB3  1  
ATOM 327   H HG   . LEU A 1 23  ? -1.238  11.831  0.133   1.00 0.00 ? 23  LEU A HG   1  
ATOM 328   H HD11 . LEU A 1 23  ? 0.372   10.317  -0.272  1.00 0.00 ? 23  LEU A HD11 1  
ATOM 329   H HD12 . LEU A 1 23  ? 0.079   10.312  -2.027  1.00 0.00 ? 23  LEU A HD12 1  
ATOM 330   H HD13 . LEU A 1 23  ? 1.063   11.601  -1.293  1.00 0.00 ? 23  LEU A HD13 1  
ATOM 331   H HD21 . LEU A 1 23  ? -0.299  13.789  -0.684  1.00 0.00 ? 23  LEU A HD21 1  
ATOM 332   H HD22 . LEU A 1 23  ? -0.325  13.223  -2.371  1.00 0.00 ? 23  LEU A HD22 1  
ATOM 333   H HD23 . LEU A 1 23  ? -1.842  13.692  -1.567  1.00 0.00 ? 23  LEU A HD23 1  
ATOM 334   N N    . GLY A 1 24  ? -5.271  10.683  0.280   1.00 0.00 ? 24  GLY A N    1  
ATOM 335   C CA   . GLY A 1 24  ? -6.271  9.712   0.692   1.00 0.00 ? 24  GLY A CA   1  
ATOM 336   C C    . GLY A 1 24  ? -5.683  8.708   1.687   1.00 0.00 ? 24  GLY A C    1  
ATOM 337   O O    . GLY A 1 24  ? -6.421  8.050   2.418   1.00 0.00 ? 24  GLY A O    1  
ATOM 338   H H    . GLY A 1 24  ? -5.090  11.411  0.942   1.00 0.00 ? 24  GLY A H    1  
ATOM 339   H HA2  . GLY A 1 24  ? -7.117  10.227  1.147   1.00 0.00 ? 24  GLY A HA2  1  
ATOM 340   H HA3  . GLY A 1 24  ? -6.651  9.184   -0.182  1.00 0.00 ? 24  GLY A HA3  1  
ATOM 341   N N    . PHE A 1 25  ? -4.361  8.623   1.681   1.00 0.00 ? 25  PHE A N    1  
ATOM 342   C CA   . PHE A 1 25  ? -3.667  7.711   2.574   1.00 0.00 ? 25  PHE A CA   1  
ATOM 343   C C    . PHE A 1 25  ? -2.586  8.442   3.373   1.00 0.00 ? 25  PHE A C    1  
ATOM 344   O O    . PHE A 1 25  ? -1.840  9.249   2.820   1.00 0.00 ? 25  PHE A O    1  
ATOM 345   C CB   . PHE A 1 25  ? -3.004  6.646   1.697   1.00 0.00 ? 25  PHE A CB   1  
ATOM 346   C CG   . PHE A 1 25  ? -1.726  7.119   1.002   1.00 0.00 ? 25  PHE A CG   1  
ATOM 347   C CD1  . PHE A 1 25  ? -0.532  7.046   1.649   1.00 0.00 ? 25  PHE A CD1  1  
ATOM 348   C CD2  . PHE A 1 25  ? -1.784  7.614   -0.264  1.00 0.00 ? 25  PHE A CD2  1  
ATOM 349   C CE1  . PHE A 1 25  ? 0.654   7.485   1.004   1.00 0.00 ? 25  PHE A CE1  1  
ATOM 350   C CE2  . PHE A 1 25  ? -0.598  8.053   -0.909  1.00 0.00 ? 25  PHE A CE2  1  
ATOM 351   C CZ   . PHE A 1 25  ? 0.596   7.980   -0.262  1.00 0.00 ? 25  PHE A CZ   1  
ATOM 352   H H    . PHE A 1 25  ? -3.768  9.162   1.083   1.00 0.00 ? 25  PHE A H    1  
ATOM 353   H HA   . PHE A 1 25  ? -4.409  7.301   3.259   1.00 0.00 ? 25  PHE A HA   1  
ATOM 354   H HB2  . PHE A 1 25  ? -2.770  5.777   2.313   1.00 0.00 ? 25  PHE A HB2  1  
ATOM 355   H HB3  . PHE A 1 25  ? -3.717  6.317   0.941   1.00 0.00 ? 25  PHE A HB3  1  
ATOM 356   H HD1  . PHE A 1 25  ? -0.486  6.649   2.663   1.00 0.00 ? 25  PHE A HD1  1  
ATOM 357   H HD2  . PHE A 1 25  ? -2.741  7.673   -0.782  1.00 0.00 ? 25  PHE A HD2  1  
ATOM 358   H HE1  . PHE A 1 25  ? 1.611   7.426   1.522   1.00 0.00 ? 25  PHE A HE1  1  
ATOM 359   H HE2  . PHE A 1 25  ? -0.644  8.450   -1.923  1.00 0.00 ? 25  PHE A HE2  1  
ATOM 360   H HZ   . PHE A 1 25  ? 1.506   8.317   -0.757  1.00 0.00 ? 25  PHE A HZ   1  
ATOM 361   N N    . SER A 1 26  ? -2.536  8.133   4.660   1.00 0.00 ? 26  SER A N    1  
ATOM 362   C CA   . SER A 1 26  ? -1.559  8.750   5.540   1.00 0.00 ? 26  SER A CA   1  
ATOM 363   C C    . SER A 1 26  ? -0.310  7.871   5.635   1.00 0.00 ? 26  SER A C    1  
ATOM 364   O O    . SER A 1 26  ? -0.387  6.657   5.456   1.00 0.00 ? 26  SER A O    1  
ATOM 365   C CB   . SER A 1 26  ? -2.146  8.990   6.933   1.00 0.00 ? 26  SER A CB   1  
ATOM 366   O OG   . SER A 1 26  ? -2.516  10.352  7.129   1.00 0.00 ? 26  SER A OG   1  
ATOM 367   H H    . SER A 1 26  ? -3.147  7.475   5.101   1.00 0.00 ? 26  SER A H    1  
ATOM 368   H HA   . SER A 1 26  ? -1.319  9.708   5.079   1.00 0.00 ? 26  SER A HA   1  
ATOM 369   H HB2  . SER A 1 26  ? -3.020  8.353   7.072   1.00 0.00 ? 26  SER A HB2  1  
ATOM 370   H HB3  . SER A 1 26  ? -1.417  8.700   7.689   1.00 0.00 ? 26  SER A HB3  1  
ATOM 371   H HG   . SER A 1 26  ? -2.065  10.715  7.944   1.00 0.00 ? 26  SER A HG   1  
ATOM 372   N N    . ILE A 1 27  ? 0.811   8.519   5.916   1.00 0.00 ? 27  ILE A N    1  
ATOM 373   C CA   . ILE A 1 27  ? 2.074   7.812   6.037   1.00 0.00 ? 27  ILE A CA   1  
ATOM 374   C C    . ILE A 1 27  ? 2.545   7.863   7.491   1.00 0.00 ? 27  ILE A C    1  
ATOM 375   O O    . ILE A 1 27  ? 2.013   8.629   8.294   1.00 0.00 ? 27  ILE A O    1  
ATOM 376   C CB   . ILE A 1 27  ? 3.095   8.364   5.040   1.00 0.00 ? 27  ILE A CB   1  
ATOM 377   C CG1  . ILE A 1 27  ? 3.501   9.793   5.406   1.00 0.00 ? 27  ILE A CG1  1  
ATOM 378   C CG2  . ILE A 1 27  ? 2.568   8.268   3.606   1.00 0.00 ? 27  ILE A CG2  1  
ATOM 379   C CD1  . ILE A 1 27  ? 4.914   10.106  4.909   1.00 0.00 ? 27  ILE A CD1  1  
ATOM 380   H H    . ILE A 1 27  ? 0.864   9.507   6.061   1.00 0.00 ? 27  ILE A H    1  
ATOM 381   H HA   . ILE A 1 27  ? 1.892   6.771   5.769   1.00 0.00 ? 27  ILE A HA   1  
ATOM 382   H HB   . ILE A 1 27  ? 3.993   7.749   5.095   1.00 0.00 ? 27  ILE A HB   1  
ATOM 383   H HG12 . ILE A 1 27  ? 2.794   10.499  4.972   1.00 0.00 ? 27  ILE A HG12 1  
ATOM 384   H HG13 . ILE A 1 27  ? 3.456   9.921   6.488   1.00 0.00 ? 27  ILE A HG13 1  
ATOM 385   H HG21 . ILE A 1 27  ? 2.229   7.251   3.412   1.00 0.00 ? 27  ILE A HG21 1  
ATOM 386   H HG22 . ILE A 1 27  ? 1.736   8.959   3.478   1.00 0.00 ? 27  ILE A HG22 1  
ATOM 387   H HG23 . ILE A 1 27  ? 3.366   8.525   2.909   1.00 0.00 ? 27  ILE A HG23 1  
ATOM 388   H HD11 . ILE A 1 27  ? 4.862   10.846  4.111   1.00 0.00 ? 27  ILE A HD11 1  
ATOM 389   H HD12 . ILE A 1 27  ? 5.510   10.499  5.732   1.00 0.00 ? 27  ILE A HD12 1  
ATOM 390   H HD13 . ILE A 1 27  ? 5.375   9.194   4.529   1.00 0.00 ? 27  ILE A HD13 1  
ATOM 391   N N    . ARG A 1 28  ? 3.539   7.037   7.788   1.00 0.00 ? 28  ARG A N    1  
ATOM 392   C CA   . ARG A 1 28  ? 4.088   6.979   9.131   1.00 0.00 ? 28  ARG A CA   1  
ATOM 393   C C    . ARG A 1 28  ? 5.565   6.584   9.085   1.00 0.00 ? 28  ARG A C    1  
ATOM 394   O O    . ARG A 1 28  ? 6.065   6.161   8.043   1.00 0.00 ? 28  ARG A O    1  
ATOM 395   C CB   . ARG A 1 28  ? 3.325   5.972   9.995   1.00 0.00 ? 28  ARG A CB   1  
ATOM 396   C CG   . ARG A 1 28  ? 3.247   4.608   9.306   1.00 0.00 ? 28  ARG A CG   1  
ATOM 397   C CD   . ARG A 1 28  ? 3.214   3.475   10.335  1.00 0.00 ? 28  ARG A CD   1  
ATOM 398   N NE   . ARG A 1 28  ? 3.359   2.169   9.654   1.00 0.00 ? 28  ARG A NE   1  
ATOM 399   C CZ   . ARG A 1 28  ? 3.733   1.039   10.269  1.00 0.00 ? 28  ARG A CZ   1  
ATOM 400   N NH1  . ARG A 1 28  ? 4.004   1.048   11.581  1.00 0.00 ? 28  ARG A NH1  1  
ATOM 401   N NH2  . ARG A 1 28  ? 3.837   -0.101  9.572   1.00 0.00 ? 28  ARG A NH2  1  
ATOM 402   H H    . ARG A 1 28  ? 3.966   6.417   7.129   1.00 0.00 ? 28  ARG A H    1  
ATOM 403   H HA   . ARG A 1 28  ? 3.963   7.987   9.527   1.00 0.00 ? 28  ARG A HA   1  
ATOM 404   H HB2  . ARG A 1 28  ? 3.819   5.868   10.961  1.00 0.00 ? 28  ARG A HB2  1  
ATOM 405   H HB3  . ARG A 1 28  ? 2.319   6.343   10.189  1.00 0.00 ? 28  ARG A HB3  1  
ATOM 406   H HG2  . ARG A 1 28  ? 2.355   4.562   8.682   1.00 0.00 ? 28  ARG A HG2  1  
ATOM 407   H HG3  . ARG A 1 28  ? 4.105   4.480   8.646   1.00 0.00 ? 28  ARG A HG3  1  
ATOM 408   H HD2  . ARG A 1 28  ? 4.018   3.608   11.059  1.00 0.00 ? 28  ARG A HD2  1  
ATOM 409   H HD3  . ARG A 1 28  ? 2.277   3.504   10.890  1.00 0.00 ? 28  ARG A HD3  1  
ATOM 410   H HE   . ARG A 1 28  ? 3.164   2.127   8.674   1.00 0.00 ? 28  ARG A HE   1  
ATOM 411   H HH11 . ARG A 1 28  ? 3.926   1.899   12.102  1.00 0.00 ? 28  ARG A HH11 1  
ATOM 412   H HH12 . ARG A 1 28  ? 4.283   0.205   12.040  1.00 0.00 ? 28  ARG A HH12 1  
ATOM 413   H HH21 . ARG A 1 28  ? 3.635   -0.108  8.592   1.00 0.00 ? 28  ARG A HH21 1  
ATOM 414   H HH22 . ARG A 1 28  ? 4.117   -0.944  10.031  1.00 0.00 ? 28  ARG A HH22 1  
ATOM 415   N N    . GLY A 1 29  ? 6.222   6.736   10.225  1.00 0.00 ? 29  GLY A N    1  
ATOM 416   C CA   . GLY A 1 29  ? 7.632   6.400   10.327  1.00 0.00 ? 29  GLY A CA   1  
ATOM 417   C C    . GLY A 1 29  ? 8.505   7.645   10.157  1.00 0.00 ? 29  GLY A C    1  
ATOM 418   O O    . GLY A 1 29  ? 8.228   8.687   10.748  1.00 0.00 ? 29  GLY A O    1  
ATOM 419   H H    . GLY A 1 29  ? 5.807   7.080   11.067  1.00 0.00 ? 29  GLY A H    1  
ATOM 420   H HA2  . GLY A 1 29  ? 7.831   5.942   11.296  1.00 0.00 ? 29  GLY A HA2  1  
ATOM 421   H HA3  . GLY A 1 29  ? 7.890   5.663   9.566   1.00 0.00 ? 29  GLY A HA3  1  
ATOM 422   N N    . GLY A 1 30  ? 9.543   7.494   9.346   1.00 0.00 ? 30  GLY A N    1  
ATOM 423   C CA   . GLY A 1 30  ? 10.458  8.593   9.091   1.00 0.00 ? 30  GLY A CA   1  
ATOM 424   C C    . GLY A 1 30  ? 11.852  8.284   9.641   1.00 0.00 ? 30  GLY A C    1  
ATOM 425   O O    . GLY A 1 30  ? 11.986  7.611   10.662  1.00 0.00 ? 30  GLY A O    1  
ATOM 426   H H    . GLY A 1 30  ? 9.761   6.643   8.870   1.00 0.00 ? 30  GLY A H    1  
ATOM 427   H HA2  . GLY A 1 30  ? 10.519  8.778   8.018   1.00 0.00 ? 30  GLY A HA2  1  
ATOM 428   H HA3  . GLY A 1 30  ? 10.076  9.504   9.550   1.00 0.00 ? 30  GLY A HA3  1  
ATOM 429   N N    . SER A 1 31  ? 12.856  8.791   8.940   1.00 0.00 ? 31  SER A N    1  
ATOM 430   C CA   . SER A 1 31  ? 14.235  8.578   9.345   1.00 0.00 ? 31  SER A CA   1  
ATOM 431   C C    . SER A 1 31  ? 14.443  9.079   10.776  1.00 0.00 ? 31  SER A C    1  
ATOM 432   O O    . SER A 1 31  ? 15.367  8.644   11.461  1.00 0.00 ? 31  SER A O    1  
ATOM 433   C CB   . SER A 1 31  ? 15.204  9.279   8.391   1.00 0.00 ? 31  SER A CB   1  
ATOM 434   O OG   . SER A 1 31  ? 16.540  8.808   8.546   1.00 0.00 ? 31  SER A OG   1  
ATOM 435   H H    . SER A 1 31  ? 12.739  9.337   8.110   1.00 0.00 ? 31  SER A H    1  
ATOM 436   H HA   . SER A 1 31  ? 14.388  7.500   9.291   1.00 0.00 ? 31  SER A HA   1  
ATOM 437   H HB2  . SER A 1 31  ? 14.880  9.119   7.363   1.00 0.00 ? 31  SER A HB2  1  
ATOM 438   H HB3  . SER A 1 31  ? 15.175  10.354  8.571   1.00 0.00 ? 31  SER A HB3  1  
ATOM 439   H HG   . SER A 1 31  ? 16.582  8.136   9.285   1.00 0.00 ? 31  SER A HG   1  
ATOM 440   N N    . GLU A 1 32  ? 13.568  9.986   11.185  1.00 0.00 ? 32  GLU A N    1  
ATOM 441   C CA   . GLU A 1 32  ? 13.644  10.550  12.521  1.00 0.00 ? 32  GLU A CA   1  
ATOM 442   C C    . GLU A 1 32  ? 13.374  9.469   13.570  1.00 0.00 ? 32  GLU A C    1  
ATOM 443   O O    . GLU A 1 32  ? 13.741  9.623   14.734  1.00 0.00 ? 32  GLU A O    1  
ATOM 444   C CB   . GLU A 1 32  ? 12.673  11.722  12.678  1.00 0.00 ? 32  GLU A CB   1  
ATOM 445   C CG   . GLU A 1 32  ? 11.224  11.231  12.719  1.00 0.00 ? 32  GLU A CG   1  
ATOM 446   C CD   . GLU A 1 32  ? 10.263  12.384  13.016  1.00 0.00 ? 32  GLU A CD   1  
ATOM 447   O OE1  . GLU A 1 32  ? 10.264  13.344  12.215  1.00 0.00 ? 32  GLU A OE1  1  
ATOM 448   O OE2  . GLU A 1 32  ? 9.549   12.280  14.036  1.00 0.00 ? 32  GLU A OE2  1  
ATOM 449   H H    . GLU A 1 32  ? 12.819  10.334  10.621  1.00 0.00 ? 32  GLU A H    1  
ATOM 450   H HA   . GLU A 1 32  ? 14.666  10.917  12.623  1.00 0.00 ? 32  GLU A HA   1  
ATOM 451   H HB2  . GLU A 1 32  ? 12.902  12.268  13.593  1.00 0.00 ? 32  GLU A HB2  1  
ATOM 452   H HB3  . GLU A 1 32  ? 12.801  12.419  11.850  1.00 0.00 ? 32  GLU A HB3  1  
ATOM 453   H HG2  . GLU A 1 32  ? 10.965  10.773  11.765  1.00 0.00 ? 32  GLU A HG2  1  
ATOM 454   H HG3  . GLU A 1 32  ? 11.119  10.460  13.482  1.00 0.00 ? 32  GLU A HG3  1  
ATOM 455   N N    . HIS A 1 33  ? 12.734  8.400   13.120  1.00 0.00 ? 33  HIS A N    1  
ATOM 456   C CA   . HIS A 1 33  ? 12.410  7.294   14.005  1.00 0.00 ? 33  HIS A CA   1  
ATOM 457   C C    . HIS A 1 33  ? 13.315  6.101   13.688  1.00 0.00 ? 33  HIS A C    1  
ATOM 458   O O    . HIS A 1 33  ? 13.324  5.113   14.420  1.00 0.00 ? 33  HIS A O    1  
ATOM 459   C CB   . HIS A 1 33  ? 10.922  6.948   13.920  1.00 0.00 ? 33  HIS A CB   1  
ATOM 460   C CG   . HIS A 1 33  ? 10.137  7.307   15.159  1.00 0.00 ? 33  HIS A CG   1  
ATOM 461   N ND1  . HIS A 1 33  ? 9.569   6.356   15.988  1.00 0.00 ? 33  HIS A ND1  1  
ATOM 462   C CD2  . HIS A 1 33  ? 9.833   8.521   15.702  1.00 0.00 ? 33  HIS A CD2  1  
ATOM 463   C CE1  . HIS A 1 33  ? 8.953   6.980   16.981  1.00 0.00 ? 33  HIS A CE1  1  
ATOM 464   N NE2  . HIS A 1 33  ? 9.117   8.322   16.801  1.00 0.00 ? 33  HIS A NE2  1  
ATOM 465   H H    . HIS A 1 33  ? 12.439  8.283   12.171  1.00 0.00 ? 33  HIS A H    1  
ATOM 466   H HA   . HIS A 1 33  ? 12.615  7.635   15.019  1.00 0.00 ? 33  HIS A HA   1  
ATOM 467   H HB2  . HIS A 1 33  ? 10.488  7.466   13.065  1.00 0.00 ? 33  HIS A HB2  1  
ATOM 468   H HB3  . HIS A 1 33  ? 10.818  5.880   13.733  1.00 0.00 ? 33  HIS A HB3  1  
ATOM 469   H HD1  . HIS A 1 33  ? 9.616   5.365   15.860  1.00 0.00 ? 33  HIS A HD1  1  
ATOM 470   H HD2  . HIS A 1 33  ? 10.129  9.490   15.300  1.00 0.00 ? 33  HIS A HD2  1  
ATOM 471   H HE1  . HIS A 1 33  ? 8.409   6.505   17.798  1.00 0.00 ? 33  HIS A HE1  1  
ATOM 472   N N    . GLY A 1 34  ? 14.053  6.233   12.595  1.00 0.00 ? 34  GLY A N    1  
ATOM 473   C CA   . GLY A 1 34  ? 14.959  5.179   12.173  1.00 0.00 ? 34  GLY A CA   1  
ATOM 474   C C    . GLY A 1 34  ? 14.286  4.253   11.157  1.00 0.00 ? 34  GLY A C    1  
ATOM 475   O O    . GLY A 1 34  ? 14.884  3.273   10.714  1.00 0.00 ? 34  GLY A O    1  
ATOM 476   H H    . GLY A 1 34  ? 14.039  7.040   12.005  1.00 0.00 ? 34  GLY A H    1  
ATOM 477   H HA2  . GLY A 1 34  ? 15.854  5.618   11.732  1.00 0.00 ? 34  GLY A HA2  1  
ATOM 478   H HA3  . GLY A 1 34  ? 15.280  4.601   13.039  1.00 0.00 ? 34  GLY A HA3  1  
ATOM 479   N N    . VAL A 1 35  ? 13.052  4.595   10.819  1.00 0.00 ? 35  VAL A N    1  
ATOM 480   C CA   . VAL A 1 35  ? 12.292  3.807   9.864   1.00 0.00 ? 35  VAL A CA   1  
ATOM 481   C C    . VAL A 1 35  ? 12.083  4.623   8.586   1.00 0.00 ? 35  VAL A C    1  
ATOM 482   O O    . VAL A 1 35  ? 12.308  5.832   8.574   1.00 0.00 ? 35  VAL A O    1  
ATOM 483   C CB   . VAL A 1 35  ? 10.979  3.342   10.497  1.00 0.00 ? 35  VAL A CB   1  
ATOM 484   C CG1  . VAL A 1 35  ? 11.211  2.806   11.911  1.00 0.00 ? 35  VAL A CG1  1  
ATOM 485   C CG2  . VAL A 1 35  ? 9.943   4.468   10.501  1.00 0.00 ? 35  VAL A CG2  1  
ATOM 486   H H    . VAL A 1 35  ? 12.573  5.394   11.184  1.00 0.00 ? 35  VAL A H    1  
ATOM 487   H HA   . VAL A 1 35  ? 12.882  2.923   9.623   1.00 0.00 ? 35  VAL A HA   1  
ATOM 488   H HB   . VAL A 1 35  ? 10.584  2.526   9.890   1.00 0.00 ? 35  VAL A HB   1  
ATOM 489   H HG11 . VAL A 1 35  ? 12.282  2.745   12.105  1.00 0.00 ? 35  VAL A HG11 1  
ATOM 490   H HG12 . VAL A 1 35  ? 10.749  3.478   12.635  1.00 0.00 ? 35  VAL A HG12 1  
ATOM 491   H HG13 . VAL A 1 35  ? 10.769  1.814   12.001  1.00 0.00 ? 35  VAL A HG13 1  
ATOM 492   H HG21 . VAL A 1 35  ? 9.075   4.161   11.085  1.00 0.00 ? 35  VAL A HG21 1  
ATOM 493   H HG22 . VAL A 1 35  ? 10.381  5.363   10.943  1.00 0.00 ? 35  VAL A HG22 1  
ATOM 494   H HG23 . VAL A 1 35  ? 9.635   4.682   9.477   1.00 0.00 ? 35  VAL A HG23 1  
ATOM 495   N N    . GLY A 1 36  ? 11.657  3.928   7.542   1.00 0.00 ? 36  GLY A N    1  
ATOM 496   C CA   . GLY A 1 36  ? 11.416  4.573   6.262   1.00 0.00 ? 36  GLY A CA   1  
ATOM 497   C C    . GLY A 1 36  ? 10.014  5.185   6.212   1.00 0.00 ? 36  GLY A C    1  
ATOM 498   O O    . GLY A 1 36  ? 9.655   5.993   7.067   1.00 0.00 ? 36  GLY A O    1  
ATOM 499   H H    . GLY A 1 36  ? 11.476  2.945   7.560   1.00 0.00 ? 36  GLY A H    1  
ATOM 500   H HA2  . GLY A 1 36  ? 12.162  5.350   6.096   1.00 0.00 ? 36  GLY A HA2  1  
ATOM 501   H HA3  . GLY A 1 36  ? 11.528  3.846   5.458   1.00 0.00 ? 36  GLY A HA3  1  
ATOM 502   N N    . ILE A 1 37  ? 9.261   4.776   5.202   1.00 0.00 ? 37  ILE A N    1  
ATOM 503   C CA   . ILE A 1 37  ? 7.907   5.274   5.029   1.00 0.00 ? 37  ILE A CA   1  
ATOM 504   C C    . ILE A 1 37  ? 6.962   4.096   4.785   1.00 0.00 ? 37  ILE A C    1  
ATOM 505   O O    . ILE A 1 37  ? 7.339   3.116   4.146   1.00 0.00 ? 37  ILE A O    1  
ATOM 506   C CB   . ILE A 1 37  ? 7.863   6.336   3.928   1.00 0.00 ? 37  ILE A CB   1  
ATOM 507   C CG1  . ILE A 1 37  ? 9.068   7.274   4.023   1.00 0.00 ? 37  ILE A CG1  1  
ATOM 508   C CG2  . ILE A 1 37  ? 6.538   7.100   3.956   1.00 0.00 ? 37  ILE A CG2  1  
ATOM 509   C CD1  . ILE A 1 37  ? 9.073   8.028   5.355   1.00 0.00 ? 37  ILE A CD1  1  
ATOM 510   H H    . ILE A 1 37  ? 9.560   4.119   4.511   1.00 0.00 ? 37  ILE A H    1  
ATOM 511   H HA   . ILE A 1 37  ? 7.617   5.763   5.960   1.00 0.00 ? 37  ILE A HA   1  
ATOM 512   H HB   . ILE A 1 37  ? 7.923   5.831   2.964   1.00 0.00 ? 37  ILE A HB   1  
ATOM 513   H HG12 . ILE A 1 37  ? 9.989   6.700   3.922   1.00 0.00 ? 37  ILE A HG12 1  
ATOM 514   H HG13 . ILE A 1 37  ? 9.044   7.987   3.198   1.00 0.00 ? 37  ILE A HG13 1  
ATOM 515   H HG21 . ILE A 1 37  ? 6.604   7.967   3.299   1.00 0.00 ? 37  ILE A HG21 1  
ATOM 516   H HG22 . ILE A 1 37  ? 5.734   6.447   3.616   1.00 0.00 ? 37  ILE A HG22 1  
ATOM 517   H HG23 . ILE A 1 37  ? 6.330   7.431   4.974   1.00 0.00 ? 37  ILE A HG23 1  
ATOM 518   H HD11 . ILE A 1 37  ? 8.953   9.095   5.169   1.00 0.00 ? 37  ILE A HD11 1  
ATOM 519   H HD12 . ILE A 1 37  ? 8.251   7.672   5.976   1.00 0.00 ? 37  ILE A HD12 1  
ATOM 520   H HD13 . ILE A 1 37  ? 10.018  7.852   5.868   1.00 0.00 ? 37  ILE A HD13 1  
ATOM 521   N N    . TYR A 1 38  ? 5.752   4.231   5.308   1.00 0.00 ? 38  TYR A N    1  
ATOM 522   C CA   . TYR A 1 38  ? 4.750   3.190   5.155   1.00 0.00 ? 38  TYR A CA   1  
ATOM 523   C C    . TYR A 1 38  ? 3.344   3.742   5.397   1.00 0.00 ? 38  TYR A C    1  
ATOM 524   O O    . TYR A 1 38  ? 3.172   4.715   6.130   1.00 0.00 ? 38  TYR A O    1  
ATOM 525   C CB   . TYR A 1 38  ? 5.064   2.142   6.224   1.00 0.00 ? 38  TYR A CB   1  
ATOM 526   C CG   . TYR A 1 38  ? 6.492   1.597   6.160   1.00 0.00 ? 38  TYR A CG   1  
ATOM 527   C CD1  . TYR A 1 38  ? 7.509   2.245   6.831   1.00 0.00 ? 38  TYR A CD1  1  
ATOM 528   C CD2  . TYR A 1 38  ? 6.763   0.456   5.432   1.00 0.00 ? 38  TYR A CD2  1  
ATOM 529   C CE1  . TYR A 1 38  ? 8.853   1.731   6.771   1.00 0.00 ? 38  TYR A CE1  1  
ATOM 530   C CE2  . TYR A 1 38  ? 8.107   -0.057  5.372   1.00 0.00 ? 38  TYR A CE2  1  
ATOM 531   C CZ   . TYR A 1 38  ? 9.086   0.606   6.044   1.00 0.00 ? 38  TYR A CZ   1  
ATOM 532   O OH   . TYR A 1 38  ? 10.355  0.121   5.987   1.00 0.00 ? 38  TYR A OH   1  
ATOM 533   H H    . TYR A 1 38  ? 5.453   5.032   5.827   1.00 0.00 ? 38  TYR A H    1  
ATOM 534   H HA   . TYR A 1 38  ? 4.813   2.810   4.135   1.00 0.00 ? 38  TYR A HA   1  
ATOM 535   H HB2  . TYR A 1 38  ? 4.897   2.580   7.208   1.00 0.00 ? 38  TYR A HB2  1  
ATOM 536   H HB3  . TYR A 1 38  ? 4.364   1.313   6.122   1.00 0.00 ? 38  TYR A HB3  1  
ATOM 537   H HD1  . TYR A 1 38  ? 7.295   3.146   7.406   1.00 0.00 ? 38  TYR A HD1  1  
ATOM 538   H HD2  . TYR A 1 38  ? 5.960   -0.056  4.902   1.00 0.00 ? 38  TYR A HD2  1  
ATOM 539   H HE1  . TYR A 1 38  ? 9.666   2.234   7.296   1.00 0.00 ? 38  TYR A HE1  1  
ATOM 540   H HE2  . TYR A 1 38  ? 8.335   -0.957  4.800   1.00 0.00 ? 38  TYR A HE2  1  
ATOM 541   H HH   . TYR A 1 38  ? 10.383  -0.809  6.354   1.00 0.00 ? 38  TYR A HH   1  
ATOM 542   N N    . VAL A 1 39  ? 2.373   3.098   4.766   1.00 0.00 ? 39  VAL A N    1  
ATOM 543   C CA   . VAL A 1 39  ? 0.987   3.512   4.903   1.00 0.00 ? 39  VAL A CA   1  
ATOM 544   C C    . VAL A 1 39  ? 0.531   3.283   6.346   1.00 0.00 ? 39  VAL A C    1  
ATOM 545   O O    . VAL A 1 39  ? 0.733   2.204   6.900   1.00 0.00 ? 39  VAL A O    1  
ATOM 546   C CB   . VAL A 1 39  ? 0.118   2.781   3.878   1.00 0.00 ? 39  VAL A CB   1  
ATOM 547   C CG1  . VAL A 1 39  ? -1.367  3.064   4.117   1.00 0.00 ? 39  VAL A CG1  1  
ATOM 548   C CG2  . VAL A 1 39  ? 0.525   3.151   2.451   1.00 0.00 ? 39  VAL A CG2  1  
ATOM 549   H H    . VAL A 1 39  ? 2.521   2.308   4.171   1.00 0.00 ? 39  VAL A H    1  
ATOM 550   H HA   . VAL A 1 39  ? 0.940   4.579   4.686   1.00 0.00 ? 39  VAL A HA   1  
ATOM 551   H HB   . VAL A 1 39  ? 0.279   1.710   4.005   1.00 0.00 ? 39  VAL A HB   1  
ATOM 552   H HG11 . VAL A 1 39  ? -1.564  3.091   5.189   1.00 0.00 ? 39  VAL A HG11 1  
ATOM 553   H HG12 . VAL A 1 39  ? -1.629  4.025   3.675   1.00 0.00 ? 39  VAL A HG12 1  
ATOM 554   H HG13 . VAL A 1 39  ? -1.965  2.277   3.657   1.00 0.00 ? 39  VAL A HG13 1  
ATOM 555   H HG21 . VAL A 1 39  ? 1.563   2.865   2.283   1.00 0.00 ? 39  VAL A HG21 1  
ATOM 556   H HG22 . VAL A 1 39  ? -0.116  2.626   1.743   1.00 0.00 ? 39  VAL A HG22 1  
ATOM 557   H HG23 . VAL A 1 39  ? 0.417   4.227   2.310   1.00 0.00 ? 39  VAL A HG23 1  
ATOM 558   N N    . SER A 1 40  ? -0.075  4.316   6.913   1.00 0.00 ? 40  SER A N    1  
ATOM 559   C CA   . SER A 1 40  ? -0.561  4.241   8.280   1.00 0.00 ? 40  SER A CA   1  
ATOM 560   C C    . SER A 1 40  ? -2.089  4.173   8.289   1.00 0.00 ? 40  SER A C    1  
ATOM 561   O O    . SER A 1 40  ? -2.679  3.478   9.115   1.00 0.00 ? 40  SER A O    1  
ATOM 562   C CB   . SER A 1 40  ? -0.077  5.437   9.103   1.00 0.00 ? 40  SER A CB   1  
ATOM 563   O OG   . SER A 1 40  ? -1.095  6.421   9.262   1.00 0.00 ? 40  SER A OG   1  
ATOM 564   H H    . SER A 1 40  ? -0.235  5.191   6.455   1.00 0.00 ? 40  SER A H    1  
ATOM 565   H HA   . SER A 1 40  ? -0.135  3.324   8.687   1.00 0.00 ? 40  SER A HA   1  
ATOM 566   H HB2  . SER A 1 40  ? 0.251   5.093   10.084  1.00 0.00 ? 40  SER A HB2  1  
ATOM 567   H HB3  . SER A 1 40  ? 0.788   5.885   8.616   1.00 0.00 ? 40  SER A HB3  1  
ATOM 568   H HG   . SER A 1 40  ? -1.475  6.668   8.371   1.00 0.00 ? 40  SER A HG   1  
ATOM 569   N N    . LEU A 1 41  ? -2.688  4.905   7.360   1.00 0.00 ? 41  LEU A N    1  
ATOM 570   C CA   . LEU A 1 41  ? -4.136  4.937   7.251   1.00 0.00 ? 41  LEU A CA   1  
ATOM 571   C C    . LEU A 1 41  ? -4.530  5.053   5.777   1.00 0.00 ? 41  LEU A C    1  
ATOM 572   O O    . LEU A 1 41  ? -3.857  5.731   5.003   1.00 0.00 ? 41  LEU A O    1  
ATOM 573   C CB   . LEU A 1 41  ? -4.715  6.046   8.131   1.00 0.00 ? 41  LEU A CB   1  
ATOM 574   C CG   . LEU A 1 41  ? -6.240  6.180   8.125   1.00 0.00 ? 41  LEU A CG   1  
ATOM 575   C CD1  . LEU A 1 41  ? -6.740  6.805   9.429   1.00 0.00 ? 41  LEU A CD1  1  
ATOM 576   C CD2  . LEU A 1 41  ? -6.717  6.957   6.897   1.00 0.00 ? 41  LEU A CD2  1  
ATOM 577   H H    . LEU A 1 41  ? -2.201  5.467   6.692   1.00 0.00 ? 41  LEU A H    1  
ATOM 578   H HA   . LEU A 1 41  ? -4.514  3.990   7.636   1.00 0.00 ? 41  LEU A HA   1  
ATOM 579   H HB2  . LEU A 1 41  ? -4.390  5.876   9.157   1.00 0.00 ? 41  LEU A HB2  1  
ATOM 580   H HB3  . LEU A 1 41  ? -4.286  6.996   7.814   1.00 0.00 ? 41  LEU A HB3  1  
ATOM 581   H HG   . LEU A 1 41  ? -6.670  5.181   8.061   1.00 0.00 ? 41  LEU A HG   1  
ATOM 582   H HD11 . LEU A 1 41  ? -5.941  7.392   9.881   1.00 0.00 ? 41  LEU A HD11 1  
ATOM 583   H HD12 . LEU A 1 41  ? -7.592  7.453   9.218   1.00 0.00 ? 41  LEU A HD12 1  
ATOM 584   H HD13 . LEU A 1 41  ? -7.046  6.016   10.116  1.00 0.00 ? 41  LEU A HD13 1  
ATOM 585   H HD21 . LEU A 1 41  ? -5.904  7.579   6.522   1.00 0.00 ? 41  LEU A HD21 1  
ATOM 586   H HD22 . LEU A 1 41  ? -7.026  6.257   6.121   1.00 0.00 ? 41  LEU A HD22 1  
ATOM 587   H HD23 . LEU A 1 41  ? -7.561  7.590   7.172   1.00 0.00 ? 41  LEU A HD23 1  
ATOM 588   N N    . VAL A 1 42  ? -5.618  4.380   5.434   1.00 0.00 ? 42  VAL A N    1  
ATOM 589   C CA   . VAL A 1 42  ? -6.109  4.399   4.066   1.00 0.00 ? 42  VAL A CA   1  
ATOM 590   C C    . VAL A 1 42  ? -7.630  4.566   4.077   1.00 0.00 ? 42  VAL A C    1  
ATOM 591   O O    . VAL A 1 42  ? -8.349  3.711   4.592   1.00 0.00 ? 42  VAL A O    1  
ATOM 592   C CB   . VAL A 1 42  ? -5.652  3.139   3.329   1.00 0.00 ? 42  VAL A CB   1  
ATOM 593   C CG1  . VAL A 1 42  ? -6.614  2.790   2.191   1.00 0.00 ? 42  VAL A CG1  1  
ATOM 594   C CG2  . VAL A 1 42  ? -4.222  3.296   2.809   1.00 0.00 ? 42  VAL A CG2  1  
ATOM 595   H H    . VAL A 1 42  ? -6.160  3.830   6.070   1.00 0.00 ? 42  VAL A H    1  
ATOM 596   H HA   . VAL A 1 42  ? -5.665  5.261   3.569   1.00 0.00 ? 42  VAL A HA   1  
ATOM 597   H HB   . VAL A 1 42  ? -5.661  2.312   4.040   1.00 0.00 ? 42  VAL A HB   1  
ATOM 598   H HG11 . VAL A 1 42  ? -7.122  3.694   1.854   1.00 0.00 ? 42  VAL A HG11 1  
ATOM 599   H HG12 . VAL A 1 42  ? -6.055  2.357   1.362   1.00 0.00 ? 42  VAL A HG12 1  
ATOM 600   H HG13 . VAL A 1 42  ? -7.352  2.071   2.547   1.00 0.00 ? 42  VAL A HG13 1  
ATOM 601   H HG21 . VAL A 1 42  ? -4.244  3.742   1.814   1.00 0.00 ? 42  VAL A HG21 1  
ATOM 602   H HG22 . VAL A 1 42  ? -3.659  3.942   3.483   1.00 0.00 ? 42  VAL A HG22 1  
ATOM 603   H HG23 . VAL A 1 42  ? -3.744  2.318   2.758   1.00 0.00 ? 42  VAL A HG23 1  
ATOM 604   N N    . GLU A 1 43  ? -8.076  5.674   3.504   1.00 0.00 ? 43  GLU A N    1  
ATOM 605   C CA   . GLU A 1 43  ? -9.498  5.965   3.441   1.00 0.00 ? 43  GLU A CA   1  
ATOM 606   C C    . GLU A 1 43  ? -10.205 4.961   2.529   1.00 0.00 ? 43  GLU A C    1  
ATOM 607   O O    . GLU A 1 43  ? -9.675  4.585   1.485   1.00 0.00 ? 43  GLU A O    1  
ATOM 608   C CB   . GLU A 1 43  ? -9.744  7.400   2.971   1.00 0.00 ? 43  GLU A CB   1  
ATOM 609   C CG   . GLU A 1 43  ? -9.488  8.399   4.102   1.00 0.00 ? 43  GLU A CG   1  
ATOM 610   C CD   . GLU A 1 43  ? -8.478  9.465   3.673   1.00 0.00 ? 43  GLU A CD   1  
ATOM 611   O OE1  . GLU A 1 43  ? -8.738  10.108  2.633   1.00 0.00 ? 43  GLU A OE1  1  
ATOM 612   O OE2  . GLU A 1 43  ? -7.468  9.614   4.395   1.00 0.00 ? 43  GLU A OE2  1  
ATOM 613   H H    . GLU A 1 43  ? -7.484  6.365   3.087   1.00 0.00 ? 43  GLU A H    1  
ATOM 614   H HA   . GLU A 1 43  ? -9.861  5.856   4.463   1.00 0.00 ? 43  GLU A HA   1  
ATOM 615   H HB2  . GLU A 1 43  ? -9.094  7.627   2.127   1.00 0.00 ? 43  GLU A HB2  1  
ATOM 616   H HB3  . GLU A 1 43  ? -10.771 7.500   2.619   1.00 0.00 ? 43  GLU A HB3  1  
ATOM 617   H HG2  . GLU A 1 43  ? -10.425 8.875   4.390   1.00 0.00 ? 43  GLU A HG2  1  
ATOM 618   H HG3  . GLU A 1 43  ? -9.114  7.871   4.980   1.00 0.00 ? 43  GLU A HG3  1  
ATOM 619   N N    . PRO A 1 44  ? -11.423 4.544   2.968   1.00 0.00 ? 44  PRO A N    1  
ATOM 620   C CA   . PRO A 1 44  ? -12.209 3.591   2.203   1.00 0.00 ? 44  PRO A CA   1  
ATOM 621   C C    . PRO A 1 44  ? -12.840 4.257   0.979   1.00 0.00 ? 44  PRO A C    1  
ATOM 622   O O    . PRO A 1 44  ? -12.869 5.483   0.881   1.00 0.00 ? 44  PRO A O    1  
ATOM 623   C CB   . PRO A 1 44  ? -13.238 3.053   3.184   1.00 0.00 ? 44  PRO A CB   1  
ATOM 624   C CG   . PRO A 1 44  ? -13.292 4.056   4.324   1.00 0.00 ? 44  PRO A CG   1  
ATOM 625   C CD   . PRO A 1 44  ? -12.082 4.968   4.200   1.00 0.00 ? 44  PRO A CD   1  
ATOM 626   H HA   . PRO A 1 44  ? -11.621 2.864   1.847   1.00 0.00 ? 44  PRO A HA   1  
ATOM 627   H HB2  . PRO A 1 44  ? -14.214 2.949   2.708   1.00 0.00 ? 44  PRO A HB2  1  
ATOM 628   H HB3  . PRO A 1 44  ? -12.954 2.065   3.546   1.00 0.00 ? 44  PRO A HB3  1  
ATOM 629   H HG2  . PRO A 1 44  ? -14.214 4.637   4.278   1.00 0.00 ? 44  PRO A HG2  1  
ATOM 630   H HG3  . PRO A 1 44  ? -13.286 3.543   5.285   1.00 0.00 ? 44  PRO A HG3  1  
ATOM 631   H HD2  . PRO A 1 44  ? -12.379 6.016   4.150   1.00 0.00 ? 44  PRO A HD2  1  
ATOM 632   H HD3  . PRO A 1 44  ? -11.419 4.865   5.059   1.00 0.00 ? 44  PRO A HD3  1  
ATOM 633   N N    . GLY A 1 45  ? -13.330 3.420   0.076   1.00 0.00 ? 45  GLY A N    1  
ATOM 634   C CA   . GLY A 1 45  ? -13.958 3.913   -1.137  1.00 0.00 ? 45  GLY A CA   1  
ATOM 635   C C    . GLY A 1 45  ? -13.224 5.143   -1.675  1.00 0.00 ? 45  GLY A C    1  
ATOM 636   O O    . GLY A 1 45  ? -13.833 6.011   -2.298  1.00 0.00 ? 45  GLY A O    1  
ATOM 637   H H    . GLY A 1 45  ? -13.302 2.424   0.164   1.00 0.00 ? 45  GLY A H    1  
ATOM 638   H HA2  . GLY A 1 45  ? -13.962 3.128   -1.894  1.00 0.00 ? 45  GLY A HA2  1  
ATOM 639   H HA3  . GLY A 1 45  ? -14.999 4.166   -0.935  1.00 0.00 ? 45  GLY A HA3  1  
ATOM 640   N N    . SER A 1 46  ? -11.925 5.178   -1.414  1.00 0.00 ? 46  SER A N    1  
ATOM 641   C CA   . SER A 1 46  ? -11.102 6.287   -1.864  1.00 0.00 ? 46  SER A CA   1  
ATOM 642   C C    . SER A 1 46  ? -10.322 5.886   -3.118  1.00 0.00 ? 46  SER A C    1  
ATOM 643   O O    . SER A 1 46  ? -10.406 4.743   -3.566  1.00 0.00 ? 46  SER A O    1  
ATOM 644   C CB   . SER A 1 46  ? -10.140 6.741   -0.764  1.00 0.00 ? 46  SER A CB   1  
ATOM 645   O OG   . SER A 1 46  ? -8.971  5.928   -0.709  1.00 0.00 ? 46  SER A OG   1  
ATOM 646   H H    . SER A 1 46  ? -11.437 4.468   -0.907  1.00 0.00 ? 46  SER A H    1  
ATOM 647   H HA   . SER A 1 46  ? -11.800 7.093   -2.089  1.00 0.00 ? 46  SER A HA   1  
ATOM 648   H HB2  . SER A 1 46  ? -9.853  7.778   -0.938  1.00 0.00 ? 46  SER A HB2  1  
ATOM 649   H HB3  . SER A 1 46  ? -10.649 6.709   0.199   1.00 0.00 ? 46  SER A HB3  1  
ATOM 650   H HG   . SER A 1 46  ? -9.214  4.997   -0.437  1.00 0.00 ? 46  SER A HG   1  
ATOM 651   N N    . LEU A 1 47  ? -9.582  6.848   -3.649  1.00 0.00 ? 47  LEU A N    1  
ATOM 652   C CA   . LEU A 1 47  ? -8.789  6.609   -4.842  1.00 0.00 ? 47  LEU A CA   1  
ATOM 653   C C    . LEU A 1 47  ? -7.603  5.709   -4.489  1.00 0.00 ? 47  LEU A C    1  
ATOM 654   O O    . LEU A 1 47  ? -7.379  4.688   -5.139  1.00 0.00 ? 47  LEU A O    1  
ATOM 655   C CB   . LEU A 1 47  ? -8.383  7.934   -5.491  1.00 0.00 ? 47  LEU A CB   1  
ATOM 656   C CG   . LEU A 1 47  ? -7.525  7.829   -6.753  1.00 0.00 ? 47  LEU A CG   1  
ATOM 657   C CD1  . LEU A 1 47  ? -7.941  6.624   -7.599  1.00 0.00 ? 47  LEU A CD1  1  
ATOM 658   C CD2  . LEU A 1 47  ? -7.565  9.132   -7.554  1.00 0.00 ? 47  LEU A CD2  1  
ATOM 659   H H    . LEU A 1 47  ? -9.520  7.775   -3.279  1.00 0.00 ? 47  LEU A H    1  
ATOM 660   H HA   . LEU A 1 47  ? -9.422  6.082   -5.556  1.00 0.00 ? 47  LEU A HA   1  
ATOM 661   H HB2  . LEU A 1 47  ? -9.289  8.488   -5.736  1.00 0.00 ? 47  LEU A HB2  1  
ATOM 662   H HB3  . LEU A 1 47  ? -7.838  8.524   -4.754  1.00 0.00 ? 47  LEU A HB3  1  
ATOM 663   H HG   . LEU A 1 47  ? -6.491  7.668   -6.451  1.00 0.00 ? 47  LEU A HG   1  
ATOM 664   H HD11 . LEU A 1 47  ? -7.577  5.709   -7.132  1.00 0.00 ? 47  LEU A HD11 1  
ATOM 665   H HD12 . LEU A 1 47  ? -9.028  6.587   -7.670  1.00 0.00 ? 47  LEU A HD12 1  
ATOM 666   H HD13 . LEU A 1 47  ? -7.515  6.717   -8.598  1.00 0.00 ? 47  LEU A HD13 1  
ATOM 667   H HD21 . LEU A 1 47  ? -7.007  9.902   -7.021  1.00 0.00 ? 47  LEU A HD21 1  
ATOM 668   H HD22 . LEU A 1 47  ? -7.117  8.970   -8.534  1.00 0.00 ? 47  LEU A HD22 1  
ATOM 669   H HD23 . LEU A 1 47  ? -8.600  9.452   -7.676  1.00 0.00 ? 47  LEU A HD23 1  
ATOM 670   N N    . ALA A 1 48  ? -6.875  6.119   -3.461  1.00 0.00 ? 48  ALA A N    1  
ATOM 671   C CA   . ALA A 1 48  ? -5.718  5.363   -3.014  1.00 0.00 ? 48  ALA A CA   1  
ATOM 672   C C    . ALA A 1 48  ? -6.100  3.888   -2.877  1.00 0.00 ? 48  ALA A C    1  
ATOM 673   O O    . ALA A 1 48  ? -5.573  3.037   -3.592  1.00 0.00 ? 48  ALA A O    1  
ATOM 674   C CB   . ALA A 1 48  ? -5.196  5.954   -1.703  1.00 0.00 ? 48  ALA A CB   1  
ATOM 675   H H    . ALA A 1 48  ? -7.064  6.950   -2.939  1.00 0.00 ? 48  ALA A H    1  
ATOM 676   H HA   . ALA A 1 48  ? -4.944  5.459   -3.775  1.00 0.00 ? 48  ALA A HA   1  
ATOM 677   H HB1  . ALA A 1 48  ? -4.130  5.746   -1.609  1.00 0.00 ? 48  ALA A HB1  1  
ATOM 678   H HB2  . ALA A 1 48  ? -5.357  7.032   -1.702  1.00 0.00 ? 48  ALA A HB2  1  
ATOM 679   H HB3  . ALA A 1 48  ? -5.729  5.506   -0.865  1.00 0.00 ? 48  ALA A HB3  1  
ATOM 680   N N    . GLU A 1 49  ? -7.015  3.630   -1.953  1.00 0.00 ? 49  GLU A N    1  
ATOM 681   C CA   . GLU A 1 49  ? -7.474  2.272   -1.713  1.00 0.00 ? 49  GLU A CA   1  
ATOM 682   C C    . GLU A 1 49  ? -7.886  1.611   -3.030  1.00 0.00 ? 49  GLU A C    1  
ATOM 683   O O    . GLU A 1 49  ? -7.805  0.391   -3.168  1.00 0.00 ? 49  GLU A O    1  
ATOM 684   C CB   . GLU A 1 49  ? -8.625  2.253   -0.706  1.00 0.00 ? 49  GLU A CB   1  
ATOM 685   C CG   . GLU A 1 49  ? -9.062  0.819   -0.400  1.00 0.00 ? 49  GLU A CG   1  
ATOM 686   C CD   . GLU A 1 49  ? -8.246  0.231   0.752   1.00 0.00 ? 49  GLU A CD   1  
ATOM 687   O OE1  . GLU A 1 49  ? -7.003  0.215   0.616   1.00 0.00 ? 49  GLU A OE1  1  
ATOM 688   O OE2  . GLU A 1 49  ? -8.882  -0.189  1.742   1.00 0.00 ? 49  GLU A OE2  1  
ATOM 689   H H    . GLU A 1 49  ? -7.439  4.328   -1.376  1.00 0.00 ? 49  GLU A H    1  
ATOM 690   H HA   . GLU A 1 49  ? -6.618  1.748   -1.288  1.00 0.00 ? 49  GLU A HA   1  
ATOM 691   H HB2  . GLU A 1 49  ? -8.316  2.747   0.215   1.00 0.00 ? 49  GLU A HB2  1  
ATOM 692   H HB3  . GLU A 1 49  ? -9.469  2.818   -1.102  1.00 0.00 ? 49  GLU A HB3  1  
ATOM 693   H HG2  . GLU A 1 49  ? -10.122 0.805   -0.144  1.00 0.00 ? 49  GLU A HG2  1  
ATOM 694   H HG3  . GLU A 1 49  ? -8.941  0.201   -1.290  1.00 0.00 ? 49  GLU A HG3  1  
ATOM 695   N N    . LYS A 1 50  ? -8.319  2.444   -3.964  1.00 0.00 ? 50  LYS A N    1  
ATOM 696   C CA   . LYS A 1 50  ? -8.744  1.956   -5.265  1.00 0.00 ? 50  LYS A CA   1  
ATOM 697   C C    . LYS A 1 50  ? -7.513  1.563   -6.084  1.00 0.00 ? 50  LYS A C    1  
ATOM 698   O O    . LYS A 1 50  ? -7.559  0.612   -6.863  1.00 0.00 ? 50  LYS A O    1  
ATOM 699   C CB   . LYS A 1 50  ? -9.642  2.984   -5.957  1.00 0.00 ? 50  LYS A CB   1  
ATOM 700   C CG   . LYS A 1 50  ? -9.320  3.076   -7.450  1.00 0.00 ? 50  LYS A CG   1  
ATOM 701   C CD   . LYS A 1 50  ? -10.436 3.798   -8.207  1.00 0.00 ? 50  LYS A CD   1  
ATOM 702   C CE   . LYS A 1 50  ? -11.418 2.799   -8.822  1.00 0.00 ? 50  LYS A CE   1  
ATOM 703   N NZ   . LYS A 1 50  ? -10.950 2.367   -10.158 1.00 0.00 ? 50  LYS A NZ   1  
ATOM 704   H H    . LYS A 1 50  ? -8.382  3.435   -3.844  1.00 0.00 ? 50  LYS A H    1  
ATOM 705   H HA   . LYS A 1 50  ? -9.347  1.063   -5.097  1.00 0.00 ? 50  LYS A HA   1  
ATOM 706   H HB2  . LYS A 1 50  ? -10.688 2.708   -5.822  1.00 0.00 ? 50  LYS A HB2  1  
ATOM 707   H HB3  . LYS A 1 50  ? -9.508  3.960   -5.491  1.00 0.00 ? 50  LYS A HB3  1  
ATOM 708   H HG2  . LYS A 1 50  ? -8.378  3.605   -7.590  1.00 0.00 ? 50  LYS A HG2  1  
ATOM 709   H HG3  . LYS A 1 50  ? -9.187  2.074   -7.859  1.00 0.00 ? 50  LYS A HG3  1  
ATOM 710   H HD2  . LYS A 1 50  ? -10.967 4.466   -7.529  1.00 0.00 ? 50  LYS A HD2  1  
ATOM 711   H HD3  . LYS A 1 50  ? -10.004 4.419   -8.992  1.00 0.00 ? 50  LYS A HD3  1  
ATOM 712   H HE2  . LYS A 1 50  ? -11.521 1.933   -8.168  1.00 0.00 ? 50  LYS A HE2  1  
ATOM 713   H HE3  . LYS A 1 50  ? -12.405 3.254   -8.905  1.00 0.00 ? 50  LYS A HE3  1  
ATOM 714   H HZ1  . LYS A 1 50  ? -11.715 1.973   -10.668 1.00 0.00 ? 50  LYS A HZ1  1  
ATOM 715   H HZ2  . LYS A 1 50  ? -10.588 3.155   -10.655 1.00 0.00 ? 50  LYS A HZ2  1  
ATOM 716   H HZ3  . LYS A 1 50  ? -10.231 1.680   -10.053 1.00 0.00 ? 50  LYS A HZ3  1  
ATOM 717   N N    . GLU A 1 51  ? -6.442  2.316   -5.881  1.00 0.00 ? 51  GLU A N    1  
ATOM 718   C CA   . GLU A 1 51  ? -5.201  2.059   -6.591  1.00 0.00 ? 51  GLU A CA   1  
ATOM 719   C C    . GLU A 1 51  ? -4.550  0.774   -6.075  1.00 0.00 ? 51  GLU A C    1  
ATOM 720   O O    . GLU A 1 51  ? -3.682  0.205   -6.735  1.00 0.00 ? 51  GLU A O    1  
ATOM 721   C CB   . GLU A 1 51  ? -4.244  3.246   -6.470  1.00 0.00 ? 51  GLU A CB   1  
ATOM 722   C CG   . GLU A 1 51  ? -4.861  4.512   -7.068  1.00 0.00 ? 51  GLU A CG   1  
ATOM 723   C CD   . GLU A 1 51  ? -4.760  4.504   -8.594  1.00 0.00 ? 51  GLU A CD   1  
ATOM 724   O OE1  . GLU A 1 51  ? -5.051  3.436   -9.176  1.00 0.00 ? 51  GLU A OE1  1  
ATOM 725   O OE2  . GLU A 1 51  ? -4.394  5.564   -9.144  1.00 0.00 ? 51  GLU A OE2  1  
ATOM 726   H H    . GLU A 1 51  ? -6.413  3.088   -5.246  1.00 0.00 ? 51  GLU A H    1  
ATOM 727   H HA   . GLU A 1 51  ? -5.485  1.935   -7.636  1.00 0.00 ? 51  GLU A HA   1  
ATOM 728   H HB2  . GLU A 1 51  ? -4.000  3.416   -5.421  1.00 0.00 ? 51  GLU A HB2  1  
ATOM 729   H HB3  . GLU A 1 51  ? -3.308  3.018   -6.981  1.00 0.00 ? 51  GLU A HB3  1  
ATOM 730   H HG2  . GLU A 1 51  ? -5.907  4.586   -6.769  1.00 0.00 ? 51  GLU A HG2  1  
ATOM 731   H HG3  . GLU A 1 51  ? -4.354  5.391   -6.671  1.00 0.00 ? 51  GLU A HG3  1  
ATOM 732   N N    . GLY A 1 52  ? -4.993  0.356   -4.898  1.00 0.00 ? 52  GLY A N    1  
ATOM 733   C CA   . GLY A 1 52  ? -4.464  -0.851  -4.285  1.00 0.00 ? 52  GLY A CA   1  
ATOM 734   C C    . GLY A 1 52  ? -3.878  -0.552  -2.904  1.00 0.00 ? 52  GLY A C    1  
ATOM 735   O O    . GLY A 1 52  ? -3.847  -1.424  -2.037  1.00 0.00 ? 52  GLY A O    1  
ATOM 736   H H    . GLY A 1 52  ? -5.699  0.825   -4.368  1.00 0.00 ? 52  GLY A H    1  
ATOM 737   H HA2  . GLY A 1 52  ? -5.256  -1.594  -4.195  1.00 0.00 ? 52  GLY A HA2  1  
ATOM 738   H HA3  . GLY A 1 52  ? -3.694  -1.281  -4.926  1.00 0.00 ? 52  GLY A HA3  1  
ATOM 739   N N    . LEU A 1 53  ? -3.427  0.683   -2.742  1.00 0.00 ? 53  LEU A N    1  
ATOM 740   C CA   . LEU A 1 53  ? -2.844  1.108   -1.481  1.00 0.00 ? 53  LEU A CA   1  
ATOM 741   C C    . LEU A 1 53  ? -3.649  0.510   -0.325  1.00 0.00 ? 53  LEU A C    1  
ATOM 742   O O    . LEU A 1 53  ? -4.836  0.224   -0.473  1.00 0.00 ? 53  LEU A O    1  
ATOM 743   C CB   . LEU A 1 53  ? -2.732  2.633   -1.428  1.00 0.00 ? 53  LEU A CB   1  
ATOM 744   C CG   . LEU A 1 53  ? -1.431  3.190   -0.847  1.00 0.00 ? 53  LEU A CG   1  
ATOM 745   C CD1  . LEU A 1 53  ? -0.368  3.350   -1.936  1.00 0.00 ? 53  LEU A CD1  1  
ATOM 746   C CD2  . LEU A 1 53  ? -1.682  4.498   -0.095  1.00 0.00 ? 53  LEU A CD2  1  
ATOM 747   H H    . LEU A 1 53  ? -3.456  1.387   -3.452  1.00 0.00 ? 53  LEU A H    1  
ATOM 748   H HA   . LEU A 1 53  ? -1.831  0.708   -1.439  1.00 0.00 ? 53  LEU A HA   1  
ATOM 749   H HB2  . LEU A 1 53  ? -2.850  3.021   -2.440  1.00 0.00 ? 53  LEU A HB2  1  
ATOM 750   H HB3  . LEU A 1 53  ? -3.564  3.018   -0.840  1.00 0.00 ? 53  LEU A HB3  1  
ATOM 751   H HG   . LEU A 1 53  ? -1.044  2.472   -0.124  1.00 0.00 ? 53  LEU A HG   1  
ATOM 752   H HD11 . LEU A 1 53  ? 0.115   2.390   -2.116  1.00 0.00 ? 53  LEU A HD11 1  
ATOM 753   H HD12 . LEU A 1 53  ? -0.839  3.698   -2.855  1.00 0.00 ? 53  LEU A HD12 1  
ATOM 754   H HD13 . LEU A 1 53  ? 0.377   4.076   -1.612  1.00 0.00 ? 53  LEU A HD13 1  
ATOM 755   H HD21 . LEU A 1 53  ? -1.432  5.341   -0.739  1.00 0.00 ? 53  LEU A HD21 1  
ATOM 756   H HD22 . LEU A 1 53  ? -2.733  4.557   0.190   1.00 0.00 ? 53  LEU A HD22 1  
ATOM 757   H HD23 . LEU A 1 53  ? -1.061  4.528   0.800   1.00 0.00 ? 53  LEU A HD23 1  
ATOM 758   N N    . ARG A 1 54  ? -2.971  0.340   0.801   1.00 0.00 ? 54  ARG A N    1  
ATOM 759   C CA   . ARG A 1 54  ? -3.608  -0.218  1.981   1.00 0.00 ? 54  ARG A CA   1  
ATOM 760   C C    . ARG A 1 54  ? -2.680  -0.099  3.192   1.00 0.00 ? 54  ARG A C    1  
ATOM 761   O O    . ARG A 1 54  ? -1.460  -0.169  3.052   1.00 0.00 ? 54  ARG A O    1  
ATOM 762   C CB   . ARG A 1 54  ? -3.970  -1.689  1.768   1.00 0.00 ? 54  ARG A CB   1  
ATOM 763   C CG   . ARG A 1 54  ? -2.713  -2.548  1.619   1.00 0.00 ? 54  ARG A CG   1  
ATOM 764   C CD   . ARG A 1 54  ? -2.217  -2.547  0.171   1.00 0.00 ? 54  ARG A CD   1  
ATOM 765   N NE   . ARG A 1 54  ? -2.805  -3.688  -0.566  1.00 0.00 ? 54  ARG A NE   1  
ATOM 766   C CZ   . ARG A 1 54  ? -2.389  -4.956  -0.443  1.00 0.00 ? 54  ARG A CZ   1  
ATOM 767   N NH1  . ARG A 1 54  ? -1.381  -5.253  0.388   1.00 0.00 ? 54  ARG A NH1  1  
ATOM 768   N NH2  . ARG A 1 54  ? -2.981  -5.927  -1.151  1.00 0.00 ? 54  ARG A NH2  1  
ATOM 769   H H    . ARG A 1 54  ? -2.005  0.575   0.913   1.00 0.00 ? 54  ARG A H    1  
ATOM 770   H HA   . ARG A 1 54  ? -4.510  0.377   2.119   1.00 0.00 ? 54  ARG A HA   1  
ATOM 771   H HB2  . ARG A 1 54  ? -4.562  -2.048  2.611   1.00 0.00 ? 54  ARG A HB2  1  
ATOM 772   H HB3  . ARG A 1 54  ? -4.591  -1.790  0.878   1.00 0.00 ? 54  ARG A HB3  1  
ATOM 773   H HG2  . ARG A 1 54  ? -1.929  -2.169  2.275   1.00 0.00 ? 54  ARG A HG2  1  
ATOM 774   H HG3  . ARG A 1 54  ? -2.926  -3.570  1.933   1.00 0.00 ? 54  ARG A HG3  1  
ATOM 775   H HD2  . ARG A 1 54  ? -2.490  -1.610  -0.315  1.00 0.00 ? 54  ARG A HD2  1  
ATOM 776   H HD3  . ARG A 1 54  ? -1.130  -2.612  0.150   1.00 0.00 ? 54  ARG A HD3  1  
ATOM 777   H HE   . ARG A 1 54  ? -3.560  -3.502  -1.195  1.00 0.00 ? 54  ARG A HE   1  
ATOM 778   H HH11 . ARG A 1 54  ? -0.939  -4.528  0.917   1.00 0.00 ? 54  ARG A HH11 1  
ATOM 779   H HH12 . ARG A 1 54  ? -1.070  -6.199  0.480   1.00 0.00 ? 54  ARG A HH12 1  
ATOM 780   H HH21 . ARG A 1 54  ? -3.734  -5.706  -1.771  1.00 0.00 ? 54  ARG A HH21 1  
ATOM 781   H HH22 . ARG A 1 54  ? -2.671  -6.873  -1.059  1.00 0.00 ? 54  ARG A HH22 1  
ATOM 782   N N    . VAL A 1 55  ? -3.293  0.079   4.352   1.00 0.00 ? 55  VAL A N    1  
ATOM 783   C CA   . VAL A 1 55  ? -2.538  0.208   5.587   1.00 0.00 ? 55  VAL A CA   1  
ATOM 784   C C    . VAL A 1 55  ? -1.593  -0.987  5.729   1.00 0.00 ? 55  VAL A C    1  
ATOM 785   O O    . VAL A 1 55  ? -2.022  -2.083  6.086   1.00 0.00 ? 55  VAL A O    1  
ATOM 786   C CB   . VAL A 1 55  ? -3.493  0.359   6.772   1.00 0.00 ? 55  VAL A CB   1  
ATOM 787   C CG1  . VAL A 1 55  ? -2.806  -0.029  8.083   1.00 0.00 ? 55  VAL A CG1  1  
ATOM 788   C CG2  . VAL A 1 55  ? -4.053  1.781   6.847   1.00 0.00 ? 55  VAL A CG2  1  
ATOM 789   H H    . VAL A 1 55  ? -4.286  0.135   4.457   1.00 0.00 ? 55  VAL A H    1  
ATOM 790   H HA   . VAL A 1 55  ? -1.943  1.119   5.514   1.00 0.00 ? 55  VAL A HA   1  
ATOM 791   H HB   . VAL A 1 55  ? -4.329  -0.322  6.617   1.00 0.00 ? 55  VAL A HB   1  
ATOM 792   H HG11 . VAL A 1 55  ? -1.910  0.578   8.217   1.00 0.00 ? 55  VAL A HG11 1  
ATOM 793   H HG12 . VAL A 1 55  ? -3.489  0.141   8.915   1.00 0.00 ? 55  VAL A HG12 1  
ATOM 794   H HG13 . VAL A 1 55  ? -2.529  -1.083  8.049   1.00 0.00 ? 55  VAL A HG13 1  
ATOM 795   H HG21 . VAL A 1 55  ? -4.716  1.956   5.999   1.00 0.00 ? 55  VAL A HG21 1  
ATOM 796   H HG22 . VAL A 1 55  ? -4.611  1.903   7.775   1.00 0.00 ? 55  VAL A HG22 1  
ATOM 797   H HG23 . VAL A 1 55  ? -3.232  2.497   6.820   1.00 0.00 ? 55  VAL A HG23 1  
ATOM 798   N N    . GLY A 1 56  ? -0.324  -0.735  5.442   1.00 0.00 ? 56  GLY A N    1  
ATOM 799   C CA   . GLY A 1 56  ? 0.685   -1.776  5.534   1.00 0.00 ? 56  GLY A CA   1  
ATOM 800   C C    . GLY A 1 56  ? 1.539   -1.825  4.265   1.00 0.00 ? 56  GLY A C    1  
ATOM 801   O O    . GLY A 1 56  ? 1.881   -2.904  3.784   1.00 0.00 ? 56  GLY A O    1  
ATOM 802   H H    . GLY A 1 56  ? 0.017   0.160   5.153   1.00 0.00 ? 56  GLY A H    1  
ATOM 803   H HA2  . GLY A 1 56  ? 1.323   -1.595  6.399   1.00 0.00 ? 56  GLY A HA2  1  
ATOM 804   H HA3  . GLY A 1 56  ? 0.203   -2.741  5.689   1.00 0.00 ? 56  GLY A HA3  1  
ATOM 805   N N    . ASP A 1 57  ? 1.860   -0.642  3.760   1.00 0.00 ? 57  ASP A N    1  
ATOM 806   C CA   . ASP A 1 57  ? 2.667   -0.537  2.557   1.00 0.00 ? 57  ASP A CA   1  
ATOM 807   C C    . ASP A 1 57  ? 3.963   0.210   2.881   1.00 0.00 ? 57  ASP A C    1  
ATOM 808   O O    . ASP A 1 57  ? 4.125   0.727   3.986   1.00 0.00 ? 57  ASP A O    1  
ATOM 809   C CB   . ASP A 1 57  ? 1.932   0.245   1.467   1.00 0.00 ? 57  ASP A CB   1  
ATOM 810   C CG   . ASP A 1 57  ? 1.211   -0.617  0.428   1.00 0.00 ? 57  ASP A CG   1  
ATOM 811   O OD1  . ASP A 1 57  ? 1.680   -1.755  0.212   1.00 0.00 ? 57  ASP A OD1  1  
ATOM 812   O OD2  . ASP A 1 57  ? 0.208   -0.118  -0.127  1.00 0.00 ? 57  ASP A OD2  1  
ATOM 813   H H    . ASP A 1 57  ? 1.578   0.231   4.158   1.00 0.00 ? 57  ASP A H    1  
ATOM 814   H HA   . ASP A 1 57  ? 2.846   -1.564  2.241   1.00 0.00 ? 57  ASP A HA   1  
ATOM 815   H HB2  . ASP A 1 57  ? 1.202   0.902   1.941   1.00 0.00 ? 57  ASP A HB2  1  
ATOM 816   H HB3  . ASP A 1 57  ? 2.649   0.884   0.952   1.00 0.00 ? 57  ASP A HB3  1  
ATOM 817   N N    . GLN A 1 58  ? 4.851   0.243   1.899   1.00 0.00 ? 58  GLN A N    1  
ATOM 818   C CA   . GLN A 1 58  ? 6.127   0.918   2.067   1.00 0.00 ? 58  GLN A CA   1  
ATOM 819   C C    . GLN A 1 58  ? 6.410   1.823   0.866   1.00 0.00 ? 58  GLN A C    1  
ATOM 820   O O    . GLN A 1 58  ? 6.689   1.337   -0.230  1.00 0.00 ? 58  GLN A O    1  
ATOM 821   C CB   . GLN A 1 58  ? 7.259   -0.092  2.271   1.00 0.00 ? 58  GLN A CB   1  
ATOM 822   C CG   . GLN A 1 58  ? 8.597   0.620   2.481   1.00 0.00 ? 58  GLN A CG   1  
ATOM 823   C CD   . GLN A 1 58  ? 9.684   -0.371  2.903   1.00 0.00 ? 58  GLN A CD   1  
ATOM 824   O OE1  . GLN A 1 58  ? 9.586   -1.568  2.689   1.00 0.00 ? 58  GLN A OE1  1  
ATOM 825   N NE2  . GLN A 1 58  ? 10.723  0.194   3.511   1.00 0.00 ? 58  GLN A NE2  1  
ATOM 826   H H    . GLN A 1 58  ? 4.711   -0.181  1.004   1.00 0.00 ? 58  GLN A H    1  
ATOM 827   H HA   . GLN A 1 58  ? 6.020   1.521   2.968   1.00 0.00 ? 58  GLN A HA   1  
ATOM 828   H HB2  . GLN A 1 58  ? 7.038   -0.721  3.134   1.00 0.00 ? 58  GLN A HB2  1  
ATOM 829   H HB3  . GLN A 1 58  ? 7.325   -0.751  1.405   1.00 0.00 ? 58  GLN A HB3  1  
ATOM 830   H HG2  . GLN A 1 58  ? 8.894   1.121   1.560   1.00 0.00 ? 58  GLN A HG2  1  
ATOM 831   H HG3  . GLN A 1 58  ? 8.487   1.391   3.243   1.00 0.00 ? 58  GLN A HG3  1  
ATOM 832   H HE21 . GLN A 1 58  ? 10.741  1.183   3.655   1.00 0.00 ? 58  GLN A HE21 1  
ATOM 833   H HE22 . GLN A 1 58  ? 11.486  -0.371  3.825   1.00 0.00 ? 58  GLN A HE22 1  
ATOM 834   N N    . ILE A 1 59  ? 6.329   3.122   1.112   1.00 0.00 ? 59  ILE A N    1  
ATOM 835   C CA   . ILE A 1 59  ? 6.573   4.099   0.065   1.00 0.00 ? 59  ILE A CA   1  
ATOM 836   C C    . ILE A 1 59  ? 8.063   4.103   -0.286  1.00 0.00 ? 59  ILE A C    1  
ATOM 837   O O    . ILE A 1 59  ? 8.843   4.842   0.312   1.00 0.00 ? 59  ILE A O    1  
ATOM 838   C CB   . ILE A 1 59  ? 6.035   5.471   0.476   1.00 0.00 ? 59  ILE A CB   1  
ATOM 839   C CG1  . ILE A 1 59  ? 4.562   5.383   0.882   1.00 0.00 ? 59  ILE A CG1  1  
ATOM 840   C CG2  . ILE A 1 59  ? 6.264   6.504   -0.629  1.00 0.00 ? 59  ILE A CG2  1  
ATOM 841   C CD1  . ILE A 1 59  ? 3.668   5.176   -0.342  1.00 0.00 ? 59  ILE A CD1  1  
ATOM 842   H H    . ILE A 1 59  ? 6.102   3.508   2.006   1.00 0.00 ? 59  ILE A H    1  
ATOM 843   H HA   . ILE A 1 59  ? 6.012   3.783   -0.814  1.00 0.00 ? 59  ILE A HA   1  
ATOM 844   H HB   . ILE A 1 59  ? 6.591   5.807   1.352   1.00 0.00 ? 59  ILE A HB   1  
ATOM 845   H HG12 . ILE A 1 59  ? 4.423   4.559   1.582   1.00 0.00 ? 59  ILE A HG12 1  
ATOM 846   H HG13 . ILE A 1 59  ? 4.269   6.295   1.401   1.00 0.00 ? 59  ILE A HG13 1  
ATOM 847   H HG21 . ILE A 1 59  ? 7.116   6.201   -1.238  1.00 0.00 ? 59  ILE A HG21 1  
ATOM 848   H HG22 . ILE A 1 59  ? 5.375   6.569   -1.256  1.00 0.00 ? 59  ILE A HG22 1  
ATOM 849   H HG23 . ILE A 1 59  ? 6.465   7.477   -0.181  1.00 0.00 ? 59  ILE A HG23 1  
ATOM 850   H HD11 . ILE A 1 59  ? 4.279   4.873   -1.192  1.00 0.00 ? 59  ILE A HD11 1  
ATOM 851   H HD12 . ILE A 1 59  ? 2.933   4.400   -0.128  1.00 0.00 ? 59  ILE A HD12 1  
ATOM 852   H HD13 . ILE A 1 59  ? 3.154   6.108   -0.578  1.00 0.00 ? 59  ILE A HD13 1  
ATOM 853   N N    . LEU A 1 60  ? 8.412   3.268   -1.254  1.00 0.00 ? 60  LEU A N    1  
ATOM 854   C CA   . LEU A 1 60  ? 9.794   3.166   -1.691  1.00 0.00 ? 60  LEU A CA   1  
ATOM 855   C C    . LEU A 1 60  ? 10.198  4.462   -2.395  1.00 0.00 ? 60  LEU A C    1  
ATOM 856   O O    . LEU A 1 60  ? 11.256  5.023   -2.112  1.00 0.00 ? 60  LEU A O    1  
ATOM 857   C CB   . LEU A 1 60  ? 9.994   1.913   -2.547  1.00 0.00 ? 60  LEU A CB   1  
ATOM 858   C CG   . LEU A 1 60  ? 9.454   0.607   -1.960  1.00 0.00 ? 60  LEU A CG   1  
ATOM 859   C CD1  . LEU A 1 60  ? 9.590   -0.541  -2.962  1.00 0.00 ? 60  LEU A CD1  1  
ATOM 860   C CD2  . LEU A 1 60  ? 10.129  0.286   -0.625  1.00 0.00 ? 60  LEU A CD2  1  
ATOM 861   H H    . LEU A 1 60  ? 7.771   2.670   -1.735  1.00 0.00 ? 60  LEU A H    1  
ATOM 862   H HA   . LEU A 1 60  ? 10.411  3.050   -0.800  1.00 0.00 ? 60  LEU A HA   1  
ATOM 863   H HB2  . LEU A 1 60  ? 9.518   2.078   -3.513  1.00 0.00 ? 60  LEU A HB2  1  
ATOM 864   H HB3  . LEU A 1 60  ? 11.061  1.791   -2.733  1.00 0.00 ? 60  LEU A HB3  1  
ATOM 865   H HG   . LEU A 1 60  ? 8.390   0.736   -1.760  1.00 0.00 ? 60  LEU A HG   1  
ATOM 866   H HD11 . LEU A 1 60  ? 10.303  -0.264  -3.738  1.00 0.00 ? 60  LEU A HD11 1  
ATOM 867   H HD12 . LEU A 1 60  ? 9.943   -1.434  -2.445  1.00 0.00 ? 60  LEU A HD12 1  
ATOM 868   H HD13 . LEU A 1 60  ? 8.620   -0.744  -3.415  1.00 0.00 ? 60  LEU A HD13 1  
ATOM 869   H HD21 . LEU A 1 60  ? 9.503   -0.403  -0.058  1.00 0.00 ? 60  LEU A HD21 1  
ATOM 870   H HD22 . LEU A 1 60  ? 11.100  -0.174  -0.810  1.00 0.00 ? 60  LEU A HD22 1  
ATOM 871   H HD23 . LEU A 1 60  ? 10.264  1.206   -0.056  1.00 0.00 ? 60  LEU A HD23 1  
ATOM 872   N N    . ARG A 1 61  ? 9.335   4.901   -3.300  1.00 0.00 ? 61  ARG A N    1  
ATOM 873   C CA   . ARG A 1 61  ? 9.590   6.121   -4.047  1.00 0.00 ? 61  ARG A CA   1  
ATOM 874   C C    . ARG A 1 61  ? 8.321   6.973   -4.119  1.00 0.00 ? 61  ARG A C    1  
ATOM 875   O O    . ARG A 1 61  ? 7.216   6.464   -3.939  1.00 0.00 ? 61  ARG A O    1  
ATOM 876   C CB   . ARG A 1 61  ? 10.067  5.808   -5.467  1.00 0.00 ? 61  ARG A CB   1  
ATOM 877   C CG   . ARG A 1 61  ? 11.574  5.545   -5.493  1.00 0.00 ? 61  ARG A CG   1  
ATOM 878   C CD   . ARG A 1 61  ? 11.955  4.653   -6.676  1.00 0.00 ? 61  ARG A CD   1  
ATOM 879   N NE   . ARG A 1 61  ? 13.094  5.246   -7.411  1.00 0.00 ? 61  ARG A NE   1  
ATOM 880   C CZ   . ARG A 1 61  ? 13.546  4.794   -8.589  1.00 0.00 ? 61  ARG A CZ   1  
ATOM 881   N NH1  . ARG A 1 61  ? 12.958  3.740   -9.172  1.00 0.00 ? 61  ARG A NH1  1  
ATOM 882   N NH2  . ARG A 1 61  ? 14.586  5.395   -9.183  1.00 0.00 ? 61  ARG A NH2  1  
ATOM 883   H H    . ARG A 1 61  ? 8.478   4.439   -3.525  1.00 0.00 ? 61  ARG A H    1  
ATOM 884   H HA   . ARG A 1 61  ? 10.374  6.632   -3.488  1.00 0.00 ? 61  ARG A HA   1  
ATOM 885   H HB2  . ARG A 1 61  ? 9.536   4.937   -5.849  1.00 0.00 ? 61  ARG A HB2  1  
ATOM 886   H HB3  . ARG A 1 61  ? 9.829   6.642   -6.127  1.00 0.00 ? 61  ARG A HB3  1  
ATOM 887   H HG2  . ARG A 1 61  ? 12.111  6.491   -5.558  1.00 0.00 ? 61  ARG A HG2  1  
ATOM 888   H HG3  . ARG A 1 61  ? 11.880  5.069   -4.561  1.00 0.00 ? 61  ARG A HG3  1  
ATOM 889   H HD2  . ARG A 1 61  ? 12.219  3.657   -6.321  1.00 0.00 ? 61  ARG A HD2  1  
ATOM 890   H HD3  . ARG A 1 61  ? 11.101  4.537   -7.344  1.00 0.00 ? 61  ARG A HD3  1  
ATOM 891   H HE   . ARG A 1 61  ? 13.556  6.034   -7.004  1.00 0.00 ? 61  ARG A HE   1  
ATOM 892   H HH11 . ARG A 1 61  ? 12.182  3.292   -8.728  1.00 0.00 ? 61  ARG A HH11 1  
ATOM 893   H HH12 . ARG A 1 61  ? 13.295  3.402   -10.050 1.00 0.00 ? 61  ARG A HH12 1  
ATOM 894   H HH21 . ARG A 1 61  ? 15.024  6.181   -8.748  1.00 0.00 ? 61  ARG A HH21 1  
ATOM 895   H HH22 . ARG A 1 61  ? 14.923  5.057   -10.062 1.00 0.00 ? 61  ARG A HH22 1  
ATOM 896   N N    . VAL A 1 62  ? 8.523   8.256   -4.384  1.00 0.00 ? 62  VAL A N    1  
ATOM 897   C CA   . VAL A 1 62  ? 7.409   9.184   -4.482  1.00 0.00 ? 62  VAL A CA   1  
ATOM 898   C C    . VAL A 1 62  ? 7.699   10.208  -5.581  1.00 0.00 ? 62  VAL A C    1  
ATOM 899   O O    . VAL A 1 62  ? 8.598   11.036  -5.441  1.00 0.00 ? 62  VAL A O    1  
ATOM 900   C CB   . VAL A 1 62  ? 7.142   9.827   -3.120  1.00 0.00 ? 62  VAL A CB   1  
ATOM 901   C CG1  . VAL A 1 62  ? 8.026   11.058  -2.913  1.00 0.00 ? 62  VAL A CG1  1  
ATOM 902   C CG2  . VAL A 1 62  ? 5.662   10.182  -2.962  1.00 0.00 ? 62  VAL A CG2  1  
ATOM 903   H H    . VAL A 1 62  ? 9.425   8.662   -4.529  1.00 0.00 ? 62  VAL A H    1  
ATOM 904   H HA   . VAL A 1 62  ? 6.526   8.609   -4.763  1.00 0.00 ? 62  VAL A HA   1  
ATOM 905   H HB   . VAL A 1 62  ? 7.396   9.099   -2.350  1.00 0.00 ? 62  VAL A HB   1  
ATOM 906   H HG11 . VAL A 1 62  ? 7.622   11.896  -3.481  1.00 0.00 ? 62  VAL A HG11 1  
ATOM 907   H HG12 . VAL A 1 62  ? 8.049   11.316  -1.854  1.00 0.00 ? 62  VAL A HG12 1  
ATOM 908   H HG13 . VAL A 1 62  ? 9.038   10.841  -3.255  1.00 0.00 ? 62  VAL A HG13 1  
ATOM 909   H HG21 . VAL A 1 62  ? 5.122   9.900   -3.865  1.00 0.00 ? 62  VAL A HG21 1  
ATOM 910   H HG22 . VAL A 1 62  ? 5.249   9.644   -2.108  1.00 0.00 ? 62  VAL A HG22 1  
ATOM 911   H HG23 . VAL A 1 62  ? 5.561   11.255  -2.798  1.00 0.00 ? 62  VAL A HG23 1  
ATOM 912   N N    . ASN A 1 63  ? 6.921   10.119  -6.649  1.00 0.00 ? 63  ASN A N    1  
ATOM 913   C CA   . ASN A 1 63  ? 7.083   11.028  -7.771  1.00 0.00 ? 63  ASN A CA   1  
ATOM 914   C C    . ASN A 1 63  ? 8.255   10.559  -8.636  1.00 0.00 ? 63  ASN A C    1  
ATOM 915   O O    . ASN A 1 63  ? 8.090   10.314  -9.831  1.00 0.00 ? 63  ASN A O    1  
ATOM 916   C CB   . ASN A 1 63  ? 7.390   12.448  -7.290  1.00 0.00 ? 63  ASN A CB   1  
ATOM 917   C CG   . ASN A 1 63  ? 6.707   13.488  -8.180  1.00 0.00 ? 63  ASN A CG   1  
ATOM 918   O OD1  . ASN A 1 63  ? 6.912   13.546  -9.382  1.00 0.00 ? 63  ASN A OD1  1  
ATOM 919   N ND2  . ASN A 1 63  ? 5.885   14.304  -7.526  1.00 0.00 ? 63  ASN A ND2  1  
ATOM 920   H H    . ASN A 1 63  ? 6.192   9.443   -6.755  1.00 0.00 ? 63  ASN A H    1  
ATOM 921   H HA   . ASN A 1 63  ? 6.133   10.998  -8.304  1.00 0.00 ? 63  ASN A HA   1  
ATOM 922   H HB2  . ASN A 1 63  ? 7.053   12.567  -6.260  1.00 0.00 ? 63  ASN A HB2  1  
ATOM 923   H HB3  . ASN A 1 63  ? 8.467   12.612  -7.294  1.00 0.00 ? 63  ASN A HB3  1  
ATOM 924   H HD21 . ASN A 1 63  ? 5.761   14.202  -6.539  1.00 0.00 ? 63  ASN A HD21 1  
ATOM 925   H HD22 . ASN A 1 63  ? 5.391   15.018  -8.022  1.00 0.00 ? 63  ASN A HD22 1  
ATOM 926   N N    . ASP A 1 64  ? 9.412   10.447  -8.000  1.00 0.00 ? 64  ASP A N    1  
ATOM 927   C CA   . ASP A 1 64  ? 10.610  10.012  -8.697  1.00 0.00 ? 64  ASP A CA   1  
ATOM 928   C C    . ASP A 1 64  ? 11.733  9.791   -7.682  1.00 0.00 ? 64  ASP A C    1  
ATOM 929   O O    . ASP A 1 64  ? 12.464  8.805   -7.764  1.00 0.00 ? 64  ASP A O    1  
ATOM 930   C CB   . ASP A 1 64  ? 11.080  11.069  -9.698  1.00 0.00 ? 64  ASP A CB   1  
ATOM 931   C CG   . ASP A 1 64  ? 11.947  10.537  -10.841 1.00 0.00 ? 64  ASP A CG   1  
ATOM 932   O OD1  . ASP A 1 64  ? 12.017  9.296   -10.969 1.00 0.00 ? 64  ASP A OD1  1  
ATOM 933   O OD2  . ASP A 1 64  ? 12.521  11.384  -11.559 1.00 0.00 ? 64  ASP A OD2  1  
ATOM 934   H H    . ASP A 1 64  ? 9.537   10.648  -7.029  1.00 0.00 ? 64  ASP A H    1  
ATOM 935   H HA   . ASP A 1 64  ? 10.325  9.094   -9.210  1.00 0.00 ? 64  ASP A HA   1  
ATOM 936   H HB2  . ASP A 1 64  ? 10.204  11.558  -10.125 1.00 0.00 ? 64  ASP A HB2  1  
ATOM 937   H HB3  . ASP A 1 64  ? 11.641  11.833  -9.161  1.00 0.00 ? 64  ASP A HB3  1  
ATOM 938   N N    . LYS A 1 65  ? 11.834  10.724  -6.746  1.00 0.00 ? 65  LYS A N    1  
ATOM 939   C CA   . LYS A 1 65  ? 12.856  10.643  -5.716  1.00 0.00 ? 65  LYS A CA   1  
ATOM 940   C C    . LYS A 1 65  ? 12.547  9.466   -4.789  1.00 0.00 ? 65  LYS A C    1  
ATOM 941   O O    . LYS A 1 65  ? 11.383  9.170   -4.523  1.00 0.00 ? 65  LYS A O    1  
ATOM 942   C CB   . LYS A 1 65  ? 12.989  11.982  -4.987  1.00 0.00 ? 65  LYS A CB   1  
ATOM 943   C CG   . LYS A 1 65  ? 14.261  12.020  -4.138  1.00 0.00 ? 65  LYS A CG   1  
ATOM 944   C CD   . LYS A 1 65  ? 14.452  13.396  -3.498  1.00 0.00 ? 65  LYS A CD   1  
ATOM 945   C CE   . LYS A 1 65  ? 15.762  13.457  -2.711  1.00 0.00 ? 65  LYS A CE   1  
ATOM 946   N NZ   . LYS A 1 65  ? 15.829  14.701  -1.912  1.00 0.00 ? 65  LYS A NZ   1  
ATOM 947   H H    . LYS A 1 65  ? 11.235  11.522  -6.686  1.00 0.00 ? 65  LYS A H    1  
ATOM 948   H HA   . LYS A 1 65  ? 13.807  10.451  -6.213  1.00 0.00 ? 65  LYS A HA   1  
ATOM 949   H HB2  . LYS A 1 65  ? 13.007  12.795  -5.713  1.00 0.00 ? 65  LYS A HB2  1  
ATOM 950   H HB3  . LYS A 1 65  ? 12.118  12.142  -4.352  1.00 0.00 ? 65  LYS A HB3  1  
ATOM 951   H HG2  . LYS A 1 65  ? 14.206  11.257  -3.361  1.00 0.00 ? 65  LYS A HG2  1  
ATOM 952   H HG3  . LYS A 1 65  ? 15.124  11.781  -4.759  1.00 0.00 ? 65  LYS A HG3  1  
ATOM 953   H HD2  . LYS A 1 65  ? 14.451  14.164  -4.271  1.00 0.00 ? 65  LYS A HD2  1  
ATOM 954   H HD3  . LYS A 1 65  ? 13.614  13.611  -2.834  1.00 0.00 ? 65  LYS A HD3  1  
ATOM 955   H HE2  . LYS A 1 65  ? 15.840  12.591  -2.053  1.00 0.00 ? 65  LYS A HE2  1  
ATOM 956   H HE3  . LYS A 1 65  ? 16.608  13.413  -3.397  1.00 0.00 ? 65  LYS A HE3  1  
ATOM 957   H HZ1  . LYS A 1 65  ? 15.939  15.485  -2.524  1.00 0.00 ? 65  LYS A HZ1  1  
ATOM 958   H HZ2  . LYS A 1 65  ? 14.986  14.805  -1.385  1.00 0.00 ? 65  LYS A HZ2  1  
ATOM 959   H HZ3  . LYS A 1 65  ? 16.609  14.655  -1.287  1.00 0.00 ? 65  LYS A HZ3  1  
ATOM 960   N N    . SER A 1 66  ? 13.609  8.827   -4.322  1.00 0.00 ? 66  SER A N    1  
ATOM 961   C CA   . SER A 1 66  ? 13.466  7.689   -3.430  1.00 0.00 ? 66  SER A CA   1  
ATOM 962   C C    . SER A 1 66  ? 13.673  8.131   -1.980  1.00 0.00 ? 66  SER A C    1  
ATOM 963   O O    . SER A 1 66  ? 14.742  8.625   -1.625  1.00 0.00 ? 66  SER A O    1  
ATOM 964   C CB   . SER A 1 66  ? 14.454  6.578   -3.792  1.00 0.00 ? 66  SER A CB   1  
ATOM 965   O OG   . SER A 1 66  ? 15.786  6.900   -3.403  1.00 0.00 ? 66  SER A OG   1  
ATOM 966   H H    . SER A 1 66  ? 14.553  9.074   -4.543  1.00 0.00 ? 66  SER A H    1  
ATOM 967   H HA   . SER A 1 66  ? 12.447  7.331   -3.580  1.00 0.00 ? 66  SER A HA   1  
ATOM 968   H HB2  . SER A 1 66  ? 14.149  5.650   -3.307  1.00 0.00 ? 66  SER A HB2  1  
ATOM 969   H HB3  . SER A 1 66  ? 14.422  6.401   -4.867  1.00 0.00 ? 66  SER A HB3  1  
ATOM 970   H HG   . SER A 1 66  ? 15.854  7.875   -3.191  1.00 0.00 ? 66  SER A HG   1  
ATOM 971   N N    . LEU A 1 67  ? 12.633  7.938   -1.182  1.00 0.00 ? 67  LEU A N    1  
ATOM 972   C CA   . LEU A 1 67  ? 12.687  8.310   0.221   1.00 0.00 ? 67  LEU A CA   1  
ATOM 973   C C    . LEU A 1 67  ? 13.672  7.394   0.950   1.00 0.00 ? 67  LEU A C    1  
ATOM 974   O O    . LEU A 1 67  ? 14.690  7.854   1.465   1.00 0.00 ? 67  LEU A O    1  
ATOM 975   C CB   . LEU A 1 67  ? 11.283  8.313   0.830   1.00 0.00 ? 67  LEU A CB   1  
ATOM 976   C CG   . LEU A 1 67  ? 10.207  9.047   0.028   1.00 0.00 ? 67  LEU A CG   1  
ATOM 977   C CD1  . LEU A 1 67  ? 8.812   8.753   0.585   1.00 0.00 ? 67  LEU A CD1  1  
ATOM 978   C CD2  . LEU A 1 67  ? 10.495  10.548  -0.032  1.00 0.00 ? 67  LEU A CD2  1  
ATOM 979   H H    . LEU A 1 67  ? 11.767  7.535   -1.479  1.00 0.00 ? 67  LEU A H    1  
ATOM 980   H HA   . LEU A 1 67  ? 13.063  9.332   0.274   1.00 0.00 ? 67  LEU A HA   1  
ATOM 981   H HB2  . LEU A 1 67  ? 10.966  7.279   0.966   1.00 0.00 ? 67  LEU A HB2  1  
ATOM 982   H HB3  . LEU A 1 67  ? 11.340  8.762   1.821   1.00 0.00 ? 67  LEU A HB3  1  
ATOM 983   H HG   . LEU A 1 67  ? 10.229  8.673   -0.996  1.00 0.00 ? 67  LEU A HG   1  
ATOM 984   H HD11 . LEU A 1 67  ? 8.093   8.721   -0.233  1.00 0.00 ? 67  LEU A HD11 1  
ATOM 985   H HD12 . LEU A 1 67  ? 8.822   7.791   1.099   1.00 0.00 ? 67  LEU A HD12 1  
ATOM 986   H HD13 . LEU A 1 67  ? 8.529   9.537   1.288   1.00 0.00 ? 67  LEU A HD13 1  
ATOM 987   H HD21 . LEU A 1 67  ? 10.988  10.786  -0.975  1.00 0.00 ? 67  LEU A HD21 1  
ATOM 988   H HD22 . LEU A 1 67  ? 9.559   11.101  0.038   1.00 0.00 ? 67  LEU A HD22 1  
ATOM 989   H HD23 . LEU A 1 67  ? 11.145  10.827  0.798   1.00 0.00 ? 67  LEU A HD23 1  
ATOM 990   N N    . ALA A 1 68  ? 13.334  6.113   0.971   1.00 0.00 ? 68  ALA A N    1  
ATOM 991   C CA   . ALA A 1 68  ? 14.175  5.127   1.629   1.00 0.00 ? 68  ALA A CA   1  
ATOM 992   C C    . ALA A 1 68  ? 14.192  5.400   3.134   1.00 0.00 ? 68  ALA A C    1  
ATOM 993   O O    . ALA A 1 68  ? 13.546  4.691   3.905   1.00 0.00 ? 68  ALA A O    1  
ATOM 994   C CB   . ALA A 1 68  ? 15.576  5.161   1.015   1.00 0.00 ? 68  ALA A CB   1  
ATOM 995   H H    . ALA A 1 68  ? 12.504  5.746   0.551   1.00 0.00 ? 68  ALA A H    1  
ATOM 996   H HA   . ALA A 1 68  ? 13.737  4.145   1.451   1.00 0.00 ? 68  ALA A HA   1  
ATOM 997   H HB1  . ALA A 1 68  ? 15.917  4.142   0.832   1.00 0.00 ? 68  ALA A HB1  1  
ATOM 998   H HB2  . ALA A 1 68  ? 15.547  5.708   0.073   1.00 0.00 ? 68  ALA A HB2  1  
ATOM 999   H HB3  . ALA A 1 68  ? 16.262  5.656   1.702   1.00 0.00 ? 68  ALA A HB3  1  
ATOM 1000  N N    . ARG A 1 69  ? 14.937  6.430   3.508   1.00 0.00 ? 69  ARG A N    1  
ATOM 1001  C CA   . ARG A 1 69  ? 15.046  6.806   4.908   1.00 0.00 ? 69  ARG A CA   1  
ATOM 1002  C C    . ARG A 1 69  ? 15.252  8.316   5.038   1.00 0.00 ? 69  ARG A C    1  
ATOM 1003  O O    . ARG A 1 69  ? 16.387  8.792   5.056   1.00 0.00 ? 69  ARG A O    1  
ATOM 1004  C CB   . ARG A 1 69  ? 16.210  6.079   5.584   1.00 0.00 ? 69  ARG A CB   1  
ATOM 1005  C CG   . ARG A 1 69  ? 15.759  4.731   6.151   1.00 0.00 ? 69  ARG A CG   1  
ATOM 1006  C CD   . ARG A 1 69  ? 16.650  4.302   7.319   1.00 0.00 ? 69  ARG A CD   1  
ATOM 1007  N NE   . ARG A 1 69  ? 17.251  2.979   7.038   1.00 0.00 ? 69  ARG A NE   1  
ATOM 1008  C CZ   . ARG A 1 69  ? 17.747  2.164   7.979   1.00 0.00 ? 69  ARG A CZ   1  
ATOM 1009  N NH1  . ARG A 1 69  ? 17.717  2.532   9.267   1.00 0.00 ? 69  ARG A NH1  1  
ATOM 1010  N NH2  . ARG A 1 69  ? 18.272  0.981   7.632   1.00 0.00 ? 69  ARG A NH2  1  
ATOM 1011  H H    . ARG A 1 69  ? 15.458  7.002   2.876   1.00 0.00 ? 69  ARG A H    1  
ATOM 1012  H HA   . ARG A 1 69  ? 14.099  6.500   5.353   1.00 0.00 ? 69  ARG A HA   1  
ATOM 1013  H HB2  . ARG A 1 69  ? 17.014  5.924   4.864   1.00 0.00 ? 69  ARG A HB2  1  
ATOM 1014  H HB3  . ARG A 1 69  ? 16.614  6.698   6.385   1.00 0.00 ? 69  ARG A HB3  1  
ATOM 1015  H HG2  . ARG A 1 69  ? 14.724  4.801   6.485   1.00 0.00 ? 69  ARG A HG2  1  
ATOM 1016  H HG3  . ARG A 1 69  ? 15.791  3.974   5.368   1.00 0.00 ? 69  ARG A HG3  1  
ATOM 1017  H HD2  . ARG A 1 69  ? 17.436  5.041   7.478   1.00 0.00 ? 69  ARG A HD2  1  
ATOM 1018  H HD3  . ARG A 1 69  ? 16.064  4.257   8.237   1.00 0.00 ? 69  ARG A HD3  1  
ATOM 1019  H HE   . ARG A 1 69  ? 17.289  2.674   6.086   1.00 0.00 ? 69  ARG A HE   1  
ATOM 1020  H HH11 . ARG A 1 69  ? 17.325  3.414   9.526   1.00 0.00 ? 69  ARG A HH11 1  
ATOM 1021  H HH12 . ARG A 1 69  ? 18.088  1.924   9.969   1.00 0.00 ? 69  ARG A HH12 1  
ATOM 1022  H HH21 . ARG A 1 69  ? 18.294  0.707   6.670   1.00 0.00 ? 69  ARG A HH21 1  
ATOM 1023  H HH22 . ARG A 1 69  ? 18.643  0.373   8.334   1.00 0.00 ? 69  ARG A HH22 1  
ATOM 1024  N N    . VAL A 1 70  ? 14.138  9.028   5.124   1.00 0.00 ? 70  VAL A N    1  
ATOM 1025  C CA   . VAL A 1 70  ? 14.183  10.475  5.251   1.00 0.00 ? 70  VAL A CA   1  
ATOM 1026  C C    . VAL A 1 70  ? 13.216  10.916  6.352   1.00 0.00 ? 70  VAL A C    1  
ATOM 1027  O O    . VAL A 1 70  ? 12.241  10.224  6.640   1.00 0.00 ? 70  VAL A O    1  
ATOM 1028  C CB   . VAL A 1 70  ? 13.888  11.129  3.900   1.00 0.00 ? 70  VAL A CB   1  
ATOM 1029  C CG1  . VAL A 1 70  ? 14.924  10.714  2.853   1.00 0.00 ? 70  VAL A CG1  1  
ATOM 1030  C CG2  . VAL A 1 70  ? 12.470  10.799  3.429   1.00 0.00 ? 70  VAL A CG2  1  
ATOM 1031  H H    . VAL A 1 70  ? 13.220  8.634   5.108   1.00 0.00 ? 70  VAL A H    1  
ATOM 1032  H HA   . VAL A 1 70  ? 15.197  10.748  5.544   1.00 0.00 ? 70  VAL A HA   1  
ATOM 1033  H HB   . VAL A 1 70  ? 13.956  12.209  4.028   1.00 0.00 ? 70  VAL A HB   1  
ATOM 1034  H HG11 . VAL A 1 70  ? 15.787  11.376  2.914   1.00 0.00 ? 70  VAL A HG11 1  
ATOM 1035  H HG12 . VAL A 1 70  ? 15.239  9.688   3.040   1.00 0.00 ? 70  VAL A HG12 1  
ATOM 1036  H HG13 . VAL A 1 70  ? 14.483  10.783  1.858   1.00 0.00 ? 70  VAL A HG13 1  
ATOM 1037  H HG21 . VAL A 1 70  ? 12.022  10.074  4.108   1.00 0.00 ? 70  VAL A HG21 1  
ATOM 1038  H HG22 . VAL A 1 70  ? 11.869  11.709  3.421   1.00 0.00 ? 70  VAL A HG22 1  
ATOM 1039  H HG23 . VAL A 1 70  ? 12.509  10.381  2.424   1.00 0.00 ? 70  VAL A HG23 1  
ATOM 1040  N N    . THR A 1 71  ? 13.521  12.064  6.938   1.00 0.00 ? 71  THR A N    1  
ATOM 1041  C CA   . THR A 1 71  ? 12.692  12.605  8.001   1.00 0.00 ? 71  THR A CA   1  
ATOM 1042  C C    . THR A 1 71  ? 11.236  12.709  7.542   1.00 0.00 ? 71  THR A C    1  
ATOM 1043  O O    . THR A 1 71  ? 10.967  12.873  6.353   1.00 0.00 ? 71  THR A O    1  
ATOM 1044  C CB   . THR A 1 71  ? 13.290  13.946  8.432   1.00 0.00 ? 71  THR A CB   1  
ATOM 1045  O OG1  . THR A 1 71  ? 13.768  14.519  7.218   1.00 0.00 ? 71  THR A OG1  1  
ATOM 1046  C CG2  . THR A 1 71  ? 14.548  13.779  9.286   1.00 0.00 ? 71  THR A CG2  1  
ATOM 1047  H H    . THR A 1 71  ? 14.317  12.620  6.699   1.00 0.00 ? 71  THR A H    1  
ATOM 1048  H HA   . THR A 1 71  ? 12.713  11.911  8.841   1.00 0.00 ? 71  THR A HA   1  
ATOM 1049  H HB   . THR A 1 71  ? 12.548  14.556  8.947   1.00 0.00 ? 71  THR A HB   1  
ATOM 1050  H HG1  . THR A 1 71  ? 13.005  14.684  6.593   1.00 0.00 ? 71  THR A HG1  1  
ATOM 1051  H HG21 . THR A 1 71  ? 14.704  12.722  9.501   1.00 0.00 ? 71  THR A HG21 1  
ATOM 1052  H HG22 . THR A 1 71  ? 15.409  14.170  8.745   1.00 0.00 ? 71  THR A HG22 1  
ATOM 1053  H HG23 . THR A 1 71  ? 14.428  14.326  10.221  1.00 0.00 ? 71  THR A HG23 1  
ATOM 1054  N N    . HIS A 1 72  ? 10.335  12.608  8.508   1.00 0.00 ? 72  HIS A N    1  
ATOM 1055  C CA   . HIS A 1 72  ? 8.914   12.688  8.217   1.00 0.00 ? 72  HIS A CA   1  
ATOM 1056  C C    . HIS A 1 72  ? 8.622   13.971  7.435   1.00 0.00 ? 72  HIS A C    1  
ATOM 1057  O O    . HIS A 1 72  ? 7.646   14.038  6.690   1.00 0.00 ? 72  HIS A O    1  
ATOM 1058  C CB   . HIS A 1 72  ? 8.090   12.576  9.501   1.00 0.00 ? 72  HIS A CB   1  
ATOM 1059  C CG   . HIS A 1 72  ? 6.747   11.911  9.313   1.00 0.00 ? 72  HIS A CG   1  
ATOM 1060  N ND1  . HIS A 1 72  ? 5.562   12.480  9.744   1.00 0.00 ? 72  HIS A ND1  1  
ATOM 1061  C CD2  . HIS A 1 72  ? 6.416   10.720  8.735   1.00 0.00 ? 72  HIS A CD2  1  
ATOM 1062  C CE1  . HIS A 1 72  ? 4.568   11.659  9.436   1.00 0.00 ? 72  HIS A CE1  1  
ATOM 1063  N NE2  . HIS A 1 72  ? 5.099   10.570  8.811   1.00 0.00 ? 72  HIS A NE2  1  
ATOM 1064  H H    . HIS A 1 72  ? 10.562  12.475  9.473   1.00 0.00 ? 72  HIS A H    1  
ATOM 1065  H HA   . HIS A 1 72  ? 8.674   11.829  7.592   1.00 0.00 ? 72  HIS A HA   1  
ATOM 1066  H HB2  . HIS A 1 72  ? 8.662   12.015  10.240  1.00 0.00 ? 72  HIS A HB2  1  
ATOM 1067  H HB3  . HIS A 1 72  ? 7.935   13.575  9.910   1.00 0.00 ? 72  HIS A HB3  1  
ATOM 1068  H HD1  . HIS A 1 72  ? 5.470   13.360  10.210  1.00 0.00 ? 72  HIS A HD1  1  
ATOM 1069  H HD2  . HIS A 1 72  ? 7.114   10.013  8.288   1.00 0.00 ? 72  HIS A HD2  1  
ATOM 1070  H HE1  . HIS A 1 72  ? 3.511   11.827  9.644   1.00 0.00 ? 72  HIS A HE1  1  
ATOM 1071  N N    . ALA A 1 73  ? 9.485   14.956  7.632   1.00 0.00 ? 73  ALA A N    1  
ATOM 1072  C CA   . ALA A 1 73  ? 9.332   16.232  6.955   1.00 0.00 ? 73  ALA A CA   1  
ATOM 1073  C C    . ALA A 1 73  ? 9.771   16.086  5.497   1.00 0.00 ? 73  ALA A C    1  
ATOM 1074  O O    . ALA A 1 73  ? 9.246   16.765  4.616   1.00 0.00 ? 73  ALA A O    1  
ATOM 1075  C CB   . ALA A 1 73  ? 10.130  17.304  7.700   1.00 0.00 ? 73  ALA A CB   1  
ATOM 1076  H H    . ALA A 1 73  ? 10.277  14.892  8.241   1.00 0.00 ? 73  ALA A H    1  
ATOM 1077  H HA   . ALA A 1 73  ? 8.275   16.498  6.983   1.00 0.00 ? 73  ALA A HA   1  
ATOM 1078  H HB1  . ALA A 1 73  ? 10.399  16.935  8.689   1.00 0.00 ? 73  ALA A HB1  1  
ATOM 1079  H HB2  . ALA A 1 73  ? 11.036  17.538  7.140   1.00 0.00 ? 73  ALA A HB2  1  
ATOM 1080  H HB3  . ALA A 1 73  ? 9.523   18.204  7.800   1.00 0.00 ? 73  ALA A HB3  1  
ATOM 1081  N N    . GLU A 1 74  ? 10.730  15.197  5.287   1.00 0.00 ? 74  GLU A N    1  
ATOM 1082  C CA   . GLU A 1 74  ? 11.246  14.953  3.950   1.00 0.00 ? 74  GLU A CA   1  
ATOM 1083  C C    . GLU A 1 74  ? 10.196  14.238  3.098   1.00 0.00 ? 74  GLU A C    1  
ATOM 1084  O O    . GLU A 1 74  ? 9.820   14.724  2.033   1.00 0.00 ? 74  GLU A O    1  
ATOM 1085  C CB   . GLU A 1 74  ? 12.548  14.152  4.002   1.00 0.00 ? 74  GLU A CB   1  
ATOM 1086  C CG   . GLU A 1 74  ? 13.756  15.078  4.155   1.00 0.00 ? 74  GLU A CG   1  
ATOM 1087  C CD   . GLU A 1 74  ? 13.976  15.906  2.887   1.00 0.00 ? 74  GLU A CD   1  
ATOM 1088  O OE1  . GLU A 1 74  ? 13.762  15.338  1.794   1.00 0.00 ? 74  GLU A OE1  1  
ATOM 1089  O OE2  . GLU A 1 74  ? 14.354  17.088  3.039   1.00 0.00 ? 74  GLU A OE2  1  
ATOM 1090  H H    . GLU A 1 74  ? 11.152  14.649  6.009   1.00 0.00 ? 74  GLU A H    1  
ATOM 1091  H HA   . GLU A 1 74  ? 11.450  15.940  3.534   1.00 0.00 ? 74  GLU A HA   1  
ATOM 1092  H HB2  . GLU A 1 74  ? 12.515  13.452  4.837   1.00 0.00 ? 74  GLU A HB2  1  
ATOM 1093  H HB3  . GLU A 1 74  ? 12.652  13.560  3.093   1.00 0.00 ? 74  GLU A HB3  1  
ATOM 1094  H HG2  . GLU A 1 74  ? 13.604  15.743  5.005   1.00 0.00 ? 74  GLU A HG2  1  
ATOM 1095  H HG3  . GLU A 1 74  ? 14.647  14.488  4.367   1.00 0.00 ? 74  GLU A HG3  1  
ATOM 1096  N N    . ALA A 1 75  ? 9.752   13.095  3.600   1.00 0.00 ? 75  ALA A N    1  
ATOM 1097  C CA   . ALA A 1 75  ? 8.752   12.308  2.898   1.00 0.00 ? 75  ALA A CA   1  
ATOM 1098  C C    . ALA A 1 75  ? 7.544   13.191  2.580   1.00 0.00 ? 75  ALA A C    1  
ATOM 1099  O O    . ALA A 1 75  ? 7.094   13.246  1.437   1.00 0.00 ? 75  ALA A O    1  
ATOM 1100  C CB   . ALA A 1 75  ? 8.377   11.088  3.743   1.00 0.00 ? 75  ALA A CB   1  
ATOM 1101  H H    . ALA A 1 75  ? 10.063  12.707  4.467   1.00 0.00 ? 75  ALA A H    1  
ATOM 1102  H HA   . ALA A 1 75  ? 9.196   11.964  1.964   1.00 0.00 ? 75  ALA A HA   1  
ATOM 1103  H HB1  . ALA A 1 75  ? 8.923   10.216  3.385   1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1104  H HB2  . ALA A 1 75  ? 8.634   11.276  4.785   1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1105  H HB3  . ALA A 1 75  ? 7.305   10.905  3.661   1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1106  N N    . VAL A 1 76  ? 7.053   13.861  3.613   1.00 0.00 ? 76  VAL A N    1  
ATOM 1107  C CA   . VAL A 1 76  ? 5.906   14.739  3.458   1.00 0.00 ? 76  VAL A CA   1  
ATOM 1108  C C    . VAL A 1 76  ? 6.207   15.778  2.377   1.00 0.00 ? 76  VAL A C    1  
ATOM 1109  O O    . VAL A 1 76  ? 5.426   15.951  1.442   1.00 0.00 ? 76  VAL A O    1  
ATOM 1110  C CB   . VAL A 1 76  ? 5.542   15.366  4.805   1.00 0.00 ? 76  VAL A CB   1  
ATOM 1111  C CG1  . VAL A 1 76  ? 4.385   16.357  4.654   1.00 0.00 ? 76  VAL A CG1  1  
ATOM 1112  C CG2  . VAL A 1 76  ? 5.209   14.289  5.840   1.00 0.00 ? 76  VAL A CG2  1  
ATOM 1113  H H    . VAL A 1 76  ? 7.424   13.810  4.540   1.00 0.00 ? 76  VAL A H    1  
ATOM 1114  H HA   . VAL A 1 76  ? 5.065   14.127  3.132   1.00 0.00 ? 76  VAL A HA   1  
ATOM 1115  H HB   . VAL A 1 76  ? 6.411   15.918  5.164   1.00 0.00 ? 76  VAL A HB   1  
ATOM 1116  H HG11 . VAL A 1 76  ? 3.478   15.817  4.383   1.00 0.00 ? 76  VAL A HG11 1  
ATOM 1117  H HG12 . VAL A 1 76  ? 4.229   16.880  5.597   1.00 0.00 ? 76  VAL A HG12 1  
ATOM 1118  H HG13 . VAL A 1 76  ? 4.625   17.079  3.873   1.00 0.00 ? 76  VAL A HG13 1  
ATOM 1119  H HG21 . VAL A 1 76  ? 4.138   14.086  5.821   1.00 0.00 ? 76  VAL A HG21 1  
ATOM 1120  H HG22 . VAL A 1 76  ? 5.757   13.377  5.603   1.00 0.00 ? 76  VAL A HG22 1  
ATOM 1121  H HG23 . VAL A 1 76  ? 5.496   14.638  6.832   1.00 0.00 ? 76  VAL A HG23 1  
ATOM 1122  N N    . LYS A 1 77  ? 7.342   16.443  2.539   1.00 0.00 ? 77  LYS A N    1  
ATOM 1123  C CA   . LYS A 1 77  ? 7.756   17.460  1.588   1.00 0.00 ? 77  LYS A CA   1  
ATOM 1124  C C    . LYS A 1 77  ? 7.752   16.866  0.178   1.00 0.00 ? 77  LYS A C    1  
ATOM 1125  O O    . LYS A 1 77  ? 7.695   17.599  -0.808  1.00 0.00 ? 77  LYS A O    1  
ATOM 1126  C CB   . LYS A 1 77  ? 9.101   18.062  1.998   1.00 0.00 ? 77  LYS A CB   1  
ATOM 1127  C CG   . LYS A 1 77  ? 8.909   19.206  2.996   1.00 0.00 ? 77  LYS A CG   1  
ATOM 1128  C CD   . LYS A 1 77  ? 8.960   20.562  2.290   1.00 0.00 ? 77  LYS A CD   1  
ATOM 1129  C CE   . LYS A 1 77  ? 10.140  21.397  2.792   1.00 0.00 ? 77  LYS A CE   1  
ATOM 1130  N NZ   . LYS A 1 77  ? 10.512  22.422  1.791   1.00 0.00 ? 77  LYS A NZ   1  
ATOM 1131  H H    . LYS A 1 77  ? 7.972   16.296  3.301   1.00 0.00 ? 77  LYS A H    1  
ATOM 1132  H HA   . LYS A 1 77  ? 7.019   18.263  1.626   1.00 0.00 ? 77  LYS A HA   1  
ATOM 1133  H HB2  . LYS A 1 77  ? 9.729   17.289  2.442   1.00 0.00 ? 77  LYS A HB2  1  
ATOM 1134  H HB3  . LYS A 1 77  ? 9.625   18.428  1.115   1.00 0.00 ? 77  LYS A HB3  1  
ATOM 1135  H HG2  . LYS A 1 77  ? 7.952   19.092  3.505   1.00 0.00 ? 77  LYS A HG2  1  
ATOM 1136  H HG3  . LYS A 1 77  ? 9.684   19.160  3.761   1.00 0.00 ? 77  LYS A HG3  1  
ATOM 1137  H HD2  . LYS A 1 77  ? 9.047   20.414  1.214   1.00 0.00 ? 77  LYS A HD2  1  
ATOM 1138  H HD3  . LYS A 1 77  ? 8.029   21.102  2.463   1.00 0.00 ? 77  LYS A HD3  1  
ATOM 1139  H HE2  . LYS A 1 77  ? 9.878   21.878  3.734   1.00 0.00 ? 77  LYS A HE2  1  
ATOM 1140  H HE3  . LYS A 1 77  ? 10.993  20.749  2.991   1.00 0.00 ? 77  LYS A HE3  1  
ATOM 1141  H HZ1  . LYS A 1 77  ? 10.599  21.994  0.892   1.00 0.00 ? 77  LYS A HZ1  1  
ATOM 1142  H HZ2  . LYS A 1 77  ? 9.805   23.128  1.758   1.00 0.00 ? 77  LYS A HZ2  1  
ATOM 1143  H HZ3  . LYS A 1 77  ? 11.385  22.837  2.048   1.00 0.00 ? 77  LYS A HZ3  1  
ATOM 1144  N N    . ALA A 1 78  ? 7.814   15.544  0.127   1.00 0.00 ? 78  ALA A N    1  
ATOM 1145  C CA   . ALA A 1 78  ? 7.818   14.843  -1.145  1.00 0.00 ? 78  ALA A CA   1  
ATOM 1146  C C    . ALA A 1 78  ? 6.378   14.528  -1.555  1.00 0.00 ? 78  ALA A C    1  
ATOM 1147  O O    . ALA A 1 78  ? 6.048   14.545  -2.739  1.00 0.00 ? 78  ALA A O    1  
ATOM 1148  C CB   . ALA A 1 78  ? 8.680   13.584  -1.032  1.00 0.00 ? 78  ALA A CB   1  
ATOM 1149  H H    . ALA A 1 78  ? 7.860   14.955  0.934   1.00 0.00 ? 78  ALA A H    1  
ATOM 1150  H HA   . ALA A 1 78  ? 8.262   15.506  -1.888  1.00 0.00 ? 78  ALA A HA   1  
ATOM 1151  H HB1  . ALA A 1 78  ? 8.118   12.803  -0.519  1.00 0.00 ? 78  ALA A HB1  1  
ATOM 1152  H HB2  . ALA A 1 78  ? 8.953   13.239  -2.029  1.00 0.00 ? 78  ALA A HB2  1  
ATOM 1153  H HB3  . ALA A 1 78  ? 9.584   13.812  -0.467  1.00 0.00 ? 78  ALA A HB3  1  
ATOM 1154  N N    . LEU A 1 79  ? 5.559   14.248  -0.551  1.00 0.00 ? 79  LEU A N    1  
ATOM 1155  C CA   . LEU A 1 79  ? 4.162   13.930  -0.792  1.00 0.00 ? 79  LEU A CA   1  
ATOM 1156  C C    . LEU A 1 79  ? 3.362   15.228  -0.914  1.00 0.00 ? 79  LEU A C    1  
ATOM 1157  O O    . LEU A 1 79  ? 3.937   16.314  -0.958  1.00 0.00 ? 79  LEU A O    1  
ATOM 1158  C CB   . LEU A 1 79  ? 3.635   12.982  0.287   1.00 0.00 ? 79  LEU A CB   1  
ATOM 1159  C CG   . LEU A 1 79  ? 4.210   11.564  0.274   1.00 0.00 ? 79  LEU A CG   1  
ATOM 1160  C CD1  . LEU A 1 79  ? 4.347   11.015  1.695   1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1161  C CD2  . LEU A 1 79  ? 3.378   10.643  -0.619  1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1162  H H    . LEU A 1 79  ? 5.836   14.236  0.410   1.00 0.00 ? 79  LEU A H    1  
ATOM 1163  H HA   . LEU A 1 79  ? 4.107   13.399  -1.742  1.00 0.00 ? 79  LEU A HA   1  
ATOM 1164  H HB2  . LEU A 1 79  ? 3.836   13.425  1.262   1.00 0.00 ? 79  LEU A HB2  1  
ATOM 1165  H HB3  . LEU A 1 79  ? 2.552   12.914  0.185   1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1166  H HG   . LEU A 1 79  ? 5.213   11.606  -0.153  1.00 0.00 ? 79  LEU A HG   1  
ATOM 1167  H HD11 . LEU A 1 79  ? 5.338   10.580  1.823   1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1168  H HD12 . LEU A 1 79  ? 4.210   11.824  2.412   1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1169  H HD13 . LEU A 1 79  ? 3.590   10.249  1.863   1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1170  H HD21 . LEU A 1 79  ? 2.378   10.536  -0.199  1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1171  H HD22 . LEU A 1 79  ? 3.308   11.071  -1.619  1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1172  H HD23 . LEU A 1 79  ? 3.854   9.664   -0.676  1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1173  N N    . LYS A 1 80  ? 2.047   15.073  -0.966  1.00 0.00 ? 80  LYS A N    1  
ATOM 1174  C CA   . LYS A 1 80  ? 1.162   16.219  -1.082  1.00 0.00 ? 80  LYS A CA   1  
ATOM 1175  C C    . LYS A 1 80  ? 1.155   16.707  -2.532  1.00 0.00 ? 80  LYS A C    1  
ATOM 1176  O O    . LYS A 1 80  ? 1.852   16.154  -3.381  1.00 0.00 ? 80  LYS A O    1  
ATOM 1177  C CB   . LYS A 1 80  ? 1.550   17.300  -0.071  1.00 0.00 ? 80  LYS A CB   1  
ATOM 1178  C CG   . LYS A 1 80  ? 0.410   17.563  0.915   1.00 0.00 ? 80  LYS A CG   1  
ATOM 1179  C CD   . LYS A 1 80  ? 0.952   17.855  2.315   1.00 0.00 ? 80  LYS A CD   1  
ATOM 1180  C CE   . LYS A 1 80  ? -0.079  18.609  3.157   1.00 0.00 ? 80  LYS A CE   1  
ATOM 1181  N NZ   . LYS A 1 80  ? 0.064   20.070  2.966   1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1182  H H    . LYS A 1 80  ? 1.587   14.186  -0.929  1.00 0.00 ? 80  LYS A H    1  
ATOM 1183  H HA   . LYS A 1 80  ? 0.157   15.884  -0.825  1.00 0.00 ? 80  LYS A HA   1  
ATOM 1184  H HB2  . LYS A 1 80  ? 2.442   16.992  0.473   1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1185  H HB3  . LYS A 1 80  ? 1.800   18.222  -0.597  1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1186  H HG2  . LYS A 1 80  ? -0.188  18.407  0.569   1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1187  H HG3  . LYS A 1 80  ? -0.252  16.698  0.950   1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1188  H HD2  . LYS A 1 80  ? 1.217   16.920  2.809   1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1189  H HD3  . LYS A 1 80  ? 1.866   18.445  2.239   1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1190  H HE2  . LYS A 1 80  ? -1.085  18.296  2.876   1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1191  H HE3  . LYS A 1 80  ? 0.049   18.359  4.210   1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1192  H HZ1  . LYS A 1 80  ? 0.864   20.255  2.395   1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1193  H HZ2  . LYS A 1 80  ? -0.755  20.429  2.519   1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1194  H HZ3  . LYS A 1 80  ? 0.180   20.512  3.856   1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1195  N N    . GLY A 1 81  ? 0.359   17.739  -2.772  1.00 0.00 ? 81  GLY A N    1  
ATOM 1196  C CA   . GLY A 1 81  ? 0.251   18.308  -4.104  1.00 0.00 ? 81  GLY A CA   1  
ATOM 1197  C C    . GLY A 1 81  ? 1.627   18.420  -4.765  1.00 0.00 ? 81  GLY A C    1  
ATOM 1198  O O    . GLY A 1 81  ? 2.592   18.842  -4.130  1.00 0.00 ? 81  GLY A O    1  
ATOM 1199  H H    . GLY A 1 81  ? -0.205  18.184  -2.076  1.00 0.00 ? 81  GLY A H    1  
ATOM 1200  H HA2  . GLY A 1 81  ? -0.401  17.686  -4.718  1.00 0.00 ? 81  GLY A HA2  1  
ATOM 1201  H HA3  . GLY A 1 81  ? -0.210  19.294  -4.047  1.00 0.00 ? 81  GLY A HA3  1  
ATOM 1202  N N    . SER A 1 82  ? 1.673   18.034  -6.032  1.00 0.00 ? 82  SER A N    1  
ATOM 1203  C CA   . SER A 1 82  ? 2.914   18.086  -6.785  1.00 0.00 ? 82  SER A CA   1  
ATOM 1204  C C    . SER A 1 82  ? 2.724   17.426  -8.153  1.00 0.00 ? 82  SER A C    1  
ATOM 1205  O O    . SER A 1 82  ? 3.535   16.598  -8.565  1.00 0.00 ? 82  SER A O    1  
ATOM 1206  C CB   . SER A 1 82  ? 4.051   17.405  -6.021  1.00 0.00 ? 82  SER A CB   1  
ATOM 1207  O OG   . SER A 1 82  ? 5.218   18.221  -5.961  1.00 0.00 ? 82  SER A OG   1  
ATOM 1208  H H    . SER A 1 82  ? 0.883   17.692  -6.541  1.00 0.00 ? 82  SER A H    1  
ATOM 1209  H HA   . SER A 1 82  ? 3.138   19.146  -6.900  1.00 0.00 ? 82  SER A HA   1  
ATOM 1210  H HB2  . SER A 1 82  ? 3.719   17.172  -5.009  1.00 0.00 ? 82  SER A HB2  1  
ATOM 1211  H HB3  . SER A 1 82  ? 4.295   16.458  -6.503  1.00 0.00 ? 82  SER A HB3  1  
ATOM 1212  H HG   . SER A 1 82  ? 5.623   18.305  -6.871  1.00 0.00 ? 82  SER A HG   1  
ATOM 1213  N N    . LYS A 1 83  ? 1.647   17.818  -8.819  1.00 0.00 ? 83  LYS A N    1  
ATOM 1214  C CA   . LYS A 1 83  ? 1.340   17.275  -10.131 1.00 0.00 ? 83  LYS A CA   1  
ATOM 1215  C C    . LYS A 1 83  ? 1.203   15.755  -10.030 1.00 0.00 ? 83  LYS A C    1  
ATOM 1216  O O    . LYS A 1 83  ? 1.396   15.180  -8.959  1.00 0.00 ? 83  LYS A O    1  
ATOM 1217  C CB   . LYS A 1 83  ? 2.380   17.732  -11.156 1.00 0.00 ? 83  LYS A CB   1  
ATOM 1218  C CG   . LYS A 1 83  ? 1.812   18.823  -12.065 1.00 0.00 ? 83  LYS A CG   1  
ATOM 1219  C CD   . LYS A 1 83  ? 2.536   18.846  -13.413 1.00 0.00 ? 83  LYS A CD   1  
ATOM 1220  C CE   . LYS A 1 83  ? 1.868   19.829  -14.377 1.00 0.00 ? 83  LYS A CE   1  
ATOM 1221  N NZ   . LYS A 1 83  ? 2.764   20.975  -14.651 1.00 0.00 ? 83  LYS A NZ   1  
ATOM 1222  H H    . LYS A 1 83  ? 0.993   18.492  -8.476  1.00 0.00 ? 83  LYS A H    1  
ATOM 1223  H HA   . LYS A 1 83  ? 0.380   17.689  -10.439 1.00 0.00 ? 83  LYS A HA   1  
ATOM 1224  H HB2  . LYS A 1 83  ? 3.264   18.107  -10.641 1.00 0.00 ? 83  LYS A HB2  1  
ATOM 1225  H HB3  . LYS A 1 83  ? 2.700   16.881  -11.759 1.00 0.00 ? 83  LYS A HB3  1  
ATOM 1226  H HG2  . LYS A 1 83  ? 0.747   18.651  -12.223 1.00 0.00 ? 83  LYS A HG2  1  
ATOM 1227  H HG3  . LYS A 1 83  ? 1.909   19.794  -11.579 1.00 0.00 ? 83  LYS A HG3  1  
ATOM 1228  H HD2  . LYS A 1 83  ? 3.578   19.127  -13.265 1.00 0.00 ? 83  LYS A HD2  1  
ATOM 1229  H HD3  . LYS A 1 83  ? 2.534   17.847  -13.848 1.00 0.00 ? 83  LYS A HD3  1  
ATOM 1230  H HE2  . LYS A 1 83  ? 1.622   19.322  -15.310 1.00 0.00 ? 83  LYS A HE2  1  
ATOM 1231  H HE3  . LYS A 1 83  ? 0.931   20.186  -13.951 1.00 0.00 ? 83  LYS A HE3  1  
ATOM 1232  H HZ1  . LYS A 1 83  ? 3.715   20.691  -14.530 1.00 0.00 ? 83  LYS A HZ1  1  
ATOM 1233  H HZ2  . LYS A 1 83  ? 2.626   21.289  -15.590 1.00 0.00 ? 83  LYS A HZ2  1  
ATOM 1234  H HZ3  . LYS A 1 83  ? 2.555   21.720  -14.017 1.00 0.00 ? 83  LYS A HZ3  1  
ATOM 1235  N N    . LYS A 1 84  ? 0.870   15.146  -11.159 1.00 0.00 ? 84  LYS A N    1  
ATOM 1236  C CA   . LYS A 1 84  ? 0.704   13.704  -11.211 1.00 0.00 ? 84  LYS A CA   1  
ATOM 1237  C C    . LYS A 1 84  ? 1.799   13.038  -10.375 1.00 0.00 ? 84  LYS A C    1  
ATOM 1238  O O    . LYS A 1 84  ? 2.920   12.856  -10.847 1.00 0.00 ? 84  LYS A O    1  
ATOM 1239  C CB   . LYS A 1 84  ? 0.659   13.221  -12.662 1.00 0.00 ? 84  LYS A CB   1  
ATOM 1240  C CG   . LYS A 1 84  ? 0.269   11.744  -12.737 1.00 0.00 ? 84  LYS A CG   1  
ATOM 1241  C CD   . LYS A 1 84  ? -1.208  11.585  -13.103 1.00 0.00 ? 84  LYS A CD   1  
ATOM 1242  C CE   . LYS A 1 84  ? -1.391  10.533  -14.199 1.00 0.00 ? 84  LYS A CE   1  
ATOM 1243  N NZ   . LYS A 1 84  ? -1.559  11.183  -15.518 1.00 0.00 ? 84  LYS A NZ   1  
ATOM 1244  H H    . LYS A 1 84  ? 0.714   15.621  -12.025 1.00 0.00 ? 84  LYS A H    1  
ATOM 1245  H HA   . LYS A 1 84  ? -0.262  13.470  -10.763 1.00 0.00 ? 84  LYS A HA   1  
ATOM 1246  H HB2  . LYS A 1 84  ? -0.057  13.819  -13.226 1.00 0.00 ? 84  LYS A HB2  1  
ATOM 1247  H HB3  . LYS A 1 84  ? 1.633   13.368  -13.128 1.00 0.00 ? 84  LYS A HB3  1  
ATOM 1248  H HG2  . LYS A 1 84  ? 0.888   11.238  -13.478 1.00 0.00 ? 84  LYS A HG2  1  
ATOM 1249  H HG3  . LYS A 1 84  ? 0.463   11.264  -11.778 1.00 0.00 ? 84  LYS A HG3  1  
ATOM 1250  H HD2  . LYS A 1 84  ? -1.777  11.296  -12.219 1.00 0.00 ? 84  LYS A HD2  1  
ATOM 1251  H HD3  . LYS A 1 84  ? -1.608  12.541  -13.441 1.00 0.00 ? 84  LYS A HD3  1  
ATOM 1252  H HE2  . LYS A 1 84  ? -0.527  9.869   -14.222 1.00 0.00 ? 84  LYS A HE2  1  
ATOM 1253  H HE3  . LYS A 1 84  ? -2.261  9.916   -13.978 1.00 0.00 ? 84  LYS A HE3  1  
ATOM 1254  H HZ1  . LYS A 1 84  ? -0.822  11.844  -15.660 1.00 0.00 ? 84  LYS A HZ1  1  
ATOM 1255  H HZ2  . LYS A 1 84  ? -1.528  10.489  -16.238 1.00 0.00 ? 84  LYS A HZ2  1  
ATOM 1256  H HZ3  . LYS A 1 84  ? -2.441  11.654  -15.548 1.00 0.00 ? 84  LYS A HZ3  1  
ATOM 1257  N N    . LEU A 1 85  ? 1.436   12.694  -9.148  1.00 0.00 ? 85  LEU A N    1  
ATOM 1258  C CA   . LEU A 1 85  ? 2.375   12.053  -8.243  1.00 0.00 ? 85  LEU A CA   1  
ATOM 1259  C C    . LEU A 1 85  ? 2.300   10.536  -8.428  1.00 0.00 ? 85  LEU A C    1  
ATOM 1260  O O    . LEU A 1 85  ? 1.230   9.992   -8.697  1.00 0.00 ? 85  LEU A O    1  
ATOM 1261  C CB   . LEU A 1 85  ? 2.127   12.510  -6.803  1.00 0.00 ? 85  LEU A CB   1  
ATOM 1262  C CG   . LEU A 1 85  ? 2.898   11.754  -5.718  1.00 0.00 ? 85  LEU A CG   1  
ATOM 1263  C CD1  . LEU A 1 85  ? 4.407   11.843  -5.955  1.00 0.00 ? 85  LEU A CD1  1  
ATOM 1264  C CD2  . LEU A 1 85  ? 2.506   12.248  -4.324  1.00 0.00 ? 85  LEU A CD2  1  
ATOM 1265  H H    . LEU A 1 85  ? 0.523   12.846  -8.772  1.00 0.00 ? 85  LEU A H    1  
ATOM 1266  H HA   . LEU A 1 85  ? 3.375   12.386  -8.519  1.00 0.00 ? 85  LEU A HA   1  
ATOM 1267  H HB2  . LEU A 1 85  ? 2.379   13.567  -6.731  1.00 0.00 ? 85  LEU A HB2  1  
ATOM 1268  H HB3  . LEU A 1 85  ? 1.062   12.421  -6.593  1.00 0.00 ? 85  LEU A HB3  1  
ATOM 1269  H HG   . LEU A 1 85  ? 2.624   10.701  -5.776  1.00 0.00 ? 85  LEU A HG   1  
ATOM 1270  H HD11 . LEU A 1 85  ? 4.608   12.562  -6.749  1.00 0.00 ? 85  LEU A HD11 1  
ATOM 1271  H HD12 . LEU A 1 85  ? 4.900   12.166  -5.038  1.00 0.00 ? 85  LEU A HD12 1  
ATOM 1272  H HD13 . LEU A 1 85  ? 4.787   10.864  -6.247  1.00 0.00 ? 85  LEU A HD13 1  
ATOM 1273  H HD21 . LEU A 1 85  ? 3.120   11.746  -3.576  1.00 0.00 ? 85  LEU A HD21 1  
ATOM 1274  H HD22 . LEU A 1 85  ? 2.665   13.324  -4.262  1.00 0.00 ? 85  LEU A HD22 1  
ATOM 1275  H HD23 . LEU A 1 85  ? 1.455   12.024  -4.141  1.00 0.00 ? 85  LEU A HD23 1  
ATOM 1276  N N    . VAL A 1 86  ? 3.450   9.896   -8.277  1.00 0.00 ? 86  VAL A N    1  
ATOM 1277  C CA   . VAL A 1 86  ? 3.529   8.453   -8.424  1.00 0.00 ? 86  VAL A CA   1  
ATOM 1278  C C    . VAL A 1 86  ? 4.026   7.837   -7.115  1.00 0.00 ? 86  VAL A C    1  
ATOM 1279  O O    . VAL A 1 86  ? 5.204   7.951   -6.780  1.00 0.00 ? 86  VAL A O    1  
ATOM 1280  C CB   . VAL A 1 86  ? 4.408   8.096   -9.625  1.00 0.00 ? 86  VAL A CB   1  
ATOM 1281  C CG1  . VAL A 1 86  ? 4.889   6.646   -9.541  1.00 0.00 ? 86  VAL A CG1  1  
ATOM 1282  C CG2  . VAL A 1 86  ? 3.671   8.354   -10.940 1.00 0.00 ? 86  VAL A CG2  1  
ATOM 1283  H H    . VAL A 1 86  ? 4.316   10.346  -8.058  1.00 0.00 ? 86  VAL A H    1  
ATOM 1284  H HA   . VAL A 1 86  ? 2.521   8.087   -8.623  1.00 0.00 ? 86  VAL A HA   1  
ATOM 1285  H HB   . VAL A 1 86  ? 5.286   8.742   -9.600  1.00 0.00 ? 86  VAL A HB   1  
ATOM 1286  H HG11 . VAL A 1 86  ? 5.935   6.627   -9.237  1.00 0.00 ? 86  VAL A HG11 1  
ATOM 1287  H HG12 . VAL A 1 86  ? 4.288   6.106   -8.808  1.00 0.00 ? 86  VAL A HG12 1  
ATOM 1288  H HG13 . VAL A 1 86  ? 4.785   6.172   -10.516 1.00 0.00 ? 86  VAL A HG13 1  
ATOM 1289  H HG21 . VAL A 1 86  ? 3.912   7.565   -11.652 1.00 0.00 ? 86  VAL A HG21 1  
ATOM 1290  H HG22 . VAL A 1 86  ? 2.596   8.364   -10.758 1.00 0.00 ? 86  VAL A HG22 1  
ATOM 1291  H HG23 . VAL A 1 86  ? 3.980   9.317   -11.347 1.00 0.00 ? 86  VAL A HG23 1  
ATOM 1292  N N    . LEU A 1 87  ? 3.104   7.198   -6.410  1.00 0.00 ? 87  LEU A N    1  
ATOM 1293  C CA   . LEU A 1 87  ? 3.434   6.565   -5.145  1.00 0.00 ? 87  LEU A CA   1  
ATOM 1294  C C    . LEU A 1 87  ? 3.969   5.156   -5.410  1.00 0.00 ? 87  LEU A C    1  
ATOM 1295  O O    . LEU A 1 87  ? 3.266   4.316   -5.970  1.00 0.00 ? 87  LEU A O    1  
ATOM 1296  C CB   . LEU A 1 87  ? 2.232   6.598   -4.199  1.00 0.00 ? 87  LEU A CB   1  
ATOM 1297  C CG   . LEU A 1 87  ? 1.597   7.972   -3.970  1.00 0.00 ? 87  LEU A CG   1  
ATOM 1298  C CD1  . LEU A 1 87  ? 2.616   8.957   -3.393  1.00 0.00 ? 87  LEU A CD1  1  
ATOM 1299  C CD2  . LEU A 1 87  ? 0.952   8.499   -5.253  1.00 0.00 ? 87  LEU A CD2  1  
ATOM 1300  H H    . LEU A 1 87  ? 2.148   7.111   -6.690  1.00 0.00 ? 87  LEU A H    1  
ATOM 1301  H HA   . LEU A 1 87  ? 4.225   7.154   -4.682  1.00 0.00 ? 87  LEU A HA   1  
ATOM 1302  H HB2  . LEU A 1 87  ? 1.467   5.928   -4.591  1.00 0.00 ? 87  LEU A HB2  1  
ATOM 1303  H HB3  . LEU A 1 87  ? 2.542   6.198   -3.234  1.00 0.00 ? 87  LEU A HB3  1  
ATOM 1304  H HG   . LEU A 1 87  ? 0.803   7.862   -3.232  1.00 0.00 ? 87  LEU A HG   1  
ATOM 1305  H HD11 . LEU A 1 87  ? 2.337   9.211   -2.370  1.00 0.00 ? 87  LEU A HD11 1  
ATOM 1306  H HD12 . LEU A 1 87  ? 3.606   8.500   -3.397  1.00 0.00 ? 87  LEU A HD12 1  
ATOM 1307  H HD13 . LEU A 1 87  ? 2.631   9.861   -4.001  1.00 0.00 ? 87  LEU A HD13 1  
ATOM 1308  H HD21 . LEU A 1 87  ? 0.208   9.255   -5.001  1.00 0.00 ? 87  LEU A HD21 1  
ATOM 1309  H HD22 . LEU A 1 87  ? 1.719   8.942   -5.889  1.00 0.00 ? 87  LEU A HD22 1  
ATOM 1310  H HD23 . LEU A 1 87  ? 0.471   7.677   -5.782  1.00 0.00 ? 87  LEU A HD23 1  
ATOM 1311  N N    . SER A 1 88  ? 5.208   4.940   -4.994  1.00 0.00 ? 88  SER A N    1  
ATOM 1312  C CA   . SER A 1 88  ? 5.845   3.648   -5.179  1.00 0.00 ? 88  SER A CA   1  
ATOM 1313  C C    . SER A 1 88  ? 5.749   2.828   -3.891  1.00 0.00 ? 88  SER A C    1  
ATOM 1314  O O    . SER A 1 88  ? 6.384   3.159   -2.891  1.00 0.00 ? 88  SER A O    1  
ATOM 1315  C CB   . SER A 1 88  ? 7.308   3.810   -5.597  1.00 0.00 ? 88  SER A CB   1  
ATOM 1316  O OG   . SER A 1 88  ? 7.473   3.722   -7.009  1.00 0.00 ? 88  SER A OG   1  
ATOM 1317  H H    . SER A 1 88  ? 5.773   5.629   -4.539  1.00 0.00 ? 88  SER A H    1  
ATOM 1318  H HA   . SER A 1 88  ? 5.290   3.164   -5.982  1.00 0.00 ? 88  SER A HA   1  
ATOM 1319  H HB2  . SER A 1 88  ? 7.680   4.773   -5.247  1.00 0.00 ? 88  SER A HB2  1  
ATOM 1320  H HB3  . SER A 1 88  ? 7.910   3.041   -5.113  1.00 0.00 ? 88  SER A HB3  1  
ATOM 1321  H HG   . SER A 1 88  ? 7.142   4.559   -7.445  1.00 0.00 ? 88  SER A HG   1  
ATOM 1322  N N    . VAL A 1 89  ? 4.949   1.773   -3.957  1.00 0.00 ? 89  VAL A N    1  
ATOM 1323  C CA   . VAL A 1 89  ? 4.761   0.903   -2.808  1.00 0.00 ? 89  VAL A CA   1  
ATOM 1324  C C    . VAL A 1 89  ? 5.101   -0.535  -3.203  1.00 0.00 ? 89  VAL A C    1  
ATOM 1325  O O    . VAL A 1 89  ? 4.804   -0.964  -4.316  1.00 0.00 ? 89  VAL A O    1  
ATOM 1326  C CB   . VAL A 1 89  ? 3.339   1.054   -2.265  1.00 0.00 ? 89  VAL A CB   1  
ATOM 1327  C CG1  . VAL A 1 89  ? 3.295   2.064   -1.116  1.00 0.00 ? 89  VAL A CG1  1  
ATOM 1328  C CG2  . VAL A 1 89  ? 2.365   1.446   -3.378  1.00 0.00 ? 89  VAL A CG2  1  
ATOM 1329  H H    . VAL A 1 89  ? 4.436   1.511   -4.774  1.00 0.00 ? 89  VAL A H    1  
ATOM 1330  H HA   . VAL A 1 89  ? 5.455   1.228   -2.033  1.00 0.00 ? 89  VAL A HA   1  
ATOM 1331  H HB   . VAL A 1 89  ? 3.026   0.087   -1.872  1.00 0.00 ? 89  VAL A HB   1  
ATOM 1332  H HG11 . VAL A 1 89  ? 3.486   3.065   -1.505  1.00 0.00 ? 89  VAL A HG11 1  
ATOM 1333  H HG12 . VAL A 1 89  ? 2.312   2.038   -0.647  1.00 0.00 ? 89  VAL A HG12 1  
ATOM 1334  H HG13 . VAL A 1 89  ? 4.057   1.810   -0.379  1.00 0.00 ? 89  VAL A HG13 1  
ATOM 1335  H HG21 . VAL A 1 89  ? 2.409   2.524   -3.535  1.00 0.00 ? 89  VAL A HG21 1  
ATOM 1336  H HG22 . VAL A 1 89  ? 2.641   0.933   -4.299  1.00 0.00 ? 89  VAL A HG22 1  
ATOM 1337  H HG23 . VAL A 1 89  ? 1.353   1.161   -3.092  1.00 0.00 ? 89  VAL A HG23 1  
ATOM 1338  N N    . TYR A 1 90  ? 5.720   -1.241  -2.267  1.00 0.00 ? 90  TYR A N    1  
ATOM 1339  C CA   . TYR A 1 90  ? 6.104   -2.622  -2.503  1.00 0.00 ? 90  TYR A CA   1  
ATOM 1340  C C    . TYR A 1 90  ? 5.092   -3.586  -1.879  1.00 0.00 ? 90  TYR A C    1  
ATOM 1341  O O    . TYR A 1 90  ? 4.521   -3.298  -0.829  1.00 0.00 ? 90  TYR A O    1  
ATOM 1342  C CB   . TYR A 1 90  ? 7.458   -2.807  -1.815  1.00 0.00 ? 90  TYR A CB   1  
ATOM 1343  C CG   . TYR A 1 90  ? 7.747   -4.248  -1.388  1.00 0.00 ? 90  TYR A CG   1  
ATOM 1344  C CD1  . TYR A 1 90  ? 7.932   -5.227  -2.343  1.00 0.00 ? 90  TYR A CD1  1  
ATOM 1345  C CD2  . TYR A 1 90  ? 7.823   -4.568  -0.048  1.00 0.00 ? 90  TYR A CD2  1  
ATOM 1346  C CE1  . TYR A 1 90  ? 8.204   -6.582  -1.941  1.00 0.00 ? 90  TYR A CE1  1  
ATOM 1347  C CE2  . TYR A 1 90  ? 8.096   -5.924  0.354   1.00 0.00 ? 90  TYR A CE2  1  
ATOM 1348  C CZ   . TYR A 1 90  ? 8.272   -6.864  -0.612  1.00 0.00 ? 90  TYR A CZ   1  
ATOM 1349  O OH   . TYR A 1 90  ? 8.530   -8.144  -0.232  1.00 0.00 ? 90  TYR A OH   1  
ATOM 1350  H H    . TYR A 1 90  ? 5.958   -0.885  -1.364  1.00 0.00 ? 90  TYR A H    1  
ATOM 1351  H HA   . TYR A 1 90  ? 6.132   -2.784  -3.581  1.00 0.00 ? 90  TYR A HA   1  
ATOM 1352  H HB2  . TYR A 1 90  ? 8.245   -2.475  -2.491  1.00 0.00 ? 90  TYR A HB2  1  
ATOM 1353  H HB3  . TYR A 1 90  ? 7.498   -2.164  -0.937  1.00 0.00 ? 90  TYR A HB3  1  
ATOM 1354  H HD1  . TYR A 1 90  ? 7.871   -4.974  -3.401  1.00 0.00 ? 90  TYR A HD1  1  
ATOM 1355  H HD2  . TYR A 1 90  ? 7.677   -3.794  0.707   1.00 0.00 ? 90  TYR A HD2  1  
ATOM 1356  H HE1  . TYR A 1 90  ? 8.352   -7.365  -2.685  1.00 0.00 ? 90  TYR A HE1  1  
ATOM 1357  H HE2  . TYR A 1 90  ? 8.158   -6.190  1.410   1.00 0.00 ? 90  TYR A HE2  1  
ATOM 1358  H HH   . TYR A 1 90  ? 9.236   -8.156  0.476   1.00 0.00 ? 90  TYR A HH   1  
ATOM 1359  N N    . SER A 1 91  ? 4.902   -4.712  -2.553  1.00 0.00 ? 91  SER A N    1  
ATOM 1360  C CA   . SER A 1 91  ? 3.970   -5.720  -2.078  1.00 0.00 ? 91  SER A CA   1  
ATOM 1361  C C    . SER A 1 91  ? 4.650   -7.090  -2.052  1.00 0.00 ? 91  SER A C    1  
ATOM 1362  O O    . SER A 1 91  ? 5.503   -7.380  -2.889  1.00 0.00 ? 91  SER A O    1  
ATOM 1363  C CB   . SER A 1 91  ? 2.716   -5.766  -2.953  1.00 0.00 ? 91  SER A CB   1  
ATOM 1364  O OG   . SER A 1 91  ? 3.027   -5.649  -4.339  1.00 0.00 ? 91  SER A OG   1  
ATOM 1365  H H    . SER A 1 91  ? 5.371   -4.938  -3.406  1.00 0.00 ? 91  SER A H    1  
ATOM 1366  H HA   . SER A 1 91  ? 3.697   -5.408  -1.070  1.00 0.00 ? 91  SER A HA   1  
ATOM 1367  H HB2  . SER A 1 91  ? 2.186   -6.703  -2.779  1.00 0.00 ? 91  SER A HB2  1  
ATOM 1368  H HB3  . SER A 1 91  ? 2.042   -4.960  -2.664  1.00 0.00 ? 91  SER A HB3  1  
ATOM 1369  H HG   . SER A 1 91  ? 2.195   -5.465  -4.862  1.00 0.00 ? 91  SER A HG   1  
ATOM 1370  N N    . ALA A 1 92  ? 4.246   -7.897  -1.081  1.00 0.00 ? 92  ALA A N    1  
ATOM 1371  C CA   . ALA A 1 92  ? 4.806   -9.230  -0.935  1.00 0.00 ? 92  ALA A CA   1  
ATOM 1372  C C    . ALA A 1 92  ? 3.678   -10.223 -0.648  1.00 0.00 ? 92  ALA A C    1  
ATOM 1373  O O    . ALA A 1 92  ? 3.303   -10.425 0.506   1.00 0.00 ? 92  ALA A O    1  
ATOM 1374  C CB   . ALA A 1 92  ? 5.868   -9.220  0.166   1.00 0.00 ? 92  ALA A CB   1  
ATOM 1375  H H    . ALA A 1 92  ? 3.552   -7.653  -0.404  1.00 0.00 ? 92  ALA A H    1  
ATOM 1376  H HA   . ALA A 1 92  ? 5.281   -9.496  -1.879  1.00 0.00 ? 92  ALA A HA   1  
ATOM 1377  H HB1  . ALA A 1 92  ? 6.708   -9.845  -0.134  1.00 0.00 ? 92  ALA A HB1  1  
ATOM 1378  H HB2  . ALA A 1 92  ? 6.214   -8.199  0.327   1.00 0.00 ? 92  ALA A HB2  1  
ATOM 1379  H HB3  . ALA A 1 92  ? 5.438   -9.607  1.090   1.00 0.00 ? 92  ALA A HB3  1  
ATOM 1380  N N    . GLY A 1 93  ? 3.168   -10.816 -1.717  1.00 0.00 ? 93  GLY A N    1  
ATOM 1381  C CA   . GLY A 1 93  ? 2.091   -11.783 -1.594  1.00 0.00 ? 93  GLY A CA   1  
ATOM 1382  C C    . GLY A 1 93  ? 0.992   -11.513 -2.624  1.00 0.00 ? 93  GLY A C    1  
ATOM 1383  O O    . GLY A 1 93  ? 0.830   -10.383 -3.083  1.00 0.00 ? 93  GLY A O    1  
ATOM 1384  H H    . GLY A 1 93  ? 3.479   -10.646 -2.652  1.00 0.00 ? 93  GLY A H    1  
ATOM 1385  H HA2  . GLY A 1 93  ? 2.484   -12.790 -1.733  1.00 0.00 ? 93  GLY A HA2  1  
ATOM 1386  H HA3  . GLY A 1 93  ? 1.671   -11.740 -0.589  1.00 0.00 ? 93  GLY A HA3  1  
ATOM 1387  N N    . ARG A 1 94  ? 0.264   -12.569 -2.956  1.00 0.00 ? 94  ARG A N    1  
ATOM 1388  C CA   . ARG A 1 94  ? -0.815  -12.460 -3.923  1.00 0.00 ? 94  ARG A CA   1  
ATOM 1389  C C    . ARG A 1 94  ? -2.109  -13.035 -3.342  1.00 0.00 ? 94  ARG A C    1  
ATOM 1390  O O    . ARG A 1 94  ? -2.070  -13.915 -2.483  1.00 0.00 ? 94  ARG A O    1  
ATOM 1391  C CB   . ARG A 1 94  ? -0.472  -13.200 -5.217  1.00 0.00 ? 94  ARG A CB   1  
ATOM 1392  C CG   . ARG A 1 94  ? 0.078   -14.596 -4.921  1.00 0.00 ? 94  ARG A CG   1  
ATOM 1393  C CD   . ARG A 1 94  ? -0.556  -15.642 -5.841  1.00 0.00 ? 94  ARG A CD   1  
ATOM 1394  N NE   . ARG A 1 94  ? -1.720  -16.264 -5.172  1.00 0.00 ? 94  ARG A NE   1  
ATOM 1395  C CZ   . ARG A 1 94  ? -2.511  -17.184 -5.742  1.00 0.00 ? 94  ARG A CZ   1  
ATOM 1396  N NH1  . ARG A 1 94  ? -2.268  -17.593 -6.994  1.00 0.00 ? 94  ARG A NH1  1  
ATOM 1397  N NH2  . ARG A 1 94  ? -3.545  -17.694 -5.059  1.00 0.00 ? 94  ARG A NH2  1  
ATOM 1398  H H    . ARG A 1 94  ? 0.402   -13.484 -2.578  1.00 0.00 ? 94  ARG A H    1  
ATOM 1399  H HA   . ARG A 1 94  ? -0.912  -11.391 -4.113  1.00 0.00 ? 94  ARG A HA   1  
ATOM 1400  H HB2  . ARG A 1 94  ? -1.363  -13.281 -5.841  1.00 0.00 ? 94  ARG A HB2  1  
ATOM 1401  H HB3  . ARG A 1 94  ? 0.262   -12.628 -5.784  1.00 0.00 ? 94  ARG A HB3  1  
ATOM 1402  H HG2  . ARG A 1 94  ? 1.160   -14.600 -5.053  1.00 0.00 ? 94  ARG A HG2  1  
ATOM 1403  H HG3  . ARG A 1 94  ? -0.117  -14.855 -3.881  1.00 0.00 ? 94  ARG A HG3  1  
ATOM 1404  H HD2  . ARG A 1 94  ? -0.869  -15.175 -6.774  1.00 0.00 ? 94  ARG A HD2  1  
ATOM 1405  H HD3  . ARG A 1 94  ? 0.178   -16.406 -6.097  1.00 0.00 ? 94  ARG A HD3  1  
ATOM 1406  H HE   . ARG A 1 94  ? -1.930  -15.981 -4.236  1.00 0.00 ? 94  ARG A HE   1  
ATOM 1407  H HH11 . ARG A 1 94  ? -1.496  -17.212 -7.504  1.00 0.00 ? 94  ARG A HH11 1  
ATOM 1408  H HH12 . ARG A 1 94  ? -2.858  -18.279 -7.420  1.00 0.00 ? 94  ARG A HH12 1  
ATOM 1409  H HH21 . ARG A 1 94  ? -3.727  -17.388 -4.124  1.00 0.00 ? 94  ARG A HH21 1  
ATOM 1410  H HH22 . ARG A 1 94  ? -4.135  -18.380 -5.484  1.00 0.00 ? 94  ARG A HH22 1  
ATOM 1411  N N    . ILE A 1 95  ? -3.223  -12.515 -3.833  1.00 0.00 ? 95  ILE A N    1  
ATOM 1412  C CA   . ILE A 1 95  ? -4.526  -12.966 -3.374  1.00 0.00 ? 95  ILE A CA   1  
ATOM 1413  C C    . ILE A 1 95  ? -5.186  -13.805 -4.470  1.00 0.00 ? 95  ILE A C    1  
ATOM 1414  O O    . ILE A 1 95  ? -4.708  -13.841 -5.602  1.00 0.00 ? 95  ILE A O    1  
ATOM 1415  C CB   . ILE A 1 95  ? -5.373  -11.778 -2.914  1.00 0.00 ? 95  ILE A CB   1  
ATOM 1416  C CG1  . ILE A 1 95  ? -5.764  -10.892 -4.099  1.00 0.00 ? 95  ILE A CG1  1  
ATOM 1417  C CG2  . ILE A 1 95  ? -4.658  -10.986 -1.818  1.00 0.00 ? 95  ILE A CG2  1  
ATOM 1418  C CD1  . ILE A 1 95  ? -7.242  -10.505 -4.030  1.00 0.00 ? 95  ILE A CD1  1  
ATOM 1419  H H    . ILE A 1 95  ? -3.246  -11.800 -4.532  1.00 0.00 ? 95  ILE A H    1  
ATOM 1420  H HA   . ILE A 1 95  ? -4.363  -13.602 -2.503  1.00 0.00 ? 95  ILE A HA   1  
ATOM 1421  H HB   . ILE A 1 95  ? -6.296  -12.164 -2.482  1.00 0.00 ? 95  ILE A HB   1  
ATOM 1422  H HG12 . ILE A 1 95  ? -5.148  -9.993  -4.104  1.00 0.00 ? 95  ILE A HG12 1  
ATOM 1423  H HG13 . ILE A 1 95  ? -5.565  -11.419 -5.032  1.00 0.00 ? 95  ILE A HG13 1  
ATOM 1424  H HG21 . ILE A 1 95  ? -4.451  -9.977  -2.175  1.00 0.00 ? 95  ILE A HG21 1  
ATOM 1425  H HG22 . ILE A 1 95  ? -5.292  -10.935 -0.933  1.00 0.00 ? 95  ILE A HG22 1  
ATOM 1426  H HG23 . ILE A 1 95  ? -3.720  -11.481 -1.565  1.00 0.00 ? 95  ILE A HG23 1  
ATOM 1427  H HD11 . ILE A 1 95  ? -7.856  -11.404 -4.084  1.00 0.00 ? 95  ILE A HD11 1  
ATOM 1428  H HD12 . ILE A 1 95  ? -7.439  -9.987  -3.092  1.00 0.00 ? 95  ILE A HD12 1  
ATOM 1429  H HD13 . ILE A 1 95  ? -7.485  -9.849  -4.866  1.00 0.00 ? 95  ILE A HD13 1  
ATOM 1430  N N    . SER A 1 96  ? -6.275  -14.460 -4.094  1.00 0.00 ? 96  SER A N    1  
ATOM 1431  C CA   . SER A 1 96  ? -7.006  -15.296 -5.031  1.00 0.00 ? 96  SER A CA   1  
ATOM 1432  C C    . SER A 1 96  ? -7.967  -14.439 -5.858  1.00 0.00 ? 96  SER A C    1  
ATOM 1433  O O    . SER A 1 96  ? -8.686  -13.604 -5.312  1.00 0.00 ? 96  SER A O    1  
ATOM 1434  C CB   . SER A 1 96  ? -7.774  -16.399 -4.301  1.00 0.00 ? 96  SER A CB   1  
ATOM 1435  O OG   . SER A 1 96  ? -8.858  -15.879 -3.536  1.00 0.00 ? 96  SER A OG   1  
ATOM 1436  H H    . SER A 1 96  ? -6.658  -14.425 -3.171  1.00 0.00 ? 96  SER A H    1  
ATOM 1437  H HA   . SER A 1 96  ? -6.247  -15.745 -5.671  1.00 0.00 ? 96  SER A HA   1  
ATOM 1438  H HB2  . SER A 1 96  ? -8.155  -17.117 -5.027  1.00 0.00 ? 96  SER A HB2  1  
ATOM 1439  H HB3  . SER A 1 96  ? -7.094  -16.941 -3.644  1.00 0.00 ? 96  SER A HB3  1  
ATOM 1440  H HG   . SER A 1 96  ? -9.648  -15.719 -4.127  1.00 0.00 ? 96  SER A HG   1  
ATOM 1441  N N    . GLY A 1 97  ? -7.947  -14.675 -7.162  1.00 0.00 ? 97  GLY A N    1  
ATOM 1442  C CA   . GLY A 1 97  ? -8.807  -13.935 -8.069  1.00 0.00 ? 97  GLY A CA   1  
ATOM 1443  C C    . GLY A 1 97  ? -8.011  -13.390 -9.257  1.00 0.00 ? 97  GLY A C    1  
ATOM 1444  O O    . GLY A 1 97  ? -7.089  -14.042 -9.742  1.00 0.00 ? 97  GLY A O    1  
ATOM 1445  H H    . GLY A 1 97  ? -7.359  -15.356 -7.598  1.00 0.00 ? 97  GLY A H    1  
ATOM 1446  H HA2  . GLY A 1 97  ? -9.606  -14.584 -8.429  1.00 0.00 ? 97  GLY A HA2  1  
ATOM 1447  H HA3  . GLY A 1 97  ? -9.282  -13.112 -7.536  1.00 0.00 ? 97  GLY A HA3  1  
ATOM 1448  N N    . PRO A 1 98  ? -8.408  -12.167 -9.702  1.00 0.00 ? 98  PRO A N    1  
ATOM 1449  C CA   . PRO A 1 98  ? -7.742  -11.527 -10.823 1.00 0.00 ? 98  PRO A CA   1  
ATOM 1450  C C    . PRO A 1 98  ? -6.378  -10.971 -10.406 1.00 0.00 ? 98  PRO A C    1  
ATOM 1451  O O    . PRO A 1 98  ? -6.294  -10.121 -9.521  1.00 0.00 ? 98  PRO A O    1  
ATOM 1452  C CB   . PRO A 1 98  ? -8.706  -10.447 -11.288 1.00 0.00 ? 98  PRO A CB   1  
ATOM 1453  C CG   . PRO A 1 98  ? -9.662  -10.215 -10.130 1.00 0.00 ? 98  PRO A CG   1  
ATOM 1454  C CD   . PRO A 1 98  ? -9.496  -11.365 -9.151  1.00 0.00 ? 98  PRO A CD   1  
ATOM 1455  H HA   . PRO A 1 98  ? -7.556  -12.194 -11.544 1.00 0.00 ? 98  PRO A HA   1  
ATOM 1456  H HB2  . PRO A 1 98  ? -8.173  -9.532  -11.544 1.00 0.00 ? 98  PRO A HB2  1  
ATOM 1457  H HB3  . PRO A 1 98  ? -9.244  -10.763 -12.182 1.00 0.00 ? 98  PRO A HB3  1  
ATOM 1458  H HG2  . PRO A 1 98  ? -9.448  -9.264  -9.642  1.00 0.00 ? 98  PRO A HG2  1  
ATOM 1459  H HG3  . PRO A 1 98  ? -10.690 -10.164 -10.489 1.00 0.00 ? 98  PRO A HG3  1  
ATOM 1460  H HD2  . PRO A 1 98  ? -9.255  -11.003 -8.151  1.00 0.00 ? 98  PRO A HD2  1  
ATOM 1461  H HD3  . PRO A 1 98  ? -10.414 -11.948 -9.065  1.00 0.00 ? 98  PRO A HD3  1  
ATOM 1462  N N    . SER A 1 99  ? -5.344  -11.474 -11.064 1.00 0.00 ? 99  SER A N    1  
ATOM 1463  C CA   . SER A 1 99  ? -3.989  -11.039 -10.773 1.00 0.00 ? 99  SER A CA   1  
ATOM 1464  C C    . SER A 1 99  ? -3.096  -11.254 -11.997 1.00 0.00 ? 99  SER A C    1  
ATOM 1465  O O    . SER A 1 99  ? -2.359  -10.354 -12.398 1.00 0.00 ? 99  SER A O    1  
ATOM 1466  C CB   . SER A 1 99  ? -3.419  -11.783 -9.564  1.00 0.00 ? 99  SER A CB   1  
ATOM 1467  O OG   . SER A 1 99  ? -2.216  -11.186 -9.087  1.00 0.00 ? 99  SER A OG   1  
ATOM 1468  H H    . SER A 1 99  ? -5.421  -12.165 -11.783 1.00 0.00 ? 99  SER A H    1  
ATOM 1469  H HA   . SER A 1 99  ? -4.070  -9.977  -10.540 1.00 0.00 ? 99  SER A HA   1  
ATOM 1470  H HB2  . SER A 1 99  ? -4.159  -11.795 -8.764  1.00 0.00 ? 99  SER A HB2  1  
ATOM 1471  H HB3  . SER A 1 99  ? -3.226  -12.821 -9.835  1.00 0.00 ? 99  SER A HB3  1  
ATOM 1472  H HG   . SER A 1 99  ? -2.212  -11.176 -8.088  1.00 0.00 ? 99  SER A HG   1  
ATOM 1473  N N    . SER A 1 100 ? -3.192  -12.451 -12.557 1.00 0.00 ? 100 SER A N    1  
ATOM 1474  C CA   . SER A 1 100 ? -2.402  -12.795 -13.727 1.00 0.00 ? 100 SER A CA   1  
ATOM 1475  C C    . SER A 1 100 ? -3.314  -12.957 -14.945 1.00 0.00 ? 100 SER A C    1  
ATOM 1476  O O    . SER A 1 100 ? -3.104  -12.313 -15.972 1.00 0.00 ? 100 SER A O    1  
ATOM 1477  C CB   . SER A 1 100 ? -1.598  -14.075 -13.492 1.00 0.00 ? 100 SER A CB   1  
ATOM 1478  O OG   . SER A 1 100 ? -0.565  -13.888 -12.528 1.00 0.00 ? 100 SER A OG   1  
ATOM 1479  H H    . SER A 1 100 ? -3.794  -13.177 -12.225 1.00 0.00 ? 100 SER A H    1  
ATOM 1480  H HA   . SER A 1 100 ? -1.718  -11.958 -13.870 1.00 0.00 ? 100 SER A HA   1  
ATOM 1481  H HB2  . SER A 1 100 ? -2.268  -14.867 -13.156 1.00 0.00 ? 100 SER A HB2  1  
ATOM 1482  H HB3  . SER A 1 100 ? -1.160  -14.406 -14.434 1.00 0.00 ? 100 SER A HB3  1  
ATOM 1483  H HG   . SER A 1 100 ? 0.105   -14.627 -12.597 1.00 0.00 ? 100 SER A HG   1  
ATOM 1484  N N    . GLY A 1 101 ? -4.307  -13.820 -14.790 1.00 0.00 ? 101 GLY A N    1  
ATOM 1485  C CA   . GLY A 1 101 ? -5.252  -14.074 -15.864 1.00 0.00 ? 101 GLY A CA   1  
ATOM 1486  C C    . GLY A 1 101 ? -4.892  -15.355 -16.619 1.00 0.00 ? 101 GLY A C    1  
ATOM 1487  O O    . GLY A 1 101 ? -5.766  -16.164 -16.928 1.00 0.00 ? 101 GLY A O    1  
ATOM 1488  H H    . GLY A 1 101 ? -4.471  -14.339 -13.951 1.00 0.00 ? 101 GLY A H    1  
ATOM 1489  H HA2  . GLY A 1 101 ? -6.259  -14.159 -15.455 1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1490  H HA3  . GLY A 1 101 ? -5.259  -13.231 -16.554 1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1491  N N    . GLY A 1 1   ? 23.627  -11.165 -17.214 1.00 0.00 ? 1   GLY A N    2  
ATOM 1492  C CA   . GLY A 1 1   ? 22.863  -9.934  -17.103 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1493  C C    . GLY A 1 1   ? 22.632  -9.563  -15.637 1.00 0.00 ? 1   GLY A C    2  
ATOM 1494  O O    . GLY A 1 1   ? 23.441  -9.898  -14.773 1.00 0.00 ? 1   GLY A O    2  
ATOM 1495  H H1   . GLY A 1 1   ? 23.197  -11.968 -16.802 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1496  H HA2  . GLY A 1 1   ? 23.393  -9.126  -17.607 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1497  H HA3  . GLY A 1 1   ? 21.904  -10.050 -17.607 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1498  N N    . SER A 1 2   ? 21.524  -8.876  -15.400 1.00 0.00 ? 2   SER A N    2  
ATOM 1499  C CA   . SER A 1 2   ? 21.177  -8.455  -14.054 1.00 0.00 ? 2   SER A CA   2  
ATOM 1500  C C    . SER A 1 2   ? 19.671  -8.607  -13.830 1.00 0.00 ? 2   SER A C    2  
ATOM 1501  O O    . SER A 1 2   ? 18.869  -8.061  -14.587 1.00 0.00 ? 2   SER A O    2  
ATOM 1502  C CB   . SER A 1 2   ? 21.608  -7.010  -13.799 1.00 0.00 ? 2   SER A CB   2  
ATOM 1503  O OG   . SER A 1 2   ? 22.731  -6.933  -12.925 1.00 0.00 ? 2   SER A OG   2  
ATOM 1504  H H    . SER A 1 2   ? 20.871  -8.607  -16.109 1.00 0.00 ? 2   SER A H    2  
ATOM 1505  H HA   . SER A 1 2   ? 21.731  -9.121  -13.392 1.00 0.00 ? 2   SER A HA   2  
ATOM 1506  H HB2  . SER A 1 2   ? 21.855  -6.533  -14.748 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1507  H HB3  . SER A 1 2   ? 20.776  -6.453  -13.370 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1508  H HG   . SER A 1 2   ? 22.741  -6.050  -12.457 1.00 0.00 ? 2   SER A HG   2  
ATOM 1509  N N    . SER A 1 3   ? 19.332  -9.351  -12.788 1.00 0.00 ? 3   SER A N    2  
ATOM 1510  C CA   . SER A 1 3   ? 17.936  -9.581  -12.455 1.00 0.00 ? 3   SER A CA   2  
ATOM 1511  C C    . SER A 1 3   ? 17.800  -9.909  -10.967 1.00 0.00 ? 3   SER A C    2  
ATOM 1512  O O    . SER A 1 3   ? 18.724  -10.449 -10.360 1.00 0.00 ? 3   SER A O    2  
ATOM 1513  C CB   . SER A 1 3   ? 17.347  -10.709 -13.304 1.00 0.00 ? 3   SER A CB   2  
ATOM 1514  O OG   . SER A 1 3   ? 16.062  -10.373 -13.821 1.00 0.00 ? 3   SER A OG   2  
ATOM 1515  H H    . SER A 1 3   ? 19.990  -9.791  -12.177 1.00 0.00 ? 3   SER A H    2  
ATOM 1516  H HA   . SER A 1 3   ? 17.426  -8.647  -12.689 1.00 0.00 ? 3   SER A HA   2  
ATOM 1517  H HB2  . SER A 1 3   ? 18.023  -10.934 -14.129 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1518  H HB3  . SER A 1 3   ? 17.269  -11.614 -12.701 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1519  H HG   . SER A 1 3   ? 15.930  -10.803 -14.715 1.00 0.00 ? 3   SER A HG   2  
ATOM 1520  N N    . GLY A 1 4   ? 16.641  -9.570  -10.422 1.00 0.00 ? 4   GLY A N    2  
ATOM 1521  C CA   . GLY A 1 4   ? 16.372  -9.823  -9.017  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1522  C C    . GLY A 1 4   ? 15.022  -10.520 -8.833  1.00 0.00 ? 4   GLY A C    2  
ATOM 1523  O O    . GLY A 1 4   ? 14.276  -10.698 -9.794  1.00 0.00 ? 4   GLY A O    2  
ATOM 1524  H H    . GLY A 1 4   ? 15.895  -9.132  -10.923 1.00 0.00 ? 4   GLY A H    2  
ATOM 1525  H HA2  . GLY A 1 4   ? 17.165  -10.441 -8.597  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1526  H HA3  . GLY A 1 4   ? 16.377  -8.881  -8.467  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1527  N N    . SER A 1 5   ? 14.750  -10.894 -7.592  1.00 0.00 ? 5   SER A N    2  
ATOM 1528  C CA   . SER A 1 5   ? 13.503  -11.567 -7.269  1.00 0.00 ? 5   SER A CA   2  
ATOM 1529  C C    . SER A 1 5   ? 13.129  -11.305 -5.809  1.00 0.00 ? 5   SER A C    2  
ATOM 1530  O O    . SER A 1 5   ? 13.945  -11.503 -4.911  1.00 0.00 ? 5   SER A O    2  
ATOM 1531  C CB   . SER A 1 5   ? 13.607  -13.072 -7.529  1.00 0.00 ? 5   SER A CB   2  
ATOM 1532  O OG   . SER A 1 5   ? 12.332  -13.707 -7.504  1.00 0.00 ? 5   SER A OG   2  
ATOM 1533  H H    . SER A 1 5   ? 15.363  -10.745 -6.815  1.00 0.00 ? 5   SER A H    2  
ATOM 1534  H HA   . SER A 1 5   ? 12.760  -11.134 -7.939  1.00 0.00 ? 5   SER A HA   2  
ATOM 1535  H HB2  . SER A 1 5   ? 14.077  -13.241 -8.498  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1536  H HB3  . SER A 1 5   ? 14.253  -13.526 -6.777  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1537  H HG   . SER A 1 5   ? 11.676  -13.179 -8.044  1.00 0.00 ? 5   SER A HG   2  
ATOM 1538  N N    . SER A 1 6   ? 11.894  -10.864 -5.618  1.00 0.00 ? 6   SER A N    2  
ATOM 1539  C CA   . SER A 1 6   ? 11.402  -10.573 -4.283  1.00 0.00 ? 6   SER A CA   2  
ATOM 1540  C C    . SER A 1 6   ? 9.874   -10.501 -4.292  1.00 0.00 ? 6   SER A C    2  
ATOM 1541  O O    . SER A 1 6   ? 9.205   -11.368 -3.733  1.00 0.00 ? 6   SER A O    2  
ATOM 1542  C CB   . SER A 1 6   ? 11.991  -9.264  -3.752  1.00 0.00 ? 6   SER A CB   2  
ATOM 1543  O OG   . SER A 1 6   ? 12.348  -9.359  -2.375  1.00 0.00 ? 6   SER A OG   2  
ATOM 1544  H H    . SER A 1 6   ? 11.237  -10.706 -6.355  1.00 0.00 ? 6   SER A H    2  
ATOM 1545  H HA   . SER A 1 6   ? 11.742  -11.402 -3.663  1.00 0.00 ? 6   SER A HA   2  
ATOM 1546  H HB2  . SER A 1 6   ? 12.872  -8.999  -4.337  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1547  H HB3  . SER A 1 6   ? 11.267  -8.460  -3.884  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1548  H HG   . SER A 1 6   ? 11.781  -8.741  -1.832  1.00 0.00 ? 6   SER A HG   2  
ATOM 1549  N N    . GLY A 1 7   ? 9.366   -9.459  -4.935  1.00 0.00 ? 7   GLY A N    2  
ATOM 1550  C CA   . GLY A 1 7   ? 7.929   -9.263  -5.024  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1551  C C    . GLY A 1 7   ? 7.558   -8.505  -6.300  1.00 0.00 ? 7   GLY A C    2  
ATOM 1552  O O    . GLY A 1 7   ? 7.973   -8.883  -7.395  1.00 0.00 ? 7   GLY A O    2  
ATOM 1553  H H    . GLY A 1 7   ? 9.917   -8.758  -5.387  1.00 0.00 ? 7   GLY A H    2  
ATOM 1554  H HA2  . GLY A 1 7   ? 7.425   -10.230 -5.012  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1555  H HA3  . GLY A 1 7   ? 7.579   -8.710  -4.153  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1556  N N    . GLU A 1 8   ? 6.780   -7.448  -6.117  1.00 0.00 ? 8   GLU A N    2  
ATOM 1557  C CA   . GLU A 1 8   ? 6.348   -6.633  -7.240  1.00 0.00 ? 8   GLU A CA   2  
ATOM 1558  C C    . GLU A 1 8   ? 5.912   -5.249  -6.755  1.00 0.00 ? 8   GLU A C    2  
ATOM 1559  O O    . GLU A 1 8   ? 4.845   -5.103  -6.162  1.00 0.00 ? 8   GLU A O    2  
ATOM 1560  C CB   . GLU A 1 8   ? 5.223   -7.321  -8.016  1.00 0.00 ? 8   GLU A CB   2  
ATOM 1561  C CG   . GLU A 1 8   ? 5.695   -7.740  -9.410  1.00 0.00 ? 8   GLU A CG   2  
ATOM 1562  C CD   . GLU A 1 8   ? 4.901   -8.945  -9.918  1.00 0.00 ? 8   GLU A CD   2  
ATOM 1563  O OE1  . GLU A 1 8   ? 3.815   -8.709  -10.490 1.00 0.00 ? 8   GLU A OE1  2  
ATOM 1564  O OE2  . GLU A 1 8   ? 5.398   -10.075 -9.724  1.00 0.00 ? 8   GLU A OE2  2  
ATOM 1565  H H    . GLU A 1 8   ? 6.446   -7.148  -5.224  1.00 0.00 ? 8   GLU A H    2  
ATOM 1566  H HA   . GLU A 1 8   ? 7.222   -6.542  -7.884  1.00 0.00 ? 8   GLU A HA   2  
ATOM 1567  H HB2  . GLU A 1 8   ? 4.879   -8.197  -7.466  1.00 0.00 ? 8   GLU A HB2  2  
ATOM 1568  H HB3  . GLU A 1 8   ? 4.371   -6.646  -8.104  1.00 0.00 ? 8   GLU A HB3  2  
ATOM 1569  H HG2  . GLU A 1 8   ? 5.580   -6.906  -10.102 1.00 0.00 ? 8   GLU A HG2  2  
ATOM 1570  H HG3  . GLU A 1 8   ? 6.756   -7.986  -9.379  1.00 0.00 ? 8   GLU A HG3  2  
ATOM 1571  N N    . VAL A 1 9   ? 6.761   -4.269  -7.025  1.00 0.00 ? 9   VAL A N    2  
ATOM 1572  C CA   . VAL A 1 9   ? 6.478   -2.901  -6.623  1.00 0.00 ? 9   VAL A CA   2  
ATOM 1573  C C    . VAL A 1 9   ? 5.394   -2.321  -7.534  1.00 0.00 ? 9   VAL A C    2  
ATOM 1574  O O    . VAL A 1 9   ? 5.540   -2.319  -8.755  1.00 0.00 ? 9   VAL A O    2  
ATOM 1575  C CB   . VAL A 1 9   ? 7.767   -2.076  -6.628  1.00 0.00 ? 9   VAL A CB   2  
ATOM 1576  C CG1  . VAL A 1 9   ? 7.460   -0.580  -6.551  1.00 0.00 ? 9   VAL A CG1  2  
ATOM 1577  C CG2  . VAL A 1 9   ? 8.695   -2.505  -5.490  1.00 0.00 ? 9   VAL A CG2  2  
ATOM 1578  H H    . VAL A 1 9   ? 7.628   -4.396  -7.507  1.00 0.00 ? 9   VAL A H    2  
ATOM 1579  H HA   . VAL A 1 9   ? 6.099   -2.930  -5.601  1.00 0.00 ? 9   VAL A HA   2  
ATOM 1580  H HB   . VAL A 1 9   ? 8.282   -2.265  -7.569  1.00 0.00 ? 9   VAL A HB   2  
ATOM 1581  H HG11 . VAL A 1 9   ? 6.856   -0.288  -7.410  1.00 0.00 ? 9   VAL A HG11 2  
ATOM 1582  H HG12 . VAL A 1 9   ? 6.911   -0.368  -5.633  1.00 0.00 ? 9   VAL A HG12 2  
ATOM 1583  H HG13 . VAL A 1 9   ? 8.393   -0.017  -6.555  1.00 0.00 ? 9   VAL A HG13 2  
ATOM 1584  H HG21 . VAL A 1 9   ? 9.600   -1.897  -5.511  1.00 0.00 ? 9   VAL A HG21 2  
ATOM 1585  H HG22 . VAL A 1 9   ? 8.188   -2.367  -4.535  1.00 0.00 ? 9   VAL A HG22 2  
ATOM 1586  H HG23 . VAL A 1 9   ? 8.960   -3.555  -5.612  1.00 0.00 ? 9   VAL A HG23 2  
ATOM 1587  N N    . ARG A 1 10  ? 4.330   -1.844  -6.904  1.00 0.00 ? 10  ARG A N    2  
ATOM 1588  C CA   . ARG A 1 10  ? 3.222   -1.262  -7.642  1.00 0.00 ? 10  ARG A CA   2  
ATOM 1589  C C    . ARG A 1 10  ? 3.375   0.258   -7.720  1.00 0.00 ? 10  ARG A C    2  
ATOM 1590  O O    . ARG A 1 10  ? 4.163   0.844   -6.979  1.00 0.00 ? 10  ARG A O    2  
ATOM 1591  C CB   . ARG A 1 10  ? 1.883   -1.601  -6.983  1.00 0.00 ? 10  ARG A CB   2  
ATOM 1592  C CG   . ARG A 1 10  ? 1.859   -1.141  -5.524  1.00 0.00 ? 10  ARG A CG   2  
ATOM 1593  C CD   . ARG A 1 10  ? 1.619   -2.322  -4.581  1.00 0.00 ? 10  ARG A CD   2  
ATOM 1594  N NE   . ARG A 1 10  ? 0.215   -2.320  -4.114  1.00 0.00 ? 10  ARG A NE   2  
ATOM 1595  C CZ   . ARG A 1 10  ? -0.776  -2.999  -4.708  1.00 0.00 ? 10  ARG A CZ   2  
ATOM 1596  N NH1  . ARG A 1 10  ? -0.522  -3.740  -5.795  1.00 0.00 ? 10  ARG A NH1  2  
ATOM 1597  N NH2  . ARG A 1 10  ? -2.020  -2.938  -4.214  1.00 0.00 ? 10  ARG A NH2  2  
ATOM 1598  H H    . ARG A 1 10  ? 4.219   -1.850  -5.910  1.00 0.00 ? 10  ARG A H    2  
ATOM 1599  H HA   . ARG A 1 10  ? 3.280   -1.713  -8.633  1.00 0.00 ? 10  ARG A HA   2  
ATOM 1600  H HB2  . ARG A 1 10  ? 1.072   -1.122  -7.532  1.00 0.00 ? 10  ARG A HB2  2  
ATOM 1601  H HB3  . ARG A 1 10  ? 1.711   -2.676  -7.033  1.00 0.00 ? 10  ARG A HB3  2  
ATOM 1602  H HG2  . ARG A 1 10  ? 2.804   -0.659  -5.275  1.00 0.00 ? 10  ARG A HG2  2  
ATOM 1603  H HG3  . ARG A 1 10  ? 1.075   -0.396  -5.386  1.00 0.00 ? 10  ARG A HG3  2  
ATOM 1604  H HD2  . ARG A 1 10  ? 1.839   -3.258  -5.095  1.00 0.00 ? 10  ARG A HD2  2  
ATOM 1605  H HD3  . ARG A 1 10  ? 2.295   -2.261  -3.728  1.00 0.00 ? 10  ARG A HD3  2  
ATOM 1606  H HE   . ARG A 1 10  ? -0.009  -1.777  -3.304  1.00 0.00 ? 10  ARG A HE   2  
ATOM 1607  H HH11 . ARG A 1 10  ? 0.406   -3.785  -6.164  1.00 0.00 ? 10  ARG A HH11 2  
ATOM 1608  H HH12 . ARG A 1 10  ? -1.262  -4.247  -6.238  1.00 0.00 ? 10  ARG A HH12 2  
ATOM 1609  H HH21 . ARG A 1 10  ? -2.209  -2.385  -3.402  1.00 0.00 ? 10  ARG A HH21 2  
ATOM 1610  H HH22 . ARG A 1 10  ? -2.759  -3.445  -4.657  1.00 0.00 ? 10  ARG A HH22 2  
ATOM 1611  N N    . LEU A 1 11  ? 2.609   0.853   -8.622  1.00 0.00 ? 11  LEU A N    2  
ATOM 1612  C CA   . LEU A 1 11  ? 2.649   2.294   -8.806  1.00 0.00 ? 11  LEU A CA   2  
ATOM 1613  C C    . LEU A 1 11  ? 1.257   2.875   -8.552  1.00 0.00 ? 11  LEU A C    2  
ATOM 1614  O O    . LEU A 1 11  ? 0.368   2.756   -9.394  1.00 0.00 ? 11  LEU A O    2  
ATOM 1615  C CB   . LEU A 1 11  ? 3.221   2.643   -10.182 1.00 0.00 ? 11  LEU A CB   2  
ATOM 1616  C CG   . LEU A 1 11  ? 4.687   2.273   -10.412 1.00 0.00 ? 11  LEU A CG   2  
ATOM 1617  C CD1  . LEU A 1 11  ? 5.137   2.668   -11.820 1.00 0.00 ? 11  LEU A CD1  2  
ATOM 1618  C CD2  . LEU A 1 11  ? 5.583   2.883   -9.332  1.00 0.00 ? 11  LEU A CD2  2  
ATOM 1619  H H    . LEU A 1 11  ? 1.971   0.368   -9.220  1.00 0.00 ? 11  LEU A H    2  
ATOM 1620  H HA   . LEU A 1 11  ? 3.334   2.699   -8.060  1.00 0.00 ? 11  LEU A HA   2  
ATOM 1621  H HB2  . LEU A 1 11  ? 2.617   2.144   -10.940 1.00 0.00 ? 11  LEU A HB2  2  
ATOM 1622  H HB3  . LEU A 1 11  ? 3.108   3.715   -10.338 1.00 0.00 ? 11  LEU A HB3  2  
ATOM 1623  H HG   . LEU A 1 11  ? 4.783   1.190   -10.336 1.00 0.00 ? 11  LEU A HG   2  
ATOM 1624  H HD11 . LEU A 1 11  ? 4.262   2.871   -12.438 1.00 0.00 ? 11  LEU A HD11 2  
ATOM 1625  H HD12 . LEU A 1 11  ? 5.758   3.562   -11.766 1.00 0.00 ? 11  LEU A HD12 2  
ATOM 1626  H HD13 . LEU A 1 11  ? 5.712   1.853   -12.260 1.00 0.00 ? 11  LEU A HD13 2  
ATOM 1627  H HD21 . LEU A 1 11  ? 5.016   3.621   -8.764  1.00 0.00 ? 11  LEU A HD21 2  
ATOM 1628  H HD22 . LEU A 1 11  ? 5.930   2.097   -8.661  1.00 0.00 ? 11  LEU A HD22 2  
ATOM 1629  H HD23 . LEU A 1 11  ? 6.440   3.366   -9.801  1.00 0.00 ? 11  LEU A HD23 2  
ATOM 1630  N N    . VAL A 1 12  ? 1.111   3.491   -7.389  1.00 0.00 ? 12  VAL A N    2  
ATOM 1631  C CA   . VAL A 1 12  ? -0.158  4.092   -7.014  1.00 0.00 ? 12  VAL A CA   2  
ATOM 1632  C C    . VAL A 1 12  ? -0.146  5.575   -7.388  1.00 0.00 ? 12  VAL A C    2  
ATOM 1633  O O    . VAL A 1 12  ? 0.893   6.229   -7.312  1.00 0.00 ? 12  VAL A O    2  
ATOM 1634  C CB   . VAL A 1 12  ? -0.432  3.852   -5.528  1.00 0.00 ? 12  VAL A CB   2  
ATOM 1635  C CG1  . VAL A 1 12  ? -1.673  4.619   -5.068  1.00 0.00 ? 12  VAL A CG1  2  
ATOM 1636  C CG2  . VAL A 1 12  ? -0.569  2.357   -5.230  1.00 0.00 ? 12  VAL A CG2  2  
ATOM 1637  H H    . VAL A 1 12  ? 1.839   3.584   -6.709  1.00 0.00 ? 12  VAL A H    2  
ATOM 1638  H HA   . VAL A 1 12  ? -0.940  3.592   -7.586  1.00 0.00 ? 12  VAL A HA   2  
ATOM 1639  H HB   . VAL A 1 12  ? 0.422   4.228   -4.965  1.00 0.00 ? 12  VAL A HB   2  
ATOM 1640  H HG11 . VAL A 1 12  ? -1.373  5.438   -4.414  1.00 0.00 ? 12  VAL A HG11 2  
ATOM 1641  H HG12 . VAL A 1 12  ? -2.195  5.020   -5.937  1.00 0.00 ? 12  VAL A HG12 2  
ATOM 1642  H HG13 . VAL A 1 12  ? -2.336  3.945   -4.525  1.00 0.00 ? 12  VAL A HG13 2  
ATOM 1643  H HG21 . VAL A 1 12  ? 0.353   1.991   -4.779  1.00 0.00 ? 12  VAL A HG21 2  
ATOM 1644  H HG22 . VAL A 1 12  ? -1.398  2.199   -4.540  1.00 0.00 ? 12  VAL A HG22 2  
ATOM 1645  H HG23 . VAL A 1 12  ? -0.760  1.818   -6.157  1.00 0.00 ? 12  VAL A HG23 2  
ATOM 1646  N N    . SER A 1 13  ? -1.313  6.063   -7.783  1.00 0.00 ? 13  SER A N    2  
ATOM 1647  C CA   . SER A 1 13  ? -1.449  7.457   -8.169  1.00 0.00 ? 13  SER A CA   2  
ATOM 1648  C C    . SER A 1 13  ? -2.609  8.100   -7.405  1.00 0.00 ? 13  SER A C    2  
ATOM 1649  O O    . SER A 1 13  ? -3.710  7.554   -7.366  1.00 0.00 ? 13  SER A O    2  
ATOM 1650  C CB   . SER A 1 13  ? -1.667  7.592   -9.677  1.00 0.00 ? 13  SER A CB   2  
ATOM 1651  O OG   . SER A 1 13  ? -1.553  8.944   -10.114 1.00 0.00 ? 13  SER A OG   2  
ATOM 1652  H H    . SER A 1 13  ? -2.153  5.524   -7.842  1.00 0.00 ? 13  SER A H    2  
ATOM 1653  H HA   . SER A 1 13  ? -0.504  7.926   -7.895  1.00 0.00 ? 13  SER A HA   2  
ATOM 1654  H HB2  . SER A 1 13  ? -0.938  6.978   -10.205 1.00 0.00 ? 13  SER A HB2  2  
ATOM 1655  H HB3  . SER A 1 13  ? -2.654  7.210   -9.936  1.00 0.00 ? 13  SER A HB3  2  
ATOM 1656  H HG   . SER A 1 13  ? -2.043  9.549   -9.486  1.00 0.00 ? 13  SER A HG   2  
ATOM 1657  N N    . LEU A 1 14  ? -2.321  9.252   -6.816  1.00 0.00 ? 14  LEU A N    2  
ATOM 1658  C CA   . LEU A 1 14  ? -3.326  9.975   -6.056  1.00 0.00 ? 14  LEU A CA   2  
ATOM 1659  C C    . LEU A 1 14  ? -3.422  11.409  -6.581  1.00 0.00 ? 14  LEU A C    2  
ATOM 1660  O O    . LEU A 1 14  ? -2.500  11.900  -7.229  1.00 0.00 ? 14  LEU A O    2  
ATOM 1661  C CB   . LEU A 1 14  ? -3.030  9.887   -4.557  1.00 0.00 ? 14  LEU A CB   2  
ATOM 1662  C CG   . LEU A 1 14  ? -3.608  8.673   -3.829  1.00 0.00 ? 14  LEU A CG   2  
ATOM 1663  C CD1  . LEU A 1 14  ? -5.093  8.494   -4.154  1.00 0.00 ? 14  LEU A CD1  2  
ATOM 1664  C CD2  . LEU A 1 14  ? -2.799  7.411   -4.137  1.00 0.00 ? 14  LEU A CD2  2  
ATOM 1665  H H    . LEU A 1 14  ? -1.422  9.689   -6.852  1.00 0.00 ? 14  LEU A H    2  
ATOM 1666  H HA   . LEU A 1 14  ? -4.282  9.480   -6.225  1.00 0.00 ? 14  LEU A HA   2  
ATOM 1667  H HB2  . LEU A 1 14  ? -1.948  9.887   -4.420  1.00 0.00 ? 14  LEU A HB2  2  
ATOM 1668  H HB3  . LEU A 1 14  ? -3.411  10.789  -4.078  1.00 0.00 ? 14  LEU A HB3  2  
ATOM 1669  H HG   . LEU A 1 14  ? -3.533  8.850   -2.756  1.00 0.00 ? 14  LEU A HG   2  
ATOM 1670  H HD11 . LEU A 1 14  ? -5.541  9.468   -4.351  1.00 0.00 ? 14  LEU A HD11 2  
ATOM 1671  H HD12 . LEU A 1 14  ? -5.198  7.860   -5.034  1.00 0.00 ? 14  LEU A HD12 2  
ATOM 1672  H HD13 . LEU A 1 14  ? -5.597  8.028   -3.307  1.00 0.00 ? 14  LEU A HD13 2  
ATOM 1673  H HD21 . LEU A 1 14  ? -3.169  6.585   -3.531  1.00 0.00 ? 14  LEU A HD21 2  
ATOM 1674  H HD22 . LEU A 1 14  ? -2.902  7.163   -5.193  1.00 0.00 ? 14  LEU A HD22 2  
ATOM 1675  H HD23 . LEU A 1 14  ? -1.748  7.589   -3.907  1.00 0.00 ? 14  LEU A HD23 2  
ATOM 1676  N N    . ARG A 1 15  ? -4.548  12.040  -6.281  1.00 0.00 ? 15  ARG A N    2  
ATOM 1677  C CA   . ARG A 1 15  ? -4.777  13.408  -6.715  1.00 0.00 ? 15  ARG A CA   2  
ATOM 1678  C C    . ARG A 1 15  ? -4.360  14.389  -5.618  1.00 0.00 ? 15  ARG A C    2  
ATOM 1679  O O    . ARG A 1 15  ? -4.111  13.988  -4.482  1.00 0.00 ? 15  ARG A O    2  
ATOM 1680  C CB   . ARG A 1 15  ? -6.250  13.636  -7.061  1.00 0.00 ? 15  ARG A CB   2  
ATOM 1681  C CG   . ARG A 1 15  ? -6.427  13.893  -8.559  1.00 0.00 ? 15  ARG A CG   2  
ATOM 1682  C CD   . ARG A 1 15  ? -6.853  15.339  -8.821  1.00 0.00 ? 15  ARG A CD   2  
ATOM 1683  N NE   . ARG A 1 15  ? -8.195  15.367  -9.444  1.00 0.00 ? 15  ARG A NE   2  
ATOM 1684  C CZ   . ARG A 1 15  ? -8.450  14.964  -10.696 1.00 0.00 ? 15  ARG A CZ   2  
ATOM 1685  N NH1  . ARG A 1 15  ? -7.457  14.499  -11.466 1.00 0.00 ? 15  ARG A NH1  2  
ATOM 1686  N NH2  . ARG A 1 15  ? -9.699  15.025  -11.178 1.00 0.00 ? 15  ARG A NH2  2  
ATOM 1687  H H    . ARG A 1 15  ? -5.294  11.634  -5.753  1.00 0.00 ? 15  ARG A H    2  
ATOM 1688  H HA   . ARG A 1 15  ? -4.157  13.526  -7.604  1.00 0.00 ? 15  ARG A HA   2  
ATOM 1689  H HB2  . ARG A 1 15  ? -6.836  12.766  -6.766  1.00 0.00 ? 15  ARG A HB2  2  
ATOM 1690  H HB3  . ARG A 1 15  ? -6.633  14.486  -6.495  1.00 0.00 ? 15  ARG A HB3  2  
ATOM 1691  H HG2  . ARG A 1 15  ? -5.493  13.685  -9.081  1.00 0.00 ? 15  ARG A HG2  2  
ATOM 1692  H HG3  . ARG A 1 15  ? -7.176  13.211  -8.962  1.00 0.00 ? 15  ARG A HG3  2  
ATOM 1693  H HD2  . ARG A 1 15  ? -6.865  15.898  -7.885  1.00 0.00 ? 15  ARG A HD2  2  
ATOM 1694  H HD3  . ARG A 1 15  ? -6.129  15.827  -9.474  1.00 0.00 ? 15  ARG A HD3  2  
ATOM 1695  H HE   . ARG A 1 15  ? -8.959  15.709  -8.897  1.00 0.00 ? 15  ARG A HE   2  
ATOM 1696  H HH11 . ARG A 1 15  ? -6.525  14.454  -11.106 1.00 0.00 ? 15  ARG A HH11 2  
ATOM 1697  H HH12 . ARG A 1 15  ? -7.647  14.198  -12.401 1.00 0.00 ? 15  ARG A HH12 2  
ATOM 1698  H HH21 . ARG A 1 15  ? -10.440 15.372  -10.604 1.00 0.00 ? 15  ARG A HH21 2  
ATOM 1699  H HH22 . ARG A 1 15  ? -9.890  14.724  -12.113 1.00 0.00 ? 15  ARG A HH22 2  
ATOM 1700  N N    . ARG A 1 16  ? -4.296  15.658  -5.996  1.00 0.00 ? 16  ARG A N    2  
ATOM 1701  C CA   . ARG A 1 16  ? -3.914  16.700  -5.059  1.00 0.00 ? 16  ARG A CA   2  
ATOM 1702  C C    . ARG A 1 16  ? -5.104  17.616  -4.769  1.00 0.00 ? 16  ARG A C    2  
ATOM 1703  O O    . ARG A 1 16  ? -4.966  18.613  -4.062  1.00 0.00 ? 16  ARG A O    2  
ATOM 1704  C CB   . ARG A 1 16  ? -2.756  17.536  -5.608  1.00 0.00 ? 16  ARG A CB   2  
ATOM 1705  C CG   . ARG A 1 16  ? -3.194  18.340  -6.834  1.00 0.00 ? 16  ARG A CG   2  
ATOM 1706  C CD   . ARG A 1 16  ? -3.465  19.800  -6.464  1.00 0.00 ? 16  ARG A CD   2  
ATOM 1707  N NE   . ARG A 1 16  ? -3.027  20.690  -7.563  1.00 0.00 ? 16  ARG A NE   2  
ATOM 1708  C CZ   . ARG A 1 16  ? -1.748  21.005  -7.809  1.00 0.00 ? 16  ARG A CZ   2  
ATOM 1709  N NH1  . ARG A 1 16  ? -0.773  20.504  -7.038  1.00 0.00 ? 16  ARG A NH1  2  
ATOM 1710  N NH2  . ARG A 1 16  ? -1.443  21.820  -8.828  1.00 0.00 ? 16  ARG A NH2  2  
ATOM 1711  H H    . ARG A 1 16  ? -4.500  15.976  -6.922  1.00 0.00 ? 16  ARG A H    2  
ATOM 1712  H HA   . ARG A 1 16  ? -3.602  16.166  -4.161  1.00 0.00 ? 16  ARG A HA   2  
ATOM 1713  H HB2  . ARG A 1 16  ? -2.394  18.214  -4.834  1.00 0.00 ? 16  ARG A HB2  2  
ATOM 1714  H HB3  . ARG A 1 16  ? -1.925  16.883  -5.874  1.00 0.00 ? 16  ARG A HB3  2  
ATOM 1715  H HG2  . ARG A 1 16  ? -2.419  18.293  -7.599  1.00 0.00 ? 16  ARG A HG2  2  
ATOM 1716  H HG3  . ARG A 1 16  ? -4.093  17.897  -7.262  1.00 0.00 ? 16  ARG A HG3  2  
ATOM 1717  H HD2  . ARG A 1 16  ? -4.528  19.943  -6.271  1.00 0.00 ? 16  ARG A HD2  2  
ATOM 1718  H HD3  . ARG A 1 16  ? -2.936  20.055  -5.545  1.00 0.00 ? 16  ARG A HD3  2  
ATOM 1719  H HE   . ARG A 1 16  ? -3.729  21.081  -8.157  1.00 0.00 ? 16  ARG A HE   2  
ATOM 1720  H HH11 . ARG A 1 16  ? -1.001  19.896  -6.277  1.00 0.00 ? 16  ARG A HH11 2  
ATOM 1721  H HH12 . ARG A 1 16  ? 0.181   20.739  -7.222  1.00 0.00 ? 16  ARG A HH12 2  
ATOM 1722  H HH21 . ARG A 1 16  ? -2.171  22.194  -9.404  1.00 0.00 ? 16  ARG A HH21 2  
ATOM 1723  H HH22 . ARG A 1 16  ? -0.489  22.055  -9.012  1.00 0.00 ? 16  ARG A HH22 2  
ATOM 1724  N N    . ALA A 1 17  ? -6.245  17.246  -5.330  1.00 0.00 ? 17  ALA A N    2  
ATOM 1725  C CA   . ALA A 1 17  ? -7.459  18.023  -5.141  1.00 0.00 ? 17  ALA A CA   2  
ATOM 1726  C C    . ALA A 1 17  ? -8.635  17.289  -5.789  1.00 0.00 ? 17  ALA A C    2  
ATOM 1727  O O    . ALA A 1 17  ? -8.626  17.037  -6.993  1.00 0.00 ? 17  ALA A O    2  
ATOM 1728  C CB   . ALA A 1 17  ? -7.261  19.428  -5.714  1.00 0.00 ? 17  ALA A CB   2  
ATOM 1729  H H    . ALA A 1 17  ? -6.349  16.434  -5.904  1.00 0.00 ? 17  ALA A H    2  
ATOM 1730  H HA   . ALA A 1 17  ? -7.638  18.103  -4.069  1.00 0.00 ? 17  ALA A HA   2  
ATOM 1731  H HB1  . ALA A 1 17  ? -6.333  19.850  -5.329  1.00 0.00 ? 17  ALA A HB1  2  
ATOM 1732  H HB2  . ALA A 1 17  ? -7.210  19.373  -6.802  1.00 0.00 ? 17  ALA A HB2  2  
ATOM 1733  H HB3  . ALA A 1 17  ? -8.098  20.061  -5.421  1.00 0.00 ? 17  ALA A HB3  2  
ATOM 1734  N N    . LYS A 1 18  ? -9.619  16.968  -4.962  1.00 0.00 ? 18  LYS A N    2  
ATOM 1735  C CA   . LYS A 1 18  ? -10.799 16.268  -5.440  1.00 0.00 ? 18  LYS A CA   2  
ATOM 1736  C C    . LYS A 1 18  ? -11.788 16.099  -4.285  1.00 0.00 ? 18  LYS A C    2  
ATOM 1737  O O    . LYS A 1 18  ? -12.179 14.980  -3.956  1.00 0.00 ? 18  LYS A O    2  
ATOM 1738  C CB   . LYS A 1 18  ? -10.407 14.951  -6.111  1.00 0.00 ? 18  LYS A CB   2  
ATOM 1739  C CG   . LYS A 1 18  ? -9.686  14.027  -5.126  1.00 0.00 ? 18  LYS A CG   2  
ATOM 1740  C CD   . LYS A 1 18  ? -10.383 12.668  -5.039  1.00 0.00 ? 18  LYS A CD   2  
ATOM 1741  C CE   . LYS A 1 18  ? -9.362  11.535  -4.915  1.00 0.00 ? 18  LYS A CE   2  
ATOM 1742  N NZ   . LYS A 1 18  ? -9.827  10.335  -5.646  1.00 0.00 ? 18  LYS A NZ   2  
ATOM 1743  H H    . LYS A 1 18  ? -9.618  17.177  -3.984  1.00 0.00 ? 18  LYS A H    2  
ATOM 1744  H HA   . LYS A 1 18  ? -11.263 16.893  -6.203  1.00 0.00 ? 18  LYS A HA   2  
ATOM 1745  H HB2  . LYS A 1 18  ? -11.297 14.454  -6.496  1.00 0.00 ? 18  LYS A HB2  2  
ATOM 1746  H HB3  . LYS A 1 18  ? -9.761  15.152  -6.965  1.00 0.00 ? 18  LYS A HB3  2  
ATOM 1747  H HG2  . LYS A 1 18  ? -8.652  13.890  -5.442  1.00 0.00 ? 18  LYS A HG2  2  
ATOM 1748  H HG3  . LYS A 1 18  ? -9.660  14.490  -4.140  1.00 0.00 ? 18  LYS A HG3  2  
ATOM 1749  H HD2  . LYS A 1 18  ? -11.054 12.654  -4.181  1.00 0.00 ? 18  LYS A HD2  2  
ATOM 1750  H HD3  . LYS A 1 18  ? -10.997 12.513  -5.926  1.00 0.00 ? 18  LYS A HD3  2  
ATOM 1751  H HE2  . LYS A 1 18  ? -8.400  11.860  -5.311  1.00 0.00 ? 18  LYS A HE2  2  
ATOM 1752  H HE3  . LYS A 1 18  ? -9.208  11.291  -3.864  1.00 0.00 ? 18  LYS A HE3  2  
ATOM 1753  H HZ1  . LYS A 1 18  ? -10.752 10.494  -5.992  1.00 0.00 ? 18  LYS A HZ1  2  
ATOM 1754  H HZ2  . LYS A 1 18  ? -9.212  10.153  -6.412  1.00 0.00 ? 18  LYS A HZ2  2  
ATOM 1755  H HZ3  . LYS A 1 18  ? -9.833  9.550   -5.027  1.00 0.00 ? 18  LYS A HZ3  2  
ATOM 1756  N N    . ALA A 1 19  ? -12.165 17.227  -3.700  1.00 0.00 ? 19  ALA A N    2  
ATOM 1757  C CA   . ALA A 1 19  ? -13.101 17.218  -2.589  1.00 0.00 ? 19  ALA A CA   2  
ATOM 1758  C C    . ALA A 1 19  ? -12.615 16.230  -1.526  1.00 0.00 ? 19  ALA A C    2  
ATOM 1759  O O    . ALA A 1 19  ? -13.371 15.366  -1.085  1.00 0.00 ? 19  ALA A O    2  
ATOM 1760  C CB   . ALA A 1 19  ? -14.501 16.879  -3.103  1.00 0.00 ? 19  ALA A CB   2  
ATOM 1761  H H    . ALA A 1 19  ? -11.842 18.133  -3.973  1.00 0.00 ? 19  ALA A H    2  
ATOM 1762  H HA   . ALA A 1 19  ? -13.118 18.220  -2.160  1.00 0.00 ? 19  ALA A HA   2  
ATOM 1763  H HB1  . ALA A 1 19  ? -14.979 16.175  -2.421  1.00 0.00 ? 19  ALA A HB1  2  
ATOM 1764  H HB2  . ALA A 1 19  ? -15.097 17.789  -3.162  1.00 0.00 ? 19  ALA A HB2  2  
ATOM 1765  H HB3  . ALA A 1 19  ? -14.425 16.430  -4.094  1.00 0.00 ? 19  ALA A HB3  2  
ATOM 1766  N N    . HIS A 1 20  ? -11.356 16.390  -1.147  1.00 0.00 ? 20  HIS A N    2  
ATOM 1767  C CA   . HIS A 1 20  ? -10.760 15.523  -0.145  1.00 0.00 ? 20  HIS A CA   2  
ATOM 1768  C C    . HIS A 1 20  ? -9.610  16.255  0.549   1.00 0.00 ? 20  HIS A C    2  
ATOM 1769  O O    . HIS A 1 20  ? -9.246  17.363  0.155   1.00 0.00 ? 20  HIS A O    2  
ATOM 1770  C CB   . HIS A 1 20  ? -10.328 14.193  -0.765  1.00 0.00 ? 20  HIS A CB   2  
ATOM 1771  C CG   . HIS A 1 20  ? -9.164  14.310  -1.720  1.00 0.00 ? 20  HIS A CG   2  
ATOM 1772  N ND1  . HIS A 1 20  ? -8.483  13.210  -2.210  1.00 0.00 ? 20  HIS A ND1  2  
ATOM 1773  C CD2  . HIS A 1 20  ? -8.570  15.408  -2.270  1.00 0.00 ? 20  HIS A CD2  2  
ATOM 1774  C CE1  . HIS A 1 20  ? -7.523  13.637  -3.017  1.00 0.00 ? 20  HIS A CE1  2  
ATOM 1775  N NE2  . HIS A 1 20  ? -7.578  15.000  -3.053  1.00 0.00 ? 20  HIS A NE2  2  
ATOM 1776  H H    . HIS A 1 20  ? -10.747 17.096  -1.511  1.00 0.00 ? 20  HIS A H    2  
ATOM 1777  H HA   . HIS A 1 20  ? -11.539 15.311  0.588   1.00 0.00 ? 20  HIS A HA   2  
ATOM 1778  H HB2  . HIS A 1 20  ? -10.061 13.501  0.034   1.00 0.00 ? 20  HIS A HB2  2  
ATOM 1779  H HB3  . HIS A 1 20  ? -11.176 13.758  -1.293  1.00 0.00 ? 20  HIS A HB3  2  
ATOM 1780  H HD1  . HIS A 1 20  ? -8.681  12.254  -1.992  1.00 0.00 ? 20  HIS A HD1  2  
ATOM 1781  H HD2  . HIS A 1 20  ? -8.860  16.444  -2.096  1.00 0.00 ? 20  HIS A HD2  2  
ATOM 1782  H HE1  . HIS A 1 20  ? -6.814  13.011  -3.558  1.00 0.00 ? 20  HIS A HE1  2  
ATOM 1783  N N    . GLU A 1 21  ? -9.068  15.607  1.570   1.00 0.00 ? 21  GLU A N    2  
ATOM 1784  C CA   . GLU A 1 21  ? -7.967  16.183  2.323   1.00 0.00 ? 21  GLU A CA   2  
ATOM 1785  C C    . GLU A 1 21  ? -6.688  16.174  1.483   1.00 0.00 ? 21  GLU A C    2  
ATOM 1786  O O    . GLU A 1 21  ? -6.112  17.226  1.211   1.00 0.00 ? 21  GLU A O    2  
ATOM 1787  C CB   . GLU A 1 21  ? -7.760  15.442  3.645   1.00 0.00 ? 21  GLU A CB   2  
ATOM 1788  C CG   . GLU A 1 21  ? -8.376  16.218  4.811   1.00 0.00 ? 21  GLU A CG   2  
ATOM 1789  C CD   . GLU A 1 21  ? -8.205  15.458  6.128   1.00 0.00 ? 21  GLU A CD   2  
ATOM 1790  O OE1  . GLU A 1 21  ? -7.061  15.447  6.631   1.00 0.00 ? 21  GLU A OE1  2  
ATOM 1791  O OE2  . GLU A 1 21  ? -9.221  14.905  6.601   1.00 0.00 ? 21  GLU A OE2  2  
ATOM 1792  H H    . GLU A 1 21  ? -9.370  14.707  1.884   1.00 0.00 ? 21  GLU A H    2  
ATOM 1793  H HA   . GLU A 1 21  ? -8.264  17.211  2.532   1.00 0.00 ? 21  GLU A HA   2  
ATOM 1794  H HB2  . GLU A 1 21  ? -8.209  14.451  3.585   1.00 0.00 ? 21  GLU A HB2  2  
ATOM 1795  H HB3  . GLU A 1 21  ? -6.694  15.299  3.823   1.00 0.00 ? 21  GLU A HB3  2  
ATOM 1796  H HG2  . GLU A 1 21  ? -7.907  17.199  4.889   1.00 0.00 ? 21  GLU A HG2  2  
ATOM 1797  H HG3  . GLU A 1 21  ? -9.436  16.387  4.620   1.00 0.00 ? 21  GLU A HG3  2  
ATOM 1798  N N    . GLY A 1 22  ? -6.282  14.973  1.095   1.00 0.00 ? 22  GLY A N    2  
ATOM 1799  C CA   . GLY A 1 22  ? -5.082  14.813  0.292   1.00 0.00 ? 22  GLY A CA   2  
ATOM 1800  C C    . GLY A 1 22  ? -5.135  13.518  -0.521  1.00 0.00 ? 22  GLY A C    2  
ATOM 1801  O O    . GLY A 1 22  ? -6.213  13.066  -0.905  1.00 0.00 ? 22  GLY A O    2  
ATOM 1802  H H    . GLY A 1 22  ? -6.756  14.123  1.321   1.00 0.00 ? 22  GLY A H    2  
ATOM 1803  H HA2  . GLY A 1 22  ? -4.973  15.664  -0.380  1.00 0.00 ? 22  GLY A HA2  2  
ATOM 1804  H HA3  . GLY A 1 22  ? -4.205  14.804  0.939   1.00 0.00 ? 22  GLY A HA3  2  
ATOM 1805  N N    . LEU A 1 23  ? -3.959  12.957  -0.759  1.00 0.00 ? 23  LEU A N    2  
ATOM 1806  C CA   . LEU A 1 23  ? -3.858  11.723  -1.519  1.00 0.00 ? 23  LEU A CA   2  
ATOM 1807  C C    . LEU A 1 23  ? -5.000  10.787  -1.118  1.00 0.00 ? 23  LEU A C    2  
ATOM 1808  O O    . LEU A 1 23  ? -5.582  10.113  -1.966  1.00 0.00 ? 23  LEU A O    2  
ATOM 1809  C CB   . LEU A 1 23  ? -2.468  11.104  -1.354  1.00 0.00 ? 23  LEU A CB   2  
ATOM 1810  C CG   . LEU A 1 23  ? -1.315  12.089  -1.151  1.00 0.00 ? 23  LEU A CG   2  
ATOM 1811  C CD1  . LEU A 1 23  ? 0.036   11.377  -1.242  1.00 0.00 ? 23  LEU A CD1  2  
ATOM 1812  C CD2  . LEU A 1 23  ? -1.414  13.258  -2.132  1.00 0.00 ? 23  LEU A CD2  2  
ATOM 1813  H H    . LEU A 1 23  ? -3.087  13.331  -0.443  1.00 0.00 ? 23  LEU A H    2  
ATOM 1814  H HA   . LEU A 1 23  ? -3.974  11.978  -2.573  1.00 0.00 ? 23  LEU A HA   2  
ATOM 1815  H HB2  . LEU A 1 23  ? -2.494  10.425  -0.501  1.00 0.00 ? 23  LEU A HB2  2  
ATOM 1816  H HB3  . LEU A 1 23  ? -2.254  10.500  -2.236  1.00 0.00 ? 23  LEU A HB3  2  
ATOM 1817  H HG   . LEU A 1 23  ? -1.393  12.504  -0.146  1.00 0.00 ? 23  LEU A HG   2  
ATOM 1818  H HD11 . LEU A 1 23  ? 0.174   10.986  -2.250  1.00 0.00 ? 23  LEU A HD11 2  
ATOM 1819  H HD12 . LEU A 1 23  ? 0.835   12.082  -1.014  1.00 0.00 ? 23  LEU A HD12 2  
ATOM 1820  H HD13 . LEU A 1 23  ? 0.063   10.554  -0.527  1.00 0.00 ? 23  LEU A HD13 2  
ATOM 1821  H HD21 . LEU A 1 23  ? -0.793  13.055  -3.004  1.00 0.00 ? 23  LEU A HD21 2  
ATOM 1822  H HD22 . LEU A 1 23  ? -2.450  13.383  -2.445  1.00 0.00 ? 23  LEU A HD22 2  
ATOM 1823  H HD23 . LEU A 1 23  ? -1.069  14.171  -1.645  1.00 0.00 ? 23  LEU A HD23 2  
ATOM 1824  N N    . GLY A 1 24  ? -5.286  10.776  0.176   1.00 0.00 ? 24  GLY A N    2  
ATOM 1825  C CA   . GLY A 1 24  ? -6.348  9.934   0.700   1.00 0.00 ? 24  GLY A CA   2  
ATOM 1826  C C    . GLY A 1 24  ? -5.787  8.863   1.637   1.00 0.00 ? 24  GLY A C    2  
ATOM 1827  O O    . GLY A 1 24  ? -6.538  8.059   2.187   1.00 0.00 ? 24  GLY A O    2  
ATOM 1828  H H    . GLY A 1 24  ? -4.808  11.327  0.859   1.00 0.00 ? 24  GLY A H    2  
ATOM 1829  H HA2  . GLY A 1 24  ? -7.073  10.547  1.235   1.00 0.00 ? 24  GLY A HA2  2  
ATOM 1830  H HA3  . GLY A 1 24  ? -6.880  9.458   -0.124  1.00 0.00 ? 24  GLY A HA3  2  
ATOM 1831  N N    . PHE A 1 25  ? -4.471  8.888   1.791   1.00 0.00 ? 25  PHE A N    2  
ATOM 1832  C CA   . PHE A 1 25  ? -3.800  7.929   2.653   1.00 0.00 ? 25  PHE A CA   2  
ATOM 1833  C C    . PHE A 1 25  ? -2.691  8.603   3.464   1.00 0.00 ? 25  PHE A C    2  
ATOM 1834  O O    . PHE A 1 25  ? -1.899  9.370   2.920   1.00 0.00 ? 25  PHE A O    2  
ATOM 1835  C CB   . PHE A 1 25  ? -3.178  6.869   1.743   1.00 0.00 ? 25  PHE A CB   2  
ATOM 1836  C CG   . PHE A 1 25  ? -1.933  7.346   0.993   1.00 0.00 ? 25  PHE A CG   2  
ATOM 1837  C CD1  . PHE A 1 25  ? -2.062  8.016   -0.183  1.00 0.00 ? 25  PHE A CD1  2  
ATOM 1838  C CD2  . PHE A 1 25  ? -0.696  7.099   1.502   1.00 0.00 ? 25  PHE A CD2  2  
ATOM 1839  C CE1  . PHE A 1 25  ? -0.907  8.459   -0.880  1.00 0.00 ? 25  PHE A CE1  2  
ATOM 1840  C CE2  . PHE A 1 25  ? 0.460   7.542   0.806   1.00 0.00 ? 25  PHE A CE2  2  
ATOM 1841  C CZ   . PHE A 1 25  ? 0.330   8.212   -0.370  1.00 0.00 ? 25  PHE A CZ   2  
ATOM 1842  H H    . PHE A 1 25  ? -3.867  9.545   1.341   1.00 0.00 ? 25  PHE A H    2  
ATOM 1843  H HA   . PHE A 1 25  ? -4.550  7.525   3.333   1.00 0.00 ? 25  PHE A HA   2  
ATOM 1844  H HB2  . PHE A 1 25  ? -2.916  5.997   2.343   1.00 0.00 ? 25  PHE A HB2  2  
ATOM 1845  H HB3  . PHE A 1 25  ? -3.924  6.543   1.018   1.00 0.00 ? 25  PHE A HB3  2  
ATOM 1846  H HD1  . PHE A 1 25  ? -3.054  8.214   -0.591  1.00 0.00 ? 25  PHE A HD1  2  
ATOM 1847  H HD2  . PHE A 1 25  ? -0.592  6.561   2.444   1.00 0.00 ? 25  PHE A HD2  2  
ATOM 1848  H HE1  . PHE A 1 25  ? -1.011  8.997   -1.822  1.00 0.00 ? 25  PHE A HE1  2  
ATOM 1849  H HE2  . PHE A 1 25  ? 1.451   7.344   1.214   1.00 0.00 ? 25  PHE A HE2  2  
ATOM 1850  H HZ   . PHE A 1 25  ? 1.217   8.552   -0.905  1.00 0.00 ? 25  PHE A HZ   2  
ATOM 1851  N N    . SER A 1 26  ? -2.671  8.291   4.752   1.00 0.00 ? 26  SER A N    2  
ATOM 1852  C CA   . SER A 1 26  ? -1.673  8.857   5.643   1.00 0.00 ? 26  SER A CA   2  
ATOM 1853  C C    . SER A 1 26  ? -0.443  7.948   5.695   1.00 0.00 ? 26  SER A C    2  
ATOM 1854  O O    . SER A 1 26  ? -0.565  6.727   5.613   1.00 0.00 ? 26  SER A O    2  
ATOM 1855  C CB   . SER A 1 26  ? -2.241  9.061   7.048   1.00 0.00 ? 26  SER A CB   2  
ATOM 1856  O OG   . SER A 1 26  ? -2.450  10.440  7.344   1.00 0.00 ? 26  SER A OG   2  
ATOM 1857  H H    . SER A 1 26  ? -3.320  7.666   5.186   1.00 0.00 ? 26  SER A H    2  
ATOM 1858  H HA   . SER A 1 26  ? -1.415  9.824   5.211   1.00 0.00 ? 26  SER A HA   2  
ATOM 1859  H HB2  . SER A 1 26  ? -3.185  8.524   7.139   1.00 0.00 ? 26  SER A HB2  2  
ATOM 1860  H HB3  . SER A 1 26  ? -1.559  8.632   7.782   1.00 0.00 ? 26  SER A HB3  2  
ATOM 1861  H HG   . SER A 1 26  ? -1.860  11.006  6.769   1.00 0.00 ? 26  SER A HG   2  
ATOM 1862  N N    . ILE A 1 27  ? 0.714   8.579   5.831   1.00 0.00 ? 27  ILE A N    2  
ATOM 1863  C CA   . ILE A 1 27  ? 1.965   7.842   5.895   1.00 0.00 ? 27  ILE A CA   2  
ATOM 1864  C C    . ILE A 1 27  ? 2.585   8.018   7.283   1.00 0.00 ? 27  ILE A C    2  
ATOM 1865  O O    . ILE A 1 27  ? 2.232   8.944   8.011   1.00 0.00 ? 27  ILE A O    2  
ATOM 1866  C CB   . ILE A 1 27  ? 2.891   8.258   4.751   1.00 0.00 ? 27  ILE A CB   2  
ATOM 1867  C CG1  . ILE A 1 27  ? 3.324   9.718   4.899   1.00 0.00 ? 27  ILE A CG1  2  
ATOM 1868  C CG2  . ILE A 1 27  ? 2.240   7.988   3.393   1.00 0.00 ? 27  ILE A CG2  2  
ATOM 1869  C CD1  . ILE A 1 27  ? 4.819   9.878   4.615   1.00 0.00 ? 27  ILE A CD1  2  
ATOM 1870  H H    . ILE A 1 27  ? 0.805   9.572   5.897   1.00 0.00 ? 27  ILE A H    2  
ATOM 1871  H HA   . ILE A 1 27  ? 1.731   6.787   5.753   1.00 0.00 ? 27  ILE A HA   2  
ATOM 1872  H HB   . ILE A 1 27  ? 3.793   7.648   4.802   1.00 0.00 ? 27  ILE A HB   2  
ATOM 1873  H HG12 . ILE A 1 27  ? 2.752   10.342  4.213   1.00 0.00 ? 27  ILE A HG12 2  
ATOM 1874  H HG13 . ILE A 1 27  ? 3.103   10.066  5.908   1.00 0.00 ? 27  ILE A HG13 2  
ATOM 1875  H HG21 . ILE A 1 27  ? 1.295   8.528   3.329   1.00 0.00 ? 27  ILE A HG21 2  
ATOM 1876  H HG22 . ILE A 1 27  ? 2.905   8.326   2.598   1.00 0.00 ? 27  ILE A HG22 2  
ATOM 1877  H HG23 . ILE A 1 27  ? 2.056   6.920   3.284   1.00 0.00 ? 27  ILE A HG23 2  
ATOM 1878  H HD11 . ILE A 1 27  ? 5.013   9.676   3.561   1.00 0.00 ? 27  ILE A HD11 2  
ATOM 1879  H HD12 . ILE A 1 27  ? 5.127   10.896  4.852   1.00 0.00 ? 27  ILE A HD12 2  
ATOM 1880  H HD13 . ILE A 1 27  ? 5.383   9.175   5.229   1.00 0.00 ? 27  ILE A HD13 2  
ATOM 1881  N N    . ARG A 1 28  ? 3.498   7.115   7.607   1.00 0.00 ? 28  ARG A N    2  
ATOM 1882  C CA   . ARG A 1 28  ? 4.171   7.159   8.894   1.00 0.00 ? 28  ARG A CA   2  
ATOM 1883  C C    . ARG A 1 28  ? 5.629   6.718   8.747   1.00 0.00 ? 28  ARG A C    2  
ATOM 1884  O O    . ARG A 1 28  ? 6.033   6.241   7.687   1.00 0.00 ? 28  ARG A O    2  
ATOM 1885  C CB   . ARG A 1 28  ? 3.472   6.255   9.912   1.00 0.00 ? 28  ARG A CB   2  
ATOM 1886  C CG   . ARG A 1 28  ? 3.481   4.797   9.447   1.00 0.00 ? 28  ARG A CG   2  
ATOM 1887  C CD   . ARG A 1 28  ? 3.549   3.842   10.640  1.00 0.00 ? 28  ARG A CD   2  
ATOM 1888  N NE   . ARG A 1 28  ? 4.054   2.521   10.203  1.00 0.00 ? 28  ARG A NE   2  
ATOM 1889  C CZ   . ARG A 1 28  ? 4.356   1.518   11.038  1.00 0.00 ? 28  ARG A CZ   2  
ATOM 1890  N NH1  . ARG A 1 28  ? 4.206   1.678   12.360  1.00 0.00 ? 28  ARG A NH1  2  
ATOM 1891  N NH2  . ARG A 1 28  ? 4.808   0.354   10.552  1.00 0.00 ? 28  ARG A NH2  2  
ATOM 1892  H H    . ARG A 1 28  ? 3.780   6.365   7.008   1.00 0.00 ? 28  ARG A H    2  
ATOM 1893  H HA   . ARG A 1 28  ? 4.106   8.201   9.207   1.00 0.00 ? 28  ARG A HA   2  
ATOM 1894  H HB2  . ARG A 1 28  ? 3.971   6.335   10.878  1.00 0.00 ? 28  ARG A HB2  2  
ATOM 1895  H HB3  . ARG A 1 28  ? 2.444   6.589   10.055  1.00 0.00 ? 28  ARG A HB3  2  
ATOM 1896  H HG2  . ARG A 1 28  ? 2.583   4.592   8.864   1.00 0.00 ? 28  ARG A HG2  2  
ATOM 1897  H HG3  . ARG A 1 28  ? 4.333   4.626   8.790   1.00 0.00 ? 28  ARG A HG3  2  
ATOM 1898  H HD2  . ARG A 1 28  ? 4.203   4.254   11.409  1.00 0.00 ? 28  ARG A HD2  2  
ATOM 1899  H HD3  . ARG A 1 28  ? 2.561   3.732   11.087  1.00 0.00 ? 28  ARG A HD3  2  
ATOM 1900  H HE   . ARG A 1 28  ? 4.178   2.368   9.222   1.00 0.00 ? 28  ARG A HE   2  
ATOM 1901  H HH11 . ARG A 1 28  ? 3.868   2.547   12.723  1.00 0.00 ? 28  ARG A HH11 2  
ATOM 1902  H HH12 . ARG A 1 28  ? 4.431   0.929   12.983  1.00 0.00 ? 28  ARG A HH12 2  
ATOM 1903  H HH21 . ARG A 1 28  ? 4.921   0.234   9.565   1.00 0.00 ? 28  ARG A HH21 2  
ATOM 1904  H HH22 . ARG A 1 28  ? 5.034   -0.395  11.175  1.00 0.00 ? 28  ARG A HH22 2  
ATOM 1905  N N    . GLY A 1 29  ? 6.378   6.892   9.825   1.00 0.00 ? 29  GLY A N    2  
ATOM 1906  C CA   . GLY A 1 29  ? 7.782   6.518   9.830   1.00 0.00 ? 29  GLY A CA   2  
ATOM 1907  C C    . GLY A 1 29  ? 8.678   7.754   9.929   1.00 0.00 ? 29  GLY A C    2  
ATOM 1908  O O    . GLY A 1 29  ? 8.264   8.785   10.457  1.00 0.00 ? 29  GLY A O    2  
ATOM 1909  H H    . GLY A 1 29  ? 6.042   7.281   10.683  1.00 0.00 ? 29  GLY A H    2  
ATOM 1910  H HA2  . GLY A 1 29  ? 7.982   5.851   10.668  1.00 0.00 ? 29  GLY A HA2  2  
ATOM 1911  H HA3  . GLY A 1 29  ? 8.018   5.966   8.920   1.00 0.00 ? 29  GLY A HA3  2  
ATOM 1912  N N    . GLY A 1 30  ? 9.891   7.610   9.414   1.00 0.00 ? 30  GLY A N    2  
ATOM 1913  C CA   . GLY A 1 30  ? 10.849  8.702   9.438   1.00 0.00 ? 30  GLY A CA   2  
ATOM 1914  C C    . GLY A 1 30  ? 12.238  8.203   9.844   1.00 0.00 ? 30  GLY A C    2  
ATOM 1915  O O    . GLY A 1 30  ? 12.367  7.387   10.755  1.00 0.00 ? 30  GLY A O    2  
ATOM 1916  H H    . GLY A 1 30  ? 10.220  6.768   8.986   1.00 0.00 ? 30  GLY A H    2  
ATOM 1917  H HA2  . GLY A 1 30  ? 10.899  9.168   8.455   1.00 0.00 ? 30  GLY A HA2  2  
ATOM 1918  H HA3  . GLY A 1 30  ? 10.515  9.468   10.138  1.00 0.00 ? 30  GLY A HA3  2  
ATOM 1919  N N    . SER A 1 31  ? 13.242  8.715   9.147   1.00 0.00 ? 31  SER A N    2  
ATOM 1920  C CA   . SER A 1 31  ? 14.616  8.332   9.423   1.00 0.00 ? 31  SER A CA   2  
ATOM 1921  C C    . SER A 1 31  ? 14.968  8.657   10.876  1.00 0.00 ? 31  SER A C    2  
ATOM 1922  O O    . SER A 1 31  ? 15.739  7.936   11.508  1.00 0.00 ? 31  SER A O    2  
ATOM 1923  C CB   . SER A 1 31  ? 15.585  9.037   8.472   1.00 0.00 ? 31  SER A CB   2  
ATOM 1924  O OG   . SER A 1 31  ? 16.945  8.825   8.842   1.00 0.00 ? 31  SER A OG   2  
ATOM 1925  H H    . SER A 1 31  ? 13.128  9.378   8.407   1.00 0.00 ? 31  SER A H    2  
ATOM 1926  H HA   . SER A 1 31  ? 14.656  7.257   9.251   1.00 0.00 ? 31  SER A HA   2  
ATOM 1927  H HB2  . SER A 1 31  ? 15.425  8.674   7.457   1.00 0.00 ? 31  SER A HB2  2  
ATOM 1928  H HB3  . SER A 1 31  ? 15.374  10.106  8.465   1.00 0.00 ? 31  SER A HB3  2  
ATOM 1929  H HG   . SER A 1 31  ? 17.507  8.703   8.024   1.00 0.00 ? 31  SER A HG   2  
ATOM 1930  N N    . GLU A 1 32  ? 14.386  9.742   11.364  1.00 0.00 ? 32  GLU A N    2  
ATOM 1931  C CA   . GLU A 1 32  ? 14.628  10.171  12.731  1.00 0.00 ? 32  GLU A CA   2  
ATOM 1932  C C    . GLU A 1 32  ? 14.301  9.040   13.708  1.00 0.00 ? 32  GLU A C    2  
ATOM 1933  O O    . GLU A 1 32  ? 14.975  8.879   14.724  1.00 0.00 ? 32  GLU A O    2  
ATOM 1934  C CB   . GLU A 1 32  ? 13.824  11.431  13.061  1.00 0.00 ? 32  GLU A CB   2  
ATOM 1935  C CG   . GLU A 1 32  ? 14.161  11.944  14.463  1.00 0.00 ? 32  GLU A CG   2  
ATOM 1936  C CD   . GLU A 1 32  ? 14.095  13.472  14.518  1.00 0.00 ? 32  GLU A CD   2  
ATOM 1937  O OE1  . GLU A 1 32  ? 12.988  13.982  14.795  1.00 0.00 ? 32  GLU A OE1  2  
ATOM 1938  O OE2  . GLU A 1 32  ? 15.153  14.094  14.282  1.00 0.00 ? 32  GLU A OE2  2  
ATOM 1939  H H    . GLU A 1 32  ? 13.760  10.323  10.844  1.00 0.00 ? 32  GLU A H    2  
ATOM 1940  H HA   . GLU A 1 32  ? 15.692  10.404  12.777  1.00 0.00 ? 32  GLU A HA   2  
ATOM 1941  H HB2  . GLU A 1 32  ? 14.038  12.206  12.325  1.00 0.00 ? 32  GLU A HB2  2  
ATOM 1942  H HB3  . GLU A 1 32  ? 12.758  11.214  12.996  1.00 0.00 ? 32  GLU A HB3  2  
ATOM 1943  H HG2  . GLU A 1 32  ? 13.464  11.520  15.186  1.00 0.00 ? 32  GLU A HG2  2  
ATOM 1944  H HG3  . GLU A 1 32  ? 15.159  11.609  14.747  1.00 0.00 ? 32  GLU A HG3  2  
ATOM 1945  N N    . HIS A 1 33  ? 13.267  8.286   13.366  1.00 0.00 ? 33  HIS A N    2  
ATOM 1946  C CA   . HIS A 1 33  ? 12.842  7.175   14.200  1.00 0.00 ? 33  HIS A CA   2  
ATOM 1947  C C    . HIS A 1 33  ? 13.729  5.959   13.925  1.00 0.00 ? 33  HIS A C    2  
ATOM 1948  O O    . HIS A 1 33  ? 13.903  5.104   14.793  1.00 0.00 ? 33  HIS A O    2  
ATOM 1949  C CB   . HIS A 1 33  ? 11.355  6.881   13.999  1.00 0.00 ? 33  HIS A CB   2  
ATOM 1950  C CG   . HIS A 1 33  ? 10.454  7.552   15.008  1.00 0.00 ? 33  HIS A CG   2  
ATOM 1951  N ND1  . HIS A 1 33  ? 9.108   7.780   14.777  1.00 0.00 ? 33  HIS A ND1  2  
ATOM 1952  C CD2  . HIS A 1 33  ? 10.719  8.040   16.254  1.00 0.00 ? 33  HIS A CD2  2  
ATOM 1953  C CE1  . HIS A 1 33  ? 8.597   8.380   15.842  1.00 0.00 ? 33  HIS A CE1  2  
ATOM 1954  N NE2  . HIS A 1 33  ? 9.597   8.541   16.756  1.00 0.00 ? 33  HIS A NE2  2  
ATOM 1955  H H    . HIS A 1 33  ? 12.724  8.424   12.537  1.00 0.00 ? 33  HIS A H    2  
ATOM 1956  H HA   . HIS A 1 33  ? 12.982  7.489   15.235  1.00 0.00 ? 33  HIS A HA   2  
ATOM 1957  H HB2  . HIS A 1 33  ? 11.064  7.202   12.998  1.00 0.00 ? 33  HIS A HB2  2  
ATOM 1958  H HB3  . HIS A 1 33  ? 11.198  5.804   14.046  1.00 0.00 ? 33  HIS A HB3  2  
ATOM 1959  H HD1  . HIS A 1 33  ? 8.607   7.535   13.947  1.00 0.00 ? 33  HIS A HD1  2  
ATOM 1960  H HD2  . HIS A 1 33  ? 11.688  8.022   16.752  1.00 0.00 ? 33  HIS A HD2  2  
ATOM 1961  H HE1  . HIS A 1 33  ? 7.560   8.691   15.967  1.00 0.00 ? 33  HIS A HE1  2  
ATOM 1962  N N    . GLY A 1 34  ? 14.267  5.920   12.715  1.00 0.00 ? 34  GLY A N    2  
ATOM 1963  C CA   . GLY A 1 34  ? 15.131  4.823   12.315  1.00 0.00 ? 34  GLY A CA   2  
ATOM 1964  C C    . GLY A 1 34  ? 14.463  3.962   11.241  1.00 0.00 ? 34  GLY A C    2  
ATOM 1965  O O    . GLY A 1 34  ? 15.094  3.072   10.672  1.00 0.00 ? 34  GLY A O    2  
ATOM 1966  H H    . GLY A 1 34  ? 14.120  6.619   12.015  1.00 0.00 ? 34  GLY A H    2  
ATOM 1967  H HA2  . GLY A 1 34  ? 16.074  5.217   11.936  1.00 0.00 ? 34  GLY A HA2  2  
ATOM 1968  H HA3  . GLY A 1 34  ? 15.369  4.208   13.183  1.00 0.00 ? 34  GLY A HA3  2  
ATOM 1969  N N    . VAL A 1 35  ? 13.195  4.257   10.995  1.00 0.00 ? 35  VAL A N    2  
ATOM 1970  C CA   . VAL A 1 35  ? 12.435  3.521   10.000  1.00 0.00 ? 35  VAL A CA   2  
ATOM 1971  C C    . VAL A 1 35  ? 12.250  4.395   8.757   1.00 0.00 ? 35  VAL A C    2  
ATOM 1972  O O    . VAL A 1 35  ? 12.599  5.574   8.766   1.00 0.00 ? 35  VAL A O    2  
ATOM 1973  C CB   . VAL A 1 35  ? 11.109  3.046   10.599  1.00 0.00 ? 35  VAL A CB   2  
ATOM 1974  C CG1  . VAL A 1 35  ? 11.273  2.690   12.078  1.00 0.00 ? 35  VAL A CG1  2  
ATOM 1975  C CG2  . VAL A 1 35  ? 10.013  4.096   10.406  1.00 0.00 ? 35  VAL A CG2  2  
ATOM 1976  H H    . VAL A 1 35  ? 12.689  4.982   11.462  1.00 0.00 ? 35  VAL A H    2  
ATOM 1977  H HA   . VAL A 1 35  ? 13.016  2.641   9.726   1.00 0.00 ? 35  VAL A HA   2  
ATOM 1978  H HB   . VAL A 1 35  ? 10.806  2.143   10.069  1.00 0.00 ? 35  VAL A HB   2  
ATOM 1979  H HG11 . VAL A 1 35  ? 10.573  1.897   12.340  1.00 0.00 ? 35  VAL A HG11 2  
ATOM 1980  H HG12 . VAL A 1 35  ? 12.292  2.350   12.259  1.00 0.00 ? 35  VAL A HG12 2  
ATOM 1981  H HG13 . VAL A 1 35  ? 11.069  3.570   12.688  1.00 0.00 ? 35  VAL A HG13 2  
ATOM 1982  H HG21 . VAL A 1 35  ? 9.107   3.774   10.920  1.00 0.00 ? 35  VAL A HG21 2  
ATOM 1983  H HG22 . VAL A 1 35  ? 10.345  5.049   10.817  1.00 0.00 ? 35  VAL A HG22 2  
ATOM 1984  H HG23 . VAL A 1 35  ? 9.805   4.212   9.342   1.00 0.00 ? 35  VAL A HG23 2  
ATOM 1985  N N    . GLY A 1 36  ? 11.702  3.782   7.718   1.00 0.00 ? 36  GLY A N    2  
ATOM 1986  C CA   . GLY A 1 36  ? 11.466  4.489   6.471   1.00 0.00 ? 36  GLY A CA   2  
ATOM 1987  C C    . GLY A 1 36  ? 10.068  5.110   6.448   1.00 0.00 ? 36  GLY A C    2  
ATOM 1988  O O    . GLY A 1 36  ? 9.716   5.889   7.333   1.00 0.00 ? 36  GLY A O    2  
ATOM 1989  H H    . GLY A 1 36  ? 11.420  2.822   7.720   1.00 0.00 ? 36  GLY A H    2  
ATOM 1990  H HA2  . GLY A 1 36  ? 12.217  5.269   6.344   1.00 0.00 ? 36  GLY A HA2  2  
ATOM 1991  H HA3  . GLY A 1 36  ? 11.576  3.801   5.633   1.00 0.00 ? 36  GLY A HA3  2  
ATOM 1992  N N    . ILE A 1 37  ? 9.309   4.742   5.427   1.00 0.00 ? 37  ILE A N    2  
ATOM 1993  C CA   . ILE A 1 37  ? 7.957   5.253   5.277   1.00 0.00 ? 37  ILE A CA   2  
ATOM 1994  C C    . ILE A 1 37  ? 7.002   4.088   5.011   1.00 0.00 ? 37  ILE A C    2  
ATOM 1995  O O    . ILE A 1 37  ? 7.372   3.114   4.357   1.00 0.00 ? 37  ILE A O    2  
ATOM 1996  C CB   . ILE A 1 37  ? 7.912   6.342   4.203   1.00 0.00 ? 37  ILE A CB   2  
ATOM 1997  C CG1  . ILE A 1 37  ? 9.078   7.320   4.364   1.00 0.00 ? 37  ILE A CG1  2  
ATOM 1998  C CG2  . ILE A 1 37  ? 6.560   7.058   4.204   1.00 0.00 ? 37  ILE A CG2  2  
ATOM 1999  C CD1  . ILE A 1 37  ? 8.877   8.217   5.587   1.00 0.00 ? 37  ILE A CD1  2  
ATOM 2000  H H    . ILE A 1 37  ? 9.603   4.108   4.711   1.00 0.00 ? 37  ILE A H    2  
ATOM 2001  H HA   . ILE A 1 37  ? 7.678   5.720   6.221   1.00 0.00 ? 37  ILE A HA   2  
ATOM 2002  H HB   . ILE A 1 37  ? 8.023   5.866   3.229   1.00 0.00 ? 37  ILE A HB   2  
ATOM 2003  H HG12 . ILE A 1 37  ? 10.011  6.765   4.465   1.00 0.00 ? 37  ILE A HG12 2  
ATOM 2004  H HG13 . ILE A 1 37  ? 9.168   7.934   3.468   1.00 0.00 ? 37  ILE A HG13 2  
ATOM 2005  H HG21 . ILE A 1 37  ? 5.811   6.420   3.734   1.00 0.00 ? 37  ILE A HG21 2  
ATOM 2006  H HG22 . ILE A 1 37  ? 6.263   7.272   5.231   1.00 0.00 ? 37  ILE A HG22 2  
ATOM 2007  H HG23 . ILE A 1 37  ? 6.642   7.991   3.647   1.00 0.00 ? 37  ILE A HG23 2  
ATOM 2008  H HD11 . ILE A 1 37  ? 8.053   8.905   5.401   1.00 0.00 ? 37  ILE A HD11 2  
ATOM 2009  H HD12 . ILE A 1 37  ? 8.646   7.600   6.455   1.00 0.00 ? 37  ILE A HD12 2  
ATOM 2010  H HD13 . ILE A 1 37  ? 9.789   8.783   5.775   1.00 0.00 ? 37  ILE A HD13 2  
ATOM 2011  N N    . TYR A 1 38  ? 5.792   4.226   5.532   1.00 0.00 ? 38  TYR A N    2  
ATOM 2012  C CA   . TYR A 1 38  ? 4.781   3.196   5.360   1.00 0.00 ? 38  TYR A CA   2  
ATOM 2013  C C    . TYR A 1 38  ? 3.377   3.763   5.583   1.00 0.00 ? 38  TYR A C    2  
ATOM 2014  O O    . TYR A 1 38  ? 3.200   4.706   6.353   1.00 0.00 ? 38  TYR A O    2  
ATOM 2015  C CB   . TYR A 1 38  ? 5.068   2.140   6.429   1.00 0.00 ? 38  TYR A CB   2  
ATOM 2016  C CG   . TYR A 1 38  ? 6.479   1.552   6.360   1.00 0.00 ? 38  TYR A CG   2  
ATOM 2017  C CD1  . TYR A 1 38  ? 6.728   0.447   5.572   1.00 0.00 ? 38  TYR A CD1  2  
ATOM 2018  C CD2  . TYR A 1 38  ? 7.502   2.127   7.087   1.00 0.00 ? 38  TYR A CD2  2  
ATOM 2019  C CE1  . TYR A 1 38  ? 8.056   -0.106  5.507   1.00 0.00 ? 38  TYR A CE1  2  
ATOM 2020  C CE2  . TYR A 1 38  ? 8.830   1.574   7.022   1.00 0.00 ? 38  TYR A CE2  2  
ATOM 2021  C CZ   . TYR A 1 38  ? 9.041   0.485   6.236   1.00 0.00 ? 38  TYR A CZ   2  
ATOM 2022  O OH   . TYR A 1 38  ? 10.296  -0.038  6.175   1.00 0.00 ? 38  TYR A OH   2  
ATOM 2023  H H    . TYR A 1 38  ? 5.499   5.021   6.063   1.00 0.00 ? 38  TYR A H    2  
ATOM 2024  H HA   . TYR A 1 38  ? 4.855   2.820   4.340   1.00 0.00 ? 38  TYR A HA   2  
ATOM 2025  H HB2  . TYR A 1 38  ? 4.918   2.584   7.413   1.00 0.00 ? 38  TYR A HB2  2  
ATOM 2026  H HB3  . TYR A 1 38  ? 4.343   1.332   6.330   1.00 0.00 ? 38  TYR A HB3  2  
ATOM 2027  H HD1  . TYR A 1 38  ? 5.920   -0.007  4.998   1.00 0.00 ? 38  TYR A HD1  2  
ATOM 2028  H HD2  . TYR A 1 38  ? 7.305   3.000   7.709   1.00 0.00 ? 38  TYR A HD2  2  
ATOM 2029  H HE1  . TYR A 1 38  ? 8.267   -0.978  4.889   1.00 0.00 ? 38  TYR A HE1  2  
ATOM 2030  H HE2  . TYR A 1 38  ? 9.647   2.018   7.591   1.00 0.00 ? 38  TYR A HE2  2  
ATOM 2031  H HH   . TYR A 1 38  ? 10.297  -0.857  5.601   1.00 0.00 ? 38  TYR A HH   2  
ATOM 2032  N N    . VAL A 1 39  ? 2.416   3.163   4.897   1.00 0.00 ? 39  VAL A N    2  
ATOM 2033  C CA   . VAL A 1 39  ? 1.033   3.597   5.011   1.00 0.00 ? 39  VAL A CA   2  
ATOM 2034  C C    . VAL A 1 39  ? 0.572   3.440   6.461   1.00 0.00 ? 39  VAL A C    2  
ATOM 2035  O O    . VAL A 1 39  ? 0.855   2.427   7.100   1.00 0.00 ? 39  VAL A O    2  
ATOM 2036  C CB   . VAL A 1 39  ? 0.160   2.826   4.019   1.00 0.00 ? 39  VAL A CB   2  
ATOM 2037  C CG1  . VAL A 1 39  ? -1.295  3.292   4.092   1.00 0.00 ? 39  VAL A CG1  2  
ATOM 2038  C CG2  . VAL A 1 39  ? 0.706   2.951   2.595   1.00 0.00 ? 39  VAL A CG2  2  
ATOM 2039  H H    . VAL A 1 39  ? 2.568   2.397   4.273   1.00 0.00 ? 39  VAL A H    2  
ATOM 2040  H HA   . VAL A 1 39  ? 0.997   4.653   4.743   1.00 0.00 ? 39  VAL A HA   2  
ATOM 2041  H HB   . VAL A 1 39  ? 0.188   1.772   4.296   1.00 0.00 ? 39  VAL A HB   2  
ATOM 2042  H HG11 . VAL A 1 39  ? -1.958  2.444   3.919   1.00 0.00 ? 39  VAL A HG11 2  
ATOM 2043  H HG12 . VAL A 1 39  ? -1.493  3.713   5.078   1.00 0.00 ? 39  VAL A HG12 2  
ATOM 2044  H HG13 . VAL A 1 39  ? -1.472  4.053   3.331   1.00 0.00 ? 39  VAL A HG13 2  
ATOM 2045  H HG21 . VAL A 1 39  ? 1.663   2.436   2.526   1.00 0.00 ? 39  VAL A HG21 2  
ATOM 2046  H HG22 . VAL A 1 39  ? 0.000   2.503   1.895   1.00 0.00 ? 39  VAL A HG22 2  
ATOM 2047  H HG23 . VAL A 1 39  ? 0.841   4.005   2.349   1.00 0.00 ? 39  VAL A HG23 2  
ATOM 2048  N N    . SER A 1 40  ? -0.130  4.457   6.939   1.00 0.00 ? 40  SER A N    2  
ATOM 2049  C CA   . SER A 1 40  ? -0.633  4.445   8.302   1.00 0.00 ? 40  SER A CA   2  
ATOM 2050  C C    . SER A 1 40  ? -2.158  4.328   8.296   1.00 0.00 ? 40  SER A C    2  
ATOM 2051  O O    . SER A 1 40  ? -2.738  3.683   9.167   1.00 0.00 ? 40  SER A O    2  
ATOM 2052  C CB   . SER A 1 40  ? -0.199  5.701   9.060   1.00 0.00 ? 40  SER A CB   2  
ATOM 2053  O OG   . SER A 1 40  ? -1.115  6.778   8.877   1.00 0.00 ? 40  SER A OG   2  
ATOM 2054  H H    . SER A 1 40  ? -0.355  5.277   6.412   1.00 0.00 ? 40  SER A H    2  
ATOM 2055  H HA   . SER A 1 40  ? -0.184  3.568   8.767   1.00 0.00 ? 40  SER A HA   2  
ATOM 2056  H HB2  . SER A 1 40  ? -0.117  5.473   10.123  1.00 0.00 ? 40  SER A HB2  2  
ATOM 2057  H HB3  . SER A 1 40  ? 0.791   6.006   8.721   1.00 0.00 ? 40  SER A HB3  2  
ATOM 2058  H HG   . SER A 1 40  ? -1.875  6.694   9.521   1.00 0.00 ? 40  SER A HG   2  
ATOM 2059  N N    . LEU A 1 41  ? -2.764  4.963   7.303   1.00 0.00 ? 41  LEU A N    2  
ATOM 2060  C CA   . LEU A 1 41  ? -4.211  4.938   7.171   1.00 0.00 ? 41  LEU A CA   2  
ATOM 2061  C C    . LEU A 1 41  ? -4.586  5.021   5.690   1.00 0.00 ? 41  LEU A C    2  
ATOM 2062  O O    . LEU A 1 41  ? -3.878  5.644   4.901   1.00 0.00 ? 41  LEU A O    2  
ATOM 2063  C CB   . LEU A 1 41  ? -4.845  6.035   8.029   1.00 0.00 ? 41  LEU A CB   2  
ATOM 2064  C CG   . LEU A 1 41  ? -6.328  6.314   7.773   1.00 0.00 ? 41  LEU A CG   2  
ATOM 2065  C CD1  . LEU A 1 41  ? -6.534  6.977   6.410   1.00 0.00 ? 41  LEU A CD1  2  
ATOM 2066  C CD2  . LEU A 1 41  ? -7.159  5.037   7.920   1.00 0.00 ? 41  LEU A CD2  2  
ATOM 2067  H H    . LEU A 1 41  ? -2.285  5.485   6.597   1.00 0.00 ? 41  LEU A H    2  
ATOM 2068  H HA   . LEU A 1 41  ? -4.558  3.982   7.563   1.00 0.00 ? 41  LEU A HA   2  
ATOM 2069  H HB2  . LEU A 1 41  ? -4.723  5.765   9.078   1.00 0.00 ? 41  LEU A HB2  2  
ATOM 2070  H HB3  . LEU A 1 41  ? -4.290  6.959   7.870   1.00 0.00 ? 41  LEU A HB3  2  
ATOM 2071  H HG   . LEU A 1 41  ? -6.679  7.015   8.529   1.00 0.00 ? 41  LEU A HG   2  
ATOM 2072  H HD11 . LEU A 1 41  ? -5.565  7.244   5.986   1.00 0.00 ? 41  LEU A HD11 2  
ATOM 2073  H HD12 . LEU A 1 41  ? -7.045  6.284   5.741   1.00 0.00 ? 41  LEU A HD12 2  
ATOM 2074  H HD13 . LEU A 1 41  ? -7.137  7.877   6.531   1.00 0.00 ? 41  LEU A HD13 2  
ATOM 2075  H HD21 . LEU A 1 41  ? -6.495  4.188   8.083   1.00 0.00 ? 41  LEU A HD21 2  
ATOM 2076  H HD22 . LEU A 1 41  ? -7.834  5.139   8.770   1.00 0.00 ? 41  LEU A HD22 2  
ATOM 2077  H HD23 . LEU A 1 41  ? -7.740  4.875   7.012   1.00 0.00 ? 41  LEU A HD23 2  
ATOM 2078  N N    . VAL A 1 42  ? -5.699  4.384   5.358   1.00 0.00 ? 42  VAL A N    2  
ATOM 2079  C CA   . VAL A 1 42  ? -6.177  4.378   3.986   1.00 0.00 ? 42  VAL A CA   2  
ATOM 2080  C C    . VAL A 1 42  ? -7.688  4.616   3.975   1.00 0.00 ? 42  VAL A C    2  
ATOM 2081  O O    . VAL A 1 42  ? -8.441  3.873   4.604   1.00 0.00 ? 42  VAL A O    2  
ATOM 2082  C CB   . VAL A 1 42  ? -5.772  3.073   3.297   1.00 0.00 ? 42  VAL A CB   2  
ATOM 2083  C CG1  . VAL A 1 42  ? -6.525  2.894   1.977   1.00 0.00 ? 42  VAL A CG1  2  
ATOM 2084  C CG2  . VAL A 1 42  ? -4.259  3.015   3.077   1.00 0.00 ? 42  VAL A CG2  2  
ATOM 2085  H H    . VAL A 1 42  ? -6.270  3.880   6.006   1.00 0.00 ? 42  VAL A H    2  
ATOM 2086  H HA   . VAL A 1 42  ? -5.689  5.201   3.464   1.00 0.00 ? 42  VAL A HA   2  
ATOM 2087  H HB   . VAL A 1 42  ? -6.047  2.248   3.954   1.00 0.00 ? 42  VAL A HB   2  
ATOM 2088  H HG11 . VAL A 1 42  ? -7.160  3.762   1.800   1.00 0.00 ? 42  VAL A HG11 2  
ATOM 2089  H HG12 . VAL A 1 42  ? -5.809  2.796   1.161   1.00 0.00 ? 42  VAL A HG12 2  
ATOM 2090  H HG13 . VAL A 1 42  ? -7.142  1.997   2.029   1.00 0.00 ? 42  VAL A HG13 2  
ATOM 2091  H HG21 . VAL A 1 42  ? -3.888  2.031   3.363   1.00 0.00 ? 42  VAL A HG21 2  
ATOM 2092  H HG22 . VAL A 1 42  ? -4.037  3.197   2.026   1.00 0.00 ? 42  VAL A HG22 2  
ATOM 2093  H HG23 . VAL A 1 42  ? -3.774  3.777   3.688   1.00 0.00 ? 42  VAL A HG23 2  
ATOM 2094  N N    . GLU A 1 43  ? -8.087  5.654   3.255   1.00 0.00 ? 43  GLU A N    2  
ATOM 2095  C CA   . GLU A 1 43  ? -9.495  5.999   3.155   1.00 0.00 ? 43  GLU A CA   2  
ATOM 2096  C C    . GLU A 1 43  ? -10.252 4.918   2.381   1.00 0.00 ? 43  GLU A C    2  
ATOM 2097  O O    . GLU A 1 43  ? -9.738  4.371   1.406   1.00 0.00 ? 43  GLU A O    2  
ATOM 2098  C CB   . GLU A 1 43  ? -9.678  7.370   2.502   1.00 0.00 ? 43  GLU A CB   2  
ATOM 2099  C CG   . GLU A 1 43  ? -9.291  8.493   3.467   1.00 0.00 ? 43  GLU A CG   2  
ATOM 2100  C CD   . GLU A 1 43  ? -10.424 9.512   3.606   1.00 0.00 ? 43  GLU A CD   2  
ATOM 2101  O OE1  . GLU A 1 43  ? -11.578 9.059   3.763   1.00 0.00 ? 43  GLU A OE1  2  
ATOM 2102  O OE2  . GLU A 1 43  ? -10.109 10.721  3.551   1.00 0.00 ? 43  GLU A OE2  2  
ATOM 2103  H H    . GLU A 1 43  ? -7.468  6.253   2.747   1.00 0.00 ? 43  GLU A H    2  
ATOM 2104  H HA   . GLU A 1 43  ? -9.857  6.041   4.182   1.00 0.00 ? 43  GLU A HA   2  
ATOM 2105  H HB2  . GLU A 1 43  ? -9.067  7.433   1.602   1.00 0.00 ? 43  GLU A HB2  2  
ATOM 2106  H HB3  . GLU A 1 43  ? -10.716 7.494   2.192   1.00 0.00 ? 43  GLU A HB3  2  
ATOM 2107  H HG2  . GLU A 1 43  ? -9.054  8.072   4.444   1.00 0.00 ? 43  GLU A HG2  2  
ATOM 2108  H HG3  . GLU A 1 43  ? -8.390  8.991   3.108   1.00 0.00 ? 43  GLU A HG3  2  
ATOM 2109  N N    . PRO A 1 44  ? -11.494 4.634   2.856   1.00 0.00 ? 44  PRO A N    2  
ATOM 2110  C CA   . PRO A 1 44  ? -12.328 3.629   2.220   1.00 0.00 ? 44  PRO A CA   2  
ATOM 2111  C C    . PRO A 1 44  ? -12.912 4.152   0.906   1.00 0.00 ? 44  PRO A C    2  
ATOM 2112  O O    . PRO A 1 44  ? -12.991 5.361   0.696   1.00 0.00 ? 44  PRO A O    2  
ATOM 2113  C CB   . PRO A 1 44  ? -13.392 3.290   3.250   1.00 0.00 ? 44  PRO A CB   2  
ATOM 2114  C CG   . PRO A 1 44  ? -13.396 4.444   4.240   1.00 0.00 ? 44  PRO A CG   2  
ATOM 2115  C CD   . PRO A 1 44  ? -12.136 5.261   4.008   1.00 0.00 ? 44  PRO A CD   2  
ATOM 2116  H HA   . PRO A 1 44  ? -11.780 2.828   1.975   1.00 0.00 ? 44  PRO A HA   2  
ATOM 2117  H HB2  . PRO A 1 44  ? -14.369 3.175   2.780   1.00 0.00 ? 44  PRO A HB2  2  
ATOM 2118  H HB3  . PRO A 1 44  ? -13.167 2.348   3.750   1.00 0.00 ? 44  PRO A HB3  2  
ATOM 2119  H HG2  . PRO A 1 44  ? -14.283 5.063   4.101   1.00 0.00 ? 44  PRO A HG2  2  
ATOM 2120  H HG3  . PRO A 1 44  ? -13.426 4.070   5.263   1.00 0.00 ? 44  PRO A HG3  2  
ATOM 2121  H HD2  . PRO A 1 44  ? -12.373 6.307   3.809   1.00 0.00 ? 44  PRO A HD2  2  
ATOM 2122  H HD3  . PRO A 1 44  ? -11.486 5.243   4.882   1.00 0.00 ? 44  PRO A HD3  2  
ATOM 2123  N N    . GLY A 1 45  ? -13.307 3.215   0.056   1.00 0.00 ? 45  GLY A N    2  
ATOM 2124  C CA   . GLY A 1 45  ? -13.882 3.567   -1.231  1.00 0.00 ? 45  GLY A CA   2  
ATOM 2125  C C    . GLY A 1 45  ? -13.185 4.792   -1.826  1.00 0.00 ? 45  GLY A C    2  
ATOM 2126  O O    . GLY A 1 45  ? -13.815 5.597   -2.510  1.00 0.00 ? 45  GLY A O    2  
ATOM 2127  H H    . GLY A 1 45  ? -13.239 2.234   0.235   1.00 0.00 ? 45  GLY A H    2  
ATOM 2128  H HA2  . GLY A 1 45  ? -13.791 2.724   -1.916  1.00 0.00 ? 45  GLY A HA2  2  
ATOM 2129  H HA3  . GLY A 1 45  ? -14.946 3.770   -1.115  1.00 0.00 ? 45  GLY A HA3  2  
ATOM 2130  N N    . SER A 1 46  ? -11.895 4.895   -1.544  1.00 0.00 ? 46  SER A N    2  
ATOM 2131  C CA   . SER A 1 46  ? -11.106 6.009   -2.043  1.00 0.00 ? 46  SER A CA   2  
ATOM 2132  C C    . SER A 1 46  ? -10.236 5.551   -3.214  1.00 0.00 ? 46  SER A C    2  
ATOM 2133  O O    . SER A 1 46  ? -10.173 4.360   -3.517  1.00 0.00 ? 46  SER A O    2  
ATOM 2134  C CB   . SER A 1 46  ? -10.235 6.606   -0.936  1.00 0.00 ? 46  SER A CB   2  
ATOM 2135  O OG   . SER A 1 46  ? -8.979  5.942   -0.828  1.00 0.00 ? 46  SER A OG   2  
ATOM 2136  H H    . SER A 1 46  ? -11.390 4.236   -0.987  1.00 0.00 ? 46  SER A H    2  
ATOM 2137  H HA   . SER A 1 46  ? -11.832 6.752   -2.373  1.00 0.00 ? 46  SER A HA   2  
ATOM 2138  H HB2  . SER A 1 46  ? -10.070 7.665   -1.136  1.00 0.00 ? 46  SER A HB2  2  
ATOM 2139  H HB3  . SER A 1 46  ? -10.762 6.541   0.016   1.00 0.00 ? 46  SER A HB3  2  
ATOM 2140  H HG   . SER A 1 46  ? -8.869  5.565   0.091   1.00 0.00 ? 46  SER A HG   2  
ATOM 2141  N N    . LEU A 1 47  ? -9.586  6.520   -3.842  1.00 0.00 ? 47  LEU A N    2  
ATOM 2142  C CA   . LEU A 1 47  ? -8.721  6.230   -4.974  1.00 0.00 ? 47  LEU A CA   2  
ATOM 2143  C C    . LEU A 1 47  ? -7.510  5.430   -4.493  1.00 0.00 ? 47  LEU A C    2  
ATOM 2144  O O    . LEU A 1 47  ? -7.204  4.371   -5.039  1.00 0.00 ? 47  LEU A O    2  
ATOM 2145  C CB   . LEU A 1 47  ? -8.353  7.520   -5.710  1.00 0.00 ? 47  LEU A CB   2  
ATOM 2146  C CG   . LEU A 1 47  ? -7.411  7.364   -6.905  1.00 0.00 ? 47  LEU A CG   2  
ATOM 2147  C CD1  . LEU A 1 47  ? -7.707  6.074   -7.673  1.00 0.00 ? 47  LEU A CD1  2  
ATOM 2148  C CD2  . LEU A 1 47  ? -7.467  8.595   -7.812  1.00 0.00 ? 47  LEU A CD2  2  
ATOM 2149  H H    . LEU A 1 47  ? -9.642  7.486   -3.589  1.00 0.00 ? 47  LEU A H    2  
ATOM 2150  H HA   . LEU A 1 47  ? -9.290  5.613   -5.669  1.00 0.00 ? 47  LEU A HA   2  
ATOM 2151  H HB2  . LEU A 1 47  ? -9.273  7.992   -6.057  1.00 0.00 ? 47  LEU A HB2  2  
ATOM 2152  H HB3  . LEU A 1 47  ? -7.893  8.204   -4.997  1.00 0.00 ? 47  LEU A HB3  2  
ATOM 2153  H HG   . LEU A 1 47  ? -6.391  7.288   -6.529  1.00 0.00 ? 47  LEU A HG   2  
ATOM 2154  H HD11 . LEU A 1 47  ? -6.904  5.882   -8.384  1.00 0.00 ? 47  LEU A HD11 2  
ATOM 2155  H HD12 . LEU A 1 47  ? -7.779  5.242   -6.971  1.00 0.00 ? 47  LEU A HD12 2  
ATOM 2156  H HD13 . LEU A 1 47  ? -8.650  6.179   -8.209  1.00 0.00 ? 47  LEU A HD13 2  
ATOM 2157  H HD21 . LEU A 1 47  ? -6.999  8.364   -8.769  1.00 0.00 ? 47  LEU A HD21 2  
ATOM 2158  H HD22 . LEU A 1 47  ? -8.506  8.880   -7.975  1.00 0.00 ? 47  LEU A HD22 2  
ATOM 2159  H HD23 . LEU A 1 47  ? -6.935  9.420   -7.337  1.00 0.00 ? 47  LEU A HD23 2  
ATOM 2160  N N    . ALA A 1 48  ? -6.852  5.966   -3.475  1.00 0.00 ? 48  ALA A N    2  
ATOM 2161  C CA   . ALA A 1 48  ? -5.680  5.315   -2.915  1.00 0.00 ? 48  ALA A CA   2  
ATOM 2162  C C    . ALA A 1 48  ? -5.945  3.812   -2.796  1.00 0.00 ? 48  ALA A C    2  
ATOM 2163  O O    . ALA A 1 48  ? -5.225  3.004   -3.381  1.00 0.00 ? 48  ALA A O    2  
ATOM 2164  C CB   . ALA A 1 48  ? -5.336  5.954   -1.568  1.00 0.00 ? 48  ALA A CB   2  
ATOM 2165  H H    . ALA A 1 48  ? -7.107  6.828   -3.037  1.00 0.00 ? 48  ALA A H    2  
ATOM 2166  H HA   . ALA A 1 48  ? -4.850  5.476   -3.602  1.00 0.00 ? 48  ALA A HA   2  
ATOM 2167  H HB1  . ALA A 1 48  ? -5.899  5.459   -0.777  1.00 0.00 ? 48  ALA A HB1  2  
ATOM 2168  H HB2  . ALA A 1 48  ? -4.268  5.845   -1.377  1.00 0.00 ? 48  ALA A HB2  2  
ATOM 2169  H HB3  . ALA A 1 48  ? -5.595  7.012   -1.591  1.00 0.00 ? 48  ALA A HB3  2  
ATOM 2170  N N    . GLU A 1 49  ? -6.979  3.484   -2.036  1.00 0.00 ? 49  GLU A N    2  
ATOM 2171  C CA   . GLU A 1 49  ? -7.348  2.093   -1.834  1.00 0.00 ? 49  GLU A CA   2  
ATOM 2172  C C    . GLU A 1 49  ? -7.633  1.419   -3.177  1.00 0.00 ? 49  GLU A C    2  
ATOM 2173  O O    . GLU A 1 49  ? -7.256  0.268   -3.390  1.00 0.00 ? 49  GLU A O    2  
ATOM 2174  C CB   . GLU A 1 49  ? -8.550  1.976   -0.895  1.00 0.00 ? 49  GLU A CB   2  
ATOM 2175  C CG   . GLU A 1 49  ? -9.144  0.567   -0.939  1.00 0.00 ? 49  GLU A CG   2  
ATOM 2176  C CD   . GLU A 1 49  ? -10.061 0.395   -2.151  1.00 0.00 ? 49  GLU A CD   2  
ATOM 2177  O OE1  . GLU A 1 49  ? -10.888 1.307   -2.370  1.00 0.00 ? 49  GLU A OE1  2  
ATOM 2178  O OE2  . GLU A 1 49  ? -9.915  -0.643  -2.832  1.00 0.00 ? 49  GLU A OE2  2  
ATOM 2179  H H    . GLU A 1 49  ? -7.560  4.148   -1.565  1.00 0.00 ? 49  GLU A H    2  
ATOM 2180  H HA   . GLU A 1 49  ? -6.481  1.630   -1.364  1.00 0.00 ? 49  GLU A HA   2  
ATOM 2181  H HB2  . GLU A 1 49  ? -8.245  2.214   0.124   1.00 0.00 ? 49  GLU A HB2  2  
ATOM 2182  H HB3  . GLU A 1 49  ? -9.310  2.704   -1.179  1.00 0.00 ? 49  GLU A HB3  2  
ATOM 2183  H HG2  . GLU A 1 49  ? -8.341  -0.169  -0.979  1.00 0.00 ? 49  GLU A HG2  2  
ATOM 2184  H HG3  . GLU A 1 49  ? -9.705  0.376   -0.024  1.00 0.00 ? 49  GLU A HG3  2  
ATOM 2185  N N    . LYS A 1 50  ? -8.297  2.165   -4.049  1.00 0.00 ? 50  LYS A N    2  
ATOM 2186  C CA   . LYS A 1 50  ? -8.637  1.653   -5.365  1.00 0.00 ? 50  LYS A CA   2  
ATOM 2187  C C    . LYS A 1 50  ? -7.351  1.354   -6.139  1.00 0.00 ? 50  LYS A C    2  
ATOM 2188  O O    . LYS A 1 50  ? -7.296  0.399   -6.912  1.00 0.00 ? 50  LYS A O    2  
ATOM 2189  C CB   . LYS A 1 50  ? -9.579  2.618   -6.088  1.00 0.00 ? 50  LYS A CB   2  
ATOM 2190  C CG   . LYS A 1 50  ? -11.005 2.502   -5.545  1.00 0.00 ? 50  LYS A CG   2  
ATOM 2191  C CD   . LYS A 1 50  ? -11.848 3.712   -5.953  1.00 0.00 ? 50  LYS A CD   2  
ATOM 2192  C CE   . LYS A 1 50  ? -12.636 3.424   -7.232  1.00 0.00 ? 50  LYS A CE   2  
ATOM 2193  N NZ   . LYS A 1 50  ? -11.980 4.056   -8.398  1.00 0.00 ? 50  LYS A NZ   2  
ATOM 2194  H H    . LYS A 1 50  ? -8.600  3.100   -3.867  1.00 0.00 ? 50  LYS A H    2  
ATOM 2195  H HA   . LYS A 1 50  ? -9.180  0.719   -5.223  1.00 0.00 ? 50  LYS A HA   2  
ATOM 2196  H HB2  . LYS A 1 50  ? -9.223  3.641   -5.966  1.00 0.00 ? 50  LYS A HB2  2  
ATOM 2197  H HB3  . LYS A 1 50  ? -9.575  2.405   -7.157  1.00 0.00 ? 50  LYS A HB3  2  
ATOM 2198  H HG2  . LYS A 1 50  ? -11.467 1.589   -5.920  1.00 0.00 ? 50  LYS A HG2  2  
ATOM 2199  H HG3  . LYS A 1 50  ? -10.979 2.422   -4.458  1.00 0.00 ? 50  LYS A HG3  2  
ATOM 2200  H HD2  . LYS A 1 50  ? -12.536 3.969   -5.147  1.00 0.00 ? 50  LYS A HD2  2  
ATOM 2201  H HD3  . LYS A 1 50  ? -11.201 4.575   -6.107  1.00 0.00 ? 50  LYS A HD3  2  
ATOM 2202  H HE2  . LYS A 1 50  ? -12.709 2.348   -7.388  1.00 0.00 ? 50  LYS A HE2  2  
ATOM 2203  H HE3  . LYS A 1 50  ? -13.654 3.801   -7.132  1.00 0.00 ? 50  LYS A HE3  2  
ATOM 2204  H HZ1  . LYS A 1 50  ? -11.245 4.656   -8.083  1.00 0.00 ? 50  LYS A HZ1  2  
ATOM 2205  H HZ2  . LYS A 1 50  ? -11.600 3.347   -8.992  1.00 0.00 ? 50  LYS A HZ2  2  
ATOM 2206  H HZ3  . LYS A 1 50  ? -12.652 4.593   -8.909  1.00 0.00 ? 50  LYS A HZ3  2  
ATOM 2207  N N    . GLU A 1 51  ? -6.350  2.190   -5.905  1.00 0.00 ? 51  GLU A N    2  
ATOM 2208  C CA   . GLU A 1 51  ? -5.069  2.027   -6.571  1.00 0.00 ? 51  GLU A CA   2  
ATOM 2209  C C    . GLU A 1 51  ? -4.372  0.757   -6.078  1.00 0.00 ? 51  GLU A C    2  
ATOM 2210  O O    . GLU A 1 51  ? -3.540  0.187   -6.783  1.00 0.00 ? 51  GLU A O    2  
ATOM 2211  C CB   . GLU A 1 51  ? -4.182  3.255   -6.361  1.00 0.00 ? 51  GLU A CB   2  
ATOM 2212  C CG   . GLU A 1 51  ? -4.708  4.454   -7.154  1.00 0.00 ? 51  GLU A CG   2  
ATOM 2213  C CD   . GLU A 1 51  ? -4.897  4.095   -8.629  1.00 0.00 ? 51  GLU A CD   2  
ATOM 2214  O OE1  . GLU A 1 51  ? -3.893  4.186   -9.368  1.00 0.00 ? 51  GLU A OE1  2  
ATOM 2215  O OE2  . GLU A 1 51  ? -6.041  3.739   -8.984  1.00 0.00 ? 51  GLU A OE2  2  
ATOM 2216  H H    . GLU A 1 51  ? -6.403  2.965   -5.276  1.00 0.00 ? 51  GLU A H    2  
ATOM 2217  H HA   . GLU A 1 51  ? -5.303  1.932   -7.631  1.00 0.00 ? 51  GLU A HA   2  
ATOM 2218  H HB2  . GLU A 1 51  ? -4.144  3.504   -5.301  1.00 0.00 ? 51  GLU A HB2  2  
ATOM 2219  H HB3  . GLU A 1 51  ? -3.162  3.029   -6.672  1.00 0.00 ? 51  GLU A HB3  2  
ATOM 2220  H HG2  . GLU A 1 51  ? -5.657  4.784   -6.732  1.00 0.00 ? 51  GLU A HG2  2  
ATOM 2221  H HG3  . GLU A 1 51  ? -4.012  5.287   -7.064  1.00 0.00 ? 51  GLU A HG3  2  
ATOM 2222  N N    . GLY A 1 52  ? -4.737  0.351   -4.871  1.00 0.00 ? 52  GLY A N    2  
ATOM 2223  C CA   . GLY A 1 52  ? -4.158  -0.841  -4.275  1.00 0.00 ? 52  GLY A CA   2  
ATOM 2224  C C    . GLY A 1 52  ? -3.561  -0.533  -2.900  1.00 0.00 ? 52  GLY A C    2  
ATOM 2225  O O    . GLY A 1 52  ? -3.316  -1.441  -2.108  1.00 0.00 ? 52  GLY A O    2  
ATOM 2226  H H    . GLY A 1 52  ? -5.414  0.820   -4.304  1.00 0.00 ? 52  GLY A H    2  
ATOM 2227  H HA2  . GLY A 1 52  ? -4.922  -1.613  -4.179  1.00 0.00 ? 52  GLY A HA2  2  
ATOM 2228  H HA3  . GLY A 1 52  ? -3.383  -1.240  -4.930  1.00 0.00 ? 52  GLY A HA3  2  
ATOM 2229  N N    . LEU A 1 53  ? -3.345  0.752   -2.659  1.00 0.00 ? 53  LEU A N    2  
ATOM 2230  C CA   . LEU A 1 53  ? -2.782  1.192   -1.394  1.00 0.00 ? 53  LEU A CA   2  
ATOM 2231  C C    . LEU A 1 53  ? -3.499  0.478   -0.246  1.00 0.00 ? 53  LEU A C    2  
ATOM 2232  O O    . LEU A 1 53  ? -4.615  -0.010  -0.414  1.00 0.00 ? 53  LEU A O    2  
ATOM 2233  C CB   . LEU A 1 53  ? -2.825  2.718   -1.290  1.00 0.00 ? 53  LEU A CB   2  
ATOM 2234  C CG   . LEU A 1 53  ? -1.519  3.398   -0.873  1.00 0.00 ? 53  LEU A CG   2  
ATOM 2235  C CD1  . LEU A 1 53  ? -0.542  3.477   -2.048  1.00 0.00 ? 53  LEU A CD1  2  
ATOM 2236  C CD2  . LEU A 1 53  ? -1.789  4.773   -0.259  1.00 0.00 ? 53  LEU A CD2  2  
ATOM 2237  H H    . LEU A 1 53  ? -3.548  1.485   -3.309  1.00 0.00 ? 53  LEU A H    2  
ATOM 2238  H HA   . LEU A 1 53  ? -1.733  0.897   -1.383  1.00 0.00 ? 53  LEU A HA   2  
ATOM 2239  H HB2  . LEU A 1 53  ? -3.128  3.120   -2.257  1.00 0.00 ? 53  LEU A HB2  2  
ATOM 2240  H HB3  . LEU A 1 53  ? -3.599  2.992   -0.574  1.00 0.00 ? 53  LEU A HB3  2  
ATOM 2241  H HG   . LEU A 1 53  ? -1.047  2.789   -0.103  1.00 0.00 ? 53  LEU A HG   2  
ATOM 2242  H HD11 . LEU A 1 53  ? 0.080   2.582   -2.064  1.00 0.00 ? 53  LEU A HD11 2  
ATOM 2243  H HD12 . LEU A 1 53  ? -1.101  3.548   -2.981  1.00 0.00 ? 53  LEU A HD12 2  
ATOM 2244  H HD13 . LEU A 1 53  ? 0.090   4.358   -1.936  1.00 0.00 ? 53  LEU A HD13 2  
ATOM 2245  H HD21 . LEU A 1 53  ? -0.887  5.134   0.235   1.00 0.00 ? 53  LEU A HD21 2  
ATOM 2246  H HD22 . LEU A 1 53  ? -2.077  5.472   -1.045  1.00 0.00 ? 53  LEU A HD22 2  
ATOM 2247  H HD23 . LEU A 1 53  ? -2.596  4.694   0.470   1.00 0.00 ? 53  LEU A HD23 2  
ATOM 2248  N N    . ARG A 1 54  ? -2.827  0.438   0.895   1.00 0.00 ? 54  ARG A N    2  
ATOM 2249  C CA   . ARG A 1 54  ? -3.385  -0.209  2.070   1.00 0.00 ? 54  ARG A CA   2  
ATOM 2250  C C    . ARG A 1 54  ? -2.381  -0.171  3.224   1.00 0.00 ? 54  ARG A C    2  
ATOM 2251  O O    . ARG A 1 54  ? -1.206  -0.484  3.040   1.00 0.00 ? 54  ARG A O    2  
ATOM 2252  C CB   . ARG A 1 54  ? -3.757  -1.663  1.774   1.00 0.00 ? 54  ARG A CB   2  
ATOM 2253  C CG   . ARG A 1 54  ? -5.267  -1.877  1.892   1.00 0.00 ? 54  ARG A CG   2  
ATOM 2254  C CD   . ARG A 1 54  ? -5.656  -2.273  3.318   1.00 0.00 ? 54  ARG A CD   2  
ATOM 2255  N NE   . ARG A 1 54  ? -5.189  -3.647  3.607   1.00 0.00 ? 54  ARG A NE   2  
ATOM 2256  C CZ   . ARG A 1 54  ? -4.965  -4.120  4.840   1.00 0.00 ? 54  ARG A CZ   2  
ATOM 2257  N NH1  . ARG A 1 54  ? -5.163  -3.333  5.906   1.00 0.00 ? 54  ARG A NH1  2  
ATOM 2258  N NH2  . ARG A 1 54  ? -4.543  -5.381  5.008   1.00 0.00 ? 54  ARG A NH2  2  
ATOM 2259  H H    . ARG A 1 54  ? -1.919  0.837   1.023   1.00 0.00 ? 54  ARG A H    2  
ATOM 2260  H HA   . ARG A 1 54  ? -4.278  0.369   2.308   1.00 0.00 ? 54  ARG A HA   2  
ATOM 2261  H HB2  . ARG A 1 54  ? -3.425  -1.930  0.771   1.00 0.00 ? 54  ARG A HB2  2  
ATOM 2262  H HB3  . ARG A 1 54  ? -3.237  -2.323  2.468   1.00 0.00 ? 54  ARG A HB3  2  
ATOM 2263  H HG2  . ARG A 1 54  ? -5.791  -0.964  1.608   1.00 0.00 ? 54  ARG A HG2  2  
ATOM 2264  H HG3  . ARG A 1 54  ? -5.583  -2.655  1.196   1.00 0.00 ? 54  ARG A HG3  2  
ATOM 2265  H HD2  . ARG A 1 54  ? -5.217  -1.574  4.030   1.00 0.00 ? 54  ARG A HD2  2  
ATOM 2266  H HD3  . ARG A 1 54  ? -6.737  -2.214  3.439   1.00 0.00 ? 54  ARG A HD3  2  
ATOM 2267  H HE   . ARG A 1 54  ? -5.032  -4.261  2.834   1.00 0.00 ? 54  ARG A HE   2  
ATOM 2268  H HH11 . ARG A 1 54  ? -5.478  -2.392  5.782   1.00 0.00 ? 54  ARG A HH11 2  
ATOM 2269  H HH12 . ARG A 1 54  ? -4.996  -3.686  6.827   1.00 0.00 ? 54  ARG A HH12 2  
ATOM 2270  H HH21 . ARG A 1 54  ? -4.396  -5.969  4.212   1.00 0.00 ? 54  ARG A HH21 2  
ATOM 2271  H HH22 . ARG A 1 54  ? -4.376  -5.735  5.928   1.00 0.00 ? 54  ARG A HH22 2  
ATOM 2272  N N    . VAL A 1 55  ? -2.881  0.216   4.389   1.00 0.00 ? 55  VAL A N    2  
ATOM 2273  C CA   . VAL A 1 55  ? -2.042  0.298   5.573   1.00 0.00 ? 55  VAL A CA   2  
ATOM 2274  C C    . VAL A 1 55  ? -1.172  -0.957  5.665   1.00 0.00 ? 55  VAL A C    2  
ATOM 2275  O O    . VAL A 1 55  ? -1.688  -2.066  5.795   1.00 0.00 ? 55  VAL A O    2  
ATOM 2276  C CB   . VAL A 1 55  ? -2.909  0.517   6.814   1.00 0.00 ? 55  VAL A CB   2  
ATOM 2277  C CG1  . VAL A 1 55  ? -2.070  0.437   8.091   1.00 0.00 ? 55  VAL A CG1  2  
ATOM 2278  C CG2  . VAL A 1 55  ? -3.658  1.849   6.732   1.00 0.00 ? 55  VAL A CG2  2  
ATOM 2279  H H    . VAL A 1 55  ? -3.838  0.469   4.530   1.00 0.00 ? 55  VAL A H    2  
ATOM 2280  H HA   . VAL A 1 55  ? -1.394  1.167   5.456   1.00 0.00 ? 55  VAL A HA   2  
ATOM 2281  H HB   . VAL A 1 55  ? -3.650  -0.282  6.850   1.00 0.00 ? 55  VAL A HB   2  
ATOM 2282  H HG11 . VAL A 1 55  ? -1.135  -0.083  7.879   1.00 0.00 ? 55  VAL A HG11 2  
ATOM 2283  H HG12 . VAL A 1 55  ? -1.852  1.445   8.446   1.00 0.00 ? 55  VAL A HG12 2  
ATOM 2284  H HG13 . VAL A 1 55  ? -2.623  -0.107  8.856   1.00 0.00 ? 55  VAL A HG13 2  
ATOM 2285  H HG21 . VAL A 1 55  ? -4.361  1.820   5.900   1.00 0.00 ? 55  VAL A HG21 2  
ATOM 2286  H HG22 . VAL A 1 55  ? -4.202  2.018   7.662   1.00 0.00 ? 55  VAL A HG22 2  
ATOM 2287  H HG23 . VAL A 1 55  ? -2.944  2.658   6.577   1.00 0.00 ? 55  VAL A HG23 2  
ATOM 2288  N N    . GLY A 1 56  ? 0.133   -0.740  5.594   1.00 0.00 ? 56  GLY A N    2  
ATOM 2289  C CA   . GLY A 1 56  ? 1.080   -1.840  5.668   1.00 0.00 ? 56  GLY A CA   2  
ATOM 2290  C C    . GLY A 1 56  ? 2.135   -1.730  4.566   1.00 0.00 ? 56  GLY A C    2  
ATOM 2291  O O    . GLY A 1 56  ? 3.283   -2.127  4.759   1.00 0.00 ? 56  GLY A O    2  
ATOM 2292  H H    . GLY A 1 56  ? 0.544   0.165   5.488   1.00 0.00 ? 56  GLY A H    2  
ATOM 2293  H HA2  . GLY A 1 56  ? 1.566   -1.841  6.643   1.00 0.00 ? 56  GLY A HA2  2  
ATOM 2294  H HA3  . GLY A 1 56  ? 0.549   -2.788  5.575   1.00 0.00 ? 56  GLY A HA3  2  
ATOM 2295  N N    . ASP A 1 57  ? 1.709   -1.188  3.434   1.00 0.00 ? 57  ASP A N    2  
ATOM 2296  C CA   . ASP A 1 57  ? 2.603   -1.021  2.301   1.00 0.00 ? 57  ASP A CA   2  
ATOM 2297  C C    . ASP A 1 57  ? 3.848   -0.251  2.749   1.00 0.00 ? 57  ASP A C    2  
ATOM 2298  O O    . ASP A 1 57  ? 3.996   0.065   3.928   1.00 0.00 ? 57  ASP A O    2  
ATOM 2299  C CB   . ASP A 1 57  ? 1.931   -0.223  1.182   1.00 0.00 ? 57  ASP A CB   2  
ATOM 2300  C CG   . ASP A 1 57  ? 1.532   -1.042  -0.047  1.00 0.00 ? 57  ASP A CG   2  
ATOM 2301  O OD1  . ASP A 1 57  ? 2.196   -2.075  -0.280  1.00 0.00 ? 57  ASP A OD1  2  
ATOM 2302  O OD2  . ASP A 1 57  ? 0.572   -0.617  -0.725  1.00 0.00 ? 57  ASP A OD2  2  
ATOM 2303  H H    . ASP A 1 57  ? 0.773   -0.867  3.285   1.00 0.00 ? 57  ASP A H    2  
ATOM 2304  H HA   . ASP A 1 57  ? 2.836   -2.032  1.968   1.00 0.00 ? 57  ASP A HA   2  
ATOM 2305  H HB2  . ASP A 1 57  ? 1.039   0.258   1.584   1.00 0.00 ? 57  ASP A HB2  2  
ATOM 2306  H HB3  . ASP A 1 57  ? 2.607   0.572   0.866   1.00 0.00 ? 57  ASP A HB3  2  
ATOM 2307  N N    . GLN A 1 58  ? 4.711   0.028   1.783   1.00 0.00 ? 58  GLN A N    2  
ATOM 2308  C CA   . GLN A 1 58  ? 5.937   0.755   2.063   1.00 0.00 ? 58  GLN A CA   2  
ATOM 2309  C C    . GLN A 1 58  ? 6.261   1.712   0.914   1.00 0.00 ? 58  GLN A C    2  
ATOM 2310  O O    . GLN A 1 58  ? 6.562   1.276   -0.196  1.00 0.00 ? 58  GLN A O    2  
ATOM 2311  C CB   . GLN A 1 58  ? 7.099   -0.208  2.317   1.00 0.00 ? 58  GLN A CB   2  
ATOM 2312  C CG   . GLN A 1 58  ? 8.396   0.557   2.587   1.00 0.00 ? 58  GLN A CG   2  
ATOM 2313  C CD   . GLN A 1 58  ? 9.537   -0.403  2.931   1.00 0.00 ? 58  GLN A CD   2  
ATOM 2314  O OE1  . GLN A 1 58  ? 9.549   -1.559  2.542   1.00 0.00 ? 58  GLN A OE1  2  
ATOM 2315  N NE2  . GLN A 1 58  ? 10.493  0.139   3.680   1.00 0.00 ? 58  GLN A NE2  2  
ATOM 2316  H H    . GLN A 1 58  ? 4.583   -0.233  0.826   1.00 0.00 ? 58  GLN A H    2  
ATOM 2317  H HA   . GLN A 1 58  ? 5.738   1.321   2.972   1.00 0.00 ? 58  GLN A HA   2  
ATOM 2318  H HB2  . GLN A 1 58  ? 6.866   -0.848  3.168   1.00 0.00 ? 58  GLN A HB2  2  
ATOM 2319  H HB3  . GLN A 1 58  ? 7.230   -0.861  1.454   1.00 0.00 ? 58  GLN A HB3  2  
ATOM 2320  H HG2  . GLN A 1 58  ? 8.664   1.146   1.710   1.00 0.00 ? 58  GLN A HG2  2  
ATOM 2321  H HG3  . GLN A 1 58  ? 8.245   1.257   3.408   1.00 0.00 ? 58  GLN A HG3  2  
ATOM 2322  H HE21 . GLN A 1 58  ? 10.422  1.095   3.966   1.00 0.00 ? 58  GLN A HE21 2  
ATOM 2323  H HE22 . GLN A 1 58  ? 11.282  -0.409  3.958   1.00 0.00 ? 58  GLN A HE22 2  
ATOM 2324  N N    . ILE A 1 59  ? 6.188   2.999   1.220   1.00 0.00 ? 59  ILE A N    2  
ATOM 2325  C CA   . ILE A 1 59  ? 6.469   4.022   0.228   1.00 0.00 ? 59  ILE A CA   2  
ATOM 2326  C C    . ILE A 1 59  ? 7.963   4.010   -0.102  1.00 0.00 ? 59  ILE A C    2  
ATOM 2327  O O    . ILE A 1 59  ? 8.757   4.661   0.576   1.00 0.00 ? 59  ILE A O    2  
ATOM 2328  C CB   . ILE A 1 59  ? 5.955   5.383   0.700   1.00 0.00 ? 59  ILE A CB   2  
ATOM 2329  C CG1  . ILE A 1 59  ? 4.487   5.298   1.123   1.00 0.00 ? 59  ILE A CG1  2  
ATOM 2330  C CG2  . ILE A 1 59  ? 6.183   6.456   -0.367  1.00 0.00 ? 59  ILE A CG2  2  
ATOM 2331  C CD1  . ILE A 1 59  ? 3.575   5.121   -0.093  1.00 0.00 ? 59  ILE A CD1  2  
ATOM 2332  H H    . ILE A 1 59  ? 5.943   3.345   2.126   1.00 0.00 ? 59  ILE A H    2  
ATOM 2333  H HA   . ILE A 1 59  ? 5.915   3.763   -0.674  1.00 0.00 ? 59  ILE A HA   2  
ATOM 2334  H HB   . ILE A 1 59  ? 6.527   5.678   1.580   1.00 0.00 ? 59  ILE A HB   2  
ATOM 2335  H HG12 . ILE A 1 59  ? 4.351   4.462   1.809   1.00 0.00 ? 59  ILE A HG12 2  
ATOM 2336  H HG13 . ILE A 1 59  ? 4.208   6.202   1.664   1.00 0.00 ? 59  ILE A HG13 2  
ATOM 2337  H HG21 . ILE A 1 59  ? 6.218   7.437   0.106   1.00 0.00 ? 59  ILE A HG21 2  
ATOM 2338  H HG22 . ILE A 1 59  ? 7.126   6.265   -0.878  1.00 0.00 ? 59  ILE A HG22 2  
ATOM 2339  H HG23 . ILE A 1 59  ? 5.366   6.430   -1.088  1.00 0.00 ? 59  ILE A HG23 2  
ATOM 2340  H HD11 . ILE A 1 59  ? 4.173   4.824   -0.954  1.00 0.00 ? 59  ILE A HD11 2  
ATOM 2341  H HD12 . ILE A 1 59  ? 2.834   4.351   0.118   1.00 0.00 ? 59  ILE A HD12 2  
ATOM 2342  H HD13 . ILE A 1 59  ? 3.070   6.063   -0.308  1.00 0.00 ? 59  ILE A HD13 2  
ATOM 2343  N N    . LEU A 1 60  ? 8.301   3.262   -1.142  1.00 0.00 ? 60  LEU A N    2  
ATOM 2344  C CA   . LEU A 1 60  ? 9.686   3.157   -1.570  1.00 0.00 ? 60  LEU A CA   2  
ATOM 2345  C C    . LEU A 1 60  ? 10.110  4.466   -2.237  1.00 0.00 ? 60  LEU A C    2  
ATOM 2346  O O    . LEU A 1 60  ? 11.130  5.050   -1.874  1.00 0.00 ? 60  LEU A O    2  
ATOM 2347  C CB   . LEU A 1 60  ? 9.881   1.924   -2.455  1.00 0.00 ? 60  LEU A CB   2  
ATOM 2348  C CG   . LEU A 1 60  ? 9.267   0.622   -1.936  1.00 0.00 ? 60  LEU A CG   2  
ATOM 2349  C CD1  . LEU A 1 60  ? 9.480   -0.520  -2.932  1.00 0.00 ? 60  LEU A CD1  2  
ATOM 2350  C CD2  . LEU A 1 60  ? 9.805   0.278   -0.546  1.00 0.00 ? 60  LEU A CD2  2  
ATOM 2351  H H    . LEU A 1 60  ? 7.649   2.736   -1.688  1.00 0.00 ? 60  LEU A H    2  
ATOM 2352  H HA   . LEU A 1 60  ? 10.294  3.011   -0.676  1.00 0.00 ? 60  LEU A HA   2  
ATOM 2353  H HB2  . LEU A 1 60  ? 9.459   2.136   -3.437  1.00 0.00 ? 60  LEU A HB2  2  
ATOM 2354  H HB3  . LEU A 1 60  ? 10.951  1.767   -2.595  1.00 0.00 ? 60  LEU A HB3  2  
ATOM 2355  H HG   . LEU A 1 60  ? 8.191   0.767   -1.838  1.00 0.00 ? 60  LEU A HG   2  
ATOM 2356  H HD11 . LEU A 1 60  ? 10.241  -0.232  -3.657  1.00 0.00 ? 60  LEU A HD11 2  
ATOM 2357  H HD12 . LEU A 1 60  ? 9.807   -1.412  -2.397  1.00 0.00 ? 60  LEU A HD12 2  
ATOM 2358  H HD13 . LEU A 1 60  ? 8.545   -0.729  -3.450  1.00 0.00 ? 60  LEU A HD13 2  
ATOM 2359  H HD21 . LEU A 1 60  ? 10.785  -0.189  -0.641  1.00 0.00 ? 60  LEU A HD21 2  
ATOM 2360  H HD22 . LEU A 1 60  ? 9.892   1.189   0.046   1.00 0.00 ? 60  LEU A HD22 2  
ATOM 2361  H HD23 . LEU A 1 60  ? 9.120   -0.412  -0.052  1.00 0.00 ? 60  LEU A HD23 2  
ATOM 2362  N N    . ARG A 1 61  ? 9.307   4.889   -3.202  1.00 0.00 ? 61  ARG A N    2  
ATOM 2363  C CA   . ARG A 1 61  ? 9.586   6.119   -3.924  1.00 0.00 ? 61  ARG A CA   2  
ATOM 2364  C C    . ARG A 1 61  ? 8.330   6.988   -3.998  1.00 0.00 ? 61  ARG A C    2  
ATOM 2365  O O    . ARG A 1 61  ? 7.222   6.505   -3.769  1.00 0.00 ? 61  ARG A O    2  
ATOM 2366  C CB   . ARG A 1 61  ? 10.079  5.825   -5.342  1.00 0.00 ? 61  ARG A CB   2  
ATOM 2367  C CG   . ARG A 1 61  ? 11.590  5.586   -5.360  1.00 0.00 ? 61  ARG A CG   2  
ATOM 2368  C CD   . ARG A 1 61  ? 12.006  4.796   -6.602  1.00 0.00 ? 61  ARG A CD   2  
ATOM 2369  N NE   . ARG A 1 61  ? 13.368  4.247   -6.420  1.00 0.00 ? 61  ARG A NE   2  
ATOM 2370  C CZ   . ARG A 1 61  ? 14.157  3.845   -7.426  1.00 0.00 ? 61  ARG A CZ   2  
ATOM 2371  N NH1  . ARG A 1 61  ? 13.724  3.929   -8.691  1.00 0.00 ? 61  ARG A NH1  2  
ATOM 2372  N NH2  . ARG A 1 61  ? 15.379  3.359   -7.166  1.00 0.00 ? 61  ARG A NH2  2  
ATOM 2373  H H    . ARG A 1 61  ? 8.480   4.408   -3.492  1.00 0.00 ? 61  ARG A H    2  
ATOM 2374  H HA   . ARG A 1 61  ? 10.370  6.609   -3.346  1.00 0.00 ? 61  ARG A HA   2  
ATOM 2375  H HB2  . ARG A 1 61  ? 9.564   4.948   -5.736  1.00 0.00 ? 61  ARG A HB2  2  
ATOM 2376  H HB3  . ARG A 1 61  ? 9.832   6.660   -5.997  1.00 0.00 ? 61  ARG A HB3  2  
ATOM 2377  H HG2  . ARG A 1 61  ? 12.113  6.542   -5.340  1.00 0.00 ? 61  ARG A HG2  2  
ATOM 2378  H HG3  . ARG A 1 61  ? 11.886  5.042   -4.462  1.00 0.00 ? 61  ARG A HG3  2  
ATOM 2379  H HD2  . ARG A 1 61  ? 11.299  3.986   -6.782  1.00 0.00 ? 61  ARG A HD2  2  
ATOM 2380  H HD3  . ARG A 1 61  ? 11.980  5.442   -7.479  1.00 0.00 ? 61  ARG A HD3  2  
ATOM 2381  H HE   . ARG A 1 61  ? 13.722  4.170   -5.487  1.00 0.00 ? 61  ARG A HE   2  
ATOM 2382  H HH11 . ARG A 1 61  ? 12.813  4.291   -8.885  1.00 0.00 ? 61  ARG A HH11 2  
ATOM 2383  H HH12 . ARG A 1 61  ? 14.313  3.629   -9.442  1.00 0.00 ? 61  ARG A HH12 2  
ATOM 2384  H HH21 . ARG A 1 61  ? 15.702  3.297   -6.222  1.00 0.00 ? 61  ARG A HH21 2  
ATOM 2385  H HH22 . ARG A 1 61  ? 15.967  3.059   -7.917  1.00 0.00 ? 61  ARG A HH22 2  
ATOM 2386  N N    . VAL A 1 62  ? 8.544   8.256   -4.317  1.00 0.00 ? 62  VAL A N    2  
ATOM 2387  C CA   . VAL A 1 62  ? 7.442   9.197   -4.424  1.00 0.00 ? 62  VAL A CA   2  
ATOM 2388  C C    . VAL A 1 62  ? 7.721   10.175  -5.568  1.00 0.00 ? 62  VAL A C    2  
ATOM 2389  O O    . VAL A 1 62  ? 8.657   10.970  -5.496  1.00 0.00 ? 62  VAL A O    2  
ATOM 2390  C CB   . VAL A 1 62  ? 7.220   9.897   -3.081  1.00 0.00 ? 62  VAL A CB   2  
ATOM 2391  C CG1  . VAL A 1 62  ? 8.114   11.131  -2.951  1.00 0.00 ? 62  VAL A CG1  2  
ATOM 2392  C CG2  . VAL A 1 62  ? 5.747   10.264  -2.892  1.00 0.00 ? 62  VAL A CG2  2  
ATOM 2393  H H    . VAL A 1 62  ? 9.448   8.641   -4.501  1.00 0.00 ? 62  VAL A H    2  
ATOM 2394  H HA   . VAL A 1 62  ? 6.544   8.627   -4.661  1.00 0.00 ? 62  VAL A HA   2  
ATOM 2395  H HB   . VAL A 1 62  ? 7.495   9.199   -2.290  1.00 0.00 ? 62  VAL A HB   2  
ATOM 2396  H HG11 . VAL A 1 62  ? 9.137   10.868  -3.220  1.00 0.00 ? 62  VAL A HG11 2  
ATOM 2397  H HG12 . VAL A 1 62  ? 7.753   11.914  -3.618  1.00 0.00 ? 62  VAL A HG12 2  
ATOM 2398  H HG13 . VAL A 1 62  ? 8.090   11.491  -1.922  1.00 0.00 ? 62  VAL A HG13 2  
ATOM 2399  H HG21 . VAL A 1 62  ? 5.612   11.331  -3.075  1.00 0.00 ? 62  VAL A HG21 2  
ATOM 2400  H HG22 . VAL A 1 62  ? 5.137   9.696   -3.595  1.00 0.00 ? 62  VAL A HG22 2  
ATOM 2401  H HG23 . VAL A 1 62  ? 5.441   10.028  -1.873  1.00 0.00 ? 62  VAL A HG23 2  
ATOM 2402  N N    . ASN A 1 63  ? 6.892   10.083  -6.597  1.00 0.00 ? 63  ASN A N    2  
ATOM 2403  C CA   . ASN A 1 63  ? 7.037   10.949  -7.755  1.00 0.00 ? 63  ASN A CA   2  
ATOM 2404  C C    . ASN A 1 63  ? 8.152   10.410  -8.653  1.00 0.00 ? 63  ASN A C    2  
ATOM 2405  O O    . ASN A 1 63  ? 7.906   10.044  -9.801  1.00 0.00 ? 63  ASN A O    2  
ATOM 2406  C CB   . ASN A 1 63  ? 7.415   12.371  -7.335  1.00 0.00 ? 63  ASN A CB   2  
ATOM 2407  C CG   . ASN A 1 63  ? 7.046   13.381  -8.423  1.00 0.00 ? 63  ASN A CG   2  
ATOM 2408  O OD1  . ASN A 1 63  ? 7.893   13.945  -9.095  1.00 0.00 ? 63  ASN A OD1  2  
ATOM 2409  N ND2  . ASN A 1 63  ? 5.737   13.576  -8.559  1.00 0.00 ? 63  ASN A ND2  2  
ATOM 2410  H H    . ASN A 1 63  ? 6.133   9.434   -6.648  1.00 0.00 ? 63  ASN A H    2  
ATOM 2411  H HA   . ASN A 1 63  ? 6.064   10.938  -8.245  1.00 0.00 ? 63  ASN A HA   2  
ATOM 2412  H HB2  . ASN A 1 63  ? 6.904   12.628  -6.407  1.00 0.00 ? 63  ASN A HB2  2  
ATOM 2413  H HB3  . ASN A 1 63  ? 8.485   12.423  -7.134  1.00 0.00 ? 63  ASN A HB3  2  
ATOM 2414  H HD21 . ASN A 1 63  ? 5.095   13.080  -7.975  1.00 0.00 ? 63  ASN A HD21 2  
ATOM 2415  H HD22 . ASN A 1 63  ? 5.396   14.218  -9.245  1.00 0.00 ? 63  ASN A HD22 2  
ATOM 2416  N N    . ASP A 1 64  ? 9.354   10.377  -8.096  1.00 0.00 ? 64  ASP A N    2  
ATOM 2417  C CA   . ASP A 1 64  ? 10.507  9.888   -8.832  1.00 0.00 ? 64  ASP A CA   2  
ATOM 2418  C C    . ASP A 1 64  ? 11.642  9.587   -7.852  1.00 0.00 ? 64  ASP A C    2  
ATOM 2419  O O    . ASP A 1 64  ? 12.303  8.555   -7.959  1.00 0.00 ? 64  ASP A O    2  
ATOM 2420  C CB   . ASP A 1 64  ? 11.008  10.935  -9.829  1.00 0.00 ? 64  ASP A CB   2  
ATOM 2421  C CG   . ASP A 1 64  ? 12.408  10.677  -10.389 1.00 0.00 ? 64  ASP A CG   2  
ATOM 2422  O OD1  . ASP A 1 64  ? 12.713  9.489   -10.631 1.00 0.00 ? 64  ASP A OD1  2  
ATOM 2423  O OD2  . ASP A 1 64  ? 13.143  11.674  -10.561 1.00 0.00 ? 64  ASP A OD2  2  
ATOM 2424  H H    . ASP A 1 64  ? 9.545   10.676  -7.161  1.00 0.00 ? 64  ASP A H    2  
ATOM 2425  H HA   . ASP A 1 64  ? 10.157  8.996   -9.352  1.00 0.00 ? 64  ASP A HA   2  
ATOM 2426  H HB2  . ASP A 1 64  ? 10.305  10.988  -10.661 1.00 0.00 ? 64  ASP A HB2  2  
ATOM 2427  H HB3  . ASP A 1 64  ? 11.001  11.910  -9.343  1.00 0.00 ? 64  ASP A HB3  2  
ATOM 2428  N N    . LYS A 1 65  ? 11.835  10.507  -6.919  1.00 0.00 ? 65  LYS A N    2  
ATOM 2429  C CA   . LYS A 1 65  ? 12.879  10.354  -5.920  1.00 0.00 ? 65  LYS A CA   2  
ATOM 2430  C C    . LYS A 1 65  ? 12.490  9.238   -4.949  1.00 0.00 ? 65  LYS A C    2  
ATOM 2431  O O    . LYS A 1 65  ? 11.322  8.859   -4.869  1.00 0.00 ? 65  LYS A O    2  
ATOM 2432  C CB   . LYS A 1 65  ? 13.168  11.692  -5.236  1.00 0.00 ? 65  LYS A CB   2  
ATOM 2433  C CG   . LYS A 1 65  ? 14.066  12.571  -6.110  1.00 0.00 ? 65  LYS A CG   2  
ATOM 2434  C CD   . LYS A 1 65  ? 14.925  13.501  -5.250  1.00 0.00 ? 65  LYS A CD   2  
ATOM 2435  C CE   . LYS A 1 65  ? 15.942  14.256  -6.109  1.00 0.00 ? 65  LYS A CE   2  
ATOM 2436  N NZ   . LYS A 1 65  ? 15.571  15.685  -6.214  1.00 0.00 ? 65  LYS A NZ   2  
ATOM 2437  H H    . LYS A 1 65  ? 11.294  11.344  -6.839  1.00 0.00 ? 65  LYS A H    2  
ATOM 2438  H HA   . LYS A 1 65  ? 13.789  10.056  -6.442  1.00 0.00 ? 65  LYS A HA   2  
ATOM 2439  H HB2  . LYS A 1 65  ? 12.231  12.210  -5.033  1.00 0.00 ? 65  LYS A HB2  2  
ATOM 2440  H HB3  . LYS A 1 65  ? 13.650  11.516  -4.275  1.00 0.00 ? 65  LYS A HB3  2  
ATOM 2441  H HG2  . LYS A 1 65  ? 14.708  11.942  -6.726  1.00 0.00 ? 65  LYS A HG2  2  
ATOM 2442  H HG3  . LYS A 1 65  ? 13.451  13.162  -6.789  1.00 0.00 ? 65  LYS A HG3  2  
ATOM 2443  H HD2  . LYS A 1 65  ? 14.286  14.212  -4.727  1.00 0.00 ? 65  LYS A HD2  2  
ATOM 2444  H HD3  . LYS A 1 65  ? 15.446  12.920  -4.489  1.00 0.00 ? 65  LYS A HD3  2  
ATOM 2445  H HE2  . LYS A 1 65  ? 16.936  14.163  -5.671  1.00 0.00 ? 65  LYS A HE2  2  
ATOM 2446  H HE3  . LYS A 1 65  ? 15.988  13.812  -7.103  1.00 0.00 ? 65  LYS A HE3  2  
ATOM 2447  H HZ1  . LYS A 1 65  ? 16.295  16.247  -5.813  1.00 0.00 ? 65  LYS A HZ1  2  
ATOM 2448  H HZ2  . LYS A 1 65  ? 15.455  15.929  -7.176  1.00 0.00 ? 65  LYS A HZ2  2  
ATOM 2449  H HZ3  . LYS A 1 65  ? 14.715  15.845  -5.723  1.00 0.00 ? 65  LYS A HZ3  2  
ATOM 2450  N N    . SER A 1 66  ? 13.490  8.743   -4.234  1.00 0.00 ? 66  SER A N    2  
ATOM 2451  C CA   . SER A 1 66  ? 13.266  7.678   -3.271  1.00 0.00 ? 66  SER A CA   2  
ATOM 2452  C C    . SER A 1 66  ? 13.426  8.217   -1.849  1.00 0.00 ? 66  SER A C    2  
ATOM 2453  O O    . SER A 1 66  ? 14.332  9.005   -1.578  1.00 0.00 ? 66  SER A O    2  
ATOM 2454  C CB   . SER A 1 66  ? 14.227  6.511   -3.508  1.00 0.00 ? 66  SER A CB   2  
ATOM 2455  O OG   . SER A 1 66  ? 15.590  6.908   -3.384  1.00 0.00 ? 66  SER A OG   2  
ATOM 2456  H H    . SER A 1 66  ? 14.437  9.056   -4.306  1.00 0.00 ? 66  SER A H    2  
ATOM 2457  H HA   . SER A 1 66  ? 12.242  7.345   -3.441  1.00 0.00 ? 66  SER A HA   2  
ATOM 2458  H HB2  . SER A 1 66  ? 14.014  5.716   -2.793  1.00 0.00 ? 66  SER A HB2  2  
ATOM 2459  H HB3  . SER A 1 66  ? 14.058  6.098   -4.503  1.00 0.00 ? 66  SER A HB3  2  
ATOM 2460  H HG   . SER A 1 66  ? 16.045  6.354   -2.687  1.00 0.00 ? 66  SER A HG   2  
ATOM 2461  N N    . LEU A 1 67  ? 12.533  7.772   -0.977  1.00 0.00 ? 67  LEU A N    2  
ATOM 2462  C CA   . LEU A 1 67  ? 12.564  8.200   0.411   1.00 0.00 ? 67  LEU A CA   2  
ATOM 2463  C C    . LEU A 1 67  ? 13.507  7.289   1.200   1.00 0.00 ? 67  LEU A C    2  
ATOM 2464  O O    . LEU A 1 67  ? 13.154  6.807   2.275   1.00 0.00 ? 67  LEU A O    2  
ATOM 2465  C CB   . LEU A 1 67  ? 11.147  8.262   0.984   1.00 0.00 ? 67  LEU A CB   2  
ATOM 2466  C CG   . LEU A 1 67  ? 10.065  8.794   0.042   1.00 0.00 ? 67  LEU A CG   2  
ATOM 2467  C CD1  . LEU A 1 67  ? 8.683   8.277   0.446   1.00 0.00 ? 67  LEU A CD1  2  
ATOM 2468  C CD2  . LEU A 1 67  ? 10.107  10.322  -0.033  1.00 0.00 ? 67  LEU A CD2  2  
ATOM 2469  H H    . LEU A 1 67  ? 11.800  7.131   -1.206  1.00 0.00 ? 67  LEU A H    2  
ATOM 2470  H HA   . LEU A 1 67  ? 12.965  9.213   0.432   1.00 0.00 ? 67  LEU A HA   2  
ATOM 2471  H HB2  . LEU A 1 67  ? 10.861  7.260   1.304   1.00 0.00 ? 67  LEU A HB2  2  
ATOM 2472  H HB3  . LEU A 1 67  ? 11.164  8.889   1.876   1.00 0.00 ? 67  LEU A HB3  2  
ATOM 2473  H HG   . LEU A 1 67  ? 10.269  8.417   -0.960  1.00 0.00 ? 67  LEU A HG   2  
ATOM 2474  H HD11 . LEU A 1 67  ? 8.121   8.007   -0.448  1.00 0.00 ? 67  LEU A HD11 2  
ATOM 2475  H HD12 . LEU A 1 67  ? 8.795   7.400   1.084   1.00 0.00 ? 67  LEU A HD12 2  
ATOM 2476  H HD13 . LEU A 1 67  ? 8.149   9.056   0.990   1.00 0.00 ? 67  LEU A HD13 2  
ATOM 2477  H HD21 . LEU A 1 67  ? 10.659  10.627  -0.922  1.00 0.00 ? 67  LEU A HD21 2  
ATOM 2478  H HD22 . LEU A 1 67  ? 9.089   10.711  -0.085  1.00 0.00 ? 67  LEU A HD22 2  
ATOM 2479  H HD23 . LEU A 1 67  ? 10.601  10.716  0.855   1.00 0.00 ? 67  LEU A HD23 2  
ATOM 2480  N N    . ALA A 1 68  ? 14.687  7.081   0.636   1.00 0.00 ? 68  ALA A N    2  
ATOM 2481  C CA   . ALA A 1 68  ? 15.683  6.237   1.273   1.00 0.00 ? 68  ALA A CA   2  
ATOM 2482  C C    . ALA A 1 68  ? 15.994  6.785   2.667   1.00 0.00 ? 68  ALA A C    2  
ATOM 2483  O O    . ALA A 1 68  ? 16.769  7.729   2.808   1.00 0.00 ? 68  ALA A O    2  
ATOM 2484  C CB   . ALA A 1 68  ? 16.928  6.158   0.387   1.00 0.00 ? 68  ALA A CB   2  
ATOM 2485  H H    . ALA A 1 68  ? 14.966  7.477   -0.239  1.00 0.00 ? 68  ALA A H    2  
ATOM 2486  H HA   . ALA A 1 68  ? 15.258  5.238   1.371   1.00 0.00 ? 68  ALA A HA   2  
ATOM 2487  H HB1  . ALA A 1 68  ? 17.809  6.421   0.973   1.00 0.00 ? 68  ALA A HB1  2  
ATOM 2488  H HB2  . ALA A 1 68  ? 17.037  5.144   0.003   1.00 0.00 ? 68  ALA A HB2  2  
ATOM 2489  H HB3  . ALA A 1 68  ? 16.826  6.853   -0.446  1.00 0.00 ? 68  ALA A HB3  2  
ATOM 2490  N N    . ARG A 1 69  ? 15.372  6.169   3.662   1.00 0.00 ? 69  ARG A N    2  
ATOM 2491  C CA   . ARG A 1 69  ? 15.572  6.584   5.040   1.00 0.00 ? 69  ARG A CA   2  
ATOM 2492  C C    . ARG A 1 69  ? 15.638  8.110   5.131   1.00 0.00 ? 69  ARG A C    2  
ATOM 2493  O O    . ARG A 1 69  ? 16.724  8.688   5.160   1.00 0.00 ? 69  ARG A O    2  
ATOM 2494  C CB   . ARG A 1 69  ? 16.861  5.990   5.613   1.00 0.00 ? 69  ARG A CB   2  
ATOM 2495  C CG   . ARG A 1 69  ? 16.568  4.729   6.427   1.00 0.00 ? 69  ARG A CG   2  
ATOM 2496  C CD   . ARG A 1 69  ? 17.317  4.751   7.761   1.00 0.00 ? 69  ARG A CD   2  
ATOM 2497  N NE   . ARG A 1 69  ? 17.340  3.395   8.352   1.00 0.00 ? 69  ARG A NE   2  
ATOM 2498  C CZ   . ARG A 1 69  ? 18.008  3.073   9.469   1.00 0.00 ? 69  ARG A CZ   2  
ATOM 2499  N NH1  . ARG A 1 69  ? 18.711  4.008   10.122  1.00 0.00 ? 69  ARG A NH1  2  
ATOM 2500  N NH2  . ARG A 1 69  ? 17.972  1.816   9.932   1.00 0.00 ? 69  ARG A NH2  2  
ATOM 2501  H H    . ARG A 1 69  ? 14.743  5.402   3.539   1.00 0.00 ? 69  ARG A H    2  
ATOM 2502  H HA   . ARG A 1 69  ? 14.706  6.196   5.577   1.00 0.00 ? 69  ARG A HA   2  
ATOM 2503  H HB2  . ARG A 1 69  ? 17.548  5.752   4.800   1.00 0.00 ? 69  ARG A HB2  2  
ATOM 2504  H HB3  . ARG A 1 69  ? 17.357  6.728   6.243   1.00 0.00 ? 69  ARG A HB3  2  
ATOM 2505  H HG2  . ARG A 1 69  ? 15.497  4.649   6.609   1.00 0.00 ? 69  ARG A HG2  2  
ATOM 2506  H HG3  . ARG A 1 69  ? 16.861  3.847   5.857   1.00 0.00 ? 69  ARG A HG3  2  
ATOM 2507  H HD2  . ARG A 1 69  ? 18.336  5.108   7.610   1.00 0.00 ? 69  ARG A HD2  2  
ATOM 2508  H HD3  . ARG A 1 69  ? 16.834  5.448   8.447   1.00 0.00 ? 69  ARG A HD3  2  
ATOM 2509  H HE   . ARG A 1 69  ? 16.825  2.673   7.889   1.00 0.00 ? 69  ARG A HE   2  
ATOM 2510  H HH11 . ARG A 1 69  ? 18.738  4.946   9.776   1.00 0.00 ? 69  ARG A HH11 2  
ATOM 2511  H HH12 . ARG A 1 69  ? 19.209  3.767   10.955  1.00 0.00 ? 69  ARG A HH12 2  
ATOM 2512  H HH21 . ARG A 1 69  ? 17.447  1.118   9.444   1.00 0.00 ? 69  ARG A HH21 2  
ATOM 2513  H HH22 . ARG A 1 69  ? 18.470  1.575   10.765  1.00 0.00 ? 69  ARG A HH22 2  
ATOM 2514  N N    . VAL A 1 70  ? 14.462  8.720   5.174   1.00 0.00 ? 70  VAL A N    2  
ATOM 2515  C CA   . VAL A 1 70  ? 14.373  10.167  5.261   1.00 0.00 ? 70  VAL A CA   2  
ATOM 2516  C C    . VAL A 1 70  ? 13.375  10.547  6.357   1.00 0.00 ? 70  VAL A C    2  
ATOM 2517  O O    . VAL A 1 70  ? 12.425  9.811   6.619   1.00 0.00 ? 70  VAL A O    2  
ATOM 2518  C CB   . VAL A 1 70  ? 14.011  10.752  3.894   1.00 0.00 ? 70  VAL A CB   2  
ATOM 2519  C CG1  . VAL A 1 70  ? 15.167  10.591  2.905   1.00 0.00 ? 70  VAL A CG1  2  
ATOM 2520  C CG2  . VAL A 1 70  ? 12.730  10.118  3.349   1.00 0.00 ? 70  VAL A CG2  2  
ATOM 2521  H H    . VAL A 1 70  ? 13.584  8.242   5.150   1.00 0.00 ? 70  VAL A H    2  
ATOM 2522  H HA   . VAL A 1 70  ? 15.358  10.542  5.538   1.00 0.00 ? 70  VAL A HA   2  
ATOM 2523  H HB   . VAL A 1 70  ? 13.827  11.819  4.024   1.00 0.00 ? 70  VAL A HB   2  
ATOM 2524  H HG11 . VAL A 1 70  ? 14.780  10.238  1.949   1.00 0.00 ? 70  VAL A HG11 2  
ATOM 2525  H HG12 . VAL A 1 70  ? 15.661  11.552  2.765   1.00 0.00 ? 70  VAL A HG12 2  
ATOM 2526  H HG13 . VAL A 1 70  ? 15.882  9.868   3.298   1.00 0.00 ? 70  VAL A HG13 2  
ATOM 2527  H HG21 . VAL A 1 70  ? 12.004  10.901  3.125   1.00 0.00 ? 70  VAL A HG21 2  
ATOM 2528  H HG22 . VAL A 1 70  ? 12.958  9.564   2.438   1.00 0.00 ? 70  VAL A HG22 2  
ATOM 2529  H HG23 . VAL A 1 70  ? 12.314  9.439   4.093   1.00 0.00 ? 70  VAL A HG23 2  
ATOM 2530  N N    . THR A 1 71  ? 13.625  11.696  6.968   1.00 0.00 ? 71  THR A N    2  
ATOM 2531  C CA   . THR A 1 71  ? 12.761  12.182  8.030   1.00 0.00 ? 71  THR A CA   2  
ATOM 2532  C C    . THR A 1 71  ? 11.319  12.300  7.532   1.00 0.00 ? 71  THR A C    2  
ATOM 2533  O O    . THR A 1 71  ? 11.077  12.350  6.327   1.00 0.00 ? 71  THR A O    2  
ATOM 2534  C CB   . THR A 1 71  ? 13.337  13.504  8.541   1.00 0.00 ? 71  THR A CB   2  
ATOM 2535  O OG1  . THR A 1 71  ? 13.503  14.289  7.364   1.00 0.00 ? 71  THR A OG1  2  
ATOM 2536  C CG2  . THR A 1 71  ? 14.758  13.350  9.089   1.00 0.00 ? 71  THR A CG2  2  
ATOM 2537  H H    . THR A 1 71  ? 14.400  12.288  6.749   1.00 0.00 ? 71  THR A H    2  
ATOM 2538  H HA   . THR A 1 71  ? 12.761  11.449  8.837   1.00 0.00 ? 71  THR A HA   2  
ATOM 2539  H HB   . THR A 1 71  ? 12.680  13.954  9.285   1.00 0.00 ? 71  THR A HB   2  
ATOM 2540  H HG1  . THR A 1 71  ? 13.199  15.226  7.532   1.00 0.00 ? 71  THR A HG1  2  
ATOM 2541  H HG21 . THR A 1 71  ? 14.885  12.345  9.491   1.00 0.00 ? 71  THR A HG21 2  
ATOM 2542  H HG22 . THR A 1 71  ? 15.477  13.515  8.286   1.00 0.00 ? 71  THR A HG22 2  
ATOM 2543  H HG23 . THR A 1 71  ? 14.923  14.081  9.880   1.00 0.00 ? 71  THR A HG23 2  
ATOM 2544  N N    . HIS A 1 72  ? 10.399  12.343  8.485   1.00 0.00 ? 72  HIS A N    2  
ATOM 2545  C CA   . HIS A 1 72  ? 8.988   12.454  8.158   1.00 0.00 ? 72  HIS A CA   2  
ATOM 2546  C C    . HIS A 1 72  ? 8.741   13.751  7.385   1.00 0.00 ? 72  HIS A C    2  
ATOM 2547  O O    . HIS A 1 72  ? 7.829   13.824  6.562   1.00 0.00 ? 72  HIS A O    2  
ATOM 2548  C CB   . HIS A 1 72  ? 8.128   12.342  9.418   1.00 0.00 ? 72  HIS A CB   2  
ATOM 2549  C CG   . HIS A 1 72  ? 6.748   11.779  9.173   1.00 0.00 ? 72  HIS A CG   2  
ATOM 2550  N ND1  . HIS A 1 72  ? 5.590   12.476  9.472   1.00 0.00 ? 72  HIS A ND1  2  
ATOM 2551  C CD2  . HIS A 1 72  ? 6.354   10.582  8.653   1.00 0.00 ? 72  HIS A CD2  2  
ATOM 2552  C CE1  . HIS A 1 72  ? 4.552   11.721  9.144   1.00 0.00 ? 72  HIS A CE1  2  
ATOM 2553  N NE2  . HIS A 1 72  ? 5.027   10.547  8.637   1.00 0.00 ? 72  HIS A NE2  2  
ATOM 2554  H H    . HIS A 1 72  ? 10.604  12.302  9.463   1.00 0.00 ? 72  HIS A H    2  
ATOM 2555  H HA   . HIS A 1 72  ? 8.748   11.607  7.515   1.00 0.00 ? 72  HIS A HA   2  
ATOM 2556  H HB2  . HIS A 1 72  ? 8.643   11.711  10.142  1.00 0.00 ? 72  HIS A HB2  2  
ATOM 2557  H HB3  . HIS A 1 72  ? 8.031   13.330  9.869   1.00 0.00 ? 72  HIS A HB3  2  
ATOM 2558  H HD1  . HIS A 1 72  ? 5.545   13.392  9.868   1.00 0.00 ? 72  HIS A HD1  2  
ATOM 2559  H HD2  . HIS A 1 72  ? 7.017   9.787   8.309   1.00 0.00 ? 72  HIS A HD2  2  
ATOM 2560  H HE1  . HIS A 1 72  ? 3.502   11.991  9.258   1.00 0.00 ? 72  HIS A HE1  2  
ATOM 2561  N N    . ALA A 1 73  ? 9.570   14.743  7.677   1.00 0.00 ? 73  ALA A N    2  
ATOM 2562  C CA   . ALA A 1 73  ? 9.453   16.034  7.019   1.00 0.00 ? 73  ALA A CA   2  
ATOM 2563  C C    . ALA A 1 73  ? 9.889   15.899  5.559   1.00 0.00 ? 73  ALA A C    2  
ATOM 2564  O O    . ALA A 1 73  ? 9.368   16.591  4.686   1.00 0.00 ? 73  ALA A O    2  
ATOM 2565  C CB   . ALA A 1 73  ? 10.280  17.071  7.781   1.00 0.00 ? 73  ALA A CB   2  
ATOM 2566  H H    . ALA A 1 73  ? 10.309  14.675  8.347   1.00 0.00 ? 73  ALA A H    2  
ATOM 2567  H HA   . ALA A 1 73  ? 8.404   16.329  7.051   1.00 0.00 ? 73  ALA A HA   2  
ATOM 2568  H HB1  . ALA A 1 73  ? 10.605  16.650  8.732   1.00 0.00 ? 73  ALA A HB1  2  
ATOM 2569  H HB2  . ALA A 1 73  ? 11.152  17.347  7.189   1.00 0.00 ? 73  ALA A HB2  2  
ATOM 2570  H HB3  . ALA A 1 73  ? 9.671   17.957  7.965   1.00 0.00 ? 73  ALA A HB3  2  
ATOM 2571  N N    . GLU A 1 74  ? 10.840  15.003  5.339   1.00 0.00 ? 74  GLU A N    2  
ATOM 2572  C CA   . GLU A 1 74  ? 11.351  14.768  4.000   1.00 0.00 ? 74  GLU A CA   2  
ATOM 2573  C C    . GLU A 1 74  ? 10.270  14.134  3.122   1.00 0.00 ? 74  GLU A C    2  
ATOM 2574  O O    . GLU A 1 74  ? 9.916   14.678  2.077   1.00 0.00 ? 74  GLU A O    2  
ATOM 2575  C CB   . GLU A 1 74  ? 12.608  13.896  4.038   1.00 0.00 ? 74  GLU A CB   2  
ATOM 2576  C CG   . GLU A 1 74  ? 13.859  14.746  4.269   1.00 0.00 ? 74  GLU A CG   2  
ATOM 2577  C CD   . GLU A 1 74  ? 14.111  15.684  3.087   1.00 0.00 ? 74  GLU A CD   2  
ATOM 2578  O OE1  . GLU A 1 74  ? 14.287  15.153  1.969   1.00 0.00 ? 74  GLU A OE1  2  
ATOM 2579  O OE2  . GLU A 1 74  ? 14.122  16.910  3.328   1.00 0.00 ? 74  GLU A OE2  2  
ATOM 2580  H H    . GLU A 1 74  ? 11.258  14.444  6.055   1.00 0.00 ? 74  GLU A H    2  
ATOM 2581  H HA   . GLU A 1 74  ? 11.612  15.753  3.612   1.00 0.00 ? 74  GLU A HA   2  
ATOM 2582  H HB2  . GLU A 1 74  ? 12.516  13.154  4.831   1.00 0.00 ? 74  GLU A HB2  2  
ATOM 2583  H HB3  . GLU A 1 74  ? 12.704  13.349  3.099   1.00 0.00 ? 74  GLU A HB3  2  
ATOM 2584  H HG2  . GLU A 1 74  ? 13.742  15.329  5.182   1.00 0.00 ? 74  GLU A HG2  2  
ATOM 2585  H HG3  . GLU A 1 74  ? 14.722  14.097  4.413   1.00 0.00 ? 74  GLU A HG3  2  
ATOM 2586  N N    . ALA A 1 75  ? 9.776   12.993  3.578   1.00 0.00 ? 75  ALA A N    2  
ATOM 2587  C CA   . ALA A 1 75  ? 8.742   12.279  2.848   1.00 0.00 ? 75  ALA A CA   2  
ATOM 2588  C C    . ALA A 1 75  ? 7.579   13.230  2.559   1.00 0.00 ? 75  ALA A C    2  
ATOM 2589  O O    . ALA A 1 75  ? 7.127   13.336  1.420   1.00 0.00 ? 75  ALA A O    2  
ATOM 2590  C CB   . ALA A 1 75  ? 8.306   11.051  3.649   1.00 0.00 ? 75  ALA A CB   2  
ATOM 2591  H H    . ALA A 1 75  ? 10.070  12.557  4.429   1.00 0.00 ? 75  ALA A H    2  
ATOM 2592  H HA   . ALA A 1 75  ? 9.173   11.948  1.903   1.00 0.00 ? 75  ALA A HA   2  
ATOM 2593  H HB1  . ALA A 1 75  ? 7.263   10.826  3.429   1.00 0.00 ? 75  ALA A HB1  2  
ATOM 2594  H HB2  . ALA A 1 75  ? 8.927   10.199  3.374   1.00 0.00 ? 75  ALA A HB2  2  
ATOM 2595  H HB3  . ALA A 1 75  ? 8.418   11.253  4.714   1.00 0.00 ? 75  ALA A HB3  2  
ATOM 2596  N N    . VAL A 1 76  ? 7.128   13.899  3.610   1.00 0.00 ? 76  VAL A N    2  
ATOM 2597  C CA   . VAL A 1 76  ? 6.026   14.837  3.484   1.00 0.00 ? 76  VAL A CA   2  
ATOM 2598  C C    . VAL A 1 76  ? 6.348   15.850  2.383   1.00 0.00 ? 76  VAL A C    2  
ATOM 2599  O O    . VAL A 1 76  ? 5.590   15.992  1.424   1.00 0.00 ? 76  VAL A O    2  
ATOM 2600  C CB   . VAL A 1 76  ? 5.741   15.495  4.835   1.00 0.00 ? 76  VAL A CB   2  
ATOM 2601  C CG1  . VAL A 1 76  ? 4.629   16.539  4.714   1.00 0.00 ? 76  VAL A CG1  2  
ATOM 2602  C CG2  . VAL A 1 76  ? 5.394   14.445  5.893   1.00 0.00 ? 76  VAL A CG2  2  
ATOM 2603  H H    . VAL A 1 76  ? 7.501   13.807  4.533   1.00 0.00 ? 76  VAL A H    2  
ATOM 2604  H HA   . VAL A 1 76  ? 5.143   14.270  3.191   1.00 0.00 ? 76  VAL A HA   2  
ATOM 2605  H HB   . VAL A 1 76  ? 6.648   16.007  5.157   1.00 0.00 ? 76  VAL A HB   2  
ATOM 2606  H HG11 . VAL A 1 76  ? 4.794   17.143  3.822   1.00 0.00 ? 76  VAL A HG11 2  
ATOM 2607  H HG12 . VAL A 1 76  ? 3.665   16.035  4.638   1.00 0.00 ? 76  VAL A HG12 2  
ATOM 2608  H HG13 . VAL A 1 76  ? 4.636   17.181  5.594   1.00 0.00 ? 76  VAL A HG13 2  
ATOM 2609  H HG21 . VAL A 1 76  ? 5.807   13.481  5.597   1.00 0.00 ? 76  VAL A HG21 2  
ATOM 2610  H HG22 . VAL A 1 76  ? 5.818   14.742  6.853   1.00 0.00 ? 76  VAL A HG22 2  
ATOM 2611  H HG23 . VAL A 1 76  ? 4.311   14.364  5.984   1.00 0.00 ? 76  VAL A HG23 2  
ATOM 2612  N N    . LYS A 1 77  ? 7.474   16.527  2.556   1.00 0.00 ? 77  LYS A N    2  
ATOM 2613  C CA   . LYS A 1 77  ? 7.905   17.522  1.589   1.00 0.00 ? 77  LYS A CA   2  
ATOM 2614  C C    . LYS A 1 77  ? 7.900   16.903  0.190   1.00 0.00 ? 77  LYS A C    2  
ATOM 2615  O O    . LYS A 1 77  ? 7.831   17.618  -0.808  1.00 0.00 ? 77  LYS A O    2  
ATOM 2616  C CB   . LYS A 1 77  ? 9.257   18.113  1.996   1.00 0.00 ? 77  LYS A CB   2  
ATOM 2617  C CG   . LYS A 1 77  ? 9.073   19.331  2.903   1.00 0.00 ? 77  LYS A CG   2  
ATOM 2618  C CD   . LYS A 1 77  ? 10.411  20.021  3.172   1.00 0.00 ? 77  LYS A CD   2  
ATOM 2619  C CE   . LYS A 1 77  ? 10.210  21.321  3.954   1.00 0.00 ? 77  LYS A CE   2  
ATOM 2620  N NZ   . LYS A 1 77  ? 11.464  21.717  4.632   1.00 0.00 ? 77  LYS A NZ   2  
ATOM 2621  H H    . LYS A 1 77  ? 8.085   16.405  3.339   1.00 0.00 ? 77  LYS A H    2  
ATOM 2622  H HA   . LYS A 1 77  ? 7.179   18.334  1.610   1.00 0.00 ? 77  LYS A HA   2  
ATOM 2623  H HB2  . LYS A 1 77  ? 9.849   17.357  2.512   1.00 0.00 ? 77  LYS A HB2  2  
ATOM 2624  H HB3  . LYS A 1 77  ? 9.815   18.399  1.104   1.00 0.00 ? 77  LYS A HB3  2  
ATOM 2625  H HG2  . LYS A 1 77  ? 8.384   20.035  2.436   1.00 0.00 ? 77  LYS A HG2  2  
ATOM 2626  H HG3  . LYS A 1 77  ? 8.623   19.022  3.846   1.00 0.00 ? 77  LYS A HG3  2  
ATOM 2627  H HD2  . LYS A 1 77  ? 11.063  19.352  3.734   1.00 0.00 ? 77  LYS A HD2  2  
ATOM 2628  H HD3  . LYS A 1 77  ? 10.911  20.235  2.227   1.00 0.00 ? 77  LYS A HD3  2  
ATOM 2629  H HE2  . LYS A 1 77  ? 9.890   22.113  3.277   1.00 0.00 ? 77  LYS A HE2  2  
ATOM 2630  H HE3  . LYS A 1 77  ? 9.417   21.191  4.690   1.00 0.00 ? 77  LYS A HE3  2  
ATOM 2631  H HZ1  . LYS A 1 77  ? 11.397  21.505  5.607   1.00 0.00 ? 77  LYS A HZ1  2  
ATOM 2632  H HZ2  . LYS A 1 77  ? 12.232  21.215  4.234   1.00 0.00 ? 77  LYS A HZ2  2  
ATOM 2633  H HZ3  . LYS A 1 77  ? 11.611  22.700  4.515   1.00 0.00 ? 77  LYS A HZ3  2  
ATOM 2634  N N    . ALA A 1 78  ? 7.975   15.580  0.163   1.00 0.00 ? 78  ALA A N    2  
ATOM 2635  C CA   . ALA A 1 78  ? 7.979   14.857  -1.097  1.00 0.00 ? 78  ALA A CA   2  
ATOM 2636  C C    . ALA A 1 78  ? 6.538   14.564  -1.518  1.00 0.00 ? 78  ALA A C    2  
ATOM 2637  O O    . ALA A 1 78  ? 6.170   14.770  -2.673  1.00 0.00 ? 78  ALA A O    2  
ATOM 2638  C CB   . ALA A 1 78  ? 8.815   13.584  -0.952  1.00 0.00 ? 78  ALA A CB   2  
ATOM 2639  H H    . ALA A 1 78  ? 8.031   15.006  0.980   1.00 0.00 ? 78  ALA A H    2  
ATOM 2640  H HA   . ALA A 1 78  ? 8.444   15.499  -1.846  1.00 0.00 ? 78  ALA A HA   2  
ATOM 2641  H HB1  . ALA A 1 78  ? 9.714   13.802  -0.375  1.00 0.00 ? 78  ALA A HB1  2  
ATOM 2642  H HB2  . ALA A 1 78  ? 8.230   12.822  -0.438  1.00 0.00 ? 78  ALA A HB2  2  
ATOM 2643  H HB3  . ALA A 1 78  ? 9.097   13.220  -1.940  1.00 0.00 ? 78  ALA A HB3  2  
ATOM 2644  N N    . LEU A 1 79  ? 5.760   14.087  -0.556  1.00 0.00 ? 79  LEU A N    2  
ATOM 2645  C CA   . LEU A 1 79  ? 4.367   13.763  -0.812  1.00 0.00 ? 79  LEU A CA   2  
ATOM 2646  C C    . LEU A 1 79  ? 3.567   15.058  -0.966  1.00 0.00 ? 79  LEU A C    2  
ATOM 2647  O O    . LEU A 1 79  ? 2.864   15.470  -0.045  1.00 0.00 ? 79  LEU A O    2  
ATOM 2648  C CB   . LEU A 1 79  ? 3.826   12.831  0.273   1.00 0.00 ? 79  LEU A CB   2  
ATOM 2649  C CG   . LEU A 1 79  ? 4.183   11.350  0.125   1.00 0.00 ? 79  LEU A CG   2  
ATOM 2650  C CD1  . LEU A 1 79  ? 4.282   10.671  1.492   1.00 0.00 ? 79  LEU A CD1  2  
ATOM 2651  C CD2  . LEU A 1 79  ? 3.194   10.637  -0.799  1.00 0.00 ? 79  LEU A CD2  2  
ATOM 2652  H H    . LEU A 1 79  ? 6.067   13.922  0.381   1.00 0.00 ? 79  LEU A H    2  
ATOM 2653  H HA   . LEU A 1 79  ? 4.326   13.218  -1.755  1.00 0.00 ? 79  LEU A HA   2  
ATOM 2654  H HB2  . LEU A 1 79  ? 4.193   13.178  1.239   1.00 0.00 ? 79  LEU A HB2  2  
ATOM 2655  H HB3  . LEU A 1 79  ? 2.740   12.922  0.294   1.00 0.00 ? 79  LEU A HB3  2  
ATOM 2656  H HG   . LEU A 1 79  ? 5.166   11.281  -0.340  1.00 0.00 ? 79  LEU A HG   2  
ATOM 2657  H HD11 . LEU A 1 79  ? 3.697   11.233  2.221   1.00 0.00 ? 79  LEU A HD11 2  
ATOM 2658  H HD12 . LEU A 1 79  ? 3.894   9.655   1.422   1.00 0.00 ? 79  LEU A HD12 2  
ATOM 2659  H HD13 . LEU A 1 79  ? 5.325   10.641  1.809   1.00 0.00 ? 79  LEU A HD13 2  
ATOM 2660  H HD21 . LEU A 1 79  ? 3.619   9.687   -1.122  1.00 0.00 ? 79  LEU A HD21 2  
ATOM 2661  H HD22 . LEU A 1 79  ? 2.263   10.455  -0.263  1.00 0.00 ? 79  LEU A HD22 2  
ATOM 2662  H HD23 . LEU A 1 79  ? 2.996   11.262  -1.670  1.00 0.00 ? 79  LEU A HD23 2  
ATOM 2663  N N    . LYS A 1 80  ? 3.701   15.664  -2.137  1.00 0.00 ? 80  LYS A N    2  
ATOM 2664  C CA   . LYS A 1 80  ? 2.999   16.904  -2.423  1.00 0.00 ? 80  LYS A CA   2  
ATOM 2665  C C    . LYS A 1 80  ? 2.370   16.819  -3.815  1.00 0.00 ? 80  LYS A C    2  
ATOM 2666  O O    . LYS A 1 80  ? 2.726   15.949  -4.609  1.00 0.00 ? 80  LYS A O    2  
ATOM 2667  C CB   . LYS A 1 80  ? 3.933   18.102  -2.242  1.00 0.00 ? 80  LYS A CB   2  
ATOM 2668  C CG   . LYS A 1 80  ? 3.716   18.766  -0.880  1.00 0.00 ? 80  LYS A CG   2  
ATOM 2669  C CD   . LYS A 1 80  ? 5.034   18.892  -0.115  1.00 0.00 ? 80  LYS A CD   2  
ATOM 2670  C CE   . LYS A 1 80  ? 5.095   20.210  0.660   1.00 0.00 ? 80  LYS A CE   2  
ATOM 2671  N NZ   . LYS A 1 80  ? 3.839   20.426  1.413   1.00 0.00 ? 80  LYS A NZ   2  
ATOM 2672  H H    . LYS A 1 80  ? 4.275   15.322  -2.881  1.00 0.00 ? 80  LYS A H    2  
ATOM 2673  H HA   . LYS A 1 80  ? 2.201   17.004  -1.688  1.00 0.00 ? 80  LYS A HA   2  
ATOM 2674  H HB2  . LYS A 1 80  ? 4.970   17.777  -2.330  1.00 0.00 ? 80  LYS A HB2  2  
ATOM 2675  H HB3  . LYS A 1 80  ? 3.758   18.827  -3.036  1.00 0.00 ? 80  LYS A HB3  2  
ATOM 2676  H HG2  . LYS A 1 80  ? 3.276   19.753  -1.020  1.00 0.00 ? 80  LYS A HG2  2  
ATOM 2677  H HG3  . LYS A 1 80  ? 3.006   18.181  -0.296  1.00 0.00 ? 80  LYS A HG3  2  
ATOM 2678  H HD2  . LYS A 1 80  ? 5.140   18.055  0.576   1.00 0.00 ? 80  LYS A HD2  2  
ATOM 2679  H HD3  . LYS A 1 80  ? 5.870   18.837  -0.812  1.00 0.00 ? 80  LYS A HD3  2  
ATOM 2680  H HE2  . LYS A 1 80  ? 5.941   20.197  1.347   1.00 0.00 ? 80  LYS A HE2  2  
ATOM 2681  H HE3  . LYS A 1 80  ? 5.258   21.037  -0.031  1.00 0.00 ? 80  LYS A HE3  2  
ATOM 2682  H HZ1  . LYS A 1 80  ? 3.529   19.558  1.800   1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 2683  H HZ2  . LYS A 1 80  ? 4.002   21.081  2.151   1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 2684  H HZ3  . LYS A 1 80  ? 3.138   20.786  0.797   1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 2685  N N    . GLY A 1 81  ? 1.447   17.735  -4.069  1.00 0.00 ? 81  GLY A N    2  
ATOM 2686  C CA   . GLY A 1 81  ? 0.765   17.775  -5.351  1.00 0.00 ? 81  GLY A CA   2  
ATOM 2687  C C    . GLY A 1 81  ? 1.727   18.175  -6.471  1.00 0.00 ? 81  GLY A C    2  
ATOM 2688  O O    . GLY A 1 81  ? 1.781   19.340  -6.862  1.00 0.00 ? 81  GLY A O    2  
ATOM 2689  H H    . GLY A 1 81  ? 1.164   18.439  -3.417  1.00 0.00 ? 81  GLY A H    2  
ATOM 2690  H HA2  . GLY A 1 81  ? 0.335   16.797  -5.569  1.00 0.00 ? 81  GLY A HA2  2  
ATOM 2691  H HA3  . GLY A 1 81  ? -0.061  18.484  -5.306  1.00 0.00 ? 81  GLY A HA3  2  
ATOM 2692  N N    . SER A 1 82  ? 2.464   17.186  -6.957  1.00 0.00 ? 82  SER A N    2  
ATOM 2693  C CA   . SER A 1 82  ? 3.421   17.421  -8.024  1.00 0.00 ? 82  SER A CA   2  
ATOM 2694  C C    . SER A 1 82  ? 2.917   16.795  -9.326  1.00 0.00 ? 82  SER A C    2  
ATOM 2695  O O    . SER A 1 82  ? 1.979   16.000  -9.314  1.00 0.00 ? 82  SER A O    2  
ATOM 2696  C CB   . SER A 1 82  ? 4.798   16.859  -7.663  1.00 0.00 ? 82  SER A CB   2  
ATOM 2697  O OG   . SER A 1 82  ? 4.703   15.603  -6.996  1.00 0.00 ? 82  SER A OG   2  
ATOM 2698  H H    . SER A 1 82  ? 2.415   16.241  -6.634  1.00 0.00 ? 82  SER A H    2  
ATOM 2699  H HA   . SER A 1 82  ? 3.486   18.505  -8.121  1.00 0.00 ? 82  SER A HA   2  
ATOM 2700  H HB2  . SER A 1 82  ? 5.391   16.743  -8.570  1.00 0.00 ? 82  SER A HB2  2  
ATOM 2701  H HB3  . SER A 1 82  ? 5.324   17.569  -7.026  1.00 0.00 ? 82  SER A HB3  2  
ATOM 2702  H HG   . SER A 1 82  ? 5.339   15.577  -6.225  1.00 0.00 ? 82  SER A HG   2  
ATOM 2703  N N    . LYS A 1 83  ? 3.563   17.178  -10.418 1.00 0.00 ? 83  LYS A N    2  
ATOM 2704  C CA   . LYS A 1 83  ? 3.191   16.664  -11.726 1.00 0.00 ? 83  LYS A CA   2  
ATOM 2705  C C    . LYS A 1 83  ? 2.974   15.153  -11.632 1.00 0.00 ? 83  LYS A C    2  
ATOM 2706  O O    . LYS A 1 83  ? 3.927   14.379  -11.703 1.00 0.00 ? 83  LYS A O    2  
ATOM 2707  C CB   . LYS A 1 83  ? 4.227   17.072  -12.776 1.00 0.00 ? 83  LYS A CB   2  
ATOM 2708  C CG   . LYS A 1 83  ? 3.635   18.075  -13.768 1.00 0.00 ? 83  LYS A CG   2  
ATOM 2709  C CD   . LYS A 1 83  ? 4.511   18.193  -15.017 1.00 0.00 ? 83  LYS A CD   2  
ATOM 2710  C CE   . LYS A 1 83  ? 3.956   19.245  -15.979 1.00 0.00 ? 83  LYS A CE   2  
ATOM 2711  N NZ   . LYS A 1 83  ? 4.946   19.556  -17.035 1.00 0.00 ? 83  LYS A NZ   2  
ATOM 2712  H H    . LYS A 1 83  ? 4.325   17.825  -10.419 1.00 0.00 ? 83  LYS A H    2  
ATOM 2713  H HA   . LYS A 1 83  ? 2.247   17.132  -12.005 1.00 0.00 ? 83  LYS A HA   2  
ATOM 2714  H HB2  . LYS A 1 83  ? 5.095   17.511  -12.284 1.00 0.00 ? 83  LYS A HB2  2  
ATOM 2715  H HB3  . LYS A 1 83  ? 4.576   16.189  -13.310 1.00 0.00 ? 83  LYS A HB3  2  
ATOM 2716  H HG2  . LYS A 1 83  ? 2.631   17.761  -14.053 1.00 0.00 ? 83  LYS A HG2  2  
ATOM 2717  H HG3  . LYS A 1 83  ? 3.541   19.051  -13.292 1.00 0.00 ? 83  LYS A HG3  2  
ATOM 2718  H HD2  . LYS A 1 83  ? 5.528   18.460  -14.728 1.00 0.00 ? 83  LYS A HD2  2  
ATOM 2719  H HD3  . LYS A 1 83  ? 4.566   17.227  -15.520 1.00 0.00 ? 83  LYS A HD3  2  
ATOM 2720  H HE2  . LYS A 1 83  ? 3.034   18.880  -16.433 1.00 0.00 ? 83  LYS A HE2  2  
ATOM 2721  H HE3  . LYS A 1 83  ? 3.703   20.152  -15.430 1.00 0.00 ? 83  LYS A HE3  2  
ATOM 2722  H HZ1  . LYS A 1 83  ? 4.501   20.071  -17.767 1.00 0.00 ? 83  LYS A HZ1  2  
ATOM 2723  H HZ2  . LYS A 1 83  ? 5.687   20.103  -16.645 1.00 0.00 ? 83  LYS A HZ2  2  
ATOM 2724  H HZ3  . LYS A 1 83  ? 5.318   18.704  -17.404 1.00 0.00 ? 83  LYS A HZ3  2  
ATOM 2725  N N    . LYS A 1 84  ? 1.713   14.777  -11.474 1.00 0.00 ? 84  LYS A N    2  
ATOM 2726  C CA   . LYS A 1 84  ? 1.358   13.372  -11.369 1.00 0.00 ? 84  LYS A CA   2  
ATOM 2727  C C    . LYS A 1 84  ? 2.211   12.714  -10.283 1.00 0.00 ? 84  LYS A C    2  
ATOM 2728  O O    . LYS A 1 84  ? 3.367   12.368  -10.520 1.00 0.00 ? 84  LYS A O    2  
ATOM 2729  C CB   . LYS A 1 84  ? 1.468   12.689  -12.734 1.00 0.00 ? 84  LYS A CB   2  
ATOM 2730  C CG   . LYS A 1 84  ? 0.702   11.364  -12.747 1.00 0.00 ? 84  LYS A CG   2  
ATOM 2731  C CD   . LYS A 1 84  ? -0.738  11.567  -13.222 1.00 0.00 ? 84  LYS A CD   2  
ATOM 2732  C CE   . LYS A 1 84  ? -0.921  11.052  -14.651 1.00 0.00 ? 84  LYS A CE   2  
ATOM 2733  N NZ   . LYS A 1 84  ? -1.678  12.032  -15.462 1.00 0.00 ? 84  LYS A NZ   2  
ATOM 2734  H H    . LYS A 1 84  ? 0.943   15.413  -11.417 1.00 0.00 ? 84  LYS A H    2  
ATOM 2735  H HA   . LYS A 1 84  ? 0.312   13.321  -11.066 1.00 0.00 ? 84  LYS A HA   2  
ATOM 2736  H HB2  . LYS A 1 84  ? 1.074   13.348  -13.508 1.00 0.00 ? 84  LYS A HB2  2  
ATOM 2737  H HB3  . LYS A 1 84  ? 2.516   12.510  -12.972 1.00 0.00 ? 84  LYS A HB3  2  
ATOM 2738  H HG2  . LYS A 1 84  ? 1.209   10.654  -13.402 1.00 0.00 ? 84  LYS A HG2  2  
ATOM 2739  H HG3  . LYS A 1 84  ? 0.702   10.931  -11.747 1.00 0.00 ? 84  LYS A HG3  2  
ATOM 2740  H HD2  . LYS A 1 84  ? -1.422  11.046  -12.553 1.00 0.00 ? 84  LYS A HD2  2  
ATOM 2741  H HD3  . LYS A 1 84  ? -0.993  12.626  -13.178 1.00 0.00 ? 84  LYS A HD3  2  
ATOM 2742  H HE2  . LYS A 1 84  ? 0.052   10.869  -15.106 1.00 0.00 ? 84  LYS A HE2  2  
ATOM 2743  H HE3  . LYS A 1 84  ? -1.450  10.099  -14.636 1.00 0.00 ? 84  LYS A HE3  2  
ATOM 2744  H HZ1  . LYS A 1 84  ? -1.578  12.944  -15.063 1.00 0.00 ? 84  LYS A HZ1  2  
ATOM 2745  H HZ2  . LYS A 1 84  ? -1.322  12.037  -16.397 1.00 0.00 ? 84  LYS A HZ2  2  
ATOM 2746  H HZ3  . LYS A 1 84  ? -2.645  11.778  -15.475 1.00 0.00 ? 84  LYS A HZ3  2  
ATOM 2747  N N    . LEU A 1 85  ? 1.607   12.562  -9.113  1.00 0.00 ? 85  LEU A N    2  
ATOM 2748  C CA   . LEU A 1 85  ? 2.297   11.952  -7.989  1.00 0.00 ? 85  LEU A CA   2  
ATOM 2749  C C    . LEU A 1 85  ? 2.172   10.430  -8.084  1.00 0.00 ? 85  LEU A C    2  
ATOM 2750  O O    . LEU A 1 85  ? 1.088   9.880   -7.897  1.00 0.00 ? 85  LEU A O    2  
ATOM 2751  C CB   . LEU A 1 85  ? 1.784   12.530  -6.668  1.00 0.00 ? 85  LEU A CB   2  
ATOM 2752  C CG   . LEU A 1 85  ? 2.355   11.902  -5.395  1.00 0.00 ? 85  LEU A CG   2  
ATOM 2753  C CD1  . LEU A 1 85  ? 3.835   11.556  -5.570  1.00 0.00 ? 85  LEU A CD1  2  
ATOM 2754  C CD2  . LEU A 1 85  ? 2.118   12.807  -4.184  1.00 0.00 ? 85  LEU A CD2  2  
ATOM 2755  H H    . LEU A 1 85  ? 0.667   12.847  -8.928  1.00 0.00 ? 85  LEU A H    2  
ATOM 2756  H HA   . LEU A 1 85  ? 3.351   12.218  -8.069  1.00 0.00 ? 85  LEU A HA   2  
ATOM 2757  H HB2  . LEU A 1 85  ? 2.002   13.598  -6.653  1.00 0.00 ? 85  LEU A HB2  2  
ATOM 2758  H HB3  . LEU A 1 85  ? 0.699   12.426  -6.646  1.00 0.00 ? 85  LEU A HB3  2  
ATOM 2759  H HG   . LEU A 1 85  ? 1.826   10.968  -5.207  1.00 0.00 ? 85  LEU A HG   2  
ATOM 2760  H HD11 . LEU A 1 85  ? 4.329   11.571  -4.599  1.00 0.00 ? 85  LEU A HD11 2  
ATOM 2761  H HD12 . LEU A 1 85  ? 3.926   10.562  -6.009  1.00 0.00 ? 85  LEU A HD12 2  
ATOM 2762  H HD13 . LEU A 1 85  ? 4.304   12.287  -6.228  1.00 0.00 ? 85  LEU A HD13 2  
ATOM 2763  H HD21 . LEU A 1 85  ? 2.279   12.238  -3.268  1.00 0.00 ? 85  LEU A HD21 2  
ATOM 2764  H HD22 . LEU A 1 85  ? 2.811   13.647  -4.217  1.00 0.00 ? 85  LEU A HD22 2  
ATOM 2765  H HD23 . LEU A 1 85  ? 1.093   13.179  -4.204  1.00 0.00 ? 85  LEU A HD23 2  
ATOM 2766  N N    . VAL A 1 86  ? 3.296   9.793   -8.376  1.00 0.00 ? 86  VAL A N    2  
ATOM 2767  C CA   . VAL A 1 86  ? 3.326   8.345   -8.498  1.00 0.00 ? 86  VAL A CA   2  
ATOM 2768  C C    . VAL A 1 86  ? 3.895   7.741   -7.213  1.00 0.00 ? 86  VAL A C    2  
ATOM 2769  O O    . VAL A 1 86  ? 5.103   7.776   -6.988  1.00 0.00 ? 86  VAL A O    2  
ATOM 2770  C CB   . VAL A 1 86  ? 4.112   7.942   -9.747  1.00 0.00 ? 86  VAL A CB   2  
ATOM 2771  C CG1  . VAL A 1 86  ? 4.417   6.443   -9.743  1.00 0.00 ? 86  VAL A CG1  2  
ATOM 2772  C CG2  . VAL A 1 86  ? 3.364   8.346   -11.020 1.00 0.00 ? 86  VAL A CG2  2  
ATOM 2773  H H    . VAL A 1 86  ? 4.174   10.248  -8.527  1.00 0.00 ? 86  VAL A H    2  
ATOM 2774  H HA   . VAL A 1 86  ? 2.298   8.005   -8.622  1.00 0.00 ? 86  VAL A HA   2  
ATOM 2775  H HB   . VAL A 1 86  ? 5.062   8.477   -9.733  1.00 0.00 ? 86  VAL A HB   2  
ATOM 2776  H HG11 . VAL A 1 86  ? 3.992   5.989   -8.848  1.00 0.00 ? 86  VAL A HG11 2  
ATOM 2777  H HG12 . VAL A 1 86  ? 3.980   5.980   -10.627 1.00 0.00 ? 86  VAL A HG12 2  
ATOM 2778  H HG13 . VAL A 1 86  ? 5.497   6.292   -9.749  1.00 0.00 ? 86  VAL A HG13 2  
ATOM 2779  H HG21 . VAL A 1 86  ? 2.297   8.414   -10.808 1.00 0.00 ? 86  VAL A HG21 2  
ATOM 2780  H HG22 . VAL A 1 86  ? 3.729   9.314   -11.364 1.00 0.00 ? 86  VAL A HG22 2  
ATOM 2781  H HG23 . VAL A 1 86  ? 3.534   7.597   -11.794 1.00 0.00 ? 86  VAL A HG23 2  
ATOM 2782  N N    . LEU A 1 87  ? 2.996   7.200   -6.403  1.00 0.00 ? 87  LEU A N    2  
ATOM 2783  C CA   . LEU A 1 87  ? 3.393   6.589   -5.146  1.00 0.00 ? 87  LEU A CA   2  
ATOM 2784  C C    . LEU A 1 87  ? 3.967   5.197   -5.420  1.00 0.00 ? 87  LEU A C    2  
ATOM 2785  O O    . LEU A 1 87  ? 3.294   4.347   -6.002  1.00 0.00 ? 87  LEU A O    2  
ATOM 2786  C CB   . LEU A 1 87  ? 2.225   6.589   -4.158  1.00 0.00 ? 87  LEU A CB   2  
ATOM 2787  C CG   . LEU A 1 87  ? 1.507   7.926   -3.968  1.00 0.00 ? 87  LEU A CG   2  
ATOM 2788  C CD1  . LEU A 1 87  ? 2.510   9.074   -3.842  1.00 0.00 ? 87  LEU A CD1  2  
ATOM 2789  C CD2  . LEU A 1 87  ? 0.495   8.170   -5.090  1.00 0.00 ? 87  LEU A CD2  2  
ATOM 2790  H H    . LEU A 1 87  ? 2.015   7.176   -6.594  1.00 0.00 ? 87  LEU A H    2  
ATOM 2791  H HA   . LEU A 1 87  ? 4.179   7.208   -4.716  1.00 0.00 ? 87  LEU A HA   2  
ATOM 2792  H HB2  . LEU A 1 87  ? 1.495   5.851   -4.489  1.00 0.00 ? 87  LEU A HB2  2  
ATOM 2793  H HB3  . LEU A 1 87  ? 2.596   6.257   -3.188  1.00 0.00 ? 87  LEU A HB3  2  
ATOM 2794  H HG   . LEU A 1 87  ? 0.947   7.884   -3.034  1.00 0.00 ? 87  LEU A HG   2  
ATOM 2795  H HD11 . LEU A 1 87  ? 3.322   8.776   -3.179  1.00 0.00 ? 87  LEU A HD11 2  
ATOM 2796  H HD12 . LEU A 1 87  ? 2.914   9.313   -4.826  1.00 0.00 ? 87  LEU A HD12 2  
ATOM 2797  H HD13 . LEU A 1 87  ? 2.010   9.951   -3.432  1.00 0.00 ? 87  LEU A HD13 2  
ATOM 2798  H HD21 . LEU A 1 87  ? 0.978   8.712   -5.903  1.00 0.00 ? 87  LEU A HD21 2  
ATOM 2799  H HD22 . LEU A 1 87  ? 0.126   7.213   -5.460  1.00 0.00 ? 87  LEU A HD22 2  
ATOM 2800  H HD23 . LEU A 1 87  ? -0.338  8.757   -4.706  1.00 0.00 ? 87  LEU A HD23 2  
ATOM 2801  N N    . SER A 1 88  ? 5.205   5.007   -4.988  1.00 0.00 ? 88  SER A N    2  
ATOM 2802  C CA   . SER A 1 88  ? 5.877   3.733   -5.179  1.00 0.00 ? 88  SER A CA   2  
ATOM 2803  C C    . SER A 1 88  ? 5.769   2.889   -3.908  1.00 0.00 ? 88  SER A C    2  
ATOM 2804  O O    . SER A 1 88  ? 6.447   3.161   -2.918  1.00 0.00 ? 88  SER A O    2  
ATOM 2805  C CB   . SER A 1 88  ? 7.345   3.936   -5.558  1.00 0.00 ? 88  SER A CB   2  
ATOM 2806  O OG   . SER A 1 88  ? 7.546   3.874   -6.968  1.00 0.00 ? 88  SER A OG   2  
ATOM 2807  H H    . SER A 1 88  ? 5.745   5.703   -4.516  1.00 0.00 ? 88  SER A H    2  
ATOM 2808  H HA   . SER A 1 88  ? 5.353   3.251   -6.004  1.00 0.00 ? 88  SER A HA   2  
ATOM 2809  H HB2  . SER A 1 88  ? 7.685   4.903   -5.186  1.00 0.00 ? 88  SER A HB2  2  
ATOM 2810  H HB3  . SER A 1 88  ? 7.954   3.175   -5.071  1.00 0.00 ? 88  SER A HB3  2  
ATOM 2811  H HG   . SER A 1 88  ? 6.676   4.001   -7.443  1.00 0.00 ? 88  SER A HG   2  
ATOM 2812  N N    . VAL A 1 89  ? 4.912   1.881   -3.976  1.00 0.00 ? 89  VAL A N    2  
ATOM 2813  C CA   . VAL A 1 89  ? 4.707   0.995   -2.843  1.00 0.00 ? 89  VAL A CA   2  
ATOM 2814  C C    . VAL A 1 89  ? 5.046   -0.440  -3.255  1.00 0.00 ? 89  VAL A C    2  
ATOM 2815  O O    . VAL A 1 89  ? 4.837   -0.825  -4.404  1.00 0.00 ? 89  VAL A O    2  
ATOM 2816  C CB   . VAL A 1 89  ? 3.279   1.144   -2.314  1.00 0.00 ? 89  VAL A CB   2  
ATOM 2817  C CG1  . VAL A 1 89  ? 3.232   2.107   -1.127  1.00 0.00 ? 89  VAL A CG1  2  
ATOM 2818  C CG2  . VAL A 1 89  ? 2.327   1.594   -3.424  1.00 0.00 ? 89  VAL A CG2  2  
ATOM 2819  H H    . VAL A 1 89  ? 4.365   1.666   -4.785  1.00 0.00 ? 89  VAL A H    2  
ATOM 2820  H HA   . VAL A 1 89  ? 5.393   1.305   -2.055  1.00 0.00 ? 89  VAL A HA   2  
ATOM 2821  H HB   . VAL A 1 89  ? 2.947   0.166   -1.966  1.00 0.00 ? 89  VAL A HB   2  
ATOM 2822  H HG11 . VAL A 1 89  ? 4.094   1.932   -0.483  1.00 0.00 ? 89  VAL A HG11 2  
ATOM 2823  H HG12 . VAL A 1 89  ? 3.253   3.134   -1.491  1.00 0.00 ? 89  VAL A HG12 2  
ATOM 2824  H HG13 . VAL A 1 89  ? 2.316   1.941   -0.560  1.00 0.00 ? 89  VAL A HG13 2  
ATOM 2825  H HG21 . VAL A 1 89  ? 2.436   2.667   -3.582  1.00 0.00 ? 89  VAL A HG21 2  
ATOM 2826  H HG22 . VAL A 1 89  ? 2.569   1.066   -4.346  1.00 0.00 ? 89  VAL A HG22 2  
ATOM 2827  H HG23 . VAL A 1 89  ? 1.300   1.371   -3.135  1.00 0.00 ? 89  VAL A HG23 2  
ATOM 2828  N N    . TYR A 1 90  ? 5.562   -1.191  -2.293  1.00 0.00 ? 90  TYR A N    2  
ATOM 2829  C CA   . TYR A 1 90  ? 5.931   -2.574  -2.541  1.00 0.00 ? 90  TYR A CA   2  
ATOM 2830  C C    . TYR A 1 90  ? 4.898   -3.533  -1.946  1.00 0.00 ? 90  TYR A C    2  
ATOM 2831  O O    . TYR A 1 90  ? 4.736   -3.598  -0.728  1.00 0.00 ? 90  TYR A O    2  
ATOM 2832  C CB   . TYR A 1 90  ? 7.272   -2.786  -1.836  1.00 0.00 ? 90  TYR A CB   2  
ATOM 2833  C CG   . TYR A 1 90  ? 7.552   -4.241  -1.455  1.00 0.00 ? 90  TYR A CG   2  
ATOM 2834  C CD1  . TYR A 1 90  ? 7.747   -5.187  -2.441  1.00 0.00 ? 90  TYR A CD1  2  
ATOM 2835  C CD2  . TYR A 1 90  ? 7.610   -4.607  -0.126  1.00 0.00 ? 90  TYR A CD2  2  
ATOM 2836  C CE1  . TYR A 1 90  ? 8.011   -6.556  -2.082  1.00 0.00 ? 90  TYR A CE1  2  
ATOM 2837  C CE2  . TYR A 1 90  ? 7.874   -5.977  0.233   1.00 0.00 ? 90  TYR A CE2  2  
ATOM 2838  C CZ   . TYR A 1 90  ? 8.061   -6.884  -0.763  1.00 0.00 ? 90  TYR A CZ   2  
ATOM 2839  O OH   . TYR A 1 90  ? 8.310   -8.177  -0.425  1.00 0.00 ? 90  TYR A OH   2  
ATOM 2840  H H    . TYR A 1 90  ? 5.728   -0.870  -1.361  1.00 0.00 ? 90  TYR A H    2  
ATOM 2841  H HA   . TYR A 1 90  ? 5.974   -2.723  -3.620  1.00 0.00 ? 90  TYR A HA   2  
ATOM 2842  H HB2  . TYR A 1 90  ? 8.072   -2.430  -2.485  1.00 0.00 ? 90  TYR A HB2  2  
ATOM 2843  H HB3  . TYR A 1 90  ? 7.297   -2.174  -0.934  1.00 0.00 ? 90  TYR A HB3  2  
ATOM 2844  H HD1  . TYR A 1 90  ? 7.701   -4.897  -3.491  1.00 0.00 ? 90  TYR A HD1  2  
ATOM 2845  H HD2  . TYR A 1 90  ? 7.456   -3.860  0.653   1.00 0.00 ? 90  TYR A HD2  2  
ATOM 2846  H HE1  . TYR A 1 90  ? 8.166   -7.314  -2.851  1.00 0.00 ? 90  TYR A HE1  2  
ATOM 2847  H HE2  . TYR A 1 90  ? 7.922   -6.280  1.278   1.00 0.00 ? 90  TYR A HE2  2  
ATOM 2848  H HH   . TYR A 1 90  ? 7.553   -8.541  0.118   1.00 0.00 ? 90  TYR A HH   2  
ATOM 2849  N N    . SER A 1 91  ? 4.226   -4.254  -2.832  1.00 0.00 ? 91  SER A N    2  
ATOM 2850  C CA   . SER A 1 91  ? 3.214   -5.206  -2.409  1.00 0.00 ? 91  SER A CA   2  
ATOM 2851  C C    . SER A 1 91  ? 3.840   -6.589  -2.226  1.00 0.00 ? 91  SER A C    2  
ATOM 2852  O O    . SER A 1 91  ? 4.648   -7.022  -3.046  1.00 0.00 ? 91  SER A O    2  
ATOM 2853  C CB   . SER A 1 91  ? 2.065   -5.272  -3.417  1.00 0.00 ? 91  SER A CB   2  
ATOM 2854  O OG   . SER A 1 91  ? 1.312   -6.476  -3.290  1.00 0.00 ? 91  SER A OG   2  
ATOM 2855  H H    . SER A 1 91  ? 4.365   -4.195  -3.820  1.00 0.00 ? 91  SER A H    2  
ATOM 2856  H HA   . SER A 1 91  ? 2.840   -4.826  -1.458  1.00 0.00 ? 91  SER A HA   2  
ATOM 2857  H HB2  . SER A 1 91  ? 1.406   -4.416  -3.273  1.00 0.00 ? 91  SER A HB2  2  
ATOM 2858  H HB3  . SER A 1 91  ? 2.465   -5.200  -4.428  1.00 0.00 ? 91  SER A HB3  2  
ATOM 2859  H HG   . SER A 1 91  ? 1.433   -6.860  -2.375  1.00 0.00 ? 91  SER A HG   2  
ATOM 2860  N N    . ALA A 1 92  ? 3.444   -7.245  -1.145  1.00 0.00 ? 92  ALA A N    2  
ATOM 2861  C CA   . ALA A 1 92  ? 3.957   -8.571  -0.844  1.00 0.00 ? 92  ALA A CA   2  
ATOM 2862  C C    . ALA A 1 92  ? 2.791   -9.494  -0.481  1.00 0.00 ? 92  ALA A C    2  
ATOM 2863  O O    . ALA A 1 92  ? 1.658   -9.039  -0.332  1.00 0.00 ? 92  ALA A O    2  
ATOM 2864  C CB   . ALA A 1 92  ? 4.995   -8.475  0.276   1.00 0.00 ? 92  ALA A CB   2  
ATOM 2865  H H    . ALA A 1 92  ? 2.786   -6.886  -0.483  1.00 0.00 ? 92  ALA A H    2  
ATOM 2866  H HA   . ALA A 1 92  ? 4.443   -8.951  -1.742  1.00 0.00 ? 92  ALA A HA   2  
ATOM 2867  H HB1  . ALA A 1 92  ? 5.522   -9.425  0.365   1.00 0.00 ? 92  ALA A HB1  2  
ATOM 2868  H HB2  . ALA A 1 92  ? 5.708   -7.684  0.043   1.00 0.00 ? 92  ALA A HB2  2  
ATOM 2869  H HB3  . ALA A 1 92  ? 4.494   -8.248  1.217   1.00 0.00 ? 92  ALA A HB3  2  
ATOM 2870  N N    . GLY A 1 93  ? 3.110   -10.773 -0.349  1.00 0.00 ? 93  GLY A N    2  
ATOM 2871  C CA   . GLY A 1 93  ? 2.104   -11.763 -0.006  1.00 0.00 ? 93  GLY A CA   2  
ATOM 2872  C C    . GLY A 1 93  ? 1.560   -12.450 -1.261  1.00 0.00 ? 93  GLY A C    2  
ATOM 2873  O O    . GLY A 1 93  ? 1.294   -11.793 -2.266  1.00 0.00 ? 93  GLY A O    2  
ATOM 2874  H H    . GLY A 1 93  ? 4.034   -11.134 -0.471  1.00 0.00 ? 93  GLY A H    2  
ATOM 2875  H HA2  . GLY A 1 93  ? 2.534   -12.508 0.663   1.00 0.00 ? 93  GLY A HA2  2  
ATOM 2876  H HA3  . GLY A 1 93  ? 1.286   -11.285 0.534   1.00 0.00 ? 93  GLY A HA3  2  
ATOM 2877  N N    . ARG A 1 94  ? 1.412   -13.763 -1.161  1.00 0.00 ? 94  ARG A N    2  
ATOM 2878  C CA   . ARG A 1 94  ? 0.905   -14.545 -2.275  1.00 0.00 ? 94  ARG A CA   2  
ATOM 2879  C C    . ARG A 1 94  ? -0.281  -13.833 -2.928  1.00 0.00 ? 94  ARG A C    2  
ATOM 2880  O O    . ARG A 1 94  ? -0.155  -13.285 -4.022  1.00 0.00 ? 94  ARG A O    2  
ATOM 2881  C CB   . ARG A 1 94  ? 0.465   -15.937 -1.816  1.00 0.00 ? 94  ARG A CB   2  
ATOM 2882  C CG   . ARG A 1 94  ? 1.012   -17.020 -2.748  1.00 0.00 ? 94  ARG A CG   2  
ATOM 2883  C CD   . ARG A 1 94  ? 2.068   -17.871 -2.040  1.00 0.00 ? 94  ARG A CD   2  
ATOM 2884  N NE   . ARG A 1 94  ? 2.849   -18.639 -3.035  1.00 0.00 ? 94  ARG A NE   2  
ATOM 2885  C CZ   . ARG A 1 94  ? 3.622   -19.691 -2.733  1.00 0.00 ? 94  ARG A CZ   2  
ATOM 2886  N NH1  . ARG A 1 94  ? 3.723   -20.106 -1.462  1.00 0.00 ? 94  ARG A NH1  2  
ATOM 2887  N NH2  . ARG A 1 94  ? 4.295   -20.328 -3.701  1.00 0.00 ? 94  ARG A NH2  2  
ATOM 2888  H H    . ARG A 1 94  ? 1.630   -14.289 -0.339  1.00 0.00 ? 94  ARG A H    2  
ATOM 2889  H HA   . ARG A 1 94  ? 1.744   -14.623 -2.966  1.00 0.00 ? 94  ARG A HA   2  
ATOM 2890  H HB2  . ARG A 1 94  ? 0.816   -16.116 -0.799  1.00 0.00 ? 94  ARG A HB2  2  
ATOM 2891  H HB3  . ARG A 1 94  ? -0.623  -15.989 -1.791  1.00 0.00 ? 94  ARG A HB3  2  
ATOM 2892  H HG2  . ARG A 1 94  ? 0.196   -17.657 -3.089  1.00 0.00 ? 94  ARG A HG2  2  
ATOM 2893  H HG3  . ARG A 1 94  ? 1.446   -16.557 -3.634  1.00 0.00 ? 94  ARG A HG3  2  
ATOM 2894  H HD2  . ARG A 1 94  ? 2.733   -17.231 -1.459  1.00 0.00 ? 94  ARG A HD2  2  
ATOM 2895  H HD3  . ARG A 1 94  ? 1.588   -18.552 -1.337  1.00 0.00 ? 94  ARG A HD3  2  
ATOM 2896  H HE   . ARG A 1 94  ? 2.796   -18.356 -3.992  1.00 0.00 ? 94  ARG A HE   2  
ATOM 2897  H HH11 . ARG A 1 94  ? 3.221   -19.631 -0.740  1.00 0.00 ? 94  ARG A HH11 2  
ATOM 2898  H HH12 . ARG A 1 94  ? 4.300   -20.891 -1.237  1.00 0.00 ? 94  ARG A HH12 2  
ATOM 2899  H HH21 . ARG A 1 94  ? 4.220   -20.019 -4.649  1.00 0.00 ? 94  ARG A HH21 2  
ATOM 2900  H HH22 . ARG A 1 94  ? 4.872   -21.113 -3.475  1.00 0.00 ? 94  ARG A HH22 2  
ATOM 2901  N N    . ILE A 1 95  ? -1.407  -13.864 -2.229  1.00 0.00 ? 95  ILE A N    2  
ATOM 2902  C CA   . ILE A 1 95  ? -2.614  -13.228 -2.728  1.00 0.00 ? 95  ILE A CA   2  
ATOM 2903  C C    . ILE A 1 95  ? -3.091  -12.184 -1.715  1.00 0.00 ? 95  ILE A C    2  
ATOM 2904  O O    . ILE A 1 95  ? -3.513  -12.530 -0.613  1.00 0.00 ? 95  ILE A O    2  
ATOM 2905  C CB   . ILE A 1 95  ? -3.671  -14.279 -3.070  1.00 0.00 ? 95  ILE A CB   2  
ATOM 2906  C CG1  . ILE A 1 95  ? -3.198  -15.180 -4.213  1.00 0.00 ? 95  ILE A CG1  2  
ATOM 2907  C CG2  . ILE A 1 95  ? -5.019  -13.623 -3.378  1.00 0.00 ? 95  ILE A CG2  2  
ATOM 2908  C CD1  . ILE A 1 95  ? -2.663  -16.510 -3.678  1.00 0.00 ? 95  ILE A CD1  2  
ATOM 2909  H H    . ILE A 1 95  ? -1.501  -14.311 -1.340  1.00 0.00 ? 95  ILE A H    2  
ATOM 2910  H HA   . ILE A 1 95  ? -2.356  -12.717 -3.655  1.00 0.00 ? 95  ILE A HA   2  
ATOM 2911  H HB   . ILE A 1 95  ? -3.815  -14.916 -2.197  1.00 0.00 ? 95  ILE A HB   2  
ATOM 2912  H HG12 . ILE A 1 95  ? -4.024  -15.366 -4.900  1.00 0.00 ? 95  ILE A HG12 2  
ATOM 2913  H HG13 . ILE A 1 95  ? -2.419  -14.673 -4.782  1.00 0.00 ? 95  ILE A HG13 2  
ATOM 2914  H HG21 . ILE A 1 95  ? -4.869  -12.793 -4.070  1.00 0.00 ? 95  ILE A HG21 2  
ATOM 2915  H HG22 . ILE A 1 95  ? -5.686  -14.357 -3.830  1.00 0.00 ? 95  ILE A HG22 2  
ATOM 2916  H HG23 . ILE A 1 95  ? -5.461  -13.250 -2.454  1.00 0.00 ? 95  ILE A HG23 2  
ATOM 2917  H HD11 . ILE A 1 95  ? -3.432  -17.276 -3.775  1.00 0.00 ? 95  ILE A HD11 2  
ATOM 2918  H HD12 . ILE A 1 95  ? -1.783  -16.803 -4.249  1.00 0.00 ? 95  ILE A HD12 2  
ATOM 2919  H HD13 . ILE A 1 95  ? -2.393  -16.396 -2.628  1.00 0.00 ? 95  ILE A HD13 2  
ATOM 2920  N N    . SER A 1 96  ? -3.007  -10.927 -2.126  1.00 0.00 ? 96  SER A N    2  
ATOM 2921  C CA   . SER A 1 96  ? -3.425  -9.831  -1.268  1.00 0.00 ? 96  SER A CA   2  
ATOM 2922  C C    . SER A 1 96  ? -4.626  -9.111  -1.886  1.00 0.00 ? 96  SER A C    2  
ATOM 2923  O O    . SER A 1 96  ? -4.906  -9.271  -3.073  1.00 0.00 ? 96  SER A O    2  
ATOM 2924  C CB   . SER A 1 96  ? -2.278  -8.845  -1.036  1.00 0.00 ? 96  SER A CB   2  
ATOM 2925  O OG   . SER A 1 96  ? -1.976  -8.092  -2.207  1.00 0.00 ? 96  SER A OG   2  
ATOM 2926  H H    . SER A 1 96  ? -2.663  -10.654 -3.024  1.00 0.00 ? 96  SER A H    2  
ATOM 2927  H HA   . SER A 1 96  ? -3.702  -10.294 -0.322  1.00 0.00 ? 96  SER A HA   2  
ATOM 2928  H HB2  . SER A 1 96  ? -2.542  -8.166  -0.226  1.00 0.00 ? 96  SER A HB2  2  
ATOM 2929  H HB3  . SER A 1 96  ? -1.390  -9.391  -0.718  1.00 0.00 ? 96  SER A HB3  2  
ATOM 2930  H HG   . SER A 1 96  ? -1.668  -8.702  -2.937  1.00 0.00 ? 96  SER A HG   2  
ATOM 2931  N N    . GLY A 1 97  ? -5.302  -8.334  -1.053  1.00 0.00 ? 97  GLY A N    2  
ATOM 2932  C CA   . GLY A 1 97  ? -6.466  -7.590  -1.503  1.00 0.00 ? 97  GLY A CA   2  
ATOM 2933  C C    . GLY A 1 97  ? -7.673  -8.513  -1.681  1.00 0.00 ? 97  GLY A C    2  
ATOM 2934  O O    . GLY A 1 97  ? -7.515  -9.696  -1.979  1.00 0.00 ? 97  GLY A O    2  
ATOM 2935  H H    . GLY A 1 97  ? -5.067  -8.209  -0.089  1.00 0.00 ? 97  GLY A H    2  
ATOM 2936  H HA2  . GLY A 1 97  ? -6.705  -6.809  -0.780  1.00 0.00 ? 97  GLY A HA2  2  
ATOM 2937  H HA3  . GLY A 1 97  ? -6.242  -7.092  -2.446  1.00 0.00 ? 97  GLY A HA3  2  
ATOM 2938  N N    . PRO A 1 98  ? -8.882  -7.923  -1.485  1.00 0.00 ? 98  PRO A N    2  
ATOM 2939  C CA   . PRO A 1 98  ? -10.115 -8.680  -1.621  1.00 0.00 ? 98  PRO A CA   2  
ATOM 2940  C C    . PRO A 1 98  ? -10.440 -8.939  -3.094  1.00 0.00 ? 98  PRO A C    2  
ATOM 2941  O O    . PRO A 1 98  ? -9.763  -8.424  -3.982  1.00 0.00 ? 98  PRO A O    2  
ATOM 2942  C CB   . PRO A 1 98  ? -11.171 -7.843  -0.918  1.00 0.00 ? 98  PRO A CB   2  
ATOM 2943  C CG   . PRO A 1 98  ? -10.593 -6.440  -0.821  1.00 0.00 ? 98  PRO A CG   2  
ATOM 2944  C CD   . PRO A 1 98  ? -9.107  -6.525  -1.131  1.00 0.00 ? 98  PRO A CD   2  
ATOM 2945  H HA   . PRO A 1 98  ? -10.017 -9.582  -1.201  1.00 0.00 ? 98  PRO A HA   2  
ATOM 2946  H HB2  . PRO A 1 98  ? -12.106 -7.842  -1.478  1.00 0.00 ? 98  PRO A HB2  2  
ATOM 2947  H HB3  . PRO A 1 98  ? -11.392 -8.243  0.071   1.00 0.00 ? 98  PRO A HB3  2  
ATOM 2948  H HG2  . PRO A 1 98  ? -11.092 -5.772  -1.524  1.00 0.00 ? 98  PRO A HG2  2  
ATOM 2949  H HG3  . PRO A 1 98  ? -10.752 -6.030  0.176   1.00 0.00 ? 98  PRO A HG3  2  
ATOM 2950  H HD2  . PRO A 1 98  ? -8.835  -5.860  -1.951  1.00 0.00 ? 98  PRO A HD2  2  
ATOM 2951  H HD3  . PRO A 1 98  ? -8.506  -6.232  -0.271  1.00 0.00 ? 98  PRO A HD3  2  
ATOM 2952  N N    . SER A 1 99  ? -11.477 -9.736  -3.307  1.00 0.00 ? 99  SER A N    2  
ATOM 2953  C CA   . SER A 1 99  ? -11.900 -10.069 -4.656  1.00 0.00 ? 99  SER A CA   2  
ATOM 2954  C C    . SER A 1 99  ? -13.427 -10.117 -4.729  1.00 0.00 ? 99  SER A C    2  
ATOM 2955  O O    . SER A 1 99  ? -14.060 -10.915 -4.039  1.00 0.00 ? 99  SER A O    2  
ATOM 2956  C CB   . SER A 1 99  ? -11.305 -11.405 -5.106  1.00 0.00 ? 99  SER A CB   2  
ATOM 2957  O OG   . SER A 1 99  ? -9.893  -11.329 -5.281  1.00 0.00 ? 99  SER A OG   2  
ATOM 2958  H H    . SER A 1 99  ? -12.022 -10.151 -2.578  1.00 0.00 ? 99  SER A H    2  
ATOM 2959  H HA   . SER A 1 99  ? -11.512 -9.269  -5.286  1.00 0.00 ? 99  SER A HA   2  
ATOM 2960  H HB2  . SER A 1 99  ? -11.538 -12.173 -4.368  1.00 0.00 ? 99  SER A HB2  2  
ATOM 2961  H HB3  . SER A 1 99  ? -11.771 -11.713 -6.042  1.00 0.00 ? 99  SER A HB3  2  
ATOM 2962  H HG   . SER A 1 99  ? -9.675  -11.190 -6.247  1.00 0.00 ? 99  SER A HG   2  
ATOM 2963  N N    . SER A 1 100 ? -13.975 -9.253  -5.570  1.00 0.00 ? 100 SER A N    2  
ATOM 2964  C CA   . SER A 1 100 ? -15.416 -9.186  -5.742  1.00 0.00 ? 100 SER A CA   2  
ATOM 2965  C C    . SER A 1 100 ? -15.852 -10.119 -6.874  1.00 0.00 ? 100 SER A C    2  
ATOM 2966  O O    . SER A 1 100 ? -15.237 -10.138 -7.939  1.00 0.00 ? 100 SER A O    2  
ATOM 2967  C CB   . SER A 1 100 ? -15.872 -7.754  -6.029  1.00 0.00 ? 100 SER A CB   2  
ATOM 2968  O OG   . SER A 1 100 ? -17.225 -7.536  -5.640  1.00 0.00 ? 100 SER A OG   2  
ATOM 2969  H H    . SER A 1 100 ? -13.453 -8.607  -6.128  1.00 0.00 ? 100 SER A H    2  
ATOM 2970  H HA   . SER A 1 100 ? -15.836 -9.516  -4.791  1.00 0.00 ? 100 SER A HA   2  
ATOM 2971  H HB2  . SER A 1 100 ? -15.225 -7.055  -5.499  1.00 0.00 ? 100 SER A HB2  2  
ATOM 2972  H HB3  . SER A 1 100 ? -15.762 -7.546  -7.094  1.00 0.00 ? 100 SER A HB3  2  
ATOM 2973  H HG   . SER A 1 100 ? -17.790 -7.368  -6.448  1.00 0.00 ? 100 SER A HG   2  
ATOM 2974  N N    . GLY A 1 101 ? -16.911 -10.870 -6.605  1.00 0.00 ? 101 GLY A N    2  
ATOM 2975  C CA   . GLY A 1 101 ? -17.436 -11.802 -7.588  1.00 0.00 ? 101 GLY A CA   2  
ATOM 2976  C C    . GLY A 1 101 ? -16.540 -13.037 -7.706  1.00 0.00 ? 101 GLY A C    2  
ATOM 2977  O O    . GLY A 1 101 ? -17.011 -14.120 -8.049  1.00 0.00 ? 101 GLY A O    2  
ATOM 2978  H H    . GLY A 1 101 ? -17.405 -10.848 -5.736  1.00 0.00 ? 101 GLY A H    2  
ATOM 2979  H HA2  . GLY A 1 101 ? -18.443 -12.106 -7.304  1.00 0.00 ? 101 GLY A HA2  2  
ATOM 2980  H HA3  . GLY A 1 101 ? -17.512 -11.310 -8.557  1.00 0.00 ? 101 GLY A HA3  2  
ATOM 2981  N N    . GLY A 1 1   ? 23.362  -21.403 -5.525  1.00 0.00 ? 1   GLY A N    3  
ATOM 2982  C CA   . GLY A 1 1   ? 22.352  -22.276 -4.950  1.00 0.00 ? 1   GLY A CA   3  
ATOM 2983  C C    . GLY A 1 1   ? 21.062  -22.237 -5.771  1.00 0.00 ? 1   GLY A C    3  
ATOM 2984  O O    . GLY A 1 1   ? 21.071  -21.822 -6.929  1.00 0.00 ? 1   GLY A O    3  
ATOM 2985  H H1   . GLY A 1 1   ? 23.008  -20.683 -6.120  1.00 0.00 ? 1   GLY A H1   3  
ATOM 2986  H HA2  . GLY A 1 1   ? 22.730  -23.297 -4.908  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 2987  H HA3  . GLY A 1 1   ? 22.144  -21.971 -3.924  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 2988  N N    . SER A 1 2   ? 19.982  -22.674 -5.139  1.00 0.00 ? 2   SER A N    3  
ATOM 2989  C CA   . SER A 1 2   ? 18.687  -22.694 -5.797  1.00 0.00 ? 2   SER A CA   3  
ATOM 2990  C C    . SER A 1 2   ? 17.660  -21.934 -4.954  1.00 0.00 ? 2   SER A C    3  
ATOM 2991  O O    . SER A 1 2   ? 17.018  -22.514 -4.080  1.00 0.00 ? 2   SER A O    3  
ATOM 2992  C CB   . SER A 1 2   ? 18.215  -24.129 -6.041  1.00 0.00 ? 2   SER A CB   3  
ATOM 2993  O OG   . SER A 1 2   ? 18.124  -24.432 -7.430  1.00 0.00 ? 2   SER A OG   3  
ATOM 2994  H H    . SER A 1 2   ? 19.983  -23.009 -4.197  1.00 0.00 ? 2   SER A H    3  
ATOM 2995  H HA   . SER A 1 2   ? 18.841  -22.195 -6.754  1.00 0.00 ? 2   SER A HA   3  
ATOM 2996  H HB2  . SER A 1 2   ? 18.906  -24.824 -5.563  1.00 0.00 ? 2   SER A HB2  3  
ATOM 2997  H HB3  . SER A 1 2   ? 17.241  -24.275 -5.574  1.00 0.00 ? 2   SER A HB3  3  
ATOM 2998  H HG   . SER A 1 2   ? 17.373  -23.918 -7.844  1.00 0.00 ? 2   SER A HG   3  
ATOM 2999  N N    . SER A 1 3   ? 17.537  -20.648 -5.247  1.00 0.00 ? 3   SER A N    3  
ATOM 3000  C CA   . SER A 1 3   ? 16.600  -19.803 -4.527  1.00 0.00 ? 3   SER A CA   3  
ATOM 3001  C C    . SER A 1 3   ? 16.508  -18.432 -5.201  1.00 0.00 ? 3   SER A C    3  
ATOM 3002  O O    . SER A 1 3   ? 17.486  -17.948 -5.768  1.00 0.00 ? 3   SER A O    3  
ATOM 3003  C CB   . SER A 1 3   ? 17.011  -19.648 -3.062  1.00 0.00 ? 3   SER A CB   3  
ATOM 3004  O OG   . SER A 1 3   ? 15.898  -19.759 -2.180  1.00 0.00 ? 3   SER A OG   3  
ATOM 3005  H H    . SER A 1 3   ? 18.064  -20.184 -5.960  1.00 0.00 ? 3   SER A H    3  
ATOM 3006  H HA   . SER A 1 3   ? 15.643  -20.321 -4.582  1.00 0.00 ? 3   SER A HA   3  
ATOM 3007  H HB2  . SER A 1 3   ? 17.751  -20.408 -2.810  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3008  H HB3  . SER A 1 3   ? 17.490  -18.679 -2.920  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3009  H HG   . SER A 1 3   ? 15.050  -19.829 -2.706  1.00 0.00 ? 3   SER A HG   3  
ATOM 3010  N N    . GLY A 1 4   ? 15.323  -17.845 -5.116  1.00 0.00 ? 4   GLY A N    3  
ATOM 3011  C CA   . GLY A 1 4   ? 15.090  -16.540 -5.710  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3012  C C    . GLY A 1 4   ? 13.599  -16.311 -5.964  1.00 0.00 ? 4   GLY A C    3  
ATOM 3013  O O    . GLY A 1 4   ? 13.027  -16.886 -6.888  1.00 0.00 ? 4   GLY A O    3  
ATOM 3014  H H    . GLY A 1 4   ? 14.532  -18.246 -4.653  1.00 0.00 ? 4   GLY A H    3  
ATOM 3015  H HA2  . GLY A 1 4   ? 15.474  -15.762 -5.050  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3016  H HA3  . GLY A 1 4   ? 15.638  -16.461 -6.649  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3017  N N    . SER A 1 5   ? 13.011  -15.469 -5.126  1.00 0.00 ? 5   SER A N    3  
ATOM 3018  C CA   . SER A 1 5   ? 11.597  -15.157 -5.247  1.00 0.00 ? 5   SER A CA   3  
ATOM 3019  C C    . SER A 1 5   ? 11.336  -13.723 -4.781  1.00 0.00 ? 5   SER A C    3  
ATOM 3020  O O    . SER A 1 5   ? 11.628  -13.375 -3.638  1.00 0.00 ? 5   SER A O    3  
ATOM 3021  C CB   . SER A 1 5   ? 10.745  -16.140 -4.442  1.00 0.00 ? 5   SER A CB   3  
ATOM 3022  O OG   . SER A 1 5   ? 9.359   -15.812 -4.494  1.00 0.00 ? 5   SER A OG   3  
ATOM 3023  H H    . SER A 1 5   ? 13.483  -15.006 -4.376  1.00 0.00 ? 5   SER A H    3  
ATOM 3024  H HA   . SER A 1 5   ? 11.368  -15.263 -6.307  1.00 0.00 ? 5   SER A HA   3  
ATOM 3025  H HB2  . SER A 1 5   ? 10.893  -17.149 -4.828  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3026  H HB3  . SER A 1 5   ? 11.078  -16.144 -3.404  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3027  H HG   . SER A 1 5   ? 8.819   -16.542 -4.075  1.00 0.00 ? 5   SER A HG   3  
ATOM 3028  N N    . SER A 1 6   ? 10.789  -12.930 -5.691  1.00 0.00 ? 6   SER A N    3  
ATOM 3029  C CA   . SER A 1 6   ? 10.485  -11.542 -5.387  1.00 0.00 ? 6   SER A CA   3  
ATOM 3030  C C    . SER A 1 6   ? 9.047   -11.219 -5.798  1.00 0.00 ? 6   SER A C    3  
ATOM 3031  O O    . SER A 1 6   ? 8.482   -11.882 -6.667  1.00 0.00 ? 6   SER A O    3  
ATOM 3032  C CB   . SER A 1 6   ? 11.462  -10.598 -6.091  1.00 0.00 ? 6   SER A CB   3  
ATOM 3033  O OG   . SER A 1 6   ? 11.318  -10.640 -7.508  1.00 0.00 ? 6   SER A OG   3  
ATOM 3034  H H    . SER A 1 6   ? 10.555  -13.221 -6.618  1.00 0.00 ? 6   SER A H    3  
ATOM 3035  H HA   . SER A 1 6   ? 10.605  -11.449 -4.308  1.00 0.00 ? 6   SER A HA   3  
ATOM 3036  H HB2  . SER A 1 6   ? 11.298  -9.579  -5.740  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3037  H HB3  . SER A 1 6   ? 12.484  -10.867 -5.822  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3038  H HG   . SER A 1 6   ? 10.359  -10.512 -7.758  1.00 0.00 ? 6   SER A HG   3  
ATOM 3039  N N    . GLY A 1 7   ? 8.496   -10.201 -5.153  1.00 0.00 ? 7   GLY A N    3  
ATOM 3040  C CA   . GLY A 1 7   ? 7.134   -9.783  -5.440  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3041  C C    . GLY A 1 7   ? 7.088   -8.871  -6.668  1.00 0.00 ? 7   GLY A C    3  
ATOM 3042  O O    . GLY A 1 7   ? 7.463   -9.282  -7.765  1.00 0.00 ? 7   GLY A O    3  
ATOM 3043  H H    . GLY A 1 7   ? 8.962   -9.668  -4.448  1.00 0.00 ? 7   GLY A H    3  
ATOM 3044  H HA2  . GLY A 1 7   ? 6.509   -10.659 -5.610  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3045  H HA3  . GLY A 1 7   ? 6.721   -9.259  -4.578  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3046  N N    . GLU A 1 8   ? 6.626   -7.650  -6.441  1.00 0.00 ? 8   GLU A N    3  
ATOM 3047  C CA   . GLU A 1 8   ? 6.526   -6.677  -7.515  1.00 0.00 ? 8   GLU A CA   3  
ATOM 3048  C C    . GLU A 1 8   ? 6.068   -5.324  -6.965  1.00 0.00 ? 8   GLU A C    3  
ATOM 3049  O O    . GLU A 1 8   ? 5.128   -5.258  -6.174  1.00 0.00 ? 8   GLU A O    3  
ATOM 3050  C CB   . GLU A 1 8   ? 5.583   -7.169  -8.616  1.00 0.00 ? 8   GLU A CB   3  
ATOM 3051  C CG   . GLU A 1 8   ? 4.189   -7.455  -8.055  1.00 0.00 ? 8   GLU A CG   3  
ATOM 3052  C CD   . GLU A 1 8   ? 3.313   -8.157  -9.096  1.00 0.00 ? 8   GLU A CD   3  
ATOM 3053  O OE1  . GLU A 1 8   ? 3.777   -9.190  -9.624  1.00 0.00 ? 8   GLU A OE1  3  
ATOM 3054  O OE2  . GLU A 1 8   ? 2.200   -7.643  -9.339  1.00 0.00 ? 8   GLU A OE2  3  
ATOM 3055  H H    . GLU A 1 8   ? 6.323   -7.324  -5.546  1.00 0.00 ? 8   GLU A H    3  
ATOM 3056  H HA   . GLU A 1 8   ? 7.534   -6.589  -7.921  1.00 0.00 ? 8   GLU A HA   3  
ATOM 3057  H HB2  . GLU A 1 8   ? 5.515   -6.418  -9.403  1.00 0.00 ? 8   GLU A HB2  3  
ATOM 3058  H HB3  . GLU A 1 8   ? 5.989   -8.072  -9.070  1.00 0.00 ? 8   GLU A HB3  3  
ATOM 3059  H HG2  . GLU A 1 8   ? 4.272   -8.079  -7.165  1.00 0.00 ? 8   GLU A HG2  3  
ATOM 3060  H HG3  . GLU A 1 8   ? 3.718   -6.522  -7.748  1.00 0.00 ? 8   GLU A HG3  3  
ATOM 3061  N N    . VAL A 1 9   ? 6.753   -4.279  -7.406  1.00 0.00 ? 9   VAL A N    3  
ATOM 3062  C CA   . VAL A 1 9   ? 6.428   -2.933  -6.967  1.00 0.00 ? 9   VAL A CA   3  
ATOM 3063  C C    . VAL A 1 9   ? 5.345   -2.352  -7.878  1.00 0.00 ? 9   VAL A C    3  
ATOM 3064  O O    . VAL A 1 9   ? 5.472   -2.389  -9.101  1.00 0.00 ? 9   VAL A O    3  
ATOM 3065  C CB   . VAL A 1 9   ? 7.696   -2.077  -6.923  1.00 0.00 ? 9   VAL A CB   3  
ATOM 3066  C CG1  . VAL A 1 9   ? 7.350   -0.592  -6.792  1.00 0.00 ? 9   VAL A CG1  3  
ATOM 3067  C CG2  . VAL A 1 9   ? 8.622   -2.526  -5.792  1.00 0.00 ? 9   VAL A CG2  3  
ATOM 3068  H H    . VAL A 1 9   ? 7.516   -4.342  -8.049  1.00 0.00 ? 9   VAL A H    3  
ATOM 3069  H HA   . VAL A 1 9   ? 6.033   -3.003  -5.954  1.00 0.00 ? 9   VAL A HA   3  
ATOM 3070  H HB   . VAL A 1 9   ? 8.226   -2.215  -7.866  1.00 0.00 ? 9   VAL A HB   3  
ATOM 3071  H HG11 . VAL A 1 9   ? 8.239   0.007   -6.990  1.00 0.00 ? 9   VAL A HG11 3  
ATOM 3072  H HG12 . VAL A 1 9   ? 6.572   -0.335  -7.510  1.00 0.00 ? 9   VAL A HG12 3  
ATOM 3073  H HG13 . VAL A 1 9   ? 6.994   -0.390  -5.782  1.00 0.00 ? 9   VAL A HG13 3  
ATOM 3074  H HG21 . VAL A 1 9   ? 9.419   -1.794  -5.663  1.00 0.00 ? 9   VAL A HG21 3  
ATOM 3075  H HG22 . VAL A 1 9   ? 8.052   -2.610  -4.867  1.00 0.00 ? 9   VAL A HG22 3  
ATOM 3076  H HG23 . VAL A 1 9   ? 9.055   -3.495  -6.041  1.00 0.00 ? 9   VAL A HG23 3  
ATOM 3077  N N    . ARG A 1 10  ? 4.305   -1.827  -7.248  1.00 0.00 ? 10  ARG A N    3  
ATOM 3078  C CA   . ARG A 1 10  ? 3.200   -1.239  -7.986  1.00 0.00 ? 10  ARG A CA   3  
ATOM 3079  C C    . ARG A 1 10  ? 3.402   0.271   -8.129  1.00 0.00 ? 10  ARG A C    3  
ATOM 3080  O O    . ARG A 1 10  ? 4.288   0.845   -7.499  1.00 0.00 ? 10  ARG A O    3  
ATOM 3081  C CB   . ARG A 1 10  ? 1.866   -1.505  -7.287  1.00 0.00 ? 10  ARG A CB   3  
ATOM 3082  C CG   . ARG A 1 10  ? 1.796   -0.774  -5.944  1.00 0.00 ? 10  ARG A CG   3  
ATOM 3083  C CD   . ARG A 1 10  ? 0.609   -1.266  -5.113  1.00 0.00 ? 10  ARG A CD   3  
ATOM 3084  N NE   . ARG A 1 10  ? 1.081   -1.766  -3.802  1.00 0.00 ? 10  ARG A NE   3  
ATOM 3085  C CZ   . ARG A 1 10  ? 0.270   -2.091  -2.786  1.00 0.00 ? 10  ARG A CZ   3  
ATOM 3086  N NH1  . ARG A 1 10  ? -1.057  -1.971  -2.924  1.00 0.00 ? 10  ARG A NH1  3  
ATOM 3087  N NH2  . ARG A 1 10  ? 0.787   -2.536  -1.633  1.00 0.00 ? 10  ARG A NH2  3  
ATOM 3088  H H    . ARG A 1 10  ? 4.209   -1.801  -6.253  1.00 0.00 ? 10  ARG A H    3  
ATOM 3089  H HA   . ARG A 1 10  ? 3.222   -1.732  -8.959  1.00 0.00 ? 10  ARG A HA   3  
ATOM 3090  H HB2  . ARG A 1 10  ? 1.045   -1.178  -7.925  1.00 0.00 ? 10  ARG A HB2  3  
ATOM 3091  H HB3  . ARG A 1 10  ? 1.741   -2.576  -7.129  1.00 0.00 ? 10  ARG A HB3  3  
ATOM 3092  H HG2  . ARG A 1 10  ? 2.722   -0.933  -5.391  1.00 0.00 ? 10  ARG A HG2  3  
ATOM 3093  H HG3  . ARG A 1 10  ? 1.706   0.299   -6.114  1.00 0.00 ? 10  ARG A HG3  3  
ATOM 3094  H HD2  . ARG A 1 10  ? -0.104  -0.455  -4.967  1.00 0.00 ? 10  ARG A HD2  3  
ATOM 3095  H HD3  . ARG A 1 10  ? 0.085   -2.059  -5.647  1.00 0.00 ? 10  ARG A HD3  3  
ATOM 3096  H HE   . ARG A 1 10  ? 2.067   -1.866  -3.666  1.00 0.00 ? 10  ARG A HE   3  
ATOM 3097  H HH11 . ARG A 1 10  ? -1.443  -1.639  -3.785  1.00 0.00 ? 10  ARG A HH11 3  
ATOM 3098  H HH12 . ARG A 1 10  ? -1.662  -2.214  -2.166  1.00 0.00 ? 10  ARG A HH12 3  
ATOM 3099  H HH21 . ARG A 1 10  ? 1.778   -2.625  -1.530  1.00 0.00 ? 10  ARG A HH21 3  
ATOM 3100  H HH22 . ARG A 1 10  ? 0.182   -2.779  -0.875  1.00 0.00 ? 10  ARG A HH22 3  
ATOM 3101  N N    . LEU A 1 11  ? 2.565   0.871   -8.963  1.00 0.00 ? 11  LEU A N    3  
ATOM 3102  C CA   . LEU A 1 11  ? 2.640   2.303   -9.196  1.00 0.00 ? 11  LEU A CA   3  
ATOM 3103  C C    . LEU A 1 11  ? 1.268   2.930   -8.940  1.00 0.00 ? 11  LEU A C    3  
ATOM 3104  O O    . LEU A 1 11  ? 0.379   2.854   -9.787  1.00 0.00 ? 11  LEU A O    3  
ATOM 3105  C CB   . LEU A 1 11  ? 3.196   2.590   -10.592 1.00 0.00 ? 11  LEU A CB   3  
ATOM 3106  C CG   . LEU A 1 11  ? 4.694   2.339   -10.782 1.00 0.00 ? 11  LEU A CG   3  
ATOM 3107  C CD1  . LEU A 1 11  ? 5.120   2.630   -12.222 1.00 0.00 ? 11  LEU A CD1  3  
ATOM 3108  C CD2  . LEU A 1 11  ? 5.516   3.138   -9.769  1.00 0.00 ? 11  LEU A CD2  3  
ATOM 3109  H H    . LEU A 1 11  ? 1.847   0.397   -9.472  1.00 0.00 ? 11  LEU A H    3  
ATOM 3110  H HA   . LEU A 1 11  ? 3.348   2.715   -8.477  1.00 0.00 ? 11  LEU A HA   3  
ATOM 3111  H HB2  . LEU A 1 11  ? 2.652   1.978   -11.312 1.00 0.00 ? 11  LEU A HB2  3  
ATOM 3112  H HB3  . LEU A 1 11  ? 2.989   3.631   -10.838 1.00 0.00 ? 11  LEU A HB3  3  
ATOM 3113  H HG   . LEU A 1 11  ? 4.890   1.283   -10.595 1.00 0.00 ? 11  LEU A HG   3  
ATOM 3114  H HD11 . LEU A 1 11  ? 6.199   2.784   -12.258 1.00 0.00 ? 11  LEU A HD11 3  
ATOM 3115  H HD12 . LEU A 1 11  ? 4.853   1.785   -12.858 1.00 0.00 ? 11  LEU A HD12 3  
ATOM 3116  H HD13 . LEU A 1 11  ? 4.613   3.526   -12.578 1.00 0.00 ? 11  LEU A HD13 3  
ATOM 3117  H HD21 . LEU A 1 11  ? 6.378   3.580   -10.268 1.00 0.00 ? 11  LEU A HD21 3  
ATOM 3118  H HD22 . LEU A 1 11  ? 4.898   3.927   -9.341  1.00 0.00 ? 11  LEU A HD22 3  
ATOM 3119  H HD23 . LEU A 1 11  ? 5.858   2.474   -8.975  1.00 0.00 ? 11  LEU A HD23 3  
ATOM 3120  N N    . VAL A 1 12  ? 1.139   3.536   -7.769  1.00 0.00 ? 12  VAL A N    3  
ATOM 3121  C CA   . VAL A 1 12  ? -0.110  4.175   -7.391  1.00 0.00 ? 12  VAL A CA   3  
ATOM 3122  C C    . VAL A 1 12  ? -0.032  5.668   -7.717  1.00 0.00 ? 12  VAL A C    3  
ATOM 3123  O O    . VAL A 1 12  ? 1.023   6.284   -7.578  1.00 0.00 ? 12  VAL A O    3  
ATOM 3124  C CB   . VAL A 1 12  ? -0.414  3.900   -5.917  1.00 0.00 ? 12  VAL A CB   3  
ATOM 3125  C CG1  . VAL A 1 12  ? -1.611  4.726   -5.441  1.00 0.00 ? 12  VAL A CG1  3  
ATOM 3126  C CG2  . VAL A 1 12  ? -0.646  2.408   -5.674  1.00 0.00 ? 12  VAL A CG2  3  
ATOM 3127  H H    . VAL A 1 12  ? 1.867   3.593   -7.086  1.00 0.00 ? 12  VAL A H    3  
ATOM 3128  H HA   . VAL A 1 12  ? -0.904  3.726   -7.989  1.00 0.00 ? 12  VAL A HA   3  
ATOM 3129  H HB   . VAL A 1 12  ? 0.456   4.203   -5.334  1.00 0.00 ? 12  VAL A HB   3  
ATOM 3130  H HG11 . VAL A 1 12  ? -1.618  5.686   -5.956  1.00 0.00 ? 12  VAL A HG11 3  
ATOM 3131  H HG12 . VAL A 1 12  ? -2.533  4.189   -5.660  1.00 0.00 ? 12  VAL A HG12 3  
ATOM 3132  H HG13 . VAL A 1 12  ? -1.533  4.891   -4.366  1.00 0.00 ? 12  VAL A HG13 3  
ATOM 3133  H HG21 . VAL A 1 12  ? 0.315   1.905   -5.558  1.00 0.00 ? 12  VAL A HG21 3  
ATOM 3134  H HG22 . VAL A 1 12  ? -1.238  2.275   -4.769  1.00 0.00 ? 12  VAL A HG22 3  
ATOM 3135  H HG23 . VAL A 1 12  ? -1.179  1.980   -6.523  1.00 0.00 ? 12  VAL A HG23 3  
ATOM 3136  N N    . SER A 1 13  ? -1.164  6.207   -8.145  1.00 0.00 ? 13  SER A N    3  
ATOM 3137  C CA   . SER A 1 13  ? -1.238  7.617   -8.492  1.00 0.00 ? 13  SER A CA   3  
ATOM 3138  C C    . SER A 1 13  ? -2.417  8.272   -7.771  1.00 0.00 ? 13  SER A C    3  
ATOM 3139  O O    . SER A 1 13  ? -3.572  7.934   -8.028  1.00 0.00 ? 13  SER A O    3  
ATOM 3140  C CB   . SER A 1 13  ? -1.369  7.805   -10.005 1.00 0.00 ? 13  SER A CB   3  
ATOM 3141  O OG   . SER A 1 13  ? -1.001  9.120   -10.413 1.00 0.00 ? 13  SER A OG   3  
ATOM 3142  H H    . SER A 1 13  ? -2.019  5.700   -8.256  1.00 0.00 ? 13  SER A H    3  
ATOM 3143  H HA   . SER A 1 13  ? -0.295  8.047   -8.153  1.00 0.00 ? 13  SER A HA   3  
ATOM 3144  H HB2  . SER A 1 13  ? -0.740  7.077   -10.517 1.00 0.00 ? 13  SER A HB2  3  
ATOM 3145  H HB3  . SER A 1 13  ? -2.397  7.606   -10.307 1.00 0.00 ? 13  SER A HB3  3  
ATOM 3146  H HG   . SER A 1 13  ? -0.005  9.210   -10.417 1.00 0.00 ? 13  SER A HG   3  
ATOM 3147  N N    . LEU A 1 14  ? -2.086  9.199   -6.884  1.00 0.00 ? 14  LEU A N    3  
ATOM 3148  C CA   . LEU A 1 14  ? -3.104  9.905   -6.124  1.00 0.00 ? 14  LEU A CA   3  
ATOM 3149  C C    . LEU A 1 14  ? -3.077  11.388  -6.499  1.00 0.00 ? 14  LEU A C    3  
ATOM 3150  O O    . LEU A 1 14  ? -2.012  12.001  -6.543  1.00 0.00 ? 14  LEU A O    3  
ATOM 3151  C CB   . LEU A 1 14  ? -2.930  9.646   -4.626  1.00 0.00 ? 14  LEU A CB   3  
ATOM 3152  C CG   . LEU A 1 14  ? -3.616  8.393   -4.078  1.00 0.00 ? 14  LEU A CG   3  
ATOM 3153  C CD1  . LEU A 1 14  ? -5.101  8.377   -4.443  1.00 0.00 ? 14  LEU A CD1  3  
ATOM 3154  C CD2  . LEU A 1 14  ? -2.897  7.126   -4.545  1.00 0.00 ? 14  LEU A CD2  3  
ATOM 3155  H H    . LEU A 1 14  ? -1.145  9.468   -6.681  1.00 0.00 ? 14  LEU A H    3  
ATOM 3156  H HA   . LEU A 1 14  ? -4.071  9.493   -6.412  1.00 0.00 ? 14  LEU A HA   3  
ATOM 3157  H HB2  . LEU A 1 14  ? -1.864  9.576   -4.411  1.00 0.00 ? 14  LEU A HB2  3  
ATOM 3158  H HB3  . LEU A 1 14  ? -3.309  10.511  -4.082  1.00 0.00 ? 14  LEU A HB3  3  
ATOM 3159  H HG   . LEU A 1 14  ? -3.552  8.417   -2.990  1.00 0.00 ? 14  LEU A HG   3  
ATOM 3160  H HD11 . LEU A 1 14  ? -5.693  8.170   -3.551  1.00 0.00 ? 14  LEU A HD11 3  
ATOM 3161  H HD12 . LEU A 1 14  ? -5.386  9.347   -4.851  1.00 0.00 ? 14  LEU A HD12 3  
ATOM 3162  H HD13 . LEU A 1 14  ? -5.284  7.602   -5.187  1.00 0.00 ? 14  LEU A HD13 3  
ATOM 3163  H HD21 . LEU A 1 14  ? -3.345  6.776   -5.475  1.00 0.00 ? 14  LEU A HD21 3  
ATOM 3164  H HD22 . LEU A 1 14  ? -1.842  7.346   -4.710  1.00 0.00 ? 14  LEU A HD22 3  
ATOM 3165  H HD23 . LEU A 1 14  ? -2.991  6.353   -3.782  1.00 0.00 ? 14  LEU A HD23 3  
ATOM 3166  N N    . ARG A 1 15  ? -4.262  11.921  -6.761  1.00 0.00 ? 15  ARG A N    3  
ATOM 3167  C CA   . ARG A 1 15  ? -4.388  13.320  -7.131  1.00 0.00 ? 15  ARG A CA   3  
ATOM 3168  C C    . ARG A 1 15  ? -5.048  14.111  -6.000  1.00 0.00 ? 15  ARG A C    3  
ATOM 3169  O O    . ARG A 1 15  ? -5.529  13.529  -5.029  1.00 0.00 ? 15  ARG A O    3  
ATOM 3170  C CB   . ARG A 1 15  ? -5.216  13.480  -8.407  1.00 0.00 ? 15  ARG A CB   3  
ATOM 3171  C CG   . ARG A 1 15  ? -4.636  14.575  -9.304  1.00 0.00 ? 15  ARG A CG   3  
ATOM 3172  C CD   . ARG A 1 15  ? -4.292  14.025  -10.689 1.00 0.00 ? 15  ARG A CD   3  
ATOM 3173  N NE   . ARG A 1 15  ? -5.528  13.610  -11.390 1.00 0.00 ? 15  ARG A NE   3  
ATOM 3174  C CZ   . ARG A 1 15  ? -5.957  12.343  -11.472 1.00 0.00 ? 15  ARG A CZ   3  
ATOM 3175  N NH1  . ARG A 1 15  ? -5.252  11.359  -10.898 1.00 0.00 ? 15  ARG A NH1  3  
ATOM 3176  N NH2  . ARG A 1 15  ? -7.090  12.061  -12.129 1.00 0.00 ? 15  ARG A NH2  3  
ATOM 3177  H H    . ARG A 1 15  ? -5.123  11.414  -6.723  1.00 0.00 ? 15  ARG A H    3  
ATOM 3178  H HA   . ARG A 1 15  ? -3.365  13.657  -7.299  1.00 0.00 ? 15  ARG A HA   3  
ATOM 3179  H HB2  . ARG A 1 15  ? -5.240  12.535  -8.950  1.00 0.00 ? 15  ARG A HB2  3  
ATOM 3180  H HB3  . ARG A 1 15  ? -6.246  13.725  -8.148  1.00 0.00 ? 15  ARG A HB3  3  
ATOM 3181  H HG2  . ARG A 1 15  ? -5.353  15.390  -9.400  1.00 0.00 ? 15  ARG A HG2  3  
ATOM 3182  H HG3  . ARG A 1 15  ? -3.741  14.992  -8.842  1.00 0.00 ? 15  ARG A HG3  3  
ATOM 3183  H HD2  . ARG A 1 15  ? -3.770  14.784  -11.272 1.00 0.00 ? 15  ARG A HD2  3  
ATOM 3184  H HD3  . ARG A 1 15  ? -3.616  13.175  -10.595 1.00 0.00 ? 15  ARG A HD3  3  
ATOM 3185  H HE   . ARG A 1 15  ? -6.078  14.321  -11.830 1.00 0.00 ? 15  ARG A HE   3  
ATOM 3186  H HH11 . ARG A 1 15  ? -4.406  11.570  -10.408 1.00 0.00 ? 15  ARG A HH11 3  
ATOM 3187  H HH12 . ARG A 1 15  ? -5.571  10.414  -10.959 1.00 0.00 ? 15  ARG A HH12 3  
ATOM 3188  H HH21 . ARG A 1 15  ? -7.616  12.795  -12.558 1.00 0.00 ? 15  ARG A HH21 3  
ATOM 3189  H HH22 . ARG A 1 15  ? -7.410  11.115  -12.190 1.00 0.00 ? 15  ARG A HH22 3  
ATOM 3190  N N    . ARG A 1 16  ? -5.051  15.426  -6.163  1.00 0.00 ? 16  ARG A N    3  
ATOM 3191  C CA   . ARG A 1 16  ? -5.645  16.302  -5.168  1.00 0.00 ? 16  ARG A CA   3  
ATOM 3192  C C    . ARG A 1 16  ? -6.856  17.029  -5.756  1.00 0.00 ? 16  ARG A C    3  
ATOM 3193  O O    . ARG A 1 16  ? -7.068  18.210  -5.485  1.00 0.00 ? 16  ARG A O    3  
ATOM 3194  C CB   . ARG A 1 16  ? -4.632  17.334  -4.669  1.00 0.00 ? 16  ARG A CB   3  
ATOM 3195  C CG   . ARG A 1 16  ? -4.274  18.331  -5.774  1.00 0.00 ? 16  ARG A CG   3  
ATOM 3196  C CD   . ARG A 1 16  ? -2.961  19.050  -5.459  1.00 0.00 ? 16  ARG A CD   3  
ATOM 3197  N NE   . ARG A 1 16  ? -3.233  20.287  -4.694  1.00 0.00 ? 16  ARG A NE   3  
ATOM 3198  C CZ   . ARG A 1 16  ? -2.331  21.257  -4.489  1.00 0.00 ? 16  ARG A CZ   3  
ATOM 3199  N NH1  . ARG A 1 16  ? -1.094  21.139  -4.992  1.00 0.00 ? 16  ARG A NH1  3  
ATOM 3200  N NH2  . ARG A 1 16  ? -2.666  22.345  -3.782  1.00 0.00 ? 16  ARG A NH2  3  
ATOM 3201  H H    . ARG A 1 16  ? -4.659  15.891  -6.956  1.00 0.00 ? 16  ARG A H    3  
ATOM 3202  H HA   . ARG A 1 16  ? -5.942  15.640  -4.355  1.00 0.00 ? 16  ARG A HA   3  
ATOM 3203  H HB2  . ARG A 1 16  ? -5.044  17.868  -3.812  1.00 0.00 ? 16  ARG A HB2  3  
ATOM 3204  H HB3  . ARG A 1 16  ? -3.731  16.828  -4.325  1.00 0.00 ? 16  ARG A HB3  3  
ATOM 3205  H HG2  . ARG A 1 16  ? -4.188  17.807  -6.726  1.00 0.00 ? 16  ARG A HG2  3  
ATOM 3206  H HG3  . ARG A 1 16  ? -5.076  19.061  -5.883  1.00 0.00 ? 16  ARG A HG3  3  
ATOM 3207  H HD2  . ARG A 1 16  ? -2.306  18.394  -4.886  1.00 0.00 ? 16  ARG A HD2  3  
ATOM 3208  H HD3  . ARG A 1 16  ? -2.439  19.292  -6.385  1.00 0.00 ? 16  ARG A HD3  3  
ATOM 3209  H HE   . ARG A 1 16  ? -4.146  20.407  -4.305  1.00 0.00 ? 16  ARG A HE   3  
ATOM 3210  H HH11 . ARG A 1 16  ? -0.845  20.327  -5.519  1.00 0.00 ? 16  ARG A HH11 3  
ATOM 3211  H HH12 . ARG A 1 16  ? -0.421  21.863  -4.839  1.00 0.00 ? 16  ARG A HH12 3  
ATOM 3212  H HH21 . ARG A 1 16  ? -3.589  22.433  -3.407  1.00 0.00 ? 16  ARG A HH21 3  
ATOM 3213  H HH22 . ARG A 1 16  ? -1.993  23.069  -3.629  1.00 0.00 ? 16  ARG A HH22 3  
ATOM 3214  N N    . ALA A 1 17  ? -7.620  16.294  -6.551  1.00 0.00 ? 17  ALA A N    3  
ATOM 3215  C CA   . ALA A 1 17  ? -8.804  16.854  -7.179  1.00 0.00 ? 17  ALA A CA   3  
ATOM 3216  C C    . ALA A 1 17  ? -9.869  15.763  -7.314  1.00 0.00 ? 17  ALA A C    3  
ATOM 3217  O O    . ALA A 1 17  ? -9.979  15.124  -8.359  1.00 0.00 ? 17  ALA A O    3  
ATOM 3218  C CB   . ALA A 1 17  ? -8.424  17.467  -8.528  1.00 0.00 ? 17  ALA A CB   3  
ATOM 3219  H H    . ALA A 1 17  ? -7.441  15.334  -6.766  1.00 0.00 ? 17  ALA A H    3  
ATOM 3220  H HA   . ALA A 1 17  ? -9.184  17.642  -6.529  1.00 0.00 ? 17  ALA A HA   3  
ATOM 3221  H HB1  . ALA A 1 17  ? -8.803  18.488  -8.582  1.00 0.00 ? 17  ALA A HB1  3  
ATOM 3222  H HB2  . ALA A 1 17  ? -7.339  17.477  -8.631  1.00 0.00 ? 17  ALA A HB2  3  
ATOM 3223  H HB3  . ALA A 1 17  ? -8.860  16.875  -9.333  1.00 0.00 ? 17  ALA A HB3  3  
ATOM 3224  N N    . LYS A 1 18  ? -10.626 15.584  -6.241  1.00 0.00 ? 18  LYS A N    3  
ATOM 3225  C CA   . LYS A 1 18  ? -11.677 14.581  -6.227  1.00 0.00 ? 18  LYS A CA   3  
ATOM 3226  C C    . LYS A 1 18  ? -12.628 14.863  -5.061  1.00 0.00 ? 18  LYS A C    3  
ATOM 3227  O O    . LYS A 1 18  ? -13.071 13.939  -4.380  1.00 0.00 ? 18  LYS A O    3  
ATOM 3228  C CB   . LYS A 1 18  ? -11.077 13.174  -6.204  1.00 0.00 ? 18  LYS A CB   3  
ATOM 3229  C CG   . LYS A 1 18  ? -12.173 12.109  -6.273  1.00 0.00 ? 18  LYS A CG   3  
ATOM 3230  C CD   . LYS A 1 18  ? -11.909 11.124  -7.414  1.00 0.00 ? 18  LYS A CD   3  
ATOM 3231  C CE   . LYS A 1 18  ? -12.938 11.293  -8.534  1.00 0.00 ? 18  LYS A CE   3  
ATOM 3232  N NZ   . LYS A 1 18  ? -13.299 9.978   -9.109  1.00 0.00 ? 18  LYS A NZ   3  
ATOM 3233  H H    . LYS A 1 18  ? -10.529 16.107  -5.395  1.00 0.00 ? 18  LYS A H    3  
ATOM 3234  H HA   . LYS A 1 18  ? -12.235 14.679  -7.158  1.00 0.00 ? 18  LYS A HA   3  
ATOM 3235  H HB2  . LYS A 1 18  ? -10.393 13.053  -7.045  1.00 0.00 ? 18  LYS A HB2  3  
ATOM 3236  H HB3  . LYS A 1 18  ? -10.490 13.040  -5.296  1.00 0.00 ? 18  LYS A HB3  3  
ATOM 3237  H HG2  . LYS A 1 18  ? -12.221 11.571  -5.327  1.00 0.00 ? 18  LYS A HG2  3  
ATOM 3238  H HG3  . LYS A 1 18  ? -13.141 12.588  -6.418  1.00 0.00 ? 18  LYS A HG3  3  
ATOM 3239  H HD2  . LYS A 1 18  ? -10.906 11.281  -7.810  1.00 0.00 ? 18  LYS A HD2  3  
ATOM 3240  H HD3  . LYS A 1 18  ? -11.945 10.103  -7.034  1.00 0.00 ? 18  LYS A HD3  3  
ATOM 3241  H HE2  . LYS A 1 18  ? -13.830 11.784  -8.144  1.00 0.00 ? 18  LYS A HE2  3  
ATOM 3242  H HE3  . LYS A 1 18  ? -12.533 11.939  -9.313  1.00 0.00 ? 18  LYS A HE3  3  
ATOM 3243  H HZ1  . LYS A 1 18  ? -12.605 9.704   -9.775  1.00 0.00 ? 18  LYS A HZ1  3  
ATOM 3244  H HZ2  . LYS A 1 18  ? -13.348 9.297   -8.378  1.00 0.00 ? 18  LYS A HZ2  3  
ATOM 3245  H HZ3  . LYS A 1 18  ? -14.188 10.046  -9.562  1.00 0.00 ? 18  LYS A HZ3  3  
ATOM 3246  N N    . ALA A 1 19  ? -12.913 16.142  -4.867  1.00 0.00 ? 19  ALA A N    3  
ATOM 3247  C CA   . ALA A 1 19  ? -13.803 16.557  -3.796  1.00 0.00 ? 19  ALA A CA   3  
ATOM 3248  C C    . ALA A 1 19  ? -13.015 16.638  -2.487  1.00 0.00 ? 19  ALA A C    3  
ATOM 3249  O O    . ALA A 1 19  ? -12.950 17.695  -1.862  1.00 0.00 ? 19  ALA A O    3  
ATOM 3250  C CB   . ALA A 1 19  ? -14.982 15.586  -3.707  1.00 0.00 ? 19  ALA A CB   3  
ATOM 3251  H H    . ALA A 1 19  ? -12.548 16.887  -5.426  1.00 0.00 ? 19  ALA A H    3  
ATOM 3252  H HA   . ALA A 1 19  ? -14.182 17.548  -4.044  1.00 0.00 ? 19  ALA A HA   3  
ATOM 3253  H HB1  . ALA A 1 19  ? -14.810 14.878  -2.897  1.00 0.00 ? 19  ALA A HB1  3  
ATOM 3254  H HB2  . ALA A 1 19  ? -15.898 16.144  -3.513  1.00 0.00 ? 19  ALA A HB2  3  
ATOM 3255  H HB3  . ALA A 1 19  ? -15.079 15.045  -4.648  1.00 0.00 ? 19  ALA A HB3  3  
ATOM 3256  N N    . HIS A 1 20  ? -12.435 15.507  -2.112  1.00 0.00 ? 20  HIS A N    3  
ATOM 3257  C CA   . HIS A 1 20  ? -11.654 15.437  -0.888  1.00 0.00 ? 20  HIS A CA   3  
ATOM 3258  C C    . HIS A 1 20  ? -10.169 15.603  -1.217  1.00 0.00 ? 20  HIS A C    3  
ATOM 3259  O O    . HIS A 1 20  ? -9.496  14.637  -1.574  1.00 0.00 ? 20  HIS A O    3  
ATOM 3260  C CB   . HIS A 1 20  ? -11.951 14.143  -0.127  1.00 0.00 ? 20  HIS A CB   3  
ATOM 3261  C CG   . HIS A 1 20  ? -11.998 12.913  -1.002  1.00 0.00 ? 20  HIS A CG   3  
ATOM 3262  N ND1  . HIS A 1 20  ? -10.859 12.306  -1.503  1.00 0.00 ? 20  HIS A ND1  3  
ATOM 3263  C CD2  . HIS A 1 20  ? -13.056 12.183  -1.458  1.00 0.00 ? 20  HIS A CD2  3  
ATOM 3264  C CE1  . HIS A 1 20  ? -11.228 11.260  -2.227  1.00 0.00 ? 20  HIS A CE1  3  
ATOM 3265  N NE2  . HIS A 1 20  ? -12.590 11.185  -2.198  1.00 0.00 ? 20  HIS A NE2  3  
ATOM 3266  H H    . HIS A 1 20  ? -12.492 14.651  -2.626  1.00 0.00 ? 20  HIS A H    3  
ATOM 3267  H HA   . HIS A 1 20  ? -11.974 16.271  -0.264  1.00 0.00 ? 20  HIS A HA   3  
ATOM 3268  H HB2  . HIS A 1 20  ? -11.190 14.002  0.640   1.00 0.00 ? 20  HIS A HB2  3  
ATOM 3269  H HB3  . HIS A 1 20  ? -12.906 14.247  0.387   1.00 0.00 ? 20  HIS A HB3  3  
ATOM 3270  H HD1  . HIS A 1 20  ? -9.919  12.607  -1.346  1.00 0.00 ? 20  HIS A HD1  3  
ATOM 3271  H HD2  . HIS A 1 20  ? -14.106 12.385  -1.248  1.00 0.00 ? 20  HIS A HD2  3  
ATOM 3272  H HE1  . HIS A 1 20  ? -10.560 10.578  -2.754  1.00 0.00 ? 20  HIS A HE1  3  
ATOM 3273  N N    . GLU A 1 21  ? -9.701  16.836  -1.086  1.00 0.00 ? 21  GLU A N    3  
ATOM 3274  C CA   . GLU A 1 21  ? -8.308  17.142  -1.365  1.00 0.00 ? 21  GLU A CA   3  
ATOM 3275  C C    . GLU A 1 21  ? -7.391  16.257  -0.518  1.00 0.00 ? 21  GLU A C    3  
ATOM 3276  O O    . GLU A 1 21  ? -7.460  16.280  0.710   1.00 0.00 ? 21  GLU A O    3  
ATOM 3277  C CB   . GLU A 1 21  ? -8.014  18.624  -1.126  1.00 0.00 ? 21  GLU A CB   3  
ATOM 3278  C CG   . GLU A 1 21  ? -8.173  19.429  -2.417  1.00 0.00 ? 21  GLU A CG   3  
ATOM 3279  C CD   . GLU A 1 21  ? -8.531  20.886  -2.113  1.00 0.00 ? 21  GLU A CD   3  
ATOM 3280  O OE1  . GLU A 1 21  ? -9.628  21.096  -1.552  1.00 0.00 ? 21  GLU A OE1  3  
ATOM 3281  O OE2  . GLU A 1 21  ? -7.699  21.756  -2.450  1.00 0.00 ? 21  GLU A OE2  3  
ATOM 3282  H H    . GLU A 1 21  ? -10.255 17.616  -0.795  1.00 0.00 ? 21  GLU A H    3  
ATOM 3283  H HA   . GLU A 1 21  ? -8.168  16.915  -2.422  1.00 0.00 ? 21  GLU A HA   3  
ATOM 3284  H HB2  . GLU A 1 21  ? -8.688  19.014  -0.364  1.00 0.00 ? 21  GLU A HB2  3  
ATOM 3285  H HB3  . GLU A 1 21  ? -7.000  18.740  -0.744  1.00 0.00 ? 21  GLU A HB3  3  
ATOM 3286  H HG2  . GLU A 1 21  ? -7.248  19.391  -2.991  1.00 0.00 ? 21  GLU A HG2  3  
ATOM 3287  H HG3  . GLU A 1 21  ? -8.951  18.982  -3.035  1.00 0.00 ? 21  GLU A HG3  3  
ATOM 3288  N N    . GLY A 1 22  ? -6.552  15.498  -1.208  1.00 0.00 ? 22  GLY A N    3  
ATOM 3289  C CA   . GLY A 1 22  ? -5.622  14.607  -0.535  1.00 0.00 ? 22  GLY A CA   3  
ATOM 3290  C C    . GLY A 1 22  ? -5.603  13.230  -1.201  1.00 0.00 ? 22  GLY A C    3  
ATOM 3291  O O    . GLY A 1 22  ? -6.586  12.820  -1.816  1.00 0.00 ? 22  GLY A O    3  
ATOM 3292  H H    . GLY A 1 22  ? -6.502  15.485  -2.207  1.00 0.00 ? 22  GLY A H    3  
ATOM 3293  H HA2  . GLY A 1 22  ? -4.621  15.038  -0.555  1.00 0.00 ? 22  GLY A HA2  3  
ATOM 3294  H HA3  . GLY A 1 22  ? -5.905  14.505  0.513   1.00 0.00 ? 22  GLY A HA3  3  
ATOM 3295  N N    . LEU A 1 23  ? -4.474  12.552  -1.054  1.00 0.00 ? 23  LEU A N    3  
ATOM 3296  C CA   . LEU A 1 23  ? -4.314  11.230  -1.634  1.00 0.00 ? 23  LEU A CA   3  
ATOM 3297  C C    . LEU A 1 23  ? -5.364  10.288  -1.041  1.00 0.00 ? 23  LEU A C    3  
ATOM 3298  O O    . LEU A 1 23  ? -5.818  9.360   -1.708  1.00 0.00 ? 23  LEU A O    3  
ATOM 3299  C CB   . LEU A 1 23  ? -2.876  10.737  -1.457  1.00 0.00 ? 23  LEU A CB   3  
ATOM 3300  C CG   . LEU A 1 23  ? -1.795  11.820  -1.428  1.00 0.00 ? 23  LEU A CG   3  
ATOM 3301  C CD1  . LEU A 1 23  ? -0.400  11.206  -1.560  1.00 0.00 ? 23  LEU A CD1  3  
ATOM 3302  C CD2  . LEU A 1 23  ? -2.057  12.884  -2.497  1.00 0.00 ? 23  LEU A CD2  3  
ATOM 3303  H H    . LEU A 1 23  ? -3.679  12.893  -0.552  1.00 0.00 ? 23  LEU A H    3  
ATOM 3304  H HA   . LEU A 1 23  ? -4.495  11.318  -2.705  1.00 0.00 ? 23  LEU A HA   3  
ATOM 3305  H HB2  . LEU A 1 23  ? -2.819  10.170  -0.527  1.00 0.00 ? 23  LEU A HB2  3  
ATOM 3306  H HB3  . LEU A 1 23  ? -2.648  10.045  -2.267  1.00 0.00 ? 23  LEU A HB3  3  
ATOM 3307  H HG   . LEU A 1 23  ? -1.837  12.319  -0.460  1.00 0.00 ? 23  LEU A HG   3  
ATOM 3308  H HD11 . LEU A 1 23  ? -0.239  10.888  -2.590  1.00 0.00 ? 23  LEU A HD11 3  
ATOM 3309  H HD12 . LEU A 1 23  ? 0.351   11.947  -1.287  1.00 0.00 ? 23  LEU A HD12 3  
ATOM 3310  H HD13 . LEU A 1 23  ? -0.319  10.344  -0.898  1.00 0.00 ? 23  LEU A HD13 3  
ATOM 3311  H HD21 . LEU A 1 23  ? -2.697  13.663  -2.084  1.00 0.00 ? 23  LEU A HD21 3  
ATOM 3312  H HD22 . LEU A 1 23  ? -1.110  13.321  -2.813  1.00 0.00 ? 23  LEU A HD22 3  
ATOM 3313  H HD23 . LEU A 1 23  ? -2.549  12.424  -3.354  1.00 0.00 ? 23  LEU A HD23 3  
ATOM 3314  N N    . GLY A 1 24  ? -5.719  10.559  0.207   1.00 0.00 ? 24  GLY A N    3  
ATOM 3315  C CA   . GLY A 1 24  ? -6.706  9.747   0.897   1.00 0.00 ? 24  GLY A CA   3  
ATOM 3316  C C    . GLY A 1 24  ? -6.032  8.700   1.786   1.00 0.00 ? 24  GLY A C    3  
ATOM 3317  O O    . GLY A 1 24  ? -6.699  7.830   2.342   1.00 0.00 ? 24  GLY A O    3  
ATOM 3318  H H    . GLY A 1 24  ? -5.344  11.316  0.743   1.00 0.00 ? 24  GLY A H    3  
ATOM 3319  H HA2  . GLY A 1 24  ? -7.347  10.386  1.505   1.00 0.00 ? 24  GLY A HA2  3  
ATOM 3320  H HA3  . GLY A 1 24  ? -7.349  9.252   0.169   1.00 0.00 ? 24  GLY A HA3  3  
ATOM 3321  N N    . PHE A 1 25  ? -4.716  8.820   1.892   1.00 0.00 ? 25  PHE A N    3  
ATOM 3322  C CA   . PHE A 1 25  ? -3.944  7.895   2.703   1.00 0.00 ? 25  PHE A CA   3  
ATOM 3323  C C    . PHE A 1 25  ? -2.783  8.611   3.396   1.00 0.00 ? 25  PHE A C    3  
ATOM 3324  O O    . PHE A 1 25  ? -2.039  9.355   2.759   1.00 0.00 ? 25  PHE A O    3  
ATOM 3325  C CB   . PHE A 1 25  ? -3.380  6.833   1.757   1.00 0.00 ? 25  PHE A CB   3  
ATOM 3326  C CG   . PHE A 1 25  ? -2.136  7.282   0.988   1.00 0.00 ? 25  PHE A CG   3  
ATOM 3327  C CD1  . PHE A 1 25  ? -0.914  7.230   1.582   1.00 0.00 ? 25  PHE A CD1  3  
ATOM 3328  C CD2  . PHE A 1 25  ? -2.252  7.733   -0.290  1.00 0.00 ? 25  PHE A CD2  3  
ATOM 3329  C CE1  . PHE A 1 25  ? 0.241   7.647   0.868   1.00 0.00 ? 25  PHE A CE1  3  
ATOM 3330  C CE2  . PHE A 1 25  ? -1.098  8.149   -1.004  1.00 0.00 ? 25  PHE A CE2  3  
ATOM 3331  C CZ   . PHE A 1 25  ? 0.125   8.098   -0.409  1.00 0.00 ? 25  PHE A CZ   3  
ATOM 3332  H H    . PHE A 1 25  ? -4.181  9.531   1.436   1.00 0.00 ? 25  PHE A H    3  
ATOM 3333  H HA   . PHE A 1 25  ? -4.617  7.485   3.456   1.00 0.00 ? 25  PHE A HA   3  
ATOM 3334  H HB2  . PHE A 1 25  ? -3.136  5.940   2.333   1.00 0.00 ? 25  PHE A HB2  3  
ATOM 3335  H HB3  . PHE A 1 25  ? -4.154  6.550   1.043   1.00 0.00 ? 25  PHE A HB3  3  
ATOM 3336  H HD1  . PHE A 1 25  ? -0.821  6.868   2.606   1.00 0.00 ? 25  PHE A HD1  3  
ATOM 3337  H HD2  . PHE A 1 25  ? -3.232  7.774   -0.766  1.00 0.00 ? 25  PHE A HD2  3  
ATOM 3338  H HE1  . PHE A 1 25  ? 1.220   7.605   1.345   1.00 0.00 ? 25  PHE A HE1  3  
ATOM 3339  H HE2  . PHE A 1 25  ? -1.191  8.511   -2.028  1.00 0.00 ? 25  PHE A HE2  3  
ATOM 3340  H HZ   . PHE A 1 25  ? 1.011   8.418   -0.957  1.00 0.00 ? 25  PHE A HZ   3  
ATOM 3341  N N    . SER A 1 26  ? -2.665  8.361   4.692   1.00 0.00 ? 26  SER A N    3  
ATOM 3342  C CA   . SER A 1 26  ? -1.607  8.972   5.479   1.00 0.00 ? 26  SER A CA   3  
ATOM 3343  C C    . SER A 1 26  ? -0.360  8.086   5.459   1.00 0.00 ? 26  SER A C    3  
ATOM 3344  O O    . SER A 1 26  ? -0.429  6.921   5.068   1.00 0.00 ? 26  SER A O    3  
ATOM 3345  C CB   . SER A 1 26  ? -2.062  9.216   6.919   1.00 0.00 ? 26  SER A CB   3  
ATOM 3346  O OG   . SER A 1 26  ? -2.076  10.603  7.247   1.00 0.00 ? 26  SER A OG   3  
ATOM 3347  H H    . SER A 1 26  ? -3.274  7.754   5.203   1.00 0.00 ? 26  SER A H    3  
ATOM 3348  H HA   . SER A 1 26  ? -1.404  9.928   4.996   1.00 0.00 ? 26  SER A HA   3  
ATOM 3349  H HB2  . SER A 1 26  ? -3.060  8.801   7.059   1.00 0.00 ? 26  SER A HB2  3  
ATOM 3350  H HB3  . SER A 1 26  ? -1.398  8.688   7.603   1.00 0.00 ? 26  SER A HB3  3  
ATOM 3351  H HG   . SER A 1 26  ? -2.457  11.130  6.488   1.00 0.00 ? 26  SER A HG   3  
ATOM 3352  N N    . ILE A 1 27  ? 0.750   8.670   5.885   1.00 0.00 ? 27  ILE A N    3  
ATOM 3353  C CA   . ILE A 1 27  ? 2.009   7.947   5.922   1.00 0.00 ? 27  ILE A CA   3  
ATOM 3354  C C    . ILE A 1 27  ? 2.619   8.063   7.320   1.00 0.00 ? 27  ILE A C    3  
ATOM 3355  O O    . ILE A 1 27  ? 2.173   8.874   8.130   1.00 0.00 ? 27  ILE A O    3  
ATOM 3356  C CB   . ILE A 1 27  ? 2.937   8.431   4.805   1.00 0.00 ? 27  ILE A CB   3  
ATOM 3357  C CG1  . ILE A 1 27  ? 3.432   9.852   5.080   1.00 0.00 ? 27  ILE A CG1  3  
ATOM 3358  C CG2  . ILE A 1 27  ? 2.257   8.314   3.439   1.00 0.00 ? 27  ILE A CG2  3  
ATOM 3359  C CD1  . ILE A 1 27  ? 4.927   9.979   4.783   1.00 0.00 ? 27  ILE A CD1  3  
ATOM 3360  H H    . ILE A 1 27  ? 0.797   9.618   6.201   1.00 0.00 ? 27  ILE A H    3  
ATOM 3361  H HA   . ILE A 1 27  ? 1.790   6.898   5.727   1.00 0.00 ? 27  ILE A HA   3  
ATOM 3362  H HB   . ILE A 1 27  ? 3.813   7.783   4.784   1.00 0.00 ? 27  ILE A HB   3  
ATOM 3363  H HG12 . ILE A 1 27  ? 2.874   10.560  4.466   1.00 0.00 ? 27  ILE A HG12 3  
ATOM 3364  H HG13 . ILE A 1 27  ? 3.241   10.112  6.121   1.00 0.00 ? 27  ILE A HG13 3  
ATOM 3365  H HG21 . ILE A 1 27  ? 2.963   8.593   2.657   1.00 0.00 ? 27  ILE A HG21 3  
ATOM 3366  H HG22 . ILE A 1 27  ? 1.929   7.287   3.283   1.00 0.00 ? 27  ILE A HG22 3  
ATOM 3367  H HG23 . ILE A 1 27  ? 1.395   8.980   3.405   1.00 0.00 ? 27  ILE A HG23 3  
ATOM 3368  H HD11 . ILE A 1 27  ? 5.209   11.032  4.781   1.00 0.00 ? 27  ILE A HD11 3  
ATOM 3369  H HD12 . ILE A 1 27  ? 5.496   9.451   5.548   1.00 0.00 ? 27  ILE A HD12 3  
ATOM 3370  H HD13 . ILE A 1 27  ? 5.142   9.544   3.806   1.00 0.00 ? 27  ILE A HD13 3  
ATOM 3371  N N    . ARG A 1 28  ? 3.629   7.241   7.561   1.00 0.00 ? 28  ARG A N    3  
ATOM 3372  C CA   . ARG A 1 28  ? 4.305   7.241   8.847   1.00 0.00 ? 28  ARG A CA   3  
ATOM 3373  C C    . ARG A 1 28  ? 5.732   6.710   8.698   1.00 0.00 ? 28  ARG A C    3  
ATOM 3374  O O    . ARG A 1 28  ? 6.077   6.127   7.671   1.00 0.00 ? 28  ARG A O    3  
ATOM 3375  C CB   . ARG A 1 28  ? 3.552   6.381   9.864   1.00 0.00 ? 28  ARG A CB   3  
ATOM 3376  C CG   . ARG A 1 28  ? 3.396   4.945   9.360   1.00 0.00 ? 28  ARG A CG   3  
ATOM 3377  C CD   . ARG A 1 28  ? 3.432   3.949   10.520  1.00 0.00 ? 28  ARG A CD   3  
ATOM 3378  N NE   . ARG A 1 28  ? 3.208   2.575   10.016  1.00 0.00 ? 28  ARG A NE   3  
ATOM 3379  C CZ   . ARG A 1 28  ? 3.583   1.466   10.667  1.00 0.00 ? 28  ARG A CZ   3  
ATOM 3380  N NH1  . ARG A 1 28  ? 4.201   1.561   11.852  1.00 0.00 ? 28  ARG A NH1  3  
ATOM 3381  N NH2  . ARG A 1 28  ? 3.339   0.261   10.133  1.00 0.00 ? 28  ARG A NH2  3  
ATOM 3382  H H    . ARG A 1 28  ? 3.986   6.584   6.896   1.00 0.00 ? 28  ARG A H    3  
ATOM 3383  H HA   . ARG A 1 28  ? 4.305   8.285   9.161   1.00 0.00 ? 28  ARG A HA   3  
ATOM 3384  H HB2  . ARG A 1 28  ? 4.088   6.380   10.813  1.00 0.00 ? 28  ARG A HB2  3  
ATOM 3385  H HB3  . ARG A 1 28  ? 2.569   6.812   10.054  1.00 0.00 ? 28  ARG A HB3  3  
ATOM 3386  H HG2  . ARG A 1 28  ? 2.455   4.846   8.819   1.00 0.00 ? 28  ARG A HG2  3  
ATOM 3387  H HG3  . ARG A 1 28  ? 4.195   4.715   8.654   1.00 0.00 ? 28  ARG A HG3  3  
ATOM 3388  H HD2  . ARG A 1 28  ? 4.393   4.006   11.030  1.00 0.00 ? 28  ARG A HD2  3  
ATOM 3389  H HD3  . ARG A 1 28  ? 2.667   4.205   11.253  1.00 0.00 ? 28  ARG A HD3  3  
ATOM 3390  H HE   . ARG A 1 28  ? 2.749   2.469   9.134   1.00 0.00 ? 28  ARG A HE   3  
ATOM 3391  H HH11 . ARG A 1 28  ? 4.383   2.460   12.250  1.00 0.00 ? 28  ARG A HH11 3  
ATOM 3392  H HH12 . ARG A 1 28  ? 4.480   0.732   12.338  1.00 0.00 ? 28  ARG A HH12 3  
ATOM 3393  H HH21 . ARG A 1 28  ? 2.878   0.190   9.249   1.00 0.00 ? 28  ARG A HH21 3  
ATOM 3394  H HH22 . ARG A 1 28  ? 3.619   -0.567  10.619  1.00 0.00 ? 28  ARG A HH22 3  
ATOM 3395  N N    . GLY A 1 29  ? 6.523   6.932   9.737   1.00 0.00 ? 29  GLY A N    3  
ATOM 3396  C CA   . GLY A 1 29  ? 7.906   6.483   9.734   1.00 0.00 ? 29  GLY A CA   3  
ATOM 3397  C C    . GLY A 1 29  ? 8.868   7.672   9.782   1.00 0.00 ? 29  GLY A C    3  
ATOM 3398  O O    . GLY A 1 29  ? 8.530   8.728   10.314  1.00 0.00 ? 29  GLY A O    3  
ATOM 3399  H H    . GLY A 1 29  ? 6.235   7.407   10.568  1.00 0.00 ? 29  GLY A H    3  
ATOM 3400  H HA2  . GLY A 1 29  ? 8.082   5.833   10.591  1.00 0.00 ? 29  GLY A HA2  3  
ATOM 3401  H HA3  . GLY A 1 29  ? 8.097   5.891   8.839   1.00 0.00 ? 29  GLY A HA3  3  
ATOM 3402  N N    . GLY A 1 30  ? 10.048  7.459   9.219   1.00 0.00 ? 30  GLY A N    3  
ATOM 3403  C CA   . GLY A 1 30  ? 11.062  8.500   9.190   1.00 0.00 ? 30  GLY A CA   3  
ATOM 3404  C C    . GLY A 1 30  ? 12.435  7.938   9.566   1.00 0.00 ? 30  GLY A C    3  
ATOM 3405  O O    . GLY A 1 30  ? 12.531  7.006   10.363  1.00 0.00 ? 30  GLY A O    3  
ATOM 3406  H H    . GLY A 1 30  ? 10.315  6.597   8.788   1.00 0.00 ? 30  GLY A H    3  
ATOM 3407  H HA2  . GLY A 1 30  ? 11.106  8.942   8.195   1.00 0.00 ? 30  GLY A HA2  3  
ATOM 3408  H HA3  . GLY A 1 30  ? 10.789  9.297   9.881   1.00 0.00 ? 30  GLY A HA3  3  
ATOM 3409  N N    . SER A 1 31  ? 13.463  8.530   8.976   1.00 0.00 ? 31  SER A N    3  
ATOM 3410  C CA   . SER A 1 31  ? 14.826  8.101   9.239   1.00 0.00 ? 31  SER A CA   3  
ATOM 3411  C C    . SER A 1 31  ? 15.173  8.334   10.711  1.00 0.00 ? 31  SER A C    3  
ATOM 3412  O O    . SER A 1 31  ? 16.005  7.626   11.276  1.00 0.00 ? 31  SER A O    3  
ATOM 3413  C CB   . SER A 1 31  ? 15.818  8.835   8.336   1.00 0.00 ? 31  SER A CB   3  
ATOM 3414  O OG   . SER A 1 31  ? 17.133  8.293   8.436   1.00 0.00 ? 31  SER A OG   3  
ATOM 3415  H H    . SER A 1 31  ? 13.376  9.288   8.329   1.00 0.00 ? 31  SER A H    3  
ATOM 3416  H HA   . SER A 1 31  ? 14.843  7.036   9.006   1.00 0.00 ? 31  SER A HA   3  
ATOM 3417  H HB2  . SER A 1 31  ? 15.480  8.777   7.302   1.00 0.00 ? 31  SER A HB2  3  
ATOM 3418  H HB3  . SER A 1 31  ? 15.840  9.891   8.605   1.00 0.00 ? 31  SER A HB3  3  
ATOM 3419  H HG   . SER A 1 31  ? 17.788  8.900   7.985   1.00 0.00 ? 31  SER A HG   3  
ATOM 3420  N N    . GLU A 1 32  ? 14.517  9.330   11.289  1.00 0.00 ? 32  GLU A N    3  
ATOM 3421  C CA   . GLU A 1 32  ? 14.746  9.665   12.684  1.00 0.00 ? 32  GLU A CA   3  
ATOM 3422  C C    . GLU A 1 32  ? 14.378  8.483   13.582  1.00 0.00 ? 32  GLU A C    3  
ATOM 3423  O O    . GLU A 1 32  ? 14.944  8.318   14.662  1.00 0.00 ? 32  GLU A O    3  
ATOM 3424  C CB   . GLU A 1 32  ? 13.966  10.920  13.082  1.00 0.00 ? 32  GLU A CB   3  
ATOM 3425  C CG   . GLU A 1 32  ? 12.462  10.712  12.896  1.00 0.00 ? 32  GLU A CG   3  
ATOM 3426  C CD   . GLU A 1 32  ? 11.679  11.952  13.329  1.00 0.00 ? 32  GLU A CD   3  
ATOM 3427  O OE1  . GLU A 1 32  ? 11.834  12.339  14.508  1.00 0.00 ? 32  GLU A OE1  3  
ATOM 3428  O OE2  . GLU A 1 32  ? 10.942  12.487  12.473  1.00 0.00 ? 32  GLU A OE2  3  
ATOM 3429  H H    . GLU A 1 32  ? 13.842  9.900   10.823  1.00 0.00 ? 32  GLU A H    3  
ATOM 3430  H HA   . GLU A 1 32  ? 15.814  9.870   12.762  1.00 0.00 ? 32  GLU A HA   3  
ATOM 3431  H HB2  . GLU A 1 32  ? 14.176  11.169  14.122  1.00 0.00 ? 32  GLU A HB2  3  
ATOM 3432  H HB3  . GLU A 1 32  ? 14.297  11.765  12.478  1.00 0.00 ? 32  GLU A HB3  3  
ATOM 3433  H HG2  . GLU A 1 32  ? 12.248  10.489  11.850  1.00 0.00 ? 32  GLU A HG2  3  
ATOM 3434  H HG3  . GLU A 1 32  ? 12.135  9.850   13.478  1.00 0.00 ? 32  GLU A HG3  3  
ATOM 3435  N N    . HIS A 1 33  ? 13.431  7.689   13.103  1.00 0.00 ? 33  HIS A N    3  
ATOM 3436  C CA   . HIS A 1 33  ? 12.980  6.527   13.849  1.00 0.00 ? 33  HIS A CA   3  
ATOM 3437  C C    . HIS A 1 33  ? 13.782  5.298   13.418  1.00 0.00 ? 33  HIS A C    3  
ATOM 3438  O O    . HIS A 1 33  ? 13.728  4.256   14.071  1.00 0.00 ? 33  HIS A O    3  
ATOM 3439  C CB   . HIS A 1 33  ? 11.470  6.334   13.694  1.00 0.00 ? 33  HIS A CB   3  
ATOM 3440  C CG   . HIS A 1 33  ? 10.672  6.725   14.915  1.00 0.00 ? 33  HIS A CG   3  
ATOM 3441  N ND1  . HIS A 1 33  ? 9.305   6.937   14.880  1.00 0.00 ? 33  HIS A ND1  3  
ATOM 3442  C CD2  . HIS A 1 33  ? 11.063  6.940   16.204  1.00 0.00 ? 33  HIS A CD2  3  
ATOM 3443  C CE1  . HIS A 1 33  ? 8.902   7.265   16.099  1.00 0.00 ? 33  HIS A CE1  3  
ATOM 3444  N NE2  . HIS A 1 33  ? 9.993   7.267   16.918  1.00 0.00 ? 33  HIS A NE2  3  
ATOM 3445  H H    . HIS A 1 33  ? 12.975  7.830   12.224  1.00 0.00 ? 33  HIS A H    3  
ATOM 3446  H HA   . HIS A 1 33  ? 13.182  6.732   14.900  1.00 0.00 ? 33  HIS A HA   3  
ATOM 3447  H HB2  . HIS A 1 33  ? 11.124  6.921   12.843  1.00 0.00 ? 33  HIS A HB2  3  
ATOM 3448  H HB3  . HIS A 1 33  ? 11.270  5.288   13.461  1.00 0.00 ? 33  HIS A HB3  3  
ATOM 3449  H HD1  . HIS A 1 33  ? 8.720   6.857   14.073  1.00 0.00 ? 33  HIS A HD1  3  
ATOM 3450  H HD2  . HIS A 1 33  ? 12.082  6.857   16.583  1.00 0.00 ? 33  HIS A HD2  3  
ATOM 3451  H HE1  . HIS A 1 33  ? 7.878   7.493   16.396  1.00 0.00 ? 33  HIS A HE1  3  
ATOM 3452  N N    . GLY A 1 34  ? 14.507  5.459   12.321  1.00 0.00 ? 34  GLY A N    3  
ATOM 3453  C CA   . GLY A 1 34  ? 15.320  4.375   11.795  1.00 0.00 ? 34  GLY A CA   3  
ATOM 3454  C C    . GLY A 1 34  ? 14.526  3.529   10.797  1.00 0.00 ? 34  GLY A C    3  
ATOM 3455  O O    . GLY A 1 34  ? 15.067  2.604   10.194  1.00 0.00 ? 34  GLY A O    3  
ATOM 3456  H H    . GLY A 1 34  ? 14.546  6.309   11.796  1.00 0.00 ? 34  GLY A H    3  
ATOM 3457  H HA2  . GLY A 1 34  ? 16.205  4.783   11.307  1.00 0.00 ? 34  GLY A HA2  3  
ATOM 3458  H HA3  . GLY A 1 34  ? 15.668  3.746   12.614  1.00 0.00 ? 34  GLY A HA3  3  
ATOM 3459  N N    . VAL A 1 35  ? 13.256  3.878   10.654  1.00 0.00 ? 35  VAL A N    3  
ATOM 3460  C CA   . VAL A 1 35  ? 12.382  3.162   9.740   1.00 0.00 ? 35  VAL A CA   3  
ATOM 3461  C C    . VAL A 1 35  ? 12.189  3.993   8.470   1.00 0.00 ? 35  VAL A C    3  
ATOM 3462  O O    . VAL A 1 35  ? 12.500  5.183   8.449   1.00 0.00 ? 35  VAL A O    3  
ATOM 3463  C CB   . VAL A 1 35  ? 11.063  2.820   10.436  1.00 0.00 ? 35  VAL A CB   3  
ATOM 3464  C CG1  . VAL A 1 35  ? 11.290  2.512   11.918  1.00 0.00 ? 35  VAL A CG1  3  
ATOM 3465  C CG2  . VAL A 1 35  ? 10.042  3.945   10.260  1.00 0.00 ? 35  VAL A CG2  3  
ATOM 3466  H H    . VAL A 1 35  ? 12.823  4.632   11.148  1.00 0.00 ? 35  VAL A H    3  
ATOM 3467  H HA   . VAL A 1 35  ? 12.877  2.227   9.476   1.00 0.00 ? 35  VAL A HA   3  
ATOM 3468  H HB   . VAL A 1 35  ? 10.659  1.923   9.966   1.00 0.00 ? 35  VAL A HB   3  
ATOM 3469  H HG11 . VAL A 1 35  ? 10.553  1.782   12.254  1.00 0.00 ? 35  VAL A HG11 3  
ATOM 3470  H HG12 . VAL A 1 35  ? 12.292  2.106   12.056  1.00 0.00 ? 35  VAL A HG12 3  
ATOM 3471  H HG13 . VAL A 1 35  ? 11.185  3.428   12.500  1.00 0.00 ? 35  VAL A HG13 3  
ATOM 3472  H HG21 . VAL A 1 35  ? 10.462  4.879   10.633  1.00 0.00 ? 35  VAL A HG21 3  
ATOM 3473  H HG22 . VAL A 1 35  ? 9.798   4.052   9.203   1.00 0.00 ? 35  VAL A HG22 3  
ATOM 3474  H HG23 . VAL A 1 35  ? 9.137   3.705   10.819  1.00 0.00 ? 35  VAL A HG23 3  
ATOM 3475  N N    . GLY A 1 36  ? 11.676  3.334   7.442   1.00 0.00 ? 36  GLY A N    3  
ATOM 3476  C CA   . GLY A 1 36  ? 11.438  3.997   6.171   1.00 0.00 ? 36  GLY A CA   3  
ATOM 3477  C C    . GLY A 1 36  ? 10.118  4.771   6.195   1.00 0.00 ? 36  GLY A C    3  
ATOM 3478  O O    . GLY A 1 36  ? 9.893   5.593   7.082   1.00 0.00 ? 36  GLY A O    3  
ATOM 3479  H H    . GLY A 1 36  ? 11.426  2.366   7.467   1.00 0.00 ? 36  GLY A H    3  
ATOM 3480  H HA2  . GLY A 1 36  ? 12.260  4.678   5.953   1.00 0.00 ? 36  GLY A HA2  3  
ATOM 3481  H HA3  . GLY A 1 36  ? 11.415  3.258   5.370   1.00 0.00 ? 36  GLY A HA3  3  
ATOM 3482  N N    . ILE A 1 37  ? 9.281   4.481   5.211   1.00 0.00 ? 37  ILE A N    3  
ATOM 3483  C CA   . ILE A 1 37  ? 7.990   5.140   5.108   1.00 0.00 ? 37  ILE A CA   3  
ATOM 3484  C C    . ILE A 1 37  ? 6.905   4.090   4.857   1.00 0.00 ? 37  ILE A C    3  
ATOM 3485  O O    . ILE A 1 37  ? 7.152   3.083   4.196   1.00 0.00 ? 37  ILE A O    3  
ATOM 3486  C CB   . ILE A 1 37  ? 8.034   6.243   4.050   1.00 0.00 ? 37  ILE A CB   3  
ATOM 3487  C CG1  . ILE A 1 37  ? 9.206   7.195   4.299   1.00 0.00 ? 37  ILE A CG1  3  
ATOM 3488  C CG2  . ILE A 1 37  ? 6.698   6.986   3.975   1.00 0.00 ? 37  ILE A CG2  3  
ATOM 3489  C CD1  . ILE A 1 37  ? 8.875   8.193   5.410   1.00 0.00 ? 37  ILE A CD1  3  
ATOM 3490  H H    . ILE A 1 37  ? 9.472   3.811   4.493   1.00 0.00 ? 37  ILE A H    3  
ATOM 3491  H HA   . ILE A 1 37  ? 7.791   5.620   6.066   1.00 0.00 ? 37  ILE A HA   3  
ATOM 3492  H HB   . ILE A 1 37  ? 8.198   5.778   3.078   1.00 0.00 ? 37  ILE A HB   3  
ATOM 3493  H HG12 . ILE A 1 37  ? 10.092  6.623   4.571   1.00 0.00 ? 37  ILE A HG12 3  
ATOM 3494  H HG13 . ILE A 1 37  ? 9.444   7.733   3.381   1.00 0.00 ? 37  ILE A HG13 3  
ATOM 3495  H HG21 . ILE A 1 37  ? 6.404   7.306   4.975   1.00 0.00 ? 37  ILE A HG21 3  
ATOM 3496  H HG22 . ILE A 1 37  ? 6.803   7.859   3.331   1.00 0.00 ? 37  ILE A HG22 3  
ATOM 3497  H HG23 . ILE A 1 37  ? 5.936   6.322   3.567   1.00 0.00 ? 37  ILE A HG23 3  
ATOM 3498  H HD11 . ILE A 1 37  ? 8.456   7.661   6.264   1.00 0.00 ? 37  ILE A HD11 3  
ATOM 3499  H HD12 . ILE A 1 37  ? 9.784   8.712   5.715   1.00 0.00 ? 37  ILE A HD12 3  
ATOM 3500  H HD13 . ILE A 1 37  ? 8.149   8.919   5.043   1.00 0.00 ? 37  ILE A HD13 3  
ATOM 3501  N N    . TYR A 1 38  ? 5.727   4.362   5.398   1.00 0.00 ? 38  TYR A N    3  
ATOM 3502  C CA   . TYR A 1 38  ? 4.603   3.454   5.241   1.00 0.00 ? 38  TYR A CA   3  
ATOM 3503  C C    . TYR A 1 38  ? 3.278   4.171   5.504   1.00 0.00 ? 38  TYR A C    3  
ATOM 3504  O O    . TYR A 1 38  ? 3.254   5.232   6.125   1.00 0.00 ? 38  TYR A O    3  
ATOM 3505  C CB   . TYR A 1 38  ? 4.795   2.360   6.293   1.00 0.00 ? 38  TYR A CB   3  
ATOM 3506  C CG   . TYR A 1 38  ? 6.196   1.745   6.303   1.00 0.00 ? 38  TYR A CG   3  
ATOM 3507  C CD1  . TYR A 1 38  ? 7.187   2.296   7.090   1.00 0.00 ? 38  TYR A CD1  3  
ATOM 3508  C CD2  . TYR A 1 38  ? 6.469   0.638   5.524   1.00 0.00 ? 38  TYR A CD2  3  
ATOM 3509  C CE1  . TYR A 1 38  ? 8.505   1.717   7.099   1.00 0.00 ? 38  TYR A CE1  3  
ATOM 3510  C CE2  . TYR A 1 38  ? 7.788   0.059   5.533   1.00 0.00 ? 38  TYR A CE2  3  
ATOM 3511  C CZ   . TYR A 1 38  ? 8.740   0.627   6.320   1.00 0.00 ? 38  TYR A CZ   3  
ATOM 3512  O OH   . TYR A 1 38  ? 9.986   0.080   6.329   1.00 0.00 ? 38  TYR A OH   3  
ATOM 3513  H H    . TYR A 1 38  ? 5.534   5.184   5.935   1.00 0.00 ? 38  TYR A H    3  
ATOM 3514  H HA   . TYR A 1 38  ? 4.611   3.084   4.216   1.00 0.00 ? 38  TYR A HA   3  
ATOM 3515  H HB2  . TYR A 1 38  ? 4.586   2.777   7.279   1.00 0.00 ? 38  TYR A HB2  3  
ATOM 3516  H HB3  . TYR A 1 38  ? 4.064   1.570   6.120   1.00 0.00 ? 38  TYR A HB3  3  
ATOM 3517  H HD1  . TYR A 1 38  ? 6.971   3.169   7.705   1.00 0.00 ? 38  TYR A HD1  3  
ATOM 3518  H HD2  . TYR A 1 38  ? 5.687   0.203   4.902   1.00 0.00 ? 38  TYR A HD2  3  
ATOM 3519  H HE1  . TYR A 1 38  ? 9.296   2.142   7.716   1.00 0.00 ? 38  TYR A HE1  3  
ATOM 3520  H HE2  . TYR A 1 38  ? 8.017   -0.814  4.923   1.00 0.00 ? 38  TYR A HE2  3  
ATOM 3521  H HH   . TYR A 1 38  ? 10.676  0.803   6.350   1.00 0.00 ? 38  TYR A HH   3  
ATOM 3522  N N    . VAL A 1 39  ? 2.206   3.562   5.019   1.00 0.00 ? 39  VAL A N    3  
ATOM 3523  C CA   . VAL A 1 39  ? 0.879   4.129   5.194   1.00 0.00 ? 39  VAL A CA   3  
ATOM 3524  C C    . VAL A 1 39  ? 0.428   3.923   6.641   1.00 0.00 ? 39  VAL A C    3  
ATOM 3525  O O    . VAL A 1 39  ? 0.629   2.852   7.211   1.00 0.00 ? 39  VAL A O    3  
ATOM 3526  C CB   . VAL A 1 39  ? -0.087  3.523   4.174   1.00 0.00 ? 39  VAL A CB   3  
ATOM 3527  C CG1  . VAL A 1 39  ? -1.537  3.866   4.522   1.00 0.00 ? 39  VAL A CG1  3  
ATOM 3528  C CG2  . VAL A 1 39  ? 0.258   3.976   2.754   1.00 0.00 ? 39  VAL A CG2  3  
ATOM 3529  H H    . VAL A 1 39  ? 2.233   2.699   4.515   1.00 0.00 ? 39  VAL A H    3  
ATOM 3530  H HA   . VAL A 1 39  ? 0.950   5.199   4.997   1.00 0.00 ? 39  VAL A HA   3  
ATOM 3531  H HB   . VAL A 1 39  ? 0.019   2.439   4.215   1.00 0.00 ? 39  VAL A HB   3  
ATOM 3532  H HG11 . VAL A 1 39  ? -2.100  2.946   4.682   1.00 0.00 ? 39  VAL A HG11 3  
ATOM 3533  H HG12 . VAL A 1 39  ? -1.560  4.468   5.430   1.00 0.00 ? 39  VAL A HG12 3  
ATOM 3534  H HG13 . VAL A 1 39  ? -1.984  4.428   3.702   1.00 0.00 ? 39  VAL A HG13 3  
ATOM 3535  H HG21 . VAL A 1 39  ? -0.086  3.227   2.040   1.00 0.00 ? 39  VAL A HG21 3  
ATOM 3536  H HG22 . VAL A 1 39  ? -0.232  4.927   2.547   1.00 0.00 ? 39  VAL A HG22 3  
ATOM 3537  H HG23 . VAL A 1 39  ? 1.337   4.096   2.664   1.00 0.00 ? 39  VAL A HG23 3  
ATOM 3538  N N    . SER A 1 40  ? -0.173  4.966   7.194   1.00 0.00 ? 40  SER A N    3  
ATOM 3539  C CA   . SER A 1 40  ? -0.654  4.914   8.564   1.00 0.00 ? 40  SER A CA   3  
ATOM 3540  C C    . SER A 1 40  ? -2.181  4.822   8.579   1.00 0.00 ? 40  SER A C    3  
ATOM 3541  O O    . SER A 1 40  ? -2.766  4.293   9.524   1.00 0.00 ? 40  SER A O    3  
ATOM 3542  C CB   . SER A 1 40  ? -0.188  6.135   9.359   1.00 0.00 ? 40  SER A CB   3  
ATOM 3543  O OG   . SER A 1 40  ? -1.086  7.234   9.224   1.00 0.00 ? 40  SER A OG   3  
ATOM 3544  H H    . SER A 1 40  ? -0.333  5.834   6.723   1.00 0.00 ? 40  SER A H    3  
ATOM 3545  H HA   . SER A 1 40  ? -0.212  4.013   8.990   1.00 0.00 ? 40  SER A HA   3  
ATOM 3546  H HB2  . SER A 1 40  ? -0.096  5.869   10.412  1.00 0.00 ? 40  SER A HB2  3  
ATOM 3547  H HB3  . SER A 1 40  ? 0.803   6.433   9.018   1.00 0.00 ? 40  SER A HB3  3  
ATOM 3548  H HG   . SER A 1 40  ? -1.983  6.989   9.590   1.00 0.00 ? 40  SER A HG   3  
ATOM 3549  N N    . LEU A 1 41  ? -2.784  5.344   7.521   1.00 0.00 ? 41  LEU A N    3  
ATOM 3550  C CA   . LEU A 1 41  ? -4.232  5.327   7.401   1.00 0.00 ? 41  LEU A CA   3  
ATOM 3551  C C    . LEU A 1 41  ? -4.617  5.349   5.920   1.00 0.00 ? 41  LEU A C    3  
ATOM 3552  O O    . LEU A 1 41  ? -3.906  5.926   5.099   1.00 0.00 ? 41  LEU A O    3  
ATOM 3553  C CB   . LEU A 1 41  ? -4.850  6.467   8.213   1.00 0.00 ? 41  LEU A CB   3  
ATOM 3554  C CG   . LEU A 1 41  ? -6.343  6.718   7.989   1.00 0.00 ? 41  LEU A CG   3  
ATOM 3555  C CD1  . LEU A 1 41  ? -6.603  7.262   6.583   1.00 0.00 ? 41  LEU A CD1  3  
ATOM 3556  C CD2  . LEU A 1 41  ? -7.160  5.456   8.275   1.00 0.00 ? 41  LEU A CD2  3  
ATOM 3557  H H    . LEU A 1 41  ? -2.302  5.772   6.757   1.00 0.00 ? 41  LEU A H    3  
ATOM 3558  H HA   . LEU A 1 41  ? -4.586  4.393   7.836   1.00 0.00 ? 41  LEU A HA   3  
ATOM 3559  H HB2  . LEU A 1 41  ? -4.692  6.260   9.272   1.00 0.00 ? 41  LEU A HB2  3  
ATOM 3560  H HB3  . LEU A 1 41  ? -4.310  7.385   7.984   1.00 0.00 ? 41  LEU A HB3  3  
ATOM 3561  H HG   . LEU A 1 41  ? -6.671  7.480   8.696   1.00 0.00 ? 41  LEU A HG   3  
ATOM 3562  H HD11 . LEU A 1 41  ? -7.124  6.509   5.992   1.00 0.00 ? 41  LEU A HD11 3  
ATOM 3563  H HD12 . LEU A 1 41  ? -7.216  8.161   6.650   1.00 0.00 ? 41  LEU A HD12 3  
ATOM 3564  H HD13 . LEU A 1 41  ? -5.653  7.505   6.107   1.00 0.00 ? 41  LEU A HD13 3  
ATOM 3565  H HD21 . LEU A 1 41  ? -7.829  5.259   7.437   1.00 0.00 ? 41  LEU A HD21 3  
ATOM 3566  H HD22 . LEU A 1 41  ? -6.486  4.609   8.408   1.00 0.00 ? 41  LEU A HD22 3  
ATOM 3567  H HD23 . LEU A 1 41  ? -7.746  5.600   9.183   1.00 0.00 ? 41  LEU A HD23 3  
ATOM 3568  N N    . VAL A 1 42  ? -5.741  4.712   5.624   1.00 0.00 ? 42  VAL A N    3  
ATOM 3569  C CA   . VAL A 1 42  ? -6.228  4.651   4.257   1.00 0.00 ? 42  VAL A CA   3  
ATOM 3570  C C    . VAL A 1 42  ? -7.737  4.903   4.246   1.00 0.00 ? 42  VAL A C    3  
ATOM 3571  O O    . VAL A 1 42  ? -8.500  4.156   4.857   1.00 0.00 ? 42  VAL A O    3  
ATOM 3572  C CB   . VAL A 1 42  ? -5.842  3.313   3.623   1.00 0.00 ? 42  VAL A CB   3  
ATOM 3573  C CG1  . VAL A 1 42  ? -6.794  2.952   2.481   1.00 0.00 ? 42  VAL A CG1  3  
ATOM 3574  C CG2  . VAL A 1 42  ? -4.390  3.334   3.141   1.00 0.00 ? 42  VAL A CG2  3  
ATOM 3575  H H    . VAL A 1 42  ? -6.313  4.245   6.298   1.00 0.00 ? 42  VAL A H    3  
ATOM 3576  H HA   . VAL A 1 42  ? -5.736  5.445   3.696   1.00 0.00 ? 42  VAL A HA   3  
ATOM 3577  H HB   . VAL A 1 42  ? -5.929  2.542   4.388   1.00 0.00 ? 42  VAL A HB   3  
ATOM 3578  H HG11 . VAL A 1 42  ? -7.636  2.385   2.876   1.00 0.00 ? 42  VAL A HG11 3  
ATOM 3579  H HG12 . VAL A 1 42  ? -7.159  3.865   2.010   1.00 0.00 ? 42  VAL A HG12 3  
ATOM 3580  H HG13 . VAL A 1 42  ? -6.264  2.350   1.743   1.00 0.00 ? 42  VAL A HG13 3  
ATOM 3581  H HG21 . VAL A 1 42  ? -3.816  2.583   3.683   1.00 0.00 ? 42  VAL A HG21 3  
ATOM 3582  H HG22 . VAL A 1 42  ? -4.358  3.115   2.073   1.00 0.00 ? 42  VAL A HG22 3  
ATOM 3583  H HG23 . VAL A 1 42  ? -3.961  4.320   3.322   1.00 0.00 ? 42  VAL A HG23 3  
ATOM 3584  N N    . GLU A 1 43  ? -8.124  5.959   3.546   1.00 0.00 ? 43  GLU A N    3  
ATOM 3585  C CA   . GLU A 1 43  ? -9.528  6.320   3.448   1.00 0.00 ? 43  GLU A CA   3  
ATOM 3586  C C    . GLU A 1 43  ? -10.295 5.256   2.660   1.00 0.00 ? 43  GLU A C    3  
ATOM 3587  O O    . GLU A 1 43  ? -9.779  4.704   1.690   1.00 0.00 ? 43  GLU A O    3  
ATOM 3588  C CB   . GLU A 1 43  ? -9.696  7.701   2.811   1.00 0.00 ? 43  GLU A CB   3  
ATOM 3589  C CG   . GLU A 1 43  ? -9.679  8.800   3.875   1.00 0.00 ? 43  GLU A CG   3  
ATOM 3590  C CD   . GLU A 1 43  ? -9.022  10.073  3.337   1.00 0.00 ? 43  GLU A CD   3  
ATOM 3591  O OE1  . GLU A 1 43  ? -9.722  10.810  2.610   1.00 0.00 ? 43  GLU A OE1  3  
ATOM 3592  O OE2  . GLU A 1 43  ? -7.833  10.280  3.664   1.00 0.00 ? 43  GLU A OE2  3  
ATOM 3593  H H    . GLU A 1 43  ? -7.497  6.562   3.051   1.00 0.00 ? 43  GLU A H    3  
ATOM 3594  H HA   . GLU A 1 43  ? -9.891  6.353   4.475   1.00 0.00 ? 43  GLU A HA   3  
ATOM 3595  H HB2  . GLU A 1 43  ? -8.896  7.873   2.091   1.00 0.00 ? 43  GLU A HB2  3  
ATOM 3596  H HB3  . GLU A 1 43  ? -10.636 7.739   2.259   1.00 0.00 ? 43  GLU A HB3  3  
ATOM 3597  H HG2  . GLU A 1 43  ? -10.698 9.020   4.193   1.00 0.00 ? 43  GLU A HG2  3  
ATOM 3598  H HG3  . GLU A 1 43  ? -9.138  8.452   4.754   1.00 0.00 ? 43  GLU A HG3  3  
ATOM 3599  N N    . PRO A 1 44  ? -11.548 4.993   3.119   1.00 0.00 ? 44  PRO A N    3  
ATOM 3600  C CA   . PRO A 1 44  ? -12.392 4.005   2.468   1.00 0.00 ? 44  PRO A CA   3  
ATOM 3601  C C    . PRO A 1 44  ? -12.950 4.544   1.150   1.00 0.00 ? 44  PRO A C    3  
ATOM 3602  O O    . PRO A 1 44  ? -12.928 5.750   0.908   1.00 0.00 ? 44  PRO A O    3  
ATOM 3603  C CB   . PRO A 1 44  ? -13.475 3.682   3.484   1.00 0.00 ? 44  PRO A CB   3  
ATOM 3604  C CG   . PRO A 1 44  ? -13.470 4.832   4.478   1.00 0.00 ? 44  PRO A CG   3  
ATOM 3605  C CD   . PRO A 1 44  ? -12.193 5.627   4.265   1.00 0.00 ? 44  PRO A CD   3  
ATOM 3606  H HA   . PRO A 1 44  ? -11.856 3.196   2.227   1.00 0.00 ? 44  PRO A HA   3  
ATOM 3607  H HB2  . PRO A 1 44  ? -14.447 3.587   3.001   1.00 0.00 ? 44  PRO A HB2  3  
ATOM 3608  H HB3  . PRO A 1 44  ? -13.273 2.734   3.983   1.00 0.00 ? 44  PRO A HB3  3  
ATOM 3609  H HG2  . PRO A 1 44  ? -14.344 5.467   4.331   1.00 0.00 ? 44  PRO A HG2  3  
ATOM 3610  H HG3  . PRO A 1 44  ? -13.519 4.454   5.499   1.00 0.00 ? 44  PRO A HG3  3  
ATOM 3611  H HD2  . PRO A 1 44  ? -12.408 6.677   4.067   1.00 0.00 ? 44  PRO A HD2  3  
ATOM 3612  H HD3  . PRO A 1 44  ? -11.553 5.593   5.147   1.00 0.00 ? 44  PRO A HD3  3  
ATOM 3613  N N    . GLY A 1 45  ? -13.438 3.624   0.330   1.00 0.00 ? 45  GLY A N    3  
ATOM 3614  C CA   . GLY A 1 45  ? -14.002 3.992   -0.957  1.00 0.00 ? 45  GLY A CA   3  
ATOM 3615  C C    . GLY A 1 45  ? -13.201 5.124   -1.603  1.00 0.00 ? 45  GLY A C    3  
ATOM 3616  O O    . GLY A 1 45  ? -13.752 5.934   -2.347  1.00 0.00 ? 45  GLY A O    3  
ATOM 3617  H H    . GLY A 1 45  ? -13.453 2.645   0.534   1.00 0.00 ? 45  GLY A H    3  
ATOM 3618  H HA2  . GLY A 1 45  ? -14.008 3.124   -1.617  1.00 0.00 ? 45  GLY A HA2  3  
ATOM 3619  H HA3  . GLY A 1 45  ? -15.039 4.302   -0.829  1.00 0.00 ? 45  GLY A HA3  3  
ATOM 3620  N N    . SER A 1 46  ? -11.912 5.146   -1.294  1.00 0.00 ? 46  SER A N    3  
ATOM 3621  C CA   . SER A 1 46  ? -11.030 6.165   -1.835  1.00 0.00 ? 46  SER A CA   3  
ATOM 3622  C C    . SER A 1 46  ? -10.248 5.604   -3.024  1.00 0.00 ? 46  SER A C    3  
ATOM 3623  O O    . SER A 1 46  ? -10.336 4.414   -3.323  1.00 0.00 ? 46  SER A O    3  
ATOM 3624  C CB   . SER A 1 46  ? -10.068 6.685   -0.765  1.00 0.00 ? 46  SER A CB   3  
ATOM 3625  O OG   . SER A 1 46  ? -8.843  5.957   -0.750  1.00 0.00 ? 46  SER A OG   3  
ATOM 3626  H H    . SER A 1 46  ? -11.472 4.484   -0.688  1.00 0.00 ? 46  SER A H    3  
ATOM 3627  H HA   . SER A 1 46  ? -11.686 6.974   -2.157  1.00 0.00 ? 46  SER A HA   3  
ATOM 3628  H HB2  . SER A 1 46  ? -9.861  7.740   -0.946  1.00 0.00 ? 46  SER A HB2  3  
ATOM 3629  H HB3  . SER A 1 46  ? -10.543 6.617   0.213   1.00 0.00 ? 46  SER A HB3  3  
ATOM 3630  H HG   . SER A 1 46  ? -8.995  5.039   -0.384  1.00 0.00 ? 46  SER A HG   3  
ATOM 3631  N N    . LEU A 1 47  ? -9.501  6.487   -3.671  1.00 0.00 ? 47  LEU A N    3  
ATOM 3632  C CA   . LEU A 1 47  ? -8.705  6.094   -4.821  1.00 0.00 ? 47  LEU A CA   3  
ATOM 3633  C C    . LEU A 1 47  ? -7.568  5.179   -4.360  1.00 0.00 ? 47  LEU A C    3  
ATOM 3634  O O    . LEU A 1 47  ? -7.423  4.064   -4.858  1.00 0.00 ? 47  LEU A O    3  
ATOM 3635  C CB   . LEU A 1 47  ? -8.227  7.328   -5.589  1.00 0.00 ? 47  LEU A CB   3  
ATOM 3636  C CG   . LEU A 1 47  ? -7.435  7.057   -6.869  1.00 0.00 ? 47  LEU A CG   3  
ATOM 3637  C CD1  . LEU A 1 47  ? -8.053  5.904   -7.663  1.00 0.00 ? 47  LEU A CD1  3  
ATOM 3638  C CD2  . LEU A 1 47  ? -7.302  8.327   -7.712  1.00 0.00 ? 47  LEU A CD2  3  
ATOM 3639  H H    . LEU A 1 47  ? -9.436  7.453   -3.422  1.00 0.00 ? 47  LEU A H    3  
ATOM 3640  H HA   . LEU A 1 47  ? -9.353  5.529   -5.490  1.00 0.00 ? 47  LEU A HA   3  
ATOM 3641  H HB2  . LEU A 1 47  ? -9.098  7.932   -5.845  1.00 0.00 ? 47  LEU A HB2  3  
ATOM 3642  H HB3  . LEU A 1 47  ? -7.609  7.930   -4.923  1.00 0.00 ? 47  LEU A HB3  3  
ATOM 3643  H HG   . LEU A 1 47  ? -6.427  6.750   -6.589  1.00 0.00 ? 47  LEU A HG   3  
ATOM 3644  H HD11 . LEU A 1 47  ? -9.047  6.193   -8.007  1.00 0.00 ? 47  LEU A HD11 3  
ATOM 3645  H HD12 . LEU A 1 47  ? -7.423  5.675   -8.522  1.00 0.00 ? 47  LEU A HD12 3  
ATOM 3646  H HD13 . LEU A 1 47  ? -8.132  5.024   -7.024  1.00 0.00 ? 47  LEU A HD13 3  
ATOM 3647  H HD21 . LEU A 1 47  ? -8.290  8.755   -7.881  1.00 0.00 ? 47  LEU A HD21 3  
ATOM 3648  H HD22 . LEU A 1 47  ? -6.679  9.049   -7.185  1.00 0.00 ? 47  LEU A HD22 3  
ATOM 3649  H HD23 . LEU A 1 47  ? -6.843  8.081   -8.669  1.00 0.00 ? 47  LEU A HD23 3  
ATOM 3650  N N    . ALA A 1 48  ? -6.791  5.685   -3.413  1.00 0.00 ? 48  ALA A N    3  
ATOM 3651  C CA   . ALA A 1 48  ? -5.672  4.927   -2.880  1.00 0.00 ? 48  ALA A CA   3  
ATOM 3652  C C    . ALA A 1 48  ? -6.112  3.483   -2.632  1.00 0.00 ? 48  ALA A C    3  
ATOM 3653  O O    . ALA A 1 48  ? -5.622  2.561   -3.282  1.00 0.00 ? 48  ALA A O    3  
ATOM 3654  C CB   . ALA A 1 48  ? -5.155  5.606   -1.609  1.00 0.00 ? 48  ALA A CB   3  
ATOM 3655  H H    . ALA A 1 48  ? -6.916  6.593   -3.013  1.00 0.00 ? 48  ALA A H    3  
ATOM 3656  H HA   . ALA A 1 48  ? -4.880  4.934   -3.628  1.00 0.00 ? 48  ALA A HA   3  
ATOM 3657  H HB1  . ALA A 1 48  ? -5.187  6.688   -1.737  1.00 0.00 ? 48  ALA A HB1  3  
ATOM 3658  H HB2  . ALA A 1 48  ? -5.783  5.321   -0.765  1.00 0.00 ? 48  ALA A HB2  3  
ATOM 3659  H HB3  . ALA A 1 48  ? -4.129  5.291   -1.421  1.00 0.00 ? 48  ALA A HB3  3  
ATOM 3660  N N    . GLU A 1 49  ? -7.031  3.331   -1.690  1.00 0.00 ? 49  GLU A N    3  
ATOM 3661  C CA   . GLU A 1 49  ? -7.543  2.015   -1.348  1.00 0.00 ? 49  GLU A CA   3  
ATOM 3662  C C    . GLU A 1 49  ? -7.982  1.272   -2.611  1.00 0.00 ? 49  GLU A C    3  
ATOM 3663  O O    . GLU A 1 49  ? -7.959  0.043   -2.653  1.00 0.00 ? 49  GLU A O    3  
ATOM 3664  C CB   . GLU A 1 49  ? -8.692  2.117   -0.344  1.00 0.00 ? 49  GLU A CB   3  
ATOM 3665  C CG   . GLU A 1 49  ? -9.218  0.730   0.031   1.00 0.00 ? 49  GLU A CG   3  
ATOM 3666  C CD   . GLU A 1 49  ? -9.212  0.533   1.548   1.00 0.00 ? 49  GLU A CD   3  
ATOM 3667  O OE1  . GLU A 1 49  ? -10.202 0.962   2.179   1.00 0.00 ? 49  GLU A OE1  3  
ATOM 3668  O OE2  . GLU A 1 49  ? -8.219  -0.043  2.042   1.00 0.00 ? 49  GLU A OE2  3  
ATOM 3669  H H    . GLU A 1 49  ? -7.425  4.087   -1.166  1.00 0.00 ? 49  GLU A H    3  
ATOM 3670  H HA   . GLU A 1 49  ? -6.707  1.491   -0.883  1.00 0.00 ? 49  GLU A HA   3  
ATOM 3671  H HB2  . GLU A 1 49  ? -8.352  2.635   0.553   1.00 0.00 ? 49  GLU A HB2  3  
ATOM 3672  H HB3  . GLU A 1 49  ? -9.500  2.713   -0.769  1.00 0.00 ? 49  GLU A HB3  3  
ATOM 3673  H HG2  . GLU A 1 49  ? -10.231 0.605   -0.352  1.00 0.00 ? 49  GLU A HG2  3  
ATOM 3674  H HG3  . GLU A 1 49  ? -8.602  -0.036  -0.441  1.00 0.00 ? 49  GLU A HG3  3  
ATOM 3675  N N    . LYS A 1 50  ? -8.373  2.049   -3.611  1.00 0.00 ? 50  LYS A N    3  
ATOM 3676  C CA   . LYS A 1 50  ? -8.818  1.480   -4.872  1.00 0.00 ? 50  LYS A CA   3  
ATOM 3677  C C    . LYS A 1 50  ? -7.598  1.082   -5.705  1.00 0.00 ? 50  LYS A C    3  
ATOM 3678  O O    . LYS A 1 50  ? -7.659  0.136   -6.488  1.00 0.00 ? 50  LYS A O    3  
ATOM 3679  C CB   . LYS A 1 50  ? -9.766  2.443   -5.590  1.00 0.00 ? 50  LYS A CB   3  
ATOM 3680  C CG   . LYS A 1 50  ? -11.212 2.227   -5.139  1.00 0.00 ? 50  LYS A CG   3  
ATOM 3681  C CD   . LYS A 1 50  ? -12.173 3.107   -5.940  1.00 0.00 ? 50  LYS A CD   3  
ATOM 3682  C CE   . LYS A 1 50  ? -13.464 3.361   -5.160  1.00 0.00 ? 50  LYS A CE   3  
ATOM 3683  N NZ   . LYS A 1 50  ? -14.166 4.551   -5.691  1.00 0.00 ? 50  LYS A NZ   3  
ATOM 3684  H H    . LYS A 1 50  ? -8.390  3.048   -3.569  1.00 0.00 ? 50  LYS A H    3  
ATOM 3685  H HA   . LYS A 1 50  ? -9.387  0.580   -4.641  1.00 0.00 ? 50  LYS A HA   3  
ATOM 3686  H HB2  . LYS A 1 50  ? -9.468  3.472   -5.387  1.00 0.00 ? 50  LYS A HB2  3  
ATOM 3687  H HB3  . LYS A 1 50  ? -9.691  2.297   -6.667  1.00 0.00 ? 50  LYS A HB3  3  
ATOM 3688  H HG2  . LYS A 1 50  ? -11.483 1.179   -5.264  1.00 0.00 ? 50  LYS A HG2  3  
ATOM 3689  H HG3  . LYS A 1 50  ? -11.304 2.455   -4.077  1.00 0.00 ? 50  LYS A HG3  3  
ATOM 3690  H HD2  . LYS A 1 50  ? -11.693 4.057   -6.175  1.00 0.00 ? 50  LYS A HD2  3  
ATOM 3691  H HD3  . LYS A 1 50  ? -12.407 2.626   -6.890  1.00 0.00 ? 50  LYS A HD3  3  
ATOM 3692  H HE2  . LYS A 1 50  ? -14.114 2.489   -5.226  1.00 0.00 ? 50  LYS A HE2  3  
ATOM 3693  H HE3  . LYS A 1 50  ? -13.235 3.508   -4.104  1.00 0.00 ? 50  LYS A HE3  3  
ATOM 3694  H HZ1  . LYS A 1 50  ? -14.559 5.072   -4.934  1.00 0.00 ? 50  LYS A HZ1  3  
ATOM 3695  H HZ2  . LYS A 1 50  ? -13.517 5.125   -6.190  1.00 0.00 ? 50  LYS A HZ2  3  
ATOM 3696  H HZ3  . LYS A 1 50  ? -14.896 4.259   -6.309  1.00 0.00 ? 50  LYS A HZ3  3  
ATOM 3697  N N    . GLU A 1 51  ? -6.519  1.825   -5.508  1.00 0.00 ? 51  GLU A N    3  
ATOM 3698  C CA   . GLU A 1 51  ? -5.287  1.562   -6.231  1.00 0.00 ? 51  GLU A CA   3  
ATOM 3699  C C    . GLU A 1 51  ? -4.561  0.360   -5.624  1.00 0.00 ? 51  GLU A C    3  
ATOM 3700  O O    . GLU A 1 51  ? -3.680  -0.222  -6.255  1.00 0.00 ? 51  GLU A O    3  
ATOM 3701  C CB   . GLU A 1 51  ? -4.384  2.797   -6.245  1.00 0.00 ? 51  GLU A CB   3  
ATOM 3702  C CG   . GLU A 1 51  ? -5.048  3.952   -6.998  1.00 0.00 ? 51  GLU A CG   3  
ATOM 3703  C CD   . GLU A 1 51  ? -5.439  3.530   -8.416  1.00 0.00 ? 51  GLU A CD   3  
ATOM 3704  O OE1  . GLU A 1 51  ? -4.585  3.696   -9.313  1.00 0.00 ? 51  GLU A OE1  3  
ATOM 3705  O OE2  . GLU A 1 51  ? -6.583  3.051   -8.569  1.00 0.00 ? 51  GLU A OE2  3  
ATOM 3706  H H    . GLU A 1 51  ? -6.478  2.593   -4.869  1.00 0.00 ? 51  GLU A H    3  
ATOM 3707  H HA   . GLU A 1 51  ? -5.593  1.332   -7.252  1.00 0.00 ? 51  GLU A HA   3  
ATOM 3708  H HB2  . GLU A 1 51  ? -4.165  3.103   -5.222  1.00 0.00 ? 51  GLU A HB2  3  
ATOM 3709  H HB3  . GLU A 1 51  ? -3.432  2.551   -6.715  1.00 0.00 ? 51  GLU A HB3  3  
ATOM 3710  H HG2  . GLU A 1 51  ? -5.933  4.284   -6.456  1.00 0.00 ? 51  GLU A HG2  3  
ATOM 3711  H HG3  . GLU A 1 51  ? -4.365  4.801   -7.043  1.00 0.00 ? 51  GLU A HG3  3  
ATOM 3712  N N    . GLY A 1 52  ? -4.958  0.023   -4.406  1.00 0.00 ? 52  GLY A N    3  
ATOM 3713  C CA   . GLY A 1 52  ? -4.357  -1.100  -3.706  1.00 0.00 ? 52  GLY A CA   3  
ATOM 3714  C C    . GLY A 1 52  ? -3.760  -0.657  -2.369  1.00 0.00 ? 52  GLY A C    3  
ATOM 3715  O O    . GLY A 1 52  ? -3.594  -1.468  -1.460  1.00 0.00 ? 52  GLY A O    3  
ATOM 3716  H H    . GLY A 1 52  ? -5.676  0.501   -3.899  1.00 0.00 ? 52  GLY A H    3  
ATOM 3717  H HA2  . GLY A 1 52  ? -5.108  -1.871  -3.536  1.00 0.00 ? 52  GLY A HA2  3  
ATOM 3718  H HA3  . GLY A 1 52  ? -3.579  -1.544  -4.326  1.00 0.00 ? 52  GLY A HA3  3  
ATOM 3719  N N    . LEU A 1 53  ? -3.455  0.630   -2.291  1.00 0.00 ? 53  LEU A N    3  
ATOM 3720  C CA   . LEU A 1 53  ? -2.881  1.192   -1.080  1.00 0.00 ? 53  LEU A CA   3  
ATOM 3721  C C    . LEU A 1 53  ? -3.623  0.636   0.136   1.00 0.00 ? 53  LEU A C    3  
ATOM 3722  O O    . LEU A 1 53  ? -4.747  0.150   0.014   1.00 0.00 ? 53  LEU A O    3  
ATOM 3723  C CB   . LEU A 1 53  ? -2.872  2.720   -1.150  1.00 0.00 ? 53  LEU A CB   3  
ATOM 3724  C CG   . LEU A 1 53  ? -1.541  3.399   -0.820  1.00 0.00 ? 53  LEU A CG   3  
ATOM 3725  C CD1  . LEU A 1 53  ? -0.573  3.312   -2.002  1.00 0.00 ? 53  LEU A CD1  3  
ATOM 3726  C CD2  . LEU A 1 53  ? -1.760  4.842   -0.363  1.00 0.00 ? 53  LEU A CD2  3  
ATOM 3727  H H    . LEU A 1 53  ? -3.593  1.284   -3.035  1.00 0.00 ? 53  LEU A H    3  
ATOM 3728  H HA   . LEU A 1 53  ? -1.842  0.865   -1.030  1.00 0.00 ? 53  LEU A HA   3  
ATOM 3729  H HB2  . LEU A 1 53  ? -3.171  3.020   -2.154  1.00 0.00 ? 53  LEU A HB2  3  
ATOM 3730  H HB3  . LEU A 1 53  ? -3.630  3.099   -0.465  1.00 0.00 ? 53  LEU A HB3  3  
ATOM 3731  H HG   . LEU A 1 53  ? -1.081  2.864   0.012   1.00 0.00 ? 53  LEU A HG   3  
ATOM 3732  H HD11 . LEU A 1 53  ? 0.162   2.529   -1.813  1.00 0.00 ? 53  LEU A HD11 3  
ATOM 3733  H HD12 . LEU A 1 53  ? -1.129  3.077   -2.910  1.00 0.00 ? 53  LEU A HD12 3  
ATOM 3734  H HD13 . LEU A 1 53  ? -0.063  4.267   -2.125  1.00 0.00 ? 53  LEU A HD13 3  
ATOM 3735  H HD21 . LEU A 1 53  ? -1.976  5.468   -1.229  1.00 0.00 ? 53  LEU A HD21 3  
ATOM 3736  H HD22 . LEU A 1 53  ? -2.598  4.880   0.332   1.00 0.00 ? 53  LEU A HD22 3  
ATOM 3737  H HD23 . LEU A 1 53  ? -0.860  5.207   0.132   1.00 0.00 ? 53  LEU A HD23 3  
ATOM 3738  N N    . ARG A 1 54  ? -2.965  0.725   1.283   1.00 0.00 ? 54  ARG A N    3  
ATOM 3739  C CA   . ARG A 1 54  ? -3.549  0.237   2.521   1.00 0.00 ? 54  ARG A CA   3  
ATOM 3740  C C    . ARG A 1 54  ? -2.514  0.272   3.646   1.00 0.00 ? 54  ARG A C    3  
ATOM 3741  O O    . ARG A 1 54  ? -1.327  0.050   3.410   1.00 0.00 ? 54  ARG A O    3  
ATOM 3742  C CB   . ARG A 1 54  ? -4.069  -1.193  2.359   1.00 0.00 ? 54  ARG A CB   3  
ATOM 3743  C CG   . ARG A 1 54  ? -5.598  -1.219  2.312   1.00 0.00 ? 54  ARG A CG   3  
ATOM 3744  C CD   . ARG A 1 54  ? -6.096  -1.867  1.018   1.00 0.00 ? 54  ARG A CD   3  
ATOM 3745  N NE   . ARG A 1 54  ? -7.117  -2.892  1.326   1.00 0.00 ? 54  ARG A NE   3  
ATOM 3746  C CZ   . ARG A 1 54  ? -7.567  -3.794  0.443   1.00 0.00 ? 54  ARG A CZ   3  
ATOM 3747  N NH1  . ARG A 1 54  ? -7.088  -3.802  -0.809  1.00 0.00 ? 54  ARG A NH1  3  
ATOM 3748  N NH2  . ARG A 1 54  ? -8.496  -4.687  0.811   1.00 0.00 ? 54  ARG A NH2  3  
ATOM 3749  H H    . ARG A 1 54  ? -2.052  1.121   1.374   1.00 0.00 ? 54  ARG A H    3  
ATOM 3750  H HA   . ARG A 1 54  ? -4.375  0.918   2.727   1.00 0.00 ? 54  ARG A HA   3  
ATOM 3751  H HB2  . ARG A 1 54  ? -3.666  -1.628  1.444   1.00 0.00 ? 54  ARG A HB2  3  
ATOM 3752  H HB3  . ARG A 1 54  ? -3.716  -1.808  3.187   1.00 0.00 ? 54  ARG A HB3  3  
ATOM 3753  H HG2  . ARG A 1 54  ? -5.982  -1.771  3.170   1.00 0.00 ? 54  ARG A HG2  3  
ATOM 3754  H HG3  . ARG A 1 54  ? -5.985  -0.203  2.387   1.00 0.00 ? 54  ARG A HG3  3  
ATOM 3755  H HD2  . ARG A 1 54  ? -6.518  -1.107  0.361   1.00 0.00 ? 54  ARG A HD2  3  
ATOM 3756  H HD3  . ARG A 1 54  ? -5.261  -2.322  0.485   1.00 0.00 ? 54  ARG A HD3  3  
ATOM 3757  H HE   . ARG A 1 54  ? -7.496  -2.914  2.252   1.00 0.00 ? 54  ARG A HE   3  
ATOM 3758  H HH11 . ARG A 1 54  ? -6.395  -3.135  -1.083  1.00 0.00 ? 54  ARG A HH11 3  
ATOM 3759  H HH12 . ARG A 1 54  ? -7.424  -4.475  -1.468  1.00 0.00 ? 54  ARG A HH12 3  
ATOM 3760  H HH21 . ARG A 1 54  ? -8.853  -4.681  1.745   1.00 0.00 ? 54  ARG A HH21 3  
ATOM 3761  H HH22 . ARG A 1 54  ? -8.831  -5.360  0.152   1.00 0.00 ? 54  ARG A HH22 3  
ATOM 3762  N N    . VAL A 1 55  ? -3.000  0.552   4.847   1.00 0.00 ? 55  VAL A N    3  
ATOM 3763  C CA   . VAL A 1 55  ? -2.131  0.619   6.009   1.00 0.00 ? 55  VAL A CA   3  
ATOM 3764  C C    . VAL A 1 55  ? -1.269  -0.644  6.069   1.00 0.00 ? 55  VAL A C    3  
ATOM 3765  O O    . VAL A 1 55  ? -1.783  -1.741  6.281   1.00 0.00 ? 55  VAL A O    3  
ATOM 3766  C CB   . VAL A 1 55  ? -2.965  0.834   7.274   1.00 0.00 ? 55  VAL A CB   3  
ATOM 3767  C CG1  . VAL A 1 55  ? -2.107  0.671   8.530   1.00 0.00 ? 55  VAL A CG1  3  
ATOM 3768  C CG2  . VAL A 1 55  ? -3.650  2.202   7.252   1.00 0.00 ? 55  VAL A CG2  3  
ATOM 3769  H H    . VAL A 1 55  ? -3.966  0.731   5.030   1.00 0.00 ? 55  VAL A H    3  
ATOM 3770  H HA   . VAL A 1 55  ? -1.479  1.483   5.883   1.00 0.00 ? 55  VAL A HA   3  
ATOM 3771  H HB   . VAL A 1 55  ? -3.742  0.071   7.297   1.00 0.00 ? 55  VAL A HB   3  
ATOM 3772  H HG11 . VAL A 1 55  ? -2.012  1.633   9.033   1.00 0.00 ? 55  VAL A HG11 3  
ATOM 3773  H HG12 . VAL A 1 55  ? -2.580  -0.045  9.203   1.00 0.00 ? 55  VAL A HG12 3  
ATOM 3774  H HG13 . VAL A 1 55  ? -1.118  0.308   8.251   1.00 0.00 ? 55  VAL A HG13 3  
ATOM 3775  H HG21 . VAL A 1 55  ? -2.983  2.936   6.800   1.00 0.00 ? 55  VAL A HG21 3  
ATOM 3776  H HG22 . VAL A 1 55  ? -4.569  2.139   6.669   1.00 0.00 ? 55  VAL A HG22 3  
ATOM 3777  H HG23 . VAL A 1 55  ? -3.887  2.506   8.271   1.00 0.00 ? 55  VAL A HG23 3  
ATOM 3778  N N    . GLY A 1 56  ? 0.027   -0.447  5.880   1.00 0.00 ? 56  GLY A N    3  
ATOM 3779  C CA   . GLY A 1 56  ? 0.965   -1.557  5.910   1.00 0.00 ? 56  GLY A CA   3  
ATOM 3780  C C    . GLY A 1 56  ? 1.928   -1.493  4.722   1.00 0.00 ? 56  GLY A C    3  
ATOM 3781  O O    . GLY A 1 56  ? 3.048   -1.995  4.800   1.00 0.00 ? 56  GLY A O    3  
ATOM 3782  H H    . GLY A 1 56  ? 0.437   0.448   5.708   1.00 0.00 ? 56  GLY A H    3  
ATOM 3783  H HA2  . GLY A 1 56  ? 1.530   -1.535  6.842   1.00 0.00 ? 56  GLY A HA2  3  
ATOM 3784  H HA3  . GLY A 1 56  ? 0.419   -2.500  5.890   1.00 0.00 ? 56  GLY A HA3  3  
ATOM 3785  N N    . ASP A 1 57  ? 1.456   -0.872  3.651   1.00 0.00 ? 57  ASP A N    3  
ATOM 3786  C CA   . ASP A 1 57  ? 2.261   -0.737  2.449   1.00 0.00 ? 57  ASP A CA   3  
ATOM 3787  C C    . ASP A 1 57  ? 3.579   -0.043  2.799   1.00 0.00 ? 57  ASP A C    3  
ATOM 3788  O O    . ASP A 1 57  ? 3.748   0.452   3.913   1.00 0.00 ? 57  ASP A O    3  
ATOM 3789  C CB   . ASP A 1 57  ? 1.543   0.114   1.399   1.00 0.00 ? 57  ASP A CB   3  
ATOM 3790  C CG   . ASP A 1 57  ? 1.641   1.626   1.614   1.00 0.00 ? 57  ASP A CG   3  
ATOM 3791  O OD1  . ASP A 1 57  ? 2.003   2.015   2.746   1.00 0.00 ? 57  ASP A OD1  3  
ATOM 3792  O OD2  . ASP A 1 57  ? 1.352   2.357   0.643   1.00 0.00 ? 57  ASP A OD2  3  
ATOM 3793  H H    . ASP A 1 57  ? 0.543   -0.467  3.597   1.00 0.00 ? 57  ASP A H    3  
ATOM 3794  H HA   . ASP A 1 57  ? 2.408   -1.754  2.087   1.00 0.00 ? 57  ASP A HA   3  
ATOM 3795  H HB2  . ASP A 1 57  ? 1.953   -0.125  0.418   1.00 0.00 ? 57  ASP A HB2  3  
ATOM 3796  H HB3  . ASP A 1 57  ? 0.491   -0.168  1.382   1.00 0.00 ? 57  ASP A HB3  3  
ATOM 3797  N N    . GLN A 1 58  ? 4.480   -0.029  1.827   1.00 0.00 ? 58  GLN A N    3  
ATOM 3798  C CA   . GLN A 1 58  ? 5.777   0.595   2.019   1.00 0.00 ? 58  GLN A CA   3  
ATOM 3799  C C    . GLN A 1 58  ? 6.070   1.571   0.877   1.00 0.00 ? 58  GLN A C    3  
ATOM 3800  O O    . GLN A 1 58  ? 6.241   1.158   -0.269  1.00 0.00 ? 58  GLN A O    3  
ATOM 3801  C CB   . GLN A 1 58  ? 6.881   -0.459  2.136   1.00 0.00 ? 58  GLN A CB   3  
ATOM 3802  C CG   . GLN A 1 58  ? 8.243   0.198   2.371   1.00 0.00 ? 58  GLN A CG   3  
ATOM 3803  C CD   . GLN A 1 58  ? 9.264   -0.824  2.874   1.00 0.00 ? 58  GLN A CD   3  
ATOM 3804  O OE1  . GLN A 1 58  ? 9.282   -1.975  2.469   1.00 0.00 ? 58  GLN A OE1  3  
ATOM 3805  N NE2  . GLN A 1 58  ? 10.112  -0.341  3.779   1.00 0.00 ? 58  GLN A NE2  3  
ATOM 3806  H H    . GLN A 1 58  ? 4.334   -0.434  0.925   1.00 0.00 ? 58  GLN A H    3  
ATOM 3807  H HA   . GLN A 1 58  ? 5.701   1.139   2.960   1.00 0.00 ? 58  GLN A HA   3  
ATOM 3808  H HB2  . GLN A 1 58  ? 6.654   -1.138  2.958   1.00 0.00 ? 58  GLN A HB2  3  
ATOM 3809  H HB3  . GLN A 1 58  ? 6.914   -1.059  1.227   1.00 0.00 ? 58  GLN A HB3  3  
ATOM 3810  H HG2  . GLN A 1 58  ? 8.599   0.646   1.443   1.00 0.00 ? 58  GLN A HG2  3  
ATOM 3811  H HG3  . GLN A 1 58  ? 8.142   1.004   3.096   1.00 0.00 ? 58  GLN A HG3  3  
ATOM 3812  H HE21 . GLN A 1 58  ? 10.043  0.614   4.068   1.00 0.00 ? 58  GLN A HE21 3  
ATOM 3813  H HE22 . GLN A 1 58  ? 10.817  -0.932  4.168   1.00 0.00 ? 58  GLN A HE22 3  
ATOM 3814  N N    . ILE A 1 59  ? 6.120   2.847   1.230   1.00 0.00 ? 59  ILE A N    3  
ATOM 3815  C CA   . ILE A 1 59  ? 6.389   3.885   0.250   1.00 0.00 ? 59  ILE A CA   3  
ATOM 3816  C C    . ILE A 1 59  ? 7.886   3.905   -0.067  1.00 0.00 ? 59  ILE A C    3  
ATOM 3817  O O    . ILE A 1 59  ? 8.655   4.601   0.594   1.00 0.00 ? 59  ILE A O    3  
ATOM 3818  C CB   . ILE A 1 59  ? 5.845   5.231   0.731   1.00 0.00 ? 59  ILE A CB   3  
ATOM 3819  C CG1  . ILE A 1 59  ? 4.414   5.088   1.256   1.00 0.00 ? 59  ILE A CG1  3  
ATOM 3820  C CG2  . ILE A 1 59  ? 5.948   6.289   -0.369  1.00 0.00 ? 59  ILE A CG2  3  
ATOM 3821  C CD1  . ILE A 1 59  ? 3.422   4.915   0.104   1.00 0.00 ? 59  ILE A CD1  3  
ATOM 3822  H H    . ILE A 1 59  ? 5.980   3.174   2.165   1.00 0.00 ? 59  ILE A H    3  
ATOM 3823  H HA   . ILE A 1 59  ? 5.847   3.624   -0.659  1.00 0.00 ? 59  ILE A HA   3  
ATOM 3824  H HB   . ILE A 1 59  ? 6.460   5.571   1.564   1.00 0.00 ? 59  ILE A HB   3  
ATOM 3825  H HG12 . ILE A 1 59  ? 4.353   4.230   1.925   1.00 0.00 ? 59  ILE A HG12 3  
ATOM 3826  H HG13 . ILE A 1 59  ? 4.148   5.968   1.841   1.00 0.00 ? 59  ILE A HG13 3  
ATOM 3827  H HG21 . ILE A 1 59  ? 6.494   7.154   0.009   1.00 0.00 ? 59  ILE A HG21 3  
ATOM 3828  H HG22 . ILE A 1 59  ? 6.478   5.872   -1.226  1.00 0.00 ? 59  ILE A HG22 3  
ATOM 3829  H HG23 . ILE A 1 59  ? 4.948   6.596   -0.674  1.00 0.00 ? 59  ILE A HG23 3  
ATOM 3830  H HD11 . ILE A 1 59  ? 2.798   5.805   0.025   1.00 0.00 ? 59  ILE A HD11 3  
ATOM 3831  H HD12 . ILE A 1 59  ? 3.969   4.772   -0.828  1.00 0.00 ? 59  ILE A HD12 3  
ATOM 3832  H HD13 . ILE A 1 59  ? 2.793   4.045   0.293   1.00 0.00 ? 59  ILE A HD13 3  
ATOM 3833  N N    . LEU A 1 60  ? 8.255   3.133   -1.079  1.00 0.00 ? 60  LEU A N    3  
ATOM 3834  C CA   . LEU A 1 60  ? 9.646   3.053   -1.491  1.00 0.00 ? 60  LEU A CA   3  
ATOM 3835  C C    . LEU A 1 60  ? 10.080  4.401   -2.070  1.00 0.00 ? 60  LEU A C    3  
ATOM 3836  O O    . LEU A 1 60  ? 10.970  5.055   -1.529  1.00 0.00 ? 60  LEU A O    3  
ATOM 3837  C CB   . LEU A 1 60  ? 9.855   1.877   -2.448  1.00 0.00 ? 60  LEU A CB   3  
ATOM 3838  C CG   . LEU A 1 60  ? 9.349   0.518   -1.960  1.00 0.00 ? 60  LEU A CG   3  
ATOM 3839  C CD1  . LEU A 1 60  ? 9.313   -0.496  -3.105  1.00 0.00 ? 60  LEU A CD1  3  
ATOM 3840  C CD2  . LEU A 1 60  ? 10.178  0.017   -0.776  1.00 0.00 ? 60  LEU A CD2  3  
ATOM 3841  H H    . LEU A 1 60  ? 7.623   2.569   -1.611  1.00 0.00 ? 60  LEU A H    3  
ATOM 3842  H HA   . LEU A 1 60  ? 10.240  2.853   -0.600  1.00 0.00 ? 60  LEU A HA   3  
ATOM 3843  H HB2  . LEU A 1 60  ? 9.360   2.110   -3.391  1.00 0.00 ? 60  LEU A HB2  3  
ATOM 3844  H HB3  . LEU A 1 60  ? 10.920  1.792   -2.659  1.00 0.00 ? 60  LEU A HB3  3  
ATOM 3845  H HG   . LEU A 1 60  ? 8.325   0.641   -1.608  1.00 0.00 ? 60  LEU A HG   3  
ATOM 3846  H HD11 . LEU A 1 60  ? 8.278   -0.722  -3.359  1.00 0.00 ? 60  LEU A HD11 3  
ATOM 3847  H HD12 . LEU A 1 60  ? 9.819   -0.079  -3.976  1.00 0.00 ? 60  LEU A HD12 3  
ATOM 3848  H HD13 . LEU A 1 60  ? 9.819   -1.411  -2.795  1.00 0.00 ? 60  LEU A HD13 3  
ATOM 3849  H HD21 . LEU A 1 60  ? 11.004  -0.592  -1.143  1.00 0.00 ? 60  LEU A HD21 3  
ATOM 3850  H HD22 . LEU A 1 60  ? 10.572  0.869   -0.222  1.00 0.00 ? 60  LEU A HD22 3  
ATOM 3851  H HD23 . LEU A 1 60  ? 9.548   -0.582  -0.119  1.00 0.00 ? 60  LEU A HD23 3  
ATOM 3852  N N    . ARG A 1 61  ? 9.430   4.777   -3.162  1.00 0.00 ? 61  ARG A N    3  
ATOM 3853  C CA   . ARG A 1 61  ? 9.737   6.036   -3.820  1.00 0.00 ? 61  ARG A CA   3  
ATOM 3854  C C    . ARG A 1 61  ? 8.490   6.920   -3.882  1.00 0.00 ? 61  ARG A C    3  
ATOM 3855  O O    . ARG A 1 61  ? 7.382   6.458   -3.614  1.00 0.00 ? 61  ARG A O    3  
ATOM 3856  C CB   . ARG A 1 61  ? 10.260  5.802   -5.239  1.00 0.00 ? 61  ARG A CB   3  
ATOM 3857  C CG   . ARG A 1 61  ? 11.766  5.534   -5.231  1.00 0.00 ? 61  ARG A CG   3  
ATOM 3858  C CD   . ARG A 1 61  ? 12.195  4.778   -6.490  1.00 0.00 ? 61  ARG A CD   3  
ATOM 3859  N NE   . ARG A 1 61  ? 12.637  5.735   -7.529  1.00 0.00 ? 61  ARG A NE   3  
ATOM 3860  C CZ   . ARG A 1 61  ? 13.283  5.383   -8.649  1.00 0.00 ? 61  ARG A CZ   3  
ATOM 3861  N NH1  . ARG A 1 61  ? 13.568  4.094   -8.881  1.00 0.00 ? 61  ARG A NH1  3  
ATOM 3862  N NH2  . ARG A 1 61  ? 13.645  6.319   -9.536  1.00 0.00 ? 61  ARG A NH2  3  
ATOM 3863  H H    . ARG A 1 61  ? 8.707   4.239   -3.595  1.00 0.00 ? 61  ARG A H    3  
ATOM 3864  H HA   . ARG A 1 61  ? 10.511  6.491   -3.202  1.00 0.00 ? 61  ARG A HA   3  
ATOM 3865  H HB2  . ARG A 1 61  ? 9.739   4.956   -5.688  1.00 0.00 ? 61  ARG A HB2  3  
ATOM 3866  H HB3  . ARG A 1 61  ? 10.046  6.673   -5.857  1.00 0.00 ? 61  ARG A HB3  3  
ATOM 3867  H HG2  . ARG A 1 61  ? 12.307  6.478   -5.167  1.00 0.00 ? 61  ARG A HG2  3  
ATOM 3868  H HG3  . ARG A 1 61  ? 12.032  4.954   -4.346  1.00 0.00 ? 61  ARG A HG3  3  
ATOM 3869  H HD2  . ARG A 1 61  ? 13.005  4.088   -6.252  1.00 0.00 ? 61  ARG A HD2  3  
ATOM 3870  H HD3  . ARG A 1 61  ? 11.366  4.178   -6.864  1.00 0.00 ? 61  ARG A HD3  3  
ATOM 3871  H HE   . ARG A 1 61  ? 12.440  6.705   -7.386  1.00 0.00 ? 61  ARG A HE   3  
ATOM 3872  H HH11 . ARG A 1 61  ? 13.298  3.395   -8.219  1.00 0.00 ? 61  ARG A HH11 3  
ATOM 3873  H HH12 . ARG A 1 61  ? 14.050  3.831   -9.716  1.00 0.00 ? 61  ARG A HH12 3  
ATOM 3874  H HH21 . ARG A 1 61  ? 13.433  7.281   -9.362  1.00 0.00 ? 61  ARG A HH21 3  
ATOM 3875  H HH22 . ARG A 1 61  ? 14.128  6.057   -10.371 1.00 0.00 ? 61  ARG A HH22 3  
ATOM 3876  N N    . VAL A 1 62  ? 8.713   8.177   -4.238  1.00 0.00 ? 62  VAL A N    3  
ATOM 3877  C CA   . VAL A 1 62  ? 7.621   9.130   -4.339  1.00 0.00 ? 62  VAL A CA   3  
ATOM 3878  C C    . VAL A 1 62  ? 7.883   10.077  -5.513  1.00 0.00 ? 62  VAL A C    3  
ATOM 3879  O O    . VAL A 1 62  ? 8.825   10.867  -5.479  1.00 0.00 ? 62  VAL A O    3  
ATOM 3880  C CB   . VAL A 1 62  ? 7.442   9.864   -3.008  1.00 0.00 ? 62  VAL A CB   3  
ATOM 3881  C CG1  . VAL A 1 62  ? 8.582   10.857  -2.771  1.00 0.00 ? 62  VAL A CG1  3  
ATOM 3882  C CG2  . VAL A 1 62  ? 6.083   10.564  -2.947  1.00 0.00 ? 62  VAL A CG2  3  
ATOM 3883  H H    . VAL A 1 62  ? 9.617   8.545   -4.454  1.00 0.00 ? 62  VAL A H    3  
ATOM 3884  H HA   . VAL A 1 62  ? 6.710   8.567   -4.540  1.00 0.00 ? 62  VAL A HA   3  
ATOM 3885  H HB   . VAL A 1 62  ? 7.472   9.122   -2.210  1.00 0.00 ? 62  VAL A HB   3  
ATOM 3886  H HG11 . VAL A 1 62  ? 8.454   11.719  -3.426  1.00 0.00 ? 62  VAL A HG11 3  
ATOM 3887  H HG12 . VAL A 1 62  ? 8.568   11.184  -1.732  1.00 0.00 ? 62  VAL A HG12 3  
ATOM 3888  H HG13 . VAL A 1 62  ? 9.535   10.374  -2.988  1.00 0.00 ? 62  VAL A HG13 3  
ATOM 3889  H HG21 . VAL A 1 62  ? 6.105   11.455  -3.575  1.00 0.00 ? 62  VAL A HG21 3  
ATOM 3890  H HG22 . VAL A 1 62  ? 5.308   9.886   -3.305  1.00 0.00 ? 62  VAL A HG22 3  
ATOM 3891  H HG23 . VAL A 1 62  ? 5.868   10.850  -1.918  1.00 0.00 ? 62  VAL A HG23 3  
ATOM 3892  N N    . ASN A 1 63  ? 7.033   9.965   -6.522  1.00 0.00 ? 63  ASN A N    3  
ATOM 3893  C CA   . ASN A 1 63  ? 7.161   10.801  -7.704  1.00 0.00 ? 63  ASN A CA   3  
ATOM 3894  C C    . ASN A 1 63  ? 8.387   10.360  -8.505  1.00 0.00 ? 63  ASN A C    3  
ATOM 3895  O O    . ASN A 1 63  ? 8.260   9.907   -9.642  1.00 0.00 ? 63  ASN A O    3  
ATOM 3896  C CB   . ASN A 1 63  ? 7.350   12.271  -7.322  1.00 0.00 ? 63  ASN A CB   3  
ATOM 3897  C CG   . ASN A 1 63  ? 6.661   13.192  -8.330  1.00 0.00 ? 63  ASN A CG   3  
ATOM 3898  O OD1  . ASN A 1 63  ? 6.942   13.177  -9.517  1.00 0.00 ? 63  ASN A OD1  3  
ATOM 3899  N ND2  . ASN A 1 63  ? 5.746   13.994  -7.793  1.00 0.00 ? 63  ASN A ND2  3  
ATOM 3900  H H    . ASN A 1 63  ? 6.269   9.320   -6.542  1.00 0.00 ? 63  ASN A H    3  
ATOM 3901  H HA   . ASN A 1 63  ? 6.231   10.663  -8.255  1.00 0.00 ? 63  ASN A HA   3  
ATOM 3902  H HB2  . ASN A 1 63  ? 6.943   12.446  -6.326  1.00 0.00 ? 63  ASN A HB2  3  
ATOM 3903  H HB3  . ASN A 1 63  ? 8.413   12.505  -7.277  1.00 0.00 ? 63  ASN A HB3  3  
ATOM 3904  H HD21 . ASN A 1 63  ? 5.563   13.957  -6.810  1.00 0.00 ? 63  ASN A HD21 3  
ATOM 3905  H HD22 . ASN A 1 63  ? 5.241   14.635  -8.371  1.00 0.00 ? 63  ASN A HD22 3  
ATOM 3906  N N    . ASP A 1 64  ? 9.547   10.507  -7.881  1.00 0.00 ? 64  ASP A N    3  
ATOM 3907  C CA   . ASP A 1 64  ? 10.795  10.130  -8.522  1.00 0.00 ? 64  ASP A CA   3  
ATOM 3908  C C    . ASP A 1 64  ? 11.854  9.867   -7.450  1.00 0.00 ? 64  ASP A C    3  
ATOM 3909  O O    . ASP A 1 64  ? 12.579  8.875   -7.519  1.00 0.00 ? 64  ASP A O    3  
ATOM 3910  C CB   . ASP A 1 64  ? 11.309  11.249  -9.430  1.00 0.00 ? 64  ASP A CB   3  
ATOM 3911  C CG   . ASP A 1 64  ? 12.648  10.965  -10.112 1.00 0.00 ? 64  ASP A CG   3  
ATOM 3912  O OD1  . ASP A 1 64  ? 12.877  9.781   -10.443 1.00 0.00 ? 64  ASP A OD1  3  
ATOM 3913  O OD2  . ASP A 1 64  ? 13.414  11.937  -10.287 1.00 0.00 ? 64  ASP A OD2  3  
ATOM 3914  H H    . ASP A 1 64  ? 9.641   10.877  -6.957  1.00 0.00 ? 64  ASP A H    3  
ATOM 3915  H HA   . ASP A 1 64  ? 10.560  9.238   -9.104  1.00 0.00 ? 64  ASP A HA   3  
ATOM 3916  H HB2  . ASP A 1 64  ? 10.561  11.445  -10.198 1.00 0.00 ? 64  ASP A HB2  3  
ATOM 3917  H HB3  . ASP A 1 64  ? 11.405  12.160  -8.839  1.00 0.00 ? 64  ASP A HB3  3  
ATOM 3918  N N    . LYS A 1 65  ? 11.910  10.772  -6.484  1.00 0.00 ? 65  LYS A N    3  
ATOM 3919  C CA   . LYS A 1 65  ? 12.869  10.650  -5.399  1.00 0.00 ? 65  LYS A CA   3  
ATOM 3920  C C    . LYS A 1 65  ? 12.510  9.435   -4.541  1.00 0.00 ? 65  LYS A C    3  
ATOM 3921  O O    . LYS A 1 65  ? 11.341  9.064   -4.443  1.00 0.00 ? 65  LYS A O    3  
ATOM 3922  C CB   . LYS A 1 65  ? 12.953  11.957  -4.609  1.00 0.00 ? 65  LYS A CB   3  
ATOM 3923  C CG   . LYS A 1 65  ? 13.631  13.054  -5.433  1.00 0.00 ? 65  LYS A CG   3  
ATOM 3924  C CD   . LYS A 1 65  ? 12.710  14.265  -5.597  1.00 0.00 ? 65  LYS A CD   3  
ATOM 3925  C CE   . LYS A 1 65  ? 12.009  14.241  -6.956  1.00 0.00 ? 65  LYS A CE   3  
ATOM 3926  N NZ   . LYS A 1 65  ? 11.656  15.614  -7.382  1.00 0.00 ? 65  LYS A NZ   3  
ATOM 3927  H H    . LYS A 1 65  ? 11.317  11.575  -6.435  1.00 0.00 ? 65  LYS A H    3  
ATOM 3928  H HA   . LYS A 1 65  ? 13.848  10.480  -5.846  1.00 0.00 ? 65  LYS A HA   3  
ATOM 3929  H HB2  . LYS A 1 65  ? 11.952  12.279  -4.323  1.00 0.00 ? 65  LYS A HB2  3  
ATOM 3930  H HB3  . LYS A 1 65  ? 13.510  11.794  -3.686  1.00 0.00 ? 65  LYS A HB3  3  
ATOM 3931  H HG2  . LYS A 1 65  ? 14.557  13.359  -4.947  1.00 0.00 ? 65  LYS A HG2  3  
ATOM 3932  H HG3  . LYS A 1 65  ? 13.900  12.662  -6.414  1.00 0.00 ? 65  LYS A HG3  3  
ATOM 3933  H HD2  . LYS A 1 65  ? 11.967  14.271  -4.800  1.00 0.00 ? 65  LYS A HD2  3  
ATOM 3934  H HD3  . LYS A 1 65  ? 13.290  15.183  -5.499  1.00 0.00 ? 65  LYS A HD3  3  
ATOM 3935  H HE2  . LYS A 1 65  ? 12.658  13.779  -7.699  1.00 0.00 ? 65  LYS A HE2  3  
ATOM 3936  H HE3  . LYS A 1 65  ? 11.108  13.630  -6.896  1.00 0.00 ? 65  LYS A HE3  3  
ATOM 3937  H HZ1  . LYS A 1 65  ? 12.488  16.108  -7.636  1.00 0.00 ? 65  LYS A HZ1  3  
ATOM 3938  H HZ2  . LYS A 1 65  ? 11.041  15.571  -8.169  1.00 0.00 ? 65  LYS A HZ2  3  
ATOM 3939  H HZ3  . LYS A 1 65  ? 11.203  16.091  -6.629  1.00 0.00 ? 65  LYS A HZ3  3  
ATOM 3940  N N    . SER A 1 66  ? 13.536  8.849   -3.942  1.00 0.00 ? 66  SER A N    3  
ATOM 3941  C CA   . SER A 1 66  ? 13.344  7.684   -3.096  1.00 0.00 ? 66  SER A CA   3  
ATOM 3942  C C    . SER A 1 66  ? 13.487  8.077   -1.624  1.00 0.00 ? 66  SER A C    3  
ATOM 3943  O O    . SER A 1 66  ? 14.465  8.716   -1.241  1.00 0.00 ? 66  SER A O    3  
ATOM 3944  C CB   . SER A 1 66  ? 14.338  6.576   -3.449  1.00 0.00 ? 66  SER A CB   3  
ATOM 3945  O OG   . SER A 1 66  ? 14.483  6.418   -4.858  1.00 0.00 ? 66  SER A OG   3  
ATOM 3946  H H    . SER A 1 66  ? 14.484  9.158   -4.028  1.00 0.00 ? 66  SER A H    3  
ATOM 3947  H HA   . SER A 1 66  ? 12.330  7.341   -3.303  1.00 0.00 ? 66  SER A HA   3  
ATOM 3948  H HB2  . SER A 1 66  ? 15.309  6.806   -3.008  1.00 0.00 ? 66  SER A HB2  3  
ATOM 3949  H HB3  . SER A 1 66  ? 14.004  5.636   -3.011  1.00 0.00 ? 66  SER A HB3  3  
ATOM 3950  H HG   . SER A 1 66  ? 14.354  7.298   -5.316  1.00 0.00 ? 66  SER A HG   3  
ATOM 3951  N N    . LEU A 1 67  ? 12.497  7.677   -0.839  1.00 0.00 ? 67  LEU A N    3  
ATOM 3952  C CA   . LEU A 1 67  ? 12.501  7.979   0.582   1.00 0.00 ? 67  LEU A CA   3  
ATOM 3953  C C    . LEU A 1 67  ? 13.196  6.846   1.338   1.00 0.00 ? 67  LEU A C    3  
ATOM 3954  O O    . LEU A 1 67  ? 12.686  6.365   2.349   1.00 0.00 ? 67  LEU A O    3  
ATOM 3955  C CB   . LEU A 1 67  ? 11.080  8.265   1.073   1.00 0.00 ? 67  LEU A CB   3  
ATOM 3956  C CG   . LEU A 1 67  ? 10.192  9.071   0.123   1.00 0.00 ? 67  LEU A CG   3  
ATOM 3957  C CD1  . LEU A 1 67  ? 8.722   8.981   0.537   1.00 0.00 ? 67  LEU A CD1  3  
ATOM 3958  C CD2  . LEU A 1 67  ? 10.671  10.521  0.022   1.00 0.00 ? 67  LEU A CD2  3  
ATOM 3959  H H    . LEU A 1 67  ? 11.705  7.157   -1.159  1.00 0.00 ? 67  LEU A H    3  
ATOM 3960  H HA   . LEU A 1 67  ? 13.079  8.893   0.721   1.00 0.00 ? 67  LEU A HA   3  
ATOM 3961  H HB2  . LEU A 1 67  ? 10.589  7.314   1.278   1.00 0.00 ? 67  LEU A HB2  3  
ATOM 3962  H HB3  . LEU A 1 67  ? 11.145  8.801   2.020   1.00 0.00 ? 67  LEU A HB3  3  
ATOM 3963  H HG   . LEU A 1 67  ? 10.273  8.635   -0.873  1.00 0.00 ? 67  LEU A HG   3  
ATOM 3964  H HD11 . LEU A 1 67  ? 8.652   8.543   1.533   1.00 0.00 ? 67  LEU A HD11 3  
ATOM 3965  H HD12 . LEU A 1 67  ? 8.285   9.979   0.548   1.00 0.00 ? 67  LEU A HD12 3  
ATOM 3966  H HD13 . LEU A 1 67  ? 8.182   8.356   -0.173  1.00 0.00 ? 67  LEU A HD13 3  
ATOM 3967  H HD21 . LEU A 1 67  ? 9.849   11.193  0.268   1.00 0.00 ? 67  LEU A HD21 3  
ATOM 3968  H HD22 . LEU A 1 67  ? 11.493  10.681  0.719   1.00 0.00 ? 67  LEU A HD22 3  
ATOM 3969  H HD23 . LEU A 1 67  ? 11.012  10.721  -0.994  1.00 0.00 ? 67  LEU A HD23 3  
ATOM 3970  N N    . ALA A 1 68  ? 14.350  6.451   0.820   1.00 0.00 ? 68  ALA A N    3  
ATOM 3971  C CA   . ALA A 1 68  ? 15.121  5.383   1.433   1.00 0.00 ? 68  ALA A CA   3  
ATOM 3972  C C    . ALA A 1 68  ? 15.169  5.600   2.947   1.00 0.00 ? 68  ALA A C    3  
ATOM 3973  O O    . ALA A 1 68  ? 14.693  4.763   3.713   1.00 0.00 ? 68  ALA A O    3  
ATOM 3974  C CB   . ALA A 1 68  ? 16.515  5.335   0.807   1.00 0.00 ? 68  ALA A CB   3  
ATOM 3975  H H    . ALA A 1 68  ? 14.758  6.848   -0.003  1.00 0.00 ? 68  ALA A H    3  
ATOM 3976  H HA   . ALA A 1 68  ? 14.609  4.443   1.225   1.00 0.00 ? 68  ALA A HA   3  
ATOM 3977  H HB1  . ALA A 1 68  ? 16.964  6.328   0.841   1.00 0.00 ? 68  ALA A HB1  3  
ATOM 3978  H HB2  . ALA A 1 68  ? 17.139  4.635   1.362   1.00 0.00 ? 68  ALA A HB2  3  
ATOM 3979  H HB3  . ALA A 1 68  ? 16.437  5.008   -0.230  1.00 0.00 ? 68  ALA A HB3  3  
ATOM 3980  N N    . ARG A 1 69  ? 15.747  6.728   3.333   1.00 0.00 ? 69  ARG A N    3  
ATOM 3981  C CA   . ARG A 1 69  ? 15.863  7.065   4.742   1.00 0.00 ? 69  ARG A CA   3  
ATOM 3982  C C    . ARG A 1 69  ? 15.797  8.582   4.932   1.00 0.00 ? 69  ARG A C    3  
ATOM 3983  O O    . ARG A 1 69  ? 16.824  9.258   4.921   1.00 0.00 ? 69  ARG A O    3  
ATOM 3984  C CB   . ARG A 1 69  ? 17.177  6.542   5.327   1.00 0.00 ? 69  ARG A CB   3  
ATOM 3985  C CG   . ARG A 1 69  ? 16.917  5.612   6.514   1.00 0.00 ? 69  ARG A CG   3  
ATOM 3986  C CD   . ARG A 1 69  ? 17.910  4.449   6.527   1.00 0.00 ? 69  ARG A CD   3  
ATOM 3987  N NE   . ARG A 1 69  ? 18.739  4.504   7.752   1.00 0.00 ? 69  ARG A NE   3  
ATOM 3988  C CZ   . ARG A 1 69  ? 19.786  5.324   7.914   1.00 0.00 ? 69  ARG A CZ   3  
ATOM 3989  N NH1  . ARG A 1 69  ? 20.139  6.162   6.930   1.00 0.00 ? 69  ARG A NH1  3  
ATOM 3990  N NH2  . ARG A 1 69  ? 20.480  5.306   9.060   1.00 0.00 ? 69  ARG A NH2  3  
ATOM 3991  H H    . ARG A 1 69  ? 16.131  7.403   2.704   1.00 0.00 ? 69  ARG A H    3  
ATOM 3992  H HA   . ARG A 1 69  ? 15.015  6.572   5.217   1.00 0.00 ? 69  ARG A HA   3  
ATOM 3993  H HB2  . ARG A 1 69  ? 17.734  6.008   4.558   1.00 0.00 ? 69  ARG A HB2  3  
ATOM 3994  H HB3  . ARG A 1 69  ? 17.796  7.380   5.646   1.00 0.00 ? 69  ARG A HB3  3  
ATOM 3995  H HG2  . ARG A 1 69  ? 16.997  6.174   7.445   1.00 0.00 ? 69  ARG A HG2  3  
ATOM 3996  H HG3  . ARG A 1 69  ? 15.899  5.226   6.462   1.00 0.00 ? 69  ARG A HG3  3  
ATOM 3997  H HD2  . ARG A 1 69  ? 17.373  3.501   6.484   1.00 0.00 ? 69  ARG A HD2  3  
ATOM 3998  H HD3  . ARG A 1 69  ? 18.548  4.494   5.644   1.00 0.00 ? 69  ARG A HD3  3  
ATOM 3999  H HE   . ARG A 1 69  ? 18.502  3.892   8.506   1.00 0.00 ? 69  ARG A HE   3  
ATOM 4000  H HH11 . ARG A 1 69  ? 19.621  6.176   6.075   1.00 0.00 ? 69  ARG A HH11 3  
ATOM 4001  H HH12 . ARG A 1 69  ? 20.921  6.774   7.051   1.00 0.00 ? 69  ARG A HH12 3  
ATOM 4002  H HH21 . ARG A 1 69  ? 20.217  4.681   9.794   1.00 0.00 ? 69  ARG A HH21 3  
ATOM 4003  H HH22 . ARG A 1 69  ? 21.262  5.918   9.181   1.00 0.00 ? 69  ARG A HH22 3  
ATOM 4004  N N    . VAL A 1 70  ? 14.577  9.072   5.102   1.00 0.00 ? 70  VAL A N    3  
ATOM 4005  C CA   . VAL A 1 70  ? 14.363  10.496  5.295   1.00 0.00 ? 70  VAL A CA   3  
ATOM 4006  C C    . VAL A 1 70  ? 13.355  10.708  6.426   1.00 0.00 ? 70  VAL A C    3  
ATOM 4007  O O    . VAL A 1 70  ? 12.579  9.809   6.746   1.00 0.00 ? 70  VAL A O    3  
ATOM 4008  C CB   . VAL A 1 70  ? 13.929  11.142  3.977   1.00 0.00 ? 70  VAL A CB   3  
ATOM 4009  C CG1  . VAL A 1 70  ? 15.037  11.045  2.927   1.00 0.00 ? 70  VAL A CG1  3  
ATOM 4010  C CG2  . VAL A 1 70  ? 12.629  10.519  3.463   1.00 0.00 ? 70  VAL A CG2  3  
ATOM 4011  H H    . VAL A 1 70  ? 13.747  8.515   5.110   1.00 0.00 ? 70  VAL A H    3  
ATOM 4012  H HA   . VAL A 1 70  ? 15.317  10.935  5.588   1.00 0.00 ? 70  VAL A HA   3  
ATOM 4013  H HB   . VAL A 1 70  ? 13.741  12.199  4.169   1.00 0.00 ? 70  VAL A HB   3  
ATOM 4014  H HG11 . VAL A 1 70  ? 15.687  10.202  3.162   1.00 0.00 ? 70  VAL A HG11 3  
ATOM 4015  H HG12 . VAL A 1 70  ? 14.593  10.897  1.943   1.00 0.00 ? 70  VAL A HG12 3  
ATOM 4016  H HG13 . VAL A 1 70  ? 15.621  11.965  2.928   1.00 0.00 ? 70  VAL A HG13 3  
ATOM 4017  H HG21 . VAL A 1 70  ? 11.898  11.305  3.277   1.00 0.00 ? 70  VAL A HG21 3  
ATOM 4018  H HG22 . VAL A 1 70  ? 12.827  9.980   2.537   1.00 0.00 ? 70  VAL A HG22 3  
ATOM 4019  H HG23 . VAL A 1 70  ? 12.238  9.828   4.210   1.00 0.00 ? 70  VAL A HG23 3  
ATOM 4020  N N    . THR A 1 71  ? 13.400  11.901  6.999   1.00 0.00 ? 71  THR A N    3  
ATOM 4021  C CA   . THR A 1 71  ? 12.500  12.242  8.088   1.00 0.00 ? 71  THR A CA   3  
ATOM 4022  C C    . THR A 1 71  ? 11.055  12.303  7.587   1.00 0.00 ? 71  THR A C    3  
ATOM 4023  O O    . THR A 1 71  ? 10.816  12.461  6.390   1.00 0.00 ? 71  THR A O    3  
ATOM 4024  C CB   . THR A 1 71  ? 12.984  13.554  8.708   1.00 0.00 ? 71  THR A CB   3  
ATOM 4025  O OG1  . THR A 1 71  ? 13.215  14.403  7.588   1.00 0.00 ? 71  THR A OG1  3  
ATOM 4026  C CG2  . THR A 1 71  ? 14.360  13.419  9.364   1.00 0.00 ? 71  THR A CG2  3  
ATOM 4027  H H    . THR A 1 71  ? 14.034  12.626  6.733   1.00 0.00 ? 71  THR A H    3  
ATOM 4028  H HA   . THR A 1 71  ? 12.546  11.448  8.833   1.00 0.00 ? 71  THR A HA   3  
ATOM 4029  H HB   . THR A 1 71  ? 12.252  13.944  9.416   1.00 0.00 ? 71  THR A HB   3  
ATOM 4030  H HG1  . THR A 1 71  ? 13.098  15.360  7.854   1.00 0.00 ? 71  THR A HG1  3  
ATOM 4031  H HG21 . THR A 1 71  ? 14.490  12.400  9.728   1.00 0.00 ? 71  THR A HG21 3  
ATOM 4032  H HG22 . THR A 1 71  ? 15.135  13.646  8.632   1.00 0.00 ? 71  THR A HG22 3  
ATOM 4033  H HG23 . THR A 1 71  ? 14.434  14.116  10.199  1.00 0.00 ? 71  THR A HG23 3  
ATOM 4034  N N    . HIS A 1 72  ? 10.130  12.176  8.527   1.00 0.00 ? 72  HIS A N    3  
ATOM 4035  C CA   . HIS A 1 72  ? 8.716   12.215  8.195   1.00 0.00 ? 72  HIS A CA   3  
ATOM 4036  C C    . HIS A 1 72  ? 8.411   13.483  7.396   1.00 0.00 ? 72  HIS A C    3  
ATOM 4037  O O    . HIS A 1 72  ? 7.540   13.480  6.528   1.00 0.00 ? 72  HIS A O    3  
ATOM 4038  C CB   . HIS A 1 72  ? 7.859   12.087  9.456   1.00 0.00 ? 72  HIS A CB   3  
ATOM 4039  C CG   . HIS A 1 72  ? 6.451   11.609  9.195   1.00 0.00 ? 72  HIS A CG   3  
ATOM 4040  N ND1  . HIS A 1 72  ? 5.333   12.360  9.514   1.00 0.00 ? 72  HIS A ND1  3  
ATOM 4041  C CD2  . HIS A 1 72  ? 5.991   10.450  8.643   1.00 0.00 ? 72  HIS A CD2  3  
ATOM 4042  C CE1  . HIS A 1 72  ? 4.254   11.674  9.166   1.00 0.00 ? 72  HIS A CE1  3  
ATOM 4043  N NE2  . HIS A 1 72  ? 4.664   10.491  8.626   1.00 0.00 ? 72  HIS A NE2  3  
ATOM 4044  H H    . HIS A 1 72  ? 10.334  12.048  9.497   1.00 0.00 ? 72  HIS A H    3  
ATOM 4045  H HA   . HIS A 1 72  ? 8.518   11.345  7.569   1.00 0.00 ? 72  HIS A HA   3  
ATOM 4046  H HB2  . HIS A 1 72  ? 8.345   11.396  10.145  1.00 0.00 ? 72  HIS A HB2  3  
ATOM 4047  H HB3  . HIS A 1 72  ? 7.817   13.056  9.954   1.00 0.00 ? 72  HIS A HB3  3  
ATOM 4048  H HD1  . HIS A 1 72  ? 5.338   13.267  9.936   1.00 0.00 ? 72  HIS A HD1  3  
ATOM 4049  H HD2  . HIS A 1 72  ? 6.608   9.630   8.276   1.00 0.00 ? 72  HIS A HD2  3  
ATOM 4050  H HE1  . HIS A 1 72  ? 3.221   11.999  9.289   1.00 0.00 ? 72  HIS A HE1  3  
ATOM 4051  N N    . ALA A 1 73  ? 9.145   14.538  7.719   1.00 0.00 ? 73  ALA A N    3  
ATOM 4052  C CA   . ALA A 1 73  ? 8.964   15.811  7.042   1.00 0.00 ? 73  ALA A CA   3  
ATOM 4053  C C    . ALA A 1 73  ? 9.422   15.681  5.588   1.00 0.00 ? 73  ALA A C    3  
ATOM 4054  O O    . ALA A 1 73  ? 8.685   16.030  4.668   1.00 0.00 ? 73  ALA A O    3  
ATOM 4055  C CB   . ALA A 1 73  ? 9.724   16.903  7.797   1.00 0.00 ? 73  ALA A CB   3  
ATOM 4056  H H    . ALA A 1 73  ? 9.852   14.532  8.426   1.00 0.00 ? 73  ALA A H    3  
ATOM 4057  H HA   . ALA A 1 73  ? 7.900   16.048  7.060   1.00 0.00 ? 73  ALA A HA   3  
ATOM 4058  H HB1  . ALA A 1 73  ? 10.060  16.514  8.759   1.00 0.00 ? 73  ALA A HB1  3  
ATOM 4059  H HB2  . ALA A 1 73  ? 10.588  17.216  7.211   1.00 0.00 ? 73  ALA A HB2  3  
ATOM 4060  H HB3  . ALA A 1 73  ? 9.067   17.757  7.960   1.00 0.00 ? 73  ALA A HB3  3  
ATOM 4061  N N    . GLU A 1 74  ? 10.637  15.177  5.427   1.00 0.00 ? 74  GLU A N    3  
ATOM 4062  C CA   . GLU A 1 74  ? 11.202  14.996  4.101   1.00 0.00 ? 74  GLU A CA   3  
ATOM 4063  C C    . GLU A 1 74  ? 10.237  14.205  3.216   1.00 0.00 ? 74  GLU A C    3  
ATOM 4064  O O    . GLU A 1 74  ? 9.903   14.638  2.114   1.00 0.00 ? 74  GLU A O    3  
ATOM 4065  C CB   . GLU A 1 74  ? 12.567  14.309  4.175   1.00 0.00 ? 74  GLU A CB   3  
ATOM 4066  C CG   . GLU A 1 74  ? 13.690  15.335  4.335   1.00 0.00 ? 74  GLU A CG   3  
ATOM 4067  C CD   . GLU A 1 74  ? 13.740  16.286  3.138   1.00 0.00 ? 74  GLU A CD   3  
ATOM 4068  O OE1  . GLU A 1 74  ? 13.841  15.767  2.005   1.00 0.00 ? 74  GLU A OE1  3  
ATOM 4069  O OE2  . GLU A 1 74  ? 13.675  17.510  3.381   1.00 0.00 ? 74  GLU A OE2  3  
ATOM 4070  H H    . GLU A 1 74  ? 11.231  14.896  6.181   1.00 0.00 ? 74  GLU A H    3  
ATOM 4071  H HA   . GLU A 1 74  ? 11.331  16.002  3.701   1.00 0.00 ? 74  GLU A HA   3  
ATOM 4072  H HB2  . GLU A 1 74  ? 12.583  13.613  5.014   1.00 0.00 ? 74  GLU A HB2  3  
ATOM 4073  H HB3  . GLU A 1 74  ? 12.732  13.722  3.272   1.00 0.00 ? 74  GLU A HB3  3  
ATOM 4074  H HG2  . GLU A 1 74  ? 13.538  15.906  5.251   1.00 0.00 ? 74  GLU A HG2  3  
ATOM 4075  H HG3  . GLU A 1 74  ? 14.646  14.821  4.436   1.00 0.00 ? 74  GLU A HG3  3  
ATOM 4076  N N    . ALA A 1 75  ? 9.816   13.059  3.731   1.00 0.00 ? 75  ALA A N    3  
ATOM 4077  C CA   . ALA A 1 75  ? 8.896   12.204  3.002   1.00 0.00 ? 75  ALA A CA   3  
ATOM 4078  C C    . ALA A 1 75  ? 7.667   13.017  2.591   1.00 0.00 ? 75  ALA A C    3  
ATOM 4079  O O    . ALA A 1 75  ? 7.301   13.046  1.417   1.00 0.00 ? 75  ALA A O    3  
ATOM 4080  C CB   . ALA A 1 75  ? 8.533   10.992  3.863   1.00 0.00 ? 75  ALA A CB   3  
ATOM 4081  H H    . ALA A 1 75  ? 10.093  12.715  4.628   1.00 0.00 ? 75  ALA A H    3  
ATOM 4082  H HA   . ALA A 1 75  ? 9.408   11.855  2.104   1.00 0.00 ? 75  ALA A HA   3  
ATOM 4083  H HB1  . ALA A 1 75  ? 7.531   10.651  3.606   1.00 0.00 ? 75  ALA A HB1  3  
ATOM 4084  H HB2  . ALA A 1 75  ? 9.248   10.190  3.682   1.00 0.00 ? 75  ALA A HB2  3  
ATOM 4085  H HB3  . ALA A 1 75  ? 8.562   11.273  4.916   1.00 0.00 ? 75  ALA A HB3  3  
ATOM 4086  N N    . VAL A 1 76  ? 7.063   13.657  3.582   1.00 0.00 ? 76  VAL A N    3  
ATOM 4087  C CA   . VAL A 1 76  ? 5.882   14.468  3.338   1.00 0.00 ? 76  VAL A CA   3  
ATOM 4088  C C    . VAL A 1 76  ? 6.199   15.513  2.266   1.00 0.00 ? 76  VAL A C    3  
ATOM 4089  O O    . VAL A 1 76  ? 5.539   15.562  1.229   1.00 0.00 ? 76  VAL A O    3  
ATOM 4090  C CB   . VAL A 1 76  ? 5.393   15.087  4.649   1.00 0.00 ? 76  VAL A CB   3  
ATOM 4091  C CG1  . VAL A 1 76  ? 4.176   15.983  4.412   1.00 0.00 ? 76  VAL A CG1  3  
ATOM 4092  C CG2  . VAL A 1 76  ? 5.084   14.004  5.685   1.00 0.00 ? 76  VAL A CG2  3  
ATOM 4093  H H    . VAL A 1 76  ? 7.367   13.628  4.534   1.00 0.00 ? 76  VAL A H    3  
ATOM 4094  H HA   . VAL A 1 76  ? 5.100   13.807  2.965   1.00 0.00 ? 76  VAL A HA   3  
ATOM 4095  H HB   . VAL A 1 76  ? 6.195   15.710  5.046   1.00 0.00 ? 76  VAL A HB   3  
ATOM 4096  H HG11 . VAL A 1 76  ? 3.276   15.369  4.371   1.00 0.00 ? 76  VAL A HG11 3  
ATOM 4097  H HG12 . VAL A 1 76  ? 4.089   16.701  5.228   1.00 0.00 ? 76  VAL A HG12 3  
ATOM 4098  H HG13 . VAL A 1 76  ? 4.295   16.516  3.469   1.00 0.00 ? 76  VAL A HG13 3  
ATOM 4099  H HG21 . VAL A 1 76  ? 4.009   13.827  5.715   1.00 0.00 ? 76  VAL A HG21 3  
ATOM 4100  H HG22 . VAL A 1 76  ? 5.597   13.082  5.411   1.00 0.00 ? 76  VAL A HG22 3  
ATOM 4101  H HG23 . VAL A 1 76  ? 5.426   14.332  6.667   1.00 0.00 ? 76  VAL A HG23 3  
ATOM 4102  N N    . LYS A 1 77  ? 7.208   16.322  2.552   1.00 0.00 ? 77  LYS A N    3  
ATOM 4103  C CA   . LYS A 1 77  ? 7.620   17.362  1.625   1.00 0.00 ? 77  LYS A CA   3  
ATOM 4104  C C    . LYS A 1 77  ? 7.865   16.743  0.247   1.00 0.00 ? 77  LYS A C    3  
ATOM 4105  O O    . LYS A 1 77  ? 7.829   17.441  -0.765  1.00 0.00 ? 77  LYS A O    3  
ATOM 4106  C CB   . LYS A 1 77  ? 8.823   18.127  2.179   1.00 0.00 ? 77  LYS A CB   3  
ATOM 4107  C CG   . LYS A 1 77  ? 8.373   19.311  3.038   1.00 0.00 ? 77  LYS A CG   3  
ATOM 4108  C CD   . LYS A 1 77  ? 9.038   19.273  4.415   1.00 0.00 ? 77  LYS A CD   3  
ATOM 4109  C CE   . LYS A 1 77  ? 10.530  19.594  4.313   1.00 0.00 ? 77  LYS A CE   3  
ATOM 4110  N NZ   . LYS A 1 77  ? 11.114  19.778  5.660   1.00 0.00 ? 77  LYS A NZ   3  
ATOM 4111  H H    . LYS A 1 77  ? 7.739   16.275  3.398   1.00 0.00 ? 77  LYS A H    3  
ATOM 4112  H HA   . LYS A 1 77  ? 6.796   18.072  1.544   1.00 0.00 ? 77  LYS A HA   3  
ATOM 4113  H HB2  . LYS A 1 77  ? 9.444   17.457  2.773   1.00 0.00 ? 77  LYS A HB2  3  
ATOM 4114  H HB3  . LYS A 1 77  ? 9.441   18.485  1.355   1.00 0.00 ? 77  LYS A HB3  3  
ATOM 4115  H HG2  . LYS A 1 77  ? 8.623   20.245  2.535   1.00 0.00 ? 77  LYS A HG2  3  
ATOM 4116  H HG3  . LYS A 1 77  ? 7.289   19.290  3.152   1.00 0.00 ? 77  LYS A HG3  3  
ATOM 4117  H HD2  . LYS A 1 77  ? 8.552   19.990  5.077   1.00 0.00 ? 77  LYS A HD2  3  
ATOM 4118  H HD3  . LYS A 1 77  ? 8.904   18.287  4.860   1.00 0.00 ? 77  LYS A HD3  3  
ATOM 4119  H HE2  . LYS A 1 77  ? 11.047  18.787  3.793   1.00 0.00 ? 77  LYS A HE2  3  
ATOM 4120  H HE3  . LYS A 1 77  ? 10.674  20.498  3.721   1.00 0.00 ? 77  LYS A HE3  3  
ATOM 4121  H HZ1  . LYS A 1 77  ? 12.003  19.321  5.703   1.00 0.00 ? 77  LYS A HZ1  3  
ATOM 4122  H HZ2  . LYS A 1 77  ? 11.233  20.754  5.841   1.00 0.00 ? 77  LYS A HZ2  3  
ATOM 4123  H HZ3  . LYS A 1 77  ? 10.503  19.383  6.345   1.00 0.00 ? 77  LYS A HZ3  3  
ATOM 4124  N N    . ALA A 1 78  ? 8.107   15.441  0.254   1.00 0.00 ? 78  ALA A N    3  
ATOM 4125  C CA   . ALA A 1 78  ? 8.358   14.720  -0.983  1.00 0.00 ? 78  ALA A CA   3  
ATOM 4126  C C    . ALA A 1 78  ? 7.023   14.339  -1.626  1.00 0.00 ? 78  ALA A C    3  
ATOM 4127  O O    . ALA A 1 78  ? 6.873   14.415  -2.845  1.00 0.00 ? 78  ALA A O    3  
ATOM 4128  C CB   . ALA A 1 78  ? 9.236   13.501  -0.695  1.00 0.00 ? 78  ALA A CB   3  
ATOM 4129  H H    . ALA A 1 78  ? 8.134   14.881  1.082   1.00 0.00 ? 78  ALA A H    3  
ATOM 4130  H HA   . ALA A 1 78  ? 8.897   15.390  -1.654  1.00 0.00 ? 78  ALA A HA   3  
ATOM 4131  H HB1  . ALA A 1 78  ? 9.788   13.229  -1.594  1.00 0.00 ? 78  ALA A HB1  3  
ATOM 4132  H HB2  . ALA A 1 78  ? 9.938   13.739  0.104   1.00 0.00 ? 78  ALA A HB2  3  
ATOM 4133  H HB3  . ALA A 1 78  ? 8.607   12.665  -0.388  1.00 0.00 ? 78  ALA A HB3  3  
ATOM 4134  N N    . LEU A 1 79  ? 6.088   13.938  -0.778  1.00 0.00 ? 79  LEU A N    3  
ATOM 4135  C CA   . LEU A 1 79  ? 4.770   13.545  -1.248  1.00 0.00 ? 79  LEU A CA   3  
ATOM 4136  C C    . LEU A 1 79  ? 4.114   14.728  -1.962  1.00 0.00 ? 79  LEU A C    3  
ATOM 4137  O O    . LEU A 1 79  ? 4.119   14.798  -3.190  1.00 0.00 ? 79  LEU A O    3  
ATOM 4138  C CB   . LEU A 1 79  ? 3.936   12.982  -0.096  1.00 0.00 ? 79  LEU A CB   3  
ATOM 4139  C CG   . LEU A 1 79  ? 4.174   11.510  0.249   1.00 0.00 ? 79  LEU A CG   3  
ATOM 4140  C CD1  . LEU A 1 79  ? 3.844   11.230  1.716   1.00 0.00 ? 79  LEU A CD1  3  
ATOM 4141  C CD2  . LEU A 1 79  ? 3.399   10.593  -0.699  1.00 0.00 ? 79  LEU A CD2  3  
ATOM 4142  H H    . LEU A 1 79  ? 6.218   13.879  0.212   1.00 0.00 ? 79  LEU A H    3  
ATOM 4143  H HA   . LEU A 1 79  ? 4.908   12.739  -1.970  1.00 0.00 ? 79  LEU A HA   3  
ATOM 4144  H HB2  . LEU A 1 79  ? 4.133   13.579  0.794   1.00 0.00 ? 79  LEU A HB2  3  
ATOM 4145  H HB3  . LEU A 1 79  ? 2.882   13.111  -0.340  1.00 0.00 ? 79  LEU A HB3  3  
ATOM 4146  H HG   . LEU A 1 79  ? 5.234   11.294  0.110   1.00 0.00 ? 79  LEU A HG   3  
ATOM 4147  H HD11 . LEU A 1 79  ? 4.749   10.921  2.239   1.00 0.00 ? 79  LEU A HD11 3  
ATOM 4148  H HD12 . LEU A 1 79  ? 3.448   12.135  2.178   1.00 0.00 ? 79  LEU A HD12 3  
ATOM 4149  H HD13 . LEU A 1 79  ? 3.100   10.436  1.776   1.00 0.00 ? 79  LEU A HD13 3  
ATOM 4150  H HD21 . LEU A 1 79  ? 2.702   11.187  -1.291  1.00 0.00 ? 79  LEU A HD21 3  
ATOM 4151  H HD22 . LEU A 1 79  ? 4.097   10.083  -1.363  1.00 0.00 ? 79  LEU A HD22 3  
ATOM 4152  H HD23 . LEU A 1 79  ? 2.845   9.855   -0.118  1.00 0.00 ? 79  LEU A HD23 3  
ATOM 4153  N N    . LYS A 1 80  ? 3.565   15.630  -1.162  1.00 0.00 ? 80  LYS A N    3  
ATOM 4154  C CA   . LYS A 1 80  ? 2.907   16.808  -1.701  1.00 0.00 ? 80  LYS A CA   3  
ATOM 4155  C C    . LYS A 1 80  ? 1.807   16.372  -2.672  1.00 0.00 ? 80  LYS A C    3  
ATOM 4156  O O    . LYS A 1 80  ? 1.489   15.187  -2.764  1.00 0.00 ? 80  LYS A O    3  
ATOM 4157  C CB   . LYS A 1 80  ? 3.932   17.759  -2.321  1.00 0.00 ? 80  LYS A CB   3  
ATOM 4158  C CG   . LYS A 1 80  ? 4.063   19.039  -1.493  1.00 0.00 ? 80  LYS A CG   3  
ATOM 4159  C CD   . LYS A 1 80  ? 4.882   18.791  -0.225  1.00 0.00 ? 80  LYS A CD   3  
ATOM 4160  C CE   . LYS A 1 80  ? 5.151   20.101  0.519   1.00 0.00 ? 80  LYS A CE   3  
ATOM 4161  N NZ   . LYS A 1 80  ? 6.432   20.696  0.075   1.00 0.00 ? 80  LYS A NZ   3  
ATOM 4162  H H    . LYS A 1 80  ? 3.566   15.567  -0.164  1.00 0.00 ? 80  LYS A H    3  
ATOM 4163  H HA   . LYS A 1 80  ? 2.442   17.333  -0.867  1.00 0.00 ? 80  LYS A HA   3  
ATOM 4164  H HB2  . LYS A 1 80  ? 4.901   17.264  -2.386  1.00 0.00 ? 80  LYS A HB2  3  
ATOM 4165  H HB3  . LYS A 1 80  ? 3.634   18.009  -3.339  1.00 0.00 ? 80  LYS A HB3  3  
ATOM 4166  H HG2  . LYS A 1 80  ? 4.538   19.817  -2.092  1.00 0.00 ? 80  LYS A HG2  3  
ATOM 4167  H HG3  . LYS A 1 80  ? 3.072   19.405  -1.224  1.00 0.00 ? 80  LYS A HG3  3  
ATOM 4168  H HD2  . LYS A 1 80  ? 4.349   18.101  0.428   1.00 0.00 ? 80  LYS A HD2  3  
ATOM 4169  H HD3  . LYS A 1 80  ? 5.828   18.317  -0.486  1.00 0.00 ? 80  LYS A HD3  3  
ATOM 4170  H HE2  . LYS A 1 80  ? 4.336   20.802  0.339   1.00 0.00 ? 80  LYS A HE2  3  
ATOM 4171  H HE3  . LYS A 1 80  ? 5.181   19.917  1.593   1.00 0.00 ? 80  LYS A HE3  3  
ATOM 4172  H HZ1  . LYS A 1 80  ? 6.360   20.964  -0.885  1.00 0.00 ? 80  LYS A HZ1  3  
ATOM 4173  H HZ2  . LYS A 1 80  ? 6.636   21.501  0.632   1.00 0.00 ? 80  LYS A HZ2  3  
ATOM 4174  H HZ3  . LYS A 1 80  ? 7.165   20.024  0.180   1.00 0.00 ? 80  LYS A HZ3  3  
ATOM 4175  N N    . GLY A 1 81  ? 1.257   17.353  -3.372  1.00 0.00 ? 81  GLY A N    3  
ATOM 4176  C CA   . GLY A 1 81  ? 0.200   17.085  -4.333  1.00 0.00 ? 81  GLY A CA   3  
ATOM 4177  C C    . GLY A 1 81  ? 0.559   17.643  -5.712  1.00 0.00 ? 81  GLY A C    3  
ATOM 4178  O O    . GLY A 1 81  ? 0.199   18.773  -6.041  1.00 0.00 ? 81  GLY A O    3  
ATOM 4179  H H    . GLY A 1 81  ? 1.522   18.314  -3.292  1.00 0.00 ? 81  GLY A H    3  
ATOM 4180  H HA2  . GLY A 1 81  ? 0.032   16.011  -4.404  1.00 0.00 ? 81  GLY A HA2  3  
ATOM 4181  H HA3  . GLY A 1 81  ? -0.732  17.531  -3.987  1.00 0.00 ? 81  GLY A HA3  3  
ATOM 4182  N N    . SER A 1 82  ? 1.262   16.826  -6.481  1.00 0.00 ? 82  SER A N    3  
ATOM 4183  C CA   . SER A 1 82  ? 1.673   17.224  -7.817  1.00 0.00 ? 82  SER A CA   3  
ATOM 4184  C C    . SER A 1 82  ? 0.562   16.912  -8.821  1.00 0.00 ? 82  SER A C    3  
ATOM 4185  O O    . SER A 1 82  ? -0.311  16.089  -8.550  1.00 0.00 ? 82  SER A O    3  
ATOM 4186  C CB   . SER A 1 82  ? 2.970   16.523  -8.226  1.00 0.00 ? 82  SER A CB   3  
ATOM 4187  O OG   . SER A 1 82  ? 4.123   17.260  -7.830  1.00 0.00 ? 82  SER A OG   3  
ATOM 4188  H H    . SER A 1 82  ? 1.551   15.909  -6.206  1.00 0.00 ? 82  SER A H    3  
ATOM 4189  H HA   . SER A 1 82  ? 1.845   18.299  -7.758  1.00 0.00 ? 82  SER A HA   3  
ATOM 4190  H HB2  . SER A 1 82  ? 3.003   15.530  -7.777  1.00 0.00 ? 82  SER A HB2  3  
ATOM 4191  H HB3  . SER A 1 82  ? 2.982   16.384  -9.307  1.00 0.00 ? 82  SER A HB3  3  
ATOM 4192  H HG   . SER A 1 82  ? 4.456   16.927  -6.948  1.00 0.00 ? 82  SER A HG   3  
ATOM 4193  N N    . LYS A 1 83  ? 0.630   17.586  -9.960  1.00 0.00 ? 83  LYS A N    3  
ATOM 4194  C CA   . LYS A 1 83  ? -0.360  17.391  -11.005 1.00 0.00 ? 83  LYS A CA   3  
ATOM 4195  C C    . LYS A 1 83  ? -0.624  15.894  -11.178 1.00 0.00 ? 83  LYS A C    3  
ATOM 4196  O O    . LYS A 1 83  ? -1.713  15.496  -11.589 1.00 0.00 ? 83  LYS A O    3  
ATOM 4197  C CB   . LYS A 1 83  ? 0.077   18.091  -12.294 1.00 0.00 ? 83  LYS A CB   3  
ATOM 4198  C CG   . LYS A 1 83  ? 1.497   17.679  -12.687 1.00 0.00 ? 83  LYS A CG   3  
ATOM 4199  C CD   . LYS A 1 83  ? 1.513   17.012  -14.064 1.00 0.00 ? 83  LYS A CD   3  
ATOM 4200  C CE   . LYS A 1 83  ? 2.696   17.505  -14.899 1.00 0.00 ? 83  LYS A CE   3  
ATOM 4201  N NZ   . LYS A 1 83  ? 2.219   18.287  -16.062 1.00 0.00 ? 83  LYS A NZ   3  
ATOM 4202  H H    . LYS A 1 83  ? 1.343   18.253  -10.172 1.00 0.00 ? 83  LYS A H    3  
ATOM 4203  H HA   . LYS A 1 83  ? -1.282  17.869  -10.676 1.00 0.00 ? 83  LYS A HA   3  
ATOM 4204  H HB2  . LYS A 1 83  ? -0.614  17.843  -13.100 1.00 0.00 ? 83  LYS A HB2  3  
ATOM 4205  H HB3  . LYS A 1 83  ? 0.032   19.171  -12.158 1.00 0.00 ? 83  LYS A HB3  3  
ATOM 4206  H HG2  . LYS A 1 83  ? 2.144   18.556  -12.697 1.00 0.00 ? 83  LYS A HG2  3  
ATOM 4207  H HG3  . LYS A 1 83  ? 1.900   16.993  -11.942 1.00 0.00 ? 83  LYS A HG3  3  
ATOM 4208  H HD2  . LYS A 1 83  ? 1.572   15.929  -13.947 1.00 0.00 ? 83  LYS A HD2  3  
ATOM 4209  H HD3  . LYS A 1 83  ? 0.580   17.225  -14.586 1.00 0.00 ? 83  LYS A HD3  3  
ATOM 4210  H HE2  . LYS A 1 83  ? 3.352   18.120  -14.283 1.00 0.00 ? 83  LYS A HE2  3  
ATOM 4211  H HE3  . LYS A 1 83  ? 3.286   16.655  -15.242 1.00 0.00 ? 83  LYS A HE3  3  
ATOM 4212  H HZ1  . LYS A 1 83  ? 2.841   18.150  -16.833 1.00 0.00 ? 83  LYS A HZ1  3  
ATOM 4213  H HZ2  . LYS A 1 83  ? 1.301   17.982  -16.315 1.00 0.00 ? 83  LYS A HZ2  3  
ATOM 4214  H HZ3  . LYS A 1 83  ? 2.194   19.258  -15.823 1.00 0.00 ? 83  LYS A HZ3  3  
ATOM 4215  N N    . LYS A 1 84  ? 0.390   15.105  -10.857 1.00 0.00 ? 84  LYS A N    3  
ATOM 4216  C CA   . LYS A 1 84  ? 0.281   13.661  -10.971 1.00 0.00 ? 84  LYS A CA   3  
ATOM 4217  C C    . LYS A 1 84  ? 1.481   13.006  -10.282 1.00 0.00 ? 84  LYS A C    3  
ATOM 4218  O O    . LYS A 1 84  ? 2.529   12.821  -10.898 1.00 0.00 ? 84  LYS A O    3  
ATOM 4219  C CB   . LYS A 1 84  ? 0.114   13.250  -12.436 1.00 0.00 ? 84  LYS A CB   3  
ATOM 4220  C CG   . LYS A 1 84  ? -0.136  11.746  -12.559 1.00 0.00 ? 84  LYS A CG   3  
ATOM 4221  C CD   . LYS A 1 84  ? 0.027   11.280  -14.007 1.00 0.00 ? 84  LYS A CD   3  
ATOM 4222  C CE   . LYS A 1 84  ? 1.503   11.094  -14.360 1.00 0.00 ? 84  LYS A CE   3  
ATOM 4223  N NZ   . LYS A 1 84  ? 1.817   11.762  -15.643 1.00 0.00 ? 84  LYS A NZ   3  
ATOM 4224  H H    . LYS A 1 84  ? 1.273   15.437  -10.523 1.00 0.00 ? 84  LYS A H    3  
ATOM 4225  H HA   . LYS A 1 84  ? -0.625  13.359  -10.446 1.00 0.00 ? 84  LYS A HA   3  
ATOM 4226  H HB2  . LYS A 1 84  ? -0.718  13.798  -12.878 1.00 0.00 ? 84  LYS A HB2  3  
ATOM 4227  H HB3  . LYS A 1 84  ? 1.008   13.521  -12.997 1.00 0.00 ? 84  LYS A HB3  3  
ATOM 4228  H HG2  . LYS A 1 84  ? 0.560   11.205  -11.918 1.00 0.00 ? 84  LYS A HG2  3  
ATOM 4229  H HG3  . LYS A 1 84  ? -1.141  11.511  -12.208 1.00 0.00 ? 84  LYS A HG3  3  
ATOM 4230  H HD2  . LYS A 1 84  ? -0.507  10.340  -14.152 1.00 0.00 ? 84  LYS A HD2  3  
ATOM 4231  H HD3  . LYS A 1 84  ? -0.423  12.009  -14.680 1.00 0.00 ? 84  LYS A HD3  3  
ATOM 4232  H HE2  . LYS A 1 84  ? 2.128   11.504  -13.567 1.00 0.00 ? 84  LYS A HE2  3  
ATOM 4233  H HE3  . LYS A 1 84  ? 1.736   10.031  -14.431 1.00 0.00 ? 84  LYS A HE3  3  
ATOM 4234  H HZ1  . LYS A 1 84  ? 2.171   12.680  -15.463 1.00 0.00 ? 84  LYS A HZ1  3  
ATOM 4235  H HZ2  . LYS A 1 84  ? 2.506   11.230  -16.136 1.00 0.00 ? 84  LYS A HZ2  3  
ATOM 4236  H HZ3  . LYS A 1 84  ? 0.987   11.827  -16.197 1.00 0.00 ? 84  LYS A HZ3  3  
ATOM 4237  N N    . LEU A 1 85  ? 1.286   12.674  -9.015  1.00 0.00 ? 85  LEU A N    3  
ATOM 4238  C CA   . LEU A 1 85  ? 2.339   12.045  -8.236  1.00 0.00 ? 85  LEU A CA   3  
ATOM 4239  C C    . LEU A 1 85  ? 2.261   10.527  -8.415  1.00 0.00 ? 85  LEU A C    3  
ATOM 4240  O O    . LEU A 1 85  ? 1.172   9.965   -8.510  1.00 0.00 ? 85  LEU A O    3  
ATOM 4241  C CB   . LEU A 1 85  ? 2.268   12.496  -6.776  1.00 0.00 ? 85  LEU A CB   3  
ATOM 4242  C CG   . LEU A 1 85  ? 3.026   11.630  -5.768  1.00 0.00 ? 85  LEU A CG   3  
ATOM 4243  C CD1  . LEU A 1 85  ? 4.522   11.601  -6.086  1.00 0.00 ? 85  LEU A CD1  3  
ATOM 4244  C CD2  . LEU A 1 85  ? 2.754   12.090  -4.335  1.00 0.00 ? 85  LEU A CD2  3  
ATOM 4245  H H    . LEU A 1 85  ? 0.430   12.828  -8.521  1.00 0.00 ? 85  LEU A H    3  
ATOM 4246  H HA   . LEU A 1 85  ? 3.292   12.392  -8.635  1.00 0.00 ? 85  LEU A HA   3  
ATOM 4247  H HB2  . LEU A 1 85  ? 2.653   13.514  -6.712  1.00 0.00 ? 85  LEU A HB2  3  
ATOM 4248  H HB3  . LEU A 1 85  ? 1.220   12.533  -6.478  1.00 0.00 ? 85  LEU A HB3  3  
ATOM 4249  H HG   . LEU A 1 85  ? 2.659   10.607  -5.853  1.00 0.00 ? 85  LEU A HG   3  
ATOM 4250  H HD11 . LEU A 1 85  ? 4.905   10.591  -5.943  1.00 0.00 ? 85  LEU A HD11 3  
ATOM 4251  H HD12 . LEU A 1 85  ? 4.680   11.906  -7.121  1.00 0.00 ? 85  LEU A HD12 3  
ATOM 4252  H HD13 . LEU A 1 85  ? 5.048   12.287  -5.422  1.00 0.00 ? 85  LEU A HD13 3  
ATOM 4253  H HD21 . LEU A 1 85  ? 2.828   13.176  -4.281  1.00 0.00 ? 85  LEU A HD21 3  
ATOM 4254  H HD22 . LEU A 1 85  ? 1.752   11.779  -4.038  1.00 0.00 ? 85  LEU A HD22 3  
ATOM 4255  H HD23 . LEU A 1 85  ? 3.487   11.642  -3.664  1.00 0.00 ? 85  LEU A HD23 3  
ATOM 4256  N N    . VAL A 1 86  ? 3.432   9.908   -8.454  1.00 0.00 ? 86  VAL A N    3  
ATOM 4257  C CA   . VAL A 1 86  ? 3.511   8.466   -8.620  1.00 0.00 ? 86  VAL A CA   3  
ATOM 4258  C C    . VAL A 1 86  ? 4.018   7.835   -7.322  1.00 0.00 ? 86  VAL A C    3  
ATOM 4259  O O    . VAL A 1 86  ? 5.208   7.906   -7.017  1.00 0.00 ? 86  VAL A O    3  
ATOM 4260  C CB   . VAL A 1 86  ? 4.381   8.125   -9.831  1.00 0.00 ? 86  VAL A CB   3  
ATOM 4261  C CG1  . VAL A 1 86  ? 4.781   6.649   -9.820  1.00 0.00 ? 86  VAL A CG1  3  
ATOM 4262  C CG2  . VAL A 1 86  ? 3.672   8.492   -11.136 1.00 0.00 ? 86  VAL A CG2  3  
ATOM 4263  H H    . VAL A 1 86  ? 4.314   10.373  -8.376  1.00 0.00 ? 86  VAL A H    3  
ATOM 4264  H HA   . VAL A 1 86  ? 2.502   8.102   -8.816  1.00 0.00 ? 86  VAL A HA   3  
ATOM 4265  H HB   . VAL A 1 86  ? 5.292   8.720   -9.767  1.00 0.00 ? 86  VAL A HB   3  
ATOM 4266  H HG11 . VAL A 1 86  ? 4.037   6.075   -9.269  1.00 0.00 ? 86  VAL A HG11 3  
ATOM 4267  H HG12 . VAL A 1 86  ? 4.839   6.280   -10.844 1.00 0.00 ? 86  VAL A HG12 3  
ATOM 4268  H HG13 . VAL A 1 86  ? 5.753   6.539   -9.339  1.00 0.00 ? 86  VAL A HG13 3  
ATOM 4269  H HG21 . VAL A 1 86  ? 2.595   8.516   -10.970 1.00 0.00 ? 86  VAL A HG21 3  
ATOM 4270  H HG22 . VAL A 1 86  ? 4.010   9.473   -11.470 1.00 0.00 ? 86  VAL A HG22 3  
ATOM 4271  H HG23 . VAL A 1 86  ? 3.906   7.749   -11.898 1.00 0.00 ? 86  VAL A HG23 3  
ATOM 4272  N N    . LEU A 1 87  ? 3.091   7.232   -6.592  1.00 0.00 ? 87  LEU A N    3  
ATOM 4273  C CA   . LEU A 1 87  ? 3.430   6.589   -5.334  1.00 0.00 ? 87  LEU A CA   3  
ATOM 4274  C C    . LEU A 1 87  ? 4.063   5.225   -5.618  1.00 0.00 ? 87  LEU A C    3  
ATOM 4275  O O    . LEU A 1 87  ? 3.430   4.354   -6.212  1.00 0.00 ? 87  LEU A O    3  
ATOM 4276  C CB   . LEU A 1 87  ? 2.205   6.520   -4.421  1.00 0.00 ? 87  LEU A CB   3  
ATOM 4277  C CG   . LEU A 1 87  ? 1.531   7.856   -4.101  1.00 0.00 ? 87  LEU A CG   3  
ATOM 4278  C CD1  . LEU A 1 87  ? 2.521   8.830   -3.459  1.00 0.00 ? 87  LEU A CD1  3  
ATOM 4279  C CD2  . LEU A 1 87  ? 0.870   8.448   -5.347  1.00 0.00 ? 87  LEU A CD2  3  
ATOM 4280  H H    . LEU A 1 87  ? 2.126   7.179   -6.848  1.00 0.00 ? 87  LEU A H    3  
ATOM 4281  H HA   . LEU A 1 87  ? 4.169   7.216   -4.836  1.00 0.00 ? 87  LEU A HA   3  
ATOM 4282  H HB2  . LEU A 1 87  ? 1.467   5.865   -4.884  1.00 0.00 ? 87  LEU A HB2  3  
ATOM 4283  H HB3  . LEU A 1 87  ? 2.502   6.052   -3.482  1.00 0.00 ? 87  LEU A HB3  3  
ATOM 4284  H HG   . LEU A 1 87  ? 0.740   7.674   -3.373  1.00 0.00 ? 87  LEU A HG   3  
ATOM 4285  H HD11 . LEU A 1 87  ? 2.151   9.131   -2.479  1.00 0.00 ? 87  LEU A HD11 3  
ATOM 4286  H HD12 . LEU A 1 87  ? 3.490   8.343   -3.348  1.00 0.00 ? 87  LEU A HD12 3  
ATOM 4287  H HD13 . LEU A 1 87  ? 2.627   9.710   -4.093  1.00 0.00 ? 87  LEU A HD13 3  
ATOM 4288  H HD21 . LEU A 1 87  ? 0.149   9.209   -5.049  1.00 0.00 ? 87  LEU A HD21 3  
ATOM 4289  H HD22 . LEU A 1 87  ? 1.632   8.899   -5.983  1.00 0.00 ? 87  LEU A HD22 3  
ATOM 4290  H HD23 . LEU A 1 87  ? 0.358   7.658   -5.897  1.00 0.00 ? 87  LEU A HD23 3  
ATOM 4291  N N    . SER A 1 88  ? 5.306   5.082   -5.180  1.00 0.00 ? 88  SER A N    3  
ATOM 4292  C CA   . SER A 1 88  ? 6.031   3.839   -5.379  1.00 0.00 ? 88  SER A CA   3  
ATOM 4293  C C    . SER A 1 88  ? 5.923   2.964   -4.129  1.00 0.00 ? 88  SER A C    3  
ATOM 4294  O O    . SER A 1 88  ? 6.548   3.252   -3.110  1.00 0.00 ? 88  SER A O    3  
ATOM 4295  C CB   . SER A 1 88  ? 7.500   4.106   -5.715  1.00 0.00 ? 88  SER A CB   3  
ATOM 4296  O OG   . SER A 1 88  ? 7.698   4.322   -7.110  1.00 0.00 ? 88  SER A OG   3  
ATOM 4297  H H    . SER A 1 88  ? 5.814   5.796   -4.698  1.00 0.00 ? 88  SER A H    3  
ATOM 4298  H HA   . SER A 1 88  ? 5.547   3.356   -6.228  1.00 0.00 ? 88  SER A HA   3  
ATOM 4299  H HB2  . SER A 1 88  ? 7.845   4.979   -5.160  1.00 0.00 ? 88  SER A HB2  3  
ATOM 4300  H HB3  . SER A 1 88  ? 8.106   3.261   -5.389  1.00 0.00 ? 88  SER A HB3  3  
ATOM 4301  H HG   . SER A 1 88  ? 8.545   3.882   -7.407  1.00 0.00 ? 88  SER A HG   3  
ATOM 4302  N N    . VAL A 1 89  ? 5.125   1.913   -4.249  1.00 0.00 ? 89  VAL A N    3  
ATOM 4303  C CA   . VAL A 1 89  ? 4.927   0.994   -3.141  1.00 0.00 ? 89  VAL A CA   3  
ATOM 4304  C C    . VAL A 1 89  ? 5.257   -0.429  -3.599  1.00 0.00 ? 89  VAL A C    3  
ATOM 4305  O O    . VAL A 1 89  ? 5.081   -0.764  -4.769  1.00 0.00 ? 89  VAL A O    3  
ATOM 4306  C CB   . VAL A 1 89  ? 3.505   1.131   -2.595  1.00 0.00 ? 89  VAL A CB   3  
ATOM 4307  C CG1  . VAL A 1 89  ? 3.411   2.285   -1.594  1.00 0.00 ? 89  VAL A CG1  3  
ATOM 4308  C CG2  . VAL A 1 89  ? 2.496   1.308   -3.731  1.00 0.00 ? 89  VAL A CG2  3  
ATOM 4309  H H    . VAL A 1 89  ? 4.620   1.686   -5.082  1.00 0.00 ? 89  VAL A H    3  
ATOM 4310  H HA   . VAL A 1 89  ? 5.622   1.277   -2.350  1.00 0.00 ? 89  VAL A HA   3  
ATOM 4311  H HB   . VAL A 1 89  ? 3.258   0.210   -2.067  1.00 0.00 ? 89  VAL A HB   3  
ATOM 4312  H HG11 . VAL A 1 89  ? 4.016   2.055   -0.716  1.00 0.00 ? 89  VAL A HG11 3  
ATOM 4313  H HG12 . VAL A 1 89  ? 3.779   3.200   -2.059  1.00 0.00 ? 89  VAL A HG12 3  
ATOM 4314  H HG13 . VAL A 1 89  ? 2.372   2.422   -1.294  1.00 0.00 ? 89  VAL A HG13 3  
ATOM 4315  H HG21 . VAL A 1 89  ? 2.282   2.368   -3.866  1.00 0.00 ? 89  VAL A HG21 3  
ATOM 4316  H HG22 . VAL A 1 89  ? 2.912   0.901   -4.653  1.00 0.00 ? 89  VAL A HG22 3  
ATOM 4317  H HG23 . VAL A 1 89  ? 1.575   0.780   -3.484  1.00 0.00 ? 89  VAL A HG23 3  
ATOM 4318  N N    . TYR A 1 90  ? 5.729   -1.226  -2.652  1.00 0.00 ? 90  TYR A N    3  
ATOM 4319  C CA   . TYR A 1 90  ? 6.085   -2.605  -2.944  1.00 0.00 ? 90  TYR A CA   3  
ATOM 4320  C C    . TYR A 1 90  ? 4.960   -3.559  -2.537  1.00 0.00 ? 90  TYR A C    3  
ATOM 4321  O O    . TYR A 1 90  ? 4.714   -3.762  -1.349  1.00 0.00 ? 90  TYR A O    3  
ATOM 4322  C CB   . TYR A 1 90  ? 7.325   -2.907  -2.100  1.00 0.00 ? 90  TYR A CB   3  
ATOM 4323  C CG   . TYR A 1 90  ? 7.475   -4.382  -1.722  1.00 0.00 ? 90  TYR A CG   3  
ATOM 4324  C CD1  . TYR A 1 90  ? 7.651   -5.333  -2.707  1.00 0.00 ? 90  TYR A CD1  3  
ATOM 4325  C CD2  . TYR A 1 90  ? 7.435   -4.762  -0.396  1.00 0.00 ? 90  TYR A CD2  3  
ATOM 4326  C CE1  . TYR A 1 90  ? 7.793   -6.721  -2.352  1.00 0.00 ? 90  TYR A CE1  3  
ATOM 4327  C CE2  . TYR A 1 90  ? 7.577   -6.150  -0.040  1.00 0.00 ? 90  TYR A CE2  3  
ATOM 4328  C CZ   . TYR A 1 90  ? 7.749   -7.061  -1.036  1.00 0.00 ? 90  TYR A CZ   3  
ATOM 4329  O OH   . TYR A 1 90  ? 7.882   -8.372  -0.699  1.00 0.00 ? 90  TYR A OH   3  
ATOM 4330  H H    . TYR A 1 90  ? 5.869   -0.945  -1.703  1.00 0.00 ? 90  TYR A H    3  
ATOM 4331  H HA   . TYR A 1 90  ? 6.252   -2.689  -4.017  1.00 0.00 ? 90  TYR A HA   3  
ATOM 4332  H HB2  . TYR A 1 90  ? 8.212   -2.592  -2.650  1.00 0.00 ? 90  TYR A HB2  3  
ATOM 4333  H HB3  . TYR A 1 90  ? 7.286   -2.311  -1.189  1.00 0.00 ? 90  TYR A HB3  3  
ATOM 4334  H HD1  . TYR A 1 90  ? 7.683   -5.033  -3.755  1.00 0.00 ? 90  TYR A HD1  3  
ATOM 4335  H HD2  . TYR A 1 90  ? 7.297   -4.011  0.382   1.00 0.00 ? 90  TYR A HD2  3  
ATOM 4336  H HE1  . TYR A 1 90  ? 7.932   -7.482  -3.120  1.00 0.00 ? 90  TYR A HE1  3  
ATOM 4337  H HE2  . TYR A 1 90  ? 7.547   -6.464  1.003   1.00 0.00 ? 90  TYR A HE2  3  
ATOM 4338  H HH   . TYR A 1 90  ? 8.717   -8.505  -0.166  1.00 0.00 ? 90  TYR A HH   3  
ATOM 4339  N N    . SER A 1 91  ? 4.309   -4.119  -3.545  1.00 0.00 ? 91  SER A N    3  
ATOM 4340  C CA   . SER A 1 91  ? 3.216   -5.047  -3.307  1.00 0.00 ? 91  SER A CA   3  
ATOM 4341  C C    . SER A 1 91  ? 3.763   -6.465  -3.133  1.00 0.00 ? 91  SER A C    3  
ATOM 4342  O O    . SER A 1 91  ? 4.714   -6.855  -3.809  1.00 0.00 ? 91  SER A O    3  
ATOM 4343  C CB   . SER A 1 91  ? 2.200   -5.006  -4.450  1.00 0.00 ? 91  SER A CB   3  
ATOM 4344  O OG   . SER A 1 91  ? 1.035   -5.773  -4.156  1.00 0.00 ? 91  SER A OG   3  
ATOM 4345  H H    . SER A 1 91  ? 4.516   -3.948  -4.508  1.00 0.00 ? 91  SER A H    3  
ATOM 4346  H HA   . SER A 1 91  ? 2.742   -4.705  -2.387  1.00 0.00 ? 91  SER A HA   3  
ATOM 4347  H HB2  . SER A 1 91  ? 1.914   -3.972  -4.644  1.00 0.00 ? 91  SER A HB2  3  
ATOM 4348  H HB3  . SER A 1 91  ? 2.663   -5.385  -5.361  1.00 0.00 ? 91  SER A HB3  3  
ATOM 4349  H HG   . SER A 1 91  ? 0.964   -6.543  -4.789  1.00 0.00 ? 91  SER A HG   3  
ATOM 4350  N N    . ALA A 1 92  ? 3.138   -7.199  -2.224  1.00 0.00 ? 92  ALA A N    3  
ATOM 4351  C CA   . ALA A 1 92  ? 3.550   -8.566  -1.953  1.00 0.00 ? 92  ALA A CA   3  
ATOM 4352  C C    . ALA A 1 92  ? 2.350   -9.364  -1.440  1.00 0.00 ? 92  ALA A C    3  
ATOM 4353  O O    . ALA A 1 92  ? 1.293   -8.796  -1.166  1.00 0.00 ? 92  ALA A O    3  
ATOM 4354  C CB   . ALA A 1 92  ? 4.714   -8.561  -0.961  1.00 0.00 ? 92  ALA A CB   3  
ATOM 4355  H H    . ALA A 1 92  ? 2.365   -6.875  -1.679  1.00 0.00 ? 92  ALA A H    3  
ATOM 4356  H HA   . ALA A 1 92  ? 3.891   -9.002  -2.892  1.00 0.00 ? 92  ALA A HA   3  
ATOM 4357  H HB1  . ALA A 1 92  ? 5.598   -8.986  -1.436  1.00 0.00 ? 92  ALA A HB1  3  
ATOM 4358  H HB2  . ALA A 1 92  ? 4.925   -7.537  -0.652  1.00 0.00 ? 92  ALA A HB2  3  
ATOM 4359  H HB3  . ALA A 1 92  ? 4.449   -9.156  -0.087  1.00 0.00 ? 92  ALA A HB3  3  
ATOM 4360  N N    . GLY A 1 93  ? 2.552   -10.668 -1.325  1.00 0.00 ? 93  GLY A N    3  
ATOM 4361  C CA   . GLY A 1 93  ? 1.499   -11.549 -0.850  1.00 0.00 ? 93  GLY A CA   3  
ATOM 4362  C C    . GLY A 1 93  ? 0.194   -11.304 -1.609  1.00 0.00 ? 93  GLY A C    3  
ATOM 4363  O O    . GLY A 1 93  ? -0.713  -10.650 -1.096  1.00 0.00 ? 93  GLY A O    3  
ATOM 4364  H H    . GLY A 1 93  ? 3.414   -11.122 -1.550  1.00 0.00 ? 93  GLY A H    3  
ATOM 4365  H HA2  . GLY A 1 93  ? 1.806   -12.588 -0.974  1.00 0.00 ? 93  GLY A HA2  3  
ATOM 4366  H HA3  . GLY A 1 93  ? 1.340   -11.389 0.216   1.00 0.00 ? 93  GLY A HA3  3  
ATOM 4367  N N    . ARG A 1 94  ? 0.140   -11.840 -2.819  1.00 0.00 ? 94  ARG A N    3  
ATOM 4368  C CA   . ARG A 1 94  ? -1.040  -11.687 -3.654  1.00 0.00 ? 94  ARG A CA   3  
ATOM 4369  C C    . ARG A 1 94  ? -1.256  -10.213 -4.001  1.00 0.00 ? 94  ARG A C    3  
ATOM 4370  O O    . ARG A 1 94  ? -0.693  -9.330  -3.356  1.00 0.00 ? 94  ARG A O    3  
ATOM 4371  C CB   . ARG A 1 94  ? -2.286  -12.227 -2.950  1.00 0.00 ? 94  ARG A CB   3  
ATOM 4372  C CG   . ARG A 1 94  ? -2.569  -13.672 -3.367  1.00 0.00 ? 94  ARG A CG   3  
ATOM 4373  C CD   . ARG A 1 94  ? -3.643  -13.729 -4.455  1.00 0.00 ? 94  ARG A CD   3  
ATOM 4374  N NE   . ARG A 1 94  ? -4.069  -15.130 -4.672  1.00 0.00 ? 94  ARG A NE   3  
ATOM 4375  C CZ   . ARG A 1 94  ? -4.954  -15.774 -3.900  1.00 0.00 ? 94  ARG A CZ   3  
ATOM 4376  N NH1  . ARG A 1 94  ? -5.511  -15.149 -2.854  1.00 0.00 ? 94  ARG A NH1  3  
ATOM 4377  N NH2  . ARG A 1 94  ? -5.281  -17.045 -4.172  1.00 0.00 ? 94  ARG A NH2  3  
ATOM 4378  H H    . ARG A 1 94  ? 0.882   -12.370 -3.229  1.00 0.00 ? 94  ARG A H    3  
ATOM 4379  H HA   . ARG A 1 94  ? -0.826  -12.274 -4.548  1.00 0.00 ? 94  ARG A HA   3  
ATOM 4380  H HB2  . ARG A 1 94  ? -2.149  -12.177 -1.870  1.00 0.00 ? 94  ARG A HB2  3  
ATOM 4381  H HB3  . ARG A 1 94  ? -3.145  -11.601 -3.192  1.00 0.00 ? 94  ARG A HB3  3  
ATOM 4382  H HG2  . ARG A 1 94  ? -1.652  -14.135 -3.732  1.00 0.00 ? 94  ARG A HG2  3  
ATOM 4383  H HG3  . ARG A 1 94  ? -2.893  -14.248 -2.500  1.00 0.00 ? 94  ARG A HG3  3  
ATOM 4384  H HD2  . ARG A 1 94  ? -4.499  -13.121 -4.163  1.00 0.00 ? 94  ARG A HD2  3  
ATOM 4385  H HD3  . ARG A 1 94  ? -3.255  -13.310 -5.383  1.00 0.00 ? 94  ARG A HD3  3  
ATOM 4386  H HE   . ARG A 1 94  ? -3.672  -15.626 -5.444  1.00 0.00 ? 94  ARG A HE   3  
ATOM 4387  H HH11 . ARG A 1 94  ? -5.267  -14.201 -2.650  1.00 0.00 ? 94  ARG A HH11 3  
ATOM 4388  H HH12 . ARG A 1 94  ? -6.172  -15.630 -2.277  1.00 0.00 ? 94  ARG A HH12 3  
ATOM 4389  H HH21 . ARG A 1 94  ? -4.865  -17.512 -4.953  1.00 0.00 ? 94  ARG A HH21 3  
ATOM 4390  H HH22 . ARG A 1 94  ? -5.941  -17.526 -3.596  1.00 0.00 ? 94  ARG A HH22 3  
ATOM 4391  N N    . ILE A 1 95  ? -2.075  -9.992  -5.019  1.00 0.00 ? 95  ILE A N    3  
ATOM 4392  C CA   . ILE A 1 95  ? -2.373  -8.640  -5.460  1.00 0.00 ? 95  ILE A CA   3  
ATOM 4393  C C    . ILE A 1 95  ? -3.630  -8.141  -4.745  1.00 0.00 ? 95  ILE A C    3  
ATOM 4394  O O    . ILE A 1 95  ? -4.531  -8.924  -4.446  1.00 0.00 ? 95  ILE A O    3  
ATOM 4395  C CB   . ILE A 1 95  ? -2.470  -8.583  -6.986  1.00 0.00 ? 95  ILE A CB   3  
ATOM 4396  C CG1  . ILE A 1 95  ? -2.379  -7.141  -7.488  1.00 0.00 ? 95  ILE A CG1  3  
ATOM 4397  C CG2  . ILE A 1 95  ? -3.738  -9.283  -7.481  1.00 0.00 ? 95  ILE A CG2  3  
ATOM 4398  C CD1  . ILE A 1 95  ? -0.929  -6.756  -7.787  1.00 0.00 ? 95  ILE A CD1  3  
ATOM 4399  H H    . ILE A 1 95  ? -2.529  -10.716 -5.539  1.00 0.00 ? 95  ILE A H    3  
ATOM 4400  H HA   . ILE A 1 95  ? -1.535  -8.009  -5.167  1.00 0.00 ? 95  ILE A HA   3  
ATOM 4401  H HB   . ILE A 1 95  ? -1.621  -9.124  -7.403  1.00 0.00 ? 95  ILE A HB   3  
ATOM 4402  H HG12 . ILE A 1 95  ? -2.983  -7.026  -8.388  1.00 0.00 ? 95  ILE A HG12 3  
ATOM 4403  H HG13 . ILE A 1 95  ? -2.791  -6.465  -6.739  1.00 0.00 ? 95  ILE A HG13 3  
ATOM 4404  H HG21 . ILE A 1 95  ? -3.532  -10.343 -7.633  1.00 0.00 ? 95  ILE A HG21 3  
ATOM 4405  H HG22 . ILE A 1 95  ? -4.529  -9.170  -6.740  1.00 0.00 ? 95  ILE A HG22 3  
ATOM 4406  H HG23 . ILE A 1 95  ? -4.055  -8.836  -8.423  1.00 0.00 ? 95  ILE A HG23 3  
ATOM 4407  H HD11 . ILE A 1 95  ? -0.418  -7.598  -8.253  1.00 0.00 ? 95  ILE A HD11 3  
ATOM 4408  H HD12 . ILE A 1 95  ? -0.912  -5.901  -8.464  1.00 0.00 ? 95  ILE A HD12 3  
ATOM 4409  H HD13 . ILE A 1 95  ? -0.423  -6.492  -6.858  1.00 0.00 ? 95  ILE A HD13 3  
ATOM 4410  N N    . SER A 1 96  ? -3.651  -6.841  -4.491  1.00 0.00 ? 96  SER A N    3  
ATOM 4411  C CA   . SER A 1 96  ? -4.782  -6.228  -3.816  1.00 0.00 ? 96  SER A CA   3  
ATOM 4412  C C    . SER A 1 96  ? -6.091  -6.737  -4.422  1.00 0.00 ? 96  SER A C    3  
ATOM 4413  O O    . SER A 1 96  ? -6.909  -7.338  -3.727  1.00 0.00 ? 96  SER A O    3  
ATOM 4414  C CB   . SER A 1 96  ? -4.715  -4.702  -3.903  1.00 0.00 ? 96  SER A CB   3  
ATOM 4415  O OG   . SER A 1 96  ? -4.543  -4.251  -5.244  1.00 0.00 ? 96  SER A OG   3  
ATOM 4416  H H    . SER A 1 96  ? -2.914  -6.211  -4.737  1.00 0.00 ? 96  SER A H    3  
ATOM 4417  H HA   . SER A 1 96  ? -4.698  -6.536  -2.774  1.00 0.00 ? 96  SER A HA   3  
ATOM 4418  H HB2  . SER A 1 96  ? -5.629  -4.275  -3.491  1.00 0.00 ? 96  SER A HB2  3  
ATOM 4419  H HB3  . SER A 1 96  ? -3.890  -4.340  -3.290  1.00 0.00 ? 96  SER A HB3  3  
ATOM 4420  H HG   . SER A 1 96  ? -4.352  -3.269  -5.253  1.00 0.00 ? 96  SER A HG   3  
ATOM 4421  N N    . GLY A 1 97  ? -6.249  -6.479  -5.712  1.00 0.00 ? 97  GLY A N    3  
ATOM 4422  C CA   . GLY A 1 97  ? -7.445  -6.903  -6.420  1.00 0.00 ? 97  GLY A CA   3  
ATOM 4423  C C    . GLY A 1 97  ? -7.127  -7.246  -7.877  1.00 0.00 ? 97  GLY A C    3  
ATOM 4424  O O    . GLY A 1 97  ? -6.129  -6.781  -8.424  1.00 0.00 ? 97  GLY A O    3  
ATOM 4425  H H    . GLY A 1 97  ? -5.579  -5.990  -6.270  1.00 0.00 ? 97  GLY A H    3  
ATOM 4426  H HA2  . GLY A 1 97  ? -7.876  -7.773  -5.923  1.00 0.00 ? 97  GLY A HA2  3  
ATOM 4427  H HA3  . GLY A 1 97  ? -8.193  -6.112  -6.384  1.00 0.00 ? 97  GLY A HA3  3  
ATOM 4428  N N    . PRO A 1 98  ? -8.018  -8.080  -8.478  1.00 0.00 ? 98  PRO A N    3  
ATOM 4429  C CA   . PRO A 1 98  ? -7.842  -8.490  -9.861  1.00 0.00 ? 98  PRO A CA   3  
ATOM 4430  C C    . PRO A 1 98  ? -8.204  -7.355  -10.820 1.00 0.00 ? 98  PRO A C    3  
ATOM 4431  O O    . PRO A 1 98  ? -7.433  -7.030  -11.722 1.00 0.00 ? 98  PRO A O    3  
ATOM 4432  C CB   . PRO A 1 98  ? -8.732  -9.712  -10.024 1.00 0.00 ? 98  PRO A CB   3  
ATOM 4433  C CG   . PRO A 1 98  ? -9.722  -9.664  -8.872  1.00 0.00 ? 98  PRO A CG   3  
ATOM 4434  C CD   . PRO A 1 98  ? -9.211  -8.651  -7.861  1.00 0.00 ? 98  PRO A CD   3  
ATOM 4435  H HA   . PRO A 1 98  ? -6.882  -8.704  -10.040 1.00 0.00 ? 98  PRO A HA   3  
ATOM 4436  H HB2  . PRO A 1 98  ? -9.248  -9.693  -10.984 1.00 0.00 ? 98  PRO A HB2  3  
ATOM 4437  H HB3  . PRO A 1 98  ? -8.144  -10.629 -9.997  1.00 0.00 ? 98  PRO A HB3  3  
ATOM 4438  H HG2  . PRO A 1 98  ? -10.711 -9.380  -9.230  1.00 0.00 ? 98  PRO A HG2  3  
ATOM 4439  H HG3  . PRO A 1 98  ? -9.820  -10.647 -8.412  1.00 0.00 ? 98  PRO A HG3  3  
ATOM 4440  H HD2  . PRO A 1 98  ? -9.958  -7.883  -7.657  1.00 0.00 ? 98  PRO A HD2  3  
ATOM 4441  H HD3  . PRO A 1 98  ? -8.975  -9.126  -6.909  1.00 0.00 ? 98  PRO A HD3  3  
ATOM 4442  N N    . SER A 1 99  ? -9.377  -6.782  -10.593 1.00 0.00 ? 99  SER A N    3  
ATOM 4443  C CA   . SER A 1 99  ? -9.850  -5.689  -11.426 1.00 0.00 ? 99  SER A CA   3  
ATOM 4444  C C    . SER A 1 99  ? -10.727 -4.745  -10.602 1.00 0.00 ? 99  SER A C    3  
ATOM 4445  O O    . SER A 1 99  ? -11.814 -5.122  -10.167 1.00 0.00 ? 99  SER A O    3  
ATOM 4446  C CB   . SER A 1 99  ? -10.627 -6.215  -12.635 1.00 0.00 ? 99  SER A CB   3  
ATOM 4447  O OG   . SER A 1 99  ? -9.998  -5.868  -13.866 1.00 0.00 ? 99  SER A OG   3  
ATOM 4448  H H    . SER A 1 99  ? -9.998  -7.052  -9.857  1.00 0.00 ? 99  SER A H    3  
ATOM 4449  H HA   . SER A 1 99  ? -8.951  -5.176  -11.768 1.00 0.00 ? 99  SER A HA   3  
ATOM 4450  H HB2  . SER A 1 99  ? -10.715 -7.299  -12.566 1.00 0.00 ? 99  SER A HB2  3  
ATOM 4451  H HB3  . SER A 1 99  ? -11.639 -5.811  -12.619 1.00 0.00 ? 99  SER A HB3  3  
ATOM 4452  H HG   . SER A 1 99  ? -9.561  -6.674  -14.266 1.00 0.00 ? 99  SER A HG   3  
ATOM 4453  N N    . SER A 1 100 ? -10.221 -3.535  -10.412 1.00 0.00 ? 100 SER A N    3  
ATOM 4454  C CA   . SER A 1 100 ? -10.945 -2.533  -9.647  1.00 0.00 ? 100 SER A CA   3  
ATOM 4455  C C    . SER A 1 100 ? -12.071 -1.940  -10.496 1.00 0.00 ? 100 SER A C    3  
ATOM 4456  O O    . SER A 1 100 ? -11.850 -1.001  -11.259 1.00 0.00 ? 100 SER A O    3  
ATOM 4457  C CB   . SER A 1 100 ? -10.006 -1.426  -9.162  1.00 0.00 ? 100 SER A CB   3  
ATOM 4458  O OG   . SER A 1 100 ? -10.720 -0.338  -8.581  1.00 0.00 ? 100 SER A OG   3  
ATOM 4459  H H    . SER A 1 100 ? -9.336  -3.236  -10.769 1.00 0.00 ? 100 SER A H    3  
ATOM 4460  H HA   . SER A 1 100 ? -11.353 -3.065  -8.788  1.00 0.00 ? 100 SER A HA   3  
ATOM 4461  H HB2  . SER A 1 100 ? -9.311  -1.836  -8.429  1.00 0.00 ? 100 SER A HB2  3  
ATOM 4462  H HB3  . SER A 1 100 ? -9.410  -1.064  -9.999  1.00 0.00 ? 100 SER A HB3  3  
ATOM 4463  H HG   . SER A 1 100 ? -11.355 -0.677  -7.888  1.00 0.00 ? 100 SER A HG   3  
ATOM 4464  N N    . GLY A 1 101 ? -13.255 -2.512  -10.334 1.00 0.00 ? 101 GLY A N    3  
ATOM 4465  C CA   . GLY A 1 101 ? -14.417 -2.051  -11.075 1.00 0.00 ? 101 GLY A CA   3  
ATOM 4466  C C    . GLY A 1 101 ? -15.542 -3.087  -11.030 1.00 0.00 ? 101 GLY A C    3  
ATOM 4467  O O    . GLY A 1 101 ? -16.693 -2.772  -11.330 1.00 0.00 ? 101 GLY A O    3  
ATOM 4468  H H    . GLY A 1 101 ? -13.427 -3.275  -9.711  1.00 0.00 ? 101 GLY A H    3  
ATOM 4469  H HA2  . GLY A 1 101 ? -14.769 -1.108  -10.658 1.00 0.00 ? 101 GLY A HA2  3  
ATOM 4470  H HA3  . GLY A 1 101 ? -14.138 -1.857  -12.111 1.00 0.00 ? 101 GLY A HA3  3  
ATOM 4471  N N    . GLY A 1 1   ? 9.343   -16.585 -22.791 1.00 0.00 ? 1   GLY A N    4  
ATOM 4472  C CA   . GLY A 1 1   ? 8.239   -15.880 -22.163 1.00 0.00 ? 1   GLY A CA   4  
ATOM 4473  C C    . GLY A 1 1   ? 8.389   -15.870 -20.640 1.00 0.00 ? 1   GLY A C    4  
ATOM 4474  O O    . GLY A 1 1   ? 9.505   -15.849 -20.123 1.00 0.00 ? 1   GLY A O    4  
ATOM 4475  H H1   . GLY A 1 1   ? 9.755   -17.306 -22.234 1.00 0.00 ? 1   GLY A H1   4  
ATOM 4476  H HA2  . GLY A 1 1   ? 8.198   -14.856 -22.534 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4477  H HA3  . GLY A 1 1   ? 7.297   -16.356 -22.436 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4478  N N    . SER A 1 2   ? 7.249   -15.886 -19.965 1.00 0.00 ? 2   SER A N    4  
ATOM 4479  C CA   . SER A 1 2   ? 7.240   -15.879 -18.512 1.00 0.00 ? 2   SER A CA   4  
ATOM 4480  C C    . SER A 1 2   ? 5.869   -16.319 -17.995 1.00 0.00 ? 2   SER A C    4  
ATOM 4481  O O    . SER A 1 2   ? 4.922   -16.448 -18.770 1.00 0.00 ? 2   SER A O    4  
ATOM 4482  C CB   . SER A 1 2   ? 7.593   -14.494 -17.965 1.00 0.00 ? 2   SER A CB   4  
ATOM 4483  O OG   . SER A 1 2   ? 6.654   -13.503 -18.374 1.00 0.00 ? 2   SER A OG   4  
ATOM 4484  H H    . SER A 1 2   ? 6.346   -15.902 -20.393 1.00 0.00 ? 2   SER A H    4  
ATOM 4485  H HA   . SER A 1 2   ? 8.008   -16.592 -18.215 1.00 0.00 ? 2   SER A HA   4  
ATOM 4486  H HB2  . SER A 1 2   ? 7.629   -14.532 -16.877 1.00 0.00 ? 2   SER A HB2  4  
ATOM 4487  H HB3  . SER A 1 2   ? 8.589   -14.212 -18.307 1.00 0.00 ? 2   SER A HB3  4  
ATOM 4488  H HG   . SER A 1 2   ? 5.746   -13.725 -18.018 1.00 0.00 ? 2   SER A HG   4  
ATOM 4489  N N    . SER A 1 3   ? 5.806   -16.538 -16.690 1.00 0.00 ? 3   SER A N    4  
ATOM 4490  C CA   . SER A 1 3   ? 4.567   -16.962 -16.061 1.00 0.00 ? 3   SER A CA   4  
ATOM 4491  C C    . SER A 1 3   ? 4.144   -15.944 -15.000 1.00 0.00 ? 3   SER A C    4  
ATOM 4492  O O    . SER A 1 3   ? 3.074   -15.346 -15.100 1.00 0.00 ? 3   SER A O    4  
ATOM 4493  C CB   . SER A 1 3   ? 4.714   -18.351 -15.435 1.00 0.00 ? 3   SER A CB   4  
ATOM 4494  O OG   . SER A 1 3   ? 5.807   -18.413 -14.524 1.00 0.00 ? 3   SER A OG   4  
ATOM 4495  H H    . SER A 1 3   ? 6.581   -16.431 -16.067 1.00 0.00 ? 3   SER A H    4  
ATOM 4496  H HA   . SER A 1 3   ? 3.834   -17.003 -16.866 1.00 0.00 ? 3   SER A HA   4  
ATOM 4497  H HB2  . SER A 1 3   ? 3.792   -18.613 -14.915 1.00 0.00 ? 3   SER A HB2  4  
ATOM 4498  H HB3  . SER A 1 3   ? 4.856   -19.090 -16.223 1.00 0.00 ? 3   SER A HB3  4  
ATOM 4499  H HG   . SER A 1 3   ? 6.594   -18.847 -14.962 1.00 0.00 ? 3   SER A HG   4  
ATOM 4500  N N    . GLY A 1 4   ? 5.006   -15.778 -14.008 1.00 0.00 ? 4   GLY A N    4  
ATOM 4501  C CA   . GLY A 1 4   ? 4.735   -14.843 -12.930 1.00 0.00 ? 4   GLY A CA   4  
ATOM 4502  C C    . GLY A 1 4   ? 5.907   -14.783 -11.948 1.00 0.00 ? 4   GLY A C    4  
ATOM 4503  O O    . GLY A 1 4   ? 7.015   -15.209 -12.271 1.00 0.00 ? 4   GLY A O    4  
ATOM 4504  H H    . GLY A 1 4   ? 5.875   -16.268 -13.934 1.00 0.00 ? 4   GLY A H    4  
ATOM 4505  H HA2  . GLY A 1 4   ? 4.551   -13.851 -13.342 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4506  H HA3  . GLY A 1 4   ? 3.829   -15.142 -12.402 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4507  N N    . SER A 1 5   ? 5.623   -14.252 -10.768 1.00 0.00 ? 5   SER A N    4  
ATOM 4508  C CA   . SER A 1 5   ? 6.639   -14.132 -9.736  1.00 0.00 ? 5   SER A CA   4  
ATOM 4509  C C    . SER A 1 5   ? 6.035   -13.508 -8.477  1.00 0.00 ? 5   SER A C    4  
ATOM 4510  O O    . SER A 1 5   ? 4.961   -12.912 -8.529  1.00 0.00 ? 5   SER A O    4  
ATOM 4511  C CB   . SER A 1 5   ? 7.824   -13.297 -10.226 1.00 0.00 ? 5   SER A CB   4  
ATOM 4512  O OG   . SER A 1 5   ? 9.002   -13.544 -9.463  1.00 0.00 ? 5   SER A OG   4  
ATOM 4513  H H    . SER A 1 5   ? 4.719   -13.909 -10.512 1.00 0.00 ? 5   SER A H    4  
ATOM 4514  H HA   . SER A 1 5   ? 6.971   -15.151 -9.538  1.00 0.00 ? 5   SER A HA   4  
ATOM 4515  H HB2  . SER A 1 5   ? 8.018   -13.523 -11.275 1.00 0.00 ? 5   SER A HB2  4  
ATOM 4516  H HB3  . SER A 1 5   ? 7.570   -12.239 -10.169 1.00 0.00 ? 5   SER A HB3  4  
ATOM 4517  H HG   . SER A 1 5   ? 8.944   -13.074 -8.583  1.00 0.00 ? 5   SER A HG   4  
ATOM 4518  N N    . SER A 1 6   ? 6.753   -13.667 -7.374  1.00 0.00 ? 6   SER A N    4  
ATOM 4519  C CA   . SER A 1 6   ? 6.301   -13.127 -6.103  1.00 0.00 ? 6   SER A CA   4  
ATOM 4520  C C    . SER A 1 6   ? 6.951   -11.765 -5.852  1.00 0.00 ? 6   SER A C    4  
ATOM 4521  O O    . SER A 1 6   ? 8.024   -11.479 -6.382  1.00 0.00 ? 6   SER A O    4  
ATOM 4522  C CB   . SER A 1 6   ? 6.617   -14.086 -4.954  1.00 0.00 ? 6   SER A CB   4  
ATOM 4523  O OG   . SER A 1 6   ? 5.554   -14.153 -4.006  1.00 0.00 ? 6   SER A OG   4  
ATOM 4524  H H    . SER A 1 6   ? 7.626   -14.154 -7.340  1.00 0.00 ? 6   SER A H    4  
ATOM 4525  H HA   . SER A 1 6   ? 5.220   -13.023 -6.201  1.00 0.00 ? 6   SER A HA   4  
ATOM 4526  H HB2  . SER A 1 6   ? 6.809   -15.082 -5.354  1.00 0.00 ? 6   SER A HB2  4  
ATOM 4527  H HB3  . SER A 1 6   ? 7.529   -13.763 -4.452  1.00 0.00 ? 6   SER A HB3  4  
ATOM 4528  H HG   . SER A 1 6   ? 5.907   -13.991 -3.085  1.00 0.00 ? 6   SER A HG   4  
ATOM 4529  N N    . GLY A 1 7   ? 6.275   -10.962 -5.044  1.00 0.00 ? 7   GLY A N    4  
ATOM 4530  C CA   . GLY A 1 7   ? 6.774   -9.637  -4.717  1.00 0.00 ? 7   GLY A CA   4  
ATOM 4531  C C    . GLY A 1 7   ? 6.922   -8.780  -5.976  1.00 0.00 ? 7   GLY A C    4  
ATOM 4532  O O    . GLY A 1 7   ? 7.636   -9.154  -6.905  1.00 0.00 ? 7   GLY A O    4  
ATOM 4533  H H    . GLY A 1 7   ? 5.403   -11.203 -4.618  1.00 0.00 ? 7   GLY A H    4  
ATOM 4534  H HA2  . GLY A 1 7   ? 6.093   -9.150  -4.019  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 4535  H HA3  . GLY A 1 7   ? 7.738   -9.721  -4.215  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 4536  N N    . GLU A 1 8   ? 6.235   -7.647  -5.966  1.00 0.00 ? 8   GLU A N    4  
ATOM 4537  C CA   . GLU A 1 8   ? 6.281   -6.734  -7.095  1.00 0.00 ? 8   GLU A CA   4  
ATOM 4538  C C    . GLU A 1 8   ? 5.840   -5.334  -6.664  1.00 0.00 ? 8   GLU A C    4  
ATOM 4539  O O    . GLU A 1 8   ? 4.790   -5.173  -6.045  1.00 0.00 ? 8   GLU A O    4  
ATOM 4540  C CB   . GLU A 1 8   ? 5.420   -7.248  -8.251  1.00 0.00 ? 8   GLU A CB   4  
ATOM 4541  C CG   . GLU A 1 8   ? 5.288   -6.191  -9.349  1.00 0.00 ? 8   GLU A CG   4  
ATOM 4542  C CD   . GLU A 1 8   ? 6.581   -6.077  -10.160 1.00 0.00 ? 8   GLU A CD   4  
ATOM 4543  O OE1  . GLU A 1 8   ? 7.521   -5.436  -9.642  1.00 0.00 ? 8   GLU A OE1  4  
ATOM 4544  O OE2  . GLU A 1 8   ? 6.599   -6.634  -11.279 1.00 0.00 ? 8   GLU A OE2  4  
ATOM 4545  H H    . GLU A 1 8   ? 5.657   -7.351  -5.206  1.00 0.00 ? 8   GLU A H    4  
ATOM 4546  H HA   . GLU A 1 8   ? 7.325   -6.713  -7.409  1.00 0.00 ? 8   GLU A HA   4  
ATOM 4547  H HB2  . GLU A 1 8   ? 5.864   -8.154  -8.665  1.00 0.00 ? 8   GLU A HB2  4  
ATOM 4548  H HB3  . GLU A 1 8   ? 4.432   -7.519  -7.881  1.00 0.00 ? 8   GLU A HB3  4  
ATOM 4549  H HG2  . GLU A 1 8   ? 4.461   -6.449  -10.010 1.00 0.00 ? 8   GLU A HG2  4  
ATOM 4550  H HG3  . GLU A 1 8   ? 5.049   -5.226  -8.902  1.00 0.00 ? 8   GLU A HG3  4  
ATOM 4551  N N    . VAL A 1 9   ? 6.666   -4.356  -7.008  1.00 0.00 ? 9   VAL A N    4  
ATOM 4552  C CA   . VAL A 1 9   ? 6.374   -2.975  -6.664  1.00 0.00 ? 9   VAL A CA   4  
ATOM 4553  C C    . VAL A 1 9   ? 5.314   -2.428  -7.622  1.00 0.00 ? 9   VAL A C    4  
ATOM 4554  O O    . VAL A 1 9   ? 5.433   -2.579  -8.837  1.00 0.00 ? 9   VAL A O    4  
ATOM 4555  C CB   . VAL A 1 9   ? 7.664   -2.152  -6.668  1.00 0.00 ? 9   VAL A CB   4  
ATOM 4556  C CG1  . VAL A 1 9   ? 7.357   -0.653  -6.689  1.00 0.00 ? 9   VAL A CG1  4  
ATOM 4557  C CG2  . VAL A 1 9   ? 8.548   -2.513  -5.473  1.00 0.00 ? 9   VAL A CG2  4  
ATOM 4558  H H    . VAL A 1 9   ? 7.518   -4.496  -7.512  1.00 0.00 ? 9   VAL A H    4  
ATOM 4559  H HA   . VAL A 1 9   ? 5.971   -2.966  -5.652  1.00 0.00 ? 9   VAL A HA   4  
ATOM 4560  H HB   . VAL A 1 9   ? 8.214   -2.394  -7.577  1.00 0.00 ? 9   VAL A HB   4  
ATOM 4561  H HG11 . VAL A 1 9   ? 7.882   -0.163  -5.869  1.00 0.00 ? 9   VAL A HG11 4  
ATOM 4562  H HG12 . VAL A 1 9   ? 7.688   -0.228  -7.637  1.00 0.00 ? 9   VAL A HG12 4  
ATOM 4563  H HG13 . VAL A 1 9   ? 6.284   -0.500  -6.577  1.00 0.00 ? 9   VAL A HG13 4  
ATOM 4564  H HG21 . VAL A 1 9   ? 9.579   -2.231  -5.685  1.00 0.00 ? 9   VAL A HG21 4  
ATOM 4565  H HG22 . VAL A 1 9   ? 8.200   -1.979  -4.588  1.00 0.00 ? 9   VAL A HG22 4  
ATOM 4566  H HG23 . VAL A 1 9   ? 8.495   -3.587  -5.293  1.00 0.00 ? 9   VAL A HG23 4  
ATOM 4567  N N    . ARG A 1 10  ? 4.300   -1.806  -7.039  1.00 0.00 ? 10  ARG A N    4  
ATOM 4568  C CA   . ARG A 1 10  ? 3.219   -1.236  -7.826  1.00 0.00 ? 10  ARG A CA   4  
ATOM 4569  C C    . ARG A 1 10  ? 3.376   0.283   -7.922  1.00 0.00 ? 10  ARG A C    4  
ATOM 4570  O O    . ARG A 1 10  ? 4.204   0.870   -7.228  1.00 0.00 ? 10  ARG A O    4  
ATOM 4571  C CB   . ARG A 1 10  ? 1.858   -1.563  -7.209  1.00 0.00 ? 10  ARG A CB   4  
ATOM 4572  C CG   . ARG A 1 10  ? 1.684   -0.861  -5.860  1.00 0.00 ? 10  ARG A CG   4  
ATOM 4573  C CD   . ARG A 1 10  ? 0.452   -1.389  -5.122  1.00 0.00 ? 10  ARG A CD   4  
ATOM 4574  N NE   . ARG A 1 10  ? 0.869   -2.264  -4.004  1.00 0.00 ? 10  ARG A NE   4  
ATOM 4575  C CZ   . ARG A 1 10  ? 0.016   -2.904  -3.193  1.00 0.00 ? 10  ARG A CZ   4  
ATOM 4576  N NH1  . ARG A 1 10  ? -1.306  -2.770  -3.371  1.00 0.00 ? 10  ARG A NH1  4  
ATOM 4577  N NH2  . ARG A 1 10  ? 0.484   -3.677  -2.204  1.00 0.00 ? 10  ARG A NH2  4  
ATOM 4578  H H    . ARG A 1 10  ? 4.210   -1.688  -6.050  1.00 0.00 ? 10  ARG A H    4  
ATOM 4579  H HA   . ARG A 1 10  ? 3.312   -1.703  -8.806  1.00 0.00 ? 10  ARG A HA   4  
ATOM 4580  H HB2  . ARG A 1 10  ? 1.063   -1.254  -7.888  1.00 0.00 ? 10  ARG A HB2  4  
ATOM 4581  H HB3  . ARG A 1 10  ? 1.763   -2.641  -7.076  1.00 0.00 ? 10  ARG A HB3  4  
ATOM 4582  H HG2  . ARG A 1 10  ? 2.573   -1.015  -5.249  1.00 0.00 ? 10  ARG A HG2  4  
ATOM 4583  H HG3  . ARG A 1 10  ? 1.587   0.214   -6.015  1.00 0.00 ? 10  ARG A HG3  4  
ATOM 4584  H HD2  . ARG A 1 10  ? -0.139  -0.555  -4.742  1.00 0.00 ? 10  ARG A HD2  4  
ATOM 4585  H HD3  . ARG A 1 10  ? -0.185  -1.943  -5.811  1.00 0.00 ? 10  ARG A HD3  4  
ATOM 4586  H HE   . ARG A 1 10  ? 1.848   -2.385  -3.843  1.00 0.00 ? 10  ARG A HE   4  
ATOM 4587  H HH11 . ARG A 1 10  ? -1.655  -2.193  -4.109  1.00 0.00 ? 10  ARG A HH11 4  
ATOM 4588  H HH12 . ARG A 1 10  ? -1.943  -3.248  -2.765  1.00 0.00 ? 10  ARG A HH12 4  
ATOM 4589  H HH21 . ARG A 1 10  ? 1.470   -3.777  -2.071  1.00 0.00 ? 10  ARG A HH21 4  
ATOM 4590  H HH22 . ARG A 1 10  ? -0.153  -4.155  -1.598  1.00 0.00 ? 10  ARG A HH22 4  
ATOM 4591  N N    . LEU A 1 11  ? 2.569   0.875   -8.789  1.00 0.00 ? 11  LEU A N    4  
ATOM 4592  C CA   . LEU A 1 11  ? 2.608   2.314   -8.986  1.00 0.00 ? 11  LEU A CA   4  
ATOM 4593  C C    . LEU A 1 11  ? 1.217   2.898   -8.729  1.00 0.00 ? 11  LEU A C    4  
ATOM 4594  O O    . LEU A 1 11  ? 0.333   2.803   -9.580  1.00 0.00 ? 11  LEU A O    4  
ATOM 4595  C CB   . LEU A 1 11  ? 3.170   2.651   -10.368 1.00 0.00 ? 11  LEU A CB   4  
ATOM 4596  C CG   . LEU A 1 11  ? 4.638   2.287   -10.602 1.00 0.00 ? 11  LEU A CG   4  
ATOM 4597  C CD1  . LEU A 1 11  ? 5.104   2.750   -11.984 1.00 0.00 ? 11  LEU A CD1  4  
ATOM 4598  C CD2  . LEU A 1 11  ? 5.524   2.839   -9.484  1.00 0.00 ? 11  LEU A CD2  4  
ATOM 4599  H H    . LEU A 1 11  ? 1.898   0.390   -9.350  1.00 0.00 ? 11  LEU A H    4  
ATOM 4600  H HA   . LEU A 1 11  ? 3.297   2.726   -8.249  1.00 0.00 ? 11  LEU A HA   4  
ATOM 4601  H HB2  . LEU A 1 11  ? 2.566   2.141   -11.119 1.00 0.00 ? 11  LEU A HB2  4  
ATOM 4602  H HB3  . LEU A 1 11  ? 3.051   3.721   -10.536 1.00 0.00 ? 11  LEU A HB3  4  
ATOM 4603  H HG   . LEU A 1 11  ? 4.729   1.201   -10.578 1.00 0.00 ? 11  LEU A HG   4  
ATOM 4604  H HD11 . LEU A 1 11  ? 5.097   3.839   -12.024 1.00 0.00 ? 11  LEU A HD11 4  
ATOM 4605  H HD12 . LEU A 1 11  ? 6.115   2.386   -12.167 1.00 0.00 ? 11  LEU A HD12 4  
ATOM 4606  H HD13 . LEU A 1 11  ? 4.432   2.353   -12.745 1.00 0.00 ? 11  LEU A HD13 4  
ATOM 4607  H HD21 . LEU A 1 11  ? 6.571   2.764   -9.779  1.00 0.00 ? 11  LEU A HD21 4  
ATOM 4608  H HD22 . LEU A 1 11  ? 5.272   3.884   -9.303  1.00 0.00 ? 11  LEU A HD22 4  
ATOM 4609  H HD23 . LEU A 1 11  ? 5.361   2.263   -8.573  1.00 0.00 ? 11  LEU A HD23 4  
ATOM 4610  N N    . VAL A 1 12  ? 1.066   3.488   -7.553  1.00 0.00 ? 12  VAL A N    4  
ATOM 4611  C CA   . VAL A 1 12  ? -0.203  4.087   -7.174  1.00 0.00 ? 12  VAL A CA   4  
ATOM 4612  C C    . VAL A 1 12  ? -0.178  5.579   -7.510  1.00 0.00 ? 12  VAL A C    4  
ATOM 4613  O O    . VAL A 1 12  ? 0.843   6.242   -7.334  1.00 0.00 ? 12  VAL A O    4  
ATOM 4614  C CB   . VAL A 1 12  ? -0.490  3.812   -5.696  1.00 0.00 ? 12  VAL A CB   4  
ATOM 4615  C CG1  . VAL A 1 12  ? -1.736  4.569   -5.230  1.00 0.00 ? 12  VAL A CG1  4  
ATOM 4616  C CG2  . VAL A 1 12  ? -0.631  2.311   -5.435  1.00 0.00 ? 12  VAL A CG2  4  
ATOM 4617  H H    . VAL A 1 12  ? 1.789   3.561   -6.866  1.00 0.00 ? 12  VAL A H    4  
ATOM 4618  H HA   . VAL A 1 12  ? -0.983  3.607   -7.764  1.00 0.00 ? 12  VAL A HA   4  
ATOM 4619  H HB   . VAL A 1 12  ? 0.359   4.174   -5.116  1.00 0.00 ? 12  VAL A HB   4  
ATOM 4620  H HG11 . VAL A 1 12  ? -1.450  5.318   -4.491  1.00 0.00 ? 12  VAL A HG11 4  
ATOM 4621  H HG12 . VAL A 1 12  ? -2.203  5.059   -6.083  1.00 0.00 ? 12  VAL A HG12 4  
ATOM 4622  H HG13 . VAL A 1 12  ? -2.440  3.868   -4.782  1.00 0.00 ? 12  VAL A HG13 4  
ATOM 4623  H HG21 . VAL A 1 12  ? -0.029  2.034   -4.569  1.00 0.00 ? 12  VAL A HG21 4  
ATOM 4624  H HG22 . VAL A 1 12  ? -1.677  2.072   -5.242  1.00 0.00 ? 12  VAL A HG22 4  
ATOM 4625  H HG23 . VAL A 1 12  ? -0.287  1.756   -6.308  1.00 0.00 ? 12  VAL A HG23 4  
ATOM 4626  N N    . SER A 1 13  ? -1.315  6.064   -7.988  1.00 0.00 ? 13  SER A N    4  
ATOM 4627  C CA   . SER A 1 13  ? -1.437  7.466   -8.350  1.00 0.00 ? 13  SER A CA   4  
ATOM 4628  C C    . SER A 1 13  ? -2.673  8.073   -7.684  1.00 0.00 ? 13  SER A C    4  
ATOM 4629  O O    . SER A 1 13  ? -3.790  7.604   -7.895  1.00 0.00 ? 13  SER A O    4  
ATOM 4630  C CB   . SER A 1 13  ? -1.514  7.637   -9.869  1.00 0.00 ? 13  SER A CB   4  
ATOM 4631  O OG   . SER A 1 13  ? -2.824  7.382   -10.369 1.00 0.00 ? 13  SER A OG   4  
ATOM 4632  H H    . SER A 1 13  ? -2.141  5.518   -8.128  1.00 0.00 ? 13  SER A H    4  
ATOM 4633  H HA   . SER A 1 13  ? -0.529  7.940   -7.978  1.00 0.00 ? 13  SER A HA   4  
ATOM 4634  H HB2  . SER A 1 13  ? -1.216  8.651   -10.135 1.00 0.00 ? 13  SER A HB2  4  
ATOM 4635  H HB3  . SER A 1 13  ? -0.806  6.961   -10.347 1.00 0.00 ? 13  SER A HB3  4  
ATOM 4636  H HG   . SER A 1 13  ? -2.771  7.030   -11.303 1.00 0.00 ? 13  SER A HG   4  
ATOM 4637  N N    . LEU A 1 14  ? -2.431  9.108   -6.892  1.00 0.00 ? 14  LEU A N    4  
ATOM 4638  C CA   . LEU A 1 14  ? -3.510  9.784   -6.194  1.00 0.00 ? 14  LEU A CA   4  
ATOM 4639  C C    . LEU A 1 14  ? -3.652  11.207  -6.739  1.00 0.00 ? 14  LEU A C    4  
ATOM 4640  O O    . LEU A 1 14  ? -2.675  11.950  -6.806  1.00 0.00 ? 14  LEU A O    4  
ATOM 4641  C CB   . LEU A 1 14  ? -3.289  9.725   -4.681  1.00 0.00 ? 14  LEU A CB   4  
ATOM 4642  C CG   . LEU A 1 14  ? -3.724  8.431   -3.990  1.00 0.00 ? 14  LEU A CG   4  
ATOM 4643  C CD1  . LEU A 1 14  ? -5.211  8.159   -4.220  1.00 0.00 ? 14  LEU A CD1  4  
ATOM 4644  C CD2  . LEU A 1 14  ? -2.851  7.254   -4.431  1.00 0.00 ? 14  LEU A CD2  4  
ATOM 4645  H H    . LEU A 1 14  ? -1.519  9.483   -6.726  1.00 0.00 ? 14  LEU A H    4  
ATOM 4646  H HA   . LEU A 1 14  ? -4.430  9.239   -6.407  1.00 0.00 ? 14  LEU A HA   4  
ATOM 4647  H HB2  . LEU A 1 14  ? -2.229  9.882   -4.482  1.00 0.00 ? 14  LEU A HB2  4  
ATOM 4648  H HB3  . LEU A 1 14  ? -3.826  10.556  -4.223  1.00 0.00 ? 14  LEU A HB3  4  
ATOM 4649  H HG   . LEU A 1 14  ? -3.581  8.552   -2.916  1.00 0.00 ? 14  LEU A HG   4  
ATOM 4650  H HD11 . LEU A 1 14  ? -5.633  8.949   -4.842  1.00 0.00 ? 14  LEU A HD11 4  
ATOM 4651  H HD12 . LEU A 1 14  ? -5.332  7.198   -4.721  1.00 0.00 ? 14  LEU A HD12 4  
ATOM 4652  H HD13 . LEU A 1 14  ? -5.729  8.136   -3.261  1.00 0.00 ? 14  LEU A HD13 4  
ATOM 4653  H HD21 . LEU A 1 14  ? -2.313  6.858   -3.570  1.00 0.00 ? 14  LEU A HD21 4  
ATOM 4654  H HD22 . LEU A 1 14  ? -3.482  6.474   -4.857  1.00 0.00 ? 14  LEU A HD22 4  
ATOM 4655  H HD23 . LEU A 1 14  ? -2.136  7.593   -5.182  1.00 0.00 ? 14  LEU A HD23 4  
ATOM 4656  N N    . ARG A 1 15  ? -4.878  11.543  -7.115  1.00 0.00 ? 15  ARG A N    4  
ATOM 4657  C CA   . ARG A 1 15  ? -5.161  12.863  -7.652  1.00 0.00 ? 15  ARG A CA   4  
ATOM 4658  C C    . ARG A 1 15  ? -5.417  13.855  -6.515  1.00 0.00 ? 15  ARG A C    4  
ATOM 4659  O O    . ARG A 1 15  ? -5.612  13.454  -5.369  1.00 0.00 ? 15  ARG A O    4  
ATOM 4660  C CB   . ARG A 1 15  ? -6.379  12.832  -8.577  1.00 0.00 ? 15  ARG A CB   4  
ATOM 4661  C CG   . ARG A 1 15  ? -7.677  12.750  -7.771  1.00 0.00 ? 15  ARG A CG   4  
ATOM 4662  C CD   . ARG A 1 15  ? -8.897  12.758  -8.694  1.00 0.00 ? 15  ARG A CD   4  
ATOM 4663  N NE   . ARG A 1 15  ? -9.817  11.659  -8.326  1.00 0.00 ? 15  ARG A NE   4  
ATOM 4664  C CZ   . ARG A 1 15  ? -11.018 11.464  -8.889  1.00 0.00 ? 15  ARG A CZ   4  
ATOM 4665  N NH1  . ARG A 1 15  ? -11.451 12.293  -9.848  1.00 0.00 ? 15  ARG A NH1  4  
ATOM 4666  N NH2  . ARG A 1 15  ? -11.785 10.440  -8.492  1.00 0.00 ? 15  ARG A NH2  4  
ATOM 4667  H H    . ARG A 1 15  ? -5.668  10.932  -7.057  1.00 0.00 ? 15  ARG A H    4  
ATOM 4668  H HA   . ARG A 1 15  ? -4.266  13.132  -8.214  1.00 0.00 ? 15  ARG A HA   4  
ATOM 4669  H HB2  . ARG A 1 15  ? -6.390  13.725  -9.200  1.00 0.00 ? 15  ARG A HB2  4  
ATOM 4670  H HB3  . ARG A 1 15  ? -6.309  11.976  -9.248  1.00 0.00 ? 15  ARG A HB3  4  
ATOM 4671  H HG2  . ARG A 1 15  ? -7.679  11.842  -7.168  1.00 0.00 ? 15  ARG A HG2  4  
ATOM 4672  H HG3  . ARG A 1 15  ? -7.734  13.591  -7.080  1.00 0.00 ? 15  ARG A HG3  4  
ATOM 4673  H HD2  . ARG A 1 15  ? -9.413  13.715  -8.620  1.00 0.00 ? 15  ARG A HD2  4  
ATOM 4674  H HD3  . ARG A 1 15  ? -8.580  12.646  -9.731  1.00 0.00 ? 15  ARG A HD3  4  
ATOM 4675  H HE   . ARG A 1 15  ? -9.525  11.021  -7.613  1.00 0.00 ? 15  ARG A HE   4  
ATOM 4676  H HH11 . ARG A 1 15  ? -10.878 13.058  -10.144 1.00 0.00 ? 15  ARG A HH11 4  
ATOM 4677  H HH12 . ARG A 1 15  ? -12.347 12.148  -10.268 1.00 0.00 ? 15  ARG A HH12 4  
ATOM 4678  H HH21 . ARG A 1 15  ? -11.462 9.821   -7.776  1.00 0.00 ? 15  ARG A HH21 4  
ATOM 4679  H HH22 . ARG A 1 15  ? -12.681 10.294  -8.912  1.00 0.00 ? 15  ARG A HH22 4  
ATOM 4680  N N    . ARG A 1 16  ? -5.407  15.130  -6.873  1.00 0.00 ? 16  ARG A N    4  
ATOM 4681  C CA   . ARG A 1 16  ? -5.635  16.183  -5.898  1.00 0.00 ? 16  ARG A CA   4  
ATOM 4682  C C    . ARG A 1 16  ? -6.867  15.861  -5.048  1.00 0.00 ? 16  ARG A C    4  
ATOM 4683  O O    . ARG A 1 16  ? -7.761  15.142  -5.492  1.00 0.00 ? 16  ARG A O    4  
ATOM 4684  C CB   . ARG A 1 16  ? -5.837  17.535  -6.584  1.00 0.00 ? 16  ARG A CB   4  
ATOM 4685  C CG   . ARG A 1 16  ? -5.527  18.688  -5.625  1.00 0.00 ? 16  ARG A CG   4  
ATOM 4686  C CD   . ARG A 1 16  ? -5.898  20.034  -6.250  1.00 0.00 ? 16  ARG A CD   4  
ATOM 4687  N NE   . ARG A 1 16  ? -5.044  20.298  -7.429  1.00 0.00 ? 16  ARG A NE   4  
ATOM 4688  C CZ   . ARG A 1 16  ? -5.099  21.419  -8.161  1.00 0.00 ? 16  ARG A CZ   4  
ATOM 4689  N NH1  . ARG A 1 16  ? -5.967  22.388  -7.839  1.00 0.00 ? 16  ARG A NH1  4  
ATOM 4690  N NH2  . ARG A 1 16  ? -4.285  21.572  -9.215  1.00 0.00 ? 16  ARG A NH2  4  
ATOM 4691  H H    . ARG A 1 16  ? -5.247  15.448  -7.808  1.00 0.00 ? 16  ARG A H    4  
ATOM 4692  H HA   . ARG A 1 16  ? -4.732  16.199  -5.288  1.00 0.00 ? 16  ARG A HA   4  
ATOM 4693  H HB2  . ARG A 1 16  ? -5.192  17.603  -7.459  1.00 0.00 ? 16  ARG A HB2  4  
ATOM 4694  H HB3  . ARG A 1 16  ? -6.864  17.618  -6.938  1.00 0.00 ? 16  ARG A HB3  4  
ATOM 4695  H HG2  . ARG A 1 16  ? -6.079  18.550  -4.695  1.00 0.00 ? 16  ARG A HG2  4  
ATOM 4696  H HG3  . ARG A 1 16  ? -4.467  18.680  -5.372  1.00 0.00 ? 16  ARG A HG3  4  
ATOM 4697  H HD2  . ARG A 1 16  ? -6.948  20.032  -6.543  1.00 0.00 ? 16  ARG A HD2  4  
ATOM 4698  H HD3  . ARG A 1 16  ? -5.775  20.831  -5.516  1.00 0.00 ? 16  ARG A HD3  4  
ATOM 4699  H HE   . ARG A 1 16  ? -4.385  19.595  -7.698  1.00 0.00 ? 16  ARG A HE   4  
ATOM 4700  H HH11 . ARG A 1 16  ? -6.574  22.274  -7.052  1.00 0.00 ? 16  ARG A HH11 4  
ATOM 4701  H HH12 . ARG A 1 16  ? -6.007  23.225  -8.385  1.00 0.00 ? 16  ARG A HH12 4  
ATOM 4702  H HH21 . ARG A 1 16  ? -3.638  20.849  -9.456  1.00 0.00 ? 16  ARG A HH21 4  
ATOM 4703  H HH22 . ARG A 1 16  ? -4.326  22.408  -9.761  1.00 0.00 ? 16  ARG A HH22 4  
ATOM 4704  N N    . ALA A 1 17  ? -6.874  16.409  -3.842  1.00 0.00 ? 17  ALA A N    4  
ATOM 4705  C CA   . ALA A 1 17  ? -7.981  16.189  -2.927  1.00 0.00 ? 17  ALA A CA   4  
ATOM 4706  C C    . ALA A 1 17  ? -7.892  17.192  -1.775  1.00 0.00 ? 17  ALA A C    4  
ATOM 4707  O O    . ALA A 1 17  ? -8.803  17.993  -1.573  1.00 0.00 ? 17  ALA A O    4  
ATOM 4708  C CB   . ALA A 1 17  ? -7.960  14.739  -2.439  1.00 0.00 ? 17  ALA A CB   4  
ATOM 4709  H H    . ALA A 1 17  ? -6.143  16.992  -3.488  1.00 0.00 ? 17  ALA A H    4  
ATOM 4710  H HA   . ALA A 1 17  ? -8.906  16.361  -3.477  1.00 0.00 ? 17  ALA A HA   4  
ATOM 4711  H HB1  . ALA A 1 17  ? -8.478  14.669  -1.483  1.00 0.00 ? 17  ALA A HB1  4  
ATOM 4712  H HB2  . ALA A 1 17  ? -8.460  14.103  -3.170  1.00 0.00 ? 17  ALA A HB2  4  
ATOM 4713  H HB3  . ALA A 1 17  ? -6.928  14.411  -2.318  1.00 0.00 ? 17  ALA A HB3  4  
ATOM 4714  N N    . LYS A 1 18  ? -6.785  17.116  -1.050  1.00 0.00 ? 18  LYS A N    4  
ATOM 4715  C CA   . LYS A 1 18  ? -6.565  18.007  0.076   1.00 0.00 ? 18  LYS A CA   4  
ATOM 4716  C C    . LYS A 1 18  ? -5.439  18.985  -0.266  1.00 0.00 ? 18  LYS A C    4  
ATOM 4717  O O    . LYS A 1 18  ? -5.412  20.107  0.239   1.00 0.00 ? 18  LYS A O    4  
ATOM 4718  C CB   . LYS A 1 18  ? -6.315  17.204  1.354   1.00 0.00 ? 18  LYS A CB   4  
ATOM 4719  C CG   . LYS A 1 18  ? -6.567  18.060  2.597   1.00 0.00 ? 18  LYS A CG   4  
ATOM 4720  C CD   . LYS A 1 18  ? -7.546  17.370  3.549   1.00 0.00 ? 18  LYS A CD   4  
ATOM 4721  C CE   . LYS A 1 18  ? -6.998  17.347  4.977   1.00 0.00 ? 18  LYS A CE   4  
ATOM 4722  N NZ   . LYS A 1 18  ? -8.105  17.242  5.955   1.00 0.00 ? 18  LYS A NZ   4  
ATOM 4723  H H    . LYS A 1 18  ? -6.049  16.461  -1.221  1.00 0.00 ? 18  LYS A H    4  
ATOM 4724  H HA   . LYS A 1 18  ? -7.483  18.576  0.227   1.00 0.00 ? 18  LYS A HA   4  
ATOM 4725  H HB2  . LYS A 1 18  ? -6.965  16.330  1.372   1.00 0.00 ? 18  LYS A HB2  4  
ATOM 4726  H HB3  . LYS A 1 18  ? -5.289  16.838  1.362   1.00 0.00 ? 18  LYS A HB3  4  
ATOM 4727  H HG2  . LYS A 1 18  ? -5.624  18.246  3.112   1.00 0.00 ? 18  LYS A HG2  4  
ATOM 4728  H HG3  . LYS A 1 18  ? -6.965  19.030  2.300   1.00 0.00 ? 18  LYS A HG3  4  
ATOM 4729  H HD2  . LYS A 1 18  ? -8.504  17.890  3.531   1.00 0.00 ? 18  LYS A HD2  4  
ATOM 4730  H HD3  . LYS A 1 18  ? -7.731  16.350  3.210   1.00 0.00 ? 18  LYS A HD3  4  
ATOM 4731  H HE2  . LYS A 1 18  ? -6.317  16.504  5.098   1.00 0.00 ? 18  LYS A HE2  4  
ATOM 4732  H HE3  . LYS A 1 18  ? -6.422  18.252  5.167   1.00 0.00 ? 18  LYS A HE3  4  
ATOM 4733  H HZ1  . LYS A 1 18  ? -7.733  17.020  6.856   1.00 0.00 ? 18  LYS A HZ1  4  
ATOM 4734  H HZ2  . LYS A 1 18  ? -8.593  18.113  6.000   1.00 0.00 ? 18  LYS A HZ2  4  
ATOM 4735  H HZ3  . LYS A 1 18  ? -8.736  16.521  5.668   1.00 0.00 ? 18  LYS A HZ3  4  
ATOM 4736  N N    . ALA A 1 19  ? -4.538  18.525  -1.121  1.00 0.00 ? 19  ALA A N    4  
ATOM 4737  C CA   . ALA A 1 19  ? -3.413  19.345  -1.537  1.00 0.00 ? 19  ALA A CA   4  
ATOM 4738  C C    . ALA A 1 19  ? -2.320  19.284  -0.467  1.00 0.00 ? 19  ALA A C    4  
ATOM 4739  O O    . ALA A 1 19  ? -1.288  18.645  -0.665  1.00 0.00 ? 19  ALA A O    4  
ATOM 4740  C CB   . ALA A 1 19  ? -3.892  20.775  -1.799  1.00 0.00 ? 19  ALA A CB   4  
ATOM 4741  H H    . ALA A 1 19  ? -4.568  17.612  -1.527  1.00 0.00 ? 19  ALA A H    4  
ATOM 4742  H HA   . ALA A 1 19  ? -3.024  18.930  -2.466  1.00 0.00 ? 19  ALA A HA   4  
ATOM 4743  H HB1  . ALA A 1 19  ? -3.754  21.375  -0.899  1.00 0.00 ? 19  ALA A HB1  4  
ATOM 4744  H HB2  . ALA A 1 19  ? -3.315  21.207  -2.616  1.00 0.00 ? 19  ALA A HB2  4  
ATOM 4745  H HB3  . ALA A 1 19  ? -4.948  20.760  -2.067  1.00 0.00 ? 19  ALA A HB3  4  
ATOM 4746  N N    . HIS A 1 20  ? -2.585  19.957  0.643   1.00 0.00 ? 20  HIS A N    4  
ATOM 4747  C CA   . HIS A 1 20  ? -1.637  19.987  1.744   1.00 0.00 ? 20  HIS A CA   4  
ATOM 4748  C C    . HIS A 1 20  ? -1.643  18.636  2.463   1.00 0.00 ? 20  HIS A C    4  
ATOM 4749  O O    . HIS A 1 20  ? -2.315  18.474  3.481   1.00 0.00 ? 20  HIS A O    4  
ATOM 4750  C CB   . HIS A 1 20  ? -1.930  21.159  2.682   1.00 0.00 ? 20  HIS A CB   4  
ATOM 4751  C CG   . HIS A 1 20  ? -3.097  20.925  3.611   1.00 0.00 ? 20  HIS A CG   4  
ATOM 4752  N ND1  . HIS A 1 20  ? -4.388  20.716  3.156   1.00 0.00 ? 20  HIS A ND1  4  
ATOM 4753  C CD2  . HIS A 1 20  ? -3.155  20.869  4.972   1.00 0.00 ? 20  HIS A CD2  4  
ATOM 4754  C CE1  . HIS A 1 20  ? -5.178  20.544  4.205   1.00 0.00 ? 20  HIS A CE1  4  
ATOM 4755  N NE2  . HIS A 1 20  ? -4.413  20.639  5.330   1.00 0.00 ? 20  HIS A NE2  4  
ATOM 4756  H H    . HIS A 1 20  ? -3.427  20.474  0.796   1.00 0.00 ? 20  HIS A H    4  
ATOM 4757  H HA   . HIS A 1 20  ? -0.653  20.150  1.305   1.00 0.00 ? 20  HIS A HA   4  
ATOM 4758  H HB2  . HIS A 1 20  ? -1.041  21.366  3.277   1.00 0.00 ? 20  HIS A HB2  4  
ATOM 4759  H HB3  . HIS A 1 20  ? -2.128  22.049  2.084   1.00 0.00 ? 20  HIS A HB3  4  
ATOM 4760  H HD1  . HIS A 1 20  ? -4.674  20.699  2.198   1.00 0.00 ? 20  HIS A HD1  4  
ATOM 4761  H HD2  . HIS A 1 20  ? -2.311  20.991  5.652   1.00 0.00 ? 20  HIS A HD2  4  
ATOM 4762  H HE1  . HIS A 1 20  ? -6.252  20.358  4.175   1.00 0.00 ? 20  HIS A HE1  4  
ATOM 4763  N N    . GLU A 1 21  ? -0.887  17.702  1.906   1.00 0.00 ? 21  GLU A N    4  
ATOM 4764  C CA   . GLU A 1 21  ? -0.797  16.371  2.481   1.00 0.00 ? 21  GLU A CA   4  
ATOM 4765  C C    . GLU A 1 21  ? -2.196  15.796  2.712   1.00 0.00 ? 21  GLU A C    4  
ATOM 4766  O O    . GLU A 1 21  ? -2.840  16.104  3.714   1.00 0.00 ? 21  GLU A O    4  
ATOM 4767  C CB   . GLU A 1 21  ? 0.010   16.389  3.781   1.00 0.00 ? 21  GLU A CB   4  
ATOM 4768  C CG   . GLU A 1 21  ? 0.675   15.034  4.033   1.00 0.00 ? 21  GLU A CG   4  
ATOM 4769  C CD   . GLU A 1 21  ? -0.280  14.080  4.753   1.00 0.00 ? 21  GLU A CD   4  
ATOM 4770  O OE1  . GLU A 1 21  ? -0.356  14.184  5.996   1.00 0.00 ? 21  GLU A OE1  4  
ATOM 4771  O OE2  . GLU A 1 21  ? -0.913  13.268  4.044   1.00 0.00 ? 21  GLU A OE2  4  
ATOM 4772  H H    . GLU A 1 21  ? -0.344  17.842  1.078   1.00 0.00 ? 21  GLU A H    4  
ATOM 4773  H HA   . GLU A 1 21  ? -0.268  15.770  1.741   1.00 0.00 ? 21  GLU A HA   4  
ATOM 4774  H HB2  . GLU A 1 21  ? 0.771   17.167  3.730   1.00 0.00 ? 21  GLU A HB2  4  
ATOM 4775  H HB3  . GLU A 1 21  ? -0.645  16.637  4.616   1.00 0.00 ? 21  GLU A HB3  4  
ATOM 4776  H HG2  . GLU A 1 21  ? 0.986   14.596  3.084   1.00 0.00 ? 21  GLU A HG2  4  
ATOM 4777  H HG3  . GLU A 1 21  ? 1.576   15.172  4.630   1.00 0.00 ? 21  GLU A HG3  4  
ATOM 4778  N N    . GLY A 1 22  ? -2.625  14.971  1.768   1.00 0.00 ? 22  GLY A N    4  
ATOM 4779  C CA   . GLY A 1 22  ? -3.936  14.351  1.856   1.00 0.00 ? 22  GLY A CA   4  
ATOM 4780  C C    . GLY A 1 22  ? -4.341  13.732  0.517   1.00 0.00 ? 22  GLY A C    4  
ATOM 4781  O O    . GLY A 1 22  ? -5.099  14.331  -0.244  1.00 0.00 ? 22  GLY A O    4  
ATOM 4782  H H    . GLY A 1 22  ? -2.095  14.726  0.956   1.00 0.00 ? 22  GLY A H    4  
ATOM 4783  H HA2  . GLY A 1 22  ? -3.927  13.582  2.628   1.00 0.00 ? 22  GLY A HA2  4  
ATOM 4784  H HA3  . GLY A 1 22  ? -4.675  15.095  2.155   1.00 0.00 ? 22  GLY A HA3  4  
ATOM 4785  N N    . LEU A 1 23  ? -3.817  12.541  0.269   1.00 0.00 ? 23  LEU A N    4  
ATOM 4786  C CA   . LEU A 1 23  ? -4.114  11.834  -0.965  1.00 0.00 ? 23  LEU A CA   4  
ATOM 4787  C C    . LEU A 1 23  ? -5.017  10.638  -0.658  1.00 0.00 ? 23  LEU A C    4  
ATOM 4788  O O    . LEU A 1 23  ? -5.055  9.673   -1.420  1.00 0.00 ? 23  LEU A O    4  
ATOM 4789  C CB   . LEU A 1 23  ? -2.822  11.458  -1.692  1.00 0.00 ? 23  LEU A CB   4  
ATOM 4790  C CG   . LEU A 1 23  ? -1.565  12.218  -1.262  1.00 0.00 ? 23  LEU A CG   4  
ATOM 4791  C CD1  . LEU A 1 23  ? -0.301  11.435  -1.622  1.00 0.00 ? 23  LEU A CD1  4  
ATOM 4792  C CD2  . LEU A 1 23  ? -1.550  13.631  -1.848  1.00 0.00 ? 23  LEU A CD2  4  
ATOM 4793  H H    . LEU A 1 23  ? -3.201  12.060  0.893   1.00 0.00 ? 23  LEU A H    4  
ATOM 4794  H HA   . LEU A 1 23  ? -4.660  12.521  -1.612  1.00 0.00 ? 23  LEU A HA   4  
ATOM 4795  H HB2  . LEU A 1 23  ? -2.645  10.392  -1.550  1.00 0.00 ? 23  LEU A HB2  4  
ATOM 4796  H HB3  . LEU A 1 23  ? -2.970  11.617  -2.760  1.00 0.00 ? 23  LEU A HB3  4  
ATOM 4797  H HG   . LEU A 1 23  ? -1.582  12.320  -0.176  1.00 0.00 ? 23  LEU A HG   4  
ATOM 4798  H HD11 . LEU A 1 23  ? 0.554   12.110  -1.632  1.00 0.00 ? 23  LEU A HD11 4  
ATOM 4799  H HD12 . LEU A 1 23  ? -0.136  10.651  -0.883  1.00 0.00 ? 23  LEU A HD12 4  
ATOM 4800  H HD13 . LEU A 1 23  ? -0.420  10.985  -2.608  1.00 0.00 ? 23  LEU A HD13 4  
ATOM 4801  H HD21 . LEU A 1 23  ? -1.606  13.574  -2.935  1.00 0.00 ? 23  LEU A HD21 4  
ATOM 4802  H HD22 . LEU A 1 23  ? -2.406  14.190  -1.470  1.00 0.00 ? 23  LEU A HD22 4  
ATOM 4803  H HD23 . LEU A 1 23  ? -0.629  14.136  -1.557  1.00 0.00 ? 23  LEU A HD23 4  
ATOM 4804  N N    . GLY A 1 24  ? -5.722  10.740  0.459   1.00 0.00 ? 24  GLY A N    4  
ATOM 4805  C CA   . GLY A 1 24  ? -6.622  9.678   0.876   1.00 0.00 ? 24  GLY A CA   4  
ATOM 4806  C C    . GLY A 1 24  ? -5.892  8.649   1.742   1.00 0.00 ? 24  GLY A C    4  
ATOM 4807  O O    . GLY A 1 24  ? -6.524  7.877   2.460   1.00 0.00 ? 24  GLY A O    4  
ATOM 4808  H H    . GLY A 1 24  ? -5.685  11.528  1.073   1.00 0.00 ? 24  GLY A H    4  
ATOM 4809  H HA2  . GLY A 1 24  ? -7.456  10.102  1.435   1.00 0.00 ? 24  GLY A HA2  4  
ATOM 4810  H HA3  . GLY A 1 24  ? -7.042  9.187   -0.001  1.00 0.00 ? 24  GLY A HA3  4  
ATOM 4811  N N    . PHE A 1 25  ? -4.571  8.673   1.646   1.00 0.00 ? 25  PHE A N    4  
ATOM 4812  C CA   . PHE A 1 25  ? -3.748  7.752   2.411   1.00 0.00 ? 25  PHE A CA   4  
ATOM 4813  C C    . PHE A 1 25  ? -2.636  8.496   3.154   1.00 0.00 ? 25  PHE A C    4  
ATOM 4814  O O    . PHE A 1 25  ? -1.927  9.309   2.563   1.00 0.00 ? 25  PHE A O    4  
ATOM 4815  C CB   . PHE A 1 25  ? -3.116  6.780   1.412   1.00 0.00 ? 25  PHE A CB   4  
ATOM 4816  C CG   . PHE A 1 25  ? -1.891  7.342   0.688   1.00 0.00 ? 25  PHE A CG   4  
ATOM 4817  C CD1  . PHE A 1 25  ? -0.664  7.273   1.272   1.00 0.00 ? 25  PHE A CD1  4  
ATOM 4818  C CD2  . PHE A 1 25  ? -2.028  7.911   -0.540  1.00 0.00 ? 25  PHE A CD2  4  
ATOM 4819  C CE1  . PHE A 1 25  ? 0.473   7.794   0.600   1.00 0.00 ? 25  PHE A CE1  4  
ATOM 4820  C CE2  . PHE A 1 25  ? -0.891  8.433   -1.212  1.00 0.00 ? 25  PHE A CE2  4  
ATOM 4821  C CZ   . PHE A 1 25  ? 0.335   8.363   -0.628  1.00 0.00 ? 25  PHE A CZ   4  
ATOM 4822  H H    . PHE A 1 25  ? -4.064  9.304   1.059   1.00 0.00 ? 25  PHE A H    4  
ATOM 4823  H HA   . PHE A 1 25  ? -4.399  7.260   3.134   1.00 0.00 ? 25  PHE A HA   4  
ATOM 4824  H HB2  . PHE A 1 25  ? -2.828  5.870   1.938   1.00 0.00 ? 25  PHE A HB2  4  
ATOM 4825  H HB3  . PHE A 1 25  ? -3.865  6.498   0.672   1.00 0.00 ? 25  PHE A HB3  4  
ATOM 4826  H HD1  . PHE A 1 25  ? -0.554  6.817   2.256   1.00 0.00 ? 25  PHE A HD1  4  
ATOM 4827  H HD2  . PHE A 1 25  ? -3.011  7.967   -1.007  1.00 0.00 ? 25  PHE A HD2  4  
ATOM 4828  H HE1  . PHE A 1 25  ? 1.455   7.739   1.068   1.00 0.00 ? 25  PHE A HE1  4  
ATOM 4829  H HE2  . PHE A 1 25  ? -1.001  8.889   -2.196  1.00 0.00 ? 25  PHE A HE2  4  
ATOM 4830  H HZ   . PHE A 1 25  ? 1.208   8.763   -1.144  1.00 0.00 ? 25  PHE A HZ   4  
ATOM 4831  N N    . SER A 1 26  ? -2.520  8.192   4.438   1.00 0.00 ? 26  SER A N    4  
ATOM 4832  C CA   . SER A 1 26  ? -1.507  8.822   5.267   1.00 0.00 ? 26  SER A CA   4  
ATOM 4833  C C    . SER A 1 26  ? -0.216  8.002   5.231   1.00 0.00 ? 26  SER A C    4  
ATOM 4834  O O    . SER A 1 26  ? -0.224  6.844   4.816   1.00 0.00 ? 26  SER A O    4  
ATOM 4835  C CB   . SER A 1 26  ? -1.995  8.981   6.708   1.00 0.00 ? 26  SER A CB   4  
ATOM 4836  O OG   . SER A 1 26  ? -1.810  10.309  7.192   1.00 0.00 ? 26  SER A OG   4  
ATOM 4837  H H    . SER A 1 26  ? -3.101  7.530   4.911   1.00 0.00 ? 26  SER A H    4  
ATOM 4838  H HA   . SER A 1 26  ? -1.346  9.807   4.828   1.00 0.00 ? 26  SER A HA   4  
ATOM 4839  H HB2  . SER A 1 26  ? -3.052  8.719   6.764   1.00 0.00 ? 26  SER A HB2  4  
ATOM 4840  H HB3  . SER A 1 26  ? -1.459  8.283   7.352   1.00 0.00 ? 26  SER A HB3  4  
ATOM 4841  H HG   . SER A 1 26  ? -0.835  10.525  7.233   1.00 0.00 ? 26  SER A HG   4  
ATOM 4842  N N    . ILE A 1 27  ? 0.862   8.634   5.672   1.00 0.00 ? 27  ILE A N    4  
ATOM 4843  C CA   . ILE A 1 27  ? 2.158   7.976   5.695   1.00 0.00 ? 27  ILE A CA   4  
ATOM 4844  C C    . ILE A 1 27  ? 2.777   8.129   7.086   1.00 0.00 ? 27  ILE A C    4  
ATOM 4845  O O    . ILE A 1 27  ? 2.408   9.030   7.838   1.00 0.00 ? 27  ILE A O    4  
ATOM 4846  C CB   . ILE A 1 27  ? 3.046   8.501   4.566   1.00 0.00 ? 27  ILE A CB   4  
ATOM 4847  C CG1  . ILE A 1 27  ? 3.423   9.965   4.800   1.00 0.00 ? 27  ILE A CG1  4  
ATOM 4848  C CG2  . ILE A 1 27  ? 2.381   8.292   3.203   1.00 0.00 ? 27  ILE A CG2  4  
ATOM 4849  C CD1  . ILE A 1 27  ? 4.895   10.213  4.466   1.00 0.00 ? 27  ILE A CD1  4  
ATOM 4850  H H    . ILE A 1 27  ? 0.860   9.575   6.008   1.00 0.00 ? 27  ILE A H    4  
ATOM 4851  H HA   . ILE A 1 27  ? 1.989   6.916   5.507   1.00 0.00 ? 27  ILE A HA   4  
ATOM 4852  H HB   . ILE A 1 27  ? 3.972   7.926   4.564   1.00 0.00 ? 27  ILE A HB   4  
ATOM 4853  H HG12 . ILE A 1 27  ? 2.794   10.610  4.186   1.00 0.00 ? 27  ILE A HG12 4  
ATOM 4854  H HG13 . ILE A 1 27  ? 3.232   10.232  5.840   1.00 0.00 ? 27  ILE A HG13 4  
ATOM 4855  H HG21 . ILE A 1 27  ? 1.409   8.785   3.194   1.00 0.00 ? 27  ILE A HG21 4  
ATOM 4856  H HG22 . ILE A 1 27  ? 3.012   8.716   2.422   1.00 0.00 ? 27  ILE A HG22 4  
ATOM 4857  H HG23 . ILE A 1 27  ? 2.249   7.225   3.024   1.00 0.00 ? 27  ILE A HG23 4  
ATOM 4858  H HD11 . ILE A 1 27  ? 5.154   11.244  4.706   1.00 0.00 ? 27  ILE A HD11 4  
ATOM 4859  H HD12 . ILE A 1 27  ? 5.519   9.536   5.051   1.00 0.00 ? 27  ILE A HD12 4  
ATOM 4860  H HD13 . ILE A 1 27  ? 5.062   10.033  3.404   1.00 0.00 ? 27  ILE A HD13 4  
ATOM 4861  N N    . ARG A 1 28  ? 3.708   7.235   7.386   1.00 0.00 ? 28  ARG A N    4  
ATOM 4862  C CA   . ARG A 1 28  ? 4.382   7.259   8.673   1.00 0.00 ? 28  ARG A CA   4  
ATOM 4863  C C    . ARG A 1 28  ? 5.830   6.788   8.522   1.00 0.00 ? 28  ARG A C    4  
ATOM 4864  O O    . ARG A 1 28  ? 6.225   6.316   7.458   1.00 0.00 ? 28  ARG A O    4  
ATOM 4865  C CB   . ARG A 1 28  ? 3.665   6.366   9.687   1.00 0.00 ? 28  ARG A CB   4  
ATOM 4866  C CG   . ARG A 1 28  ? 3.651   4.909   9.221   1.00 0.00 ? 28  ARG A CG   4  
ATOM 4867  C CD   . ARG A 1 28  ? 3.678   3.952   10.415  1.00 0.00 ? 28  ARG A CD   4  
ATOM 4868  N NE   . ARG A 1 28  ? 2.937   4.540   11.553  1.00 0.00 ? 28  ARG A NE   4  
ATOM 4869  C CZ   . ARG A 1 28  ? 3.005   4.083   12.810  1.00 0.00 ? 28  ARG A CZ   4  
ATOM 4870  N NH1  . ARG A 1 28  ? 3.781   3.029   13.099  1.00 0.00 ? 28  ARG A NH1  4  
ATOM 4871  N NH2  . ARG A 1 28  ? 2.298   4.679   13.779  1.00 0.00 ? 28  ARG A NH2  4  
ATOM 4872  H H    . ARG A 1 28  ? 4.002   6.506   6.768   1.00 0.00 ? 28  ARG A H    4  
ATOM 4873  H HA   . ARG A 1 28  ? 4.340   8.301   8.990   1.00 0.00 ? 28  ARG A HA   4  
ATOM 4874  H HB2  . ARG A 1 28  ? 4.161   6.438   10.655  1.00 0.00 ? 28  ARG A HB2  4  
ATOM 4875  H HB3  . ARG A 1 28  ? 2.642   6.717   9.827   1.00 0.00 ? 28  ARG A HB3  4  
ATOM 4876  H HG2  . ARG A 1 28  ? 2.759   4.723   8.622   1.00 0.00 ? 28  ARG A HG2  4  
ATOM 4877  H HG3  . ARG A 1 28  ? 4.511   4.720   8.579   1.00 0.00 ? 28  ARG A HG3  4  
ATOM 4878  H HD2  . ARG A 1 28  ? 3.234   2.997   10.135  1.00 0.00 ? 28  ARG A HD2  4  
ATOM 4879  H HD3  . ARG A 1 28  ? 4.709   3.751   10.706  1.00 0.00 ? 28  ARG A HD3  4  
ATOM 4880  H HE   . ARG A 1 28  ? 2.349   5.328   11.372  1.00 0.00 ? 28  ARG A HE   4  
ATOM 4881  H HH11 . ARG A 1 28  ? 4.309   2.584   12.376  1.00 0.00 ? 28  ARG A HH11 4  
ATOM 4882  H HH12 . ARG A 1 28  ? 3.832   2.688   14.038  1.00 0.00 ? 28  ARG A HH12 4  
ATOM 4883  H HH21 . ARG A 1 28  ? 1.719   5.466   13.564  1.00 0.00 ? 28  ARG A HH21 4  
ATOM 4884  H HH22 . ARG A 1 28  ? 2.349   4.338   14.718  1.00 0.00 ? 28  ARG A HH22 4  
ATOM 4885  N N    . GLY A 1 29  ? 6.581   6.932   9.604   1.00 0.00 ? 29  GLY A N    4  
ATOM 4886  C CA   . GLY A 1 29  ? 7.976   6.527   9.606   1.00 0.00 ? 29  GLY A CA   4  
ATOM 4887  C C    . GLY A 1 29  ? 8.900   7.741   9.491   1.00 0.00 ? 29  GLY A C    4  
ATOM 4888  O O    . GLY A 1 29  ? 8.521   8.851   9.863   1.00 0.00 ? 29  GLY A O    4  
ATOM 4889  H H    . GLY A 1 29  ? 6.251   7.317   10.467  1.00 0.00 ? 29  GLY A H    4  
ATOM 4890  H HA2  . GLY A 1 29  ? 8.199   5.982   10.524  1.00 0.00 ? 29  GLY A HA2  4  
ATOM 4891  H HA3  . GLY A 1 29  ? 8.161   5.844   8.777   1.00 0.00 ? 29  GLY A HA3  4  
ATOM 4892  N N    . GLY A 1 30  ? 10.094  7.489   8.975   1.00 0.00 ? 30  GLY A N    4  
ATOM 4893  C CA   . GLY A 1 30  ? 11.074  8.548   8.806   1.00 0.00 ? 30  GLY A CA   4  
ATOM 4894  C C    . GLY A 1 30  ? 12.426  8.143   9.399   1.00 0.00 ? 30  GLY A C    4  
ATOM 4895  O O    . GLY A 1 30  ? 12.487  7.599   10.500  1.00 0.00 ? 30  GLY A O    4  
ATOM 4896  H H    . GLY A 1 30  ? 10.394  6.584   8.675   1.00 0.00 ? 30  GLY A H    4  
ATOM 4897  H HA2  . GLY A 1 30  ? 11.191  8.775   7.747   1.00 0.00 ? 30  GLY A HA2  4  
ATOM 4898  H HA3  . GLY A 1 30  ? 10.719  9.458   9.290   1.00 0.00 ? 30  GLY A HA3  4  
ATOM 4899  N N    . SER A 1 31  ? 13.476  8.424   8.641   1.00 0.00 ? 31  SER A N    4  
ATOM 4900  C CA   . SER A 1 31  ? 14.823  8.096   9.078   1.00 0.00 ? 31  SER A CA   4  
ATOM 4901  C C    . SER A 1 31  ? 14.993  8.445   10.558  1.00 0.00 ? 31  SER A C    4  
ATOM 4902  O O    . SER A 1 31  ? 15.790  7.824   11.258  1.00 0.00 ? 31  SER A O    4  
ATOM 4903  C CB   . SER A 1 31  ? 15.868  8.829   8.236   1.00 0.00 ? 31  SER A CB   4  
ATOM 4904  O OG   . SER A 1 31  ? 16.984  7.998   7.927   1.00 0.00 ? 31  SER A OG   4  
ATOM 4905  H H    . SER A 1 31  ? 13.418  8.867   7.747   1.00 0.00 ? 31  SER A H    4  
ATOM 4906  H HA   . SER A 1 31  ? 14.922  7.022   8.924   1.00 0.00 ? 31  SER A HA   4  
ATOM 4907  H HB2  . SER A 1 31  ? 15.409  9.178   7.311   1.00 0.00 ? 31  SER A HB2  4  
ATOM 4908  H HB3  . SER A 1 31  ? 16.212  9.713   8.774   1.00 0.00 ? 31  SER A HB3  4  
ATOM 4909  H HG   . SER A 1 31  ? 16.780  7.436   7.126   1.00 0.00 ? 31  SER A HG   4  
ATOM 4910  N N    . GLU A 1 32  ? 14.230  9.439   10.990  1.00 0.00 ? 32  GLU A N    4  
ATOM 4911  C CA   . GLU A 1 32  ? 14.286  9.878   12.374  1.00 0.00 ? 32  GLU A CA   4  
ATOM 4912  C C    . GLU A 1 32  ? 14.166  8.679   13.317  1.00 0.00 ? 32  GLU A C    4  
ATOM 4913  O O    . GLU A 1 32  ? 15.063  8.423   14.118  1.00 0.00 ? 32  GLU A O    4  
ATOM 4914  C CB   . GLU A 1 32  ? 13.200  10.915  12.665  1.00 0.00 ? 32  GLU A CB   4  
ATOM 4915  C CG   . GLU A 1 32  ? 13.607  11.826  13.824  1.00 0.00 ? 32  GLU A CG   4  
ATOM 4916  C CD   . GLU A 1 32  ? 12.709  13.063  13.892  1.00 0.00 ? 32  GLU A CD   4  
ATOM 4917  O OE1  . GLU A 1 32  ? 11.671  12.973  14.582  1.00 0.00 ? 32  GLU A OE1  4  
ATOM 4918  O OE2  . GLU A 1 32  ? 13.081  14.070  13.252  1.00 0.00 ? 32  GLU A OE2  4  
ATOM 4919  H H    . GLU A 1 32  ? 13.584  9.939   10.414  1.00 0.00 ? 32  GLU A H    4  
ATOM 4920  H HA   . GLU A 1 32  ? 15.265  10.344  12.490  1.00 0.00 ? 32  GLU A HA   4  
ATOM 4921  H HB2  . GLU A 1 32  ? 13.017  11.515  11.773  1.00 0.00 ? 32  GLU A HB2  4  
ATOM 4922  H HB3  . GLU A 1 32  ? 12.265  10.410  12.906  1.00 0.00 ? 32  GLU A HB3  4  
ATOM 4923  H HG2  . GLU A 1 32  ? 13.546  11.276  14.763  1.00 0.00 ? 32  GLU A HG2  4  
ATOM 4924  H HG3  . GLU A 1 32  ? 14.646  12.133  13.702  1.00 0.00 ? 32  GLU A HG3  4  
ATOM 4925  N N    . HIS A 1 33  ? 13.050  7.976   13.189  1.00 0.00 ? 33  HIS A N    4  
ATOM 4926  C CA   . HIS A 1 33  ? 12.801  6.810   14.020  1.00 0.00 ? 33  HIS A CA   4  
ATOM 4927  C C    . HIS A 1 33  ? 13.776  5.693   13.641  1.00 0.00 ? 33  HIS A C    4  
ATOM 4928  O O    . HIS A 1 33  ? 13.997  4.767   14.420  1.00 0.00 ? 33  HIS A O    4  
ATOM 4929  C CB   . HIS A 1 33  ? 11.337  6.378   13.924  1.00 0.00 ? 33  HIS A CB   4  
ATOM 4930  C CG   . HIS A 1 33  ? 10.489  6.818   15.094  1.00 0.00 ? 33  HIS A CG   4  
ATOM 4931  N ND1  . HIS A 1 33  ? 9.716   5.939   15.832  1.00 0.00 ? 33  HIS A ND1  4  
ATOM 4932  C CD2  . HIS A 1 33  ? 10.302  8.052   15.644  1.00 0.00 ? 33  HIS A CD2  4  
ATOM 4933  C CE1  . HIS A 1 33  ? 9.095   6.625   16.781  1.00 0.00 ? 33  HIS A CE1  4  
ATOM 4934  N NE2  . HIS A 1 33  ? 9.459   7.934   16.662  1.00 0.00 ? 33  HIS A NE2  4  
ATOM 4935  H H    . HIS A 1 33  ? 12.326  8.191   12.535  1.00 0.00 ? 33  HIS A H    4  
ATOM 4936  H HA   . HIS A 1 33  ? 12.992  7.113   15.049  1.00 0.00 ? 33  HIS A HA   4  
ATOM 4937  H HB2  . HIS A 1 33  ? 10.909  6.780   13.006  1.00 0.00 ? 33  HIS A HB2  4  
ATOM 4938  H HB3  . HIS A 1 33  ? 11.294  5.291   13.846  1.00 0.00 ? 33  HIS A HB3  4  
ATOM 4939  H HD1  . HIS A 1 33  ? 9.639   4.955   15.676  1.00 0.00 ? 33  HIS A HD1  4  
ATOM 4940  H HD2  . HIS A 1 33  ? 10.765  8.978   15.304  1.00 0.00 ? 33  HIS A HD2  4  
ATOM 4941  H HE1  . HIS A 1 33  ? 8.413   6.214   17.526  1.00 0.00 ? 33  HIS A HE1  4  
ATOM 4942  N N    . GLY A 1 34  ? 14.332  5.817   12.445  1.00 0.00 ? 34  GLY A N    4  
ATOM 4943  C CA   . GLY A 1 34  ? 15.277  4.829   11.954  1.00 0.00 ? 34  GLY A CA   4  
ATOM 4944  C C    . GLY A 1 34  ? 14.630  3.927   10.901  1.00 0.00 ? 34  GLY A C    4  
ATOM 4945  O O    . GLY A 1 34  ? 15.261  2.995   10.404  1.00 0.00 ? 34  GLY A O    4  
ATOM 4946  H H    . GLY A 1 34  ? 14.146  6.573   11.818  1.00 0.00 ? 34  GLY A H    4  
ATOM 4947  H HA2  . GLY A 1 34  ? 16.144  5.331   11.524  1.00 0.00 ? 34  GLY A HA2  4  
ATOM 4948  H HA3  . GLY A 1 34  ? 15.640  4.222   12.784  1.00 0.00 ? 34  GLY A HA3  4  
ATOM 4949  N N    . VAL A 1 35  ? 13.379  4.235   10.592  1.00 0.00 ? 35  VAL A N    4  
ATOM 4950  C CA   . VAL A 1 35  ? 12.640  3.464   9.607   1.00 0.00 ? 35  VAL A CA   4  
ATOM 4951  C C    . VAL A 1 35  ? 12.386  4.331   8.372   1.00 0.00 ? 35  VAL A C    4  
ATOM 4952  O O    . VAL A 1 35  ? 12.660  5.531   8.385   1.00 0.00 ? 35  VAL A O    4  
ATOM 4953  C CB   . VAL A 1 35  ? 11.352  2.919   10.229  1.00 0.00 ? 35  VAL A CB   4  
ATOM 4954  C CG1  . VAL A 1 35  ? 11.567  2.547   11.697  1.00 0.00 ? 35  VAL A CG1  4  
ATOM 4955  C CG2  . VAL A 1 35  ? 10.204  3.919   10.078  1.00 0.00 ? 35  VAL A CG2  4  
ATOM 4956  H H    . VAL A 1 35  ? 12.873  4.995   11.000  1.00 0.00 ? 35  VAL A H    4  
ATOM 4957  H HA   . VAL A 1 35  ? 13.261  2.616   9.319   1.00 0.00 ? 35  VAL A HA   4  
ATOM 4958  H HB   . VAL A 1 35  ? 11.078  2.011   9.690   1.00 0.00 ? 35  VAL A HB   4  
ATOM 4959  H HG11 . VAL A 1 35  ? 11.439  3.434   12.319  1.00 0.00 ? 35  VAL A HG11 4  
ATOM 4960  H HG12 . VAL A 1 35  ? 10.840  1.790   11.991  1.00 0.00 ? 35  VAL A HG12 4  
ATOM 4961  H HG13 . VAL A 1 35  ? 12.575  2.154   11.829  1.00 0.00 ? 35  VAL A HG13 4  
ATOM 4962  H HG21 . VAL A 1 35  ? 9.871   3.936   9.041   1.00 0.00 ? 35  VAL A HG21 4  
ATOM 4963  H HG22 . VAL A 1 35  ? 9.376   3.621   10.722  1.00 0.00 ? 35  VAL A HG22 4  
ATOM 4964  H HG23 . VAL A 1 35  ? 10.548  4.913   10.365  1.00 0.00 ? 35  VAL A HG23 4  
ATOM 4965  N N    . GLY A 1 36  ? 11.867  3.691   7.335   1.00 0.00 ? 36  GLY A N    4  
ATOM 4966  C CA   . GLY A 1 36  ? 11.574  4.388   6.095   1.00 0.00 ? 36  GLY A CA   4  
ATOM 4967  C C    . GLY A 1 36  ? 10.187  5.032   6.142   1.00 0.00 ? 36  GLY A C    4  
ATOM 4968  O O    . GLY A 1 36  ? 9.883   5.793   7.060   1.00 0.00 ? 36  GLY A O    4  
ATOM 4969  H H    . GLY A 1 36  ? 11.648  2.715   7.333   1.00 0.00 ? 36  GLY A H    4  
ATOM 4970  H HA2  . GLY A 1 36  ? 12.329  5.155   5.917   1.00 0.00 ? 36  GLY A HA2  4  
ATOM 4971  H HA3  . GLY A 1 36  ? 11.626  3.690   5.259   1.00 0.00 ? 36  GLY A HA3  4  
ATOM 4972  N N    . ILE A 1 37  ? 9.383   4.704   5.142   1.00 0.00 ? 37  ILE A N    4  
ATOM 4973  C CA   . ILE A 1 37  ? 8.035   5.240   5.058   1.00 0.00 ? 37  ILE A CA   4  
ATOM 4974  C C    . ILE A 1 37  ? 7.051   4.097   4.802   1.00 0.00 ? 37  ILE A C    4  
ATOM 4975  O O    . ILE A 1 37  ? 7.377   3.135   4.109   1.00 0.00 ? 37  ILE A O    4  
ATOM 4976  C CB   . ILE A 1 37  ? 7.967   6.356   4.014   1.00 0.00 ? 37  ILE A CB   4  
ATOM 4977  C CG1  . ILE A 1 37  ? 9.100   7.364   4.213   1.00 0.00 ? 37  ILE A CG1  4  
ATOM 4978  C CG2  . ILE A 1 37  ? 6.593   7.029   4.020   1.00 0.00 ? 37  ILE A CG2  4  
ATOM 4979  C CD1  . ILE A 1 37  ? 8.860   8.219   5.459   1.00 0.00 ? 37  ILE A CD1  4  
ATOM 4980  H H    . ILE A 1 37  ? 9.638   4.084   4.399   1.00 0.00 ? 37  ILE A H    4  
ATOM 4981  H HA   . ILE A 1 37  ? 7.801   5.688   6.024   1.00 0.00 ? 37  ILE A HA   4  
ATOM 4982  H HB   . ILE A 1 37  ? 8.102   5.910   3.028   1.00 0.00 ? 37  ILE A HB   4  
ATOM 4983  H HG12 . ILE A 1 37  ? 10.049  6.836   4.307   1.00 0.00 ? 37  ILE A HG12 4  
ATOM 4984  H HG13 . ILE A 1 37  ? 9.179   8.007   3.336   1.00 0.00 ? 37  ILE A HG13 4  
ATOM 4985  H HG21 . ILE A 1 37  ? 6.617   7.910   3.377   1.00 0.00 ? 37  ILE A HG21 4  
ATOM 4986  H HG22 . ILE A 1 37  ? 5.844   6.330   3.649   1.00 0.00 ? 37  ILE A HG22 4  
ATOM 4987  H HG23 . ILE A 1 37  ? 6.339   7.328   5.037   1.00 0.00 ? 37  ILE A HG23 4  
ATOM 4988  H HD11 . ILE A 1 37  ? 9.784   8.729   5.733   1.00 0.00 ? 37  ILE A HD11 4  
ATOM 4989  H HD12 . ILE A 1 37  ? 8.086   8.957   5.250   1.00 0.00 ? 37  ILE A HD12 4  
ATOM 4990  H HD13 . ILE A 1 37  ? 8.540   7.580   6.282   1.00 0.00 ? 37  ILE A HD13 4  
ATOM 4991  N N    . TYR A 1 38  ? 5.865   4.241   5.376   1.00 0.00 ? 38  TYR A N    4  
ATOM 4992  C CA   . TYR A 1 38  ? 4.831   3.232   5.218   1.00 0.00 ? 38  TYR A CA   4  
ATOM 4993  C C    . TYR A 1 38  ? 3.444   3.824   5.476   1.00 0.00 ? 38  TYR A C    4  
ATOM 4994  O O    . TYR A 1 38  ? 3.304   4.779   6.239   1.00 0.00 ? 38  TYR A O    4  
ATOM 4995  C CB   . TYR A 1 38  ? 5.120   2.163   6.274   1.00 0.00 ? 38  TYR A CB   4  
ATOM 4996  C CG   . TYR A 1 38  ? 6.509   1.534   6.158   1.00 0.00 ? 38  TYR A CG   4  
ATOM 4997  C CD1  . TYR A 1 38  ? 7.588   2.121   6.789   1.00 0.00 ? 38  TYR A CD1  4  
ATOM 4998  C CD2  . TYR A 1 38  ? 6.685   0.379   5.423   1.00 0.00 ? 38  TYR A CD2  4  
ATOM 4999  C CE1  . TYR A 1 38  ? 8.896   1.529   6.680   1.00 0.00 ? 38  TYR A CE1  4  
ATOM 5000  C CE2  . TYR A 1 38  ? 7.993   -0.213  5.314   1.00 0.00 ? 38  TYR A CE2  4  
ATOM 5001  C CZ   . TYR A 1 38  ? 9.034   0.391   5.948   1.00 0.00 ? 38  TYR A CZ   4  
ATOM 5002  O OH   . TYR A 1 38  ? 10.269  -0.169  5.845   1.00 0.00 ? 38  TYR A OH   4  
ATOM 5003  H H    . TYR A 1 38  ? 5.607   5.026   5.938   1.00 0.00 ? 38  TYR A H    4  
ATOM 5004  H HA   . TYR A 1 38  ? 4.875   2.862   4.194   1.00 0.00 ? 38  TYR A HA   4  
ATOM 5005  H HB2  . TYR A 1 38  ? 5.015   2.608   7.264   1.00 0.00 ? 38  TYR A HB2  4  
ATOM 5006  H HB3  . TYR A 1 38  ? 4.369   1.378   6.196   1.00 0.00 ? 38  TYR A HB3  4  
ATOM 5007  H HD1  . TYR A 1 38  ? 7.449   3.033   7.370   1.00 0.00 ? 38  TYR A HD1  4  
ATOM 5008  H HD2  . TYR A 1 38  ? 5.833   -0.084  4.925   1.00 0.00 ? 38  TYR A HD2  4  
ATOM 5009  H HE1  . TYR A 1 38  ? 9.756   1.982   7.173   1.00 0.00 ? 38  TYR A HE1  4  
ATOM 5010  H HE2  . TYR A 1 38  ? 8.145   -1.125  4.737   1.00 0.00 ? 38  TYR A HE2  4  
ATOM 5011  H HH   . TYR A 1 38  ? 10.906  0.292   6.464   1.00 0.00 ? 38  TYR A HH   4  
ATOM 5012  N N    . VAL A 1 39  ? 2.453   3.233   4.825   1.00 0.00 ? 39  VAL A N    4  
ATOM 5013  C CA   . VAL A 1 39  ? 1.082   3.690   4.974   1.00 0.00 ? 39  VAL A CA   4  
ATOM 5014  C C    . VAL A 1 39  ? 0.639   3.496   6.425   1.00 0.00 ? 39  VAL A C    4  
ATOM 5015  O O    . VAL A 1 39  ? 0.900   2.454   7.024   1.00 0.00 ? 39  VAL A O    4  
ATOM 5016  C CB   . VAL A 1 39  ? 0.178   2.969   3.971   1.00 0.00 ? 39  VAL A CB   4  
ATOM 5017  C CG1  . VAL A 1 39  ? -1.234  3.558   3.984   1.00 0.00 ? 39  VAL A CG1  4  
ATOM 5018  C CG2  . VAL A 1 39  ? 0.777   3.011   2.564   1.00 0.00 ? 39  VAL A CG2  4  
ATOM 5019  H H    . VAL A 1 39  ? 2.575   2.457   4.206   1.00 0.00 ? 39  VAL A H    4  
ATOM 5020  H HA   . VAL A 1 39  ? 1.063   4.755   4.740   1.00 0.00 ? 39  VAL A HA   4  
ATOM 5021  H HB   . VAL A 1 39  ? 0.108   1.924   4.274   1.00 0.00 ? 39  VAL A HB   4  
ATOM 5022  H HG11 . VAL A 1 39  ? -1.949  2.793   3.679   1.00 0.00 ? 39  VAL A HG11 4  
ATOM 5023  H HG12 . VAL A 1 39  ? -1.476  3.900   4.990   1.00 0.00 ? 39  VAL A HG12 4  
ATOM 5024  H HG13 . VAL A 1 39  ? -1.284  4.398   3.292   1.00 0.00 ? 39  VAL A HG13 4  
ATOM 5025  H HG21 . VAL A 1 39  ? 1.621   2.324   2.508   1.00 0.00 ? 39  VAL A HG21 4  
ATOM 5026  H HG22 . VAL A 1 39  ? 0.019   2.716   1.838   1.00 0.00 ? 39  VAL A HG22 4  
ATOM 5027  H HG23 . VAL A 1 39  ? 1.116   4.023   2.344   1.00 0.00 ? 39  VAL A HG23 4  
ATOM 5028  N N    . SER A 1 40  ? -0.025  4.516   6.949   1.00 0.00 ? 40  SER A N    4  
ATOM 5029  C CA   . SER A 1 40  ? -0.507  4.471   8.319   1.00 0.00 ? 40  SER A CA   4  
ATOM 5030  C C    . SER A 1 40  ? -2.037  4.463   8.336   1.00 0.00 ? 40  SER A C    4  
ATOM 5031  O O    . SER A 1 40  ? -2.648  3.887   9.234   1.00 0.00 ? 40  SER A O    4  
ATOM 5032  C CB   . SER A 1 40  ? 0.026   5.654   9.130   1.00 0.00 ? 40  SER A CB   4  
ATOM 5033  O OG   . SER A 1 40  ? -0.664  6.864   8.827   1.00 0.00 ? 40  SER A OG   4  
ATOM 5034  H H    . SER A 1 40  ? -0.234  5.361   6.455   1.00 0.00 ? 40  SER A H    4  
ATOM 5035  H HA   . SER A 1 40  ? -0.114  3.542   8.733   1.00 0.00 ? 40  SER A HA   4  
ATOM 5036  H HB2  . SER A 1 40  ? -0.071  5.438   10.194  1.00 0.00 ? 40  SER A HB2  4  
ATOM 5037  H HB3  . SER A 1 40  ? 1.090   5.783   8.927   1.00 0.00 ? 40  SER A HB3  4  
ATOM 5038  H HG   . SER A 1 40  ? -0.014  7.563   8.528   1.00 0.00 ? 40  SER A HG   4  
ATOM 5039  N N    . LEU A 1 41  ? -2.611  5.108   7.332   1.00 0.00 ? 41  LEU A N    4  
ATOM 5040  C CA   . LEU A 1 41  ? -4.058  5.183   7.220   1.00 0.00 ? 41  LEU A CA   4  
ATOM 5041  C C    . LEU A 1 41  ? -4.451  5.190   5.741   1.00 0.00 ? 41  LEU A C    4  
ATOM 5042  O O    . LEU A 1 41  ? -3.713  5.703   4.901   1.00 0.00 ? 41  LEU A O    4  
ATOM 5043  C CB   . LEU A 1 41  ? -4.595  6.381   8.005   1.00 0.00 ? 41  LEU A CB   4  
ATOM 5044  C CG   . LEU A 1 41  ? -6.077  6.705   7.803   1.00 0.00 ? 41  LEU A CG   4  
ATOM 5045  C CD1  . LEU A 1 41  ? -6.334  7.242   6.394   1.00 0.00 ? 41  LEU A CD1  4  
ATOM 5046  C CD2  . LEU A 1 41  ? -6.952  5.491   8.122   1.00 0.00 ? 41  LEU A CD2  4  
ATOM 5047  H H    . LEU A 1 41  ? -2.107  5.574   6.605   1.00 0.00 ? 41  LEU A H    4  
ATOM 5048  H HA   . LEU A 1 41  ? -4.468  4.284   7.682   1.00 0.00 ? 41  LEU A HA   4  
ATOM 5049  H HB2  . LEU A 1 41  ? -4.425  6.200   9.066   1.00 0.00 ? 41  LEU A HB2  4  
ATOM 5050  H HB3  . LEU A 1 41  ? -4.011  7.260   7.733   1.00 0.00 ? 41  LEU A HB3  4  
ATOM 5051  H HG   . LEU A 1 41  ? -6.353  7.493   8.503   1.00 0.00 ? 41  LEU A HG   4  
ATOM 5052  H HD11 . LEU A 1 41  ? -6.918  8.160   6.455   1.00 0.00 ? 41  LEU A HD11 4  
ATOM 5053  H HD12 . LEU A 1 41  ? -5.382  7.448   5.905   1.00 0.00 ? 41  LEU A HD12 4  
ATOM 5054  H HD13 . LEU A 1 41  ? -6.885  6.499   5.817   1.00 0.00 ? 41  LEU A HD13 4  
ATOM 5055  H HD21 . LEU A 1 41  ? -6.317  4.642   8.375   1.00 0.00 ? 41  LEU A HD21 4  
ATOM 5056  H HD22 . LEU A 1 41  ? -7.601  5.723   8.967   1.00 0.00 ? 41  LEU A HD22 4  
ATOM 5057  H HD23 . LEU A 1 41  ? -7.562  5.244   7.253   1.00 0.00 ? 41  LEU A HD23 4  
ATOM 5058  N N    . VAL A 1 42  ? -5.613  4.615   5.468   1.00 0.00 ? 42  VAL A N    4  
ATOM 5059  C CA   . VAL A 1 42  ? -6.113  4.549   4.105   1.00 0.00 ? 42  VAL A CA   4  
ATOM 5060  C C    . VAL A 1 42  ? -7.603  4.895   4.096   1.00 0.00 ? 42  VAL A C    4  
ATOM 5061  O O    . VAL A 1 42  ? -8.404  4.221   4.742   1.00 0.00 ? 42  VAL A O    4  
ATOM 5062  C CB   . VAL A 1 42  ? -5.815  3.174   3.504   1.00 0.00 ? 42  VAL A CB   4  
ATOM 5063  C CG1  . VAL A 1 42  ? -6.809  2.834   2.392   1.00 0.00 ? 42  VAL A CG1  4  
ATOM 5064  C CG2  . VAL A 1 42  ? -4.374  3.100   2.993   1.00 0.00 ? 42  VAL A CG2  4  
ATOM 5065  H H    . VAL A 1 42  ? -6.207  4.200   6.156   1.00 0.00 ? 42  VAL A H    4  
ATOM 5066  H HA   . VAL A 1 42  ? -5.576  5.296   3.521   1.00 0.00 ? 42  VAL A HA   4  
ATOM 5067  H HB   . VAL A 1 42  ? -5.928  2.431   4.294   1.00 0.00 ? 42  VAL A HB   4  
ATOM 5068  H HG11 . VAL A 1 42  ? -6.326  2.190   1.657   1.00 0.00 ? 42  VAL A HG11 4  
ATOM 5069  H HG12 . VAL A 1 42  ? -7.669  2.317   2.819   1.00 0.00 ? 42  VAL A HG12 4  
ATOM 5070  H HG13 . VAL A 1 42  ? -7.141  3.752   1.908   1.00 0.00 ? 42  VAL A HG13 4  
ATOM 5071  H HG21 . VAL A 1 42  ? -3.862  2.265   3.471   1.00 0.00 ? 42  VAL A HG21 4  
ATOM 5072  H HG22 . VAL A 1 42  ? -4.379  2.953   1.913   1.00 0.00 ? 42  VAL A HG22 4  
ATOM 5073  H HG23 . VAL A 1 42  ? -3.856  4.028   3.231   1.00 0.00 ? 42  VAL A HG23 4  
ATOM 5074  N N    . GLU A 1 43  ? -7.930  5.945   3.357   1.00 0.00 ? 43  GLU A N    4  
ATOM 5075  C CA   . GLU A 1 43  ? -9.310  6.388   3.255   1.00 0.00 ? 43  GLU A CA   4  
ATOM 5076  C C    . GLU A 1 43  ? -10.150 5.344   2.517   1.00 0.00 ? 43  GLU A C    4  
ATOM 5077  O O    . GLU A 1 43  ? -9.708  4.782   1.516   1.00 0.00 ? 43  GLU A O    4  
ATOM 5078  C CB   . GLU A 1 43  ? -9.398  7.751   2.565   1.00 0.00 ? 43  GLU A CB   4  
ATOM 5079  C CG   . GLU A 1 43  ? -9.162  8.887   3.562   1.00 0.00 ? 43  GLU A CG   4  
ATOM 5080  C CD   . GLU A 1 43  ? -10.384 9.803   3.649   1.00 0.00 ? 43  GLU A CD   4  
ATOM 5081  O OE1  . GLU A 1 43  ? -10.659 10.481  2.635   1.00 0.00 ? 43  GLU A OE1  4  
ATOM 5082  O OE2  . GLU A 1 43  ? -11.016 9.805   4.728   1.00 0.00 ? 43  GLU A OE2  4  
ATOM 5083  H H    . GLU A 1 43  ? -7.272  6.488   2.834   1.00 0.00 ? 43  GLU A H    4  
ATOM 5084  H HA   . GLU A 1 43  ? -9.660  6.485   4.283   1.00 0.00 ? 43  GLU A HA   4  
ATOM 5085  H HB2  . GLU A 1 43  ? -8.661  7.806   1.764   1.00 0.00 ? 43  GLU A HB2  4  
ATOM 5086  H HB3  . GLU A 1 43  ? -10.379 7.866   2.103   1.00 0.00 ? 43  GLU A HB3  4  
ATOM 5087  H HG2  . GLU A 1 43  ? -8.943  8.472   4.546   1.00 0.00 ? 43  GLU A HG2  4  
ATOM 5088  H HG3  . GLU A 1 43  ? -8.290  9.466   3.258   1.00 0.00 ? 43  GLU A HG3  4  
ATOM 5089  N N    . PRO A 1 44  ? -11.378 5.110   3.053   1.00 0.00 ? 44  PRO A N    4  
ATOM 5090  C CA   . PRO A 1 44  ? -12.284 4.144   2.456   1.00 0.00 ? 44  PRO A CA   4  
ATOM 5091  C C    . PRO A 1 44  ? -12.910 4.698   1.175   1.00 0.00 ? 44  PRO A C    4  
ATOM 5092  O O    . PRO A 1 44  ? -12.920 5.909   0.958   1.00 0.00 ? 44  PRO A O    4  
ATOM 5093  C CB   . PRO A 1 44  ? -13.309 3.845   3.538   1.00 0.00 ? 44  PRO A CB   4  
ATOM 5094  C CG   . PRO A 1 44  ? -13.215 4.993   4.530   1.00 0.00 ? 44  PRO A CG   4  
ATOM 5095  C CD   . PRO A 1 44  ? -11.934 5.758   4.237   1.00 0.00 ? 44  PRO A CD   4  
ATOM 5096  H HA   . PRO A 1 44  ? -11.783 3.322   2.182   1.00 0.00 ? 44  PRO A HA   4  
ATOM 5097  H HB2  . PRO A 1 44  ? -14.311 3.774   3.117   1.00 0.00 ? 44  PRO A HB2  4  
ATOM 5098  H HB3  . PRO A 1 44  ? -13.098 2.892   4.023   1.00 0.00 ? 44  PRO A HB3  4  
ATOM 5099  H HG2  . PRO A 1 44  ? -14.080 5.649   4.437   1.00 0.00 ? 44  PRO A HG2  4  
ATOM 5100  H HG3  . PRO A 1 44  ? -13.209 4.615   5.552   1.00 0.00 ? 44  PRO A HG3  4  
ATOM 5101  H HD2  . PRO A 1 44  ? -12.136 6.813   4.053   1.00 0.00 ? 44  PRO A HD2  4  
ATOM 5102  H HD3  . PRO A 1 44  ? -11.242 5.708   5.078   1.00 0.00 ? 44  PRO A HD3  4  
ATOM 5103  N N    . GLY A 1 45  ? -13.419 3.785   0.360   1.00 0.00 ? 45  GLY A N    4  
ATOM 5104  C CA   . GLY A 1 45  ? -14.046 4.168   -0.893  1.00 0.00 ? 45  GLY A CA   4  
ATOM 5105  C C    . GLY A 1 45  ? -13.289 5.320   -1.556  1.00 0.00 ? 45  GLY A C    4  
ATOM 5106  O O    . GLY A 1 45  ? -13.882 6.128   -2.270  1.00 0.00 ? 45  GLY A O    4  
ATOM 5107  H H    . GLY A 1 45  ? -13.407 2.803   0.544   1.00 0.00 ? 45  GLY A H    4  
ATOM 5108  H HA2  . GLY A 1 45  ? -14.073 3.311   -1.567  1.00 0.00 ? 45  GLY A HA2  4  
ATOM 5109  H HA3  . GLY A 1 45  ? -15.079 4.463   -0.712  1.00 0.00 ? 45  GLY A HA3  4  
ATOM 5110  N N    . SER A 1 46  ? -11.991 5.361   -1.296  1.00 0.00 ? 46  SER A N    4  
ATOM 5111  C CA   . SER A 1 46  ? -11.146 6.401   -1.858  1.00 0.00 ? 46  SER A CA   4  
ATOM 5112  C C    . SER A 1 46  ? -10.377 5.856   -3.063  1.00 0.00 ? 46  SER A C    4  
ATOM 5113  O O    . SER A 1 46  ? -10.480 4.674   -3.388  1.00 0.00 ? 46  SER A O    4  
ATOM 5114  C CB   . SER A 1 46  ? -10.175 6.948   -0.811  1.00 0.00 ? 46  SER A CB   4  
ATOM 5115  O OG   . SER A 1 46  ? -8.973  6.184   -0.747  1.00 0.00 ? 46  SER A OG   4  
ATOM 5116  H H    . SER A 1 46  ? -11.516 4.700   -0.714  1.00 0.00 ? 46  SER A H    4  
ATOM 5117  H HA   . SER A 1 46  ? -11.830 7.192   -2.167  1.00 0.00 ? 46  SER A HA   4  
ATOM 5118  H HB2  . SER A 1 46  ? -9.933  7.985   -1.046  1.00 0.00 ? 46  SER A HB2  4  
ATOM 5119  H HB3  . SER A 1 46  ? -10.657 6.947   0.167   1.00 0.00 ? 46  SER A HB3  4  
ATOM 5120  H HG   . SER A 1 46  ? -9.187  5.224   -0.566  1.00 0.00 ? 46  SER A HG   4  
ATOM 5121  N N    . LEU A 1 47  ? -9.622  6.744   -3.693  1.00 0.00 ? 47  LEU A N    4  
ATOM 5122  C CA   . LEU A 1 47  ? -8.835  6.367   -4.855  1.00 0.00 ? 47  LEU A CA   4  
ATOM 5123  C C    . LEU A 1 47  ? -7.719  5.413   -4.422  1.00 0.00 ? 47  LEU A C    4  
ATOM 5124  O O    . LEU A 1 47  ? -7.555  4.341   -5.002  1.00 0.00 ? 47  LEU A O    4  
ATOM 5125  C CB   . LEU A 1 47  ? -8.330  7.612   -5.587  1.00 0.00 ? 47  LEU A CB   4  
ATOM 5126  C CG   . LEU A 1 47  ? -7.771  7.383   -6.993  1.00 0.00 ? 47  LEU A CG   4  
ATOM 5127  C CD1  . LEU A 1 47  ? -7.900  8.646   -7.847  1.00 0.00 ? 47  LEU A CD1  4  
ATOM 5128  C CD2  . LEU A 1 47  ? -6.329  6.876   -6.933  1.00 0.00 ? 47  LEU A CD2  4  
ATOM 5129  H H    . LEU A 1 47  ? -9.543  7.704   -3.423  1.00 0.00 ? 47  LEU A H    4  
ATOM 5130  H HA   . LEU A 1 47  ? -9.497  5.837   -5.540  1.00 0.00 ? 47  LEU A HA   4  
ATOM 5131  H HB2  . LEU A 1 47  ? -9.150  8.327   -5.656  1.00 0.00 ? 47  LEU A HB2  4  
ATOM 5132  H HB3  . LEU A 1 47  ? -7.553  8.076   -4.980  1.00 0.00 ? 47  LEU A HB3  4  
ATOM 5133  H HG   . LEU A 1 47  ? -8.365  6.607   -7.475  1.00 0.00 ? 47  LEU A HG   4  
ATOM 5134  H HD11 . LEU A 1 47  ? -7.237  9.418   -7.456  1.00 0.00 ? 47  LEU A HD11 4  
ATOM 5135  H HD12 . LEU A 1 47  ? -7.625  8.418   -8.876  1.00 0.00 ? 47  LEU A HD12 4  
ATOM 5136  H HD13 . LEU A 1 47  ? -8.929  9.002   -7.816  1.00 0.00 ? 47  LEU A HD13 4  
ATOM 5137  H HD21 . LEU A 1 47  ? -6.233  6.144   -6.131  1.00 0.00 ? 47  LEU A HD21 4  
ATOM 5138  H HD22 . LEU A 1 47  ? -6.068  6.409   -7.883  1.00 0.00 ? 47  LEU A HD22 4  
ATOM 5139  H HD23 . LEU A 1 47  ? -5.657  7.713   -6.744  1.00 0.00 ? 47  LEU A HD23 4  
ATOM 5140  N N    . ALA A 1 48  ? -6.981  5.839   -3.408  1.00 0.00 ? 48  ALA A N    4  
ATOM 5141  C CA   . ALA A 1 48  ? -5.886  5.036   -2.891  1.00 0.00 ? 48  ALA A CA   4  
ATOM 5142  C C    . ALA A 1 48  ? -6.340  3.579   -2.770  1.00 0.00 ? 48  ALA A C    4  
ATOM 5143  O O    . ALA A 1 48  ? -5.866  2.715   -3.506  1.00 0.00 ? 48  ALA A O    4  
ATOM 5144  C CB   . ALA A 1 48  ? -5.416  5.613   -1.554  1.00 0.00 ? 48  ALA A CB   4  
ATOM 5145  H H    . ALA A 1 48  ? -7.121  6.712   -2.942  1.00 0.00 ? 48  ALA A H    4  
ATOM 5146  H HA   . ALA A 1 48  ? -5.066  5.094   -3.606  1.00 0.00 ? 48  ALA A HA   4  
ATOM 5147  H HB1  . ALA A 1 48  ? -4.600  6.314   -1.728  1.00 0.00 ? 48  ALA A HB1  4  
ATOM 5148  H HB2  . ALA A 1 48  ? -6.244  6.132   -1.071  1.00 0.00 ? 48  ALA A HB2  4  
ATOM 5149  H HB3  . ALA A 1 48  ? -5.070  4.804   -0.911  1.00 0.00 ? 48  ALA A HB3  4  
ATOM 5150  N N    . GLU A 1 49  ? -7.252  3.353   -1.836  1.00 0.00 ? 49  GLU A N    4  
ATOM 5151  C CA   . GLU A 1 49  ? -7.774  2.016   -1.609  1.00 0.00 ? 49  GLU A CA   4  
ATOM 5152  C C    . GLU A 1 49  ? -8.240  1.398   -2.929  1.00 0.00 ? 49  GLU A C    4  
ATOM 5153  O O    . GLU A 1 49  ? -8.320  0.176   -3.052  1.00 0.00 ? 49  GLU A O    4  
ATOM 5154  C CB   . GLU A 1 49  ? -8.909  2.038   -0.583  1.00 0.00 ? 49  GLU A CB   4  
ATOM 5155  C CG   . GLU A 1 49  ? -9.296  0.618   -0.163  1.00 0.00 ? 49  GLU A CG   4  
ATOM 5156  C CD   . GLU A 1 49  ? -8.536  0.192   1.095   1.00 0.00 ? 49  GLU A CD   4  
ATOM 5157  O OE1  . GLU A 1 49  ? -7.425  -0.355  0.928   1.00 0.00 ? 49  GLU A OE1  4  
ATOM 5158  O OE2  . GLU A 1 49  ? -9.084  0.423   2.194   1.00 0.00 ? 49  GLU A OE2  4  
ATOM 5159  H H    . GLU A 1 49  ? -7.631  4.061   -1.241  1.00 0.00 ? 49  GLU A H    4  
ATOM 5160  H HA   . GLU A 1 49  ? -6.939  1.443   -1.207  1.00 0.00 ? 49  GLU A HA   4  
ATOM 5161  H HB2  . GLU A 1 49  ? -8.601  2.608   0.293   1.00 0.00 ? 49  GLU A HB2  4  
ATOM 5162  H HB3  . GLU A 1 49  ? -9.776  2.545   -1.005  1.00 0.00 ? 49  GLU A HB3  4  
ATOM 5163  H HG2  . GLU A 1 49  ? -10.369 0.569   0.021   1.00 0.00 ? 49  GLU A HG2  4  
ATOM 5164  H HG3  . GLU A 1 49  ? -9.080  -0.076  -0.975  1.00 0.00 ? 49  GLU A HG3  4  
ATOM 5165  N N    . LYS A 1 50  ? -8.536  2.269   -3.882  1.00 0.00 ? 50  LYS A N    4  
ATOM 5166  C CA   . LYS A 1 50  ? -8.992  1.824   -5.188  1.00 0.00 ? 50  LYS A CA   4  
ATOM 5167  C C    . LYS A 1 50  ? -7.786  1.390   -6.024  1.00 0.00 ? 50  LYS A C    4  
ATOM 5168  O O    . LYS A 1 50  ? -7.888  0.474   -6.839  1.00 0.00 ? 50  LYS A O    4  
ATOM 5169  C CB   . LYS A 1 50  ? -9.845  2.904   -5.855  1.00 0.00 ? 50  LYS A CB   4  
ATOM 5170  C CG   . LYS A 1 50  ? -9.549  2.990   -7.353  1.00 0.00 ? 50  LYS A CG   4  
ATOM 5171  C CD   . LYS A 1 50  ? -10.617 3.811   -8.077  1.00 0.00 ? 50  LYS A CD   4  
ATOM 5172  C CE   . LYS A 1 50  ? -10.998 3.163   -9.410  1.00 0.00 ? 50  LYS A CE   4  
ATOM 5173  N NZ   . LYS A 1 50  ? -11.436 4.191   -10.380 1.00 0.00 ? 50  LYS A NZ   4  
ATOM 5174  H H    . LYS A 1 50  ? -8.468  3.261   -3.774  1.00 0.00 ? 50  LYS A H    4  
ATOM 5175  H HA   . LYS A 1 50  ? -9.634  0.957   -5.032  1.00 0.00 ? 50  LYS A HA   4  
ATOM 5176  H HB2  . LYS A 1 50  ? -10.902 2.685   -5.702  1.00 0.00 ? 50  LYS A HB2  4  
ATOM 5177  H HB3  . LYS A 1 50  ? -9.649  3.868   -5.386  1.00 0.00 ? 50  LYS A HB3  4  
ATOM 5178  H HG2  . LYS A 1 50  ? -8.570  3.444   -7.508  1.00 0.00 ? 50  LYS A HG2  4  
ATOM 5179  H HG3  . LYS A 1 50  ? -9.506  1.987   -7.777  1.00 0.00 ? 50  LYS A HG3  4  
ATOM 5180  H HD2  . LYS A 1 50  ? -11.502 3.901   -7.447  1.00 0.00 ? 50  LYS A HD2  4  
ATOM 5181  H HD3  . LYS A 1 50  ? -10.248 4.822   -8.253  1.00 0.00 ? 50  LYS A HD3  4  
ATOM 5182  H HE2  . LYS A 1 50  ? -10.145 2.615   -9.811  1.00 0.00 ? 50  LYS A HE2  4  
ATOM 5183  H HE3  . LYS A 1 50  ? -11.797 2.438   -9.253  1.00 0.00 ? 50  LYS A HE3  4  
ATOM 5184  H HZ1  . LYS A 1 50  ? -11.854 3.745   -11.172 1.00 0.00 ? 50  LYS A HZ1  4  
ATOM 5185  H HZ2  . LYS A 1 50  ? -12.105 4.795   -9.947  1.00 0.00 ? 50  LYS A HZ2  4  
ATOM 5186  H HZ3  . LYS A 1 50  ? -10.646 4.727   -10.678 1.00 0.00 ? 50  LYS A HZ3  4  
ATOM 5187  N N    . GLU A 1 51  ? -6.671  2.068   -5.793  1.00 0.00 ? 51  GLU A N    4  
ATOM 5188  C CA   . GLU A 1 51  ? -5.447  1.764   -6.514  1.00 0.00 ? 51  GLU A CA   4  
ATOM 5189  C C    . GLU A 1 51  ? -4.779  0.519   -5.926  1.00 0.00 ? 51  GLU A C    4  
ATOM 5190  O O    . GLU A 1 51  ? -3.851  -0.030  -6.517  1.00 0.00 ? 51  GLU A O    4  
ATOM 5191  C CB   . GLU A 1 51  ? -4.491  2.958   -6.499  1.00 0.00 ? 51  GLU A CB   4  
ATOM 5192  C CG   . GLU A 1 51  ? -5.161  4.205   -7.080  1.00 0.00 ? 51  GLU A CG   4  
ATOM 5193  C CD   . GLU A 1 51  ? -5.139  4.177   -8.609  1.00 0.00 ? 51  GLU A CD   4  
ATOM 5194  O OE1  . GLU A 1 51  ? -4.023  4.283   -9.163  1.00 0.00 ? 51  GLU A OE1  4  
ATOM 5195  O OE2  . GLU A 1 51  ? -6.238  4.051   -9.191  1.00 0.00 ? 51  GLU A OE2  4  
ATOM 5196  H H    . GLU A 1 51  ? -6.596  2.811   -5.128  1.00 0.00 ? 51  GLU A H    4  
ATOM 5197  H HA   . GLU A 1 51  ? -5.757  1.568   -7.541  1.00 0.00 ? 51  GLU A HA   4  
ATOM 5198  H HB2  . GLU A 1 51  ? -4.168  3.157   -5.477  1.00 0.00 ? 51  GLU A HB2  4  
ATOM 5199  H HB3  . GLU A 1 51  ? -3.597  2.720   -7.075  1.00 0.00 ? 51  GLU A HB3  4  
ATOM 5200  H HG2  . GLU A 1 51  ? -6.191  4.265   -6.728  1.00 0.00 ? 51  GLU A HG2  4  
ATOM 5201  H HG3  . GLU A 1 51  ? -4.649  5.098   -6.721  1.00 0.00 ? 51  GLU A HG3  4  
ATOM 5202  N N    . GLY A 1 52  ? -5.278  0.110   -4.769  1.00 0.00 ? 52  GLY A N    4  
ATOM 5203  C CA   . GLY A 1 52  ? -4.742  -1.060  -4.094  1.00 0.00 ? 52  GLY A CA   4  
ATOM 5204  C C    . GLY A 1 52  ? -4.057  -0.670  -2.783  1.00 0.00 ? 52  GLY A C    4  
ATOM 5205  O O    . GLY A 1 52  ? -3.850  -1.514  -1.912  1.00 0.00 ? 52  GLY A O    4  
ATOM 5206  H H    . GLY A 1 52  ? -6.034  0.562   -4.295  1.00 0.00 ? 52  GLY A H    4  
ATOM 5207  H HA2  . GLY A 1 52  ? -5.545  -1.768  -3.893  1.00 0.00 ? 52  GLY A HA2  4  
ATOM 5208  H HA3  . GLY A 1 52  ? -4.028  -1.564  -4.746  1.00 0.00 ? 52  GLY A HA3  4  
ATOM 5209  N N    . LEU A 1 53  ? -3.724  0.608   -2.683  1.00 0.00 ? 53  LEU A N    4  
ATOM 5210  C CA   . LEU A 1 53  ? -3.066  1.120   -1.493  1.00 0.00 ? 53  LEU A CA   4  
ATOM 5211  C C    . LEU A 1 53  ? -3.767  0.567   -0.251  1.00 0.00 ? 53  LEU A C    4  
ATOM 5212  O O    . LEU A 1 53  ? -4.915  0.129   -0.324  1.00 0.00 ? 53  LEU A O    4  
ATOM 5213  C CB   . LEU A 1 53  ? -2.999  2.648   -1.533  1.00 0.00 ? 53  LEU A CB   4  
ATOM 5214  C CG   . LEU A 1 53  ? -1.709  3.277   -1.004  1.00 0.00 ? 53  LEU A CG   4  
ATOM 5215  C CD1  . LEU A 1 53  ? -0.694  3.477   -2.131  1.00 0.00 ? 53  LEU A CD1  4  
ATOM 5216  C CD2  . LEU A 1 53  ? -2.000  4.580   -0.257  1.00 0.00 ? 53  LEU A CD2  4  
ATOM 5217  H H    . LEU A 1 53  ? -3.896  1.288   -3.396  1.00 0.00 ? 53  LEU A H    4  
ATOM 5218  H HA   . LEU A 1 53  ? -2.040  0.752   -1.503  1.00 0.00 ? 53  LEU A HA   4  
ATOM 5219  H HB2  . LEU A 1 53  ? -3.142  2.972   -2.564  1.00 0.00 ? 53  LEU A HB2  4  
ATOM 5220  H HB3  . LEU A 1 53  ? -3.836  3.043   -0.956  1.00 0.00 ? 53  LEU A HB3  4  
ATOM 5221  H HG   . LEU A 1 53  ? -1.262  2.588   -0.287  1.00 0.00 ? 53  LEU A HG   4  
ATOM 5222  H HD11 . LEU A 1 53  ? -1.188  3.338   -3.093  1.00 0.00 ? 53  LEU A HD11 4  
ATOM 5223  H HD12 . LEU A 1 53  ? -0.284  4.485   -2.076  1.00 0.00 ? 53  LEU A HD12 4  
ATOM 5224  H HD13 . LEU A 1 53  ? 0.112   2.750   -2.028  1.00 0.00 ? 53  LEU A HD13 4  
ATOM 5225  H HD21 . LEU A 1 53  ? -1.145  4.840   0.367   1.00 0.00 ? 53  LEU A HD21 4  
ATOM 5226  H HD22 . LEU A 1 53  ? -2.181  5.379   -0.976  1.00 0.00 ? 53  LEU A HD22 4  
ATOM 5227  H HD23 . LEU A 1 53  ? -2.881  4.450   0.371   1.00 0.00 ? 53  LEU A HD23 4  
ATOM 5228  N N    . ARG A 1 54  ? -3.048  0.605   0.862   1.00 0.00 ? 54  ARG A N    4  
ATOM 5229  C CA   . ARG A 1 54  ? -3.588  0.113   2.118   1.00 0.00 ? 54  ARG A CA   4  
ATOM 5230  C C    . ARG A 1 54  ? -2.554  0.268   3.236   1.00 0.00 ? 54  ARG A C    4  
ATOM 5231  O O    . ARG A 1 54  ? -1.353  0.313   2.974   1.00 0.00 ? 54  ARG A O    4  
ATOM 5232  C CB   . ARG A 1 54  ? -3.991  -1.359  2.006   1.00 0.00 ? 54  ARG A CB   4  
ATOM 5233  C CG   . ARG A 1 54  ? -2.758  -2.264  1.973   1.00 0.00 ? 54  ARG A CG   4  
ATOM 5234  C CD   . ARG A 1 54  ? -2.016  -2.134  0.641   1.00 0.00 ? 54  ARG A CD   4  
ATOM 5235  N NE   . ARG A 1 54  ? -1.833  -3.469  0.031   1.00 0.00 ? 54  ARG A NE   4  
ATOM 5236  C CZ   . ARG A 1 54  ? -1.061  -4.433  0.550   1.00 0.00 ? 54  ARG A CZ   4  
ATOM 5237  N NH1  . ARG A 1 54  ? -0.396  -4.216  1.693   1.00 0.00 ? 54  ARG A NH1  4  
ATOM 5238  N NH2  . ARG A 1 54  ? -0.955  -5.615  -0.073  1.00 0.00 ? 54  ARG A NH2  4  
ATOM 5239  H H    . ARG A 1 54  ? -2.116  0.962   0.913   1.00 0.00 ? 54  ARG A H    4  
ATOM 5240  H HA   . ARG A 1 54  ? -4.465  0.732   2.306   1.00 0.00 ? 54  ARG A HA   4  
ATOM 5241  H HB2  . ARG A 1 54  ? -4.624  -1.632  2.850   1.00 0.00 ? 54  ARG A HB2  4  
ATOM 5242  H HB3  . ARG A 1 54  ? -4.581  -1.510  1.102   1.00 0.00 ? 54  ARG A HB3  4  
ATOM 5243  H HG2  . ARG A 1 54  ? -2.088  -2.003  2.793   1.00 0.00 ? 54  ARG A HG2  4  
ATOM 5244  H HG3  . ARG A 1 54  ? -3.059  -3.301  2.126   1.00 0.00 ? 54  ARG A HG3  4  
ATOM 5245  H HD2  . ARG A 1 54  ? -2.578  -1.489  -0.035  1.00 0.00 ? 54  ARG A HD2  4  
ATOM 5246  H HD3  . ARG A 1 54  ? -1.047  -1.661  0.800   1.00 0.00 ? 54  ARG A HD3  4  
ATOM 5247  H HE   . ARG A 1 54  ? -2.316  -3.664  -0.823  1.00 0.00 ? 54  ARG A HE   4  
ATOM 5248  H HH11 . ARG A 1 54  ? -0.476  -3.334  2.158   1.00 0.00 ? 54  ARG A HH11 4  
ATOM 5249  H HH12 . ARG A 1 54  ? 0.180   -4.935  2.081   1.00 0.00 ? 54  ARG A HH12 4  
ATOM 5250  H HH21 . ARG A 1 54  ? -1.451  -5.777  -0.926  1.00 0.00 ? 54  ARG A HH21 4  
ATOM 5251  H HH22 . ARG A 1 54  ? -0.378  -6.334  0.315   1.00 0.00 ? 54  ARG A HH22 4  
ATOM 5252  N N    . VAL A 1 55  ? -3.059  0.344   4.458   1.00 0.00 ? 55  VAL A N    4  
ATOM 5253  C CA   . VAL A 1 55  ? -2.195  0.493   5.617   1.00 0.00 ? 55  VAL A CA   4  
ATOM 5254  C C    . VAL A 1 55  ? -1.315  -0.751  5.754   1.00 0.00 ? 55  VAL A C    4  
ATOM 5255  O O    . VAL A 1 55  ? -1.821  -1.858  5.932   1.00 0.00 ? 55  VAL A O    4  
ATOM 5256  C CB   . VAL A 1 55  ? -3.036  0.771   6.865   1.00 0.00 ? 55  VAL A CB   4  
ATOM 5257  C CG1  . VAL A 1 55  ? -2.172  0.734   8.127   1.00 0.00 ? 55  VAL A CG1  4  
ATOM 5258  C CG2  . VAL A 1 55  ? -3.772  2.106   6.743   1.00 0.00 ? 55  VAL A CG2  4  
ATOM 5259  H H    . VAL A 1 55  ? -4.037  0.306   4.663   1.00 0.00 ? 55  VAL A H    4  
ATOM 5260  H HA   . VAL A 1 55  ? -1.555  1.357   5.441   1.00 0.00 ? 55  VAL A HA   4  
ATOM 5261  H HB   . VAL A 1 55  ? -3.784  -0.018  6.947   1.00 0.00 ? 55  VAL A HB   4  
ATOM 5262  H HG11 . VAL A 1 55  ? -1.433  -0.062  8.038   1.00 0.00 ? 55  VAL A HG11 4  
ATOM 5263  H HG12 . VAL A 1 55  ? -1.663  1.690   8.247   1.00 0.00 ? 55  VAL A HG12 4  
ATOM 5264  H HG13 . VAL A 1 55  ? -2.805  0.547   8.995   1.00 0.00 ? 55  VAL A HG13 4  
ATOM 5265  H HG21 . VAL A 1 55  ? -4.436  2.077   5.879   1.00 0.00 ? 55  VAL A HG21 4  
ATOM 5266  H HG22 . VAL A 1 55  ? -4.358  2.282   7.645   1.00 0.00 ? 55  VAL A HG22 4  
ATOM 5267  H HG23 . VAL A 1 55  ? -3.048  2.911   6.618   1.00 0.00 ? 55  VAL A HG23 4  
ATOM 5268  N N    . GLY A 1 56  ? -0.012  -0.528  5.667   1.00 0.00 ? 56  GLY A N    4  
ATOM 5269  C CA   . GLY A 1 56  ? 0.944   -1.617  5.779   1.00 0.00 ? 56  GLY A CA   4  
ATOM 5270  C C    . GLY A 1 56  ? 1.978   -1.558  4.653   1.00 0.00 ? 56  GLY A C    4  
ATOM 5271  O O    . GLY A 1 56  ? 3.100   -2.037  4.809   1.00 0.00 ? 56  GLY A O    4  
ATOM 5272  H H    . GLY A 1 56  ? 0.392   0.375   5.522   1.00 0.00 ? 56  GLY A H    4  
ATOM 5273  H HA2  . GLY A 1 56  ? 1.448   -1.565  6.744   1.00 0.00 ? 56  GLY A HA2  4  
ATOM 5274  H HA3  . GLY A 1 56  ? 0.418   -2.571  5.745   1.00 0.00 ? 56  GLY A HA3  4  
ATOM 5275  N N    . ASP A 1 57  ? 1.563   -0.965  3.543   1.00 0.00 ? 57  ASP A N    4  
ATOM 5276  C CA   . ASP A 1 57  ? 2.439   -0.837  2.391   1.00 0.00 ? 57  ASP A CA   4  
ATOM 5277  C C    . ASP A 1 57  ? 3.708   -0.088  2.801   1.00 0.00 ? 57  ASP A C    4  
ATOM 5278  O O    . ASP A 1 57  ? 3.861   0.292   3.961   1.00 0.00 ? 57  ASP A O    4  
ATOM 5279  C CB   . ASP A 1 57  ? 1.763   -0.044  1.270   1.00 0.00 ? 57  ASP A CB   4  
ATOM 5280  C CG   . ASP A 1 57  ? 1.166   -0.893  0.146   1.00 0.00 ? 57  ASP A CG   4  
ATOM 5281  O OD1  . ASP A 1 57  ? 1.306   -2.132  0.235   1.00 0.00 ? 57  ASP A OD1  4  
ATOM 5282  O OD2  . ASP A 1 57  ? 0.583   -0.284  -0.776  1.00 0.00 ? 57  ASP A OD2  4  
ATOM 5283  H H    . ASP A 1 57  ? 0.648   -0.578  3.423   1.00 0.00 ? 57  ASP A H    4  
ATOM 5284  H HA   . ASP A 1 57  ? 2.643   -1.859  2.071   1.00 0.00 ? 57  ASP A HA   4  
ATOM 5285  H HB2  . ASP A 1 57  ? 0.971   0.566   1.704   1.00 0.00 ? 57  ASP A HB2  4  
ATOM 5286  H HB3  . ASP A 1 57  ? 2.493   0.641   0.839   1.00 0.00 ? 57  ASP A HB3  4  
ATOM 5287  N N    . GLN A 1 58  ? 4.586   0.102   1.827   1.00 0.00 ? 58  GLN A N    4  
ATOM 5288  C CA   . GLN A 1 58  ? 5.837   0.799   2.073   1.00 0.00 ? 58  GLN A CA   4  
ATOM 5289  C C    . GLN A 1 58  ? 6.151   1.750   0.916   1.00 0.00 ? 58  GLN A C    4  
ATOM 5290  O O    . GLN A 1 58  ? 6.468   1.307   -0.187  1.00 0.00 ? 58  GLN A O    4  
ATOM 5291  C CB   . GLN A 1 58  ? 6.982   -0.191  2.296   1.00 0.00 ? 58  GLN A CB   4  
ATOM 5292  C CG   . GLN A 1 58  ? 8.297   0.543   2.565   1.00 0.00 ? 58  GLN A CG   4  
ATOM 5293  C CD   . GLN A 1 58  ? 9.433   -0.447  2.830   1.00 0.00 ? 58  GLN A CD   4  
ATOM 5294  O OE1  . GLN A 1 58  ? 9.329   -1.634  2.570   1.00 0.00 ? 58  GLN A OE1  4  
ATOM 5295  N NE2  . GLN A 1 58  ? 10.520  0.107   3.359   1.00 0.00 ? 58  GLN A NE2  4  
ATOM 5296  H H    . GLN A 1 58  ? 4.454   -0.210  0.887   1.00 0.00 ? 58  GLN A H    4  
ATOM 5297  H HA   . GLN A 1 58  ? 5.676   1.370   2.987   1.00 0.00 ? 58  GLN A HA   4  
ATOM 5298  H HB2  . GLN A 1 58  ? 6.746   -0.842  3.137   1.00 0.00 ? 58  GLN A HB2  4  
ATOM 5299  H HB3  . GLN A 1 58  ? 7.091   -0.829  1.419   1.00 0.00 ? 58  GLN A HB3  4  
ATOM 5300  H HG2  . GLN A 1 58  ? 8.549   1.172   1.711   1.00 0.00 ? 58  GLN A HG2  4  
ATOM 5301  H HG3  . GLN A 1 58  ? 8.179   1.205   3.424   1.00 0.00 ? 58  GLN A HG3  4  
ATOM 5302  H HE21 . GLN A 1 58  ? 10.541  1.088   3.548   1.00 0.00 ? 58  GLN A HE21 4  
ATOM 5303  H HE22 . GLN A 1 58  ? 11.318  -0.459  3.569   1.00 0.00 ? 58  GLN A HE22 4  
ATOM 5304  N N    . ILE A 1 59  ? 6.052   3.038   1.207   1.00 0.00 ? 59  ILE A N    4  
ATOM 5305  C CA   . ILE A 1 59  ? 6.321   4.055   0.205   1.00 0.00 ? 59  ILE A CA   4  
ATOM 5306  C C    . ILE A 1 59  ? 7.829   4.139   -0.038  1.00 0.00 ? 59  ILE A C    4  
ATOM 5307  O O    . ILE A 1 59  ? 8.508   4.988   0.538   1.00 0.00 ? 59  ILE A O    4  
ATOM 5308  C CB   . ILE A 1 59  ? 5.688   5.388   0.610   1.00 0.00 ? 59  ILE A CB   4  
ATOM 5309  C CG1  . ILE A 1 59  ? 4.206   5.212   0.946   1.00 0.00 ? 59  ILE A CG1  4  
ATOM 5310  C CG2  . ILE A 1 59  ? 5.909   6.450   -0.470  1.00 0.00 ? 59  ILE A CG2  4  
ATOM 5311  C CD1  . ILE A 1 59  ? 3.376   5.007   -0.323  1.00 0.00 ? 59  ILE A CD1  4  
ATOM 5312  H H    . ILE A 1 59  ? 5.793   3.390   2.107   1.00 0.00 ? 59  ILE A H    4  
ATOM 5313  H HA   . ILE A 1 59  ? 5.840   3.738   -0.720  1.00 0.00 ? 59  ILE A HA   4  
ATOM 5314  H HB   . ILE A 1 59  ? 6.184   5.741   1.514   1.00 0.00 ? 59  ILE A HB   4  
ATOM 5315  H HG12 . ILE A 1 59  ? 4.080   4.356   1.609   1.00 0.00 ? 59  ILE A HG12 4  
ATOM 5316  H HG13 . ILE A 1 59  ? 3.845   6.088   1.484   1.00 0.00 ? 59  ILE A HG13 4  
ATOM 5317  H HG21 . ILE A 1 59  ? 4.956   6.695   -0.938  1.00 0.00 ? 59  ILE A HG21 4  
ATOM 5318  H HG22 . ILE A 1 59  ? 6.332   7.346   -0.016  1.00 0.00 ? 59  ILE A HG22 4  
ATOM 5319  H HG23 . ILE A 1 59  ? 6.596   6.065   -1.223  1.00 0.00 ? 59  ILE A HG23 4  
ATOM 5320  H HD11 . ILE A 1 59  ? 4.042   4.843   -1.170  1.00 0.00 ? 59  ILE A HD11 4  
ATOM 5321  H HD12 . ILE A 1 59  ? 2.728   4.140   -0.198  1.00 0.00 ? 59  ILE A HD12 4  
ATOM 5322  H HD13 . ILE A 1 59  ? 2.767   5.892   -0.505  1.00 0.00 ? 59  ILE A HD13 4  
ATOM 5323  N N    . LEU A 1 60  ? 8.310   3.247   -0.891  1.00 0.00 ? 60  LEU A N    4  
ATOM 5324  C CA   . LEU A 1 60  ? 9.726   3.209   -1.217  1.00 0.00 ? 60  LEU A CA   4  
ATOM 5325  C C    . LEU A 1 60  ? 10.139  4.548   -1.832  1.00 0.00 ? 60  LEU A C    4  
ATOM 5326  O O    . LEU A 1 60  ? 10.993  5.247   -1.290  1.00 0.00 ? 60  LEU A O    4  
ATOM 5327  C CB   . LEU A 1 60  ? 10.040  2.002   -2.103  1.00 0.00 ? 60  LEU A CB   4  
ATOM 5328  C CG   . LEU A 1 60  ? 9.516   0.652   -1.607  1.00 0.00 ? 60  LEU A CG   4  
ATOM 5329  C CD1  . LEU A 1 60  ? 9.694   -0.430  -2.674  1.00 0.00 ? 60  LEU A CD1  4  
ATOM 5330  C CD2  . LEU A 1 60  ? 10.172  0.263   -0.281  1.00 0.00 ? 60  LEU A CD2  4  
ATOM 5331  H H    . LEU A 1 60  ? 7.751   2.560   -1.355  1.00 0.00 ? 60  LEU A H    4  
ATOM 5332  H HA   . LEU A 1 60  ? 10.272  3.075   -0.283  1.00 0.00 ? 60  LEU A HA   4  
ATOM 5333  H HB2  . LEU A 1 60  ? 9.628   2.187   -3.095  1.00 0.00 ? 60  LEU A HB2  4  
ATOM 5334  H HB3  . LEU A 1 60  ? 11.122  1.930   -2.215  1.00 0.00 ? 60  LEU A HB3  4  
ATOM 5335  H HG   . LEU A 1 60  ? 8.447   0.748   -1.422  1.00 0.00 ? 60  LEU A HG   4  
ATOM 5336  H HD11 . LEU A 1 60  ? 8.749   -0.587  -3.194  1.00 0.00 ? 60  LEU A HD11 4  
ATOM 5337  H HD12 . LEU A 1 60  ? 10.454  -0.114  -3.389  1.00 0.00 ? 60  LEU A HD12 4  
ATOM 5338  H HD13 . LEU A 1 60  ? 10.007  -1.360  -2.200  1.00 0.00 ? 60  LEU A HD13 4  
ATOM 5339  H HD21 . LEU A 1 60  ? 10.450  1.164   0.265   1.00 0.00 ? 60  LEU A HD21 4  
ATOM 5340  H HD22 . LEU A 1 60  ? 9.470   -0.321  0.314   1.00 0.00 ? 60  LEU A HD22 4  
ATOM 5341  H HD23 . LEU A 1 60  ? 11.064  -0.332  -0.478  1.00 0.00 ? 60  LEU A HD23 4  
ATOM 5342  N N    . ARG A 1 61  ? 9.513   4.864   -2.956  1.00 0.00 ? 61  ARG A N    4  
ATOM 5343  C CA   . ARG A 1 61  ? 9.805   6.106   -3.651  1.00 0.00 ? 61  ARG A CA   4  
ATOM 5344  C C    . ARG A 1 61  ? 8.594   7.040   -3.600  1.00 0.00 ? 61  ARG A C    4  
ATOM 5345  O O    . ARG A 1 61  ? 7.480   6.603   -3.315  1.00 0.00 ? 61  ARG A O    4  
ATOM 5346  C CB   . ARG A 1 61  ? 10.177  5.845   -5.112  1.00 0.00 ? 61  ARG A CB   4  
ATOM 5347  C CG   . ARG A 1 61  ? 11.675  5.568   -5.256  1.00 0.00 ? 61  ARG A CG   4  
ATOM 5348  C CD   . ARG A 1 61  ? 11.976  4.852   -6.574  1.00 0.00 ? 61  ARG A CD   4  
ATOM 5349  N NE   . ARG A 1 61  ? 12.404  3.460   -6.307  1.00 0.00 ? 61  ARG A NE   4  
ATOM 5350  C CZ   . ARG A 1 61  ? 12.503  2.512   -7.248  1.00 0.00 ? 61  ARG A CZ   4  
ATOM 5351  N NH1  . ARG A 1 61  ? 12.205  2.799   -8.523  1.00 0.00 ? 61  ARG A NH1  4  
ATOM 5352  N NH2  . ARG A 1 61  ? 12.900  1.276   -6.915  1.00 0.00 ? 61  ARG A NH2  4  
ATOM 5353  H H    . ARG A 1 61  ? 8.819   4.289   -3.391  1.00 0.00 ? 61  ARG A H    4  
ATOM 5354  H HA   . ARG A 1 61  ? 10.653  6.533   -3.116  1.00 0.00 ? 61  ARG A HA   4  
ATOM 5355  H HB2  . ARG A 1 61  ? 9.608   4.996   -5.490  1.00 0.00 ? 61  ARG A HB2  4  
ATOM 5356  H HB3  . ARG A 1 61  ? 9.903   6.708   -5.721  1.00 0.00 ? 61  ARG A HB3  4  
ATOM 5357  H HG2  . ARG A 1 61  ? 12.228  6.506   -5.213  1.00 0.00 ? 61  ARG A HG2  4  
ATOM 5358  H HG3  . ARG A 1 61  ? 12.017  4.958   -4.420  1.00 0.00 ? 61  ARG A HG3  4  
ATOM 5359  H HD2  . ARG A 1 61  ? 11.090  4.853   -7.209  1.00 0.00 ? 61  ARG A HD2  4  
ATOM 5360  H HD3  . ARG A 1 61  ? 12.758  5.384   -7.116  1.00 0.00 ? 61  ARG A HD3  4  
ATOM 5361  H HE   . ARG A 1 61  ? 12.634  3.213   -5.366  1.00 0.00 ? 61  ARG A HE   4  
ATOM 5362  H HH11 . ARG A 1 61  ? 11.909  3.721   -8.772  1.00 0.00 ? 61  ARG A HH11 4  
ATOM 5363  H HH12 . ARG A 1 61  ? 12.279  2.090   -9.225  1.00 0.00 ? 61  ARG A HH12 4  
ATOM 5364  H HH21 . ARG A 1 61  ? 13.122  1.062   -5.964  1.00 0.00 ? 61  ARG A HH21 4  
ATOM 5365  H HH22 . ARG A 1 61  ? 12.973  0.568   -7.617  1.00 0.00 ? 61  ARG A HH22 4  
ATOM 5366  N N    . VAL A 1 62  ? 8.854   8.309   -3.879  1.00 0.00 ? 62  VAL A N    4  
ATOM 5367  C CA   . VAL A 1 62  ? 7.799   9.309   -3.868  1.00 0.00 ? 62  VAL A CA   4  
ATOM 5368  C C    . VAL A 1 62  ? 8.014   10.284  -5.027  1.00 0.00 ? 62  VAL A C    4  
ATOM 5369  O O    . VAL A 1 62  ? 8.993   11.028  -5.043  1.00 0.00 ? 62  VAL A O    4  
ATOM 5370  C CB   . VAL A 1 62  ? 7.750   10.002  -2.505  1.00 0.00 ? 62  VAL A CB   4  
ATOM 5371  C CG1  . VAL A 1 62  ? 8.776   11.134  -2.428  1.00 0.00 ? 62  VAL A CG1  4  
ATOM 5372  C CG2  . VAL A 1 62  ? 6.341   10.517  -2.202  1.00 0.00 ? 62  VAL A CG2  4  
ATOM 5373  H H    . VAL A 1 62  ? 9.763   8.656   -4.110  1.00 0.00 ? 62  VAL A H    4  
ATOM 5374  H HA   . VAL A 1 62  ? 6.852   8.790   -4.017  1.00 0.00 ? 62  VAL A HA   4  
ATOM 5375  H HB   . VAL A 1 62  ? 8.007   9.265   -1.744  1.00 0.00 ? 62  VAL A HB   4  
ATOM 5376  H HG11 . VAL A 1 62  ? 8.477   11.941  -3.098  1.00 0.00 ? 62  VAL A HG11 4  
ATOM 5377  H HG12 . VAL A 1 62  ? 8.826   11.511  -1.406  1.00 0.00 ? 62  VAL A HG12 4  
ATOM 5378  H HG13 . VAL A 1 62  ? 9.755   10.759  -2.725  1.00 0.00 ? 62  VAL A HG13 4  
ATOM 5379  H HG21 . VAL A 1 62  ? 6.052   10.213  -1.196  1.00 0.00 ? 62  VAL A HG21 4  
ATOM 5380  H HG22 . VAL A 1 62  ? 6.329   11.604  -2.271  1.00 0.00 ? 62  VAL A HG22 4  
ATOM 5381  H HG23 . VAL A 1 62  ? 5.639   10.099  -2.923  1.00 0.00 ? 62  VAL A HG23 4  
ATOM 5382  N N    . ASN A 1 63  ? 7.084   10.248  -5.969  1.00 0.00 ? 63  ASN A N    4  
ATOM 5383  C CA   . ASN A 1 63  ? 7.159   11.119  -7.129  1.00 0.00 ? 63  ASN A CA   4  
ATOM 5384  C C    . ASN A 1 63  ? 8.312   10.666  -8.028  1.00 0.00 ? 63  ASN A C    4  
ATOM 5385  O O    . ASN A 1 63  ? 8.093   10.266  -9.170  1.00 0.00 ? 63  ASN A O    4  
ATOM 5386  C CB   . ASN A 1 63  ? 7.425   12.568  -6.714  1.00 0.00 ? 63  ASN A CB   4  
ATOM 5387  C CG   . ASN A 1 63  ? 7.068   13.536  -7.844  1.00 0.00 ? 63  ASN A CG   4  
ATOM 5388  O OD1  . ASN A 1 63  ? 7.923   14.103  -8.503  1.00 0.00 ? 63  ASN A OD1  4  
ATOM 5389  N ND2  . ASN A 1 63  ? 5.760   13.693  -8.029  1.00 0.00 ? 63  ASN A ND2  4  
ATOM 5390  H H    . ASN A 1 63  ? 6.290   9.639   -5.949  1.00 0.00 ? 63  ASN A H    4  
ATOM 5391  H HA   . ASN A 1 63  ? 6.189   11.030  -7.618  1.00 0.00 ? 63  ASN A HA   4  
ATOM 5392  H HB2  . ASN A 1 63  ? 6.840   12.808  -5.826  1.00 0.00 ? 63  ASN A HB2  4  
ATOM 5393  H HB3  . ASN A 1 63  ? 8.475   12.686  -6.447  1.00 0.00 ? 63  ASN A HB3  4  
ATOM 5394  H HD21 . ASN A 1 63  ? 5.111   13.198  -7.452  1.00 0.00 ? 63  ASN A HD21 4  
ATOM 5395  H HD22 . ASN A 1 63  ? 5.427   14.307  -8.744  1.00 0.00 ? 63  ASN A HD22 4  
ATOM 5396  N N    . ASP A 1 64  ? 9.515   10.745  -7.478  1.00 0.00 ? 64  ASP A N    4  
ATOM 5397  C CA   . ASP A 1 64  ? 10.702  10.348  -8.215  1.00 0.00 ? 64  ASP A CA   4  
ATOM 5398  C C    . ASP A 1 64  ? 11.819  10.004  -7.228  1.00 0.00 ? 64  ASP A C    4  
ATOM 5399  O O    . ASP A 1 64  ? 12.498  8.990   -7.381  1.00 0.00 ? 64  ASP A O    4  
ATOM 5400  C CB   . ASP A 1 64  ? 11.197  11.482  -9.114  1.00 0.00 ? 64  ASP A CB   4  
ATOM 5401  C CG   . ASP A 1 64  ? 12.657  11.366  -9.557  1.00 0.00 ? 64  ASP A CG   4  
ATOM 5402  O OD1  . ASP A 1 64  ? 13.524  11.822  -8.781  1.00 0.00 ? 64  ASP A OD1  4  
ATOM 5403  O OD2  . ASP A 1 64  ? 12.873  10.823  -10.662 1.00 0.00 ? 64  ASP A OD2  4  
ATOM 5404  H H    . ASP A 1 64  ? 9.684   11.071  -6.548  1.00 0.00 ? 64  ASP A H    4  
ATOM 5405  H HA   . ASP A 1 64  ? 10.395  9.489   -8.812  1.00 0.00 ? 64  ASP A HA   4  
ATOM 5406  H HB2  . ASP A 1 64  ? 10.566  11.525  -10.001 1.00 0.00 ? 64  ASP A HB2  4  
ATOM 5407  H HB3  . ASP A 1 64  ? 11.068  12.427  -8.585  1.00 0.00 ? 64  ASP A HB3  4  
ATOM 5408  N N    . LYS A 1 65  ? 11.976  10.869  -6.236  1.00 0.00 ? 65  LYS A N    4  
ATOM 5409  C CA   . LYS A 1 65  ? 12.999  10.670  -5.224  1.00 0.00 ? 65  LYS A CA   4  
ATOM 5410  C C    . LYS A 1 65  ? 12.648  9.439   -4.386  1.00 0.00 ? 65  LYS A C    4  
ATOM 5411  O O    . LYS A 1 65  ? 11.487  9.038   -4.321  1.00 0.00 ? 65  LYS A O    4  
ATOM 5412  C CB   . LYS A 1 65  ? 13.189  11.944  -4.397  1.00 0.00 ? 65  LYS A CB   4  
ATOM 5413  C CG   . LYS A 1 65  ? 14.186  12.890  -5.070  1.00 0.00 ? 65  LYS A CG   4  
ATOM 5414  C CD   . LYS A 1 65  ? 14.810  13.845  -4.050  1.00 0.00 ? 65  LYS A CD   4  
ATOM 5415  C CE   . LYS A 1 65  ? 14.450  15.297  -4.368  1.00 0.00 ? 65  LYS A CE   4  
ATOM 5416  N NZ   . LYS A 1 65  ? 15.644  16.037  -4.834  1.00 0.00 ? 65  LYS A NZ   4  
ATOM 5417  H H    . LYS A 1 65  ? 11.419  11.692  -6.119  1.00 0.00 ? 65  LYS A H    4  
ATOM 5418  H HA   . LYS A 1 65  ? 13.938  10.479  -5.742  1.00 0.00 ? 65  LYS A HA   4  
ATOM 5419  H HB2  . LYS A 1 65  ? 12.231  12.448  -4.273  1.00 0.00 ? 65  LYS A HB2  4  
ATOM 5420  H HB3  . LYS A 1 65  ? 13.545  11.684  -3.400  1.00 0.00 ? 65  LYS A HB3  4  
ATOM 5421  H HG2  . LYS A 1 65  ? 14.970  12.311  -5.558  1.00 0.00 ? 65  LYS A HG2  4  
ATOM 5422  H HG3  . LYS A 1 65  ? 13.682  13.462  -5.848  1.00 0.00 ? 65  LYS A HG3  4  
ATOM 5423  H HD2  . LYS A 1 65  ? 14.461  13.591  -3.048  1.00 0.00 ? 65  LYS A HD2  4  
ATOM 5424  H HD3  . LYS A 1 65  ? 15.893  13.726  -4.050  1.00 0.00 ? 65  LYS A HD3  4  
ATOM 5425  H HE2  . LYS A 1 65  ? 13.674  15.327  -5.133  1.00 0.00 ? 65  LYS A HE2  4  
ATOM 5426  H HE3  . LYS A 1 65  ? 14.041  15.780  -3.480  1.00 0.00 ? 65  LYS A HE3  4  
ATOM 5427  H HZ1  . LYS A 1 65  ? 15.928  15.683  -5.726  1.00 0.00 ? 65  LYS A HZ1  4  
ATOM 5428  H HZ2  . LYS A 1 65  ? 15.424  17.009  -4.916  1.00 0.00 ? 65  LYS A HZ2  4  
ATOM 5429  H HZ3  . LYS A 1 65  ? 16.388  15.917  -4.177  1.00 0.00 ? 65  LYS A HZ3  4  
ATOM 5430  N N    . SER A 1 66  ? 13.673  8.875   -3.765  1.00 0.00 ? 66  SER A N    4  
ATOM 5431  C CA   . SER A 1 66  ? 13.488  7.698   -2.933  1.00 0.00 ? 66  SER A CA   4  
ATOM 5432  C C    . SER A 1 66  ? 13.716  8.054   -1.463  1.00 0.00 ? 66  SER A C    4  
ATOM 5433  O O    . SER A 1 66  ? 14.778  8.560   -1.101  1.00 0.00 ? 66  SER A O    4  
ATOM 5434  C CB   . SER A 1 66  ? 14.430  6.569   -3.358  1.00 0.00 ? 66  SER A CB   4  
ATOM 5435  O OG   . SER A 1 66  ? 15.795  6.977   -3.336  1.00 0.00 ? 66  SER A OG   4  
ATOM 5436  H H    . SER A 1 66  ? 14.614  9.207   -3.823  1.00 0.00 ? 66  SER A H    4  
ATOM 5437  H HA   . SER A 1 66  ? 12.455  7.389   -3.096  1.00 0.00 ? 66  SER A HA   4  
ATOM 5438  H HB2  . SER A 1 66  ? 14.296  5.716   -2.693  1.00 0.00 ? 66  SER A HB2  4  
ATOM 5439  H HB3  . SER A 1 66  ? 14.167  6.236   -4.361  1.00 0.00 ? 66  SER A HB3  4  
ATOM 5440  H HG   . SER A 1 66  ? 16.340  6.378   -3.922  1.00 0.00 ? 66  SER A HG   4  
ATOM 5441  N N    . LEU A 1 67  ? 12.703  7.777   -0.655  1.00 0.00 ? 67  LEU A N    4  
ATOM 5442  C CA   . LEU A 1 67  ? 12.780  8.062   0.767   1.00 0.00 ? 67  LEU A CA   4  
ATOM 5443  C C    . LEU A 1 67  ? 13.497  6.911   1.476   1.00 0.00 ? 67  LEU A C    4  
ATOM 5444  O O    . LEU A 1 67  ? 12.996  6.378   2.465   1.00 0.00 ? 67  LEU A O    4  
ATOM 5445  C CB   . LEU A 1 67  ? 11.389  8.360   1.330   1.00 0.00 ? 67  LEU A CB   4  
ATOM 5446  C CG   . LEU A 1 67  ? 10.418  9.064   0.380   1.00 0.00 ? 67  LEU A CG   4  
ATOM 5447  C CD1  . LEU A 1 67  ? 11.148  10.088  -0.491  1.00 0.00 ? 67  LEU A CD1  4  
ATOM 5448  C CD2  . LEU A 1 67  ? 9.639   8.049   -0.459  1.00 0.00 ? 67  LEU A CD2  4  
ATOM 5449  H H    . LEU A 1 67  ? 11.843  7.365   -0.958  1.00 0.00 ? 67  LEU A H    4  
ATOM 5450  H HA   . LEU A 1 67  ? 13.377  8.967   0.887   1.00 0.00 ? 67  LEU A HA   4  
ATOM 5451  H HB2  . LEU A 1 67  ? 10.938  7.419   1.648   1.00 0.00 ? 67  LEU A HB2  4  
ATOM 5452  H HB3  . LEU A 1 67  ? 11.504  8.975   2.222   1.00 0.00 ? 67  LEU A HB3  4  
ATOM 5453  H HG   . LEU A 1 67  ? 9.690   9.611   0.980   1.00 0.00 ? 67  LEU A HG   4  
ATOM 5454  H HD11 . LEU A 1 67  ? 11.288  9.679   -1.491  1.00 0.00 ? 67  LEU A HD11 4  
ATOM 5455  H HD12 . LEU A 1 67  ? 10.556  11.001  -0.551  1.00 0.00 ? 67  LEU A HD12 4  
ATOM 5456  H HD13 . LEU A 1 67  ? 12.119  10.312  -0.050  1.00 0.00 ? 67  LEU A HD13 4  
ATOM 5457  H HD21 . LEU A 1 67  ? 9.784   8.265   -1.517  1.00 0.00 ? 67  LEU A HD21 4  
ATOM 5458  H HD22 . LEU A 1 67  ? 10.000  7.044   -0.241  1.00 0.00 ? 67  LEU A HD22 4  
ATOM 5459  H HD23 . LEU A 1 67  ? 8.578   8.114   -0.216  1.00 0.00 ? 67  LEU A HD23 4  
ATOM 5460  N N    . ALA A 1 68  ? 14.658  6.561   0.942   1.00 0.00 ? 68  ALA A N    4  
ATOM 5461  C CA   . ALA A 1 68  ? 15.449  5.483   1.511   1.00 0.00 ? 68  ALA A CA   4  
ATOM 5462  C C    . ALA A 1 68  ? 15.652  5.740   3.006   1.00 0.00 ? 68  ALA A C    4  
ATOM 5463  O O    . ALA A 1 68  ? 15.272  4.917   3.838   1.00 0.00 ? 68  ALA A O    4  
ATOM 5464  C CB   . ALA A 1 68  ? 16.773  5.367   0.754   1.00 0.00 ? 68  ALA A CB   4  
ATOM 5465  H H    . ALA A 1 68  ? 15.058  7.000   0.138   1.00 0.00 ? 68  ALA A H    4  
ATOM 5466  H HA   . ALA A 1 68  ? 14.888  4.557   1.383   1.00 0.00 ? 68  ALA A HA   4  
ATOM 5467  H HB1  . ALA A 1 68  ? 17.543  5.933   1.279   1.00 0.00 ? 68  ALA A HB1  4  
ATOM 5468  H HB2  . ALA A 1 68  ? 17.068  4.319   0.698   1.00 0.00 ? 68  ALA A HB2  4  
ATOM 5469  H HB3  . ALA A 1 68  ? 16.652  5.765   -0.253  1.00 0.00 ? 68  ALA A HB3  4  
ATOM 5470  N N    . ARG A 1 69  ? 16.251  6.884   3.301   1.00 0.00 ? 69  ARG A N    4  
ATOM 5471  C CA   . ARG A 1 69  ? 16.510  7.259   4.681   1.00 0.00 ? 69  ARG A CA   4  
ATOM 5472  C C    . ARG A 1 69  ? 16.316  8.765   4.867   1.00 0.00 ? 69  ARG A C    4  
ATOM 5473  O O    . ARG A 1 69  ? 17.285  9.522   4.885   1.00 0.00 ? 69  ARG A O    4  
ATOM 5474  C CB   . ARG A 1 69  ? 17.933  6.880   5.097   1.00 0.00 ? 69  ARG A CB   4  
ATOM 5475  C CG   . ARG A 1 69  ? 17.961  5.503   5.764   1.00 0.00 ? 69  ARG A CG   4  
ATOM 5476  C CD   . ARG A 1 69  ? 19.323  4.832   5.578   1.00 0.00 ? 69  ARG A CD   4  
ATOM 5477  N NE   . ARG A 1 69  ? 19.880  4.445   6.894   1.00 0.00 ? 69  ARG A NE   4  
ATOM 5478  C CZ   . ARG A 1 69  ? 21.157  4.092   7.094   1.00 0.00 ? 69  ARG A CZ   4  
ATOM 5479  N NH1  . ARG A 1 69  ? 22.017  4.074   6.066   1.00 0.00 ? 69  ARG A NH1  4  
ATOM 5480  N NH2  . ARG A 1 69  ? 21.575  3.757   8.322   1.00 0.00 ? 69  ARG A NH2  4  
ATOM 5481  H H    . ARG A 1 69  ? 16.558  7.547   2.618   1.00 0.00 ? 69  ARG A H    4  
ATOM 5482  H HA   . ARG A 1 69  ? 15.783  6.695   5.264   1.00 0.00 ? 69  ARG A HA   4  
ATOM 5483  H HB2  . ARG A 1 69  ? 18.583  6.878   4.223   1.00 0.00 ? 69  ARG A HB2  4  
ATOM 5484  H HB3  . ARG A 1 69  ? 18.326  7.629   5.785   1.00 0.00 ? 69  ARG A HB3  4  
ATOM 5485  H HG2  . ARG A 1 69  ? 17.744  5.605   6.827   1.00 0.00 ? 69  ARG A HG2  4  
ATOM 5486  H HG3  . ARG A 1 69  ? 17.180  4.873   5.338   1.00 0.00 ? 69  ARG A HG3  4  
ATOM 5487  H HD2  . ARG A 1 69  ? 19.220  3.951   4.944   1.00 0.00 ? 69  ARG A HD2  4  
ATOM 5488  H HD3  . ARG A 1 69  ? 20.007  5.512   5.070   1.00 0.00 ? 69  ARG A HD3  4  
ATOM 5489  H HE   . ARG A 1 69  ? 19.265  4.448   7.682   1.00 0.00 ? 69  ARG A HE   4  
ATOM 5490  H HH11 . ARG A 1 69  ? 21.705  4.325   5.150   1.00 0.00 ? 69  ARG A HH11 4  
ATOM 5491  H HH12 . ARG A 1 69  ? 22.970  3.811   6.216   1.00 0.00 ? 69  ARG A HH12 4  
ATOM 5492  H HH21 . ARG A 1 69  ? 20.933  3.770   9.089   1.00 0.00 ? 69  ARG A HH21 4  
ATOM 5493  H HH22 . ARG A 1 69  ? 22.528  3.493   8.472   1.00 0.00 ? 69  ARG A HH22 4  
ATOM 5494  N N    . VAL A 1 70  ? 15.056  9.155   5.000   1.00 0.00 ? 70  VAL A N    4  
ATOM 5495  C CA   . VAL A 1 70  ? 14.722  10.557  5.184   1.00 0.00 ? 70  VAL A CA   4  
ATOM 5496  C C    . VAL A 1 70  ? 13.665  10.685  6.282   1.00 0.00 ? 70  VAL A C    4  
ATOM 5497  O O    . VAL A 1 70  ? 12.901  9.752   6.525   1.00 0.00 ? 70  VAL A O    4  
ATOM 5498  C CB   . VAL A 1 70  ? 14.279  11.168  3.853   1.00 0.00 ? 70  VAL A CB   4  
ATOM 5499  C CG1  . VAL A 1 70  ? 15.417  11.140  2.831   1.00 0.00 ? 70  VAL A CG1  4  
ATOM 5500  C CG2  . VAL A 1 70  ? 13.037  10.459  3.311   1.00 0.00 ? 70  VAL A CG2  4  
ATOM 5501  H H    . VAL A 1 70  ? 14.274  8.533   4.984   1.00 0.00 ? 70  VAL A H    4  
ATOM 5502  H HA   . VAL A 1 70  ? 15.628  11.071  5.506   1.00 0.00 ? 70  VAL A HA   4  
ATOM 5503  H HB   . VAL A 1 70  ? 14.017  12.211  4.034   1.00 0.00 ? 70  VAL A HB   4  
ATOM 5504  H HG11 . VAL A 1 70  ? 15.125  10.525  1.979   1.00 0.00 ? 70  VAL A HG11 4  
ATOM 5505  H HG12 . VAL A 1 70  ? 15.626  12.155  2.492   1.00 0.00 ? 70  VAL A HG12 4  
ATOM 5506  H HG13 . VAL A 1 70  ? 16.310  10.720  3.293   1.00 0.00 ? 70  VAL A HG13 4  
ATOM 5507  H HG21 . VAL A 1 70  ? 13.335  9.544   2.799   1.00 0.00 ? 70  VAL A HG21 4  
ATOM 5508  H HG22 . VAL A 1 70  ? 12.370  10.211  4.137   1.00 0.00 ? 70  VAL A HG22 4  
ATOM 5509  H HG23 . VAL A 1 70  ? 12.520  11.115  2.611   1.00 0.00 ? 70  VAL A HG23 4  
ATOM 5510  N N    . THR A 1 71  ? 13.655  11.848  6.917   1.00 0.00 ? 71  THR A N    4  
ATOM 5511  C CA   . THR A 1 71  ? 12.704  12.111  7.984   1.00 0.00 ? 71  THR A CA   4  
ATOM 5512  C C    . THR A 1 71  ? 11.271  12.001  7.459   1.00 0.00 ? 71  THR A C    4  
ATOM 5513  O O    . THR A 1 71  ? 11.057  11.788  6.267   1.00 0.00 ? 71  THR A O    4  
ATOM 5514  C CB   . THR A 1 71  ? 13.029  13.481  8.581   1.00 0.00 ? 71  THR A CB   4  
ATOM 5515  O OG1  . THR A 1 71  ? 13.452  14.256  7.462   1.00 0.00 ? 71  THR A OG1  4  
ATOM 5516  C CG2  . THR A 1 71  ? 14.256  13.445  9.494   1.00 0.00 ? 71  THR A CG2  4  
ATOM 5517  H H    . THR A 1 71  ? 14.280  12.602  6.713   1.00 0.00 ? 71  THR A H    4  
ATOM 5518  H HA   . THR A 1 71  ? 12.824  11.343  8.748   1.00 0.00 ? 71  THR A HA   4  
ATOM 5519  H HB   . THR A 1 71  ? 12.166  13.893  9.104   1.00 0.00 ? 71  THR A HB   4  
ATOM 5520  H HG1  . THR A 1 71  ? 12.820  14.126  6.698   1.00 0.00 ? 71  THR A HG1  4  
ATOM 5521  H HG21 . THR A 1 71  ? 15.095  13.931  8.995   1.00 0.00 ? 71  THR A HG21 4  
ATOM 5522  H HG22 . THR A 1 71  ? 14.033  13.970  10.423  1.00 0.00 ? 71  THR A HG22 4  
ATOM 5523  H HG23 . THR A 1 71  ? 14.515  12.410  9.715   1.00 0.00 ? 71  THR A HG23 4  
ATOM 5524  N N    . HIS A 1 72  ? 10.326  12.151  8.376   1.00 0.00 ? 72  HIS A N    4  
ATOM 5525  C CA   . HIS A 1 72  ? 8.919   12.072  8.022   1.00 0.00 ? 72  HIS A CA   4  
ATOM 5526  C C    . HIS A 1 72  ? 8.520   13.315  7.224   1.00 0.00 ? 72  HIS A C    4  
ATOM 5527  O O    . HIS A 1 72  ? 7.694   13.236  6.317   1.00 0.00 ? 72  HIS A O    4  
ATOM 5528  C CB   . HIS A 1 72  ? 8.056   11.864  9.267   1.00 0.00 ? 72  HIS A CB   4  
ATOM 5529  C CG   . HIS A 1 72  ? 6.637   11.441  8.968   1.00 0.00 ? 72  HIS A CG   4  
ATOM 5530  N ND1  . HIS A 1 72  ? 5.534   12.147  9.416   1.00 0.00 ? 72  HIS A ND1  4  
ATOM 5531  C CD2  . HIS A 1 72  ? 6.155   10.380  8.261   1.00 0.00 ? 72  HIS A CD2  4  
ATOM 5532  C CE1  . HIS A 1 72  ? 4.442   11.528  8.992   1.00 0.00 ? 72  HIS A CE1  4  
ATOM 5533  N NE2  . HIS A 1 72  ? 4.828   10.433  8.277   1.00 0.00 ? 72  HIS A NE2  4  
ATOM 5534  H H    . HIS A 1 72  ? 10.509  12.324  9.344   1.00 0.00 ? 72  HIS A H    4  
ATOM 5535  H HA   . HIS A 1 72  ? 8.806   11.193  7.388   1.00 0.00 ? 72  HIS A HA   4  
ATOM 5536  H HB2  . HIS A 1 72  ? 8.523   11.110  9.899   1.00 0.00 ? 72  HIS A HB2  4  
ATOM 5537  H HB3  . HIS A 1 72  ? 8.034   12.791  9.841   1.00 0.00 ? 72  HIS A HB3  4  
ATOM 5538  H HD1  . HIS A 1 72  ? 5.558   12.982  9.966   1.00 0.00 ? 72  HIS A HD1  4  
ATOM 5539  H HD2  . HIS A 1 72  ? 6.756   9.617   7.766   1.00 0.00 ? 72  HIS A HD2  4  
ATOM 5540  H HE1  . HIS A 1 72  ? 3.415   11.840  9.182   1.00 0.00 ? 72  HIS A HE1  4  
ATOM 5541  N N    . ALA A 1 73  ? 9.127   14.435  7.591   1.00 0.00 ? 73  ALA A N    4  
ATOM 5542  C CA   . ALA A 1 73  ? 8.845   15.693  6.922   1.00 0.00 ? 73  ALA A CA   4  
ATOM 5543  C C    . ALA A 1 73  ? 9.378   15.633  5.489   1.00 0.00 ? 73  ALA A C    4  
ATOM 5544  O O    . ALA A 1 73  ? 8.755   16.162  4.569   1.00 0.00 ? 73  ALA A O    4  
ATOM 5545  C CB   . ALA A 1 73  ? 9.454   16.845  7.723   1.00 0.00 ? 73  ALA A CB   4  
ATOM 5546  H H    . ALA A 1 73  ? 9.798   14.490  8.331   1.00 0.00 ? 73  ALA A H    4  
ATOM 5547  H HA   . ALA A 1 73  ? 7.763   15.819  6.893   1.00 0.00 ? 73  ALA A HA   4  
ATOM 5548  H HB1  . ALA A 1 73  ? 9.904   16.455  8.636   1.00 0.00 ? 73  ALA A HB1  4  
ATOM 5549  H HB2  . ALA A 1 73  ? 10.219  17.340  7.124   1.00 0.00 ? 73  ALA A HB2  4  
ATOM 5550  H HB3  . ALA A 1 73  ? 8.674   17.562  7.979   1.00 0.00 ? 73  ALA A HB3  4  
ATOM 5551  N N    . GLU A 1 74  ? 10.524  14.985  5.344   1.00 0.00 ? 74  GLU A N    4  
ATOM 5552  C CA   . GLU A 1 74  ? 11.147  14.849  4.038   1.00 0.00 ? 74  GLU A CA   4  
ATOM 5553  C C    . GLU A 1 74  ? 10.177  14.196  3.052   1.00 0.00 ? 74  GLU A C    4  
ATOM 5554  O O    . GLU A 1 74  ? 9.840   14.784  2.025   1.00 0.00 ? 74  GLU A O    4  
ATOM 5555  C CB   . GLU A 1 74  ? 12.451  14.054  4.133   1.00 0.00 ? 74  GLU A CB   4  
ATOM 5556  C CG   . GLU A 1 74  ? 13.639  14.979  4.403   1.00 0.00 ? 74  GLU A CG   4  
ATOM 5557  C CD   . GLU A 1 74  ? 13.848  15.956  3.244   1.00 0.00 ? 74  GLU A CD   4  
ATOM 5558  O OE1  . GLU A 1 74  ? 14.370  15.499  2.205   1.00 0.00 ? 74  GLU A OE1  4  
ATOM 5559  O OE2  . GLU A 1 74  ? 13.481  17.137  3.424   1.00 0.00 ? 74  GLU A OE2  4  
ATOM 5560  H H    . GLU A 1 74  ? 11.024  14.557  6.097   1.00 0.00 ? 74  GLU A H    4  
ATOM 5561  H HA   . GLU A 1 74  ? 11.372  15.866  3.718   1.00 0.00 ? 74  GLU A HA   4  
ATOM 5562  H HB2  . GLU A 1 74  ? 12.373  13.314  4.930   1.00 0.00 ? 74  GLU A HB2  4  
ATOM 5563  H HB3  . GLU A 1 74  ? 12.616  13.506  3.205   1.00 0.00 ? 74  GLU A HB3  4  
ATOM 5564  H HG2  . GLU A 1 74  ? 13.470  15.535  5.326   1.00 0.00 ? 74  GLU A HG2  4  
ATOM 5565  H HG3  . GLU A 1 74  ? 14.541  14.385  4.550   1.00 0.00 ? 74  GLU A HG3  4  
ATOM 5566  N N    . ALA A 1 75  ? 9.755   12.989  3.399   1.00 0.00 ? 75  ALA A N    4  
ATOM 5567  C CA   . ALA A 1 75  ? 8.830   12.249  2.556   1.00 0.00 ? 75  ALA A CA   4  
ATOM 5568  C C    . ALA A 1 75  ? 7.610   13.122  2.258   1.00 0.00 ? 75  ALA A C    4  
ATOM 5569  O O    . ALA A 1 75  ? 7.135   13.165  1.123   1.00 0.00 ? 75  ALA A O    4  
ATOM 5570  C CB   . ALA A 1 75  ? 8.453   10.935  3.244   1.00 0.00 ? 75  ALA A CB   4  
ATOM 5571  H H    . ALA A 1 75  ? 10.034  12.517  4.235   1.00 0.00 ? 75  ALA A H    4  
ATOM 5572  H HA   . ALA A 1 75  ? 9.342   12.022  1.621   1.00 0.00 ? 75  ALA A HA   4  
ATOM 5573  H HB1  . ALA A 1 75  ? 9.127   10.756  4.081   1.00 0.00 ? 75  ALA A HB1  4  
ATOM 5574  H HB2  . ALA A 1 75  ? 7.428   10.997  3.609   1.00 0.00 ? 75  ALA A HB2  4  
ATOM 5575  H HB3  . ALA A 1 75  ? 8.535   10.115  2.530   1.00 0.00 ? 75  ALA A HB3  4  
ATOM 5576  N N    . VAL A 1 76  ? 7.136   13.797  3.295   1.00 0.00 ? 76  VAL A N    4  
ATOM 5577  C CA   . VAL A 1 76  ? 5.980   14.666  3.158   1.00 0.00 ? 76  VAL A CA   4  
ATOM 5578  C C    . VAL A 1 76  ? 6.273   15.734  2.102   1.00 0.00 ? 76  VAL A C    4  
ATOM 5579  O O    . VAL A 1 76  ? 5.574   15.822  1.093   1.00 0.00 ? 76  VAL A O    4  
ATOM 5580  C CB   . VAL A 1 76  ? 5.606   15.258  4.518   1.00 0.00 ? 76  VAL A CB   4  
ATOM 5581  C CG1  . VAL A 1 76  ? 4.463   16.265  4.382   1.00 0.00 ? 76  VAL A CG1  4  
ATOM 5582  C CG2  . VAL A 1 76  ? 5.248   14.154  5.516   1.00 0.00 ? 76  VAL A CG2  4  
ATOM 5583  H H    . VAL A 1 76  ? 7.528   13.756  4.214   1.00 0.00 ? 76  VAL A H    4  
ATOM 5584  H HA   . VAL A 1 76  ? 5.146   14.053  2.815   1.00 0.00 ? 76  VAL A HA   4  
ATOM 5585  H HB   . VAL A 1 76  ? 6.476   15.789  4.904   1.00 0.00 ? 76  VAL A HB   4  
ATOM 5586  H HG11 . VAL A 1 76  ? 3.513   15.733  4.334   1.00 0.00 ? 76  VAL A HG11 4  
ATOM 5587  H HG12 . VAL A 1 76  ? 4.462   16.933  5.244   1.00 0.00 ? 76  VAL A HG12 4  
ATOM 5588  H HG13 . VAL A 1 76  ? 4.599   16.848  3.471   1.00 0.00 ? 76  VAL A HG13 4  
ATOM 5589  H HG21 . VAL A 1 76  ? 5.627   14.421  6.503   1.00 0.00 ? 76  VAL A HG21 4  
ATOM 5590  H HG22 . VAL A 1 76  ? 4.165   14.042  5.561   1.00 0.00 ? 76  VAL A HG22 4  
ATOM 5591  H HG23 . VAL A 1 76  ? 5.698   13.215  5.196   1.00 0.00 ? 76  VAL A HG23 4  
ATOM 5592  N N    . LYS A 1 77  ? 7.307   16.518  2.370   1.00 0.00 ? 77  LYS A N    4  
ATOM 5593  C CA   . LYS A 1 77  ? 7.700   17.576  1.455   1.00 0.00 ? 77  LYS A CA   4  
ATOM 5594  C C    . LYS A 1 77  ? 7.986   16.973  0.078   1.00 0.00 ? 77  LYS A C    4  
ATOM 5595  O O    . LYS A 1 77  ? 7.960   17.679  -0.930  1.00 0.00 ? 77  LYS A O    4  
ATOM 5596  C CB   . LYS A 1 77  ? 8.871   18.374  2.031   1.00 0.00 ? 77  LYS A CB   4  
ATOM 5597  C CG   . LYS A 1 77  ? 8.372   19.506  2.932   1.00 0.00 ? 77  LYS A CG   4  
ATOM 5598  C CD   . LYS A 1 77  ? 8.216   19.029  4.377   1.00 0.00 ? 77  LYS A CD   4  
ATOM 5599  C CE   . LYS A 1 77  ? 7.667   20.145  5.267   1.00 0.00 ? 77  LYS A CE   4  
ATOM 5600  N NZ   . LYS A 1 77  ? 8.388   20.181  6.559   1.00 0.00 ? 77  LYS A NZ   4  
ATOM 5601  H H    . LYS A 1 77  ? 7.870   16.439  3.192   1.00 0.00 ? 77  LYS A H    4  
ATOM 5602  H HA   . LYS A 1 77  ? 6.857   18.260  1.365   1.00 0.00 ? 77  LYS A HA   4  
ATOM 5603  H HB2  . LYS A 1 77  ? 9.523   17.712  2.601   1.00 0.00 ? 77  LYS A HB2  4  
ATOM 5604  H HB3  . LYS A 1 77  ? 9.469   18.788  1.219   1.00 0.00 ? 77  LYS A HB3  4  
ATOM 5605  H HG2  . LYS A 1 77  ? 9.072   20.341  2.895   1.00 0.00 ? 77  LYS A HG2  4  
ATOM 5606  H HG3  . LYS A 1 77  ? 7.416   19.875  2.562   1.00 0.00 ? 77  LYS A HG3  4  
ATOM 5607  H HD2  . LYS A 1 77  ? 7.546   18.169  4.410   1.00 0.00 ? 77  LYS A HD2  4  
ATOM 5608  H HD3  . LYS A 1 77  ? 9.181   18.695  4.760   1.00 0.00 ? 77  LYS A HD3  4  
ATOM 5609  H HE2  . LYS A 1 77  ? 7.767   21.105  4.761   1.00 0.00 ? 77  LYS A HE2  4  
ATOM 5610  H HE3  . LYS A 1 77  ? 6.602   19.987  5.443   1.00 0.00 ? 77  LYS A HE3  4  
ATOM 5611  H HZ1  . LYS A 1 77  ? 7.742   20.023  7.306   1.00 0.00 ? 77  LYS A HZ1  4  
ATOM 5612  H HZ2  . LYS A 1 77  ? 9.090   19.468  6.569   1.00 0.00 ? 77  LYS A HZ2  4  
ATOM 5613  H HZ3  . LYS A 1 77  ? 8.820   21.075  6.675   1.00 0.00 ? 77  LYS A HZ3  4  
ATOM 5614  N N    . ALA A 1 78  ? 8.252   15.675  0.079   1.00 0.00 ? 78  ALA A N    4  
ATOM 5615  C CA   . ALA A 1 78  ? 8.543   14.970  -1.158  1.00 0.00 ? 78  ALA A CA   4  
ATOM 5616  C C    . ALA A 1 78  ? 7.230   14.534  -1.812  1.00 0.00 ? 78  ALA A C    4  
ATOM 5617  O O    . ALA A 1 78  ? 7.170   14.342  -3.025  1.00 0.00 ? 78  ALA A O    4  
ATOM 5618  C CB   . ALA A 1 78  ? 9.470   13.789  -0.867  1.00 0.00 ? 78  ALA A CB   4  
ATOM 5619  H H    . ALA A 1 78  ? 8.272   15.109  0.902   1.00 0.00 ? 78  ALA A H    4  
ATOM 5620  H HA   . ALA A 1 78  ? 9.057   15.664  -1.823  1.00 0.00 ? 78  ALA A HA   4  
ATOM 5621  H HB1  . ALA A 1 78  ? 9.692   13.263  -1.796  1.00 0.00 ? 78  ALA A HB1  4  
ATOM 5622  H HB2  . ALA A 1 78  ? 10.397  14.154  -0.426  1.00 0.00 ? 78  ALA A HB2  4  
ATOM 5623  H HB3  . ALA A 1 78  ? 8.981   13.106  -0.172  1.00 0.00 ? 78  ALA A HB3  4  
ATOM 5624  N N    . LEU A 1 79  ? 6.210   14.391  -0.978  1.00 0.00 ? 79  LEU A N    4  
ATOM 5625  C CA   . LEU A 1 79  ? 4.902   13.981  -1.460  1.00 0.00 ? 79  LEU A CA   4  
ATOM 5626  C C    . LEU A 1 79  ? 4.262   15.137  -2.232  1.00 0.00 ? 79  LEU A C    4  
ATOM 5627  O O    . LEU A 1 79  ? 3.996   15.018  -3.427  1.00 0.00 ? 79  LEU A O    4  
ATOM 5628  C CB   . LEU A 1 79  ? 4.043   13.464  -0.304  1.00 0.00 ? 79  LEU A CB   4  
ATOM 5629  C CG   . LEU A 1 79  ? 4.156   11.968  -0.001  1.00 0.00 ? 79  LEU A CG   4  
ATOM 5630  C CD1  . LEU A 1 79  ? 3.716   11.664  1.432   1.00 0.00 ? 79  LEU A CD1  4  
ATOM 5631  C CD2  . LEU A 1 79  ? 3.379   11.141  -1.027  1.00 0.00 ? 79  LEU A CD2  4  
ATOM 5632  H H    . LEU A 1 79  ? 6.267   14.550  0.007   1.00 0.00 ? 79  LEU A H    4  
ATOM 5633  H HA   . LEU A 1 79  ? 5.053   13.148  -2.147  1.00 0.00 ? 79  LEU A HA   4  
ATOM 5634  H HB2  . LEU A 1 79  ? 4.310   14.018  0.597   1.00 0.00 ? 79  LEU A HB2  4  
ATOM 5635  H HB3  . LEU A 1 79  ? 3.000   13.693  -0.521  1.00 0.00 ? 79  LEU A HB3  4  
ATOM 5636  H HG   . LEU A 1 79  ? 5.204   11.681  -0.084  1.00 0.00 ? 79  LEU A HG   4  
ATOM 5637  H HD11 . LEU A 1 79  ? 3.202   10.703  1.458   1.00 0.00 ? 79  LEU A HD11 4  
ATOM 5638  H HD12 . LEU A 1 79  ? 4.591   11.626  2.081   1.00 0.00 ? 79  LEU A HD12 4  
ATOM 5639  H HD13 . LEU A 1 79  ? 3.041   12.447  1.779   1.00 0.00 ? 79  LEU A HD13 4  
ATOM 5640  H HD21 . LEU A 1 79  ? 3.094   10.187  -0.584  1.00 0.00 ? 79  LEU A HD21 4  
ATOM 5641  H HD22 . LEU A 1 79  ? 2.483   11.684  -1.329  1.00 0.00 ? 79  LEU A HD22 4  
ATOM 5642  H HD23 . LEU A 1 79  ? 4.007   10.963  -1.900  1.00 0.00 ? 79  LEU A HD23 4  
ATOM 5643  N N    . LYS A 1 80  ? 4.033   16.229  -1.517  1.00 0.00 ? 80  LYS A N    4  
ATOM 5644  C CA   . LYS A 1 80  ? 3.430   17.405  -2.120  1.00 0.00 ? 80  LYS A CA   4  
ATOM 5645  C C    . LYS A 1 80  ? 4.390   17.992  -3.156  1.00 0.00 ? 80  LYS A C    4  
ATOM 5646  O O    . LYS A 1 80  ? 5.520   17.526  -3.294  1.00 0.00 ? 80  LYS A O    4  
ATOM 5647  C CB   . LYS A 1 80  ? 3.006   18.403  -1.040  1.00 0.00 ? 80  LYS A CB   4  
ATOM 5648  C CG   . LYS A 1 80  ? 1.948   17.795  -0.117  1.00 0.00 ? 80  LYS A CG   4  
ATOM 5649  C CD   . LYS A 1 80  ? 2.392   17.864  1.346   1.00 0.00 ? 80  LYS A CD   4  
ATOM 5650  C CE   . LYS A 1 80  ? 2.249   19.284  1.896   1.00 0.00 ? 80  LYS A CE   4  
ATOM 5651  N NZ   . LYS A 1 80  ? 3.541   20.002  1.821   1.00 0.00 ? 80  LYS A NZ   4  
ATOM 5652  H H    . LYS A 1 80  ? 4.252   16.317  -0.545  1.00 0.00 ? 80  LYS A H    4  
ATOM 5653  H HA   . LYS A 1 80  ? 2.524   17.081  -2.633  1.00 0.00 ? 80  LYS A HA   4  
ATOM 5654  H HB2  . LYS A 1 80  ? 3.875   18.703  -0.455  1.00 0.00 ? 80  LYS A HB2  4  
ATOM 5655  H HB3  . LYS A 1 80  ? 2.610   19.304  -1.508  1.00 0.00 ? 80  LYS A HB3  4  
ATOM 5656  H HG2  . LYS A 1 80  ? 1.004   18.327  -0.239  1.00 0.00 ? 80  LYS A HG2  4  
ATOM 5657  H HG3  . LYS A 1 80  ? 1.768   16.757  -0.398  1.00 0.00 ? 80  LYS A HG3  4  
ATOM 5658  H HD2  . LYS A 1 80  ? 1.794   17.176  1.944   1.00 0.00 ? 80  LYS A HD2  4  
ATOM 5659  H HD3  . LYS A 1 80  ? 3.430   17.540  1.430   1.00 0.00 ? 80  LYS A HD3  4  
ATOM 5660  H HE2  . LYS A 1 80  ? 1.492   19.826  1.329   1.00 0.00 ? 80  LYS A HE2  4  
ATOM 5661  H HE3  . LYS A 1 80  ? 1.906   19.247  2.930   1.00 0.00 ? 80  LYS A HE3  4  
ATOM 5662  H HZ1  . LYS A 1 80  ? 4.239   19.392  1.446   1.00 0.00 ? 80  LYS A HZ1  4  
ATOM 5663  H HZ2  . LYS A 1 80  ? 3.444   20.802  1.229   1.00 0.00 ? 80  LYS A HZ2  4  
ATOM 5664  H HZ3  . LYS A 1 80  ? 3.812   20.297  2.737   1.00 0.00 ? 80  LYS A HZ3  4  
ATOM 5665  N N    . GLY A 1 81  ? 3.906   19.005  -3.858  1.00 0.00 ? 81  GLY A N    4  
ATOM 5666  C CA   . GLY A 1 81  ? 4.708   19.660  -4.878  1.00 0.00 ? 81  GLY A CA   4  
ATOM 5667  C C    . GLY A 1 81  ? 4.868   18.765  -6.108  1.00 0.00 ? 81  GLY A C    4  
ATOM 5668  O O    . GLY A 1 81  ? 5.974   18.327  -6.421  1.00 0.00 ? 81  GLY A O    4  
ATOM 5669  H H    . GLY A 1 81  ? 2.986   19.378  -3.740  1.00 0.00 ? 81  GLY A H    4  
ATOM 5670  H HA2  . GLY A 1 81  ? 4.238   20.600  -5.167  1.00 0.00 ? 81  GLY A HA2  4  
ATOM 5671  H HA3  . GLY A 1 81  ? 5.689   19.906  -4.472  1.00 0.00 ? 81  GLY A HA3  4  
ATOM 5672  N N    . SER A 1 82  ? 3.748   18.519  -6.772  1.00 0.00 ? 82  SER A N    4  
ATOM 5673  C CA   . SER A 1 82  ? 3.751   17.684  -7.961  1.00 0.00 ? 82  SER A CA   4  
ATOM 5674  C C    . SER A 1 82  ? 2.315   17.332  -8.356  1.00 0.00 ? 82  SER A C    4  
ATOM 5675  O O    . SER A 1 82  ? 1.503   16.975  -7.505  1.00 0.00 ? 82  SER A O    4  
ATOM 5676  C CB   . SER A 1 82  ? 4.568   16.410  -7.737  1.00 0.00 ? 82  SER A CB   4  
ATOM 5677  O OG   . SER A 1 82  ? 5.873   16.507  -8.300  1.00 0.00 ? 82  SER A OG   4  
ATOM 5678  H H    . SER A 1 82  ? 2.853   18.880  -6.511  1.00 0.00 ? 82  SER A H    4  
ATOM 5679  H HA   . SER A 1 82  ? 4.224   18.287  -8.736  1.00 0.00 ? 82  SER A HA   4  
ATOM 5680  H HB2  . SER A 1 82  ? 4.648   16.214  -6.668  1.00 0.00 ? 82  SER A HB2  4  
ATOM 5681  H HB3  . SER A 1 82  ? 4.044   15.562  -8.179  1.00 0.00 ? 82  SER A HB3  4  
ATOM 5682  H HG   . SER A 1 82  ? 6.076   17.458  -8.533  1.00 0.00 ? 82  SER A HG   4  
ATOM 5683  N N    . LYS A 1 83  ? 2.047   17.445  -9.649  1.00 0.00 ? 83  LYS A N    4  
ATOM 5684  C CA   . LYS A 1 83  ? 0.723   17.143  -10.167 1.00 0.00 ? 83  LYS A CA   4  
ATOM 5685  C C    . LYS A 1 83  ? 0.482   15.635  -10.089 1.00 0.00 ? 83  LYS A C    4  
ATOM 5686  O O    . LYS A 1 83  ? -0.245  15.163  -9.216  1.00 0.00 ? 83  LYS A O    4  
ATOM 5687  C CB   . LYS A 1 83  ? 0.554   17.721  -11.574 1.00 0.00 ? 83  LYS A CB   4  
ATOM 5688  C CG   . LYS A 1 83  ? -0.372  18.939  -11.559 1.00 0.00 ? 83  LYS A CG   4  
ATOM 5689  C CD   . LYS A 1 83  ? -0.729  19.374  -12.982 1.00 0.00 ? 83  LYS A CD   4  
ATOM 5690  C CE   . LYS A 1 83  ? 0.228   20.459  -13.479 1.00 0.00 ? 83  LYS A CE   4  
ATOM 5691  N NZ   . LYS A 1 83  ? 1.204   19.890  -14.436 1.00 0.00 ? 83  LYS A NZ   4  
ATOM 5692  H H    . LYS A 1 83  ? 2.713   17.737  -10.335 1.00 0.00 ? 83  LYS A H    4  
ATOM 5693  H HA   . LYS A 1 83  ? -0.001  17.643  -9.524  1.00 0.00 ? 83  LYS A HA   4  
ATOM 5694  H HB2  . LYS A 1 83  ? 1.527   18.005  -11.974 1.00 0.00 ? 83  LYS A HB2  4  
ATOM 5695  H HB3  . LYS A 1 83  ? 0.148   16.958  -12.238 1.00 0.00 ? 83  LYS A HB3  4  
ATOM 5696  H HG2  . LYS A 1 83  ? -1.282  18.701  -11.008 1.00 0.00 ? 83  LYS A HG2  4  
ATOM 5697  H HG3  . LYS A 1 83  ? 0.112   19.762  -11.033 1.00 0.00 ? 83  LYS A HG3  4  
ATOM 5698  H HD2  . LYS A 1 83  ? -0.688  18.514  -13.650 1.00 0.00 ? 83  LYS A HD2  4  
ATOM 5699  H HD3  . LYS A 1 83  ? -1.752  19.748  -13.005 1.00 0.00 ? 83  LYS A HD3  4  
ATOM 5700  H HE2  . LYS A 1 83  ? -0.336  21.258  -13.959 1.00 0.00 ? 83  LYS A HE2  4  
ATOM 5701  H HE3  . LYS A 1 83  ? 0.755   20.903  -12.635 1.00 0.00 ? 83  LYS A HE3  4  
ATOM 5702  H HZ1  . LYS A 1 83  ? 1.879   19.344  -13.939 1.00 0.00 ? 83  LYS A HZ1  4  
ATOM 5703  H HZ2  . LYS A 1 83  ? 0.725   19.309  -15.095 1.00 0.00 ? 83  LYS A HZ2  4  
ATOM 5704  H HZ3  . LYS A 1 83  ? 1.667   20.632  -14.921 1.00 0.00 ? 83  LYS A HZ3  4  
ATOM 5705  N N    . LYS A 1 84  ? 1.105   14.919  -11.014 1.00 0.00 ? 84  LYS A N    4  
ATOM 5706  C CA   . LYS A 1 84  ? 0.967   13.473  -11.061 1.00 0.00 ? 84  LYS A CA   4  
ATOM 5707  C C    . LYS A 1 84  ? 1.931   12.840  -10.055 1.00 0.00 ? 84  LYS A C    4  
ATOM 5708  O O    . LYS A 1 84  ? 3.118   12.686  -10.341 1.00 0.00 ? 84  LYS A O    4  
ATOM 5709  C CB   . LYS A 1 84  ? 1.149   12.964  -12.492 1.00 0.00 ? 84  LYS A CB   4  
ATOM 5710  C CG   . LYS A 1 84  ? 0.166   11.832  -12.800 1.00 0.00 ? 84  LYS A CG   4  
ATOM 5711  C CD   . LYS A 1 84  ? 0.114   11.544  -14.302 1.00 0.00 ? 84  LYS A CD   4  
ATOM 5712  C CE   . LYS A 1 84  ? 1.015   10.362  -14.665 1.00 0.00 ? 84  LYS A CE   4  
ATOM 5713  N NZ   . LYS A 1 84  ? 1.055   10.173  -16.132 1.00 0.00 ? 84  LYS A NZ   4  
ATOM 5714  H H    . LYS A 1 84  ? 1.694   15.310  -11.721 1.00 0.00 ? 84  LYS A H    4  
ATOM 5715  H HA   . LYS A 1 84  ? -0.053  13.233  -10.760 1.00 0.00 ? 84  LYS A HA   4  
ATOM 5716  H HB2  . LYS A 1 84  ? 0.998   13.783  -13.195 1.00 0.00 ? 84  LYS A HB2  4  
ATOM 5717  H HB3  . LYS A 1 84  ? 2.170   12.610  -12.629 1.00 0.00 ? 84  LYS A HB3  4  
ATOM 5718  H HG2  . LYS A 1 84  ? 0.464   10.931  -12.263 1.00 0.00 ? 84  LYS A HG2  4  
ATOM 5719  H HG3  . LYS A 1 84  ? -0.828  12.102  -12.443 1.00 0.00 ? 84  LYS A HG3  4  
ATOM 5720  H HD2  . LYS A 1 84  ? -0.912  11.329  -14.599 1.00 0.00 ? 84  LYS A HD2  4  
ATOM 5721  H HD3  . LYS A 1 84  ? 0.428   12.429  -14.856 1.00 0.00 ? 84  LYS A HD3  4  
ATOM 5722  H HE2  . LYS A 1 84  ? 2.023   10.536  -14.287 1.00 0.00 ? 84  LYS A HE2  4  
ATOM 5723  H HE3  . LYS A 1 84  ? 0.646   9.456   -14.185 1.00 0.00 ? 84  LYS A HE3  4  
ATOM 5724  H HZ1  . LYS A 1 84  ? 0.603   9.313   -16.369 1.00 0.00 ? 84  LYS A HZ1  4  
ATOM 5725  H HZ2  . LYS A 1 84  ? 0.583   10.932  -16.579 1.00 0.00 ? 84  LYS A HZ2  4  
ATOM 5726  H HZ3  . LYS A 1 84  ? 2.007   10.146  -16.439 1.00 0.00 ? 84  LYS A HZ3  4  
ATOM 5727  N N    . LEU A 1 85  ? 1.386   12.492  -8.899  1.00 0.00 ? 85  LEU A N    4  
ATOM 5728  C CA   . LEU A 1 85  ? 2.183   11.879  -7.850  1.00 0.00 ? 85  LEU A CA   4  
ATOM 5729  C C    . LEU A 1 85  ? 2.082   10.357  -7.962  1.00 0.00 ? 85  LEU A C    4  
ATOM 5730  O O    . LEU A 1 85  ? 1.015   9.784   -7.744  1.00 0.00 ? 85  LEU A O    4  
ATOM 5731  C CB   . LEU A 1 85  ? 1.775   12.423  -6.480  1.00 0.00 ? 85  LEU A CB   4  
ATOM 5732  C CG   . LEU A 1 85  ? 2.431   11.755  -5.270  1.00 0.00 ? 85  LEU A CG   4  
ATOM 5733  C CD1  . LEU A 1 85  ? 3.898   11.425  -5.555  1.00 0.00 ? 85  LEU A CD1  4  
ATOM 5734  C CD2  . LEU A 1 85  ? 2.271   12.615  -4.015  1.00 0.00 ? 85  LEU A CD2  4  
ATOM 5735  H H    . LEU A 1 85  ? 0.420   12.621  -8.675  1.00 0.00 ? 85  LEU A H    4  
ATOM 5736  H HA   . LEU A 1 85  ? 3.220   12.169  -8.017  1.00 0.00 ? 85  LEU A HA   4  
ATOM 5737  H HB2  . LEU A 1 85  ? 2.005   13.489  -6.451  1.00 0.00 ? 85  LEU A HB2  4  
ATOM 5738  H HB3  . LEU A 1 85  ? 0.694   12.328  -6.381  1.00 0.00 ? 85  LEU A HB3  4  
ATOM 5739  H HG   . LEU A 1 85  ? 1.919   10.812  -5.082  1.00 0.00 ? 85  LEU A HG   4  
ATOM 5740  H HD11 . LEU A 1 85  ? 4.257   10.704  -4.821  1.00 0.00 ? 85  LEU A HD11 4  
ATOM 5741  H HD12 . LEU A 1 85  ? 3.987   11.000  -6.555  1.00 0.00 ? 85  LEU A HD12 4  
ATOM 5742  H HD13 . LEU A 1 85  ? 4.494   12.335  -5.492  1.00 0.00 ? 85  LEU A HD13 4  
ATOM 5743  H HD21 . LEU A 1 85  ? 1.632   13.470  -4.239  1.00 0.00 ? 85  LEU A HD21 4  
ATOM 5744  H HD22 . LEU A 1 85  ? 1.817   12.020  -3.222  1.00 0.00 ? 85  LEU A HD22 4  
ATOM 5745  H HD23 . LEU A 1 85  ? 3.249   12.969  -3.689  1.00 0.00 ? 85  LEU A HD23 4  
ATOM 5746  N N    . VAL A 1 86  ? 3.206   9.744   -8.302  1.00 0.00 ? 86  VAL A N    4  
ATOM 5747  C CA   . VAL A 1 86  ? 3.258   8.299   -8.446  1.00 0.00 ? 86  VAL A CA   4  
ATOM 5748  C C    . VAL A 1 86  ? 3.825   7.684   -7.165  1.00 0.00 ? 86  VAL A C    4  
ATOM 5749  O O    . VAL A 1 86  ? 5.037   7.692   -6.952  1.00 0.00 ? 86  VAL A O    4  
ATOM 5750  C CB   . VAL A 1 86  ? 4.059   7.925   -9.695  1.00 0.00 ? 86  VAL A CB   4  
ATOM 5751  C CG1  . VAL A 1 86  ? 4.395   6.432   -9.704  1.00 0.00 ? 86  VAL A CG1  4  
ATOM 5752  C CG2  . VAL A 1 86  ? 3.310   8.326   -10.967 1.00 0.00 ? 86  VAL A CG2  4  
ATOM 5753  H H    . VAL A 1 86  ? 4.070   10.217  -8.478  1.00 0.00 ? 86  VAL A H    4  
ATOM 5754  H HA   . VAL A 1 86  ? 2.236   7.946   -8.582  1.00 0.00 ? 86  VAL A HA   4  
ATOM 5755  H HB   . VAL A 1 86  ? 4.997   8.480   -9.669  1.00 0.00 ? 86  VAL A HB   4  
ATOM 5756  H HG11 . VAL A 1 86  ? 3.982   5.973   -10.602 1.00 0.00 ? 86  VAL A HG11 4  
ATOM 5757  H HG12 . VAL A 1 86  ? 5.477   6.304   -9.694  1.00 0.00 ? 86  VAL A HG12 4  
ATOM 5758  H HG13 . VAL A 1 86  ? 3.965   5.958   -8.822  1.00 0.00 ? 86  VAL A HG13 4  
ATOM 5759  H HG21 . VAL A 1 86  ? 3.643   9.313   -11.289 1.00 0.00 ? 86  VAL A HG21 4  
ATOM 5760  H HG22 . VAL A 1 86  ? 3.514   7.599   -11.753 1.00 0.00 ? 86  VAL A HG22 4  
ATOM 5761  H HG23 . VAL A 1 86  ? 2.239   8.352   -10.765 1.00 0.00 ? 86  VAL A HG23 4  
ATOM 5762  N N    . LEU A 1 87  ? 2.923   7.164   -6.346  1.00 0.00 ? 87  LEU A N    4  
ATOM 5763  C CA   . LEU A 1 87  ? 3.318   6.546   -5.092  1.00 0.00 ? 87  LEU A CA   4  
ATOM 5764  C C    . LEU A 1 87  ? 3.959   5.187   -5.378  1.00 0.00 ? 87  LEU A C    4  
ATOM 5765  O O    . LEU A 1 87  ? 3.332   4.314   -5.975  1.00 0.00 ? 87  LEU A O    4  
ATOM 5766  C CB   . LEU A 1 87  ? 2.129   6.475   -4.131  1.00 0.00 ? 87  LEU A CB   4  
ATOM 5767  C CG   . LEU A 1 87  ? 1.431   7.802   -3.828  1.00 0.00 ? 87  LEU A CG   4  
ATOM 5768  C CD1  . LEU A 1 87  ? 2.452   8.920   -3.608  1.00 0.00 ? 87  LEU A CD1  4  
ATOM 5769  C CD2  . LEU A 1 87  ? 0.423   8.154   -4.923  1.00 0.00 ? 87  LEU A CD2  4  
ATOM 5770  H H    . LEU A 1 87  ? 1.939   7.162   -6.526  1.00 0.00 ? 87  LEU A H    4  
ATOM 5771  H HA   . LEU A 1 87  ? 4.066   7.191   -4.631  1.00 0.00 ? 87  LEU A HA   4  
ATOM 5772  H HB2  . LEU A 1 87  ? 1.393   5.786   -4.546  1.00 0.00 ? 87  LEU A HB2  4  
ATOM 5773  H HB3  . LEU A 1 87  ? 2.473   6.045   -3.190  1.00 0.00 ? 87  LEU A HB3  4  
ATOM 5774  H HG   . LEU A 1 87  ? 0.872   7.690   -2.899  1.00 0.00 ? 87  LEU A HG   4  
ATOM 5775  H HD11 . LEU A 1 87  ? 3.132   8.638   -2.805  1.00 0.00 ? 87  LEU A HD11 4  
ATOM 5776  H HD12 . LEU A 1 87  ? 3.019   9.081   -4.525  1.00 0.00 ? 87  LEU A HD12 4  
ATOM 5777  H HD13 . LEU A 1 87  ? 1.931   9.839   -3.338  1.00 0.00 ? 87  LEU A HD13 4  
ATOM 5778  H HD21 . LEU A 1 87  ? 0.850   8.910   -5.582  1.00 0.00 ? 87  LEU A HD21 4  
ATOM 5779  H HD22 . LEU A 1 87  ? 0.187   7.260   -5.501  1.00 0.00 ? 87  LEU A HD22 4  
ATOM 5780  H HD23 . LEU A 1 87  ? -0.488  8.542   -4.468  1.00 0.00 ? 87  LEU A HD23 4  
ATOM 5781  N N    . SER A 1 88  ? 5.202   5.050   -4.939  1.00 0.00 ? 88  SER A N    4  
ATOM 5782  C CA   . SER A 1 88  ? 5.935   3.812   -5.141  1.00 0.00 ? 88  SER A CA   4  
ATOM 5783  C C    . SER A 1 88  ? 5.811   2.923   -3.903  1.00 0.00 ? 88  SER A C    4  
ATOM 5784  O O    . SER A 1 88  ? 6.450   3.179   -2.883  1.00 0.00 ? 88  SER A O    4  
ATOM 5785  C CB   . SER A 1 88  ? 7.408   4.088   -5.451  1.00 0.00 ? 88  SER A CB   4  
ATOM 5786  O OG   . SER A 1 88  ? 7.620   4.363   -6.833  1.00 0.00 ? 88  SER A OG   4  
ATOM 5787  H H    . SER A 1 88  ? 5.706   5.765   -4.455  1.00 0.00 ? 88  SER A H    4  
ATOM 5788  H HA   . SER A 1 88  ? 5.466   3.336   -6.003  1.00 0.00 ? 88  SER A HA   4  
ATOM 5789  H HB2  . SER A 1 88  ? 7.751   4.935   -4.856  1.00 0.00 ? 88  SER A HB2  4  
ATOM 5790  H HB3  . SER A 1 88  ? 8.008   3.228   -5.157  1.00 0.00 ? 88  SER A HB3  4  
ATOM 5791  H HG   . SER A 1 88  ? 6.743   4.421   -7.309  1.00 0.00 ? 88  SER A HG   4  
ATOM 5792  N N    . VAL A 1 89  ? 4.985   1.895   -4.032  1.00 0.00 ? 89  VAL A N    4  
ATOM 5793  C CA   . VAL A 1 89  ? 4.770   0.966   -2.936  1.00 0.00 ? 89  VAL A CA   4  
ATOM 5794  C C    . VAL A 1 89  ? 5.212   -0.435  -3.365  1.00 0.00 ? 89  VAL A C    4  
ATOM 5795  O O    . VAL A 1 89  ? 5.105   -0.792  -4.537  1.00 0.00 ? 89  VAL A O    4  
ATOM 5796  C CB   . VAL A 1 89  ? 3.308   1.018   -2.485  1.00 0.00 ? 89  VAL A CB   4  
ATOM 5797  C CG1  . VAL A 1 89  ? 3.116   2.046   -1.367  1.00 0.00 ? 89  VAL A CG1  4  
ATOM 5798  C CG2  . VAL A 1 89  ? 2.381   1.312   -3.666  1.00 0.00 ? 89  VAL A CG2  4  
ATOM 5799  H H    . VAL A 1 89  ? 4.470   1.693   -4.865  1.00 0.00 ? 89  VAL A H    4  
ATOM 5800  H HA   . VAL A 1 89  ? 5.392   1.290   -2.102  1.00 0.00 ? 89  VAL A HA   4  
ATOM 5801  H HB   . VAL A 1 89  ? 3.045   0.038   -2.088  1.00 0.00 ? 89  VAL A HB   4  
ATOM 5802  H HG11 . VAL A 1 89  ? 3.764   1.794   -0.527  1.00 0.00 ? 89  VAL A HG11 4  
ATOM 5803  H HG12 . VAL A 1 89  ? 3.372   3.038   -1.738  1.00 0.00 ? 89  VAL A HG12 4  
ATOM 5804  H HG13 . VAL A 1 89  ? 2.077   2.037   -1.041  1.00 0.00 ? 89  VAL A HG13 4  
ATOM 5805  H HG21 . VAL A 1 89  ? 1.386   0.922   -3.452  1.00 0.00 ? 89  VAL A HG21 4  
ATOM 5806  H HG22 . VAL A 1 89  ? 2.322   2.390   -3.822  1.00 0.00 ? 89  VAL A HG22 4  
ATOM 5807  H HG23 . VAL A 1 89  ? 2.773   0.835   -4.564  1.00 0.00 ? 89  VAL A HG23 4  
ATOM 5808  N N    . TYR A 1 90  ? 5.701   -1.190  -2.393  1.00 0.00 ? 90  TYR A N    4  
ATOM 5809  C CA   . TYR A 1 90  ? 6.161   -2.543  -2.655  1.00 0.00 ? 90  TYR A CA   4  
ATOM 5810  C C    . TYR A 1 90  ? 5.121   -3.572  -2.208  1.00 0.00 ? 90  TYR A C    4  
ATOM 5811  O O    . TYR A 1 90  ? 4.680   -3.556  -1.060  1.00 0.00 ? 90  TYR A O    4  
ATOM 5812  C CB   . TYR A 1 90  ? 7.432   -2.726  -1.823  1.00 0.00 ? 90  TYR A CB   4  
ATOM 5813  C CG   . TYR A 1 90  ? 7.705   -4.175  -1.414  1.00 0.00 ? 90  TYR A CG   4  
ATOM 5814  C CD1  . TYR A 1 90  ? 7.881   -5.143  -2.382  1.00 0.00 ? 90  TYR A CD1  4  
ATOM 5815  C CD2  . TYR A 1 90  ? 7.776   -4.513  -0.078  1.00 0.00 ? 90  TYR A CD2  4  
ATOM 5816  C CE1  . TYR A 1 90  ? 8.138   -6.507  -1.997  1.00 0.00 ? 90  TYR A CE1  4  
ATOM 5817  C CE2  . TYR A 1 90  ? 8.034   -5.877  0.306   1.00 0.00 ? 90  TYR A CE2  4  
ATOM 5818  C CZ   . TYR A 1 90  ? 8.202   -6.806  -0.672  1.00 0.00 ? 90  TYR A CZ   4  
ATOM 5819  O OH   . TYR A 1 90  ? 8.445   -8.094  -0.309  1.00 0.00 ? 90  TYR A OH   4  
ATOM 5820  H H    . TYR A 1 90  ? 5.786   -0.892  -1.442  1.00 0.00 ? 90  TYR A H    4  
ATOM 5821  H HA   . TYR A 1 90  ? 6.321   -2.642  -3.729  1.00 0.00 ? 90  TYR A HA   4  
ATOM 5822  H HB2  . TYR A 1 90  ? 8.283   -2.353  -2.392  1.00 0.00 ? 90  TYR A HB2  4  
ATOM 5823  H HB3  . TYR A 1 90  ? 7.356   -2.114  -0.924  1.00 0.00 ? 90  TYR A HB3  4  
ATOM 5824  H HD1  . TYR A 1 90  ? 7.825   -4.875  -3.437  1.00 0.00 ? 90  TYR A HD1  4  
ATOM 5825  H HD2  . TYR A 1 90  ? 7.637   -3.748  0.686   1.00 0.00 ? 90  TYR A HD2  4  
ATOM 5826  H HE1  . TYR A 1 90  ? 8.279   -7.281  -2.751  1.00 0.00 ? 90  TYR A HE1  4  
ATOM 5827  H HE2  . TYR A 1 90  ? 8.092   -6.158  1.358   1.00 0.00 ? 90  TYR A HE2  4  
ATOM 5828  H HH   . TYR A 1 90  ? 8.517   -8.161  0.686   1.00 0.00 ? 90  TYR A HH   4  
ATOM 5829  N N    . SER A 1 91  ? 4.758   -4.443  -3.139  1.00 0.00 ? 91  SER A N    4  
ATOM 5830  C CA   . SER A 1 91  ? 3.778   -5.477  -2.855  1.00 0.00 ? 91  SER A CA   4  
ATOM 5831  C C    . SER A 1 91  ? 4.427   -6.607  -2.052  1.00 0.00 ? 91  SER A C    4  
ATOM 5832  O O    . SER A 1 91  ? 5.555   -7.006  -2.336  1.00 0.00 ? 91  SER A O    4  
ATOM 5833  C CB   . SER A 1 91  ? 3.167   -6.026  -4.145  1.00 0.00 ? 91  SER A CB   4  
ATOM 5834  O OG   . SER A 1 91  ? 1.998   -6.802  -3.895  1.00 0.00 ? 91  SER A OG   4  
ATOM 5835  H H    . SER A 1 91  ? 5.122   -4.449  -4.070  1.00 0.00 ? 91  SER A H    4  
ATOM 5836  H HA   . SER A 1 91  ? 3.003   -4.986  -2.266  1.00 0.00 ? 91  SER A HA   4  
ATOM 5837  H HB2  . SER A 1 91  ? 2.917   -5.198  -4.809  1.00 0.00 ? 91  SER A HB2  4  
ATOM 5838  H HB3  . SER A 1 91  ? 3.904   -6.638  -4.664  1.00 0.00 ? 91  SER A HB3  4  
ATOM 5839  H HG   . SER A 1 91  ? 1.656   -6.617  -2.974  1.00 0.00 ? 91  SER A HG   4  
ATOM 5840  N N    . ALA A 1 92  ? 3.686   -7.090  -1.066  1.00 0.00 ? 92  ALA A N    4  
ATOM 5841  C CA   . ALA A 1 92  ? 4.175   -8.166  -0.221  1.00 0.00 ? 92  ALA A CA   4  
ATOM 5842  C C    . ALA A 1 92  ? 2.987   -8.975  0.306   1.00 0.00 ? 92  ALA A C    4  
ATOM 5843  O O    . ALA A 1 92  ? 1.846   -8.518  0.248   1.00 0.00 ? 92  ALA A O    4  
ATOM 5844  C CB   . ALA A 1 92  ? 5.029   -7.582  0.906   1.00 0.00 ? 92  ALA A CB   4  
ATOM 5845  H H    . ALA A 1 92  ? 2.769   -6.760  -0.842  1.00 0.00 ? 92  ALA A H    4  
ATOM 5846  H HA   . ALA A 1 92  ? 4.800   -8.813  -0.836  1.00 0.00 ? 92  ALA A HA   4  
ATOM 5847  H HB1  . ALA A 1 92  ? 5.764   -6.896  0.487   1.00 0.00 ? 92  ALA A HB1  4  
ATOM 5848  H HB2  . ALA A 1 92  ? 4.388   -7.046  1.607   1.00 0.00 ? 92  ALA A HB2  4  
ATOM 5849  H HB3  . ALA A 1 92  ? 5.542   -8.389  1.429   1.00 0.00 ? 92  ALA A HB3  4  
ATOM 5850  N N    . GLY A 1 93  ? 3.296   -10.161 0.808   1.00 0.00 ? 93  GLY A N    4  
ATOM 5851  C CA   . GLY A 1 93  ? 2.269   -11.037 1.345   1.00 0.00 ? 93  GLY A CA   4  
ATOM 5852  C C    . GLY A 1 93  ? 2.417   -11.192 2.860   1.00 0.00 ? 93  GLY A C    4  
ATOM 5853  O O    . GLY A 1 93  ? 2.911   -12.212 3.338   1.00 0.00 ? 93  GLY A O    4  
ATOM 5854  H H    . GLY A 1 93  ? 4.227   -10.525 0.851   1.00 0.00 ? 93  GLY A H    4  
ATOM 5855  H HA2  . GLY A 1 93  ? 1.284   -10.634 1.111   1.00 0.00 ? 93  GLY A HA2  4  
ATOM 5856  H HA3  . GLY A 1 93  ? 2.335   -12.015 0.868   1.00 0.00 ? 93  GLY A HA3  4  
ATOM 5857  N N    . ARG A 1 94  ? 1.979   -10.164 3.573   1.00 0.00 ? 94  ARG A N    4  
ATOM 5858  C CA   . ARG A 1 94  ? 2.057   -10.173 5.024   1.00 0.00 ? 94  ARG A CA   4  
ATOM 5859  C C    . ARG A 1 94  ? 1.289   -11.369 5.589   1.00 0.00 ? 94  ARG A C    4  
ATOM 5860  O O    . ARG A 1 94  ? 1.729   -11.994 6.553   1.00 0.00 ? 94  ARG A O    4  
ATOM 5861  C CB   . ARG A 1 94  ? 1.483   -8.883  5.613   1.00 0.00 ? 94  ARG A CB   4  
ATOM 5862  C CG   . ARG A 1 94  ? 2.000   -8.653  7.035   1.00 0.00 ? 94  ARG A CG   4  
ATOM 5863  C CD   . ARG A 1 94  ? 3.436   -8.127  7.018   1.00 0.00 ? 94  ARG A CD   4  
ATOM 5864  N NE   . ARG A 1 94  ? 3.615   -7.108  8.076   1.00 0.00 ? 94  ARG A NE   4  
ATOM 5865  C CZ   . ARG A 1 94  ? 4.759   -6.444  8.295   1.00 0.00 ? 94  ARG A CZ   4  
ATOM 5866  N NH1  . ARG A 1 94  ? 5.832   -6.689  7.530   1.00 0.00 ? 94  ARG A NH1  4  
ATOM 5867  N NH2  . ARG A 1 94  ? 4.829   -5.536  9.278   1.00 0.00 ? 94  ARG A NH2  4  
ATOM 5868  H H    . ARG A 1 94  ? 1.579   -9.338  3.176   1.00 0.00 ? 94  ARG A H    4  
ATOM 5869  H HA   . ARG A 1 94  ? 3.121   -10.249 5.245   1.00 0.00 ? 94  ARG A HA   4  
ATOM 5870  H HB2  . ARG A 1 94  ? 1.756   -8.037  4.982   1.00 0.00 ? 94  ARG A HB2  4  
ATOM 5871  H HB3  . ARG A 1 94  ? 0.394   -8.935  5.622   1.00 0.00 ? 94  ARG A HB3  4  
ATOM 5872  H HG2  . ARG A 1 94  ? 1.354   -7.941  7.550   1.00 0.00 ? 94  ARG A HG2  4  
ATOM 5873  H HG3  . ARG A 1 94  ? 1.957   -9.586  7.597   1.00 0.00 ? 94  ARG A HG3  4  
ATOM 5874  H HD2  . ARG A 1 94  ? 4.135   -8.950  7.172   1.00 0.00 ? 94  ARG A HD2  4  
ATOM 5875  H HD3  . ARG A 1 94  ? 3.663   -7.695  6.043   1.00 0.00 ? 94  ARG A HD3  4  
ATOM 5876  H HE   . ARG A 1 94  ? 2.834   -6.901  8.665   1.00 0.00 ? 94  ARG A HE   4  
ATOM 5877  H HH11 . ARG A 1 94  ? 5.779   -7.367  6.797   1.00 0.00 ? 94  ARG A HH11 4  
ATOM 5878  H HH12 . ARG A 1 94  ? 6.685   -6.194  7.694   1.00 0.00 ? 94  ARG A HH12 4  
ATOM 5879  H HH21 . ARG A 1 94  ? 4.028   -5.354  9.848   1.00 0.00 ? 94  ARG A HH21 4  
ATOM 5880  H HH22 . ARG A 1 94  ? 5.682   -5.041  9.441   1.00 0.00 ? 94  ARG A HH22 4  
ATOM 5881  N N    . ILE A 1 95  ? 0.155   -11.653 4.965   1.00 0.00 ? 95  ILE A N    4  
ATOM 5882  C CA   . ILE A 1 95  ? -0.678  -12.763 5.394   1.00 0.00 ? 95  ILE A CA   4  
ATOM 5883  C C    . ILE A 1 95  ? -1.138  -13.553 4.168   1.00 0.00 ? 95  ILE A C    4  
ATOM 5884  O O    . ILE A 1 95  ? -1.207  -13.011 3.066   1.00 0.00 ? 95  ILE A O    4  
ATOM 5885  C CB   . ILE A 1 95  ? -1.828  -12.263 6.271   1.00 0.00 ? 95  ILE A CB   4  
ATOM 5886  C CG1  . ILE A 1 95  ? -2.467  -13.417 7.046   1.00 0.00 ? 95  ILE A CG1  4  
ATOM 5887  C CG2  . ILE A 1 95  ? -2.855  -11.492 5.440   1.00 0.00 ? 95  ILE A CG2  4  
ATOM 5888  C CD1  . ILE A 1 95  ? -3.396  -12.892 8.143   1.00 0.00 ? 95  ILE A CD1  4  
ATOM 5889  H H    . ILE A 1 95  ? -0.196  -11.139 4.182   1.00 0.00 ? 95  ILE A H    4  
ATOM 5890  H HA   . ILE A 1 95  ? -0.060  -13.415 6.013   1.00 0.00 ? 95  ILE A HA   4  
ATOM 5891  H HB   . ILE A 1 95  ? -1.420  -11.569 7.005   1.00 0.00 ? 95  ILE A HB   4  
ATOM 5892  H HG12 . ILE A 1 95  ? -3.029  -14.052 6.362   1.00 0.00 ? 95  ILE A HG12 4  
ATOM 5893  H HG13 . ILE A 1 95  ? -1.689  -14.037 7.491   1.00 0.00 ? 95  ILE A HG13 4  
ATOM 5894  H HG21 . ILE A 1 95  ? -3.834  -11.960 5.547   1.00 0.00 ? 95  ILE A HG21 4  
ATOM 5895  H HG22 . ILE A 1 95  ? -2.905  -10.461 5.791   1.00 0.00 ? 95  ILE A HG22 4  
ATOM 5896  H HG23 . ILE A 1 95  ? -2.558  -11.505 4.392   1.00 0.00 ? 95  ILE A HG23 4  
ATOM 5897  H HD11 . ILE A 1 95  ? -2.877  -12.915 9.101   1.00 0.00 ? 95  ILE A HD11 4  
ATOM 5898  H HD12 . ILE A 1 95  ? -3.688  -11.867 7.912   1.00 0.00 ? 95  ILE A HD12 4  
ATOM 5899  H HD13 . ILE A 1 95  ? -4.286  -13.519 8.196   1.00 0.00 ? 95  ILE A HD13 4  
ATOM 5900  N N    . SER A 1 96  ? -1.441  -14.822 4.400   1.00 0.00 ? 96  SER A N    4  
ATOM 5901  C CA   . SER A 1 96  ? -1.893  -15.692 3.328   1.00 0.00 ? 96  SER A CA   4  
ATOM 5902  C C    . SER A 1 96  ? -3.294  -16.223 3.639   1.00 0.00 ? 96  SER A C    4  
ATOM 5903  O O    . SER A 1 96  ? -3.501  -16.878 4.659   1.00 0.00 ? 96  SER A O    4  
ATOM 5904  C CB   . SER A 1 96  ? -0.921  -16.854 3.115   1.00 0.00 ? 96  SER A CB   4  
ATOM 5905  O OG   . SER A 1 96  ? -0.196  -16.727 1.894   1.00 0.00 ? 96  SER A OG   4  
ATOM 5906  H H    . SER A 1 96  ? -1.382  -15.255 5.299   1.00 0.00 ? 96  SER A H    4  
ATOM 5907  H HA   . SER A 1 96  ? -1.911  -15.066 2.436   1.00 0.00 ? 96  SER A HA   4  
ATOM 5908  H HB2  . SER A 1 96  ? -0.220  -16.899 3.949   1.00 0.00 ? 96  SER A HB2  4  
ATOM 5909  H HB3  . SER A 1 96  ? -1.473  -17.794 3.112   1.00 0.00 ? 96  SER A HB3  4  
ATOM 5910  H HG   . SER A 1 96  ? 0.694   -17.174 1.977   1.00 0.00 ? 96  SER A HG   4  
ATOM 5911  N N    . GLY A 1 97  ? -4.220  -15.919 2.742   1.00 0.00 ? 97  GLY A N    4  
ATOM 5912  C CA   . GLY A 1 97  ? -5.595  -16.358 2.908   1.00 0.00 ? 97  GLY A CA   4  
ATOM 5913  C C    . GLY A 1 97  ? -6.527  -15.614 1.949   1.00 0.00 ? 97  GLY A C    4  
ATOM 5914  O O    . GLY A 1 97  ? -6.089  -14.738 1.206   1.00 0.00 ? 97  GLY A O    4  
ATOM 5915  H H    . GLY A 1 97  ? -4.043  -15.386 1.915   1.00 0.00 ? 97  GLY A H    4  
ATOM 5916  H HA2  . GLY A 1 97  ? -5.663  -17.430 2.728   1.00 0.00 ? 97  GLY A HA2  4  
ATOM 5917  H HA3  . GLY A 1 97  ? -5.913  -16.186 3.936   1.00 0.00 ? 97  GLY A HA3  4  
ATOM 5918  N N    . PRO A 1 98  ? -7.830  -16.001 1.998   1.00 0.00 ? 98  PRO A N    4  
ATOM 5919  C CA   . PRO A 1 98  ? -8.828  -15.381 1.143   1.00 0.00 ? 98  PRO A CA   4  
ATOM 5920  C C    . PRO A 1 98  ? -9.189  -13.983 1.647   1.00 0.00 ? 98  PRO A C    4  
ATOM 5921  O O    . PRO A 1 98  ? -8.923  -13.646 2.800   1.00 0.00 ? 98  PRO A O    4  
ATOM 5922  C CB   . PRO A 1 98  ? -10.007 -16.340 1.156   1.00 0.00 ? 98  PRO A CB   4  
ATOM 5923  C CG   . PRO A 1 98  ? -9.812  -17.225 2.376   1.00 0.00 ? 98  PRO A CG   4  
ATOM 5924  C CD   . PRO A 1 98  ? -8.386  -17.036 2.866   1.00 0.00 ? 98  PRO A CD   4  
ATOM 5925  H HA   . PRO A 1 98  ? -8.464  -15.254 0.220   1.00 0.00 ? 98  PRO A HA   4  
ATOM 5926  H HB2  . PRO A 1 98  ? -10.951 -15.797 1.213   1.00 0.00 ? 98  PRO A HB2  4  
ATOM 5927  H HB3  . PRO A 1 98  ? -10.037 -16.935 0.243   1.00 0.00 ? 98  PRO A HB3  4  
ATOM 5928  H HG2  . PRO A 1 98  ? -10.523 -16.958 3.159   1.00 0.00 ? 98  PRO A HG2  4  
ATOM 5929  H HG3  . PRO A 1 98  ? -9.994  -18.269 2.124   1.00 0.00 ? 98  PRO A HG3  4  
ATOM 5930  H HD2  . PRO A 1 98  ? -8.363  -16.730 3.912   1.00 0.00 ? 98  PRO A HD2  4  
ATOM 5931  H HD3  . PRO A 1 98  ? -7.816  -17.962 2.792   1.00 0.00 ? 98  PRO A HD3  4  
ATOM 5932  N N    . SER A 1 99  ? -9.789  -13.205 0.758   1.00 0.00 ? 99  SER A N    4  
ATOM 5933  C CA   . SER A 1 99  ? -10.189 -11.850 1.098   1.00 0.00 ? 99  SER A CA   4  
ATOM 5934  C C    . SER A 1 99  ? -11.015 -11.247 -0.040  1.00 0.00 ? 99  SER A C    4  
ATOM 5935  O O    . SER A 1 99  ? -10.723 -10.149 -0.510  1.00 0.00 ? 99  SER A O    4  
ATOM 5936  C CB   . SER A 1 99  ? -8.970  -10.973 1.391   1.00 0.00 ? 99  SER A CB   4  
ATOM 5937  O OG   . SER A 1 99  ? -9.344  -9.672  1.836   1.00 0.00 ? 99  SER A OG   4  
ATOM 5938  H H    . SER A 1 99  ? -10.002 -13.486 -0.178  1.00 0.00 ? 99  SER A H    4  
ATOM 5939  H HA   . SER A 1 99  ? -10.793 -11.945 2.000   1.00 0.00 ? 99  SER A HA   4  
ATOM 5940  H HB2  . SER A 1 99  ? -8.353  -11.452 2.151   1.00 0.00 ? 99  SER A HB2  4  
ATOM 5941  H HB3  . SER A 1 99  ? -8.360  -10.888 0.492   1.00 0.00 ? 99  SER A HB3  4  
ATOM 5942  H HG   . SER A 1 99  ? -9.904  -9.740  2.661   1.00 0.00 ? 99  SER A HG   4  
ATOM 5943  N N    . SER A 1 100 ? -12.031 -11.993 -0.450  1.00 0.00 ? 100 SER A N    4  
ATOM 5944  C CA   . SER A 1 100 ? -12.902 -11.545 -1.524  1.00 0.00 ? 100 SER A CA   4  
ATOM 5945  C C    . SER A 1 100 ? -13.215 -10.057 -1.359  1.00 0.00 ? 100 SER A C    4  
ATOM 5946  O O    . SER A 1 100 ? -13.560 -9.610  -0.266  1.00 0.00 ? 100 SER A O    4  
ATOM 5947  C CB   . SER A 1 100 ? -14.196 -12.360 -1.559  1.00 0.00 ? 100 SER A CB   4  
ATOM 5948  O OG   . SER A 1 100 ? -14.056 -13.552 -2.327  1.00 0.00 ? 100 SER A OG   4  
ATOM 5949  H H    . SER A 1 100 ? -12.262 -12.885 -0.063  1.00 0.00 ? 100 SER A H    4  
ATOM 5950  H HA   . SER A 1 100 ? -12.340 -11.718 -2.442  1.00 0.00 ? 100 SER A HA   4  
ATOM 5951  H HB2  . SER A 1 100 ? -14.491 -12.616 -0.542  1.00 0.00 ? 100 SER A HB2  4  
ATOM 5952  H HB3  . SER A 1 100 ? -14.997 -11.751 -1.979  1.00 0.00 ? 100 SER A HB3  4  
ATOM 5953  H HG   . SER A 1 100 ? -13.222 -14.035 -2.060  1.00 0.00 ? 100 SER A HG   4  
ATOM 5954  N N    . GLY A 1 101 ? -13.084 -9.331  -2.459  1.00 0.00 ? 101 GLY A N    4  
ATOM 5955  C CA   . GLY A 1 101 ? -13.350 -7.902  -2.449  1.00 0.00 ? 101 GLY A CA   4  
ATOM 5956  C C    . GLY A 1 101 ? -12.828 -7.257  -1.164  1.00 0.00 ? 101 GLY A C    4  
ATOM 5957  O O    . GLY A 1 101 ? -11.798 -7.668  -0.632  1.00 0.00 ? 101 GLY A O    4  
ATOM 5958  H H    . GLY A 1 101 ? -12.803 -9.703  -3.344  1.00 0.00 ? 101 GLY A H    4  
ATOM 5959  H HA2  . GLY A 1 101 ? -12.876 -7.435  -3.313  1.00 0.00 ? 101 GLY A HA2  4  
ATOM 5960  H HA3  . GLY A 1 101 ? -14.421 -7.727  -2.540  1.00 0.00 ? 101 GLY A HA3  4  
ATOM 5961  N N    . GLY A 1 1   ? 25.672  -13.442 0.450   1.00 0.00 ? 1   GLY A N    5  
ATOM 5962  C CA   . GLY A 1 1   ? 25.675  -12.508 1.563   1.00 0.00 ? 1   GLY A CA   5  
ATOM 5963  C C    . GLY A 1 1   ? 24.376  -12.607 2.365   1.00 0.00 ? 1   GLY A C    5  
ATOM 5964  O O    . GLY A 1 1   ? 24.311  -13.323 3.363   1.00 0.00 ? 1   GLY A O    5  
ATOM 5965  H H1   . GLY A 1 1   ? 24.870  -14.038 0.400   1.00 0.00 ? 1   GLY A H1   5  
ATOM 5966  H HA2  . GLY A 1 1   ? 26.525  -12.715 2.213   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 5967  H HA3  . GLY A 1 1   ? 25.799  -11.492 1.189   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 5968  N N    . SER A 1 2   ? 23.373  -11.877 1.899   1.00 0.00 ? 2   SER A N    5  
ATOM 5969  C CA   . SER A 1 2   ? 22.079  -11.873 2.561   1.00 0.00 ? 2   SER A CA   5  
ATOM 5970  C C    . SER A 1 2   ? 20.992  -11.429 1.581   1.00 0.00 ? 2   SER A C    5  
ATOM 5971  O O    . SER A 1 2   ? 21.080  -10.349 0.998   1.00 0.00 ? 2   SER A O    5  
ATOM 5972  C CB   . SER A 1 2   ? 22.092  -10.962 3.789   1.00 0.00 ? 2   SER A CB   5  
ATOM 5973  O OG   . SER A 1 2   ? 22.293  -11.694 4.995   1.00 0.00 ? 2   SER A OG   5  
ATOM 5974  H H    . SER A 1 2   ? 23.434  -11.297 1.087   1.00 0.00 ? 2   SER A H    5  
ATOM 5975  H HA   . SER A 1 2   ? 21.913  -12.904 2.875   1.00 0.00 ? 2   SER A HA   5  
ATOM 5976  H HB2  . SER A 1 2   ? 22.881  -10.218 3.681   1.00 0.00 ? 2   SER A HB2  5  
ATOM 5977  H HB3  . SER A 1 2   ? 21.148  -10.419 3.848   1.00 0.00 ? 2   SER A HB3  5  
ATOM 5978  H HG   . SER A 1 2   ? 21.989  -11.153 5.779   1.00 0.00 ? 2   SER A HG   5  
ATOM 5979  N N    . SER A 1 3   ? 19.991  -12.284 1.430   1.00 0.00 ? 3   SER A N    5  
ATOM 5980  C CA   . SER A 1 3   ? 18.887  -11.992 0.531   1.00 0.00 ? 3   SER A CA   5  
ATOM 5981  C C    . SER A 1 3   ? 19.409  -11.808 -0.896  1.00 0.00 ? 3   SER A C    5  
ATOM 5982  O O    . SER A 1 3   ? 20.602  -11.591 -1.101  1.00 0.00 ? 3   SER A O    5  
ATOM 5983  C CB   . SER A 1 3   ? 18.124  -10.746 0.982   1.00 0.00 ? 3   SER A CB   5  
ATOM 5984  O OG   . SER A 1 3   ? 17.460  -10.947 2.226   1.00 0.00 ? 3   SER A OG   5  
ATOM 5985  H H    . SER A 1 3   ? 19.927  -13.160 1.908   1.00 0.00 ? 3   SER A H    5  
ATOM 5986  H HA   . SER A 1 3   ? 18.231  -12.861 0.589   1.00 0.00 ? 3   SER A HA   5  
ATOM 5987  H HB2  . SER A 1 3   ? 18.816  -9.909  1.072   1.00 0.00 ? 3   SER A HB2  5  
ATOM 5988  H HB3  . SER A 1 3   ? 17.392  -10.473 0.221   1.00 0.00 ? 3   SER A HB3  5  
ATOM 5989  H HG   . SER A 1 3   ? 17.909  -10.416 2.944   1.00 0.00 ? 3   SER A HG   5  
ATOM 5990  N N    . GLY A 1 4   ? 18.489  -11.900 -1.845  1.00 0.00 ? 4   GLY A N    5  
ATOM 5991  C CA   . GLY A 1 4   ? 18.842  -11.746 -3.246  1.00 0.00 ? 4   GLY A CA   5  
ATOM 5992  C C    . GLY A 1 4   ? 17.772  -12.361 -4.151  1.00 0.00 ? 4   GLY A C    5  
ATOM 5993  O O    . GLY A 1 4   ? 17.959  -13.452 -4.688  1.00 0.00 ? 4   GLY A O    5  
ATOM 5994  H H    . GLY A 1 4   ? 17.521  -12.077 -1.670  1.00 0.00 ? 4   GLY A H    5  
ATOM 5995  H HA2  . GLY A 1 4   ? 18.958  -10.688 -3.481  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 5996  H HA3  . GLY A 1 4   ? 19.803  -12.223 -3.438  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 5997  N N    . SER A 1 5   ? 16.674  -11.633 -4.293  1.00 0.00 ? 5   SER A N    5  
ATOM 5998  C CA   . SER A 1 5   ? 15.574  -12.093 -5.124  1.00 0.00 ? 5   SER A CA   5  
ATOM 5999  C C    . SER A 1 5   ? 14.840  -10.896 -5.731  1.00 0.00 ? 5   SER A C    5  
ATOM 6000  O O    . SER A 1 5   ? 15.031  -9.761  -5.297  1.00 0.00 ? 5   SER A O    5  
ATOM 6001  C CB   . SER A 1 5   ? 14.602  -12.960 -4.321  1.00 0.00 ? 5   SER A CB   5  
ATOM 6002  O OG   . SER A 1 5   ? 14.361  -14.216 -4.951  1.00 0.00 ? 5   SER A OG   5  
ATOM 6003  H H    . SER A 1 5   ? 16.529  -10.747 -3.854  1.00 0.00 ? 5   SER A H    5  
ATOM 6004  H HA   . SER A 1 5   ? 16.036  -12.696 -5.906  1.00 0.00 ? 5   SER A HA   5  
ATOM 6005  H HB2  . SER A 1 5   ? 15.005  -13.126 -3.322  1.00 0.00 ? 5   SER A HB2  5  
ATOM 6006  H HB3  . SER A 1 5   ? 13.658  -12.428 -4.200  1.00 0.00 ? 5   SER A HB3  5  
ATOM 6007  H HG   . SER A 1 5   ? 14.574  -14.156 -5.926  1.00 0.00 ? 5   SER A HG   5  
ATOM 6008  N N    . SER A 1 6   ? 14.016  -11.189 -6.726  1.00 0.00 ? 6   SER A N    5  
ATOM 6009  C CA   . SER A 1 6   ? 13.253  -10.151 -7.397  1.00 0.00 ? 6   SER A CA   5  
ATOM 6010  C C    . SER A 1 6   ? 11.869  -10.022 -6.757  1.00 0.00 ? 6   SER A C    5  
ATOM 6011  O O    . SER A 1 6   ? 11.121  -10.995 -6.688  1.00 0.00 ? 6   SER A O    5  
ATOM 6012  C CB   . SER A 1 6   ? 13.121  -10.444 -8.893  1.00 0.00 ? 6   SER A CB   5  
ATOM 6013  O OG   . SER A 1 6   ? 13.923  -9.569  -9.681  1.00 0.00 ? 6   SER A OG   5  
ATOM 6014  H H    . SER A 1 6   ? 13.867  -12.115 -7.074  1.00 0.00 ? 6   SER A H    5  
ATOM 6015  H HA   . SER A 1 6   ? 13.827  -9.235  -7.256  1.00 0.00 ? 6   SER A HA   5  
ATOM 6016  H HB2  . SER A 1 6   ? 13.412  -11.476 -9.087  1.00 0.00 ? 6   SER A HB2  5  
ATOM 6017  H HB3  . SER A 1 6   ? 12.077  -10.345 -9.191  1.00 0.00 ? 6   SER A HB3  5  
ATOM 6018  H HG   . SER A 1 6   ? 13.440  -9.327  -10.523 1.00 0.00 ? 6   SER A HG   5  
ATOM 6019  N N    . GLY A 1 7   ? 11.572  -8.812  -6.306  1.00 0.00 ? 7   GLY A N    5  
ATOM 6020  C CA   . GLY A 1 7   ? 10.291  -8.544  -5.674  1.00 0.00 ? 7   GLY A CA   5  
ATOM 6021  C C    . GLY A 1 7   ? 9.289   -7.981  -6.684  1.00 0.00 ? 7   GLY A C    5  
ATOM 6022  O O    . GLY A 1 7   ? 9.192   -8.473  -7.807  1.00 0.00 ? 7   GLY A O    5  
ATOM 6023  H H    . GLY A 1 7   ? 12.186  -8.026  -6.366  1.00 0.00 ? 7   GLY A H    5  
ATOM 6024  H HA2  . GLY A 1 7   ? 9.897   -9.461  -5.238  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6025  H HA3  . GLY A 1 7   ? 10.426  -7.835  -4.857  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6026  N N    . GLU A 1 8   ? 8.568   -6.959  -6.247  1.00 0.00 ? 8   GLU A N    5  
ATOM 6027  C CA   . GLU A 1 8   ? 7.577   -6.324  -7.099  1.00 0.00 ? 8   GLU A CA   5  
ATOM 6028  C C    . GLU A 1 8   ? 7.046   -5.050  -6.438  1.00 0.00 ? 8   GLU A C    5  
ATOM 6029  O O    . GLU A 1 8   ? 6.624   -5.076  -5.283  1.00 0.00 ? 8   GLU A O    5  
ATOM 6030  C CB   . GLU A 1 8   ? 6.435   -7.289  -7.425  1.00 0.00 ? 8   GLU A CB   5  
ATOM 6031  C CG   . GLU A 1 8   ? 6.461   -7.692  -8.901  1.00 0.00 ? 8   GLU A CG   5  
ATOM 6032  C CD   . GLU A 1 8   ? 5.659   -8.974  -9.134  1.00 0.00 ? 8   GLU A CD   5  
ATOM 6033  O OE1  . GLU A 1 8   ? 6.053   -10.004 -8.545  1.00 0.00 ? 8   GLU A OE1  5  
ATOM 6034  O OE2  . GLU A 1 8   ? 4.671   -8.895  -9.895  1.00 0.00 ? 8   GLU A OE2  5  
ATOM 6035  H H    . GLU A 1 8   ? 8.653   -6.565  -5.332  1.00 0.00 ? 8   GLU A H    5  
ATOM 6036  H HA   . GLU A 1 8   ? 8.104   -6.072  -8.019  1.00 0.00 ? 8   GLU A HA   5  
ATOM 6037  H HB2  . GLU A 1 8   ? 6.517   -8.179  -6.800  1.00 0.00 ? 8   GLU A HB2  5  
ATOM 6038  H HB3  . GLU A 1 8   ? 5.479   -6.821  -7.189  1.00 0.00 ? 8   GLU A HB3  5  
ATOM 6039  H HG2  . GLU A 1 8   ? 6.050   -6.886  -9.508  1.00 0.00 ? 8   GLU A HG2  5  
ATOM 6040  H HG3  . GLU A 1 8   ? 7.492   -7.840  -9.223  1.00 0.00 ? 8   GLU A HG3  5  
ATOM 6041  N N    . VAL A 1 9   ? 7.084   -3.967  -7.200  1.00 0.00 ? 9   VAL A N    5  
ATOM 6042  C CA   . VAL A 1 9   ? 6.612   -2.686  -6.702  1.00 0.00 ? 9   VAL A CA   5  
ATOM 6043  C C    . VAL A 1 9   ? 5.529   -2.147  -7.639  1.00 0.00 ? 9   VAL A C    5  
ATOM 6044  O O    . VAL A 1 9   ? 5.704   -2.140  -8.857  1.00 0.00 ? 9   VAL A O    5  
ATOM 6045  C CB   . VAL A 1 9   ? 7.790   -1.724  -6.535  1.00 0.00 ? 9   VAL A CB   5  
ATOM 6046  C CG1  . VAL A 1 9   ? 7.300   -0.296  -6.283  1.00 0.00 ? 9   VAL A CG1  5  
ATOM 6047  C CG2  . VAL A 1 9   ? 8.723   -2.189  -5.415  1.00 0.00 ? 9   VAL A CG2  5  
ATOM 6048  H H    . VAL A 1 9   ? 7.428   -3.955  -8.139  1.00 0.00 ? 9   VAL A H    5  
ATOM 6049  H HA   . VAL A 1 9   ? 6.173   -2.856  -5.720  1.00 0.00 ? 9   VAL A HA   5  
ATOM 6050  H HB   . VAL A 1 9   ? 8.358   -1.724  -7.465  1.00 0.00 ? 9   VAL A HB   5  
ATOM 6051  H HG11 . VAL A 1 9   ? 6.216   -0.298  -6.172  1.00 0.00 ? 9   VAL A HG11 5  
ATOM 6052  H HG12 . VAL A 1 9   ? 7.758   0.090   -5.373  1.00 0.00 ? 9   VAL A HG12 5  
ATOM 6053  H HG13 . VAL A 1 9   ? 7.577   0.337   -7.126  1.00 0.00 ? 9   VAL A HG13 5  
ATOM 6054  H HG21 . VAL A 1 9   ? 8.586   -1.553  -4.540  1.00 0.00 ? 9   VAL A HG21 5  
ATOM 6055  H HG22 . VAL A 1 9   ? 8.490   -3.221  -5.153  1.00 0.00 ? 9   VAL A HG22 5  
ATOM 6056  H HG23 . VAL A 1 9   ? 9.757   -2.124  -5.753  1.00 0.00 ? 9   VAL A HG23 5  
ATOM 6057  N N    . ARG A 1 10  ? 4.433   -1.710  -7.036  1.00 0.00 ? 10  ARG A N    5  
ATOM 6058  C CA   . ARG A 1 10  ? 3.322   -1.171  -7.801  1.00 0.00 ? 10  ARG A CA   5  
ATOM 6059  C C    . ARG A 1 10  ? 3.432   0.352   -7.897  1.00 0.00 ? 10  ARG A C    5  
ATOM 6060  O O    . ARG A 1 10  ? 4.237   0.965   -7.197  1.00 0.00 ? 10  ARG A O    5  
ATOM 6061  C CB   . ARG A 1 10  ? 1.982   -1.539  -7.161  1.00 0.00 ? 10  ARG A CB   5  
ATOM 6062  C CG   . ARG A 1 10  ? 1.820   -0.859  -5.800  1.00 0.00 ? 10  ARG A CG   5  
ATOM 6063  C CD   . ARG A 1 10  ? 0.634   -1.447  -5.031  1.00 0.00 ? 10  ARG A CD   5  
ATOM 6064  N NE   . ARG A 1 10  ? 1.106   -2.082  -3.781  1.00 0.00 ? 10  ARG A NE   5  
ATOM 6065  C CZ   . ARG A 1 10  ? 0.298   -2.646  -2.873  1.00 0.00 ? 10  ARG A CZ   5  
ATOM 6066  N NH1  . ARG A 1 10  ? -1.027  -2.657  -3.071  1.00 0.00 ? 10  ARG A NH1  5  
ATOM 6067  N NH2  . ARG A 1 10  ? 0.815   -3.199  -1.768  1.00 0.00 ? 10  ARG A NH2  5  
ATOM 6068  H H    . ARG A 1 10  ? 4.299   -1.720  -6.045  1.00 0.00 ? 10  ARG A H    5  
ATOM 6069  H HA   . ARG A 1 10  ? 3.411   -1.633  -8.785  1.00 0.00 ? 10  ARG A HA   5  
ATOM 6070  H HB2  . ARG A 1 10  ? 1.166   -1.242  -7.820  1.00 0.00 ? 10  ARG A HB2  5  
ATOM 6071  H HB3  . ARG A 1 10  ? 1.918   -2.621  -7.041  1.00 0.00 ? 10  ARG A HB3  5  
ATOM 6072  H HG2  . ARG A 1 10  ? 2.732   -0.982  -5.217  1.00 0.00 ? 10  ARG A HG2  5  
ATOM 6073  H HG3  . ARG A 1 10  ? 1.672   0.212   -5.940  1.00 0.00 ? 10  ARG A HG3  5  
ATOM 6074  H HD2  . ARG A 1 10  ? -0.085  -0.661  -4.801  1.00 0.00 ? 10  ARG A HD2  5  
ATOM 6075  H HD3  . ARG A 1 10  ? 0.117   -2.181  -5.650  1.00 0.00 ? 10  ARG A HD3  5  
ATOM 6076  H HE   . ARG A 1 10  ? 2.090   -2.091  -3.602  1.00 0.00 ? 10  ARG A HE   5  
ATOM 6077  H HH11 . ARG A 1 10  ? -1.413  -2.244  -3.896  1.00 0.00 ? 10  ARG A HH11 5  
ATOM 6078  H HH12 . ARG A 1 10  ? -1.630  -3.078  -2.394  1.00 0.00 ? 10  ARG A HH12 5  
ATOM 6079  H HH21 . ARG A 1 10  ? 1.804   -3.191  -1.620  1.00 0.00 ? 10  ARG A HH21 5  
ATOM 6080  H HH22 . ARG A 1 10  ? 0.212   -3.620  -1.090  1.00 0.00 ? 10  ARG A HH22 5  
ATOM 6081  N N    . LEU A 1 11  ? 2.612   0.919   -8.769  1.00 0.00 ? 11  LEU A N    5  
ATOM 6082  C CA   . LEU A 1 11  ? 2.607   2.359   -8.965  1.00 0.00 ? 11  LEU A CA   5  
ATOM 6083  C C    . LEU A 1 11  ? 1.202   2.901   -8.696  1.00 0.00 ? 11  LEU A C    5  
ATOM 6084  O O    . LEU A 1 11  ? 0.302   2.736   -9.518  1.00 0.00 ? 11  LEU A O    5  
ATOM 6085  C CB   . LEU A 1 11  ? 3.148   2.713   -10.352 1.00 0.00 ? 11  LEU A CB   5  
ATOM 6086  C CG   . LEU A 1 11  ? 4.626   2.398   -10.596 1.00 0.00 ? 11  LEU A CG   5  
ATOM 6087  C CD1  . LEU A 1 11  ? 5.068   2.879   -11.979 1.00 0.00 ? 11  LEU A CD1  5  
ATOM 6088  C CD2  . LEU A 1 11  ? 5.501   2.975   -9.481  1.00 0.00 ? 11  LEU A CD2  5  
ATOM 6089  H H    . LEU A 1 11  ? 1.960   0.414   -9.334  1.00 0.00 ? 11  LEU A H    5  
ATOM 6090  H HA   . LEU A 1 11  ? 3.290   2.791   -8.233  1.00 0.00 ? 11  LEU A HA   5  
ATOM 6091  H HB2  . LEU A 1 11  ? 2.556   2.182   -11.097 1.00 0.00 ? 11  LEU A HB2  5  
ATOM 6092  H HB3  . LEU A 1 11  ? 2.992   3.778   -10.520 1.00 0.00 ? 11  LEU A HB3  5  
ATOM 6093  H HG   . LEU A 1 11  ? 4.752   1.315   -10.576 1.00 0.00 ? 11  LEU A HG   5  
ATOM 6094  H HD11 . LEU A 1 11  ? 4.194   3.187   -12.553 1.00 0.00 ? 11  LEU A HD11 5  
ATOM 6095  H HD12 . LEU A 1 11  ? 5.747   3.724   -11.870 1.00 0.00 ? 11  LEU A HD12 5  
ATOM 6096  H HD13 . LEU A 1 11  ? 5.577   2.068   -12.500 1.00 0.00 ? 11  LEU A HD13 5  
ATOM 6097  H HD21 . LEU A 1 11  ? 5.101   3.940   -9.168  1.00 0.00 ? 11  LEU A HD21 5  
ATOM 6098  H HD22 . LEU A 1 11  ? 5.506   2.291   -8.632  1.00 0.00 ? 11  LEU A HD22 5  
ATOM 6099  H HD23 . LEU A 1 11  ? 6.518   3.106   -9.849  1.00 0.00 ? 11  LEU A HD23 5  
ATOM 6100  N N    . VAL A 1 12  ? 1.058   3.538   -7.543  1.00 0.00 ? 12  VAL A N    5  
ATOM 6101  C CA   . VAL A 1 12  ? -0.222  4.106   -7.156  1.00 0.00 ? 12  VAL A CA   5  
ATOM 6102  C C    . VAL A 1 12  ? -0.236  5.598   -7.492  1.00 0.00 ? 12  VAL A C    5  
ATOM 6103  O O    . VAL A 1 12  ? 0.787   6.273   -7.381  1.00 0.00 ? 12  VAL A O    5  
ATOM 6104  C CB   . VAL A 1 12  ? -0.494  3.823   -5.678  1.00 0.00 ? 12  VAL A CB   5  
ATOM 6105  C CG1  . VAL A 1 12  ? -1.742  4.568   -5.198  1.00 0.00 ? 12  VAL A CG1  5  
ATOM 6106  C CG2  . VAL A 1 12  ? -0.620  2.320   -5.421  1.00 0.00 ? 12  VAL A CG2  5  
ATOM 6107  H H    . VAL A 1 12  ? 1.796   3.668   -6.881  1.00 0.00 ? 12  VAL A H    5  
ATOM 6108  H HA   . VAL A 1 12  ? -0.994  3.607   -7.743  1.00 0.00 ? 12  VAL A HA   5  
ATOM 6109  H HB   . VAL A 1 12  ? 0.357   4.190   -5.104  1.00 0.00 ? 12  VAL A HB   5  
ATOM 6110  H HG11 . VAL A 1 12  ? -1.449  5.358   -4.506  1.00 0.00 ? 12  VAL A HG11 5  
ATOM 6111  H HG12 . VAL A 1 12  ? -2.255  5.006   -6.054  1.00 0.00 ? 12  VAL A HG12 5  
ATOM 6112  H HG13 . VAL A 1 12  ? -2.409  3.870   -4.692  1.00 0.00 ? 12  VAL A HG13 5  
ATOM 6113  H HG21 . VAL A 1 12  ? -0.946  1.821   -6.334  1.00 0.00 ? 12  VAL A HG21 5  
ATOM 6114  H HG22 . VAL A 1 12  ? 0.347   1.921   -5.114  1.00 0.00 ? 12  VAL A HG22 5  
ATOM 6115  H HG23 . VAL A 1 12  ? -1.351  2.146   -4.631  1.00 0.00 ? 12  VAL A HG23 5  
ATOM 6116  N N    . SER A 1 13  ? -1.406  6.071   -7.897  1.00 0.00 ? 13  SER A N    5  
ATOM 6117  C CA   . SER A 1 13  ? -1.566  7.471   -8.249  1.00 0.00 ? 13  SER A CA   5  
ATOM 6118  C C    . SER A 1 13  ? -2.751  8.070   -7.490  1.00 0.00 ? 13  SER A C    5  
ATOM 6119  O O    . SER A 1 13  ? -3.865  7.554   -7.565  1.00 0.00 ? 13  SER A O    5  
ATOM 6120  C CB   . SER A 1 13  ? -1.761  7.640   -9.757  1.00 0.00 ? 13  SER A CB   5  
ATOM 6121  O OG   . SER A 1 13  ? -0.943  6.746   -10.505 1.00 0.00 ? 13  SER A OG   5  
ATOM 6122  H H    . SER A 1 13  ? -2.233  5.515   -7.985  1.00 0.00 ? 13  SER A H    5  
ATOM 6123  H HA   . SER A 1 13  ? -0.636  7.953   -7.948  1.00 0.00 ? 13  SER A HA   5  
ATOM 6124  H HB2  . SER A 1 13  ? -2.808  7.470   -10.008 1.00 0.00 ? 13  SER A HB2  5  
ATOM 6125  H HB3  . SER A 1 13  ? -1.529  8.667   -10.040 1.00 0.00 ? 13  SER A HB3  5  
ATOM 6126  H HG   . SER A 1 13  ? 0.023   6.946   -10.340 1.00 0.00 ? 13  SER A HG   5  
ATOM 6127  N N    . LEU A 1 14  ? -2.471  9.150   -6.776  1.00 0.00 ? 14  LEU A N    5  
ATOM 6128  C CA   . LEU A 1 14  ? -3.501  9.824   -6.003  1.00 0.00 ? 14  LEU A CA   5  
ATOM 6129  C C    . LEU A 1 14  ? -3.536  11.304  -6.391  1.00 0.00 ? 14  LEU A C    5  
ATOM 6130  O O    . LEU A 1 14  ? -2.492  11.939  -6.525  1.00 0.00 ? 14  LEU A O    5  
ATOM 6131  C CB   . LEU A 1 14  ? -3.290  9.586   -4.507  1.00 0.00 ? 14  LEU A CB   5  
ATOM 6132  C CG   . LEU A 1 14  ? -3.861  8.280   -3.948  1.00 0.00 ? 14  LEU A CG   5  
ATOM 6133  C CD1  . LEU A 1 14  ? -5.368  8.191   -4.197  1.00 0.00 ? 14  LEU A CD1  5  
ATOM 6134  C CD2  . LEU A 1 14  ? -3.114  7.070   -4.512  1.00 0.00 ? 14  LEU A CD2  5  
ATOM 6135  H H    . LEU A 1 14  ? -1.562  9.563   -6.720  1.00 0.00 ? 14  LEU A H    5  
ATOM 6136  H HA   . LEU A 1 14  ? -4.457  9.374   -6.270  1.00 0.00 ? 14  LEU A HA   5  
ATOM 6137  H HB2  . LEU A 1 14  ? -2.220  9.607   -4.302  1.00 0.00 ? 14  LEU A HB2  5  
ATOM 6138  H HB3  . LEU A 1 14  ? -3.736  10.417  -3.960  1.00 0.00 ? 14  LEU A HB3  5  
ATOM 6139  H HG   . LEU A 1 14  ? -3.712  8.276   -2.869  1.00 0.00 ? 14  LEU A HG   5  
ATOM 6140  H HD11 . LEU A 1 14  ? -5.585  7.308   -4.798  1.00 0.00 ? 14  LEU A HD11 5  
ATOM 6141  H HD12 . LEU A 1 14  ? -5.890  8.118   -3.243  1.00 0.00 ? 14  LEU A HD12 5  
ATOM 6142  H HD13 . LEU A 1 14  ? -5.703  9.082   -4.727  1.00 0.00 ? 14  LEU A HD13 5  
ATOM 6143  H HD21 . LEU A 1 14  ? -3.286  6.206   -3.870  1.00 0.00 ? 14  LEU A HD21 5  
ATOM 6144  H HD22 . LEU A 1 14  ? -3.478  6.854   -5.517  1.00 0.00 ? 14  LEU A HD22 5  
ATOM 6145  H HD23 . LEU A 1 14  ? -2.047  7.288   -4.551  1.00 0.00 ? 14  LEU A HD23 5  
ATOM 6146  N N    . ARG A 1 15  ? -4.749  11.809  -6.560  1.00 0.00 ? 15  ARG A N    5  
ATOM 6147  C CA   . ARG A 1 15  ? -4.935  13.202  -6.930  1.00 0.00 ? 15  ARG A CA   5  
ATOM 6148  C C    . ARG A 1 15  ? -5.877  13.892  -5.942  1.00 0.00 ? 15  ARG A C    5  
ATOM 6149  O O    . ARG A 1 15  ? -6.832  13.285  -5.461  1.00 0.00 ? 15  ARG A O    5  
ATOM 6150  C CB   . ARG A 1 15  ? -5.510  13.325  -8.343  1.00 0.00 ? 15  ARG A CB   5  
ATOM 6151  C CG   . ARG A 1 15  ? -4.434  13.771  -9.335  1.00 0.00 ? 15  ARG A CG   5  
ATOM 6152  C CD   . ARG A 1 15  ? -4.633  15.234  -9.737  1.00 0.00 ? 15  ARG A CD   5  
ATOM 6153  N NE   . ARG A 1 15  ? -4.295  15.417  -11.166 1.00 0.00 ? 15  ARG A NE   5  
ATOM 6154  C CZ   . ARG A 1 15  ? -4.921  14.791  -12.172 1.00 0.00 ? 15  ARG A CZ   5  
ATOM 6155  N NH1  . ARG A 1 15  ? -5.922  13.939  -11.911 1.00 0.00 ? 15  ARG A NH1  5  
ATOM 6156  N NH2  . ARG A 1 15  ? -4.548  15.018  -13.439 1.00 0.00 ? 15  ARG A NH2  5  
ATOM 6157  H H    . ARG A 1 15  ? -5.594  11.285  -6.449  1.00 0.00 ? 15  ARG A H    5  
ATOM 6158  H HA   . ARG A 1 15  ? -3.936  13.636  -6.889  1.00 0.00 ? 15  ARG A HA   5  
ATOM 6159  H HB2  . ARG A 1 15  ? -5.923  12.366  -8.656  1.00 0.00 ? 15  ARG A HB2  5  
ATOM 6160  H HB3  . ARG A 1 15  ? -6.331  14.041  -8.344  1.00 0.00 ? 15  ARG A HB3  5  
ATOM 6161  H HG2  . ARG A 1 15  ? -3.448  13.643  -8.890  1.00 0.00 ? 15  ARG A HG2  5  
ATOM 6162  H HG3  . ARG A 1 15  ? -4.468  13.139  -10.222 1.00 0.00 ? 15  ARG A HG3  5  
ATOM 6163  H HD2  . ARG A 1 15  ? -5.666  15.532  -9.558  1.00 0.00 ? 15  ARG A HD2  5  
ATOM 6164  H HD3  . ARG A 1 15  ? -4.004  15.877  -9.121  1.00 0.00 ? 15  ARG A HD3  5  
ATOM 6165  H HE   . ARG A 1 15  ? -3.553  16.047  -11.396 1.00 0.00 ? 15  ARG A HE   5  
ATOM 6166  H HH11 . ARG A 1 15  ? -6.201  13.769  -10.966 1.00 0.00 ? 15  ARG A HH11 5  
ATOM 6167  H HH12 . ARG A 1 15  ? -6.389  13.472  -12.662 1.00 0.00 ? 15  ARG A HH12 5  
ATOM 6168  H HH21 . ARG A 1 15  ? -3.801  15.655  -13.633 1.00 0.00 ? 15  ARG A HH21 5  
ATOM 6169  H HH22 . ARG A 1 15  ? -5.015  14.551  -14.189 1.00 0.00 ? 15  ARG A HH22 5  
ATOM 6170  N N    . ARG A 1 16  ? -5.575  15.153  -5.668  1.00 0.00 ? 16  ARG A N    5  
ATOM 6171  C CA   . ARG A 1 16  ? -6.383  15.933  -4.746  1.00 0.00 ? 16  ARG A CA   5  
ATOM 6172  C C    . ARG A 1 16  ? -7.483  16.678  -5.503  1.00 0.00 ? 16  ARG A C    5  
ATOM 6173  O O    . ARG A 1 16  ? -7.300  17.828  -5.899  1.00 0.00 ? 16  ARG A O    5  
ATOM 6174  C CB   . ARG A 1 16  ? -5.525  16.943  -3.981  1.00 0.00 ? 16  ARG A CB   5  
ATOM 6175  C CG   . ARG A 1 16  ? -4.801  17.887  -4.944  1.00 0.00 ? 16  ARG A CG   5  
ATOM 6176  C CD   . ARG A 1 16  ? -3.286  17.824  -4.737  1.00 0.00 ? 16  ARG A CD   5  
ATOM 6177  N NE   . ARG A 1 16  ? -2.654  19.060  -5.249  1.00 0.00 ? 16  ARG A NE   5  
ATOM 6178  C CZ   . ARG A 1 16  ? -2.292  19.245  -6.526  1.00 0.00 ? 16  ARG A CZ   5  
ATOM 6179  N NH1  . ARG A 1 16  ? -2.497  18.275  -7.428  1.00 0.00 ? 16  ARG A NH1  5  
ATOM 6180  N NH2  . ARG A 1 16  ? -1.724  20.399  -6.902  1.00 0.00 ? 16  ARG A NH2  5  
ATOM 6181  H H    . ARG A 1 16  ? -4.796  15.640  -6.063  1.00 0.00 ? 16  ARG A H    5  
ATOM 6182  H HA   . ARG A 1 16  ? -6.806  15.200  -4.058  1.00 0.00 ? 16  ARG A HA   5  
ATOM 6183  H HB2  . ARG A 1 16  ? -6.155  17.522  -3.305  1.00 0.00 ? 16  ARG A HB2  5  
ATOM 6184  H HB3  . ARG A 1 16  ? -4.797  16.416  -3.366  1.00 0.00 ? 16  ARG A HB3  5  
ATOM 6185  H HG2  . ARG A 1 16  ? -5.042  17.618  -5.972  1.00 0.00 ? 16  ARG A HG2  5  
ATOM 6186  H HG3  . ARG A 1 16  ? -5.151  18.908  -4.790  1.00 0.00 ? 16  ARG A HG3  5  
ATOM 6187  H HD2  . ARG A 1 16  ? -3.061  17.703  -3.677  1.00 0.00 ? 16  ARG A HD2  5  
ATOM 6188  H HD3  . ARG A 1 16  ? -2.876  16.956  -5.251  1.00 0.00 ? 16  ARG A HD3  5  
ATOM 6189  H HE   . ARG A 1 16  ? -2.486  19.804  -4.603  1.00 0.00 ? 16  ARG A HE   5  
ATOM 6190  H HH11 . ARG A 1 16  ? -2.920  17.413  -7.147  1.00 0.00 ? 16  ARG A HH11 5  
ATOM 6191  H HH12 . ARG A 1 16  ? -2.227  18.412  -8.381  1.00 0.00 ? 16  ARG A HH12 5  
ATOM 6192  H HH21 . ARG A 1 16  ? -1.571  21.123  -6.229  1.00 0.00 ? 16  ARG A HH21 5  
ATOM 6193  H HH22 . ARG A 1 16  ? -1.454  20.536  -7.855  1.00 0.00 ? 16  ARG A HH22 5  
ATOM 6194  N N    . ALA A 1 17  ? -8.603  15.992  -5.683  1.00 0.00 ? 17  ALA A N    5  
ATOM 6195  C CA   . ALA A 1 17  ? -9.733  16.575  -6.386  1.00 0.00 ? 17  ALA A CA   5  
ATOM 6196  C C    . ALA A 1 17  ? -10.751 15.477  -6.704  1.00 0.00 ? 17  ALA A C    5  
ATOM 6197  O O    . ALA A 1 17  ? -11.114 15.279  -7.863  1.00 0.00 ? 17  ALA A O    5  
ATOM 6198  C CB   . ALA A 1 17  ? -9.237  17.292  -7.643  1.00 0.00 ? 17  ALA A CB   5  
ATOM 6199  H H    . ALA A 1 17  ? -8.744  15.057  -5.358  1.00 0.00 ? 17  ALA A H    5  
ATOM 6200  H HA   . ALA A 1 17  ? -10.195 17.306  -5.724  1.00 0.00 ? 17  ALA A HA   5  
ATOM 6201  H HB1  . ALA A 1 17  ? -8.370  16.767  -8.043  1.00 0.00 ? 17  ALA A HB1  5  
ATOM 6202  H HB2  . ALA A 1 17  ? -10.030 17.305  -8.391  1.00 0.00 ? 17  ALA A HB2  5  
ATOM 6203  H HB3  . ALA A 1 17  ? -8.958  18.315  -7.392  1.00 0.00 ? 17  ALA A HB3  5  
ATOM 6204  N N    . LYS A 1 18  ? -11.182 14.793  -5.655  1.00 0.00 ? 18  LYS A N    5  
ATOM 6205  C CA   . LYS A 1 18  ? -12.151 13.721  -5.808  1.00 0.00 ? 18  LYS A CA   5  
ATOM 6206  C C    . LYS A 1 18  ? -12.817 13.445  -4.458  1.00 0.00 ? 18  LYS A C    5  
ATOM 6207  O O    . LYS A 1 18  ? -13.077 12.293  -4.115  1.00 0.00 ? 18  LYS A O    5  
ATOM 6208  C CB   . LYS A 1 18  ? -11.493 12.489  -6.433  1.00 0.00 ? 18  LYS A CB   5  
ATOM 6209  C CG   . LYS A 1 18  ? -10.392 11.936  -5.525  1.00 0.00 ? 18  LYS A CG   5  
ATOM 6210  C CD   . LYS A 1 18  ? -9.321  11.212  -6.343  1.00 0.00 ? 18  LYS A CD   5  
ATOM 6211  C CE   . LYS A 1 18  ? -8.679  12.154  -7.362  1.00 0.00 ? 18  LYS A CE   5  
ATOM 6212  N NZ   . LYS A 1 18  ? -9.150  11.838  -8.729  1.00 0.00 ? 18  LYS A NZ   5  
ATOM 6213  H H    . LYS A 1 18  ? -10.882 14.961  -4.716  1.00 0.00 ? 18  LYS A H    5  
ATOM 6214  H HA   . LYS A 1 18  ? -12.915 14.067  -6.505  1.00 0.00 ? 18  LYS A HA   5  
ATOM 6215  H HB2  . LYS A 1 18  ? -12.245 11.720  -6.609  1.00 0.00 ? 18  LYS A HB2  5  
ATOM 6216  H HB3  . LYS A 1 18  ? -11.073 12.751  -7.404  1.00 0.00 ? 18  LYS A HB3  5  
ATOM 6217  H HG2  . LYS A 1 18  ? -9.937  12.751  -4.963  1.00 0.00 ? 18  LYS A HG2  5  
ATOM 6218  H HG3  . LYS A 1 18  ? -10.826 11.250  -4.798  1.00 0.00 ? 18  LYS A HG3  5  
ATOM 6219  H HD2  . LYS A 1 18  ? -8.556  10.815  -5.676  1.00 0.00 ? 18  LYS A HD2  5  
ATOM 6220  H HD3  . LYS A 1 18  ? -9.766  10.360  -6.859  1.00 0.00 ? 18  LYS A HD3  5  
ATOM 6221  H HE2  . LYS A 1 18  ? -8.924  13.187  -7.117  1.00 0.00 ? 18  LYS A HE2  5  
ATOM 6222  H HE3  . LYS A 1 18  ? -7.593  12.064  -7.316  1.00 0.00 ? 18  LYS A HE3  5  
ATOM 6223  H HZ1  . LYS A 1 18  ? -9.657  12.618  -9.096  1.00 0.00 ? 18  LYS A HZ1  5  
ATOM 6224  H HZ2  . LYS A 1 18  ? -8.364  11.645  -9.317  1.00 0.00 ? 18  LYS A HZ2  5  
ATOM 6225  H HZ3  . LYS A 1 18  ? -9.748  11.037  -8.699  1.00 0.00 ? 18  LYS A HZ3  5  
ATOM 6226  N N    . ALA A 1 19  ? -13.073 14.521  -3.729  1.00 0.00 ? 19  ALA A N    5  
ATOM 6227  C CA   . ALA A 1 19  ? -13.703 14.409  -2.425  1.00 0.00 ? 19  ALA A CA   5  
ATOM 6228  C C    . ALA A 1 19  ? -12.648 14.027  -1.385  1.00 0.00 ? 19  ALA A C    5  
ATOM 6229  O O    . ALA A 1 19  ? -12.921 13.244  -0.476  1.00 0.00 ? 19  ALA A O    5  
ATOM 6230  C CB   . ALA A 1 19  ? -14.846 13.394  -2.495  1.00 0.00 ? 19  ALA A CB   5  
ATOM 6231  H H    . ALA A 1 19  ? -12.858 15.455  -4.016  1.00 0.00 ? 19  ALA A H    5  
ATOM 6232  H HA   . ALA A 1 19  ? -14.115 15.385  -2.170  1.00 0.00 ? 19  ALA A HA   5  
ATOM 6233  H HB1  . ALA A 1 19  ? -15.656 13.713  -1.838  1.00 0.00 ? 19  ALA A HB1  5  
ATOM 6234  H HB2  . ALA A 1 19  ? -15.214 13.332  -3.520  1.00 0.00 ? 19  ALA A HB2  5  
ATOM 6235  H HB3  . ALA A 1 19  ? -14.484 12.417  -2.178  1.00 0.00 ? 19  ALA A HB3  5  
ATOM 6236  N N    . HIS A 1 20  ? -11.464 14.598  -1.552  1.00 0.00 ? 20  HIS A N    5  
ATOM 6237  C CA   . HIS A 1 20  ? -10.367 14.328  -0.639  1.00 0.00 ? 20  HIS A CA   5  
ATOM 6238  C C    . HIS A 1 20  ? -9.186  15.242  -0.970  1.00 0.00 ? 20  HIS A C    5  
ATOM 6239  O O    . HIS A 1 20  ? -8.837  15.413  -2.137  1.00 0.00 ? 20  HIS A O    5  
ATOM 6240  C CB   . HIS A 1 20  ? -9.993  12.844  -0.664  1.00 0.00 ? 20  HIS A CB   5  
ATOM 6241  C CG   . HIS A 1 20  ? -9.053  12.466  -1.784  1.00 0.00 ? 20  HIS A CG   5  
ATOM 6242  N ND1  . HIS A 1 20  ? -7.807  13.048  -1.945  1.00 0.00 ? 20  HIS A ND1  5  
ATOM 6243  C CD2  . HIS A 1 20  ? -9.189  11.560  -2.794  1.00 0.00 ? 20  HIS A CD2  5  
ATOM 6244  C CE1  . HIS A 1 20  ? -7.229  12.509  -3.009  1.00 0.00 ? 20  HIS A CE1  5  
ATOM 6245  N NE2  . HIS A 1 20  ? -8.087  11.588  -3.534  1.00 0.00 ? 20  HIS A NE2  5  
ATOM 6246  H H    . HIS A 1 20  ? -11.250 15.234  -2.293  1.00 0.00 ? 20  HIS A H    5  
ATOM 6247  H HA   . HIS A 1 20  ? -10.728 14.563  0.362   1.00 0.00 ? 20  HIS A HA   5  
ATOM 6248  H HB2  . HIS A 1 20  ? -9.532  12.580  0.288   1.00 0.00 ? 20  HIS A HB2  5  
ATOM 6249  H HB3  . HIS A 1 20  ? -10.904 12.252  -0.752  1.00 0.00 ? 20  HIS A HB3  5  
ATOM 6250  H HD1  . HIS A 1 20  ? -7.411  13.755  -1.359  1.00 0.00 ? 20  HIS A HD1  5  
ATOM 6251  H HD2  . HIS A 1 20  ? -10.056 10.922  -2.965  1.00 0.00 ? 20  HIS A HD2  5  
ATOM 6252  H HE1  . HIS A 1 20  ? -6.241  12.758  -3.396  1.00 0.00 ? 20  HIS A HE1  5  
ATOM 6253  N N    . GLU A 1 21  ? -8.604  15.807  0.078   1.00 0.00 ? 21  GLU A N    5  
ATOM 6254  C CA   . GLU A 1 21  ? -7.470  16.700  -0.087  1.00 0.00 ? 21  GLU A CA   5  
ATOM 6255  C C    . GLU A 1 21  ? -6.262  16.173  0.690   1.00 0.00 ? 21  GLU A C    5  
ATOM 6256  O O    . GLU A 1 21  ? -6.162  16.375  1.900   1.00 0.00 ? 21  GLU A O    5  
ATOM 6257  C CB   . GLU A 1 21  ? -7.824  18.123  0.349   1.00 0.00 ? 21  GLU A CB   5  
ATOM 6258  C CG   . GLU A 1 21  ? -8.156  19.000  -0.860  1.00 0.00 ? 21  GLU A CG   5  
ATOM 6259  C CD   . GLU A 1 21  ? -9.211  20.049  -0.503  1.00 0.00 ? 21  GLU A CD   5  
ATOM 6260  O OE1  . GLU A 1 21  ? -10.280 19.633  -0.008  1.00 0.00 ? 21  GLU A OE1  5  
ATOM 6261  O OE2  . GLU A 1 21  ? -8.924  21.244  -0.734  1.00 0.00 ? 21  GLU A OE2  5  
ATOM 6262  H H    . GLU A 1 21  ? -8.894  15.663  1.024   1.00 0.00 ? 21  GLU A H    5  
ATOM 6263  H HA   . GLU A 1 21  ? -7.252  16.697  -1.155  1.00 0.00 ? 21  GLU A HA   5  
ATOM 6264  H HB2  . GLU A 1 21  ? -8.676  18.097  1.029   1.00 0.00 ? 21  GLU A HB2  5  
ATOM 6265  H HB3  . GLU A 1 21  ? -6.990  18.557  0.900   1.00 0.00 ? 21  GLU A HB3  5  
ATOM 6266  H HG2  . GLU A 1 21  ? -7.251  19.494  -1.214  1.00 0.00 ? 21  GLU A HG2  5  
ATOM 6267  H HG3  . GLU A 1 21  ? -8.520  18.377  -1.677  1.00 0.00 ? 21  GLU A HG3  5  
ATOM 6268  N N    . GLY A 1 22  ? -5.375  15.508  -0.036  1.00 0.00 ? 22  GLY A N    5  
ATOM 6269  C CA   . GLY A 1 22  ? -4.178  14.951  0.571   1.00 0.00 ? 22  GLY A CA   5  
ATOM 6270  C C    . GLY A 1 22  ? -3.975  13.495  0.146   1.00 0.00 ? 22  GLY A C    5  
ATOM 6271  O O    . GLY A 1 22  ? -3.725  12.629  0.983   1.00 0.00 ? 22  GLY A O    5  
ATOM 6272  H H    . GLY A 1 22  ? -5.464  15.348  -1.019  1.00 0.00 ? 22  GLY A H    5  
ATOM 6273  H HA2  . GLY A 1 22  ? -3.310  15.543  0.281   1.00 0.00 ? 22  GLY A HA2  5  
ATOM 6274  H HA3  . GLY A 1 22  ? -4.256  15.009  1.657   1.00 0.00 ? 22  GLY A HA3  5  
ATOM 6275  N N    . LEU A 1 23  ? -4.090  13.270  -1.155  1.00 0.00 ? 23  LEU A N    5  
ATOM 6276  C CA   . LEU A 1 23  ? -3.922  11.934  -1.701  1.00 0.00 ? 23  LEU A CA   5  
ATOM 6277  C C    . LEU A 1 23  ? -5.095  11.057  -1.261  1.00 0.00 ? 23  LEU A C    5  
ATOM 6278  O O    . LEU A 1 23  ? -5.857  10.568  -2.094  1.00 0.00 ? 23  LEU A O    5  
ATOM 6279  C CB   . LEU A 1 23  ? -2.553  11.368  -1.320  1.00 0.00 ? 23  LEU A CB   5  
ATOM 6280  C CG   . LEU A 1 23  ? -1.488  12.394  -0.927  1.00 0.00 ? 23  LEU A CG   5  
ATOM 6281  C CD1  . LEU A 1 23  ? -0.103  11.748  -0.859  1.00 0.00 ? 23  LEU A CD1  5  
ATOM 6282  C CD2  . LEU A 1 23  ? -1.513  13.598  -1.871  1.00 0.00 ? 23  LEU A CD2  5  
ATOM 6283  H H    . LEU A 1 23  ? -4.294  13.980  -1.829  1.00 0.00 ? 23  LEU A H    5  
ATOM 6284  H HA   . LEU A 1 23  ? -3.944  12.021  -2.787  1.00 0.00 ? 23  LEU A HA   5  
ATOM 6285  H HB2  . LEU A 1 23  ? -2.687  10.677  -0.488  1.00 0.00 ? 23  LEU A HB2  5  
ATOM 6286  H HB3  . LEU A 1 23  ? -2.176  10.786  -2.160  1.00 0.00 ? 23  LEU A HB3  5  
ATOM 6287  H HG   . LEU A 1 23  ? -1.720  12.763  0.072   1.00 0.00 ? 23  LEU A HG   5  
ATOM 6288  H HD11 . LEU A 1 23  ? 0.445   11.966  -1.776  1.00 0.00 ? 23  LEU A HD11 5  
ATOM 6289  H HD12 . LEU A 1 23  ? 0.443   12.148  -0.005  1.00 0.00 ? 23  LEU A HD12 5  
ATOM 6290  H HD13 . LEU A 1 23  ? -0.210  10.669  -0.748  1.00 0.00 ? 23  LEU A HD13 5  
ATOM 6291  H HD21 . LEU A 1 23  ? -2.031  13.328  -2.791  1.00 0.00 ? 23  LEU A HD21 5  
ATOM 6292  H HD22 . LEU A 1 23  ? -2.034  14.426  -1.390  1.00 0.00 ? 23  LEU A HD22 5  
ATOM 6293  H HD23 . LEU A 1 23  ? -0.492  13.899  -2.104  1.00 0.00 ? 23  LEU A HD23 5  
ATOM 6294  N N    . GLY A 1 24  ? -5.204  10.883  0.048   1.00 0.00 ? 24  GLY A N    5  
ATOM 6295  C CA   . GLY A 1 24  ? -6.271  10.072  0.609   1.00 0.00 ? 24  GLY A CA   5  
ATOM 6296  C C    . GLY A 1 24  ? -5.710  8.987   1.531   1.00 0.00 ? 24  GLY A C    5  
ATOM 6297  O O    . GLY A 1 24  ? -6.464  8.200   2.100   1.00 0.00 ? 24  GLY A O    5  
ATOM 6298  H H    . GLY A 1 24  ? -4.580  11.283  0.719   1.00 0.00 ? 24  GLY A H    5  
ATOM 6299  H HA2  . GLY A 1 24  ? -6.960  10.707  1.167   1.00 0.00 ? 24  GLY A HA2  5  
ATOM 6300  H HA3  . GLY A 1 24  ? -6.844  9.611   -0.195  1.00 0.00 ? 24  GLY A HA3  5  
ATOM 6301  N N    . PHE A 1 25  ? -4.390  8.981   1.649   1.00 0.00 ? 25  PHE A N    5  
ATOM 6302  C CA   . PHE A 1 25  ? -3.719  8.006   2.491   1.00 0.00 ? 25  PHE A CA   5  
ATOM 6303  C C    . PHE A 1 25  ? -2.605  8.663   3.310   1.00 0.00 ? 25  PHE A C    5  
ATOM 6304  O O    . PHE A 1 25  ? -1.825  9.453   2.781   1.00 0.00 ? 25  PHE A O    5  
ATOM 6305  C CB   . PHE A 1 25  ? -3.103  6.960   1.561   1.00 0.00 ? 25  PHE A CB   5  
ATOM 6306  C CG   . PHE A 1 25  ? -1.861  7.447   0.812   1.00 0.00 ? 25  PHE A CG   5  
ATOM 6307  C CD1  . PHE A 1 25  ? -0.633  7.334   1.385   1.00 0.00 ? 25  PHE A CD1  5  
ATOM 6308  C CD2  . PHE A 1 25  ? -1.985  7.994   -0.427  1.00 0.00 ? 25  PHE A CD2  5  
ATOM 6309  C CE1  . PHE A 1 25  ? 0.520   7.787   0.690   1.00 0.00 ? 25  PHE A CE1  5  
ATOM 6310  C CE2  . PHE A 1 25  ? -0.832  8.447   -1.123  1.00 0.00 ? 25  PHE A CE2  5  
ATOM 6311  C CZ   . PHE A 1 25  ? 0.396   8.333   -0.549  1.00 0.00 ? 25  PHE A CZ   5  
ATOM 6312  H H    . PHE A 1 25  ? -3.784  9.625   1.183   1.00 0.00 ? 25  PHE A H    5  
ATOM 6313  H HA   . PHE A 1 25  ? -4.468  7.592   3.167   1.00 0.00 ? 25  PHE A HA   5  
ATOM 6314  H HB2  . PHE A 1 25  ? -2.839  6.078   2.145   1.00 0.00 ? 25  PHE A HB2  5  
ATOM 6315  H HB3  . PHE A 1 25  ? -3.853  6.648   0.834   1.00 0.00 ? 25  PHE A HB3  5  
ATOM 6316  H HD1  . PHE A 1 25  ? -0.533  6.896   2.378   1.00 0.00 ? 25  PHE A HD1  5  
ATOM 6317  H HD2  . PHE A 1 25  ? -2.969  8.085   -0.887  1.00 0.00 ? 25  PHE A HD2  5  
ATOM 6318  H HE1  . PHE A 1 25  ? 1.504   7.696   1.150   1.00 0.00 ? 25  PHE A HE1  5  
ATOM 6319  H HE2  . PHE A 1 25  ? -0.932  8.885   -2.116  1.00 0.00 ? 25  PHE A HE2  5  
ATOM 6320  H HZ   . PHE A 1 25  ? 1.280   8.681   -1.083  1.00 0.00 ? 25  PHE A HZ   5  
ATOM 6321  N N    . SER A 1 26  ? -2.567  8.311   4.586   1.00 0.00 ? 26  SER A N    5  
ATOM 6322  C CA   . SER A 1 26  ? -1.562  8.856   5.483   1.00 0.00 ? 26  SER A CA   5  
ATOM 6323  C C    . SER A 1 26  ? -0.317  7.966   5.477   1.00 0.00 ? 26  SER A C    5  
ATOM 6324  O O    . SER A 1 26  ? -0.395  6.786   5.137   1.00 0.00 ? 26  SER A O    5  
ATOM 6325  C CB   . SER A 1 26  ? -2.109  8.995   6.905   1.00 0.00 ? 26  SER A CB   5  
ATOM 6326  O OG   . SER A 1 26  ? -2.028  10.336  7.380   1.00 0.00 ? 26  SER A OG   5  
ATOM 6327  H H    . SER A 1 26  ? -3.205  7.667   5.009   1.00 0.00 ? 26  SER A H    5  
ATOM 6328  H HA   . SER A 1 26  ? -1.327  9.844   5.087   1.00 0.00 ? 26  SER A HA   5  
ATOM 6329  H HB2  . SER A 1 26  ? -3.147  8.664   6.927   1.00 0.00 ? 26  SER A HB2  5  
ATOM 6330  H HB3  . SER A 1 26  ? -1.551  8.339   7.574   1.00 0.00 ? 26  SER A HB3  5  
ATOM 6331  H HG   . SER A 1 26  ? -2.897  10.605  7.794   1.00 0.00 ? 26  SER A HG   5  
ATOM 6332  N N    . ILE A 1 27  ? 0.801   8.564   5.859   1.00 0.00 ? 27  ILE A N    5  
ATOM 6333  C CA   . ILE A 1 27  ? 2.060   7.840   5.902   1.00 0.00 ? 27  ILE A CA   5  
ATOM 6334  C C    . ILE A 1 27  ? 2.704   8.026   7.278   1.00 0.00 ? 27  ILE A C    5  
ATOM 6335  O O    . ILE A 1 27  ? 2.304   8.905   8.040   1.00 0.00 ? 27  ILE A O    5  
ATOM 6336  C CB   . ILE A 1 27  ? 2.962   8.263   4.740   1.00 0.00 ? 27  ILE A CB   5  
ATOM 6337  C CG1  . ILE A 1 27  ? 3.418   9.714   4.899   1.00 0.00 ? 27  ILE A CG1  5  
ATOM 6338  C CG2  . ILE A 1 27  ? 2.271   8.023   3.396   1.00 0.00 ? 27  ILE A CG2  5  
ATOM 6339  C CD1  . ILE A 1 27  ? 4.928   9.840   4.688   1.00 0.00 ? 27  ILE A CD1  5  
ATOM 6340  H H    . ILE A 1 27  ? 0.856   9.524   6.134   1.00 0.00 ? 27  ILE A H    5  
ATOM 6341  H HA   . ILE A 1 27  ? 1.834   6.783   5.767   1.00 0.00 ? 27  ILE A HA   5  
ATOM 6342  H HB   . ILE A 1 27  ? 3.856   7.640   4.758   1.00 0.00 ? 27  ILE A HB   5  
ATOM 6343  H HG12 . ILE A 1 27  ? 2.893   10.345  4.182   1.00 0.00 ? 27  ILE A HG12 5  
ATOM 6344  H HG13 . ILE A 1 27  ? 3.155   10.075  5.893   1.00 0.00 ? 27  ILE A HG13 5  
ATOM 6345  H HG21 . ILE A 1 27  ? 2.991   8.155   2.589   1.00 0.00 ? 27  ILE A HG21 5  
ATOM 6346  H HG22 . ILE A 1 27  ? 1.875   7.008   3.366   1.00 0.00 ? 27  ILE A HG22 5  
ATOM 6347  H HG23 . ILE A 1 27  ? 1.455   8.735   3.275   1.00 0.00 ? 27  ILE A HG23 5  
ATOM 6348  H HD11 . ILE A 1 27  ? 5.200   10.894  4.627   1.00 0.00 ? 27  ILE A HD11 5  
ATOM 6349  H HD12 . ILE A 1 27  ? 5.452   9.378   5.525   1.00 0.00 ? 27  ILE A HD12 5  
ATOM 6350  H HD13 . ILE A 1 27  ? 5.209   9.338   3.762   1.00 0.00 ? 27  ILE A HD13 5  
ATOM 6351  N N    . ARG A 1 28  ? 3.689   7.185   7.553   1.00 0.00 ? 28  ARG A N    5  
ATOM 6352  C CA   . ARG A 1 28  ? 4.392   7.246   8.824   1.00 0.00 ? 28  ARG A CA   5  
ATOM 6353  C C    . ARG A 1 28  ? 5.841   6.785   8.652   1.00 0.00 ? 28  ARG A C    5  
ATOM 6354  O O    . ARG A 1 28  ? 6.230   6.339   7.574   1.00 0.00 ? 28  ARG A O    5  
ATOM 6355  C CB   . ARG A 1 28  ? 3.707   6.370   9.874   1.00 0.00 ? 28  ARG A CB   5  
ATOM 6356  C CG   . ARG A 1 28  ? 3.406   4.977   9.316   1.00 0.00 ? 28  ARG A CG   5  
ATOM 6357  C CD   . ARG A 1 28  ? 2.987   4.018   10.431  1.00 0.00 ? 28  ARG A CD   5  
ATOM 6358  N NE   . ARG A 1 28  ? 3.130   2.617   9.975   1.00 0.00 ? 28  ARG A NE   5  
ATOM 6359  C CZ   . ARG A 1 28  ? 4.272   1.918   10.040  1.00 0.00 ? 28  ARG A CZ   5  
ATOM 6360  N NH1  . ARG A 1 28  ? 5.376   2.486   10.543  1.00 0.00 ? 28  ARG A NH1  5  
ATOM 6361  N NH2  . ARG A 1 28  ? 4.309   0.653   9.602   1.00 0.00 ? 28  ARG A NH2  5  
ATOM 6362  H H    . ARG A 1 28  ? 4.009   6.473   6.928   1.00 0.00 ? 28  ARG A H    5  
ATOM 6363  H HA   . ARG A 1 28  ? 4.346   8.294   9.118   1.00 0.00 ? 28  ARG A HA   5  
ATOM 6364  H HB2  . ARG A 1 28  ? 4.345   6.283   10.753  1.00 0.00 ? 28  ARG A HB2  5  
ATOM 6365  H HB3  . ARG A 1 28  ? 2.780   6.843   10.199  1.00 0.00 ? 28  ARG A HB3  5  
ATOM 6366  H HG2  . ARG A 1 28  ? 2.613   5.043   8.571   1.00 0.00 ? 28  ARG A HG2  5  
ATOM 6367  H HG3  . ARG A 1 28  ? 4.289   4.587   8.808   1.00 0.00 ? 28  ARG A HG3  5  
ATOM 6368  H HD2  . ARG A 1 28  ? 3.601   4.185   11.316  1.00 0.00 ? 28  ARG A HD2  5  
ATOM 6369  H HD3  . ARG A 1 28  ? 1.954   4.211   10.719  1.00 0.00 ? 28  ARG A HD3  5  
ATOM 6370  H HE   . ARG A 1 28  ? 2.324   2.164   9.593   1.00 0.00 ? 28  ARG A HE   5  
ATOM 6371  H HH11 . ARG A 1 28  ? 5.349   3.430   10.870  1.00 0.00 ? 28  ARG A HH11 5  
ATOM 6372  H HH12 . ARG A 1 28  ? 6.228   1.964   10.592  1.00 0.00 ? 28  ARG A HH12 5  
ATOM 6373  H HH21 . ARG A 1 28  ? 3.484   0.229   9.226   1.00 0.00 ? 28  ARG A HH21 5  
ATOM 6374  H HH22 . ARG A 1 28  ? 5.161   0.131   9.651   1.00 0.00 ? 28  ARG A HH22 5  
ATOM 6375  N N    . GLY A 1 29  ? 6.599   6.909   9.731   1.00 0.00 ? 29  GLY A N    5  
ATOM 6376  C CA   . GLY A 1 29  ? 7.997   6.511   9.713   1.00 0.00 ? 29  GLY A CA   5  
ATOM 6377  C C    . GLY A 1 29  ? 8.916   7.733   9.765   1.00 0.00 ? 29  GLY A C    5  
ATOM 6378  O O    . GLY A 1 29  ? 8.506   8.804   10.212  1.00 0.00 ? 29  GLY A O    5  
ATOM 6379  H H    . GLY A 1 29  ? 6.275   7.273   10.604  1.00 0.00 ? 29  GLY A H    5  
ATOM 6380  H HA2  . GLY A 1 29  ? 8.204   5.859   10.562  1.00 0.00 ? 29  GLY A HA2  5  
ATOM 6381  H HA3  . GLY A 1 29  ? 8.203   5.935   8.811   1.00 0.00 ? 29  GLY A HA3  5  
ATOM 6382  N N    . GLY A 1 30  ? 10.141  7.532   9.303   1.00 0.00 ? 30  GLY A N    5  
ATOM 6383  C CA   . GLY A 1 30  ? 11.122  8.605   9.292   1.00 0.00 ? 30  GLY A CA   5  
ATOM 6384  C C    . GLY A 1 30  ? 12.517  8.075   9.628   1.00 0.00 ? 30  GLY A C    5  
ATOM 6385  O O    . GLY A 1 30  ? 12.658  7.141   10.416  1.00 0.00 ? 30  GLY A O    5  
ATOM 6386  H H    . GLY A 1 30  ? 10.466  6.658   8.942   1.00 0.00 ? 30  GLY A H    5  
ATOM 6387  H HA2  . GLY A 1 30  ? 11.135  9.079   8.311   1.00 0.00 ? 30  GLY A HA2  5  
ATOM 6388  H HA3  . GLY A 1 30  ? 10.836  9.371   10.012  1.00 0.00 ? 30  GLY A HA3  5  
ATOM 6389  N N    . SER A 1 31  ? 13.514  8.695   9.013   1.00 0.00 ? 31  SER A N    5  
ATOM 6390  C CA   . SER A 1 31  ? 14.894  8.297   9.237   1.00 0.00 ? 31  SER A CA   5  
ATOM 6391  C C    . SER A 1 31  ? 15.291  8.580   10.687  1.00 0.00 ? 31  SER A C    5  
ATOM 6392  O O    . SER A 1 31  ? 16.334  8.122   11.149  1.00 0.00 ? 31  SER A O    5  
ATOM 6393  C CB   . SER A 1 31  ? 15.838  9.022   8.276   1.00 0.00 ? 31  SER A CB   5  
ATOM 6394  O OG   . SER A 1 31  ? 17.161  8.496   8.329   1.00 0.00 ? 31  SER A OG   5  
ATOM 6395  H H    . SER A 1 31  ? 13.391  9.453   8.373   1.00 0.00 ? 31  SER A H    5  
ATOM 6396  H HA   . SER A 1 31  ? 14.922  7.227   9.034   1.00 0.00 ? 31  SER A HA   5  
ATOM 6397  H HB2  . SER A 1 31  ? 15.456  8.939   7.259   1.00 0.00 ? 31  SER A HB2  5  
ATOM 6398  H HB3  . SER A 1 31  ? 15.861  10.084  8.522   1.00 0.00 ? 31  SER A HB3  5  
ATOM 6399  H HG   . SER A 1 31  ? 17.558  8.658   9.233   1.00 0.00 ? 31  SER A HG   5  
ATOM 6400  N N    . GLU A 1 32  ? 14.438  9.335   11.364  1.00 0.00 ? 32  GLU A N    5  
ATOM 6401  C CA   . GLU A 1 32  ? 14.687  9.685   12.752  1.00 0.00 ? 32  GLU A CA   5  
ATOM 6402  C C    . GLU A 1 32  ? 14.333  8.511   13.667  1.00 0.00 ? 32  GLU A C    5  
ATOM 6403  O O    . GLU A 1 32  ? 14.842  8.413   14.783  1.00 0.00 ? 32  GLU A O    5  
ATOM 6404  C CB   . GLU A 1 32  ? 13.911  10.942  13.148  1.00 0.00 ? 32  GLU A CB   5  
ATOM 6405  C CG   . GLU A 1 32  ? 12.432  10.813  12.779  1.00 0.00 ? 32  GLU A CG   5  
ATOM 6406  C CD   . GLU A 1 32  ? 11.568  11.732  13.645  1.00 0.00 ? 32  GLU A CD   5  
ATOM 6407  O OE1  . GLU A 1 32  ? 11.163  11.270  14.733  1.00 0.00 ? 32  GLU A OE1  5  
ATOM 6408  O OE2  . GLU A 1 32  ? 11.333  12.876  13.199  1.00 0.00 ? 32  GLU A OE2  5  
ATOM 6409  H H    . GLU A 1 32  ? 13.591  9.704   10.980  1.00 0.00 ? 32  GLU A H    5  
ATOM 6410  H HA   . GLU A 1 32  ? 15.756  9.891   12.812  1.00 0.00 ? 32  GLU A HA   5  
ATOM 6411  H HB2  . GLU A 1 32  ? 14.008  11.111  14.221  1.00 0.00 ? 32  GLU A HB2  5  
ATOM 6412  H HB3  . GLU A 1 32  ? 14.340  11.811  12.649  1.00 0.00 ? 32  GLU A HB3  5  
ATOM 6413  H HG2  . GLU A 1 32  ? 12.293  11.062  11.727  1.00 0.00 ? 32  GLU A HG2  5  
ATOM 6414  H HG3  . GLU A 1 32  ? 12.110  9.779   12.907  1.00 0.00 ? 32  GLU A HG3  5  
ATOM 6415  N N    . HIS A 1 33  ? 13.463  7.649   13.161  1.00 0.00 ? 33  HIS A N    5  
ATOM 6416  C CA   . HIS A 1 33  ? 13.034  6.486   13.919  1.00 0.00 ? 33  HIS A CA   5  
ATOM 6417  C C    . HIS A 1 33  ? 13.826  5.258   13.465  1.00 0.00 ? 33  HIS A C    5  
ATOM 6418  O O    . HIS A 1 33  ? 13.617  4.157   13.973  1.00 0.00 ? 33  HIS A O    5  
ATOM 6419  C CB   . HIS A 1 33  ? 11.521  6.291   13.806  1.00 0.00 ? 33  HIS A CB   5  
ATOM 6420  C CG   . HIS A 1 33  ? 10.745  6.803   14.996  1.00 0.00 ? 33  HIS A CG   5  
ATOM 6421  N ND1  . HIS A 1 33  ? 9.398   7.112   14.935  1.00 0.00 ? 33  HIS A ND1  5  
ATOM 6422  C CD2  . HIS A 1 33  ? 11.141  7.055   16.276  1.00 0.00 ? 33  HIS A CD2  5  
ATOM 6423  C CE1  . HIS A 1 33  ? 9.011   7.532   16.131  1.00 0.00 ? 33  HIS A CE1  5  
ATOM 6424  N NE2  . HIS A 1 33  ? 10.093  7.496   16.961  1.00 0.00 ? 33  HIS A NE2  5  
ATOM 6425  H H    . HIS A 1 33  ? 13.053  7.736   12.253  1.00 0.00 ? 33  HIS A H    5  
ATOM 6426  H HA   . HIS A 1 33  ? 13.266  6.691   14.964  1.00 0.00 ? 33  HIS A HA   5  
ATOM 6427  H HB2  . HIS A 1 33  ? 11.166  6.797   12.908  1.00 0.00 ? 33  HIS A HB2  5  
ATOM 6428  H HB3  . HIS A 1 33  ? 11.311  5.229   13.677  1.00 0.00 ? 33  HIS A HB3  5  
ATOM 6429  H HD1  . HIS A 1 33  ? 8.815   7.033   14.127  1.00 0.00 ? 33  HIS A HD1  5  
ATOM 6430  H HD2  . HIS A 1 33  ? 12.148  6.918   16.671  1.00 0.00 ? 33  HIS A HD2  5  
ATOM 6431  H HE1  . HIS A 1 33  ? 8.005   7.849   16.404  1.00 0.00 ? 33  HIS A HE1  5  
ATOM 6432  N N    . GLY A 1 34  ? 14.719  5.488   12.513  1.00 0.00 ? 34  GLY A N    5  
ATOM 6433  C CA   . GLY A 1 34  ? 15.543  4.414   11.985  1.00 0.00 ? 34  GLY A CA   5  
ATOM 6434  C C    . GLY A 1 34  ? 14.757  3.558   10.989  1.00 0.00 ? 34  GLY A C    5  
ATOM 6435  O O    . GLY A 1 34  ? 15.246  2.527   10.530  1.00 0.00 ? 34  GLY A O    5  
ATOM 6436  H H    . GLY A 1 34  ? 14.883  6.386   12.105  1.00 0.00 ? 34  GLY A H    5  
ATOM 6437  H HA2  . GLY A 1 34  ? 16.422  4.832   11.496  1.00 0.00 ? 34  GLY A HA2  5  
ATOM 6438  H HA3  . GLY A 1 34  ? 15.901  3.789   12.803  1.00 0.00 ? 34  GLY A HA3  5  
ATOM 6439  N N    . VAL A 1 35  ? 13.552  4.018   10.685  1.00 0.00 ? 35  VAL A N    5  
ATOM 6440  C CA   . VAL A 1 35  ? 12.694  3.308   9.752   1.00 0.00 ? 35  VAL A CA   5  
ATOM 6441  C C    . VAL A 1 35  ? 12.478  4.171   8.507   1.00 0.00 ? 35  VAL A C    5  
ATOM 6442  O O    . VAL A 1 35  ? 12.748  5.371   8.524   1.00 0.00 ? 35  VAL A O    5  
ATOM 6443  C CB   . VAL A 1 35  ? 11.386  2.915   10.440  1.00 0.00 ? 35  VAL A CB   5  
ATOM 6444  C CG1  . VAL A 1 35  ? 11.628  2.535   11.902  1.00 0.00 ? 35  VAL A CG1  5  
ATOM 6445  C CG2  . VAL A 1 35  ? 10.349  4.034   10.329  1.00 0.00 ? 35  VAL A CG2  5  
ATOM 6446  H H    . VAL A 1 35  ? 13.162  4.858   11.063  1.00 0.00 ? 35  VAL A H    5  
ATOM 6447  H HA   . VAL A 1 35  ? 13.211  2.394   9.460   1.00 0.00 ? 35  VAL A HA   5  
ATOM 6448  H HB   . VAL A 1 35  ? 10.988  2.038   9.928   1.00 0.00 ? 35  VAL A HB   5  
ATOM 6449  H HG11 . VAL A 1 35  ? 11.565  3.427   12.525  1.00 0.00 ? 35  VAL A HG11 5  
ATOM 6450  H HG12 . VAL A 1 35  ? 10.874  1.816   12.221  1.00 0.00 ? 35  VAL A HG12 5  
ATOM 6451  H HG13 . VAL A 1 35  ? 12.619  2.091   12.003  1.00 0.00 ? 35  VAL A HG13 5  
ATOM 6452  H HG21 . VAL A 1 35  ? 10.734  4.935   10.807  1.00 0.00 ? 35  VAL A HG21 5  
ATOM 6453  H HG22 . VAL A 1 35  ? 10.147  4.239   9.278   1.00 0.00 ? 35  VAL A HG22 5  
ATOM 6454  H HG23 . VAL A 1 35  ? 9.427   3.727   10.823  1.00 0.00 ? 35  VAL A HG23 5  
ATOM 6455  N N    . GLY A 1 36  ? 11.994  3.526   7.456   1.00 0.00 ? 36  GLY A N    5  
ATOM 6456  C CA   . GLY A 1 36  ? 11.739  4.219   6.204   1.00 0.00 ? 36  GLY A CA   5  
ATOM 6457  C C    . GLY A 1 36  ? 10.382  4.926   6.236   1.00 0.00 ? 36  GLY A C    5  
ATOM 6458  O O    . GLY A 1 36  ? 10.117  5.728   7.130   1.00 0.00 ? 36  GLY A O    5  
ATOM 6459  H H    . GLY A 1 36  ? 11.777  2.550   7.450   1.00 0.00 ? 36  GLY A H    5  
ATOM 6460  H HA2  . GLY A 1 36  ? 12.528  4.947   6.020   1.00 0.00 ? 36  GLY A HA2  5  
ATOM 6461  H HA3  . GLY A 1 36  ? 11.763  3.507   5.379   1.00 0.00 ? 36  GLY A HA3  5  
ATOM 6462  N N    . ILE A 1 37  ? 9.559   4.603   5.249   1.00 0.00 ? 37  ILE A N    5  
ATOM 6463  C CA   . ILE A 1 37  ? 8.237   5.197   5.152   1.00 0.00 ? 37  ILE A CA   5  
ATOM 6464  C C    . ILE A 1 37  ? 7.207   4.097   4.887   1.00 0.00 ? 37  ILE A C    5  
ATOM 6465  O O    . ILE A 1 37  ? 7.521   3.084   4.265   1.00 0.00 ? 37  ILE A O    5  
ATOM 6466  C CB   . ILE A 1 37  ? 8.227   6.314   4.107   1.00 0.00 ? 37  ILE A CB   5  
ATOM 6467  C CG1  . ILE A 1 37  ? 9.414   7.259   4.302   1.00 0.00 ? 37  ILE A CG1  5  
ATOM 6468  C CG2  . ILE A 1 37  ? 6.892   7.061   4.116   1.00 0.00 ? 37  ILE A CG2  5  
ATOM 6469  C CD1  . ILE A 1 37  ? 9.165   8.219   5.467   1.00 0.00 ? 37  ILE A CD1  5  
ATOM 6470  H H    . ILE A 1 37  ? 9.783   3.950   4.525   1.00 0.00 ? 37  ILE A H    5  
ATOM 6471  H HA   . ILE A 1 37  ? 8.013   5.655   6.115   1.00 0.00 ? 37  ILE A HA   5  
ATOM 6472  H HB   . ILE A 1 37  ? 8.335   5.861   3.121   1.00 0.00 ? 37  ILE A HB   5  
ATOM 6473  H HG12 . ILE A 1 37  ? 10.317  6.679   4.491   1.00 0.00 ? 37  ILE A HG12 5  
ATOM 6474  H HG13 . ILE A 1 37  ? 9.585   7.827   3.388   1.00 0.00 ? 37  ILE A HG13 5  
ATOM 6475  H HG21 . ILE A 1 37  ? 6.157   6.499   3.540   1.00 0.00 ? 37  ILE A HG21 5  
ATOM 6476  H HG22 . ILE A 1 37  ? 6.543   7.169   5.143   1.00 0.00 ? 37  ILE A HG22 5  
ATOM 6477  H HG23 . ILE A 1 37  ? 7.024   8.048   3.672   1.00 0.00 ? 37  ILE A HG23 5  
ATOM 6478  H HD11 . ILE A 1 37  ? 8.232   8.759   5.300   1.00 0.00 ? 37  ILE A HD11 5  
ATOM 6479  H HD12 . ILE A 1 37  ? 9.095   7.653   6.396   1.00 0.00 ? 37  ILE A HD12 5  
ATOM 6480  H HD13 . ILE A 1 37  ? 9.989   8.929   5.535   1.00 0.00 ? 37  ILE A HD13 5  
ATOM 6481  N N    . TYR A 1 38  ? 5.997   4.335   5.373   1.00 0.00 ? 38  TYR A N    5  
ATOM 6482  C CA   . TYR A 1 38  ? 4.919   3.377   5.197   1.00 0.00 ? 38  TYR A CA   5  
ATOM 6483  C C    . TYR A 1 38  ? 3.556   4.040   5.408   1.00 0.00 ? 38  TYR A C    5  
ATOM 6484  O O    . TYR A 1 38  ? 3.452   5.042   6.115   1.00 0.00 ? 38  TYR A O    5  
ATOM 6485  C CB   . TYR A 1 38  ? 5.124   2.308   6.272   1.00 0.00 ? 38  TYR A CB   5  
ATOM 6486  C CG   . TYR A 1 38  ? 6.501   1.643   6.233   1.00 0.00 ? 38  TYR A CG   5  
ATOM 6487  C CD1  . TYR A 1 38  ? 7.550   2.185   6.948   1.00 0.00 ? 38  TYR A CD1  5  
ATOM 6488  C CD2  . TYR A 1 38  ? 6.695   0.501   5.483   1.00 0.00 ? 38  TYR A CD2  5  
ATOM 6489  C CE1  . TYR A 1 38  ? 8.846   1.560   6.911   1.00 0.00 ? 38  TYR A CE1  5  
ATOM 6490  C CE2  . TYR A 1 38  ? 7.992   -0.125  5.447   1.00 0.00 ? 38  TYR A CE2  5  
ATOM 6491  C CZ   . TYR A 1 38  ? 9.003   0.435   6.163   1.00 0.00 ? 38  TYR A CZ   5  
ATOM 6492  O OH   . TYR A 1 38  ? 10.228  -0.156  6.128   1.00 0.00 ? 38  TYR A OH   5  
ATOM 6493  H H    . TYR A 1 38  ? 5.750   5.161   5.878   1.00 0.00 ? 38  TYR A H    5  
ATOM 6494  H HA   . TYR A 1 38  ? 4.973   2.992   4.178   1.00 0.00 ? 38  TYR A HA   5  
ATOM 6495  H HB2  . TYR A 1 38  ? 4.978   2.761   7.252   1.00 0.00 ? 38  TYR A HB2  5  
ATOM 6496  H HB3  . TYR A 1 38  ? 4.358   1.541   6.158   1.00 0.00 ? 38  TYR A HB3  5  
ATOM 6497  H HD1  . TYR A 1 38  ? 7.397   3.088   7.540   1.00 0.00 ? 38  TYR A HD1  5  
ATOM 6498  H HD2  . TYR A 1 38  ? 5.867   0.072   4.919   1.00 0.00 ? 38  TYR A HD2  5  
ATOM 6499  H HE1  . TYR A 1 38  ? 9.683   1.978   7.471   1.00 0.00 ? 38  TYR A HE1  5  
ATOM 6500  H HE2  . TYR A 1 38  ? 8.159   -1.028  4.859   1.00 0.00 ? 38  TYR A HE2  5  
ATOM 6501  H HH   . TYR A 1 38  ? 10.897  0.417   6.602   1.00 0.00 ? 38  TYR A HH   5  
ATOM 6502  N N    . VAL A 1 39  ? 2.546   3.456   4.782   1.00 0.00 ? 39  VAL A N    5  
ATOM 6503  C CA   . VAL A 1 39  ? 1.194   3.977   4.892   1.00 0.00 ? 39  VAL A CA   5  
ATOM 6504  C C    . VAL A 1 39  ? 0.725   3.863   6.344   1.00 0.00 ? 39  VAL A C    5  
ATOM 6505  O O    . VAL A 1 39  ? 1.000   2.868   7.012   1.00 0.00 ? 39  VAL A O    5  
ATOM 6506  C CB   . VAL A 1 39  ? 0.272   3.255   3.907   1.00 0.00 ? 39  VAL A CB   5  
ATOM 6507  C CG1  . VAL A 1 39  ? -1.174  3.732   4.060   1.00 0.00 ? 39  VAL A CG1  5  
ATOM 6508  C CG2  . VAL A 1 39  ? 0.760   3.434   2.468   1.00 0.00 ? 39  VAL A CG2  5  
ATOM 6509  H H    . VAL A 1 39  ? 2.639   2.641   4.208   1.00 0.00 ? 39  VAL A H    5  
ATOM 6510  H HA   . VAL A 1 39  ? 1.225   5.031   4.615   1.00 0.00 ? 39  VAL A HA   5  
ATOM 6511  H HB   . VAL A 1 39  ? 0.300   2.191   4.141   1.00 0.00 ? 39  VAL A HB   5  
ATOM 6512  H HG11 . VAL A 1 39  ? -1.294  4.224   5.025   1.00 0.00 ? 39  VAL A HG11 5  
ATOM 6513  H HG12 . VAL A 1 39  ? -1.411  4.435   3.261   1.00 0.00 ? 39  VAL A HG12 5  
ATOM 6514  H HG13 . VAL A 1 39  ? -1.846  2.876   4.002   1.00 0.00 ? 39  VAL A HG13 5  
ATOM 6515  H HG21 . VAL A 1 39  ? 0.449   2.577   1.870   1.00 0.00 ? 39  VAL A HG21 5  
ATOM 6516  H HG22 . VAL A 1 39  ? 0.330   4.344   2.049   1.00 0.00 ? 39  VAL A HG22 5  
ATOM 6517  H HG23 . VAL A 1 39  ? 1.847   3.508   2.459   1.00 0.00 ? 39  VAL A HG23 5  
ATOM 6518  N N    . SER A 1 40  ? 0.024   4.896   6.789   1.00 0.00 ? 40  SER A N    5  
ATOM 6519  C CA   . SER A 1 40  ? -0.486  4.924   8.149   1.00 0.00 ? 40  SER A CA   5  
ATOM 6520  C C    . SER A 1 40  ? -2.003  4.726   8.143   1.00 0.00 ? 40  SER A C    5  
ATOM 6521  O O    . SER A 1 40  ? -2.539  3.990   8.970   1.00 0.00 ? 40  SER A O    5  
ATOM 6522  C CB   . SER A 1 40  ? -0.125  6.238   8.845   1.00 0.00 ? 40  SER A CB   5  
ATOM 6523  O OG   . SER A 1 40  ? -1.255  6.838   9.472   1.00 0.00 ? 40  SER A OG   5  
ATOM 6524  H H    . SER A 1 40  ? -0.195  5.702   6.238   1.00 0.00 ? 40  SER A H    5  
ATOM 6525  H HA   . SER A 1 40  ? 0.006   4.096   8.659   1.00 0.00 ? 40  SER A HA   5  
ATOM 6526  H HB2  . SER A 1 40  ? 0.647   6.052   9.592   1.00 0.00 ? 40  SER A HB2  5  
ATOM 6527  H HB3  . SER A 1 40  ? 0.297   6.931   8.117   1.00 0.00 ? 40  SER A HB3  5  
ATOM 6528  H HG   . SER A 1 40  ? -1.064  7.000   10.440  1.00 0.00 ? 40  SER A HG   5  
ATOM 6529  N N    . LEU A 1 41  ? -2.652  5.396   7.202   1.00 0.00 ? 41  LEU A N    5  
ATOM 6530  C CA   . LEU A 1 41  ? -4.096  5.303   7.078   1.00 0.00 ? 41  LEU A CA   5  
ATOM 6531  C C    . LEU A 1 41  ? -4.486  5.422   5.603   1.00 0.00 ? 41  LEU A C    5  
ATOM 6532  O O    . LEU A 1 41  ? -3.791  6.073   4.825   1.00 0.00 ? 41  LEU A O    5  
ATOM 6533  C CB   . LEU A 1 41  ? -4.779  6.333   7.980   1.00 0.00 ? 41  LEU A CB   5  
ATOM 6534  C CG   . LEU A 1 41  ? -6.283  6.519   7.766   1.00 0.00 ? 41  LEU A CG   5  
ATOM 6535  C CD1  . LEU A 1 41  ? -6.566  7.206   6.429   1.00 0.00 ? 41  LEU A CD1  5  
ATOM 6536  C CD2  . LEU A 1 41  ? -7.024  5.187   7.895   1.00 0.00 ? 41  LEU A CD2  5  
ATOM 6537  H H    . LEU A 1 41  ? -2.208  5.993   6.534   1.00 0.00 ? 41  LEU A H    5  
ATOM 6538  H HA   . LEU A 1 41  ? -4.392  4.316   7.435   1.00 0.00 ? 41  LEU A HA   5  
ATOM 6539  H HB2  . LEU A 1 41  ? -4.612  6.046   9.018   1.00 0.00 ? 41  LEU A HB2  5  
ATOM 6540  H HB3  . LEU A 1 41  ? -4.290  7.296   7.833   1.00 0.00 ? 41  LEU A HB3  5  
ATOM 6541  H HG   . LEU A 1 41  ? -6.661  7.175   8.551   1.00 0.00 ? 41  LEU A HG   5  
ATOM 6542  H HD11 . LEU A 1 41  ? -5.626  7.526   5.979   1.00 0.00 ? 41  LEU A HD11 5  
ATOM 6543  H HD12 . LEU A 1 41  ? -7.070  6.508   5.761   1.00 0.00 ? 41  LEU A HD12 5  
ATOM 6544  H HD13 . LEU A 1 41  ? -7.203  8.075   6.594   1.00 0.00 ? 41  LEU A HD13 5  
ATOM 6545  H HD21 . LEU A 1 41  ? -7.614  5.012   6.995   1.00 0.00 ? 41  LEU A HD21 5  
ATOM 6546  H HD22 . LEU A 1 41  ? -6.302  4.380   8.018   1.00 0.00 ? 41  LEU A HD22 5  
ATOM 6547  H HD23 . LEU A 1 41  ? -7.683  5.220   8.762   1.00 0.00 ? 41  LEU A HD23 5  
ATOM 6548  N N    . VAL A 1 42  ? -5.596  4.783   5.264   1.00 0.00 ? 42  VAL A N    5  
ATOM 6549  C CA   . VAL A 1 42  ? -6.086  4.810   3.896   1.00 0.00 ? 42  VAL A CA   5  
ATOM 6550  C C    . VAL A 1 42  ? -7.600  5.031   3.906   1.00 0.00 ? 42  VAL A C    5  
ATOM 6551  O O    . VAL A 1 42  ? -8.342  4.248   4.498   1.00 0.00 ? 42  VAL A O    5  
ATOM 6552  C CB   . VAL A 1 42  ? -5.674  3.529   3.168   1.00 0.00 ? 42  VAL A CB   5  
ATOM 6553  C CG1  . VAL A 1 42  ? -6.617  3.235   2.000   1.00 0.00 ? 42  VAL A CG1  5  
ATOM 6554  C CG2  . VAL A 1 42  ? -4.222  3.611   2.693   1.00 0.00 ? 42  VAL A CG2  5  
ATOM 6555  H H    . VAL A 1 42  ? -6.155  4.256   5.904   1.00 0.00 ? 42  VAL A H    5  
ATOM 6556  H HA   . VAL A 1 42  ? -5.612  5.652   3.393   1.00 0.00 ? 42  VAL A HA   5  
ATOM 6557  H HB   . VAL A 1 42  ? -5.749  2.703   3.875   1.00 0.00 ? 42  VAL A HB   5  
ATOM 6558  H HG11 . VAL A 1 42  ? -6.056  2.775   1.187   1.00 0.00 ? 42  VAL A HG11 5  
ATOM 6559  H HG12 . VAL A 1 42  ? -7.403  2.554   2.329   1.00 0.00 ? 42  VAL A HG12 5  
ATOM 6560  H HG13 . VAL A 1 42  ? -7.066  4.165   1.652   1.00 0.00 ? 42  VAL A HG13 5  
ATOM 6561  H HG21 . VAL A 1 42  ? -4.198  3.660   1.604   1.00 0.00 ? 42  VAL A HG21 5  
ATOM 6562  H HG22 . VAL A 1 42  ? -3.755  4.505   3.107   1.00 0.00 ? 42  VAL A HG22 5  
ATOM 6563  H HG23 . VAL A 1 42  ? -3.679  2.728   3.030   1.00 0.00 ? 42  VAL A HG23 5  
ATOM 6564  N N    . GLU A 1 43  ? -8.014  6.102   3.244   1.00 0.00 ? 43  GLU A N    5  
ATOM 6565  C CA   . GLU A 1 43  ? -9.426  6.436   3.169   1.00 0.00 ? 43  GLU A CA   5  
ATOM 6566  C C    . GLU A 1 43  ? -10.177 5.385   2.350   1.00 0.00 ? 43  GLU A C    5  
ATOM 6567  O O    . GLU A 1 43  ? -9.674  4.908   1.334   1.00 0.00 ? 43  GLU A O    5  
ATOM 6568  C CB   . GLU A 1 43  ? -9.628  7.835   2.584   1.00 0.00 ? 43  GLU A CB   5  
ATOM 6569  C CG   . GLU A 1 43  ? -9.319  8.914   3.623   1.00 0.00 ? 43  GLU A CG   5  
ATOM 6570  C CD   . GLU A 1 43  ? -10.515 9.849   3.815   1.00 0.00 ? 43  GLU A CD   5  
ATOM 6571  O OE1  . GLU A 1 43  ? -11.020 10.343  2.784   1.00 0.00 ? 43  GLU A OE1  5  
ATOM 6572  O OE2  . GLU A 1 43  ? -10.897 10.048  4.988   1.00 0.00 ? 43  GLU A OE2  5  
ATOM 6573  H H    . GLU A 1 43  ? -7.404  6.733   2.766   1.00 0.00 ? 43  GLU A H    5  
ATOM 6574  H HA   . GLU A 1 43  ? -9.781  6.425   4.199   1.00 0.00 ? 43  GLU A HA   5  
ATOM 6575  H HB2  . GLU A 1 43  ? -8.982  7.966   1.715   1.00 0.00 ? 43  GLU A HB2  5  
ATOM 6576  H HB3  . GLU A 1 43  ? -10.655 7.943   2.236   1.00 0.00 ? 43  GLU A HB3  5  
ATOM 6577  H HG2  . GLU A 1 43  ? -9.062  8.446   4.573   1.00 0.00 ? 43  GLU A HG2  5  
ATOM 6578  H HG3  . GLU A 1 43  ? -8.449  9.490   3.307   1.00 0.00 ? 43  GLU A HG3  5  
ATOM 6579  N N    . PRO A 1 44  ? -11.402 5.046   2.834   1.00 0.00 ? 44  PRO A N    5  
ATOM 6580  C CA   . PRO A 1 44  ? -12.228 4.060   2.158   1.00 0.00 ? 44  PRO A CA   5  
ATOM 6581  C C    . PRO A 1 44  ? -12.853 4.646   0.890   1.00 0.00 ? 44  PRO A C    5  
ATOM 6582  O O    . PRO A 1 44  ? -12.837 5.859   0.689   1.00 0.00 ? 44  PRO A O    5  
ATOM 6583  C CB   . PRO A 1 44  ? -13.261 3.638   3.190   1.00 0.00 ? 44  PRO A CB   5  
ATOM 6584  C CG   . PRO A 1 44  ? -13.267 4.732   4.245   1.00 0.00 ? 44  PRO A CG   5  
ATOM 6585  C CD   . PRO A 1 44  ? -12.030 5.590   4.034   1.00 0.00 ? 44  PRO A CD   5  
ATOM 6586  H HA   . PRO A 1 44  ? -11.669 3.288   1.855   1.00 0.00 ? 44  PRO A HA   5  
ATOM 6587  H HB2  . PRO A 1 44  ? -14.245 3.529   2.735   1.00 0.00 ? 44  PRO A HB2  5  
ATOM 6588  H HB3  . PRO A 1 44  ? -13.004 2.674   3.628   1.00 0.00 ? 44  PRO A HB3  5  
ATOM 6589  H HG2  . PRO A 1 44  ? -14.170 5.337   4.162   1.00 0.00 ? 44  PRO A HG2  5  
ATOM 6590  H HG3  . PRO A 1 44  ? -13.265 4.298   5.245   1.00 0.00 ? 44  PRO A HG3  5  
ATOM 6591  H HD2  . PRO A 1 44  ? -12.294 6.639   3.902   1.00 0.00 ? 44  PRO A HD2  5  
ATOM 6592  H HD3  . PRO A 1 44  ? -11.360 5.535   4.892   1.00 0.00 ? 44  PRO A HD3  5  
ATOM 6593  N N    . GLY A 1 45  ? -13.390 3.756   0.068   1.00 0.00 ? 45  GLY A N    5  
ATOM 6594  C CA   . GLY A 1 45  ? -14.019 4.169   -1.174  1.00 0.00 ? 45  GLY A CA   5  
ATOM 6595  C C    . GLY A 1 45  ? -13.247 5.319   -1.824  1.00 0.00 ? 45  GLY A C    5  
ATOM 6596  O O    . GLY A 1 45  ? -13.835 6.166   -2.495  1.00 0.00 ? 45  GLY A O    5  
ATOM 6597  H H    . GLY A 1 45  ? -13.399 2.771   0.239   1.00 0.00 ? 45  GLY A H    5  
ATOM 6598  H HA2  . GLY A 1 45  ? -14.067 3.324   -1.861  1.00 0.00 ? 45  GLY A HA2  5  
ATOM 6599  H HA3  . GLY A 1 45  ? -15.046 4.480   -0.980  1.00 0.00 ? 45  GLY A HA3  5  
ATOM 6600  N N    . SER A 1 46  ? -11.941 5.312   -1.603  1.00 0.00 ? 46  SER A N    5  
ATOM 6601  C CA   . SER A 1 46  ? -11.082 6.343   -2.159  1.00 0.00 ? 46  SER A CA   5  
ATOM 6602  C C    . SER A 1 46  ? -10.301 5.788   -3.351  1.00 0.00 ? 46  SER A C    5  
ATOM 6603  O O    . SER A 1 46  ? -10.427 4.611   -3.687  1.00 0.00 ? 46  SER A O    5  
ATOM 6604  C CB   . SER A 1 46  ? -10.119 6.888   -1.101  1.00 0.00 ? 46  SER A CB   5  
ATOM 6605  O OG   . SER A 1 46  ? -9.020  6.009   -0.878  1.00 0.00 ? 46  SER A OG   5  
ATOM 6606  H H    . SER A 1 46  ? -11.470 4.619   -1.056  1.00 0.00 ? 46  SER A H    5  
ATOM 6607  H HA   . SER A 1 46  ? -11.755 7.138   -2.479  1.00 0.00 ? 46  SER A HA   5  
ATOM 6608  H HB2  . SER A 1 46  ? -9.746  7.862   -1.418  1.00 0.00 ? 46  SER A HB2  5  
ATOM 6609  H HB3  . SER A 1 46  ? -10.657 7.041   -0.166  1.00 0.00 ? 46  SER A HB3  5  
ATOM 6610  H HG   . SER A 1 46  ? -8.937  5.806   0.098   1.00 0.00 ? 46  SER A HG   5  
ATOM 6611  N N    . LEU A 1 47  ? -9.511  6.661   -3.960  1.00 0.00 ? 47  LEU A N    5  
ATOM 6612  C CA   . LEU A 1 47  ? -8.710  6.272   -5.108  1.00 0.00 ? 47  LEU A CA   5  
ATOM 6613  C C    . LEU A 1 47  ? -7.543  5.402   -4.638  1.00 0.00 ? 47  LEU A C    5  
ATOM 6614  O O    . LEU A 1 47  ? -7.221  4.396   -5.270  1.00 0.00 ? 47  LEU A O    5  
ATOM 6615  C CB   . LEU A 1 47  ? -8.277  7.506   -5.901  1.00 0.00 ? 47  LEU A CB   5  
ATOM 6616  C CG   . LEU A 1 47  ? -7.433  7.239   -7.149  1.00 0.00 ? 47  LEU A CG   5  
ATOM 6617  C CD1  . LEU A 1 47  ? -7.926  5.994   -7.888  1.00 0.00 ? 47  LEU A CD1  5  
ATOM 6618  C CD2  . LEU A 1 47  ? -7.396  8.468   -8.059  1.00 0.00 ? 47  LEU A CD2  5  
ATOM 6619  H H    . LEU A 1 47  ? -9.414  7.616   -3.680  1.00 0.00 ? 47  LEU A H    5  
ATOM 6620  H HA   . LEU A 1 47  ? -9.345  5.675   -5.762  1.00 0.00 ? 47  LEU A HA   5  
ATOM 6621  H HB2  . LEU A 1 47  ? -9.170  8.053   -6.201  1.00 0.00 ? 47  LEU A HB2  5  
ATOM 6622  H HB3  . LEU A 1 47  ? -7.711  8.160   -5.237  1.00 0.00 ? 47  LEU A HB3  5  
ATOM 6623  H HG   . LEU A 1 47  ? -6.409  7.042   -6.833  1.00 0.00 ? 47  LEU A HG   5  
ATOM 6624  H HD11 . LEU A 1 47  ? -7.395  5.899   -8.835  1.00 0.00 ? 47  LEU A HD11 5  
ATOM 6625  H HD12 . LEU A 1 47  ? -7.740  5.111   -7.276  1.00 0.00 ? 47  LEU A HD12 5  
ATOM 6626  H HD13 . LEU A 1 47  ? -8.995  6.084   -8.079  1.00 0.00 ? 47  LEU A HD13 5  
ATOM 6627  H HD21 . LEU A 1 47  ? -6.915  8.208   -9.002  1.00 0.00 ? 47  LEU A HD21 5  
ATOM 6628  H HD22 . LEU A 1 47  ? -8.413  8.809   -8.252  1.00 0.00 ? 47  LEU A HD22 5  
ATOM 6629  H HD23 . LEU A 1 47  ? -6.833  9.264   -7.572  1.00 0.00 ? 47  LEU A HD23 5  
ATOM 6630  N N    . ALA A 1 48  ? -6.941  5.819   -3.535  1.00 0.00 ? 48  ALA A N    5  
ATOM 6631  C CA   . ALA A 1 48  ? -5.816  5.090   -2.973  1.00 0.00 ? 48  ALA A CA   5  
ATOM 6632  C C    . ALA A 1 48  ? -6.195  3.616   -2.820  1.00 0.00 ? 48  ALA A C    5  
ATOM 6633  O O    . ALA A 1 48  ? -5.644  2.755   -3.504  1.00 0.00 ? 48  ALA A O    5  
ATOM 6634  C CB   . ALA A 1 48  ? -5.406  5.728   -1.645  1.00 0.00 ? 48  ALA A CB   5  
ATOM 6635  H H    . ALA A 1 48  ? -7.209  6.638   -3.027  1.00 0.00 ? 48  ALA A H    5  
ATOM 6636  H HA   . ALA A 1 48  ? -4.985  5.172   -3.674  1.00 0.00 ? 48  ALA A HA   5  
ATOM 6637  H HB1  . ALA A 1 48  ? -6.015  5.316   -0.840  1.00 0.00 ? 48  ALA A HB1  5  
ATOM 6638  H HB2  . ALA A 1 48  ? -4.355  5.516   -1.449  1.00 0.00 ? 48  ALA A HB2  5  
ATOM 6639  H HB3  . ALA A 1 48  ? -5.555  6.807   -1.698  1.00 0.00 ? 48  ALA A HB3  5  
ATOM 6640  N N    . GLU A 1 49  ? -7.134  3.370   -1.918  1.00 0.00 ? 49  GLU A N    5  
ATOM 6641  C CA   . GLU A 1 49  ? -7.593  2.015   -1.665  1.00 0.00 ? 49  GLU A CA   5  
ATOM 6642  C C    . GLU A 1 49  ? -7.970  1.329   -2.980  1.00 0.00 ? 49  GLU A C    5  
ATOM 6643  O O    . GLU A 1 49  ? -7.919  0.105   -3.083  1.00 0.00 ? 49  GLU A O    5  
ATOM 6644  C CB   . GLU A 1 49  ? -8.769  2.008   -0.686  1.00 0.00 ? 49  GLU A CB   5  
ATOM 6645  C CG   . GLU A 1 49  ? -9.167  0.577   -0.318  1.00 0.00 ? 49  GLU A CG   5  
ATOM 6646  C CD   . GLU A 1 49  ? -8.399  0.094   0.914   1.00 0.00 ? 49  GLU A CD   5  
ATOM 6647  O OE1  . GLU A 1 49  ? -7.233  0.521   1.059   1.00 0.00 ? 49  GLU A OE1  5  
ATOM 6648  O OE2  . GLU A 1 49  ? -8.995  -0.691  1.683   1.00 0.00 ? 49  GLU A OE2  5  
ATOM 6649  H H    . GLU A 1 49  ? -7.577  4.076   -1.365  1.00 0.00 ? 49  GLU A H    5  
ATOM 6650  H HA   . GLU A 1 49  ? -6.746  1.502   -1.210  1.00 0.00 ? 49  GLU A HA   5  
ATOM 6651  H HB2  . GLU A 1 49  ? -8.499  2.557   0.216   1.00 0.00 ? 49  GLU A HB2  5  
ATOM 6652  H HB3  . GLU A 1 49  ? -9.620  2.523   -1.131  1.00 0.00 ? 49  GLU A HB3  5  
ATOM 6653  H HG2  . GLU A 1 49  ? -10.238 0.532   -0.124  1.00 0.00 ? 49  GLU A HG2  5  
ATOM 6654  H HG3  . GLU A 1 49  ? -8.967  -0.088  -1.159  1.00 0.00 ? 49  GLU A HG3  5  
ATOM 6655  N N    . LYS A 1 50  ? -8.341  2.149   -3.953  1.00 0.00 ? 50  LYS A N    5  
ATOM 6656  C CA   . LYS A 1 50  ? -8.727  1.636   -5.257  1.00 0.00 ? 50  LYS A CA   5  
ATOM 6657  C C    . LYS A 1 50  ? -7.469  1.314   -6.066  1.00 0.00 ? 50  LYS A C    5  
ATOM 6658  O O    . LYS A 1 50  ? -7.471  0.396   -6.884  1.00 0.00 ? 50  LYS A O    5  
ATOM 6659  C CB   . LYS A 1 50  ? -9.675  2.612   -5.957  1.00 0.00 ? 50  LYS A CB   5  
ATOM 6660  C CG   . LYS A 1 50  ? -11.108 2.446   -5.446  1.00 0.00 ? 50  LYS A CG   5  
ATOM 6661  C CD   . LYS A 1 50  ? -12.056 3.421   -6.147  1.00 0.00 ? 50  LYS A CD   5  
ATOM 6662  C CE   . LYS A 1 50  ? -13.067 4.008   -5.160  1.00 0.00 ? 50  LYS A CE   5  
ATOM 6663  N NZ   . LYS A 1 50  ? -14.192 4.639   -5.884  1.00 0.00 ? 50  LYS A NZ   5  
ATOM 6664  H H    . LYS A 1 50  ? -8.380  3.144   -3.861  1.00 0.00 ? 50  LYS A H    5  
ATOM 6665  H HA   . LYS A 1 50  ? -9.279  0.711   -5.094  1.00 0.00 ? 50  LYS A HA   5  
ATOM 6666  H HB2  . LYS A 1 50  ? -9.341  3.635   -5.787  1.00 0.00 ? 50  LYS A HB2  5  
ATOM 6667  H HB3  . LYS A 1 50  ? -9.647  2.443   -7.033  1.00 0.00 ? 50  LYS A HB3  5  
ATOM 6668  H HG2  . LYS A 1 50  ? -11.442 1.422   -5.615  1.00 0.00 ? 50  LYS A HG2  5  
ATOM 6669  H HG3  . LYS A 1 50  ? -11.136 2.616   -4.370  1.00 0.00 ? 50  LYS A HG3  5  
ATOM 6670  H HD2  . LYS A 1 50  ? -11.482 4.225   -6.607  1.00 0.00 ? 50  LYS A HD2  5  
ATOM 6671  H HD3  . LYS A 1 50  ? -12.584 2.906   -6.950  1.00 0.00 ? 50  LYS A HD3  5  
ATOM 6672  H HE2  . LYS A 1 50  ? -13.443 3.222   -4.504  1.00 0.00 ? 50  LYS A HE2  5  
ATOM 6673  H HE3  . LYS A 1 50  ? -12.577 4.745   -4.524  1.00 0.00 ? 50  LYS A HE3  5  
ATOM 6674  H HZ1  . LYS A 1 50  ? -15.015 4.081   -5.774  1.00 0.00 ? 50  LYS A HZ1  5  
ATOM 6675  H HZ2  . LYS A 1 50  ? -14.358 5.553   -5.513  1.00 0.00 ? 50  LYS A HZ2  5  
ATOM 6676  H HZ3  . LYS A 1 50  ? -13.966 4.710   -6.856  1.00 0.00 ? 50  LYS A HZ3  5  
ATOM 6677  N N    . GLU A 1 51  ? -6.424  2.088   -5.809  1.00 0.00 ? 51  GLU A N    5  
ATOM 6678  C CA   . GLU A 1 51  ? -5.162  1.896   -6.503  1.00 0.00 ? 51  GLU A CA   5  
ATOM 6679  C C    . GLU A 1 51  ? -4.430  0.674   -5.945  1.00 0.00 ? 51  GLU A C    5  
ATOM 6680  O O    . GLU A 1 51  ? -3.514  0.152   -6.579  1.00 0.00 ? 51  GLU A O    5  
ATOM 6681  C CB   . GLU A 1 51  ? -4.289  3.149   -6.409  1.00 0.00 ? 51  GLU A CB   5  
ATOM 6682  C CG   . GLU A 1 51  ? -4.830  4.263   -7.308  1.00 0.00 ? 51  GLU A CG   5  
ATOM 6683  C CD   . GLU A 1 51  ? -4.821  3.835   -8.777  1.00 0.00 ? 51  GLU A CD   5  
ATOM 6684  O OE1  . GLU A 1 51  ? -3.722  3.873   -9.372  1.00 0.00 ? 51  GLU A OE1  5  
ATOM 6685  O OE2  . GLU A 1 51  ? -5.912  3.481   -9.272  1.00 0.00 ? 51  GLU A OE2  5  
ATOM 6686  H H    . GLU A 1 51  ? -6.431  2.833   -5.142  1.00 0.00 ? 51  GLU A H    5  
ATOM 6687  H HA   . GLU A 1 51  ? -5.429  1.724   -7.546  1.00 0.00 ? 51  GLU A HA   5  
ATOM 6688  H HB2  . GLU A 1 51  ? -4.254  3.496   -5.376  1.00 0.00 ? 51  GLU A HB2  5  
ATOM 6689  H HB3  . GLU A 1 51  ? -3.267  2.907   -6.699  1.00 0.00 ? 51  GLU A HB3  5  
ATOM 6690  H HG2  . GLU A 1 51  ? -5.846  4.518   -7.006  1.00 0.00 ? 51  GLU A HG2  5  
ATOM 6691  H HG3  . GLU A 1 51  ? -4.226  5.162   -7.183  1.00 0.00 ? 51  GLU A HG3  5  
ATOM 6692  N N    . GLY A 1 52  ? -4.860  0.254   -4.764  1.00 0.00 ? 52  GLY A N    5  
ATOM 6693  C CA   . GLY A 1 52  ? -4.257  -0.896  -4.114  1.00 0.00 ? 52  GLY A CA   5  
ATOM 6694  C C    . GLY A 1 52  ? -3.638  -0.505  -2.770  1.00 0.00 ? 52  GLY A C    5  
ATOM 6695  O O    . GLY A 1 52  ? -3.455  -1.352  -1.897  1.00 0.00 ? 52  GLY A O    5  
ATOM 6696  H H    . GLY A 1 52  ? -5.605  0.685   -4.255  1.00 0.00 ? 52  GLY A H    5  
ATOM 6697  H HA2  . GLY A 1 52  ? -5.010  -1.669  -3.960  1.00 0.00 ? 52  GLY A HA2  5  
ATOM 6698  H HA3  . GLY A 1 52  ? -3.490  -1.323  -4.761  1.00 0.00 ? 52  GLY A HA3  5  
ATOM 6699  N N    . LEU A 1 53  ? -3.334  0.779   -2.647  1.00 0.00 ? 53  LEU A N    5  
ATOM 6700  C CA   . LEU A 1 53  ? -2.740  1.293   -1.424  1.00 0.00 ? 53  LEU A CA   5  
ATOM 6701  C C    . LEU A 1 53  ? -3.480  0.710   -0.219  1.00 0.00 ? 53  LEU A C    5  
ATOM 6702  O O    . LEU A 1 53  ? -4.606  0.232   -0.349  1.00 0.00 ? 53  LEU A O    5  
ATOM 6703  C CB   . LEU A 1 53  ? -2.708  2.822   -1.446  1.00 0.00 ? 53  LEU A CB   5  
ATOM 6704  C CG   . LEU A 1 53  ? -1.413  3.473   -0.955  1.00 0.00 ? 53  LEU A CG   5  
ATOM 6705  C CD1  . LEU A 1 53  ? -0.412  3.634   -2.100  1.00 0.00 ? 53  LEU A CD1  5  
ATOM 6706  C CD2  . LEU A 1 53  ? -1.700  4.802   -0.253  1.00 0.00 ? 53  LEU A CD2  5  
ATOM 6707  H H    . LEU A 1 53  ? -3.486  1.461   -3.362  1.00 0.00 ? 53  LEU A H    5  
ATOM 6708  H HA   . LEU A 1 53  ? -1.706  0.949   -1.394  1.00 0.00 ? 53  LEU A HA   5  
ATOM 6709  H HB2  . LEU A 1 53  ? -2.894  3.155   -2.467  1.00 0.00 ? 53  LEU A HB2  5  
ATOM 6710  H HB3  . LEU A 1 53  ? -3.532  3.192   -0.835  1.00 0.00 ? 53  LEU A HB3  5  
ATOM 6711  H HG   . LEU A 1 53  ? -0.957  2.812   -0.218  1.00 0.00 ? 53  LEU A HG   5  
ATOM 6712  H HD11 . LEU A 1 53  ? 0.260   4.464   -1.881  1.00 0.00 ? 53  LEU A HD11 5  
ATOM 6713  H HD12 . LEU A 1 53  ? 0.168   2.716   -2.207  1.00 0.00 ? 53  LEU A HD12 5  
ATOM 6714  H HD13 . LEU A 1 53  ? -0.948  3.835   -3.027  1.00 0.00 ? 53  LEU A HD13 5  
ATOM 6715  H HD21 . LEU A 1 53  ? -2.564  4.688   0.401   1.00 0.00 ? 53  LEU A HD21 5  
ATOM 6716  H HD22 . LEU A 1 53  ? -0.832  5.095   0.338   1.00 0.00 ? 53  LEU A HD22 5  
ATOM 6717  H HD23 . LEU A 1 53  ? -1.907  5.569   -0.999  1.00 0.00 ? 53  LEU A HD23 5  
ATOM 6718  N N    . ARG A 1 54  ? -2.818  0.769   0.927   1.00 0.00 ? 54  ARG A N    5  
ATOM 6719  C CA   . ARG A 1 54  ? -3.399  0.253   2.155   1.00 0.00 ? 54  ARG A CA   5  
ATOM 6720  C C    . ARG A 1 54  ? -2.368  0.288   3.285   1.00 0.00 ? 54  ARG A C    5  
ATOM 6721  O O    . ARG A 1 54  ? -1.176  0.100   3.049   1.00 0.00 ? 54  ARG A O    5  
ATOM 6722  C CB   . ARG A 1 54  ? -3.894  -1.182  1.969   1.00 0.00 ? 54  ARG A CB   5  
ATOM 6723  C CG   . ARG A 1 54  ? -5.299  -1.357  2.549   1.00 0.00 ? 54  ARG A CG   5  
ATOM 6724  C CD   . ARG A 1 54  ? -5.238  -1.860  3.992   1.00 0.00 ? 54  ARG A CD   5  
ATOM 6725  N NE   . ARG A 1 54  ? -5.570  -3.302  4.040   1.00 0.00 ? 54  ARG A NE   5  
ATOM 6726  C CZ   . ARG A 1 54  ? -5.848  -3.972  5.166   1.00 0.00 ? 54  ARG A CZ   5  
ATOM 6727  N NH1  . ARG A 1 54  ? -5.837  -3.335  6.345   1.00 0.00 ? 54  ARG A NH1  5  
ATOM 6728  N NH2  . ARG A 1 54  ? -6.138  -5.279  5.114   1.00 0.00 ? 54  ARG A NH2  5  
ATOM 6729  H H    . ARG A 1 54  ? -1.902  1.160   1.024   1.00 0.00 ? 54  ARG A H    5  
ATOM 6730  H HA   . ARG A 1 54  ? -4.236  0.918   2.367   1.00 0.00 ? 54  ARG A HA   5  
ATOM 6731  H HB2  . ARG A 1 54  ? -3.901  -1.434  0.909   1.00 0.00 ? 54  ARG A HB2  5  
ATOM 6732  H HB3  . ARG A 1 54  ? -3.207  -1.874  2.457   1.00 0.00 ? 54  ARG A HB3  5  
ATOM 6733  H HG2  . ARG A 1 54  ? -5.832  -0.406  2.514   1.00 0.00 ? 54  ARG A HG2  5  
ATOM 6734  H HG3  . ARG A 1 54  ? -5.864  -2.061  1.938   1.00 0.00 ? 54  ARG A HG3  5  
ATOM 6735  H HD2  . ARG A 1 54  ? -4.242  -1.694  4.402   1.00 0.00 ? 54  ARG A HD2  5  
ATOM 6736  H HD3  . ARG A 1 54  ? -5.936  -1.298  4.612   1.00 0.00 ? 54  ARG A HD3  5  
ATOM 6737  H HE   . ARG A 1 54  ? -5.587  -3.808  3.177   1.00 0.00 ? 54  ARG A HE   5  
ATOM 6738  H HH11 . ARG A 1 54  ? -5.620  -2.359  6.384   1.00 0.00 ? 54  ARG A HH11 5  
ATOM 6739  H HH12 . ARG A 1 54  ? -6.045  -3.835  7.186   1.00 0.00 ? 54  ARG A HH12 5  
ATOM 6740  H HH21 . ARG A 1 54  ? -6.147  -5.755  4.234   1.00 0.00 ? 54  ARG A HH21 5  
ATOM 6741  H HH22 . ARG A 1 54  ? -6.346  -5.779  5.955   1.00 0.00 ? 54  ARG A HH22 5  
ATOM 6742  N N    . VAL A 1 55  ? -2.866  0.529   4.489   1.00 0.00 ? 55  VAL A N    5  
ATOM 6743  C CA   . VAL A 1 55  ? -2.003  0.591   5.657   1.00 0.00 ? 55  VAL A CA   5  
ATOM 6744  C C    . VAL A 1 55  ? -1.130  -0.665  5.707   1.00 0.00 ? 55  VAL A C    5  
ATOM 6745  O O    . VAL A 1 55  ? -1.644  -1.780  5.786   1.00 0.00 ? 55  VAL A O    5  
ATOM 6746  C CB   . VAL A 1 55  ? -2.845  0.784   6.920   1.00 0.00 ? 55  VAL A CB   5  
ATOM 6747  C CG1  . VAL A 1 55  ? -1.982  0.666   8.178   1.00 0.00 ? 55  VAL A CG1  5  
ATOM 6748  C CG2  . VAL A 1 55  ? -3.584  2.124   6.886   1.00 0.00 ? 55  VAL A CG2  5  
ATOM 6749  H H    . VAL A 1 55  ? -3.837  0.681   4.673   1.00 0.00 ? 55  VAL A H    5  
ATOM 6750  H HA   . VAL A 1 55  ? -1.358  1.462   5.544   1.00 0.00 ? 55  VAL A HA   5  
ATOM 6751  H HB   . VAL A 1 55  ? -3.591  -0.009  6.950   1.00 0.00 ? 55  VAL A HB   5  
ATOM 6752  H HG11 . VAL A 1 55  ? -1.488  1.618   8.370   1.00 0.00 ? 55  VAL A HG11 5  
ATOM 6753  H HG12 . VAL A 1 55  ? -2.612  0.405   9.028   1.00 0.00 ? 55  VAL A HG12 5  
ATOM 6754  H HG13 . VAL A 1 55  ? -1.230  -0.110  8.031   1.00 0.00 ? 55  VAL A HG13 5  
ATOM 6755  H HG21 . VAL A 1 55  ? -4.459  2.040   6.242   1.00 0.00 ? 55  VAL A HG21 5  
ATOM 6756  H HG22 . VAL A 1 55  ? -3.900  2.390   7.895   1.00 0.00 ? 55  VAL A HG22 5  
ATOM 6757  H HG23 . VAL A 1 55  ? -2.919  2.896   6.498   1.00 0.00 ? 55  VAL A HG23 5  
ATOM 6758  N N    . GLY A 1 56  ? 0.175   -0.441  5.660   1.00 0.00 ? 56  GLY A N    5  
ATOM 6759  C CA   . GLY A 1 56  ? 1.124   -1.541  5.699   1.00 0.00 ? 56  GLY A CA   5  
ATOM 6760  C C    . GLY A 1 56  ? 2.159   -1.412  4.579   1.00 0.00 ? 56  GLY A C    5  
ATOM 6761  O O    . GLY A 1 56  ? 3.342   -1.677  4.788   1.00 0.00 ? 56  GLY A O    5  
ATOM 6762  H H    . GLY A 1 56  ? 0.585   0.469   5.596   1.00 0.00 ? 56  GLY A H    5  
ATOM 6763  H HA2  . GLY A 1 56  ? 1.629   -1.556  6.665   1.00 0.00 ? 56  GLY A HA2  5  
ATOM 6764  H HA3  . GLY A 1 56  ? 0.594   -2.488  5.602   1.00 0.00 ? 56  GLY A HA3  5  
ATOM 6765  N N    . ASP A 1 57  ? 1.675   -1.006  3.414   1.00 0.00 ? 57  ASP A N    5  
ATOM 6766  C CA   . ASP A 1 57  ? 2.543   -0.839  2.261   1.00 0.00 ? 57  ASP A CA   5  
ATOM 6767  C C    . ASP A 1 57  ? 3.800   -0.074  2.680   1.00 0.00 ? 57  ASP A C    5  
ATOM 6768  O O    . ASP A 1 57  ? 3.873   0.444   3.793   1.00 0.00 ? 57  ASP A O    5  
ATOM 6769  C CB   . ASP A 1 57  ? 1.847   -0.038  1.159   1.00 0.00 ? 57  ASP A CB   5  
ATOM 6770  C CG   . ASP A 1 57  ? 0.561   -0.665  0.617   1.00 0.00 ? 57  ASP A CG   5  
ATOM 6771  O OD1  . ASP A 1 57  ? -0.109  -1.361  1.411   1.00 0.00 ? 57  ASP A OD1  5  
ATOM 6772  O OD2  . ASP A 1 57  ? 0.277   -0.435  -0.578  1.00 0.00 ? 57  ASP A OD2  5  
ATOM 6773  H H    . ASP A 1 57  ? 0.712   -0.793  3.252   1.00 0.00 ? 57  ASP A H    5  
ATOM 6774  H HA   . ASP A 1 57  ? 2.765   -1.851  1.921   1.00 0.00 ? 57  ASP A HA   5  
ATOM 6775  H HB2  . ASP A 1 57  ? 1.614   0.955   1.544   1.00 0.00 ? 57  ASP A HB2  5  
ATOM 6776  H HB3  . ASP A 1 57  ? 2.544   0.096   0.332   1.00 0.00 ? 57  ASP A HB3  5  
ATOM 6777  N N    . GLN A 1 58  ? 4.757   -0.026  1.766   1.00 0.00 ? 58  GLN A N    5  
ATOM 6778  C CA   . GLN A 1 58  ? 6.007   0.668   2.026   1.00 0.00 ? 58  GLN A CA   5  
ATOM 6779  C C    . GLN A 1 58  ? 6.306   1.663   0.904   1.00 0.00 ? 58  GLN A C    5  
ATOM 6780  O O    . GLN A 1 58  ? 6.688   1.268   -0.196  1.00 0.00 ? 58  GLN A O    5  
ATOM 6781  C CB   . GLN A 1 58  ? 7.159   -0.324  2.200   1.00 0.00 ? 58  GLN A CB   5  
ATOM 6782  C CG   . GLN A 1 58  ? 8.457   0.400   2.564   1.00 0.00 ? 58  GLN A CG   5  
ATOM 6783  C CD   . GLN A 1 58  ? 9.576   -0.598  2.865   1.00 0.00 ? 58  GLN A CD   5  
ATOM 6784  O OE1  . GLN A 1 58  ? 9.539   -1.751  2.467   1.00 0.00 ? 58  GLN A OE1  5  
ATOM 6785  N NE2  . GLN A 1 58  ? 10.570  -0.094  3.590   1.00 0.00 ? 58  GLN A NE2  5  
ATOM 6786  H H    . GLN A 1 58  ? 4.690   -0.450  0.862   1.00 0.00 ? 58  GLN A H    5  
ATOM 6787  H HA   . GLN A 1 58  ? 5.852   1.202   2.964   1.00 0.00 ? 58  GLN A HA   5  
ATOM 6788  H HB2  . GLN A 1 58  ? 6.909   -1.044  2.980   1.00 0.00 ? 58  GLN A HB2  5  
ATOM 6789  H HB3  . GLN A 1 58  ? 7.299   -0.889  1.278   1.00 0.00 ? 58  GLN A HB3  5  
ATOM 6790  H HG2  . GLN A 1 58  ? 8.756   1.051   1.742   1.00 0.00 ? 58  GLN A HG2  5  
ATOM 6791  H HG3  . GLN A 1 58  ? 8.290   1.038   3.431   1.00 0.00 ? 58  GLN A HG3  5  
ATOM 6792  H HE21 . GLN A 1 58  ? 10.539  0.861   3.886   1.00 0.00 ? 58  GLN A HE21 5  
ATOM 6793  H HE22 . GLN A 1 58  ? 11.349  -0.669  3.839   1.00 0.00 ? 58  GLN A HE22 5  
ATOM 6794  N N    . ILE A 1 59  ? 6.120   2.936   1.221   1.00 0.00 ? 59  ILE A N    5  
ATOM 6795  C CA   . ILE A 1 59  ? 6.365   3.992   0.253   1.00 0.00 ? 59  ILE A CA   5  
ATOM 6796  C C    . ILE A 1 59  ? 7.862   4.058   -0.055  1.00 0.00 ? 59  ILE A C    5  
ATOM 6797  O O    . ILE A 1 59  ? 8.572   4.911   0.476   1.00 0.00 ? 59  ILE A O    5  
ATOM 6798  C CB   . ILE A 1 59  ? 5.780   5.317   0.745   1.00 0.00 ? 59  ILE A CB   5  
ATOM 6799  C CG1  . ILE A 1 59  ? 4.270   5.201   0.966   1.00 0.00 ? 59  ILE A CG1  5  
ATOM 6800  C CG2  . ILE A 1 59  ? 6.133   6.460   -0.208  1.00 0.00 ? 59  ILE A CG2  5  
ATOM 6801  C CD1  . ILE A 1 59  ? 3.523   5.146   -0.369  1.00 0.00 ? 59  ILE A CD1  5  
ATOM 6802  H H    . ILE A 1 59  ? 5.809   3.250   2.118   1.00 0.00 ? 59  ILE A H    5  
ATOM 6803  H HA   . ILE A 1 59  ? 5.836   3.726   -0.662  1.00 0.00 ? 59  ILE A HA   5  
ATOM 6804  H HB   . ILE A 1 59  ? 6.229   5.551   1.710   1.00 0.00 ? 59  ILE A HB   5  
ATOM 6805  H HG12 . ILE A 1 59  ? 4.052   4.304   1.546   1.00 0.00 ? 59  ILE A HG12 5  
ATOM 6806  H HG13 . ILE A 1 59  ? 3.918   6.051   1.549   1.00 0.00 ? 59  ILE A HG13 5  
ATOM 6807  H HG21 . ILE A 1 59  ? 5.231   6.805   -0.713  1.00 0.00 ? 59  ILE A HG21 5  
ATOM 6808  H HG22 . ILE A 1 59  ? 6.570   7.283   0.358   1.00 0.00 ? 59  ILE A HG22 5  
ATOM 6809  H HG23 . ILE A 1 59  ? 6.851   6.108   -0.948  1.00 0.00 ? 59  ILE A HG23 5  
ATOM 6810  H HD11 . ILE A 1 59  ? 2.654   4.496   -0.272  1.00 0.00 ? 59  ILE A HD11 5  
ATOM 6811  H HD12 . ILE A 1 59  ? 3.198   6.149   -0.644  1.00 0.00 ? 59  ILE A HD12 5  
ATOM 6812  H HD13 . ILE A 1 59  ? 4.186   4.755   -1.140  1.00 0.00 ? 59  ILE A HD13 5  
ATOM 6813  N N    . LEU A 1 60  ? 8.299   3.147   -0.912  1.00 0.00 ? 60  LEU A N    5  
ATOM 6814  C CA   . LEU A 1 60  ? 9.699   3.091   -1.298  1.00 0.00 ? 60  LEU A CA   5  
ATOM 6815  C C    . LEU A 1 60  ? 10.094  4.413   -1.958  1.00 0.00 ? 60  LEU A C    5  
ATOM 6816  O O    . LEU A 1 60  ? 10.994  5.104   -1.481  1.00 0.00 ? 60  LEU A O    5  
ATOM 6817  C CB   . LEU A 1 60  ? 9.965   1.863   -2.171  1.00 0.00 ? 60  LEU A CB   5  
ATOM 6818  C CG   . LEU A 1 60  ? 9.484   0.524   -1.610  1.00 0.00 ? 60  LEU A CG   5  
ATOM 6819  C CD1  . LEU A 1 60  ? 9.689   -0.602  -2.626  1.00 0.00 ? 60  LEU A CD1  5  
ATOM 6820  C CD2  . LEU A 1 60  ? 10.157  0.216   -0.271  1.00 0.00 ? 60  LEU A CD2  5  
ATOM 6821  H H    . LEU A 1 60  ? 7.715   2.456   -1.340  1.00 0.00 ? 60  LEU A H    5  
ATOM 6822  H HA   . LEU A 1 60  ? 10.284  2.971   -0.386  1.00 0.00 ? 60  LEU A HA   5  
ATOM 6823  H HB2  . LEU A 1 60  ? 9.491   2.021   -3.139  1.00 0.00 ? 60  LEU A HB2  5  
ATOM 6824  H HB3  . LEU A 1 60  ? 11.038  1.795   -2.349  1.00 0.00 ? 60  LEU A HB3  5  
ATOM 6825  H HG   . LEU A 1 60  ? 8.413   0.597   -1.423  1.00 0.00 ? 60  LEU A HG   5  
ATOM 6826  H HD11 . LEU A 1 60  ? 8.857   -1.303  -2.565  1.00 0.00 ? 60  LEU A HD11 5  
ATOM 6827  H HD12 . LEU A 1 60  ? 9.735   -0.180  -3.630  1.00 0.00 ? 60  LEU A HD12 5  
ATOM 6828  H HD13 . LEU A 1 60  ? 10.621  -1.123  -2.408  1.00 0.00 ? 60  LEU A HD13 5  
ATOM 6829  H HD21 . LEU A 1 60  ? 10.178  1.118   0.341   1.00 0.00 ? 60  LEU A HD21 5  
ATOM 6830  H HD22 . LEU A 1 60  ? 9.596   -0.562  0.248   1.00 0.00 ? 60  LEU A HD22 5  
ATOM 6831  H HD23 . LEU A 1 60  ? 11.176  -0.127  -0.447  1.00 0.00 ? 60  LEU A HD23 5  
ATOM 6832  N N    . ARG A 1 61  ? 9.403   4.725   -3.044  1.00 0.00 ? 61  ARG A N    5  
ATOM 6833  C CA   . ARG A 1 61  ? 9.672   5.953   -3.774  1.00 0.00 ? 61  ARG A CA   5  
ATOM 6834  C C    . ARG A 1 61  ? 8.424   6.837   -3.802  1.00 0.00 ? 61  ARG A C    5  
ATOM 6835  O O    . ARG A 1 61  ? 7.327   6.380   -3.484  1.00 0.00 ? 61  ARG A O    5  
ATOM 6836  C CB   . ARG A 1 61  ? 10.109  5.655   -5.210  1.00 0.00 ? 61  ARG A CB   5  
ATOM 6837  C CG   . ARG A 1 61  ? 11.624  5.459   -5.292  1.00 0.00 ? 61  ARG A CG   5  
ATOM 6838  C CD   . ARG A 1 61  ? 12.016  4.753   -6.592  1.00 0.00 ? 61  ARG A CD   5  
ATOM 6839  N NE   . ARG A 1 61  ? 11.676  3.315   -6.508  1.00 0.00 ? 61  ARG A NE   5  
ATOM 6840  C CZ   . ARG A 1 61  ? 11.854  2.441   -7.509  1.00 0.00 ? 61  ARG A CZ   5  
ATOM 6841  N NH1  . ARG A 1 61  ? 12.369  2.855   -8.675  1.00 0.00 ? 61  ARG A NH1  5  
ATOM 6842  N NH2  . ARG A 1 61  ? 11.517  1.155   -7.344  1.00 0.00 ? 61  ARG A NH2  5  
ATOM 6843  H H    . ARG A 1 61  ? 8.673   4.158   -3.425  1.00 0.00 ? 61  ARG A H    5  
ATOM 6844  H HA   . ARG A 1 61  ? 10.481  6.433   -3.225  1.00 0.00 ? 61  ARG A HA   5  
ATOM 6845  H HB2  . ARG A 1 61  ? 9.603   4.759   -5.570  1.00 0.00 ? 61  ARG A HB2  5  
ATOM 6846  H HB3  . ARG A 1 61  ? 9.808   6.474   -5.863  1.00 0.00 ? 61  ARG A HB3  5  
ATOM 6847  H HG2  . ARG A 1 61  ? 12.123  6.427   -5.236  1.00 0.00 ? 61  ARG A HG2  5  
ATOM 6848  H HG3  . ARG A 1 61  ? 11.966  4.874   -4.439  1.00 0.00 ? 61  ARG A HG3  5  
ATOM 6849  H HD2  . ARG A 1 61  ? 11.497  5.209   -7.434  1.00 0.00 ? 61  ARG A HD2  5  
ATOM 6850  H HD3  . ARG A 1 61  ? 13.084  4.873   -6.773  1.00 0.00 ? 61  ARG A HD3  5  
ATOM 6851  H HE   . ARG A 1 61  ? 11.290  2.973   -5.652  1.00 0.00 ? 61  ARG A HE   5  
ATOM 6852  H HH11 . ARG A 1 61  ? 12.621  3.815   -8.799  1.00 0.00 ? 61  ARG A HH11 5  
ATOM 6853  H HH12 . ARG A 1 61  ? 12.502  2.203   -9.422  1.00 0.00 ? 61  ARG A HH12 5  
ATOM 6854  H HH21 . ARG A 1 61  ? 11.133  0.847   -6.474  1.00 0.00 ? 61  ARG A HH21 5  
ATOM 6855  H HH22 . ARG A 1 61  ? 11.650  0.503   -8.091  1.00 0.00 ? 61  ARG A HH22 5  
ATOM 6856  N N    . VAL A 1 62  ? 8.633   8.089   -4.184  1.00 0.00 ? 62  VAL A N    5  
ATOM 6857  C CA   . VAL A 1 62  ? 7.539   9.042   -4.257  1.00 0.00 ? 62  VAL A CA   5  
ATOM 6858  C C    . VAL A 1 62  ? 7.754   9.969   -5.455  1.00 0.00 ? 62  VAL A C    5  
ATOM 6859  O O    . VAL A 1 62  ? 8.729   10.719  -5.497  1.00 0.00 ? 62  VAL A O    5  
ATOM 6860  C CB   . VAL A 1 62  ? 7.413   9.797   -2.932  1.00 0.00 ? 62  VAL A CB   5  
ATOM 6861  C CG1  . VAL A 1 62  ? 8.602   10.736  -2.722  1.00 0.00 ? 62  VAL A CG1  5  
ATOM 6862  C CG2  . VAL A 1 62  ? 6.090   10.562  -2.860  1.00 0.00 ? 62  VAL A CG2  5  
ATOM 6863  H H    . VAL A 1 62  ? 9.528   8.453   -4.441  1.00 0.00 ? 62  VAL A H    5  
ATOM 6864  H HA   . VAL A 1 62  ? 6.620   8.476   -4.412  1.00 0.00 ? 62  VAL A HA   5  
ATOM 6865  H HB   . VAL A 1 62  ? 7.419   9.063   -2.126  1.00 0.00 ? 62  VAL A HB   5  
ATOM 6866  H HG11 . VAL A 1 62  ? 8.635   11.053  -1.679  1.00 0.00 ? 62  VAL A HG11 5  
ATOM 6867  H HG12 . VAL A 1 62  ? 9.526   10.215  -2.972  1.00 0.00 ? 62  VAL A HG12 5  
ATOM 6868  H HG13 . VAL A 1 62  ? 8.492   11.611  -3.363  1.00 0.00 ? 62  VAL A HG13 5  
ATOM 6869  H HG21 . VAL A 1 62  ? 6.164   11.346  -2.108  1.00 0.00 ? 62  VAL A HG21 5  
ATOM 6870  H HG22 . VAL A 1 62  ? 5.875   11.008  -3.831  1.00 0.00 ? 62  VAL A HG22 5  
ATOM 6871  H HG23 . VAL A 1 62  ? 5.287   9.875   -2.591  1.00 0.00 ? 62  VAL A HG23 5  
ATOM 6872  N N    . ASN A 1 63  ? 6.830   9.887   -6.400  1.00 0.00 ? 63  ASN A N    5  
ATOM 6873  C CA   . ASN A 1 63  ? 6.906   10.709  -7.596  1.00 0.00 ? 63  ASN A CA   5  
ATOM 6874  C C    . ASN A 1 63  ? 8.063   10.222  -8.471  1.00 0.00 ? 63  ASN A C    5  
ATOM 6875  O O    . ASN A 1 63  ? 7.850   9.790   -9.603  1.00 0.00 ? 63  ASN A O    5  
ATOM 6876  C CB   . ASN A 1 63  ? 7.167   12.174  -7.241  1.00 0.00 ? 63  ASN A CB   5  
ATOM 6877  C CG   . ASN A 1 63  ? 6.869   13.088  -8.431  1.00 0.00 ? 63  ASN A CG   5  
ATOM 6878  O OD1  . ASN A 1 63  ? 7.754   13.514  -9.156  1.00 0.00 ? 63  ASN A OD1  5  
ATOM 6879  N ND2  . ASN A 1 63  ? 5.578   13.365  -8.592  1.00 0.00 ? 63  ASN A ND2  5  
ATOM 6880  H H    . ASN A 1 63  ? 6.040   9.274   -6.359  1.00 0.00 ? 63  ASN A H    5  
ATOM 6881  H HA   . ASN A 1 63  ? 5.938   10.596  -8.083  1.00 0.00 ? 63  ASN A HA   5  
ATOM 6882  H HB2  . ASN A 1 63  ? 6.546   12.463  -6.392  1.00 0.00 ? 63  ASN A HB2  5  
ATOM 6883  H HB3  . ASN A 1 63  ? 8.205   12.299  -6.933  1.00 0.00 ? 63  ASN A HB3  5  
ATOM 6884  H HD21 . ASN A 1 63  ? 4.903   12.982  -7.961  1.00 0.00 ? 63  ASN A HD21 5  
ATOM 6885  H HD22 . ASN A 1 63  ? 5.283   13.955  -9.343  1.00 0.00 ? 63  ASN A HD22 5  
ATOM 6886  N N    . ASP A 1 64  ? 9.262   10.308  -7.914  1.00 0.00 ? 64  ASP A N    5  
ATOM 6887  C CA   . ASP A 1 64  ? 10.452  9.881   -8.629  1.00 0.00 ? 64  ASP A CA   5  
ATOM 6888  C C    . ASP A 1 64  ? 11.581  9.630   -7.628  1.00 0.00 ? 64  ASP A C    5  
ATOM 6889  O O    . ASP A 1 64  ? 12.279  8.621   -7.715  1.00 0.00 ? 64  ASP A O    5  
ATOM 6890  C CB   . ASP A 1 64  ? 10.921  10.958  -9.610  1.00 0.00 ? 64  ASP A CB   5  
ATOM 6891  C CG   . ASP A 1 64  ? 10.893  10.548  -11.084 1.00 0.00 ? 64  ASP A CG   5  
ATOM 6892  O OD1  . ASP A 1 64  ? 10.802  9.326   -11.330 1.00 0.00 ? 64  ASP A OD1  5  
ATOM 6893  O OD2  . ASP A 1 64  ? 10.963  11.465  -11.930 1.00 0.00 ? 64  ASP A OD2  5  
ATOM 6894  H H    . ASP A 1 64  ? 9.426   10.661  -6.993  1.00 0.00 ? 64  ASP A H    5  
ATOM 6895  H HA   . ASP A 1 64  ? 10.158  8.977   -9.162  1.00 0.00 ? 64  ASP A HA   5  
ATOM 6896  H HB2  . ASP A 1 64  ? 10.295  11.842  -9.483  1.00 0.00 ? 64  ASP A HB2  5  
ATOM 6897  H HB3  . ASP A 1 64  ? 11.938  11.249  -9.348  1.00 0.00 ? 64  ASP A HB3  5  
ATOM 6898  N N    . LYS A 1 65  ? 11.726  10.565  -6.701  1.00 0.00 ? 65  LYS A N    5  
ATOM 6899  C CA   . LYS A 1 65  ? 12.759  10.458  -5.684  1.00 0.00 ? 65  LYS A CA   5  
ATOM 6900  C C    . LYS A 1 65  ? 12.433  9.286   -4.755  1.00 0.00 ? 65  LYS A C    5  
ATOM 6901  O O    . LYS A 1 65  ? 11.276  8.885   -4.637  1.00 0.00 ? 65  LYS A O    5  
ATOM 6902  C CB   . LYS A 1 65  ? 12.933  11.791  -4.955  1.00 0.00 ? 65  LYS A CB   5  
ATOM 6903  C CG   . LYS A 1 65  ? 14.254  11.825  -4.183  1.00 0.00 ? 65  LYS A CG   5  
ATOM 6904  C CD   . LYS A 1 65  ? 14.479  13.196  -3.541  1.00 0.00 ? 65  LYS A CD   5  
ATOM 6905  C CE   . LYS A 1 65  ? 15.660  13.159  -2.570  1.00 0.00 ? 65  LYS A CE   5  
ATOM 6906  N NZ   . LYS A 1 65  ? 15.839  14.477  -1.921  1.00 0.00 ? 65  LYS A NZ   5  
ATOM 6907  H H    . LYS A 1 65  ? 11.154  11.383  -6.638  1.00 0.00 ? 65  LYS A H    5  
ATOM 6908  H HA   . LYS A 1 65  ? 13.698  10.244  -6.194  1.00 0.00 ? 65  LYS A HA   5  
ATOM 6909  H HB2  . LYS A 1 65  ? 12.907  12.610  -5.674  1.00 0.00 ? 65  LYS A HB2  5  
ATOM 6910  H HB3  . LYS A 1 65  ? 12.102  11.945  -4.267  1.00 0.00 ? 65  LYS A HB3  5  
ATOM 6911  H HG2  . LYS A 1 65  ? 14.248  11.055  -3.411  1.00 0.00 ? 65  LYS A HG2  5  
ATOM 6912  H HG3  . LYS A 1 65  ? 15.079  11.595  -4.857  1.00 0.00 ? 65  LYS A HG3  5  
ATOM 6913  H HD2  . LYS A 1 65  ? 14.664  13.938  -4.318  1.00 0.00 ? 65  LYS A HD2  5  
ATOM 6914  H HD3  . LYS A 1 65  ? 13.578  13.506  -3.012  1.00 0.00 ? 65  LYS A HD3  5  
ATOM 6915  H HE2  . LYS A 1 65  ? 15.492  12.394  -1.812  1.00 0.00 ? 65  LYS A HE2  5  
ATOM 6916  H HE3  . LYS A 1 65  ? 16.570  12.884  -3.104  1.00 0.00 ? 65  LYS A HE3  5  
ATOM 6917  H HZ1  . LYS A 1 65  ? 15.600  15.202  -2.568  1.00 0.00 ? 65  LYS A HZ1  5  
ATOM 6918  H HZ2  . LYS A 1 65  ? 15.245  14.537  -1.119  1.00 0.00 ? 65  LYS A HZ2  5  
ATOM 6919  H HZ3  . LYS A 1 65  ? 16.792  14.583  -1.639  1.00 0.00 ? 65  LYS A HZ3  5  
ATOM 6920  N N    . SER A 1 66  ? 13.475  8.770   -4.119  1.00 0.00 ? 66  SER A N    5  
ATOM 6921  C CA   . SER A 1 66  ? 13.315  7.653   -3.205  1.00 0.00 ? 66  SER A CA   5  
ATOM 6922  C C    . SER A 1 66  ? 13.451  8.136   -1.759  1.00 0.00 ? 66  SER A C    5  
ATOM 6923  O O    . SER A 1 66  ? 14.391  8.857   -1.428  1.00 0.00 ? 66  SER A O    5  
ATOM 6924  C CB   . SER A 1 66  ? 14.337  6.552   -3.495  1.00 0.00 ? 66  SER A CB   5  
ATOM 6925  O OG   . SER A 1 66  ? 15.665  6.960   -3.179  1.00 0.00 ? 66  SER A OG   5  
ATOM 6926  H H    . SER A 1 66  ? 14.413  9.102   -4.221  1.00 0.00 ? 66  SER A H    5  
ATOM 6927  H HA   . SER A 1 66  ? 12.310  7.272   -3.387  1.00 0.00 ? 66  SER A HA   5  
ATOM 6928  H HB2  . SER A 1 66  ? 14.084  5.661   -2.919  1.00 0.00 ? 66  SER A HB2  5  
ATOM 6929  H HB3  . SER A 1 66  ? 14.283  6.276   -4.548  1.00 0.00 ? 66  SER A HB3  5  
ATOM 6930  H HG   . SER A 1 66  ? 16.280  6.172   -3.202  1.00 0.00 ? 66  SER A HG   5  
ATOM 6931  N N    . LEU A 1 67  ? 12.499  7.719   -0.937  1.00 0.00 ? 67  LEU A N    5  
ATOM 6932  C CA   . LEU A 1 67  ? 12.502  8.100   0.465   1.00 0.00 ? 67  LEU A CA   5  
ATOM 6933  C C    . LEU A 1 67  ? 13.227  7.027   1.279   1.00 0.00 ? 67  LEU A C    5  
ATOM 6934  O O    . LEU A 1 67  ? 12.736  6.597   2.322   1.00 0.00 ? 67  LEU A O    5  
ATOM 6935  C CB   . LEU A 1 67  ? 11.077  8.380   0.946   1.00 0.00 ? 67  LEU A CB   5  
ATOM 6936  C CG   . LEU A 1 67  ? 10.201  9.209   0.005   1.00 0.00 ? 67  LEU A CG   5  
ATOM 6937  C CD1  . LEU A 1 67  ? 8.764   9.292   0.523   1.00 0.00 ? 67  LEU A CD1  5  
ATOM 6938  C CD2  . LEU A 1 67  ? 10.807  10.594  -0.230  1.00 0.00 ? 67  LEU A CD2  5  
ATOM 6939  H H    . LEU A 1 67  ? 11.738  7.133   -1.215  1.00 0.00 ? 67  LEU A H    5  
ATOM 6940  H HA   . LEU A 1 67  ? 13.059  9.033   0.549   1.00 0.00 ? 67  LEU A HA   5  
ATOM 6941  H HB2  . LEU A 1 67  ? 10.581  7.426   1.125   1.00 0.00 ? 67  LEU A HB2  5  
ATOM 6942  H HB3  . LEU A 1 67  ? 11.133  8.895   1.906   1.00 0.00 ? 67  LEU A HB3  5  
ATOM 6943  H HG   . LEU A 1 67  ? 10.166  8.705   -0.961  1.00 0.00 ? 67  LEU A HG   5  
ATOM 6944  H HD11 . LEU A 1 67  ? 8.080   8.920   -0.239  1.00 0.00 ? 67  LEU A HD11 5  
ATOM 6945  H HD12 . LEU A 1 67  ? 8.667   8.687   1.425   1.00 0.00 ? 67  LEU A HD12 5  
ATOM 6946  H HD13 . LEU A 1 67  ? 8.520   10.329  0.755   1.00 0.00 ? 67  LEU A HD13 5  
ATOM 6947  H HD21 . LEU A 1 67  ? 11.562  10.794  0.530   1.00 0.00 ? 67  LEU A HD21 5  
ATOM 6948  H HD22 . LEU A 1 67  ? 11.267  10.627  -1.217  1.00 0.00 ? 67  LEU A HD22 5  
ATOM 6949  H HD23 . LEU A 1 67  ? 10.022  11.349  -0.170  1.00 0.00 ? 67  LEU A HD23 5  
ATOM 6950  N N    . ALA A 1 68  ? 14.383  6.626   0.773   1.00 0.00 ? 68  ALA A N    5  
ATOM 6951  C CA   . ALA A 1 68  ? 15.181  5.611   1.441   1.00 0.00 ? 68  ALA A CA   5  
ATOM 6952  C C    . ALA A 1 68  ? 15.174  5.873   2.948   1.00 0.00 ? 68  ALA A C    5  
ATOM 6953  O O    . ALA A 1 68  ? 14.469  5.198   3.696   1.00 0.00 ? 68  ALA A O    5  
ATOM 6954  C CB   . ALA A 1 68  ? 16.595  5.606   0.856   1.00 0.00 ? 68  ALA A CB   5  
ATOM 6955  H H    . ALA A 1 68  ? 14.775  6.980   -0.076  1.00 0.00 ? 68  ALA A H    5  
ATOM 6956  H HA   . ALA A 1 68  ? 14.717  4.644   1.246   1.00 0.00 ? 68  ALA A HA   5  
ATOM 6957  H HB1  . ALA A 1 68  ? 17.208  4.883   1.394   1.00 0.00 ? 68  ALA A HB1  5  
ATOM 6958  H HB2  . ALA A 1 68  ? 16.551  5.332   -0.198  1.00 0.00 ? 68  ALA A HB2  5  
ATOM 6959  H HB3  . ALA A 1 68  ? 17.032  6.599   0.955   1.00 0.00 ? 68  ALA A HB3  5  
ATOM 6960  N N    . ARG A 1 69  ? 15.967  6.856   3.348   1.00 0.00 ? 69  ARG A N    5  
ATOM 6961  C CA   . ARG A 1 69  ? 16.061  7.216   4.753   1.00 0.00 ? 69  ARG A CA   5  
ATOM 6962  C C    . ARG A 1 69  ? 15.949  8.733   4.921   1.00 0.00 ? 69  ARG A C    5  
ATOM 6963  O O    . ARG A 1 69  ? 16.958  9.436   4.931   1.00 0.00 ? 69  ARG A O    5  
ATOM 6964  C CB   . ARG A 1 69  ? 17.384  6.740   5.356   1.00 0.00 ? 69  ARG A CB   5  
ATOM 6965  C CG   . ARG A 1 69  ? 17.254  5.318   5.908   1.00 0.00 ? 69  ARG A CG   5  
ATOM 6966  C CD   . ARG A 1 69  ? 18.443  4.969   6.806   1.00 0.00 ? 69  ARG A CD   5  
ATOM 6967  N NE   . ARG A 1 69  ? 18.333  3.566   7.267   1.00 0.00 ? 69  ARG A NE   5  
ATOM 6968  C CZ   . ARG A 1 69  ? 19.319  2.898   7.881   1.00 0.00 ? 69  ARG A CZ   5  
ATOM 6969  N NH1  . ARG A 1 69  ? 20.494  3.500   8.112   1.00 0.00 ? 69  ARG A NH1  5  
ATOM 6970  N NH2  . ARG A 1 69  ? 19.130  1.628   8.265   1.00 0.00 ? 69  ARG A NH2  5  
ATOM 6971  H H    . ARG A 1 69  ? 16.537  7.401   2.733   1.00 0.00 ? 69  ARG A H    5  
ATOM 6972  H HA   . ARG A 1 69  ? 15.223  6.706   5.228   1.00 0.00 ? 69  ARG A HA   5  
ATOM 6973  H HB2  . ARG A 1 69  ? 18.166  6.769   4.597   1.00 0.00 ? 69  ARG A HB2  5  
ATOM 6974  H HB3  . ARG A 1 69  ? 17.689  7.417   6.154   1.00 0.00 ? 69  ARG A HB3  5  
ATOM 6975  H HG2  . ARG A 1 69  ? 16.327  5.227   6.473   1.00 0.00 ? 69  ARG A HG2  5  
ATOM 6976  H HG3  . ARG A 1 69  ? 17.196  4.608   5.083   1.00 0.00 ? 69  ARG A HG3  5  
ATOM 6977  H HD2  . ARG A 1 69  ? 19.375  5.108   6.260   1.00 0.00 ? 69  ARG A HD2  5  
ATOM 6978  H HD3  . ARG A 1 69  ? 18.471  5.641   7.664   1.00 0.00 ? 69  ARG A HD3  5  
ATOM 6979  H HE   . ARG A 1 69  ? 17.469  3.088   7.111   1.00 0.00 ? 69  ARG A HE   5  
ATOM 6980  H HH11 . ARG A 1 69  ? 20.635  4.448   7.826   1.00 0.00 ? 69  ARG A HH11 5  
ATOM 6981  H HH12 . ARG A 1 69  ? 21.229  3.001   8.570   1.00 0.00 ? 69  ARG A HH12 5  
ATOM 6982  H HH21 . ARG A 1 69  ? 18.253  1.179   8.093   1.00 0.00 ? 69  ARG A HH21 5  
ATOM 6983  H HH22 . ARG A 1 69  ? 19.865  1.130   8.723   1.00 0.00 ? 69  ARG A HH22 5  
ATOM 6984  N N    . VAL A 1 70  ? 14.713  9.193   5.049   1.00 0.00 ? 70  VAL A N    5  
ATOM 6985  C CA   . VAL A 1 70  ? 14.456  10.613  5.215   1.00 0.00 ? 70  VAL A CA   5  
ATOM 6986  C C    . VAL A 1 70  ? 13.412  10.812  6.316   1.00 0.00 ? 70  VAL A C    5  
ATOM 6987  O O    . VAL A 1 70  ? 12.559  9.952   6.530   1.00 0.00 ? 70  VAL A O    5  
ATOM 6988  C CB   . VAL A 1 70  ? 14.041  11.230  3.878   1.00 0.00 ? 70  VAL A CB   5  
ATOM 6989  C CG1  . VAL A 1 70  ? 15.185  11.162  2.865   1.00 0.00 ? 70  VAL A CG1  5  
ATOM 6990  C CG2  . VAL A 1 70  ? 12.782  10.556  3.331   1.00 0.00 ? 70  VAL A CG2  5  
ATOM 6991  H H    . VAL A 1 70  ? 13.898  8.614   5.039   1.00 0.00 ? 70  VAL A H    5  
ATOM 6992  H HA   . VAL A 1 70  ? 15.389  11.081  5.529   1.00 0.00 ? 70  VAL A HA   5  
ATOM 6993  H HB   . VAL A 1 70  ? 13.810  12.281  4.052   1.00 0.00 ? 70  VAL A HB   5  
ATOM 6994  H HG11 . VAL A 1 70  ? 15.790  10.276  3.058   1.00 0.00 ? 70  VAL A HG11 5  
ATOM 6995  H HG12 . VAL A 1 70  ? 14.775  11.108  1.856   1.00 0.00 ? 70  VAL A HG12 5  
ATOM 6996  H HG13 . VAL A 1 70  ? 15.807  12.053  2.957   1.00 0.00 ? 70  VAL A HG13 5  
ATOM 6997  H HG21 . VAL A 1 70  ? 12.421  9.822   4.050   1.00 0.00 ? 70  VAL A HG21 5  
ATOM 6998  H HG22 . VAL A 1 70  ? 12.011  11.309  3.162   1.00 0.00 ? 70  VAL A HG22 5  
ATOM 6999  H HG23 . VAL A 1 70  ? 13.016  10.059  2.389   1.00 0.00 ? 70  VAL A HG23 5  
ATOM 7000  N N    . THR A 1 71  ? 13.512  11.952  6.984   1.00 0.00 ? 71  THR A N    5  
ATOM 7001  C CA   . THR A 1 71  ? 12.587  12.275  8.056   1.00 0.00 ? 71  THR A CA   5  
ATOM 7002  C C    . THR A 1 71  ? 11.149  12.291  7.533   1.00 0.00 ? 71  THR A C    5  
ATOM 7003  O O    . THR A 1 71  ? 10.921  12.481  6.340   1.00 0.00 ? 71  THR A O    5  
ATOM 7004  C CB   . THR A 1 71  ? 13.024  13.605  8.673   1.00 0.00 ? 71  THR A CB   5  
ATOM 7005  O OG1  . THR A 1 71  ? 13.032  14.512  7.574   1.00 0.00 ? 71  THR A OG1  5  
ATOM 7006  C CG2  . THR A 1 71  ? 14.479  13.581  9.147   1.00 0.00 ? 71  THR A CG2  5  
ATOM 7007  H H    . THR A 1 71  ? 14.209  12.646  6.803   1.00 0.00 ? 71  THR A H    5  
ATOM 7008  H HA   . THR A 1 71  ? 12.645  11.488  8.808   1.00 0.00 ? 71  THR A HA   5  
ATOM 7009  H HB   . THR A 1 71  ? 12.355  13.897  9.483   1.00 0.00 ? 71  THR A HB   5  
ATOM 7010  H HG1  . THR A 1 71  ? 13.044  15.454  7.908   1.00 0.00 ? 71  THR A HG1  5  
ATOM 7011  H HG21 . THR A 1 71  ? 15.131  13.904  8.335   1.00 0.00 ? 71  THR A HG21 5  
ATOM 7012  H HG22 . THR A 1 71  ? 14.595  14.254  9.996   1.00 0.00 ? 71  THR A HG22 5  
ATOM 7013  H HG23 . THR A 1 71  ? 14.747  12.568  9.446   1.00 0.00 ? 71  THR A HG23 5  
ATOM 7014  N N    . HIS A 1 72  ? 10.217  12.089  8.453   1.00 0.00 ? 72  HIS A N    5  
ATOM 7015  C CA   . HIS A 1 72  ? 8.807   12.078  8.099   1.00 0.00 ? 72  HIS A CA   5  
ATOM 7016  C C    . HIS A 1 72  ? 8.448   13.380  7.381   1.00 0.00 ? 72  HIS A C    5  
ATOM 7017  O O    . HIS A 1 72  ? 7.558   13.399  6.532   1.00 0.00 ? 72  HIS A O    5  
ATOM 7018  C CB   . HIS A 1 72  ? 7.940   11.822  9.333   1.00 0.00 ? 72  HIS A CB   5  
ATOM 7019  C CG   . HIS A 1 72  ? 6.517   11.430  9.014   1.00 0.00 ? 72  HIS A CG   5  
ATOM 7020  N ND1  . HIS A 1 72  ? 5.424   12.168  9.433   1.00 0.00 ? 72  HIS A ND1  5  
ATOM 7021  C CD2  . HIS A 1 72  ? 6.021   10.372  8.311   1.00 0.00 ? 72  HIS A CD2  5  
ATOM 7022  C CE1  . HIS A 1 72  ? 4.324   11.571  8.998   1.00 0.00 ? 72  HIS A CE1  5  
ATOM 7023  N NE2  . HIS A 1 72  ? 4.696   10.458  8.303   1.00 0.00 ? 72  HIS A NE2  5  
ATOM 7024  H H    . HIS A 1 72  ? 10.411  11.935  9.421   1.00 0.00 ? 72  HIS A H    5  
ATOM 7025  H HA   . HIS A 1 72  ? 8.664   11.243  7.413   1.00 0.00 ? 72  HIS A HA   5  
ATOM 7026  H HB2  . HIS A 1 72  ? 8.398   11.033  9.930   1.00 0.00 ? 72  HIS A HB2  5  
ATOM 7027  H HB3  . HIS A 1 72  ? 7.929   12.721  9.949   1.00 0.00 ? 72  HIS A HB3  5  
ATOM 7028  H HD1  . HIS A 1 72  ? 5.458   13.009  9.974   1.00 0.00 ? 72  HIS A HD1  5  
ATOM 7029  H HD2  . HIS A 1 72  ? 6.612   9.589   7.836   1.00 0.00 ? 72  HIS A HD2  5  
ATOM 7030  H HE1  . HIS A 1 72  ? 3.302   11.909  9.165   1.00 0.00 ? 72  HIS A HE1  5  
ATOM 7031  N N    . ALA A 1 73  ? 9.159   14.436  7.748   1.00 0.00 ? 73  ALA A N    5  
ATOM 7032  C CA   . ALA A 1 73  ? 8.926   15.739  7.149   1.00 0.00 ? 73  ALA A CA   5  
ATOM 7033  C C    . ALA A 1 73  ? 9.417   15.725  5.700   1.00 0.00 ? 73  ALA A C    5  
ATOM 7034  O O    . ALA A 1 73  ? 8.773   16.288  4.817   1.00 0.00 ? 73  ALA A O    5  
ATOM 7035  C CB   . ALA A 1 73  ? 9.615   16.817  7.988   1.00 0.00 ? 73  ALA A CB   5  
ATOM 7036  H H    . ALA A 1 73  ? 9.881   14.411  8.439   1.00 0.00 ? 73  ALA A H    5  
ATOM 7037  H HA   . ALA A 1 73  ? 7.851   15.921  7.158   1.00 0.00 ? 73  ALA A HA   5  
ATOM 7038  H HB1  . ALA A 1 73  ? 9.660   16.494  9.028   1.00 0.00 ? 73  ALA A HB1  5  
ATOM 7039  H HB2  . ALA A 1 73  ? 10.626  16.978  7.614   1.00 0.00 ? 73  ALA A HB2  5  
ATOM 7040  H HB3  . ALA A 1 73  ? 9.050   17.747  7.921   1.00 0.00 ? 73  ALA A HB3  5  
ATOM 7041  N N    . GLU A 1 74  ? 10.555  15.076  5.501   1.00 0.00 ? 74  GLU A N    5  
ATOM 7042  C CA   . GLU A 1 74  ? 11.140  14.981  4.175   1.00 0.00 ? 74  GLU A CA   5  
ATOM 7043  C C    . GLU A 1 74  ? 10.192  14.243  3.228   1.00 0.00 ? 74  GLU A C    5  
ATOM 7044  O O    . GLU A 1 74  ? 9.829   14.765  2.175   1.00 0.00 ? 74  GLU A O    5  
ATOM 7045  C CB   . GLU A 1 74  ? 12.507  14.297  4.226   1.00 0.00 ? 74  GLU A CB   5  
ATOM 7046  C CG   . GLU A 1 74  ? 13.610  15.299  4.575   1.00 0.00 ? 74  GLU A CG   5  
ATOM 7047  C CD   . GLU A 1 74  ? 13.934  16.196  3.378   1.00 0.00 ? 74  GLU A CD   5  
ATOM 7048  O OE1  . GLU A 1 74  ? 14.130  15.629  2.281   1.00 0.00 ? 74  GLU A OE1  5  
ATOM 7049  O OE2  . GLU A 1 74  ? 13.978  17.427  3.588   1.00 0.00 ? 74  GLU A OE2  5  
ATOM 7050  H H    . GLU A 1 74  ? 11.073  14.621  6.225   1.00 0.00 ? 74  GLU A H    5  
ATOM 7051  H HA   . GLU A 1 74  ? 11.269  16.011  3.841   1.00 0.00 ? 74  GLU A HA   5  
ATOM 7052  H HB2  . GLU A 1 74  ? 12.490  13.497  4.967   1.00 0.00 ? 74  GLU A HB2  5  
ATOM 7053  H HB3  . GLU A 1 74  ? 12.723  13.834  3.263   1.00 0.00 ? 74  GLU A HB3  5  
ATOM 7054  H HG2  . GLU A 1 74  ? 13.295  15.912  5.419   1.00 0.00 ? 74  GLU A HG2  5  
ATOM 7055  H HG3  . GLU A 1 74  ? 14.507  14.764  4.886   1.00 0.00 ? 74  GLU A HG3  5  
ATOM 7056  N N    . ALA A 1 75  ? 9.818   13.039  3.636   1.00 0.00 ? 75  ALA A N    5  
ATOM 7057  C CA   . ALA A 1 75  ? 8.920   12.223  2.837   1.00 0.00 ? 75  ALA A CA   5  
ATOM 7058  C C    . ALA A 1 75  ? 7.651   13.022  2.529   1.00 0.00 ? 75  ALA A C    5  
ATOM 7059  O O    . ALA A 1 75  ? 7.199   13.058  1.385   1.00 0.00 ? 75  ALA A O    5  
ATOM 7060  C CB   . ALA A 1 75  ? 8.621   10.918  3.577   1.00 0.00 ? 75  ALA A CB   5  
ATOM 7061  H H    . ALA A 1 75  ? 10.118  12.621  4.494   1.00 0.00 ? 75  ALA A H    5  
ATOM 7062  H HA   . ALA A 1 75  ? 9.428   11.988  1.902   1.00 0.00 ? 75  ALA A HA   5  
ATOM 7063  H HB1  . ALA A 1 75  ? 8.585   11.108  4.650   1.00 0.00 ? 75  ALA A HB1  5  
ATOM 7064  H HB2  . ALA A 1 75  ? 7.660   10.524  3.245   1.00 0.00 ? 75  ALA A HB2  5  
ATOM 7065  H HB3  . ALA A 1 75  ? 9.405   10.192  3.363   1.00 0.00 ? 75  ALA A HB3  5  
ATOM 7066  N N    . VAL A 1 76  ? 7.113   13.642  3.569   1.00 0.00 ? 76  VAL A N    5  
ATOM 7067  C CA   . VAL A 1 76  ? 5.906   14.438  3.423   1.00 0.00 ? 76  VAL A CA   5  
ATOM 7068  C C    . VAL A 1 76  ? 6.189   15.619  2.493   1.00 0.00 ? 76  VAL A C    5  
ATOM 7069  O O    . VAL A 1 76  ? 5.348   15.982  1.672   1.00 0.00 ? 76  VAL A O    5  
ATOM 7070  C CB   . VAL A 1 76  ? 5.395   14.869  4.799   1.00 0.00 ? 76  VAL A CB   5  
ATOM 7071  C CG1  . VAL A 1 76  ? 4.161   15.765  4.670   1.00 0.00 ? 76  VAL A CG1  5  
ATOM 7072  C CG2  . VAL A 1 76  ? 5.099   13.653  5.680   1.00 0.00 ? 76  VAL A CG2  5  
ATOM 7073  H H    . VAL A 1 76  ? 7.488   13.607  4.495   1.00 0.00 ? 76  VAL A H    5  
ATOM 7074  H HA   . VAL A 1 76  ? 5.148   13.804  2.965   1.00 0.00 ? 76  VAL A HA   5  
ATOM 7075  H HB   . VAL A 1 76  ? 6.181   15.449  5.282   1.00 0.00 ? 76  VAL A HB   5  
ATOM 7076  H HG11 . VAL A 1 76  ? 3.944   16.226  5.633   1.00 0.00 ? 76  VAL A HG11 5  
ATOM 7077  H HG12 . VAL A 1 76  ? 4.353   16.542  3.930   1.00 0.00 ? 76  VAL A HG12 5  
ATOM 7078  H HG13 . VAL A 1 76  ? 3.308   15.165  4.354   1.00 0.00 ? 76  VAL A HG13 5  
ATOM 7079  H HG21 . VAL A 1 76  ? 5.338   13.889  6.717   1.00 0.00 ? 76  VAL A HG21 5  
ATOM 7080  H HG22 . VAL A 1 76  ? 4.043   13.395  5.600   1.00 0.00 ? 76  VAL A HG22 5  
ATOM 7081  H HG23 . VAL A 1 76  ? 5.706   12.810  5.350   1.00 0.00 ? 76  VAL A HG23 5  
ATOM 7082  N N    . LYS A 1 77  ? 7.375   16.187  2.653   1.00 0.00 ? 77  LYS A N    5  
ATOM 7083  C CA   . LYS A 1 77  ? 7.779   17.320  1.838   1.00 0.00 ? 77  LYS A CA   5  
ATOM 7084  C C    . LYS A 1 77  ? 7.922   16.871  0.383   1.00 0.00 ? 77  LYS A C    5  
ATOM 7085  O O    . LYS A 1 77  ? 7.935   17.698  -0.527  1.00 0.00 ? 77  LYS A O    5  
ATOM 7086  C CB   . LYS A 1 77  ? 9.042   17.968  2.409   1.00 0.00 ? 77  LYS A CB   5  
ATOM 7087  C CG   . LYS A 1 77  ? 8.690   19.027  3.456   1.00 0.00 ? 77  LYS A CG   5  
ATOM 7088  C CD   . LYS A 1 77  ? 8.649   20.423  2.832   1.00 0.00 ? 77  LYS A CD   5  
ATOM 7089  C CE   . LYS A 1 77  ? 8.425   21.495  3.901   1.00 0.00 ? 77  LYS A CE   5  
ATOM 7090  N NZ   . LYS A 1 77  ? 7.755   22.678  3.315   1.00 0.00 ? 77  LYS A NZ   5  
ATOM 7091  H H    . LYS A 1 77  ? 8.053   15.886  3.324   1.00 0.00 ? 77  LYS A H    5  
ATOM 7092  H HA   . LYS A 1 77  ? 6.982   18.063  1.894   1.00 0.00 ? 77  LYS A HA   5  
ATOM 7093  H HB2  . LYS A 1 77  ? 9.676   17.204  2.858   1.00 0.00 ? 77  LYS A HB2  5  
ATOM 7094  H HB3  . LYS A 1 77  ? 9.616   18.425  1.603   1.00 0.00 ? 77  LYS A HB3  5  
ATOM 7095  H HG2  . LYS A 1 77  ? 7.722   18.795  3.902   1.00 0.00 ? 77  LYS A HG2  5  
ATOM 7096  H HG3  . LYS A 1 77  ? 9.424   19.005  4.261   1.00 0.00 ? 77  LYS A HG3  5  
ATOM 7097  H HD2  . LYS A 1 77  ? 9.585   20.618  2.307   1.00 0.00 ? 77  LYS A HD2  5  
ATOM 7098  H HD3  . LYS A 1 77  ? 7.852   20.471  2.090   1.00 0.00 ? 77  LYS A HD3  5  
ATOM 7099  H HE2  . LYS A 1 77  ? 7.817   21.088  4.709   1.00 0.00 ? 77  LYS A HE2  5  
ATOM 7100  H HE3  . LYS A 1 77  ? 9.380   21.789  4.336   1.00 0.00 ? 77  LYS A HE3  5  
ATOM 7101  H HZ1  . LYS A 1 77  ? 7.944   23.481  3.879   1.00 0.00 ? 77  LYS A HZ1  5  
ATOM 7102  H HZ2  . LYS A 1 77  ? 8.099   22.831  2.389   1.00 0.00 ? 77  LYS A HZ2  5  
ATOM 7103  H HZ3  . LYS A 1 77  ? 6.768   22.519  3.282   1.00 0.00 ? 77  LYS A HZ3  5  
ATOM 7104  N N    . ALA A 1 78  ? 8.025   15.561  0.209   1.00 0.00 ? 78  ALA A N    5  
ATOM 7105  C CA   . ALA A 1 78  ? 8.167   14.992  -1.120  1.00 0.00 ? 78  ALA A CA   5  
ATOM 7106  C C    . ALA A 1 78  ? 6.825   14.408  -1.566  1.00 0.00 ? 78  ALA A C    5  
ATOM 7107  O O    . ALA A 1 78  ? 6.553   14.310  -2.762  1.00 0.00 ? 78  ALA A O    5  
ATOM 7108  C CB   . ALA A 1 78  ? 9.284   13.946  -1.112  1.00 0.00 ? 78  ALA A CB   5  
ATOM 7109  H H    . ALA A 1 78  ? 8.013   14.895  0.955   1.00 0.00 ? 78  ALA A H    5  
ATOM 7110  H HA   . ALA A 1 78  ? 8.446   15.798  -1.799  1.00 0.00 ? 78  ALA A HA   5  
ATOM 7111  H HB1  . ALA A 1 78  ? 8.847   12.948  -1.087  1.00 0.00 ? 78  ALA A HB1  5  
ATOM 7112  H HB2  . ALA A 1 78  ? 9.890   14.055  -2.011  1.00 0.00 ? 78  ALA A HB2  5  
ATOM 7113  H HB3  . ALA A 1 78  ? 9.910   14.091  -0.231  1.00 0.00 ? 78  ALA A HB3  5  
ATOM 7114  N N    . LEU A 1 79  ? 6.022   14.035  -0.581  1.00 0.00 ? 79  LEU A N    5  
ATOM 7115  C CA   . LEU A 1 79  ? 4.715   13.463  -0.856  1.00 0.00 ? 79  LEU A CA   5  
ATOM 7116  C C    . LEU A 1 79  ? 3.736   14.585  -1.210  1.00 0.00 ? 79  LEU A C    5  
ATOM 7117  O O    . LEU A 1 79  ? 2.687   14.719  -0.582  1.00 0.00 ? 79  LEU A O    5  
ATOM 7118  C CB   . LEU A 1 79  ? 4.254   12.591  0.313   1.00 0.00 ? 79  LEU A CB   5  
ATOM 7119  C CG   . LEU A 1 79  ? 4.566   11.097  0.200   1.00 0.00 ? 79  LEU A CG   5  
ATOM 7120  C CD1  . LEU A 1 79  ? 4.608   10.440  1.581   1.00 0.00 ? 79  LEU A CD1  5  
ATOM 7121  C CD2  . LEU A 1 79  ? 3.578   10.400  -0.737  1.00 0.00 ? 79  LEU A CD2  5  
ATOM 7122  H H    . LEU A 1 79  ? 6.251   14.117  0.389   1.00 0.00 ? 79  LEU A H    5  
ATOM 7123  H HA   . LEU A 1 79  ? 4.820   12.810  -1.723  1.00 0.00 ? 79  LEU A HA   5  
ATOM 7124  H HB2  . LEU A 1 79  ? 4.713   12.970  1.226   1.00 0.00 ? 79  LEU A HB2  5  
ATOM 7125  H HB3  . LEU A 1 79  ? 3.176   12.709  0.426   1.00 0.00 ? 79  LEU A HB3  5  
ATOM 7126  H HG   . LEU A 1 79  ? 5.558   10.988  -0.238  1.00 0.00 ? 79  LEU A HG   5  
ATOM 7127  H HD11 . LEU A 1 79  ? 4.868   11.187  2.331   1.00 0.00 ? 79  LEU A HD11 5  
ATOM 7128  H HD12 . LEU A 1 79  ? 3.630   10.018  1.812   1.00 0.00 ? 79  LEU A HD12 5  
ATOM 7129  H HD13 . LEU A 1 79  ? 5.356   9.647   1.584   1.00 0.00 ? 79  LEU A HD13 5  
ATOM 7130  H HD21 . LEU A 1 79  ? 3.404   11.025  -1.612  1.00 0.00 ? 79  LEU A HD21 5  
ATOM 7131  H HD22 . LEU A 1 79  ? 3.990   9.441   -1.051  1.00 0.00 ? 79  LEU A HD22 5  
ATOM 7132  H HD23 . LEU A 1 79  ? 2.636   10.236  -0.214  1.00 0.00 ? 79  LEU A HD23 5  
ATOM 7133  N N    . LYS A 1 80  ? 4.114   15.362  -2.215  1.00 0.00 ? 80  LYS A N    5  
ATOM 7134  C CA   . LYS A 1 80  ? 3.283   16.467  -2.659  1.00 0.00 ? 80  LYS A CA   5  
ATOM 7135  C C    . LYS A 1 80  ? 3.922   17.118  -3.888  1.00 0.00 ? 80  LYS A C    5  
ATOM 7136  O O    . LYS A 1 80  ? 4.919   16.621  -4.410  1.00 0.00 ? 80  LYS A O    5  
ATOM 7137  C CB   . LYS A 1 80  ? 3.030   17.444  -1.509  1.00 0.00 ? 80  LYS A CB   5  
ATOM 7138  C CG   . LYS A 1 80  ? 4.304   18.212  -1.151  1.00 0.00 ? 80  LYS A CG   5  
ATOM 7139  C CD   . LYS A 1 80  ? 4.404   18.434  0.360   1.00 0.00 ? 80  LYS A CD   5  
ATOM 7140  C CE   . LYS A 1 80  ? 4.085   19.886  0.723   1.00 0.00 ? 80  LYS A CE   5  
ATOM 7141  N NZ   . LYS A 1 80  ? 2.663   20.188  0.448   1.00 0.00 ? 80  LYS A NZ   5  
ATOM 7142  H H    . LYS A 1 80  ? 4.969   15.245  -2.720  1.00 0.00 ? 80  LYS A H    5  
ATOM 7143  H HA   . LYS A 1 80  ? 2.318   16.054  -2.950  1.00 0.00 ? 80  LYS A HA   5  
ATOM 7144  H HB2  . LYS A 1 80  ? 2.244   18.145  -1.788  1.00 0.00 ? 80  LYS A HB2  5  
ATOM 7145  H HB3  . LYS A 1 80  ? 2.673   16.898  -0.635  1.00 0.00 ? 80  LYS A HB3  5  
ATOM 7146  H HG2  . LYS A 1 80  ? 5.176   17.659  -1.500  1.00 0.00 ? 80  LYS A HG2  5  
ATOM 7147  H HG3  . LYS A 1 80  ? 4.309   19.173  -1.665  1.00 0.00 ? 80  LYS A HG3  5  
ATOM 7148  H HD2  . LYS A 1 80  ? 3.714   17.767  0.876   1.00 0.00 ? 80  LYS A HD2  5  
ATOM 7149  H HD3  . LYS A 1 80  ? 5.408   18.182  0.702   1.00 0.00 ? 80  LYS A HD3  5  
ATOM 7150  H HE2  . LYS A 1 80  ? 4.303   20.060  1.776   1.00 0.00 ? 80  LYS A HE2  5  
ATOM 7151  H HE3  . LYS A 1 80  ? 4.723   20.559  0.150   1.00 0.00 ? 80  LYS A HE3  5  
ATOM 7152  H HZ1  . LYS A 1 80  ? 2.107   19.922  1.235   1.00 0.00 ? 80  LYS A HZ1  5  
ATOM 7153  H HZ2  . LYS A 1 80  ? 2.557   21.169  0.281   1.00 0.00 ? 80  LYS A HZ2  5  
ATOM 7154  H HZ3  . LYS A 1 80  ? 2.363   19.679  -0.359  1.00 0.00 ? 80  LYS A HZ3  5  
ATOM 7155  N N    . GLY A 1 81  ? 3.322   18.219  -4.315  1.00 0.00 ? 81  GLY A N    5  
ATOM 7156  C CA   . GLY A 1 81  ? 3.819   18.942  -5.472  1.00 0.00 ? 81  GLY A CA   5  
ATOM 7157  C C    . GLY A 1 81  ? 4.094   17.990  -6.638  1.00 0.00 ? 81  GLY A C    5  
ATOM 7158  O O    . GLY A 1 81  ? 3.701   16.825  -6.598  1.00 0.00 ? 81  GLY A O    5  
ATOM 7159  H H    . GLY A 1 81  ? 2.511   18.616  -3.884  1.00 0.00 ? 81  GLY A H    5  
ATOM 7160  H HA2  . GLY A 1 81  ? 3.091   19.695  -5.776  1.00 0.00 ? 81  GLY A HA2  5  
ATOM 7161  H HA3  . GLY A 1 81  ? 4.734   19.473  -5.208  1.00 0.00 ? 81  GLY A HA3  5  
ATOM 7162  N N    . SER A 1 82  ? 4.766   18.521  -7.648  1.00 0.00 ? 82  SER A N    5  
ATOM 7163  C CA   . SER A 1 82  ? 5.098   17.732  -8.823  1.00 0.00 ? 82  SER A CA   5  
ATOM 7164  C C    . SER A 1 82  ? 3.855   16.998  -9.328  1.00 0.00 ? 82  SER A C    5  
ATOM 7165  O O    . SER A 1 82  ? 3.521   15.922  -8.835  1.00 0.00 ? 82  SER A O    5  
ATOM 7166  C CB   . SER A 1 82  ? 6.217   16.734  -8.518  1.00 0.00 ? 82  SER A CB   5  
ATOM 7167  O OG   . SER A 1 82  ? 7.082   16.545  -9.634  1.00 0.00 ? 82  SER A OG   5  
ATOM 7168  H H    . SER A 1 82  ? 5.083   19.469  -7.673  1.00 0.00 ? 82  SER A H    5  
ATOM 7169  H HA   . SER A 1 82  ? 5.446   18.451  -9.564  1.00 0.00 ? 82  SER A HA   5  
ATOM 7170  H HB2  . SER A 1 82  ? 6.796   17.088  -7.665  1.00 0.00 ? 82  SER A HB2  5  
ATOM 7171  H HB3  . SER A 1 82  ? 5.781   15.777  -8.232  1.00 0.00 ? 82  SER A HB3  5  
ATOM 7172  H HG   . SER A 1 82  ? 7.127   15.575  -9.873  1.00 0.00 ? 82  SER A HG   5  
ATOM 7173  N N    . LYS A 1 83  ? 3.202   17.610  -10.306 1.00 0.00 ? 83  LYS A N    5  
ATOM 7174  C CA   . LYS A 1 83  ? 2.003   17.027  -10.884 1.00 0.00 ? 83  LYS A CA   5  
ATOM 7175  C C    . LYS A 1 83  ? 2.205   15.521  -11.057 1.00 0.00 ? 83  LYS A C    5  
ATOM 7176  O O    . LYS A 1 83  ? 3.334   15.054  -11.194 1.00 0.00 ? 83  LYS A O    5  
ATOM 7177  C CB   . LYS A 1 83  ? 1.627   17.750  -12.179 1.00 0.00 ? 83  LYS A CB   5  
ATOM 7178  C CG   . LYS A 1 83  ? 2.690   17.531  -13.257 1.00 0.00 ? 83  LYS A CG   5  
ATOM 7179  C CD   . LYS A 1 83  ? 2.108   16.777  -14.455 1.00 0.00 ? 83  LYS A CD   5  
ATOM 7180  C CE   . LYS A 1 83  ? 3.214   16.344  -15.420 1.00 0.00 ? 83  LYS A CE   5  
ATOM 7181  N NZ   . LYS A 1 83  ? 3.144   17.129  -16.673 1.00 0.00 ? 83  LYS A NZ   5  
ATOM 7182  H H    . LYS A 1 83  ? 3.480   18.485  -10.702 1.00 0.00 ? 83  LYS A H    5  
ATOM 7183  H HA   . LYS A 1 83  ? 1.189   17.188  -10.177 1.00 0.00 ? 83  LYS A HA   5  
ATOM 7184  H HB2  . LYS A 1 83  ? 0.662   17.389  -12.535 1.00 0.00 ? 83  LYS A HB2  5  
ATOM 7185  H HB3  . LYS A 1 83  ? 1.515   18.817  -11.985 1.00 0.00 ? 83  LYS A HB3  5  
ATOM 7186  H HG2  . LYS A 1 83  ? 3.084   18.493  -13.585 1.00 0.00 ? 83  LYS A HG2  5  
ATOM 7187  H HG3  . LYS A 1 83  ? 3.526   16.970  -12.840 1.00 0.00 ? 83  LYS A HG3  5  
ATOM 7188  H HD2  . LYS A 1 83  ? 1.561   15.901  -14.107 1.00 0.00 ? 83  LYS A HD2  5  
ATOM 7189  H HD3  . LYS A 1 83  ? 1.393   17.412  -14.977 1.00 0.00 ? 83  LYS A HD3  5  
ATOM 7190  H HE2  . LYS A 1 83  ? 4.188   16.482  -14.951 1.00 0.00 ? 83  LYS A HE2  5  
ATOM 7191  H HE3  . LYS A 1 83  ? 3.115   15.282  -15.643 1.00 0.00 ? 83  LYS A HE3  5  
ATOM 7192  H HZ1  . LYS A 1 83  ? 2.623   17.967  -16.513 1.00 0.00 ? 83  LYS A HZ1  5  
ATOM 7193  H HZ2  . LYS A 1 83  ? 4.070   17.364  -16.971 1.00 0.00 ? 83  LYS A HZ2  5  
ATOM 7194  H HZ3  . LYS A 1 83  ? 2.694   16.585  -17.382 1.00 0.00 ? 83  LYS A HZ3  5  
ATOM 7195  N N    . LYS A 1 84  ? 1.092   14.802  -11.044 1.00 0.00 ? 84  LYS A N    5  
ATOM 7196  C CA   . LYS A 1 84  ? 1.133   13.357  -11.198 1.00 0.00 ? 84  LYS A CA   5  
ATOM 7197  C C    . LYS A 1 84  ? 2.011   12.756  -10.099 1.00 0.00 ? 84  LYS A C    5  
ATOM 7198  O O    . LYS A 1 84  ? 3.214   12.582  -10.287 1.00 0.00 ? 84  LYS A O    5  
ATOM 7199  C CB   . LYS A 1 84  ? 1.575   12.981  -12.613 1.00 0.00 ? 84  LYS A CB   5  
ATOM 7200  C CG   . LYS A 1 84  ? 0.994   11.628  -13.028 1.00 0.00 ? 84  LYS A CG   5  
ATOM 7201  C CD   . LYS A 1 84  ? 1.549   11.185  -14.383 1.00 0.00 ? 84  LYS A CD   5  
ATOM 7202  C CE   . LYS A 1 84  ? 0.530   10.331  -15.141 1.00 0.00 ? 84  LYS A CE   5  
ATOM 7203  N NZ   . LYS A 1 84  ? 1.218   9.387   -16.049 1.00 0.00 ? 84  LYS A NZ   5  
ATOM 7204  H H    . LYS A 1 84  ? 0.177   15.189  -10.932 1.00 0.00 ? 84  LYS A H    5  
ATOM 7205  H HA   . LYS A 1 84  ? 0.116   12.986  -11.069 1.00 0.00 ? 84  LYS A HA   5  
ATOM 7206  H HB2  . LYS A 1 84  ? 1.253   13.750  -13.316 1.00 0.00 ? 84  LYS A HB2  5  
ATOM 7207  H HB3  . LYS A 1 84  ? 2.663   12.943  -12.660 1.00 0.00 ? 84  LYS A HB3  5  
ATOM 7208  H HG2  . LYS A 1 84  ? 1.230   10.880  -12.272 1.00 0.00 ? 84  LYS A HG2  5  
ATOM 7209  H HG3  . LYS A 1 84  ? -0.093  11.696  -13.081 1.00 0.00 ? 84  LYS A HG3  5  
ATOM 7210  H HD2  . LYS A 1 84  ? 1.808   12.061  -14.978 1.00 0.00 ? 84  LYS A HD2  5  
ATOM 7211  H HD3  . LYS A 1 84  ? 2.467   10.617  -14.236 1.00 0.00 ? 84  LYS A HD3  5  
ATOM 7212  H HE2  . LYS A 1 84  ? -0.089  9.780   -14.433 1.00 0.00 ? 84  LYS A HE2  5  
ATOM 7213  H HE3  . LYS A 1 84  ? -0.138  10.975  -15.714 1.00 0.00 ? 84  LYS A HE3  5  
ATOM 7214  H HZ1  . LYS A 1 84  ? 1.978   8.953   -15.564 1.00 0.00 ? 84  LYS A HZ1  5  
ATOM 7215  H HZ2  . LYS A 1 84  ? 0.573   8.686   -16.352 1.00 0.00 ? 84  LYS A HZ2  5  
ATOM 7216  H HZ3  . LYS A 1 84  ? 1.569   9.883   -16.843 1.00 0.00 ? 84  LYS A HZ3  5  
ATOM 7217  N N    . LEU A 1 85  ? 1.376   12.457  -8.975  1.00 0.00 ? 85  LEU A N    5  
ATOM 7218  C CA   . LEU A 1 85  ? 2.085   11.879  -7.846  1.00 0.00 ? 85  LEU A CA   5  
ATOM 7219  C C    . LEU A 1 85  ? 2.004   10.353  -7.925  1.00 0.00 ? 85  LEU A C    5  
ATOM 7220  O O    . LEU A 1 85  ? 0.973   9.765   -7.604  1.00 0.00 ? 85  LEU A O    5  
ATOM 7221  C CB   . LEU A 1 85  ? 1.558   12.455  -6.531  1.00 0.00 ? 85  LEU A CB   5  
ATOM 7222  C CG   . LEU A 1 85  ? 2.099   11.812  -5.252  1.00 0.00 ? 85  LEU A CG   5  
ATOM 7223  C CD1  . LEU A 1 85  ? 3.564   11.405  -5.421  1.00 0.00 ? 85  LEU A CD1  5  
ATOM 7224  C CD2  . LEU A 1 85  ? 1.894   12.732  -4.047  1.00 0.00 ? 85  LEU A CD2  5  
ATOM 7225  H H    . LEU A 1 85  ? 0.398   12.602  -8.830  1.00 0.00 ? 85  LEU A H    5  
ATOM 7226  H HA   . LEU A 1 85  ? 3.131   12.174  -7.931  1.00 0.00 ? 85  LEU A HA   5  
ATOM 7227  H HB2  . LEU A 1 85  ? 1.790   13.520  -6.505  1.00 0.00 ? 85  LEU A HB2  5  
ATOM 7228  H HB3  . LEU A 1 85  ? 0.471   12.366  -6.527  1.00 0.00 ? 85  LEU A HB3  5  
ATOM 7229  H HG   . LEU A 1 85  ? 1.531   10.901  -5.061  1.00 0.00 ? 85  LEU A HG   5  
ATOM 7230  H HD11 . LEU A 1 85  ? 4.131   12.245  -5.821  1.00 0.00 ? 85  LEU A HD11 5  
ATOM 7231  H HD12 . LEU A 1 85  ? 3.974   11.117  -4.453  1.00 0.00 ? 85  LEU A HD12 5  
ATOM 7232  H HD13 . LEU A 1 85  ? 3.630   10.562  -6.108  1.00 0.00 ? 85  LEU A HD13 5  
ATOM 7233  H HD21 . LEU A 1 85  ? 2.287   13.723  -4.276  1.00 0.00 ? 85  LEU A HD21 5  
ATOM 7234  H HD22 . LEU A 1 85  ? 0.830   12.806  -3.822  1.00 0.00 ? 85  LEU A HD22 5  
ATOM 7235  H HD23 . LEU A 1 85  ? 2.420   12.323  -3.184  1.00 0.00 ? 85  LEU A HD23 5  
ATOM 7236  N N    . VAL A 1 86  ? 3.106   9.755   -8.356  1.00 0.00 ? 86  VAL A N    5  
ATOM 7237  C CA   . VAL A 1 86  ? 3.173   8.309   -8.481  1.00 0.00 ? 86  VAL A CA   5  
ATOM 7238  C C    . VAL A 1 86  ? 3.781   7.719   -7.208  1.00 0.00 ? 86  VAL A C    5  
ATOM 7239  O O    . VAL A 1 86  ? 4.987   7.821   -6.987  1.00 0.00 ? 86  VAL A O    5  
ATOM 7240  C CB   . VAL A 1 86  ? 3.946   7.929   -9.745  1.00 0.00 ? 86  VAL A CB   5  
ATOM 7241  C CG1  . VAL A 1 86  ? 4.319   6.445   -9.734  1.00 0.00 ? 86  VAL A CG1  5  
ATOM 7242  C CG2  . VAL A 1 86  ? 3.150   8.285   -11.003 1.00 0.00 ? 86  VAL A CG2  5  
ATOM 7243  H H    . VAL A 1 86  ? 3.941   10.241  -8.615  1.00 0.00 ? 86  VAL A H    5  
ATOM 7244  H HA   . VAL A 1 86  ? 2.152   7.941   -8.586  1.00 0.00 ? 86  VAL A HA   5  
ATOM 7245  H HB   . VAL A 1 86  ? 4.870   8.507   -9.760  1.00 0.00 ? 86  VAL A HB   5  
ATOM 7246  H HG11 . VAL A 1 86  ? 4.271   6.051   -10.749 1.00 0.00 ? 86  VAL A HG11 5  
ATOM 7247  H HG12 . VAL A 1 86  ? 5.331   6.328   -9.346  1.00 0.00 ? 86  VAL A HG12 5  
ATOM 7248  H HG13 . VAL A 1 86  ? 3.621   5.900   -9.099  1.00 0.00 ? 86  VAL A HG13 5  
ATOM 7249  H HG21 . VAL A 1 86  ? 3.505   9.236   -11.400 1.00 0.00 ? 86  VAL A HG21 5  
ATOM 7250  H HG22 . VAL A 1 86  ? 3.286   7.505   -11.752 1.00 0.00 ? 86  VAL A HG22 5  
ATOM 7251  H HG23 . VAL A 1 86  ? 2.092   8.367   -10.752 1.00 0.00 ? 86  VAL A HG23 5  
ATOM 7252  N N    . LEU A 1 87  ? 2.920   7.114   -6.403  1.00 0.00 ? 87  LEU A N    5  
ATOM 7253  C CA   . LEU A 1 87  ? 3.357   6.507   -5.158  1.00 0.00 ? 87  LEU A CA   5  
ATOM 7254  C C    . LEU A 1 87  ? 3.982   5.142   -5.453  1.00 0.00 ? 87  LEU A C    5  
ATOM 7255  O O    . LEU A 1 87  ? 3.376   4.311   -6.127  1.00 0.00 ? 87  LEU A O    5  
ATOM 7256  C CB   . LEU A 1 87  ? 2.204   6.452   -4.154  1.00 0.00 ? 87  LEU A CB   5  
ATOM 7257  C CG   . LEU A 1 87  ? 1.457   7.767   -3.917  1.00 0.00 ? 87  LEU A CG   5  
ATOM 7258  C CD1  . LEU A 1 87  ? 2.427   8.949   -3.883  1.00 0.00 ? 87  LEU A CD1  5  
ATOM 7259  C CD2  . LEU A 1 87  ? 0.350   7.963   -4.955  1.00 0.00 ? 87  LEU A CD2  5  
ATOM 7260  H H    . LEU A 1 87  ? 1.940   7.036   -6.590  1.00 0.00 ? 87  LEU A H    5  
ATOM 7261  H HA   . LEU A 1 87  ? 4.125   7.153   -4.731  1.00 0.00 ? 87  LEU A HA   5  
ATOM 7262  H HB2  . LEU A 1 87  ? 1.486   5.706   -4.496  1.00 0.00 ? 87  LEU A HB2  5  
ATOM 7263  H HB3  . LEU A 1 87  ? 2.596   6.103   -3.199  1.00 0.00 ? 87  LEU A HB3  5  
ATOM 7264  H HG   . LEU A 1 87  ? 0.977   7.716   -2.940  1.00 0.00 ? 87  LEU A HG   5  
ATOM 7265  H HD11 . LEU A 1 87  ? 2.705   9.221   -4.901  1.00 0.00 ? 87  LEU A HD11 5  
ATOM 7266  H HD12 . LEU A 1 87  ? 1.947   9.799   -3.398  1.00 0.00 ? 87  LEU A HD12 5  
ATOM 7267  H HD13 . LEU A 1 87  ? 3.321   8.671   -3.324  1.00 0.00 ? 87  LEU A HD13 5  
ATOM 7268  H HD21 . LEU A 1 87  ? -0.442  8.578   -4.529  1.00 0.00 ? 87  LEU A HD21 5  
ATOM 7269  H HD22 . LEU A 1 87  ? 0.761   8.458   -5.835  1.00 0.00 ? 87  LEU A HD22 5  
ATOM 7270  H HD23 . LEU A 1 87  ? -0.057  6.993   -5.240  1.00 0.00 ? 87  LEU A HD23 5  
ATOM 7271  N N    . SER A 1 88  ? 5.186   4.953   -4.933  1.00 0.00 ? 88  SER A N    5  
ATOM 7272  C CA   . SER A 1 88  ? 5.899   3.703   -5.132  1.00 0.00 ? 88  SER A CA   5  
ATOM 7273  C C    . SER A 1 88  ? 5.822   2.849   -3.865  1.00 0.00 ? 88  SER A C    5  
ATOM 7274  O O    . SER A 1 88  ? 6.546   3.095   -2.901  1.00 0.00 ? 88  SER A O    5  
ATOM 7275  C CB   . SER A 1 88  ? 7.359   3.956   -5.513  1.00 0.00 ? 88  SER A CB   5  
ATOM 7276  O OG   . SER A 1 88  ? 7.516   4.167   -6.914  1.00 0.00 ? 88  SER A OG   5  
ATOM 7277  H H    . SER A 1 88  ? 5.672   5.634   -4.385  1.00 0.00 ? 88  SER A H    5  
ATOM 7278  H HA   . SER A 1 88  ? 5.389   3.208   -5.958  1.00 0.00 ? 88  SER A HA   5  
ATOM 7279  H HB2  . SER A 1 88  ? 7.729   4.827   -4.972  1.00 0.00 ? 88  SER A HB2  5  
ATOM 7280  H HB3  . SER A 1 88  ? 7.967   3.106   -5.204  1.00 0.00 ? 88  SER A HB3  5  
ATOM 7281  H HG   . SER A 1 88  ? 8.119   4.948   -7.076  1.00 0.00 ? 88  SER A HG   5  
ATOM 7282  N N    . VAL A 1 89  ? 4.938   1.863   -3.907  1.00 0.00 ? 89  VAL A N    5  
ATOM 7283  C CA   . VAL A 1 89  ? 4.757   0.971   -2.774  1.00 0.00 ? 89  VAL A CA   5  
ATOM 7284  C C    . VAL A 1 89  ? 5.212   -0.437  -3.161  1.00 0.00 ? 89  VAL A C    5  
ATOM 7285  O O    . VAL A 1 89  ? 5.134   -0.820  -4.327  1.00 0.00 ? 89  VAL A O    5  
ATOM 7286  C CB   . VAL A 1 89  ? 3.303   1.020   -2.297  1.00 0.00 ? 89  VAL A CB   5  
ATOM 7287  C CG1  . VAL A 1 89  ? 3.136   2.019   -1.151  1.00 0.00 ? 89  VAL A CG1  5  
ATOM 7288  C CG2  . VAL A 1 89  ? 2.357   1.347   -3.454  1.00 0.00 ? 89  VAL A CG2  5  
ATOM 7289  H H    . VAL A 1 89  ? 4.353   1.670   -4.695  1.00 0.00 ? 89  VAL A H    5  
ATOM 7290  H HA   . VAL A 1 89  ? 5.390   1.335   -1.965  1.00 0.00 ? 89  VAL A HA   5  
ATOM 7291  H HB   . VAL A 1 89  ? 3.041   0.031   -1.920  1.00 0.00 ? 89  VAL A HB   5  
ATOM 7292  H HG11 . VAL A 1 89  ? 3.153   3.034   -1.549  1.00 0.00 ? 89  VAL A HG11 5  
ATOM 7293  H HG12 . VAL A 1 89  ? 2.184   1.842   -0.650  1.00 0.00 ? 89  VAL A HG12 5  
ATOM 7294  H HG13 . VAL A 1 89  ? 3.950   1.895   -0.438  1.00 0.00 ? 89  VAL A HG13 5  
ATOM 7295  H HG21 . VAL A 1 89  ? 1.342   1.053   -3.187  1.00 0.00 ? 89  VAL A HG21 5  
ATOM 7296  H HG22 . VAL A 1 89  ? 2.384   2.419   -3.653  1.00 0.00 ? 89  VAL A HG22 5  
ATOM 7297  H HG23 . VAL A 1 89  ? 2.671   0.804   -4.345  1.00 0.00 ? 89  VAL A HG23 5  
ATOM 7298  N N    . TYR A 1 90  ? 5.678   -1.170  -2.161  1.00 0.00 ? 90  TYR A N    5  
ATOM 7299  C CA   . TYR A 1 90  ? 6.146   -2.528  -2.382  1.00 0.00 ? 90  TYR A CA   5  
ATOM 7300  C C    . TYR A 1 90  ? 4.971   -3.497  -2.521  1.00 0.00 ? 90  TYR A C    5  
ATOM 7301  O O    . TYR A 1 90  ? 4.117   -3.575  -1.639  1.00 0.00 ? 90  TYR A O    5  
ATOM 7302  C CB   . TYR A 1 90  ? 6.956   -2.902  -1.139  1.00 0.00 ? 90  TYR A CB   5  
ATOM 7303  C CG   . TYR A 1 90  ? 7.415   -4.362  -1.111  1.00 0.00 ? 90  TYR A CG   5  
ATOM 7304  C CD1  . TYR A 1 90  ? 7.511   -5.077  -2.288  1.00 0.00 ? 90  TYR A CD1  5  
ATOM 7305  C CD2  . TYR A 1 90  ? 7.732   -4.963  0.090   1.00 0.00 ? 90  TYR A CD2  5  
ATOM 7306  C CE1  . TYR A 1 90  ? 7.942   -6.450  -2.262  1.00 0.00 ? 90  TYR A CE1  5  
ATOM 7307  C CE2  . TYR A 1 90  ? 8.164   -6.336  0.115   1.00 0.00 ? 90  TYR A CE2  5  
ATOM 7308  C CZ   . TYR A 1 90  ? 8.248   -7.012  -1.062  1.00 0.00 ? 90  TYR A CZ   5  
ATOM 7309  O OH   . TYR A 1 90  ? 8.655   -8.309  -1.038  1.00 0.00 ? 90  TYR A OH   5  
ATOM 7310  H H    . TYR A 1 90  ? 5.739   -0.851  -1.215  1.00 0.00 ? 90  TYR A H    5  
ATOM 7311  H HA   . TYR A 1 90  ? 6.727   -2.537  -3.304  1.00 0.00 ? 90  TYR A HA   5  
ATOM 7312  H HB2  . TYR A 1 90  ? 7.831   -2.256  -1.079  1.00 0.00 ? 90  TYR A HB2  5  
ATOM 7313  H HB3  . TYR A 1 90  ? 6.353   -2.705  -0.252  1.00 0.00 ? 90  TYR A HB3  5  
ATOM 7314  H HD1  . TYR A 1 90  ? 7.260   -4.602  -3.236  1.00 0.00 ? 90  TYR A HD1  5  
ATOM 7315  H HD2  . TYR A 1 90  ? 7.656   -4.398  1.019   1.00 0.00 ? 90  TYR A HD2  5  
ATOM 7316  H HE1  . TYR A 1 90  ? 8.023   -7.027  -3.184  1.00 0.00 ? 90  TYR A HE1  5  
ATOM 7317  H HE2  . TYR A 1 90  ? 8.418   -6.823  1.057   1.00 0.00 ? 90  TYR A HE2  5  
ATOM 7318  H HH   . TYR A 1 90  ? 9.130   -8.535  -1.888  1.00 0.00 ? 90  TYR A HH   5  
ATOM 7319  N N    . SER A 1 91  ? 4.964   -4.212  -3.637  1.00 0.00 ? 91  SER A N    5  
ATOM 7320  C CA   . SER A 1 91  ? 3.907   -5.173  -3.903  1.00 0.00 ? 91  SER A CA   5  
ATOM 7321  C C    . SER A 1 91  ? 4.431   -6.596  -3.700  1.00 0.00 ? 91  SER A C    5  
ATOM 7322  O O    . SER A 1 91  ? 5.569   -6.899  -4.055  1.00 0.00 ? 91  SER A O    5  
ATOM 7323  C CB   . SER A 1 91  ? 3.357   -5.007  -5.321  1.00 0.00 ? 91  SER A CB   5  
ATOM 7324  O OG   . SER A 1 91  ? 4.385   -5.088  -6.306  1.00 0.00 ? 91  SER A OG   5  
ATOM 7325  H H    . SER A 1 91  ? 5.662   -4.143  -4.350  1.00 0.00 ? 91  SER A H    5  
ATOM 7326  H HA   . SER A 1 91  ? 3.123   -4.947  -3.181  1.00 0.00 ? 91  SER A HA   5  
ATOM 7327  H HB2  . SER A 1 91  ? 2.610   -5.778  -5.513  1.00 0.00 ? 91  SER A HB2  5  
ATOM 7328  H HB3  . SER A 1 91  ? 2.851   -4.046  -5.404  1.00 0.00 ? 91  SER A HB3  5  
ATOM 7329  H HG   . SER A 1 91  ? 3.980   -5.150  -7.218  1.00 0.00 ? 91  SER A HG   5  
ATOM 7330  N N    . ALA A 1 92  ? 3.575   -7.431  -3.129  1.00 0.00 ? 92  ALA A N    5  
ATOM 7331  C CA   . ALA A 1 92  ? 3.937   -8.815  -2.874  1.00 0.00 ? 92  ALA A CA   5  
ATOM 7332  C C    . ALA A 1 92  ? 2.828   -9.732  -3.394  1.00 0.00 ? 92  ALA A C    5  
ATOM 7333  O O    . ALA A 1 92  ? 1.848   -9.262  -3.971  1.00 0.00 ? 92  ALA A O    5  
ATOM 7334  C CB   . ALA A 1 92  ? 4.199   -9.007  -1.379  1.00 0.00 ? 92  ALA A CB   5  
ATOM 7335  H H    . ALA A 1 92  ? 2.651   -7.176  -2.843  1.00 0.00 ? 92  ALA A H    5  
ATOM 7336  H HA   . ALA A 1 92  ? 4.856   -9.024  -3.421  1.00 0.00 ? 92  ALA A HA   5  
ATOM 7337  H HB1  . ALA A 1 92  ? 5.274   -9.031  -1.199  1.00 0.00 ? 92  ALA A HB1  5  
ATOM 7338  H HB2  . ALA A 1 92  ? 3.756   -8.181  -0.823  1.00 0.00 ? 92  ALA A HB2  5  
ATOM 7339  H HB3  . ALA A 1 92  ? 3.754   -9.946  -1.050  1.00 0.00 ? 92  ALA A HB3  5  
ATOM 7340  N N    . GLY A 1 93  ? 3.019   -11.024 -3.172  1.00 0.00 ? 93  GLY A N    5  
ATOM 7341  C CA   . GLY A 1 93  ? 2.047   -12.011 -3.610  1.00 0.00 ? 93  GLY A CA   5  
ATOM 7342  C C    . GLY A 1 93  ? 0.664   -11.714 -3.029  1.00 0.00 ? 93  GLY A C    5  
ATOM 7343  O O    . GLY A 1 93  ? -0.142  -11.027 -3.655  1.00 0.00 ? 93  GLY A O    5  
ATOM 7344  H H    . GLY A 1 93  ? 3.819   -11.398 -2.702  1.00 0.00 ? 93  GLY A H    5  
ATOM 7345  H HA2  . GLY A 1 93  ? 1.995   -12.016 -4.699  1.00 0.00 ? 93  GLY A HA2  5  
ATOM 7346  H HA3  . GLY A 1 93  ? 2.369   -13.006 -3.303  1.00 0.00 ? 93  GLY A HA3  5  
ATOM 7347  N N    . ARG A 1 94  ? 0.431   -12.247 -1.839  1.00 0.00 ? 94  ARG A N    5  
ATOM 7348  C CA   . ARG A 1 94  ? -0.842  -12.048 -1.166  1.00 0.00 ? 94  ARG A CA   5  
ATOM 7349  C C    . ARG A 1 94  ? -1.191  -10.559 -1.120  1.00 0.00 ? 94  ARG A C    5  
ATOM 7350  O O    . ARG A 1 94  ? -0.370  -9.737  -0.716  1.00 0.00 ? 94  ARG A O    5  
ATOM 7351  C CB   . ARG A 1 94  ? -0.802  -12.599 0.261   1.00 0.00 ? 94  ARG A CB   5  
ATOM 7352  C CG   . ARG A 1 94  ? -2.035  -13.458 0.551   1.00 0.00 ? 94  ARG A CG   5  
ATOM 7353  C CD   . ARG A 1 94  ? -3.262  -12.584 0.818   1.00 0.00 ? 94  ARG A CD   5  
ATOM 7354  N NE   . ARG A 1 94  ? -4.177  -13.271 1.757   1.00 0.00 ? 94  ARG A NE   5  
ATOM 7355  C CZ   . ARG A 1 94  ? -3.953  -13.388 3.073   1.00 0.00 ? 94  ARG A CZ   5  
ATOM 7356  N NH1  . ARG A 1 94  ? -2.843  -12.867 3.613   1.00 0.00 ? 94  ARG A NH1  5  
ATOM 7357  N NH2  . ARG A 1 94  ? -4.839  -14.028 3.849   1.00 0.00 ? 94  ARG A NH2  5  
ATOM 7358  H H    . ARG A 1 94  ? 1.091   -12.805 -1.336  1.00 0.00 ? 94  ARG A H    5  
ATOM 7359  H HA   . ARG A 1 94  ? -1.564  -12.602 -1.765  1.00 0.00 ? 94  ARG A HA   5  
ATOM 7360  H HB2  . ARG A 1 94  ? 0.101   -13.193 0.401   1.00 0.00 ? 94  ARG A HB2  5  
ATOM 7361  H HB3  . ARG A 1 94  ? -0.754  -11.774 0.972   1.00 0.00 ? 94  ARG A HB3  5  
ATOM 7362  H HG2  . ARG A 1 94  ? -2.230  -14.117 -0.295  1.00 0.00 ? 94  ARG A HG2  5  
ATOM 7363  H HG3  . ARG A 1 94  ? -1.843  -14.096 1.414   1.00 0.00 ? 94  ARG A HG3  5  
ATOM 7364  H HD2  . ARG A 1 94  ? -2.952  -11.626 1.234   1.00 0.00 ? 94  ARG A HD2  5  
ATOM 7365  H HD3  . ARG A 1 94  ? -3.779  -12.374 -0.118  1.00 0.00 ? 94  ARG A HD3  5  
ATOM 7366  H HE   . ARG A 1 94  ? -5.015  -13.671 1.387   1.00 0.00 ? 94  ARG A HE   5  
ATOM 7367  H HH11 . ARG A 1 94  ? -2.182  -12.390 3.034   1.00 0.00 ? 94  ARG A HH11 5  
ATOM 7368  H HH12 . ARG A 1 94  ? -2.676  -12.955 4.595   1.00 0.00 ? 94  ARG A HH12 5  
ATOM 7369  H HH21 . ARG A 1 94  ? -5.667  -14.417 3.446   1.00 0.00 ? 94  ARG A HH21 5  
ATOM 7370  H HH22 . ARG A 1 94  ? -4.672  -14.116 4.831   1.00 0.00 ? 94  ARG A HH22 5  
ATOM 7371  N N    . ILE A 1 95  ? -2.410  -10.256 -1.541  1.00 0.00 ? 95  ILE A N    5  
ATOM 7372  C CA   . ILE A 1 95  ? -2.878  -8.881  -1.554  1.00 0.00 ? 95  ILE A CA   5  
ATOM 7373  C C    . ILE A 1 95  ? -4.364  -8.849  -1.190  1.00 0.00 ? 95  ILE A C    5  
ATOM 7374  O O    . ILE A 1 95  ? -5.074  -9.836  -1.375  1.00 0.00 ? 95  ILE A O    5  
ATOM 7375  C CB   . ILE A 1 95  ? -2.560  -8.219  -2.896  1.00 0.00 ? 95  ILE A CB   5  
ATOM 7376  C CG1  . ILE A 1 95  ? -2.954  -9.127  -4.063  1.00 0.00 ? 95  ILE A CG1  5  
ATOM 7377  C CG2  . ILE A 1 95  ? -1.089  -7.801  -2.966  1.00 0.00 ? 95  ILE A CG2  5  
ATOM 7378  C CD1  . ILE A 1 95  ? -3.959  -8.432  -4.983  1.00 0.00 ? 95  ILE A CD1  5  
ATOM 7379  H H    . ILE A 1 95  ? -3.072  -10.931 -1.869  1.00 0.00 ? 95  ILE A H    5  
ATOM 7380  H HA   . ILE A 1 95  ? -2.323  -8.340  -0.788  1.00 0.00 ? 95  ILE A HA   5  
ATOM 7381  H HB   . ILE A 1 95  ? -3.157  -7.311  -2.979  1.00 0.00 ? 95  ILE A HB   5  
ATOM 7382  H HG12 . ILE A 1 95  ? -2.065  -9.402  -4.631  1.00 0.00 ? 95  ILE A HG12 5  
ATOM 7383  H HG13 . ILE A 1 95  ? -3.385  -10.052 -3.679  1.00 0.00 ? 95  ILE A HG13 5  
ATOM 7384  H HG21 . ILE A 1 95  ? -0.885  -7.354  -3.939  1.00 0.00 ? 95  ILE A HG21 5  
ATOM 7385  H HG22 . ILE A 1 95  ? -0.880  -7.074  -2.181  1.00 0.00 ? 95  ILE A HG22 5  
ATOM 7386  H HG23 . ILE A 1 95  ? -0.456  -8.677  -2.828  1.00 0.00 ? 95  ILE A HG23 5  
ATOM 7387  H HD11 . ILE A 1 95  ? -3.740  -7.365  -5.022  1.00 0.00 ? 95  ILE A HD11 5  
ATOM 7388  H HD12 . ILE A 1 95  ? -3.887  -8.855  -5.985  1.00 0.00 ? 95  ILE A HD12 5  
ATOM 7389  H HD13 . ILE A 1 95  ? -4.968  -8.582  -4.598  1.00 0.00 ? 95  ILE A HD13 5  
ATOM 7390  N N    . SER A 1 96  ? -4.790  -7.703  -0.678  1.00 0.00 ? 96  SER A N    5  
ATOM 7391  C CA   . SER A 1 96  ? -6.178  -7.530  -0.286  1.00 0.00 ? 96  SER A CA   5  
ATOM 7392  C C    . SER A 1 96  ? -6.558  -8.570  0.769   1.00 0.00 ? 96  SER A C    5  
ATOM 7393  O O    . SER A 1 96  ? -6.600  -9.765  0.481   1.00 0.00 ? 96  SER A O    5  
ATOM 7394  C CB   . SER A 1 96  ? -7.110  -7.635  -1.495  1.00 0.00 ? 96  SER A CB   5  
ATOM 7395  O OG   . SER A 1 96  ? -8.048  -6.564  -1.542  1.00 0.00 ? 96  SER A OG   5  
ATOM 7396  H H    . SER A 1 96  ? -4.206  -6.905  -0.530  1.00 0.00 ? 96  SER A H    5  
ATOM 7397  H HA   . SER A 1 96  ? -6.237  -6.524  0.131   1.00 0.00 ? 96  SER A HA   5  
ATOM 7398  H HB2  . SER A 1 96  ? -6.517  -7.638  -2.410  1.00 0.00 ? 96  SER A HB2  5  
ATOM 7399  H HB3  . SER A 1 96  ? -7.644  -8.584  -1.459  1.00 0.00 ? 96  SER A HB3  5  
ATOM 7400  H HG   . SER A 1 96  ? -8.749  -6.692  -0.840  1.00 0.00 ? 96  SER A HG   5  
ATOM 7401  N N    . GLY A 1 97  ? -6.826  -8.079  1.970   1.00 0.00 ? 97  GLY A N    5  
ATOM 7402  C CA   . GLY A 1 97  ? -7.202  -8.951  3.070   1.00 0.00 ? 97  GLY A CA   5  
ATOM 7403  C C    . GLY A 1 97  ? -8.680  -9.336  2.985   1.00 0.00 ? 97  GLY A C    5  
ATOM 7404  O O    . GLY A 1 97  ? -9.268  -9.322  1.904   1.00 0.00 ? 97  GLY A O    5  
ATOM 7405  H H    . GLY A 1 97  ? -6.790  -7.105  2.197   1.00 0.00 ? 97  GLY A H    5  
ATOM 7406  H HA2  . GLY A 1 97  ? -6.587  -9.851  3.051   1.00 0.00 ? 97  GLY A HA2  5  
ATOM 7407  H HA3  . GLY A 1 97  ? -7.006  -8.451  4.018   1.00 0.00 ? 97  GLY A HA3  5  
ATOM 7408  N N    . PRO A 1 98  ? -9.254  -9.679  4.169   1.00 0.00 ? 98  PRO A N    5  
ATOM 7409  C CA   . PRO A 1 98  ? -10.653 -10.066 4.238   1.00 0.00 ? 98  PRO A CA   5  
ATOM 7410  C C    . PRO A 1 98  ? -11.567 -8.846  4.109   1.00 0.00 ? 98  PRO A C    5  
ATOM 7411  O O    . PRO A 1 98  ? -11.092 -7.712  4.064   1.00 0.00 ? 98  PRO A O    5  
ATOM 7412  C CB   . PRO A 1 98  ? -10.798 -10.778 5.573   1.00 0.00 ? 98  PRO A CB   5  
ATOM 7413  C CG   . PRO A 1 98  ? -9.595  -10.358 6.403   1.00 0.00 ? 98  PRO A CG   5  
ATOM 7414  C CD   . PRO A 1 98  ? -8.589  -9.707  5.468   1.00 0.00 ? 98  PRO A CD   5  
ATOM 7415  H HA   . PRO A 1 98  ? -10.886 -10.664 3.472   1.00 0.00 ? 98  PRO A HA   5  
ATOM 7416  H HB2  . PRO A 1 98  ? -11.729 -10.499 6.066   1.00 0.00 ? 98  PRO A HB2  5  
ATOM 7417  H HB3  . PRO A 1 98  ? -10.820 -11.860 5.439   1.00 0.00 ? 98  PRO A HB3  5  
ATOM 7418  H HG2  . PRO A 1 98  ? -9.896  -9.661  7.185   1.00 0.00 ? 98  PRO A HG2  5  
ATOM 7419  H HG3  . PRO A 1 98  ? -9.152  -11.222 6.898   1.00 0.00 ? 98  PRO A HG3  5  
ATOM 7420  H HD2  . PRO A 1 98  ? -8.331  -8.702  5.803   1.00 0.00 ? 98  PRO A HD2  5  
ATOM 7421  H HD3  . PRO A 1 98  ? -7.661  -10.277 5.426   1.00 0.00 ? 98  PRO A HD3  5  
ATOM 7422  N N    . SER A 1 99  ? -12.862 -9.120  4.054   1.00 0.00 ? 99  SER A N    5  
ATOM 7423  C CA   . SER A 1 99  ? -13.847 -8.059  3.931   1.00 0.00 ? 99  SER A CA   5  
ATOM 7424  C C    . SER A 1 99  ? -15.033 -8.336  4.856   1.00 0.00 ? 99  SER A C    5  
ATOM 7425  O O    . SER A 1 99  ? -14.983 -9.250  5.678   1.00 0.00 ? 99  SER A O    5  
ATOM 7426  C CB   . SER A 1 99  ? -14.324 -7.915  2.484   1.00 0.00 ? 99  SER A CB   5  
ATOM 7427  O OG   . SER A 1 99  ? -14.343 -6.555  2.061   1.00 0.00 ? 99  SER A OG   5  
ATOM 7428  H H    . SER A 1 99  ? -13.240 -10.045 4.091   1.00 0.00 ? 99  SER A H    5  
ATOM 7429  H HA   . SER A 1 99  ? -13.330 -7.149  4.234   1.00 0.00 ? 99  SER A HA   5  
ATOM 7430  H HB2  . SER A 1 99  ? -13.670 -8.490  1.828   1.00 0.00 ? 99  SER A HB2  5  
ATOM 7431  H HB3  . SER A 1 99  ? -15.324 -8.338  2.389   1.00 0.00 ? 99  SER A HB3  5  
ATOM 7432  H HG   . SER A 1 99  ? -15.265 -6.180  2.155   1.00 0.00 ? 99  SER A HG   5  
ATOM 7433  N N    . SER A 1 100 ? -16.072 -7.531  4.691   1.00 0.00 ? 100 SER A N    5  
ATOM 7434  C CA   . SER A 1 100 ? -17.269 -7.678  5.501   1.00 0.00 ? 100 SER A CA   5  
ATOM 7435  C C    . SER A 1 100 ? -18.500 -7.251  4.699   1.00 0.00 ? 100 SER A C    5  
ATOM 7436  O O    . SER A 1 100 ? -19.473 -7.998  4.603   1.00 0.00 ? 100 SER A O    5  
ATOM 7437  C CB   . SER A 1 100 ? -17.166 -6.860  6.790   1.00 0.00 ? 100 SER A CB   5  
ATOM 7438  O OG   . SER A 1 100 ? -16.969 -5.474  6.528   1.00 0.00 ? 100 SER A OG   5  
ATOM 7439  H H    . SER A 1 100 ? -16.104 -6.790  4.020   1.00 0.00 ? 100 SER A H    5  
ATOM 7440  H HA   . SER A 1 100 ? -17.322 -8.738  5.748   1.00 0.00 ? 100 SER A HA   5  
ATOM 7441  H HB2  . SER A 1 100 ? -18.075 -6.993  7.377   1.00 0.00 ? 100 SER A HB2  5  
ATOM 7442  H HB3  . SER A 1 100 ? -16.340 -7.236  7.393   1.00 0.00 ? 100 SER A HB3  5  
ATOM 7443  H HG   . SER A 1 100 ? -15.991 -5.267  6.497   1.00 0.00 ? 100 SER A HG   5  
ATOM 7444  N N    . GLY A 1 101 ? -18.418 -6.051  4.143   1.00 0.00 ? 101 GLY A N    5  
ATOM 7445  C CA   . GLY A 1 101 ? -19.513 -5.516  3.353   1.00 0.00 ? 101 GLY A CA   5  
ATOM 7446  C C    . GLY A 1 101 ? -19.388 -5.938  1.887   1.00 0.00 ? 101 GLY A C    5  
ATOM 7447  O O    . GLY A 1 101 ? -19.680 -5.155  0.985   1.00 0.00 ? 101 GLY A O    5  
ATOM 7448  H H    . GLY A 1 101 ? -17.623 -5.450  4.226   1.00 0.00 ? 101 GLY A H    5  
ATOM 7449  H HA2  . GLY A 1 101 ? -20.463 -5.866  3.756   1.00 0.00 ? 101 GLY A HA2  5  
ATOM 7450  H HA3  . GLY A 1 101 ? -19.518 -4.428  3.422   1.00 0.00 ? 101 GLY A HA3  5  
ATOM 7451  N N    . GLY A 1 1   ? 14.559  -9.705  -20.614 1.00 0.00 ? 1   GLY A N    6  
ATOM 7452  C CA   . GLY A 1 1   ? 13.507  -10.686 -20.407 1.00 0.00 ? 1   GLY A CA   6  
ATOM 7453  C C    . GLY A 1 1   ? 12.747  -10.410 -19.107 1.00 0.00 ? 1   GLY A C    6  
ATOM 7454  O O    . GLY A 1 1   ? 13.087  -10.955 -18.058 1.00 0.00 ? 1   GLY A O    6  
ATOM 7455  H H1   . GLY A 1 1   ? 15.392  -9.862  -20.084 1.00 0.00 ? 1   GLY A H1   6  
ATOM 7456  H HA2  . GLY A 1 1   ? 12.814  -10.665 -21.248 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7457  H HA3  . GLY A 1 1   ? 13.938  -11.686 -20.374 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7458  N N    . SER A 1 2   ? 11.734  -9.563  -19.220 1.00 0.00 ? 2   SER A N    6  
ATOM 7459  C CA   . SER A 1 2   ? 10.924  -9.208  -18.067 1.00 0.00 ? 2   SER A CA   6  
ATOM 7460  C C    . SER A 1 2   ? 10.407  -10.474 -17.381 1.00 0.00 ? 2   SER A C    6  
ATOM 7461  O O    . SER A 1 2   ? 9.899   -11.379 -18.042 1.00 0.00 ? 2   SER A O    6  
ATOM 7462  C CB   . SER A 1 2   ? 9.755   -8.308  -18.472 1.00 0.00 ? 2   SER A CB   6  
ATOM 7463  O OG   . SER A 1 2   ? 9.829   -7.027  -17.853 1.00 0.00 ? 2   SER A OG   6  
ATOM 7464  H H    . SER A 1 2   ? 11.465  -9.125  -20.077 1.00 0.00 ? 2   SER A H    6  
ATOM 7465  H HA   . SER A 1 2   ? 11.592  -8.659  -17.403 1.00 0.00 ? 2   SER A HA   6  
ATOM 7466  H HB2  . SER A 1 2   ? 9.748   -8.188  -19.555 1.00 0.00 ? 2   SER A HB2  6  
ATOM 7467  H HB3  . SER A 1 2   ? 8.816   -8.789  -18.199 1.00 0.00 ? 2   SER A HB3  6  
ATOM 7468  H HG   . SER A 1 2   ? 9.737   -6.308  -18.542 1.00 0.00 ? 2   SER A HG   6  
ATOM 7469  N N    . SER A 1 3   ? 10.554  -10.497 -16.065 1.00 0.00 ? 3   SER A N    6  
ATOM 7470  C CA   . SER A 1 3   ? 10.107  -11.637 -15.282 1.00 0.00 ? 3   SER A CA   6  
ATOM 7471  C C    . SER A 1 3   ? 9.912   -11.225 -13.821 1.00 0.00 ? 3   SER A C    6  
ATOM 7472  O O    . SER A 1 3   ? 10.562  -10.297 -13.342 1.00 0.00 ? 3   SER A O    6  
ATOM 7473  C CB   . SER A 1 3   ? 11.103  -12.795 -15.377 1.00 0.00 ? 3   SER A CB   6  
ATOM 7474  O OG   . SER A 1 3   ? 12.381  -12.444 -14.854 1.00 0.00 ? 3   SER A OG   6  
ATOM 7475  H H    . SER A 1 3   ? 10.968  -9.757  -15.535 1.00 0.00 ? 3   SER A H    6  
ATOM 7476  H HA   . SER A 1 3   ? 9.158   -11.938 -15.725 1.00 0.00 ? 3   SER A HA   6  
ATOM 7477  H HB2  . SER A 1 3   ? 10.713  -13.655 -14.834 1.00 0.00 ? 3   SER A HB2  6  
ATOM 7478  H HB3  . SER A 1 3   ? 11.209  -13.097 -16.419 1.00 0.00 ? 3   SER A HB3  6  
ATOM 7479  H HG   . SER A 1 3   ? 12.923  -13.269 -14.693 1.00 0.00 ? 3   SER A HG   6  
ATOM 7480  N N    . GLY A 1 4   ? 9.012   -11.934 -13.155 1.00 0.00 ? 4   GLY A N    6  
ATOM 7481  C CA   . GLY A 1 4   ? 8.723   -11.653 -11.759 1.00 0.00 ? 4   GLY A CA   6  
ATOM 7482  C C    . GLY A 1 4   ? 8.393   -12.939 -10.998 1.00 0.00 ? 4   GLY A C    6  
ATOM 7483  O O    . GLY A 1 4   ? 7.836   -13.876 -11.568 1.00 0.00 ? 4   GLY A O    6  
ATOM 7484  H H    . GLY A 1 4   ? 8.488   -12.687 -13.552 1.00 0.00 ? 4   GLY A H    6  
ATOM 7485  H HA2  . GLY A 1 4   ? 9.580   -11.163 -11.298 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 7486  H HA3  . GLY A 1 4   ? 7.884   -10.961 -11.690 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 7487  N N    . SER A 1 5   ? 8.752   -12.942 -9.723  1.00 0.00 ? 5   SER A N    6  
ATOM 7488  C CA   . SER A 1 5   ? 8.502   -14.098 -8.878  1.00 0.00 ? 5   SER A CA   6  
ATOM 7489  C C    . SER A 1 5   ? 8.603   -13.700 -7.404  1.00 0.00 ? 5   SER A C    6  
ATOM 7490  O O    . SER A 1 5   ? 9.701   -13.604 -6.858  1.00 0.00 ? 5   SER A O    6  
ATOM 7491  C CB   . SER A 1 5   ? 9.481   -15.231 -9.191  1.00 0.00 ? 5   SER A CB   6  
ATOM 7492  O OG   . SER A 1 5   ? 8.831   -16.499 -9.241  1.00 0.00 ? 5   SER A OG   6  
ATOM 7493  H H    . SER A 1 5   ? 9.205   -12.176 -9.267  1.00 0.00 ? 5   SER A H    6  
ATOM 7494  H HA   . SER A 1 5   ? 7.488   -14.417 -9.119  1.00 0.00 ? 5   SER A HA   6  
ATOM 7495  H HB2  . SER A 1 5   ? 9.969   -15.036 -10.145 1.00 0.00 ? 5   SER A HB2  6  
ATOM 7496  H HB3  . SER A 1 5   ? 10.263  -15.255 -8.432  1.00 0.00 ? 5   SER A HB3  6  
ATOM 7497  H HG   . SER A 1 5   ? 9.506   -17.224 -9.379  1.00 0.00 ? 5   SER A HG   6  
ATOM 7498  N N    . SER A 1 6   ? 7.443   -13.479 -6.803  1.00 0.00 ? 6   SER A N    6  
ATOM 7499  C CA   . SER A 1 6   ? 7.388   -13.094 -5.403  1.00 0.00 ? 6   SER A CA   6  
ATOM 7500  C C    . SER A 1 6   ? 7.999   -11.704 -5.218  1.00 0.00 ? 6   SER A C    6  
ATOM 7501  O O    . SER A 1 6   ? 9.185   -11.504 -5.477  1.00 0.00 ? 6   SER A O    6  
ATOM 7502  C CB   . SER A 1 6   ? 8.113   -14.114 -4.522  1.00 0.00 ? 6   SER A CB   6  
ATOM 7503  O OG   . SER A 1 6   ? 7.626   -15.437 -4.727  1.00 0.00 ? 6   SER A OG   6  
ATOM 7504  H H    . SER A 1 6   ? 6.555   -13.559 -7.254  1.00 0.00 ? 6   SER A H    6  
ATOM 7505  H HA   . SER A 1 6   ? 6.328   -13.083 -5.148  1.00 0.00 ? 6   SER A HA   6  
ATOM 7506  H HB2  . SER A 1 6   ? 9.181   -14.083 -4.735  1.00 0.00 ? 6   SER A HB2  6  
ATOM 7507  H HB3  . SER A 1 6   ? 7.989   -13.840 -3.474  1.00 0.00 ? 6   SER A HB3  6  
ATOM 7508  H HG   . SER A 1 6   ? 6.685   -15.511 -4.396  1.00 0.00 ? 6   SER A HG   6  
ATOM 7509  N N    . GLY A 1 7   ? 7.162   -10.779 -4.771  1.00 0.00 ? 7   GLY A N    6  
ATOM 7510  C CA   . GLY A 1 7   ? 7.605   -9.413  -4.549  1.00 0.00 ? 7   GLY A CA   6  
ATOM 7511  C C    . GLY A 1 7   ? 7.490   -8.584  -5.829  1.00 0.00 ? 7   GLY A C    6  
ATOM 7512  O O    . GLY A 1 7   ? 8.155   -8.873  -6.823  1.00 0.00 ? 7   GLY A O    6  
ATOM 7513  H H    . GLY A 1 7   ? 6.199   -10.950 -4.563  1.00 0.00 ? 7   GLY A H    6  
ATOM 7514  H HA2  . GLY A 1 7   ? 7.007   -8.957  -3.760  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 7515  H HA3  . GLY A 1 7   ? 8.639   -9.414  -4.204  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 7516  N N    . GLU A 1 8   ? 6.641   -7.569  -5.764  1.00 0.00 ? 8   GLU A N    6  
ATOM 7517  C CA   . GLU A 1 8   ? 6.429   -6.695  -6.906  1.00 0.00 ? 8   GLU A CA   6  
ATOM 7518  C C    . GLU A 1 8   ? 6.063   -5.286  -6.436  1.00 0.00 ? 8   GLU A C    6  
ATOM 7519  O O    . GLU A 1 8   ? 5.171   -5.117  -5.605  1.00 0.00 ? 8   GLU A O    6  
ATOM 7520  C CB   . GLU A 1 8   ? 5.354   -7.260  -7.836  1.00 0.00 ? 8   GLU A CB   6  
ATOM 7521  C CG   . GLU A 1 8   ? 4.973   -6.243  -8.914  1.00 0.00 ? 8   GLU A CG   6  
ATOM 7522  C CD   . GLU A 1 8   ? 6.085   -6.104  -9.956  1.00 0.00 ? 8   GLU A CD   6  
ATOM 7523  O OE1  . GLU A 1 8   ? 7.030   -5.335  -9.678  1.00 0.00 ? 8   GLU A OE1  6  
ATOM 7524  O OE2  . GLU A 1 8   ? 5.964   -6.771  -11.006 1.00 0.00 ? 8   GLU A OE2  6  
ATOM 7525  H H    . GLU A 1 8   ? 6.103   -7.340  -4.952  1.00 0.00 ? 8   GLU A H    6  
ATOM 7526  H HA   . GLU A 1 8   ? 7.383   -6.673  -7.434  1.00 0.00 ? 8   GLU A HA   6  
ATOM 7527  H HB2  . GLU A 1 8   ? 5.718   -8.174  -8.306  1.00 0.00 ? 8   GLU A HB2  6  
ATOM 7528  H HB3  . GLU A 1 8   ? 4.471   -7.529  -7.257  1.00 0.00 ? 8   GLU A HB3  6  
ATOM 7529  H HG2  . GLU A 1 8   ? 4.049   -6.554  -9.402  1.00 0.00 ? 8   GLU A HG2  6  
ATOM 7530  H HG3  . GLU A 1 8   ? 4.779   -5.274  -8.453  1.00 0.00 ? 8   GLU A HG3  6  
ATOM 7531  N N    . VAL A 1 9   ? 6.769   -4.310  -6.987  1.00 0.00 ? 9   VAL A N    6  
ATOM 7532  C CA   . VAL A 1 9   ? 6.529   -2.921  -6.634  1.00 0.00 ? 9   VAL A CA   6  
ATOM 7533  C C    . VAL A 1 9   ? 5.408   -2.363  -7.513  1.00 0.00 ? 9   VAL A C    6  
ATOM 7534  O O    . VAL A 1 9   ? 5.488   -2.422  -8.739  1.00 0.00 ? 9   VAL A O    6  
ATOM 7535  C CB   . VAL A 1 9   ? 7.829   -2.122  -6.744  1.00 0.00 ? 9   VAL A CB   6  
ATOM 7536  C CG1  . VAL A 1 9   ? 7.552   -0.617  -6.716  1.00 0.00 ? 9   VAL A CG1  6  
ATOM 7537  C CG2  . VAL A 1 9   ? 8.811   -2.518  -5.639  1.00 0.00 ? 9   VAL A CG2  6  
ATOM 7538  H H    . VAL A 1 9   ? 7.493   -4.456  -7.662  1.00 0.00 ? 9   VAL A H    6  
ATOM 7539  H HA   . VAL A 1 9   ? 6.205   -2.897  -5.594  1.00 0.00 ? 9   VAL A HA   6  
ATOM 7540  H HB   . VAL A 1 9   ? 8.290   -2.360  -7.702  1.00 0.00 ? 9   VAL A HB   6  
ATOM 7541  H HG11 . VAL A 1 9   ? 8.457   -0.076  -6.990  1.00 0.00 ? 9   VAL A HG11 6  
ATOM 7542  H HG12 . VAL A 1 9   ? 6.758   -0.382  -7.426  1.00 0.00 ? 9   VAL A HG12 6  
ATOM 7543  H HG13 . VAL A 1 9   ? 7.242   -0.323  -5.714  1.00 0.00 ? 9   VAL A HG13 6  
ATOM 7544  H HG21 . VAL A 1 9   ? 9.621   -1.790  -5.594  1.00 0.00 ? 9   VAL A HG21 6  
ATOM 7545  H HG22 . VAL A 1 9   ? 8.291   -2.542  -4.682  1.00 0.00 ? 9   VAL A HG22 6  
ATOM 7546  H HG23 . VAL A 1 9   ? 9.222   -3.505  -5.855  1.00 0.00 ? 9   VAL A HG23 6  
ATOM 7547  N N    . ARG A 1 10  ? 4.390   -1.833  -6.852  1.00 0.00 ? 10  ARG A N    6  
ATOM 7548  C CA   . ARG A 1 10  ? 3.254   -1.264  -7.558  1.00 0.00 ? 10  ARG A CA   6  
ATOM 7549  C C    . ARG A 1 10  ? 3.409   0.253   -7.677  1.00 0.00 ? 10  ARG A C    6  
ATOM 7550  O O    . ARG A 1 10  ? 4.260   0.847   -7.018  1.00 0.00 ? 10  ARG A O    6  
ATOM 7551  C CB   . ARG A 1 10  ? 1.943   -1.581  -6.836  1.00 0.00 ? 10  ARG A CB   6  
ATOM 7552  C CG   . ARG A 1 10  ? 1.949   -1.017  -5.414  1.00 0.00 ? 10  ARG A CG   6  
ATOM 7553  C CD   . ARG A 1 10  ? 1.687   -2.120  -4.386  1.00 0.00 ? 10  ARG A CD   6  
ATOM 7554  N NE   . ARG A 1 10  ? 0.281   -2.061  -3.928  1.00 0.00 ? 10  ARG A NE   6  
ATOM 7555  C CZ   . ARG A 1 10  ? -0.718  -2.765  -4.477  1.00 0.00 ? 10  ARG A CZ   6  
ATOM 7556  N NH1  . ARG A 1 10  ? -0.472  -3.586  -5.507  1.00 0.00 ? 10  ARG A NH1  6  
ATOM 7557  N NH2  . ARG A 1 10  ? -1.964  -2.648  -3.996  1.00 0.00 ? 10  ARG A NH2  6  
ATOM 7558  H H    . ARG A 1 10  ? 4.333   -1.789  -5.855  1.00 0.00 ? 10  ARG A H    6  
ATOM 7559  H HA   . ARG A 1 10  ? 3.270   -1.739  -8.539  1.00 0.00 ? 10  ARG A HA   6  
ATOM 7560  H HB2  . ARG A 1 10  ? 1.106   -1.160  -7.394  1.00 0.00 ? 10  ARG A HB2  6  
ATOM 7561  H HB3  . ARG A 1 10  ? 1.793   -2.660  -6.803  1.00 0.00 ? 10  ARG A HB3  6  
ATOM 7562  H HG2  . ARG A 1 10  ? 2.911   -0.547  -5.210  1.00 0.00 ? 10  ARG A HG2  6  
ATOM 7563  H HG3  . ARG A 1 10  ? 1.189   -0.242  -5.323  1.00 0.00 ? 10  ARG A HG3  6  
ATOM 7564  H HD2  . ARG A 1 10  ? 1.894   -3.095  -4.826  1.00 0.00 ? 10  ARG A HD2  6  
ATOM 7565  H HD3  . ARG A 1 10  ? 2.360   -2.004  -3.536  1.00 0.00 ? 10  ARG A HD3  6  
ATOM 7566  H HE   . ARG A 1 10  ? 0.062   -1.457  -3.161  1.00 0.00 ? 10  ARG A HE   6  
ATOM 7567  H HH11 . ARG A 1 10  ? 0.457   -3.673  -5.866  1.00 0.00 ? 10  ARG A HH11 6  
ATOM 7568  H HH12 . ARG A 1 10  ? -1.217  -4.112  -5.917  1.00 0.00 ? 10  ARG A HH12 6  
ATOM 7569  H HH21 . ARG A 1 10  ? -2.148  -2.035  -3.228  1.00 0.00 ? 10  ARG A HH21 6  
ATOM 7570  H HH22 . ARG A 1 10  ? -2.709  -3.174  -4.406  1.00 0.00 ? 10  ARG A HH22 6  
ATOM 7571  N N    . LEU A 1 11  ? 2.573   0.836   -8.523  1.00 0.00 ? 11  LEU A N    6  
ATOM 7572  C CA   . LEU A 1 11  ? 2.606   2.273   -8.737  1.00 0.00 ? 11  LEU A CA   6  
ATOM 7573  C C    . LEU A 1 11  ? 1.212   2.853   -8.493  1.00 0.00 ? 11  LEU A C    6  
ATOM 7574  O O    . LEU A 1 11  ? 0.307   2.668   -9.305  1.00 0.00 ? 11  LEU A O    6  
ATOM 7575  C CB   . LEU A 1 11  ? 3.172   2.595   -10.122 1.00 0.00 ? 11  LEU A CB   6  
ATOM 7576  C CG   . LEU A 1 11  ? 4.636   2.215   -10.353 1.00 0.00 ? 11  LEU A CG   6  
ATOM 7577  C CD1  . LEU A 1 11  ? 5.052   2.492   -11.799 1.00 0.00 ? 11  LEU A CD1  6  
ATOM 7578  C CD2  . LEU A 1 11  ? 5.550   2.919   -9.349  1.00 0.00 ? 11  LEU A CD2  6  
ATOM 7579  H H    . LEU A 1 11  ? 1.883   0.346   -9.056  1.00 0.00 ? 11  LEU A H    6  
ATOM 7580  H HA   . LEU A 1 11  ? 3.291   2.697   -8.003  1.00 0.00 ? 11  LEU A HA   6  
ATOM 7581  H HB2  . LEU A 1 11  ? 2.563   2.086   -10.869 1.00 0.00 ? 11  LEU A HB2  6  
ATOM 7582  H HB3  . LEU A 1 11  ? 3.063   3.666   -10.297 1.00 0.00 ? 11  LEU A HB3  6  
ATOM 7583  H HG   . LEU A 1 11  ? 4.741   1.143   -10.188 1.00 0.00 ? 11  LEU A HG   6  
ATOM 7584  H HD11 . LEU A 1 11  ? 5.095   1.553   -12.351 1.00 0.00 ? 11  LEU A HD11 6  
ATOM 7585  H HD12 . LEU A 1 11  ? 4.324   3.155   -12.267 1.00 0.00 ? 11  LEU A HD12 6  
ATOM 7586  H HD13 . LEU A 1 11  ? 6.034   2.965   -11.811 1.00 0.00 ? 11  LEU A HD13 6  
ATOM 7587  H HD21 . LEU A 1 11  ? 6.442   3.282   -9.861  1.00 0.00 ? 11  LEU A HD21 6  
ATOM 7588  H HD22 . LEU A 1 11  ? 5.020   3.761   -8.903  1.00 0.00 ? 11  LEU A HD22 6  
ATOM 7589  H HD23 . LEU A 1 11  ? 5.840   2.217   -8.567  1.00 0.00 ? 11  LEU A HD23 6  
ATOM 7590  N N    . VAL A 1 12  ? 1.082   3.544   -7.369  1.00 0.00 ? 12  VAL A N    6  
ATOM 7591  C CA   . VAL A 1 12  ? -0.187  4.153   -7.007  1.00 0.00 ? 12  VAL A CA   6  
ATOM 7592  C C    . VAL A 1 12  ? -0.181  5.623   -7.429  1.00 0.00 ? 12  VAL A C    6  
ATOM 7593  O O    . VAL A 1 12  ? 0.848   6.293   -7.344  1.00 0.00 ? 12  VAL A O    6  
ATOM 7594  C CB   . VAL A 1 12  ? -0.452  3.960   -5.513  1.00 0.00 ? 12  VAL A CB   6  
ATOM 7595  C CG1  . VAL A 1 12  ? -1.721  4.698   -5.082  1.00 0.00 ? 12  VAL A CG1  6  
ATOM 7596  C CG2  . VAL A 1 12  ? -0.535  2.474   -5.158  1.00 0.00 ? 12  VAL A CG2  6  
ATOM 7597  H H    . VAL A 1 12  ? 1.823   3.690   -6.714  1.00 0.00 ? 12  VAL A H    6  
ATOM 7598  H HA   . VAL A 1 12  ? -0.970  3.633   -7.559  1.00 0.00 ? 12  VAL A HA   6  
ATOM 7599  H HB   . VAL A 1 12  ? 0.387   4.389   -4.965  1.00 0.00 ? 12  VAL A HB   6  
ATOM 7600  H HG11 . VAL A 1 12  ? -1.467  5.454   -4.338  1.00 0.00 ? 12  VAL A HG11 6  
ATOM 7601  H HG12 . VAL A 1 12  ? -2.174  5.179   -5.949  1.00 0.00 ? 12  VAL A HG12 6  
ATOM 7602  H HG13 . VAL A 1 12  ? -2.426  3.987   -4.651  1.00 0.00 ? 12  VAL A HG13 6  
ATOM 7603  H HG21 . VAL A 1 12  ? 0.099   2.271   -4.294  1.00 0.00 ? 12  VAL A HG21 6  
ATOM 7604  H HG22 . VAL A 1 12  ? -1.566  2.214   -4.920  1.00 0.00 ? 12  VAL A HG22 6  
ATOM 7605  H HG23 . VAL A 1 12  ? -0.195  1.878   -6.005  1.00 0.00 ? 12  VAL A HG23 6  
ATOM 7606  N N    . SER A 1 13  ? -1.341  6.083   -7.874  1.00 0.00 ? 13  SER A N    6  
ATOM 7607  C CA   . SER A 1 13  ? -1.482  7.462   -8.308  1.00 0.00 ? 13  SER A CA   6  
ATOM 7608  C C    . SER A 1 13  ? -2.669  8.116   -7.597  1.00 0.00 ? 13  SER A C    6  
ATOM 7609  O O    . SER A 1 13  ? -3.793  7.625   -7.679  1.00 0.00 ? 13  SER A O    6  
ATOM 7610  C CB   . SER A 1 13  ? -1.661  7.546   -9.826  1.00 0.00 ? 13  SER A CB   6  
ATOM 7611  O OG   . SER A 1 13  ? -1.630  8.892   -10.293 1.00 0.00 ? 13  SER A OG   6  
ATOM 7612  H H    . SER A 1 13  ? -2.173  5.532   -7.939  1.00 0.00 ? 13  SER A H    6  
ATOM 7613  H HA   . SER A 1 13  ? -0.550  7.951   -8.026  1.00 0.00 ? 13  SER A HA   6  
ATOM 7614  H HB2  . SER A 1 13  ? -0.873  6.974   -10.316 1.00 0.00 ? 13  SER A HB2  6  
ATOM 7615  H HB3  . SER A 1 13  ? -2.609  7.087   -10.105 1.00 0.00 ? 13  SER A HB3  6  
ATOM 7616  H HG   . SER A 1 13  ? -2.074  9.495   -9.630  1.00 0.00 ? 13  SER A HG   6  
ATOM 7617  N N    . LEU A 1 14  ? -2.377  9.215   -6.916  1.00 0.00 ? 14  LEU A N    6  
ATOM 7618  C CA   . LEU A 1 14  ? -3.406  9.941   -6.191  1.00 0.00 ? 14  LEU A CA   6  
ATOM 7619  C C    . LEU A 1 14  ? -3.430  11.394  -6.668  1.00 0.00 ? 14  LEU A C    6  
ATOM 7620  O O    . LEU A 1 14  ? -2.464  12.131  -6.477  1.00 0.00 ? 14  LEU A O    6  
ATOM 7621  C CB   . LEU A 1 14  ? -3.203  9.793   -4.682  1.00 0.00 ? 14  LEU A CB   6  
ATOM 7622  C CG   . LEU A 1 14  ? -3.746  8.507   -4.055  1.00 0.00 ? 14  LEU A CG   6  
ATOM 7623  C CD1  . LEU A 1 14  ? -5.264  8.415   -4.219  1.00 0.00 ? 14  LEU A CD1  6  
ATOM 7624  C CD2  . LEU A 1 14  ? -3.033  7.277   -4.623  1.00 0.00 ? 14  LEU A CD2  6  
ATOM 7625  H H    . LEU A 1 14  ? -1.459  9.608   -6.854  1.00 0.00 ? 14  LEU A H    6  
ATOM 7626  H HA   . LEU A 1 14  ? -4.363  9.481   -6.434  1.00 0.00 ? 14  LEU A HA   6  
ATOM 7627  H HB2  . LEU A 1 14  ? -2.136  9.854   -4.470  1.00 0.00 ? 14  LEU A HB2  6  
ATOM 7628  H HB3  . LEU A 1 14  ? -3.675  10.641  -4.187  1.00 0.00 ? 14  LEU A HB3  6  
ATOM 7629  H HG   . LEU A 1 14  ? -3.538  8.534   -2.986  1.00 0.00 ? 14  LEU A HG   6  
ATOM 7630  H HD11 . LEU A 1 14  ? -5.522  7.471   -4.698  1.00 0.00 ? 14  LEU A HD11 6  
ATOM 7631  H HD12 . LEU A 1 14  ? -5.739  8.467   -3.239  1.00 0.00 ? 14  LEU A HD12 6  
ATOM 7632  H HD13 . LEU A 1 14  ? -5.614  9.243   -4.836  1.00 0.00 ? 14  LEU A HD13 6  
ATOM 7633  H HD21 . LEU A 1 14  ? -3.463  7.023   -5.592  1.00 0.00 ? 14  LEU A HD21 6  
ATOM 7634  H HD22 . LEU A 1 14  ? -1.972  7.495   -4.742  1.00 0.00 ? 14  LEU A HD22 6  
ATOM 7635  H HD23 . LEU A 1 14  ? -3.157  6.438   -3.939  1.00 0.00 ? 14  LEU A HD23 6  
ATOM 7636  N N    . ARG A 1 15  ? -4.545  11.764  -7.281  1.00 0.00 ? 15  ARG A N    6  
ATOM 7637  C CA   . ARG A 1 15  ? -4.708  13.116  -7.788  1.00 0.00 ? 15  ARG A CA   6  
ATOM 7638  C C    . ARG A 1 15  ? -5.879  13.807  -7.087  1.00 0.00 ? 15  ARG A C    6  
ATOM 7639  O O    . ARG A 1 15  ? -7.013  13.335  -7.152  1.00 0.00 ? 15  ARG A O    6  
ATOM 7640  C CB   . ARG A 1 15  ? -4.957  13.112  -9.297  1.00 0.00 ? 15  ARG A CB   6  
ATOM 7641  C CG   . ARG A 1 15  ? -4.796  14.517  -9.883  1.00 0.00 ? 15  ARG A CG   6  
ATOM 7642  C CD   . ARG A 1 15  ? -6.069  14.958  -10.608 1.00 0.00 ? 15  ARG A CD   6  
ATOM 7643  N NE   . ARG A 1 15  ? -5.991  16.399  -10.936 1.00 0.00 ? 15  ARG A NE   6  
ATOM 7644  C CZ   . ARG A 1 15  ? -7.058  17.174  -11.173 1.00 0.00 ? 15  ARG A CZ   6  
ATOM 7645  N NH1  . ARG A 1 15  ? -8.291  16.651  -11.119 1.00 0.00 ? 15  ARG A NH1  6  
ATOM 7646  N NH2  . ARG A 1 15  ? -6.892  18.472  -11.463 1.00 0.00 ? 15  ARG A NH2  6  
ATOM 7647  H H    . ARG A 1 15  ? -5.327  11.158  -7.433  1.00 0.00 ? 15  ARG A H    6  
ATOM 7648  H HA   . ARG A 1 15  ? -3.766  13.614  -7.561  1.00 0.00 ? 15  ARG A HA   6  
ATOM 7649  H HB2  . ARG A 1 15  ? -4.259  12.430  -9.783  1.00 0.00 ? 15  ARG A HB2  6  
ATOM 7650  H HB3  . ARG A 1 15  ? -5.960  12.741  -9.504  1.00 0.00 ? 15  ARG A HB3  6  
ATOM 7651  H HG2  . ARG A 1 15  ? -4.564  15.223  -9.085  1.00 0.00 ? 15  ARG A HG2  6  
ATOM 7652  H HG3  . ARG A 1 15  ? -3.954  14.532  -10.576 1.00 0.00 ? 15  ARG A HG3  6  
ATOM 7653  H HD2  . ARG A 1 15  ? -6.198  14.375  -11.520 1.00 0.00 ? 15  ARG A HD2  6  
ATOM 7654  H HD3  . ARG A 1 15  ? -6.939  14.766  -9.981  1.00 0.00 ? 15  ARG A HD3  6  
ATOM 7655  H HE   . ARG A 1 15  ? -5.085  16.820  -10.984 1.00 0.00 ? 15  ARG A HE   6  
ATOM 7656  H HH11 . ARG A 1 15  ? -8.414  15.683  -10.903 1.00 0.00 ? 15  ARG A HH11 6  
ATOM 7657  H HH12 . ARG A 1 15  ? -9.087  17.230  -11.296 1.00 0.00 ? 15  ARG A HH12 6  
ATOM 7658  H HH21 . ARG A 1 15  ? -5.972  18.862  -11.503 1.00 0.00 ? 15  ARG A HH21 6  
ATOM 7659  H HH22 . ARG A 1 15  ? -7.689  19.050  -11.640 1.00 0.00 ? 15  ARG A HH22 6  
ATOM 7660  N N    . ARG A 1 16  ? -5.565  14.915  -6.432  1.00 0.00 ? 16  ARG A N    6  
ATOM 7661  C CA   . ARG A 1 16  ? -6.577  15.677  -5.720  1.00 0.00 ? 16  ARG A CA   6  
ATOM 7662  C C    . ARG A 1 16  ? -5.917  16.687  -4.779  1.00 0.00 ? 16  ARG A C    6  
ATOM 7663  O O    . ARG A 1 16  ? -5.051  16.326  -3.984  1.00 0.00 ? 16  ARG A O    6  
ATOM 7664  C CB   . ARG A 1 16  ? -7.489  14.755  -4.908  1.00 0.00 ? 16  ARG A CB   6  
ATOM 7665  C CG   . ARG A 1 16  ? -8.930  14.820  -5.420  1.00 0.00 ? 16  ARG A CG   6  
ATOM 7666  C CD   . ARG A 1 16  ? -9.521  13.417  -5.574  1.00 0.00 ? 16  ARG A CD   6  
ATOM 7667  N NE   . ARG A 1 16  ? -10.199 13.014  -4.322  1.00 0.00 ? 16  ARG A NE   6  
ATOM 7668  C CZ   . ARG A 1 16  ? -10.663 11.780  -4.083  1.00 0.00 ? 16  ARG A CZ   6  
ATOM 7669  N NH1  . ARG A 1 16  ? -10.526 10.822  -5.010  1.00 0.00 ? 16  ARG A NH1  6  
ATOM 7670  N NH2  . ARG A 1 16  ? -11.265 11.504  -2.918  1.00 0.00 ? 16  ARG A NH2  6  
ATOM 7671  H H    . ARG A 1 16  ? -4.640  15.293  -6.384  1.00 0.00 ? 16  ARG A H    6  
ATOM 7672  H HA   . ARG A 1 16  ? -7.147  16.181  -6.500  1.00 0.00 ? 16  ARG A HA   6  
ATOM 7673  H HB2  . ARG A 1 16  ? -7.124  13.730  -4.969  1.00 0.00 ? 16  ARG A HB2  6  
ATOM 7674  H HB3  . ARG A 1 16  ? -7.460  15.042  -3.857  1.00 0.00 ? 16  ARG A HB3  6  
ATOM 7675  H HG2  . ARG A 1 16  ? -9.539  15.402  -4.728  1.00 0.00 ? 16  ARG A HG2  6  
ATOM 7676  H HG3  . ARG A 1 16  ? -8.956  15.337  -6.379  1.00 0.00 ? 16  ARG A HG3  6  
ATOM 7677  H HD2  . ARG A 1 16  ? -10.229 13.401  -6.402  1.00 0.00 ? 16  ARG A HD2  6  
ATOM 7678  H HD3  . ARG A 1 16  ? -8.731  12.706  -5.815  1.00 0.00 ? 16  ARG A HD3  6  
ATOM 7679  H HE   . ARG A 1 16  ? -10.318 13.705  -3.609  1.00 0.00 ? 16  ARG A HE   6  
ATOM 7680  H HH11 . ARG A 1 16  ? -10.077 11.027  -5.879  1.00 0.00 ? 16  ARG A HH11 6  
ATOM 7681  H HH12 . ARG A 1 16  ? -10.873 9.901   -4.832  1.00 0.00 ? 16  ARG A HH12 6  
ATOM 7682  H HH21 . ARG A 1 16  ? -11.368 12.219  -2.227  1.00 0.00 ? 16  ARG A HH21 6  
ATOM 7683  H HH22 . ARG A 1 16  ? -11.612 10.583  -2.740  1.00 0.00 ? 16  ARG A HH22 6  
ATOM 7684  N N    . ALA A 1 17  ? -6.351  17.933  -4.902  1.00 0.00 ? 17  ALA A N    6  
ATOM 7685  C CA   . ALA A 1 17  ? -5.813  18.998  -4.073  1.00 0.00 ? 17  ALA A CA   6  
ATOM 7686  C C    . ALA A 1 17  ? -6.597  20.286  -4.333  1.00 0.00 ? 17  ALA A C    6  
ATOM 7687  O O    . ALA A 1 17  ? -6.629  20.781  -5.459  1.00 0.00 ? 17  ALA A O    6  
ATOM 7688  C CB   . ALA A 1 17  ? -4.318  19.158  -4.354  1.00 0.00 ? 17  ALA A CB   6  
ATOM 7689  H H    . ALA A 1 17  ? -7.056  18.218  -5.552  1.00 0.00 ? 17  ALA A H    6  
ATOM 7690  H HA   . ALA A 1 17  ? -5.945  18.706  -3.031  1.00 0.00 ? 17  ALA A HA   6  
ATOM 7691  H HB1  . ALA A 1 17  ? -4.075  20.218  -4.436  1.00 0.00 ? 17  ALA A HB1  6  
ATOM 7692  H HB2  . ALA A 1 17  ? -3.746  18.716  -3.539  1.00 0.00 ? 17  ALA A HB2  6  
ATOM 7693  H HB3  . ALA A 1 17  ? -4.068  18.655  -5.288  1.00 0.00 ? 17  ALA A HB3  6  
ATOM 7694  N N    . LYS A 1 18  ? -7.210  20.792  -3.273  1.00 0.00 ? 18  LYS A N    6  
ATOM 7695  C CA   . LYS A 1 18  ? -7.992  22.013  -3.373  1.00 0.00 ? 18  LYS A CA   6  
ATOM 7696  C C    . LYS A 1 18  ? -8.598  22.339  -2.006  1.00 0.00 ? 18  LYS A C    6  
ATOM 7697  O O    . LYS A 1 18  ? -8.443  23.451  -1.504  1.00 0.00 ? 18  LYS A O    6  
ATOM 7698  C CB   . LYS A 1 18  ? -9.028  21.896  -4.493  1.00 0.00 ? 18  LYS A CB   6  
ATOM 7699  C CG   . LYS A 1 18  ? -9.795  20.576  -4.395  1.00 0.00 ? 18  LYS A CG   6  
ATOM 7700  C CD   . LYS A 1 18  ? -9.943  19.925  -5.771  1.00 0.00 ? 18  LYS A CD   6  
ATOM 7701  C CE   . LYS A 1 18  ? -11.399 19.537  -6.040  1.00 0.00 ? 18  LYS A CE   6  
ATOM 7702  N NZ   . LYS A 1 18  ? -11.810 18.423  -5.156  1.00 0.00 ? 18  LYS A NZ   6  
ATOM 7703  H H    . LYS A 1 18  ? -7.180  20.383  -2.361  1.00 0.00 ? 18  LYS A H    6  
ATOM 7704  H HA   . LYS A 1 18  ? -7.309  22.817  -3.648  1.00 0.00 ? 18  LYS A HA   6  
ATOM 7705  H HB2  . LYS A 1 18  ? -9.726  22.731  -4.436  1.00 0.00 ? 18  LYS A HB2  6  
ATOM 7706  H HB3  . LYS A 1 18  ? -8.531  21.962  -5.461  1.00 0.00 ? 18  LYS A HB3  6  
ATOM 7707  H HG2  . LYS A 1 18  ? -9.272  19.897  -3.722  1.00 0.00 ? 18  LYS A HG2  6  
ATOM 7708  H HG3  . LYS A 1 18  ? -10.780 20.755  -3.965  1.00 0.00 ? 18  LYS A HG3  6  
ATOM 7709  H HD2  . LYS A 1 18  ? -9.598  20.613  -6.542  1.00 0.00 ? 18  LYS A HD2  6  
ATOM 7710  H HD3  . LYS A 1 18  ? -9.311  19.039  -5.829  1.00 0.00 ? 18  LYS A HD3  6  
ATOM 7711  H HE2  . LYS A 1 18  ? -12.047 20.398  -5.876  1.00 0.00 ? 18  LYS A HE2  6  
ATOM 7712  H HE3  . LYS A 1 18  ? -11.516 19.243  -7.083  1.00 0.00 ? 18  LYS A HE3  6  
ATOM 7713  H HZ1  . LYS A 1 18  ? -11.688 18.693  -4.201  1.00 0.00 ? 18  LYS A HZ1  6  
ATOM 7714  H HZ2  . LYS A 1 18  ? -12.772 18.205  -5.321  1.00 0.00 ? 18  LYS A HZ2  6  
ATOM 7715  H HZ3  . LYS A 1 18  ? -11.248 17.619  -5.349  1.00 0.00 ? 18  LYS A HZ3  6  
ATOM 7716  N N    . ALA A 1 19  ? -9.275  21.348  -1.444  1.00 0.00 ? 19  ALA A N    6  
ATOM 7717  C CA   . ALA A 1 19  ? -9.904  21.516  -0.145  1.00 0.00 ? 19  ALA A CA   6  
ATOM 7718  C C    . ALA A 1 19  ? -9.622  20.283  0.717   1.00 0.00 ? 19  ALA A C    6  
ATOM 7719  O O    . ALA A 1 19  ? -10.548 19.631  1.196   1.00 0.00 ? 19  ALA A O    6  
ATOM 7720  C CB   . ALA A 1 19  ? -11.402 21.765  -0.332  1.00 0.00 ? 19  ALA A CB   6  
ATOM 7721  H H    . ALA A 1 19  ? -9.396  20.447  -1.859  1.00 0.00 ? 19  ALA A H    6  
ATOM 7722  H HA   . ALA A 1 19  ? -9.460  22.390  0.330   1.00 0.00 ? 19  ALA A HA   6  
ATOM 7723  H HB1  . ALA A 1 19  ? -11.925 20.810  -0.389  1.00 0.00 ? 19  ALA A HB1  6  
ATOM 7724  H HB2  . ALA A 1 19  ? -11.784 22.338  0.513   1.00 0.00 ? 19  ALA A HB2  6  
ATOM 7725  H HB3  . ALA A 1 19  ? -11.565 22.324  -1.253  1.00 0.00 ? 19  ALA A HB3  6  
ATOM 7726  N N    . HIS A 1 20  ? -8.338  20.002  0.888   1.00 0.00 ? 20  HIS A N    6  
ATOM 7727  C CA   . HIS A 1 20  ? -7.922  18.860  1.683   1.00 0.00 ? 20  HIS A CA   6  
ATOM 7728  C C    . HIS A 1 20  ? -6.398  18.730  1.636   1.00 0.00 ? 20  HIS A C    6  
ATOM 7729  O O    . HIS A 1 20  ? -5.758  19.220  0.707   1.00 0.00 ? 20  HIS A O    6  
ATOM 7730  C CB   . HIS A 1 20  ? -8.640  17.589  1.226   1.00 0.00 ? 20  HIS A CB   6  
ATOM 7731  C CG   . HIS A 1 20  ? -8.628  17.381  -0.270  1.00 0.00 ? 20  HIS A CG   6  
ATOM 7732  N ND1  . HIS A 1 20  ? -9.735  16.939  -0.974  1.00 0.00 ? 20  HIS A ND1  6  
ATOM 7733  C CD2  . HIS A 1 20  ? -7.635  17.560  -1.187  1.00 0.00 ? 20  HIS A CD2  6  
ATOM 7734  C CE1  . HIS A 1 20  ? -9.410  16.859  -2.256  1.00 0.00 ? 20  HIS A CE1  6  
ATOM 7735  N NE2  . HIS A 1 20  ? -8.108  17.243  -2.386  1.00 0.00 ? 20  HIS A NE2  6  
ATOM 7736  H H    . HIS A 1 20  ? -7.591  20.538  0.495   1.00 0.00 ? 20  HIS A H    6  
ATOM 7737  H HA   . HIS A 1 20  ? -8.229  19.064  2.709   1.00 0.00 ? 20  HIS A HA   6  
ATOM 7738  H HB2  . HIS A 1 20  ? -8.174  16.728  1.706   1.00 0.00 ? 20  HIS A HB2  6  
ATOM 7739  H HB3  . HIS A 1 20  ? -9.674  17.624  1.569   1.00 0.00 ? 20  HIS A HB3  6  
ATOM 7740  H HD1  . HIS A 1 20  ? -10.628 16.718  -0.582  1.00 0.00 ? 20  HIS A HD1  6  
ATOM 7741  H HD2  . HIS A 1 20  ? -6.623  17.904  -0.971  1.00 0.00 ? 20  HIS A HD2  6  
ATOM 7742  H HE1  . HIS A 1 20  ? -10.068 16.541  -3.065  1.00 0.00 ? 20  HIS A HE1  6  
ATOM 7743  N N    . GLU A 1 21  ? -5.862  18.066  2.650   1.00 0.00 ? 21  GLU A N    6  
ATOM 7744  C CA   . GLU A 1 21  ? -4.425  17.865  2.736   1.00 0.00 ? 21  GLU A CA   6  
ATOM 7745  C C    . GLU A 1 21  ? -4.106  16.378  2.897   1.00 0.00 ? 21  GLU A C    6  
ATOM 7746  O O    . GLU A 1 21  ? -3.976  15.884  4.016   1.00 0.00 ? 21  GLU A O    6  
ATOM 7747  C CB   . GLU A 1 21  ? -3.825  18.682  3.883   1.00 0.00 ? 21  GLU A CB   6  
ATOM 7748  C CG   . GLU A 1 21  ? -2.774  19.665  3.364   1.00 0.00 ? 21  GLU A CG   6  
ATOM 7749  C CD   . GLU A 1 21  ? -1.364  19.091  3.516   1.00 0.00 ? 21  GLU A CD   6  
ATOM 7750  O OE1  . GLU A 1 21  ? -0.774  19.313  4.596   1.00 0.00 ? 21  GLU A OE1  6  
ATOM 7751  O OE2  . GLU A 1 21  ? -0.907  18.443  2.550   1.00 0.00 ? 21  GLU A OE2  6  
ATOM 7752  H H    . GLU A 1 21  ? -6.389  17.671  3.402   1.00 0.00 ? 21  GLU A H    6  
ATOM 7753  H HA   . GLU A 1 21  ? -4.024  18.230  1.790   1.00 0.00 ? 21  GLU A HA   6  
ATOM 7754  H HB2  . GLU A 1 21  ? -4.616  19.227  4.398   1.00 0.00 ? 21  GLU A HB2  6  
ATOM 7755  H HB3  . GLU A 1 21  ? -3.372  18.011  4.613   1.00 0.00 ? 21  GLU A HB3  6  
ATOM 7756  H HG2  . GLU A 1 21  ? -2.967  19.890  2.315   1.00 0.00 ? 21  GLU A HG2  6  
ATOM 7757  H HG3  . GLU A 1 21  ? -2.849  20.605  3.911   1.00 0.00 ? 21  GLU A HG3  6  
ATOM 7758  N N    . GLY A 1 22  ? -3.989  15.704  1.761   1.00 0.00 ? 22  GLY A N    6  
ATOM 7759  C CA   . GLY A 1 22  ? -3.688  14.283  1.762   1.00 0.00 ? 22  GLY A CA   6  
ATOM 7760  C C    . GLY A 1 22  ? -4.054  13.644  0.421   1.00 0.00 ? 22  GLY A C    6  
ATOM 7761  O O    . GLY A 1 22  ? -4.843  14.202  -0.341  1.00 0.00 ? 22  GLY A O    6  
ATOM 7762  H H    . GLY A 1 22  ? -4.097  16.113  0.855   1.00 0.00 ? 22  GLY A H    6  
ATOM 7763  H HA2  . GLY A 1 22  ? -2.627  14.133  1.963   1.00 0.00 ? 22  GLY A HA2  6  
ATOM 7764  H HA3  . GLY A 1 22  ? -4.237  13.792  2.565   1.00 0.00 ? 22  GLY A HA3  6  
ATOM 7765  N N    . LEU A 1 23  ? -3.465  12.483  0.174   1.00 0.00 ? 23  LEU A N    6  
ATOM 7766  C CA   . LEU A 1 23  ? -3.720  11.763  -1.062  1.00 0.00 ? 23  LEU A CA   6  
ATOM 7767  C C    . LEU A 1 23  ? -4.694  10.616  -0.786  1.00 0.00 ? 23  LEU A C    6  
ATOM 7768  O O    . LEU A 1 23  ? -4.771  9.663   -1.560  1.00 0.00 ? 23  LEU A O    6  
ATOM 7769  C CB   . LEU A 1 23  ? -2.405  11.312  -1.700  1.00 0.00 ? 23  LEU A CB   6  
ATOM 7770  C CG   . LEU A 1 23  ? -1.149  12.061  -1.248  1.00 0.00 ? 23  LEU A CG   6  
ATOM 7771  C CD1  . LEU A 1 23  ? 0.117   11.304  -1.657  1.00 0.00 ? 23  LEU A CD1  6  
ATOM 7772  C CD2  . LEU A 1 23  ? -1.150  13.499  -1.769  1.00 0.00 ? 23  LEU A CD2  6  
ATOM 7773  H H    . LEU A 1 23  ? -2.825  12.037  0.799   1.00 0.00 ? 23  LEU A H    6  
ATOM 7774  H HA   . LEU A 1 23  ? -4.193  12.459  -1.754  1.00 0.00 ? 23  LEU A HA   6  
ATOM 7775  H HB2  . LEU A 1 23  ? -2.267  10.252  -1.491  1.00 0.00 ? 23  LEU A HB2  6  
ATOM 7776  H HB3  . LEU A 1 23  ? -2.495  11.415  -2.782  1.00 0.00 ? 23  LEU A HB3  6  
ATOM 7777  H HG   . LEU A 1 23  ? -1.155  12.112  -0.159  1.00 0.00 ? 23  LEU A HG   6  
ATOM 7778  H HD11 . LEU A 1 23  ? -0.048  10.812  -2.616  1.00 0.00 ? 23  LEU A HD11 6  
ATOM 7779  H HD12 . LEU A 1 23  ? 0.946   12.006  -1.746  1.00 0.00 ? 23  LEU A HD12 6  
ATOM 7780  H HD13 . LEU A 1 23  ? 0.353   10.556  -0.900  1.00 0.00 ? 23  LEU A HD13 6  
ATOM 7781  H HD21 . LEU A 1 23  ? -1.922  14.071  -1.254  1.00 0.00 ? 23  LEU A HD21 6  
ATOM 7782  H HD22 . LEU A 1 23  ? -0.177  13.954  -1.584  1.00 0.00 ? 23  LEU A HD22 6  
ATOM 7783  H HD23 . LEU A 1 23  ? -1.353  13.498  -2.840  1.00 0.00 ? 23  LEU A HD23 6  
ATOM 7784  N N    . GLY A 1 24  ? -5.414  10.745  0.318   1.00 0.00 ? 24  GLY A N    6  
ATOM 7785  C CA   . GLY A 1 24  ? -6.380  9.732   0.705   1.00 0.00 ? 24  GLY A CA   6  
ATOM 7786  C C    . GLY A 1 24  ? -5.739  8.682   1.616   1.00 0.00 ? 24  GLY A C    6  
ATOM 7787  O O    . GLY A 1 24  ? -6.439  7.941   2.304   1.00 0.00 ? 24  GLY A O    6  
ATOM 7788  H H    . GLY A 1 24  ? -5.346  11.524  0.942   1.00 0.00 ? 24  GLY A H    6  
ATOM 7789  H HA2  . GLY A 1 24  ? -7.219  10.201  1.220   1.00 0.00 ? 24  GLY A HA2  6  
ATOM 7790  H HA3  . GLY A 1 24  ? -6.783  9.249   -0.185  1.00 0.00 ? 24  GLY A HA3  6  
ATOM 7791  N N    . PHE A 1 25  ? -4.415  8.652   1.589   1.00 0.00 ? 25  PHE A N    6  
ATOM 7792  C CA   . PHE A 1 25  ? -3.671  7.706   2.404   1.00 0.00 ? 25  PHE A CA   6  
ATOM 7793  C C    . PHE A 1 25  ? -2.574  8.413   3.202   1.00 0.00 ? 25  PHE A C    6  
ATOM 7794  O O    . PHE A 1 25  ? -1.793  9.182   2.643   1.00 0.00 ? 25  PHE A O    6  
ATOM 7795  C CB   . PHE A 1 25  ? -3.024  6.704   1.446   1.00 0.00 ? 25  PHE A CB   6  
ATOM 7796  C CG   . PHE A 1 25  ? -1.744  7.215   0.782   1.00 0.00 ? 25  PHE A CG   6  
ATOM 7797  C CD1  . PHE A 1 25  ? -1.818  7.955   -0.357  1.00 0.00 ? 25  PHE A CD1  6  
ATOM 7798  C CD2  . PHE A 1 25  ? -0.533  6.930   1.331   1.00 0.00 ? 25  PHE A CD2  6  
ATOM 7799  C CE1  . PHE A 1 25  ? -0.630  8.429   -0.973  1.00 0.00 ? 25  PHE A CE1  6  
ATOM 7800  C CE2  . PHE A 1 25  ? 0.655   7.405   0.714   1.00 0.00 ? 25  PHE A CE2  6  
ATOM 7801  C CZ   . PHE A 1 25  ? 0.582   8.144   -0.425  1.00 0.00 ? 25  PHE A CZ   6  
ATOM 7802  H H    . PHE A 1 25  ? -3.853  9.258   1.027   1.00 0.00 ? 25  PHE A H    6  
ATOM 7803  H HA   . PHE A 1 25  ? -4.380  7.246   3.093   1.00 0.00 ? 25  PHE A HA   6  
ATOM 7804  H HB2  . PHE A 1 25  ? -2.797  5.789   1.993   1.00 0.00 ? 25  PHE A HB2  6  
ATOM 7805  H HB3  . PHE A 1 25  ? -3.744  6.441   0.671   1.00 0.00 ? 25  PHE A HB3  6  
ATOM 7806  H HD1  . PHE A 1 25  ? -2.789  8.183   -0.797  1.00 0.00 ? 25  PHE A HD1  6  
ATOM 7807  H HD2  . PHE A 1 25  ? -0.474  6.338   2.244   1.00 0.00 ? 25  PHE A HD2  6  
ATOM 7808  H HE1  . PHE A 1 25  ? -0.689  9.022   -1.886  1.00 0.00 ? 25  PHE A HE1  6  
ATOM 7809  H HE2  . PHE A 1 25  ? 1.626   7.177   1.154   1.00 0.00 ? 25  PHE A HE2  6  
ATOM 7810  H HZ   . PHE A 1 25  ? 1.493   8.509   -0.898  1.00 0.00 ? 25  PHE A HZ   6  
ATOM 7811  N N    . SER A 1 26  ? -2.549  8.127   4.495   1.00 0.00 ? 26  SER A N    6  
ATOM 7812  C CA   . SER A 1 26  ? -1.561  8.726   5.375   1.00 0.00 ? 26  SER A CA   6  
ATOM 7813  C C    . SER A 1 26  ? -0.306  7.851   5.425   1.00 0.00 ? 26  SER A C    6  
ATOM 7814  O O    . SER A 1 26  ? -0.384  6.637   5.242   1.00 0.00 ? 26  SER A O    6  
ATOM 7815  C CB   . SER A 1 26  ? -2.125  8.924   6.783   1.00 0.00 ? 26  SER A CB   6  
ATOM 7816  O OG   . SER A 1 26  ? -2.154  10.299  7.158   1.00 0.00 ? 26  SER A OG   6  
ATOM 7817  H H    . SER A 1 26  ? -3.188  7.500   4.941   1.00 0.00 ? 26  SER A H    6  
ATOM 7818  H HA   . SER A 1 26  ? -1.333  9.697   4.936   1.00 0.00 ? 26  SER A HA   6  
ATOM 7819  H HB2  . SER A 1 26  ? -3.134  8.514   6.831   1.00 0.00 ? 26  SER A HB2  6  
ATOM 7820  H HB3  . SER A 1 26  ? -1.520  8.367   7.499   1.00 0.00 ? 26  SER A HB3  6  
ATOM 7821  H HG   . SER A 1 26  ? -1.445  10.803  6.665   1.00 0.00 ? 26  SER A HG   6  
ATOM 7822  N N    . ILE A 1 27  ? 0.821   8.502   5.673   1.00 0.00 ? 27  ILE A N    6  
ATOM 7823  C CA   . ILE A 1 27  ? 2.090   7.799   5.749   1.00 0.00 ? 27  ILE A CA   6  
ATOM 7824  C C    . ILE A 1 27  ? 2.667   7.948   7.158   1.00 0.00 ? 27  ILE A C    6  
ATOM 7825  O O    . ILE A 1 27  ? 2.290   8.858   7.894   1.00 0.00 ? 27  ILE A O    6  
ATOM 7826  C CB   . ILE A 1 27  ? 3.034   8.277   4.644   1.00 0.00 ? 27  ILE A CB   6  
ATOM 7827  C CG1  . ILE A 1 27  ? 3.413   9.746   4.844   1.00 0.00 ? 27  ILE A CG1  6  
ATOM 7828  C CG2  . ILE A 1 27  ? 2.432   8.024   3.261   1.00 0.00 ? 27  ILE A CG2  6  
ATOM 7829  C CD1  . ILE A 1 27  ? 4.931   9.933   4.790   1.00 0.00 ? 27  ILE A CD1  6  
ATOM 7830  H H    . ILE A 1 27  ? 0.876   9.490   5.821   1.00 0.00 ? 27  ILE A H    6  
ATOM 7831  H HA   . ILE A 1 27  ? 1.890   6.743   5.567   1.00 0.00 ? 27  ILE A HA   6  
ATOM 7832  H HB   . ILE A 1 27  ? 3.954   7.696   4.706   1.00 0.00 ? 27  ILE A HB   6  
ATOM 7833  H HG12 . ILE A 1 27  ? 2.941   10.355  4.074   1.00 0.00 ? 27  ILE A HG12 6  
ATOM 7834  H HG13 . ILE A 1 27  ? 3.035   10.095  5.804   1.00 0.00 ? 27  ILE A HG13 6  
ATOM 7835  H HG21 . ILE A 1 27  ? 3.190   8.200   2.497   1.00 0.00 ? 27  ILE A HG21 6  
ATOM 7836  H HG22 . ILE A 1 27  ? 2.086   6.992   3.198   1.00 0.00 ? 27  ILE A HG22 6  
ATOM 7837  H HG23 . ILE A 1 27  ? 1.592   8.699   3.101   1.00 0.00 ? 27  ILE A HG23 6  
ATOM 7838  H HD11 . ILE A 1 27  ? 5.320   9.482   3.877   1.00 0.00 ? 27  ILE A HD11 6  
ATOM 7839  H HD12 . ILE A 1 27  ? 5.167   10.997  4.799   1.00 0.00 ? 27  ILE A HD12 6  
ATOM 7840  H HD13 . ILE A 1 27  ? 5.387   9.452   5.655   1.00 0.00 ? 27  ILE A HD13 6  
ATOM 7841  N N    . ARG A 1 28  ? 3.572   7.039   7.491   1.00 0.00 ? 28  ARG A N    6  
ATOM 7842  C CA   . ARG A 1 28  ? 4.205   7.058   8.799   1.00 0.00 ? 28  ARG A CA   6  
ATOM 7843  C C    . ARG A 1 28  ? 5.682   6.674   8.680   1.00 0.00 ? 28  ARG A C    6  
ATOM 7844  O O    . ARG A 1 28  ? 6.135   6.260   7.614   1.00 0.00 ? 28  ARG A O    6  
ATOM 7845  C CB   . ARG A 1 28  ? 3.510   6.092   9.761   1.00 0.00 ? 28  ARG A CB   6  
ATOM 7846  C CG   . ARG A 1 28  ? 3.088   4.810   9.041   1.00 0.00 ? 28  ARG A CG   6  
ATOM 7847  C CD   . ARG A 1 28  ? 2.755   3.702   10.043  1.00 0.00 ? 28  ARG A CD   6  
ATOM 7848  N NE   . ARG A 1 28  ? 2.824   2.382   9.379   1.00 0.00 ? 28  ARG A NE   6  
ATOM 7849  C CZ   . ARG A 1 28  ? 2.931   1.217   10.033  1.00 0.00 ? 28  ARG A CZ   6  
ATOM 7850  N NH1  . ARG A 1 28  ? 2.980   1.202   11.372  1.00 0.00 ? 28  ARG A NH1  6  
ATOM 7851  N NH2  . ARG A 1 28  ? 2.988   0.067   9.348   1.00 0.00 ? 28  ARG A NH2  6  
ATOM 7852  H H    . ARG A 1 28  ? 3.873   6.302   6.887   1.00 0.00 ? 28  ARG A H    6  
ATOM 7853  H HA   . ARG A 1 28  ? 4.093   8.084   9.148   1.00 0.00 ? 28  ARG A HA   6  
ATOM 7854  H HB2  . ARG A 1 28  ? 4.182   5.847   10.584  1.00 0.00 ? 28  ARG A HB2  6  
ATOM 7855  H HB3  . ARG A 1 28  ? 2.635   6.574   10.197  1.00 0.00 ? 28  ARG A HB3  6  
ATOM 7856  H HG2  . ARG A 1 28  ? 2.220   5.010   8.413   1.00 0.00 ? 28  ARG A HG2  6  
ATOM 7857  H HG3  . ARG A 1 28  ? 3.890   4.479   8.380   1.00 0.00 ? 28  ARG A HG3  6  
ATOM 7858  H HD2  . ARG A 1 28  ? 3.452   3.736   10.879  1.00 0.00 ? 28  ARG A HD2  6  
ATOM 7859  H HD3  . ARG A 1 28  ? 1.757   3.860   10.453  1.00 0.00 ? 28  ARG A HD3  6  
ATOM 7860  H HE   . ARG A 1 28  ? 2.790   2.357   8.380   1.00 0.00 ? 28  ARG A HE   6  
ATOM 7861  H HH11 . ARG A 1 28  ? 2.938   2.061   11.883  1.00 0.00 ? 28  ARG A HH11 6  
ATOM 7862  H HH12 . ARG A 1 28  ? 3.060   0.333   11.860  1.00 0.00 ? 28  ARG A HH12 6  
ATOM 7863  H HH21 . ARG A 1 28  ? 2.951   0.077   8.348   1.00 0.00 ? 28  ARG A HH21 6  
ATOM 7864  H HH22 . ARG A 1 28  ? 3.067   -0.803  9.836   1.00 0.00 ? 28  ARG A HH22 6  
ATOM 7865  N N    . GLY A 1 29  ? 6.391   6.826   9.789   1.00 0.00 ? 29  GLY A N    6  
ATOM 7866  C CA   . GLY A 1 29  ? 7.806   6.500   9.822   1.00 0.00 ? 29  GLY A CA   6  
ATOM 7867  C C    . GLY A 1 29  ? 8.662   7.754   9.629   1.00 0.00 ? 29  GLY A C    6  
ATOM 7868  O O    . GLY A 1 29  ? 8.224   8.862   9.934   1.00 0.00 ? 29  GLY A O    6  
ATOM 7869  H H    . GLY A 1 29  ? 6.014   7.163   10.652  1.00 0.00 ? 29  GLY A H    6  
ATOM 7870  H HA2  . GLY A 1 29  ? 8.053   6.031   10.774  1.00 0.00 ? 29  GLY A HA2  6  
ATOM 7871  H HA3  . GLY A 1 29  ? 8.035   5.776   9.041   1.00 0.00 ? 29  GLY A HA3  6  
ATOM 7872  N N    . GLY A 1 30  ? 9.867   7.537   9.122   1.00 0.00 ? 30  GLY A N    6  
ATOM 7873  C CA   . GLY A 1 30  ? 10.787  8.636   8.885   1.00 0.00 ? 30  GLY A CA   6  
ATOM 7874  C C    . GLY A 1 30  ? 12.186  8.303   9.409   1.00 0.00 ? 30  GLY A C    6  
ATOM 7875  O O    . GLY A 1 30  ? 12.377  7.287   10.076  1.00 0.00 ? 30  GLY A O    6  
ATOM 7876  H H    . GLY A 1 30  ? 10.216  6.633   8.877   1.00 0.00 ? 30  GLY A H    6  
ATOM 7877  H HA2  . GLY A 1 30  ? 10.837  8.849   7.817   1.00 0.00 ? 30  GLY A HA2  6  
ATOM 7878  H HA3  . GLY A 1 30  ? 10.417  9.538   9.372   1.00 0.00 ? 30  GLY A HA3  6  
ATOM 7879  N N    . SER A 1 31  ? 13.127  9.179   9.089   1.00 0.00 ? 31  SER A N    6  
ATOM 7880  C CA   . SER A 1 31  ? 14.502  8.990   9.520   1.00 0.00 ? 31  SER A CA   6  
ATOM 7881  C C    . SER A 1 31  ? 14.714  9.636   10.890  1.00 0.00 ? 31  SER A C    6  
ATOM 7882  O O    . SER A 1 31  ? 15.722  10.304  11.117  1.00 0.00 ? 31  SER A O    6  
ATOM 7883  C CB   . SER A 1 31  ? 15.483  9.573   8.501   1.00 0.00 ? 31  SER A CB   6  
ATOM 7884  O OG   . SER A 1 31  ? 16.817  9.128   8.730   1.00 0.00 ? 31  SER A OG   6  
ATOM 7885  H H    . SER A 1 31  ? 12.963  10.002  8.546   1.00 0.00 ? 31  SER A H    6  
ATOM 7886  H HA   . SER A 1 31  ? 14.640  7.911   9.580   1.00 0.00 ? 31  SER A HA   6  
ATOM 7887  H HB2  . SER A 1 31  ? 15.173  9.288   7.495   1.00 0.00 ? 31  SER A HB2  6  
ATOM 7888  H HB3  . SER A 1 31  ? 15.451  10.662  8.548   1.00 0.00 ? 31  SER A HB3  6  
ATOM 7889  H HG   . SER A 1 31  ? 17.356  9.861   9.144   1.00 0.00 ? 31  SER A HG   6  
ATOM 7890  N N    . GLU A 1 32  ? 13.747  9.415   11.769  1.00 0.00 ? 32  GLU A N    6  
ATOM 7891  C CA   . GLU A 1 32  ? 13.815  9.968   13.111  1.00 0.00 ? 32  GLU A CA   6  
ATOM 7892  C C    . GLU A 1 32  ? 13.859  8.842   14.147  1.00 0.00 ? 32  GLU A C    6  
ATOM 7893  O O    . GLU A 1 32  ? 14.556  8.948   15.154  1.00 0.00 ? 32  GLU A O    6  
ATOM 7894  C CB   . GLU A 1 32  ? 12.640  10.911  13.376  1.00 0.00 ? 32  GLU A CB   6  
ATOM 7895  C CG   . GLU A 1 32  ? 11.323  10.137  13.457  1.00 0.00 ? 32  GLU A CG   6  
ATOM 7896  C CD   . GLU A 1 32  ? 10.128  11.092  13.510  1.00 0.00 ? 32  GLU A CD   6  
ATOM 7897  O OE1  . GLU A 1 32  ? 9.787   11.635  12.437  1.00 0.00 ? 32  GLU A OE1  6  
ATOM 7898  O OE2  . GLU A 1 32  ? 9.583   11.257  14.623  1.00 0.00 ? 32  GLU A OE2  6  
ATOM 7899  H H    . GLU A 1 32  ? 12.930  8.871   11.577  1.00 0.00 ? 32  GLU A H    6  
ATOM 7900  H HA   . GLU A 1 32  ? 14.744  10.537  13.144  1.00 0.00 ? 32  GLU A HA   6  
ATOM 7901  H HB2  . GLU A 1 32  ? 12.806  11.452  14.308  1.00 0.00 ? 32  GLU A HB2  6  
ATOM 7902  H HB3  . GLU A 1 32  ? 12.581  11.656  12.582  1.00 0.00 ? 32  GLU A HB3  6  
ATOM 7903  H HG2  . GLU A 1 32  ? 11.230  9.480   12.592  1.00 0.00 ? 32  GLU A HG2  6  
ATOM 7904  H HG3  . GLU A 1 32  ? 11.324  9.501   14.342  1.00 0.00 ? 32  GLU A HG3  6  
ATOM 7905  N N    . HIS A 1 33  ? 13.105  7.790   13.863  1.00 0.00 ? 33  HIS A N    6  
ATOM 7906  C CA   . HIS A 1 33  ? 13.048  6.647   14.757  1.00 0.00 ? 33  HIS A CA   6  
ATOM 7907  C C    . HIS A 1 33  ? 13.977  5.546   14.241  1.00 0.00 ? 33  HIS A C    6  
ATOM 7908  O O    . HIS A 1 33  ? 14.264  4.586   14.954  1.00 0.00 ? 33  HIS A O    6  
ATOM 7909  C CB   . HIS A 1 33  ? 11.606  6.169   14.939  1.00 0.00 ? 33  HIS A CB   6  
ATOM 7910  C CG   . HIS A 1 33  ? 11.044  6.423   16.317  1.00 0.00 ? 33  HIS A CG   6  
ATOM 7911  N ND1  . HIS A 1 33  ? 10.298  5.484   17.007  1.00 0.00 ? 33  HIS A ND1  6  
ATOM 7912  C CD2  . HIS A 1 33  ? 11.127  7.519   17.125  1.00 0.00 ? 33  HIS A CD2  6  
ATOM 7913  C CE1  . HIS A 1 33  ? 9.953   6.002   18.177  1.00 0.00 ? 33  HIS A CE1  6  
ATOM 7914  N NE2  . HIS A 1 33  ? 10.467  7.263   18.248  1.00 0.00 ? 33  HIS A NE2  6  
ATOM 7915  H H    . HIS A 1 33  ? 12.540  7.713   13.041  1.00 0.00 ? 33  HIS A H    6  
ATOM 7916  H HA   . HIS A 1 33  ? 13.409  6.990   15.727  1.00 0.00 ? 33  HIS A HA   6  
ATOM 7917  H HB2  . HIS A 1 33  ? 10.974  6.666   14.202  1.00 0.00 ? 33  HIS A HB2  6  
ATOM 7918  H HB3  . HIS A 1 33  ? 11.559  5.100   14.730  1.00 0.00 ? 33  HIS A HB3  6  
ATOM 7919  H HD1  . HIS A 1 33  ? 10.061  4.570   16.679  1.00 0.00 ? 33  HIS A HD1  6  
ATOM 7920  H HD2  . HIS A 1 33  ? 11.648  8.447   16.889  1.00 0.00 ? 33  HIS A HD2  6  
ATOM 7921  H HE1  . HIS A 1 33  ? 9.361   5.507   18.947  1.00 0.00 ? 33  HIS A HE1  6  
ATOM 7922  N N    . GLY A 1 34  ? 14.421  5.722   13.005  1.00 0.00 ? 34  GLY A N    6  
ATOM 7923  C CA   . GLY A 1 34  ? 15.311  4.755   12.385  1.00 0.00 ? 34  GLY A CA   6  
ATOM 7924  C C    . GLY A 1 34  ? 14.532  3.782   11.498  1.00 0.00 ? 34  GLY A C    6  
ATOM 7925  O O    . GLY A 1 34  ? 14.782  2.578   11.522  1.00 0.00 ? 34  GLY A O    6  
ATOM 7926  H H    . GLY A 1 34  ? 14.183  6.505   12.432  1.00 0.00 ? 34  GLY A H    6  
ATOM 7927  H HA2  . GLY A 1 34  ? 16.061  5.276   11.789  1.00 0.00 ? 34  GLY A HA2  6  
ATOM 7928  H HA3  . GLY A 1 34  ? 15.846  4.201   13.156  1.00 0.00 ? 34  GLY A HA3  6  
ATOM 7929  N N    . VAL A 1 35  ? 13.603  4.340   10.736  1.00 0.00 ? 35  VAL A N    6  
ATOM 7930  C CA   . VAL A 1 35  ? 12.785  3.537   9.843   1.00 0.00 ? 35  VAL A CA   6  
ATOM 7931  C C    . VAL A 1 35  ? 12.596  4.284   8.522   1.00 0.00 ? 35  VAL A C    6  
ATOM 7932  O O    . VAL A 1 35  ? 13.131  5.377   8.340   1.00 0.00 ? 35  VAL A O    6  
ATOM 7933  C CB   . VAL A 1 35  ? 11.462  3.181   10.524  1.00 0.00 ? 35  VAL A CB   6  
ATOM 7934  C CG1  . VAL A 1 35  ? 11.684  2.794   11.987  1.00 0.00 ? 35  VAL A CG1  6  
ATOM 7935  C CG2  . VAL A 1 35  ? 10.459  4.330   10.407  1.00 0.00 ? 35  VAL A CG2  6  
ATOM 7936  H H    . VAL A 1 35  ? 13.406  5.321   10.723  1.00 0.00 ? 35  VAL A H    6  
ATOM 7937  H HA   . VAL A 1 35  ? 13.325  2.610   9.648   1.00 0.00 ? 35  VAL A HA   6  
ATOM 7938  H HB   . VAL A 1 35  ? 11.042  2.317   10.009  1.00 0.00 ? 35  VAL A HB   6  
ATOM 7939  H HG11 . VAL A 1 35  ? 10.880  2.136   12.315  1.00 0.00 ? 35  VAL A HG11 6  
ATOM 7940  H HG12 . VAL A 1 35  ? 12.639  2.278   12.085  1.00 0.00 ? 35  VAL A HG12 6  
ATOM 7941  H HG13 . VAL A 1 35  ? 11.693  3.693   12.603  1.00 0.00 ? 35  VAL A HG13 6  
ATOM 7942  H HG21 . VAL A 1 35  ? 10.992  5.257   10.194  1.00 0.00 ? 35  VAL A HG21 6  
ATOM 7943  H HG22 . VAL A 1 35  ? 9.759   4.120   9.598   1.00 0.00 ? 35  VAL A HG22 6  
ATOM 7944  H HG23 . VAL A 1 35  ? 9.912   4.432   11.344  1.00 0.00 ? 35  VAL A HG23 6  
ATOM 7945  N N    . GLY A 1 36  ? 11.834  3.665   7.632   1.00 0.00 ? 36  GLY A N    6  
ATOM 7946  C CA   . GLY A 1 36  ? 11.567  4.258   6.333   1.00 0.00 ? 36  GLY A CA   6  
ATOM 7947  C C    . GLY A 1 36  ? 10.194  4.931   6.309   1.00 0.00 ? 36  GLY A C    6  
ATOM 7948  O O    . GLY A 1 36  ? 9.869   5.718   7.197   1.00 0.00 ? 36  GLY A O    6  
ATOM 7949  H H    . GLY A 1 36  ? 11.403  2.776   7.788   1.00 0.00 ? 36  GLY A H    6  
ATOM 7950  H HA2  . GLY A 1 36  ? 12.340  4.990   6.098   1.00 0.00 ? 36  GLY A HA2  6  
ATOM 7951  H HA3  . GLY A 1 36  ? 11.612  3.488   5.562   1.00 0.00 ? 36  GLY A HA3  6  
ATOM 7952  N N    . ILE A 1 37  ? 9.425   4.598   5.282   1.00 0.00 ? 37  ILE A N    6  
ATOM 7953  C CA   . ILE A 1 37  ? 8.094   5.161   5.131   1.00 0.00 ? 37  ILE A CA   6  
ATOM 7954  C C    . ILE A 1 37  ? 7.094   4.033   4.873   1.00 0.00 ? 37  ILE A C    6  
ATOM 7955  O O    . ILE A 1 37  ? 7.416   3.055   4.200   1.00 0.00 ? 37  ILE A O    6  
ATOM 7956  C CB   . ILE A 1 37  ? 8.090   6.245   4.051   1.00 0.00 ? 37  ILE A CB   6  
ATOM 7957  C CG1  . ILE A 1 37  ? 9.236   7.237   4.265   1.00 0.00 ? 37  ILE A CG1  6  
ATOM 7958  C CG2  . ILE A 1 37  ? 6.732   6.945   3.981   1.00 0.00 ? 37  ILE A CG2  6  
ATOM 7959  C CD1  . ILE A 1 37  ? 8.965   8.134   5.475   1.00 0.00 ? 37  ILE A CD1  6  
ATOM 7960  H H    . ILE A 1 37  ? 9.697   3.958   4.564   1.00 0.00 ? 37  ILE A H    6  
ATOM 7961  H HA   . ILE A 1 37  ? 7.834   5.645   6.073   1.00 0.00 ? 37  ILE A HA   6  
ATOM 7962  H HB   . ILE A 1 37  ? 8.256   5.766   3.086   1.00 0.00 ? 37  ILE A HB   6  
ATOM 7963  H HG12 . ILE A 1 37  ? 10.169  6.693   4.412   1.00 0.00 ? 37  ILE A HG12 6  
ATOM 7964  H HG13 . ILE A 1 37  ? 9.362   7.851   3.373   1.00 0.00 ? 37  ILE A HG13 6  
ATOM 7965  H HG21 . ILE A 1 37  ? 6.000   6.273   3.533   1.00 0.00 ? 37  ILE A HG21 6  
ATOM 7966  H HG22 . ILE A 1 37  ? 6.410   7.215   4.986   1.00 0.00 ? 37  ILE A HG22 6  
ATOM 7967  H HG23 . ILE A 1 37  ? 6.818   7.845   3.373   1.00 0.00 ? 37  ILE A HG23 6  
ATOM 7968  H HD11 . ILE A 1 37  ? 8.032   8.676   5.323   1.00 0.00 ? 37  ILE A HD11 6  
ATOM 7969  H HD12 . ILE A 1 37  ? 8.887   7.520   6.372   1.00 0.00 ? 37  ILE A HD12 6  
ATOM 7970  H HD13 . ILE A 1 37  ? 9.783   8.845   5.590   1.00 0.00 ? 37  ILE A HD13 6  
ATOM 7971  N N    . TYR A 1 38  ? 5.900   4.206   5.421   1.00 0.00 ? 38  TYR A N    6  
ATOM 7972  C CA   . TYR A 1 38  ? 4.851   3.214   5.259   1.00 0.00 ? 38  TYR A CA   6  
ATOM 7973  C C    . TYR A 1 38  ? 3.469   3.839   5.465   1.00 0.00 ? 38  TYR A C    6  
ATOM 7974  O O    . TYR A 1 38  ? 3.330   4.821   6.192   1.00 0.00 ? 38  TYR A O    6  
ATOM 7975  C CB   . TYR A 1 38  ? 5.090   2.165   6.347   1.00 0.00 ? 38  TYR A CB   6  
ATOM 7976  C CG   . TYR A 1 38  ? 6.498   1.568   6.336   1.00 0.00 ? 38  TYR A CG   6  
ATOM 7977  C CD1  . TYR A 1 38  ? 6.774   0.464   5.555   1.00 0.00 ? 38  TYR A CD1  6  
ATOM 7978  C CD2  . TYR A 1 38  ? 7.494   2.133   7.108   1.00 0.00 ? 38  TYR A CD2  6  
ATOM 7979  C CE1  . TYR A 1 38  ? 8.099   -0.098  5.545   1.00 0.00 ? 38  TYR A CE1  6  
ATOM 7980  C CE2  . TYR A 1 38  ? 8.819   1.571   7.097   1.00 0.00 ? 38  TYR A CE2  6  
ATOM 7981  C CZ   . TYR A 1 38  ? 9.057   0.483   6.316   1.00 0.00 ? 38  TYR A CZ   6  
ATOM 7982  O OH   . TYR A 1 38  ? 10.309  -0.048  6.307   1.00 0.00 ? 38  TYR A OH   6  
ATOM 7983  H H    . TYR A 1 38  ? 5.646   5.005   5.967   1.00 0.00 ? 38  TYR A H    6  
ATOM 7984  H HA   . TYR A 1 38  ? 4.915   2.819   4.245   1.00 0.00 ? 38  TYR A HA   6  
ATOM 7985  H HB2  . TYR A 1 38  ? 4.906   2.619   7.321   1.00 0.00 ? 38  TYR A HB2  6  
ATOM 7986  H HB3  . TYR A 1 38  ? 4.364   1.361   6.227   1.00 0.00 ? 38  TYR A HB3  6  
ATOM 7987  H HD1  . TYR A 1 38  ? 5.988   0.018   4.945   1.00 0.00 ? 38  TYR A HD1  6  
ATOM 7988  H HD2  . TYR A 1 38  ? 7.276   3.005   7.725   1.00 0.00 ? 38  TYR A HD2  6  
ATOM 7989  H HE1  . TYR A 1 38  ? 8.330   -0.970  4.932   1.00 0.00 ? 38  TYR A HE1  6  
ATOM 7990  H HE2  . TYR A 1 38  ? 9.614   2.007   7.702   1.00 0.00 ? 38  TYR A HE2  6  
ATOM 7991  H HH   . TYR A 1 38  ? 10.794  0.206   7.143   1.00 0.00 ? 38  TYR A HH   6  
ATOM 7992  N N    . VAL A 1 39  ? 2.483   3.244   4.811   1.00 0.00 ? 39  VAL A N    6  
ATOM 7993  C CA   . VAL A 1 39  ? 1.117   3.730   4.913   1.00 0.00 ? 39  VAL A CA   6  
ATOM 7994  C C    . VAL A 1 39  ? 0.664   3.663   6.373   1.00 0.00 ? 39  VAL A C    6  
ATOM 7995  O O    . VAL A 1 39  ? 0.938   2.686   7.068   1.00 0.00 ? 39  VAL A O    6  
ATOM 7996  C CB   . VAL A 1 39  ? 0.208   2.939   3.969   1.00 0.00 ? 39  VAL A CB   6  
ATOM 7997  C CG1  . VAL A 1 39  ? -1.244  3.407   4.087   1.00 0.00 ? 39  VAL A CG1  6  
ATOM 7998  C CG2  . VAL A 1 39  ? 0.701   3.038   2.524   1.00 0.00 ? 39  VAL A CG2  6  
ATOM 7999  H H    . VAL A 1 39  ? 2.604   2.445   4.222   1.00 0.00 ? 39  VAL A H    6  
ATOM 8000  H HA   . VAL A 1 39  ? 1.113   4.771   4.592   1.00 0.00 ? 39  VAL A HA   6  
ATOM 8001  H HB   . VAL A 1 39  ? 0.248   1.891   4.266   1.00 0.00 ? 39  VAL A HB   6  
ATOM 8002  H HG11 . VAL A 1 39  ? -1.371  3.965   5.014   1.00 0.00 ? 39  VAL A HG11 6  
ATOM 8003  H HG12 . VAL A 1 39  ? -1.489  4.048   3.240   1.00 0.00 ? 39  VAL A HG12 6  
ATOM 8004  H HG13 . VAL A 1 39  ? -1.905  2.540   4.090   1.00 0.00 ? 39  VAL A HG13 6  
ATOM 8005  H HG21 . VAL A 1 39  ? 1.790   3.005   2.509   1.00 0.00 ? 39  VAL A HG21 6  
ATOM 8006  H HG22 . VAL A 1 39  ? 0.304   2.202   1.947   1.00 0.00 ? 39  VAL A HG22 6  
ATOM 8007  H HG23 . VAL A 1 39  ? 0.359   3.976   2.087   1.00 0.00 ? 39  VAL A HG23 6  
ATOM 8008  N N    . SER A 1 40  ? -0.020  4.716   6.796   1.00 0.00 ? 40  SER A N    6  
ATOM 8009  C CA   . SER A 1 40  ? -0.514  4.789   8.160   1.00 0.00 ? 40  SER A CA   6  
ATOM 8010  C C    . SER A 1 40  ? -2.034  4.620   8.177   1.00 0.00 ? 40  SER A C    6  
ATOM 8011  O O    . SER A 1 40  ? -2.579  3.961   9.062   1.00 0.00 ? 40  SER A O    6  
ATOM 8012  C CB   . SER A 1 40  ? -0.120  6.114   8.818   1.00 0.00 ? 40  SER A CB   6  
ATOM 8013  O OG   . SER A 1 40  ? -1.259  6.879   9.200   1.00 0.00 ? 40  SER A OG   6  
ATOM 8014  H H    . SER A 1 40  ? -0.239  5.507   6.224   1.00 0.00 ? 40  SER A H    6  
ATOM 8015  H HA   . SER A 1 40  ? -0.031  3.966   8.686   1.00 0.00 ? 40  SER A HA   6  
ATOM 8016  H HB2  . SER A 1 40  ? 0.494   5.914   9.696   1.00 0.00 ? 40  SER A HB2  6  
ATOM 8017  H HB3  . SER A 1 40  ? 0.491   6.694   8.126   1.00 0.00 ? 40  SER A HB3  6  
ATOM 8018  H HG   . SER A 1 40  ? -1.399  6.814   10.188  1.00 0.00 ? 40  SER A HG   6  
ATOM 8019  N N    . LEU A 1 41  ? -2.676  5.226   7.189   1.00 0.00 ? 41  LEU A N    6  
ATOM 8020  C CA   . LEU A 1 41  ? -4.123  5.150   7.080   1.00 0.00 ? 41  LEU A CA   6  
ATOM 8021  C C    . LEU A 1 41  ? -4.523  5.224   5.605   1.00 0.00 ? 41  LEU A C    6  
ATOM 8022  O O    . LEU A 1 41  ? -3.928  5.976   4.834   1.00 0.00 ? 41  LEU A O    6  
ATOM 8023  C CB   . LEU A 1 41  ? -4.783  6.221   7.951   1.00 0.00 ? 41  LEU A CB   6  
ATOM 8024  C CG   . LEU A 1 41  ? -6.288  6.413   7.751   1.00 0.00 ? 41  LEU A CG   6  
ATOM 8025  C CD1  . LEU A 1 41  ? -7.000  6.591   9.094   1.00 0.00 ? 41  LEU A CD1  6  
ATOM 8026  C CD2  . LEU A 1 41  ? -6.570  7.574   6.795   1.00 0.00 ? 41  LEU A CD2  6  
ATOM 8027  H H    . LEU A 1 41  ? -2.225  5.760   6.474   1.00 0.00 ? 41  LEU A H    6  
ATOM 8028  H HA   . LEU A 1 41  ? -4.430  4.181   7.472   1.00 0.00 ? 41  LEU A HA   6  
ATOM 8029  H HB2  . LEU A 1 41  ? -4.604  5.971   8.997   1.00 0.00 ? 41  LEU A HB2  6  
ATOM 8030  H HB3  . LEU A 1 41  ? -4.287  7.172   7.761   1.00 0.00 ? 41  LEU A HB3  6  
ATOM 8031  H HG   . LEU A 1 41  ? -6.690  5.511   7.291   1.00 0.00 ? 41  LEU A HG   6  
ATOM 8032  H HD11 . LEU A 1 41  ? -7.995  7.003   8.925   1.00 0.00 ? 41  LEU A HD11 6  
ATOM 8033  H HD12 . LEU A 1 41  ? -7.087  5.624   9.590   1.00 0.00 ? 41  LEU A HD12 6  
ATOM 8034  H HD13 . LEU A 1 41  ? -6.427  7.272   9.722   1.00 0.00 ? 41  LEU A HD13 6  
ATOM 8035  H HD21 . LEU A 1 41  ? -6.832  7.179   5.813   1.00 0.00 ? 41  LEU A HD21 6  
ATOM 8036  H HD22 . LEU A 1 41  ? -7.398  8.169   7.180   1.00 0.00 ? 41  LEU A HD22 6  
ATOM 8037  H HD23 . LEU A 1 41  ? -5.681  8.199   6.710   1.00 0.00 ? 41  LEU A HD23 6  
ATOM 8038  N N    . VAL A 1 42  ? -5.528  4.434   5.256   1.00 0.00 ? 42  VAL A N    6  
ATOM 8039  C CA   . VAL A 1 42  ? -6.014  4.401   3.888   1.00 0.00 ? 42  VAL A CA   6  
ATOM 8040  C C    . VAL A 1 42  ? -7.544  4.397   3.894   1.00 0.00 ? 42  VAL A C    6  
ATOM 8041  O O    . VAL A 1 42  ? -8.163  3.489   4.446   1.00 0.00 ? 42  VAL A O    6  
ATOM 8042  C CB   . VAL A 1 42  ? -5.416  3.202   3.149   1.00 0.00 ? 42  VAL A CB   6  
ATOM 8043  C CG1  . VAL A 1 42  ? -6.320  2.763   1.995   1.00 0.00 ? 42  VAL A CG1  6  
ATOM 8044  C CG2  . VAL A 1 42  ? -4.004  3.514   2.650   1.00 0.00 ? 42  VAL A CG2  6  
ATOM 8045  H H    . VAL A 1 42  ? -6.006  3.826   5.890   1.00 0.00 ? 42  VAL A H    6  
ATOM 8046  H HA   . VAL A 1 42  ? -5.668  5.309   3.394   1.00 0.00 ? 42  VAL A HA   6  
ATOM 8047  H HB   . VAL A 1 42  ? -5.347  2.374   3.854   1.00 0.00 ? 42  VAL A HB   6  
ATOM 8048  H HG11 . VAL A 1 42  ? -6.764  3.642   1.527   1.00 0.00 ? 42  VAL A HG11 6  
ATOM 8049  H HG12 . VAL A 1 42  ? -5.730  2.218   1.258   1.00 0.00 ? 42  VAL A HG12 6  
ATOM 8050  H HG13 . VAL A 1 42  ? -7.110  2.117   2.378   1.00 0.00 ? 42  VAL A HG13 6  
ATOM 8051  H HG21 . VAL A 1 42  ? -4.048  3.830   1.608   1.00 0.00 ? 42  VAL A HG21 6  
ATOM 8052  H HG22 . VAL A 1 42  ? -3.574  4.313   3.254   1.00 0.00 ? 42  VAL A HG22 6  
ATOM 8053  H HG23 . VAL A 1 42  ? -3.384  2.621   2.734   1.00 0.00 ? 42  VAL A HG23 6  
ATOM 8054  N N    . GLU A 1 43  ? -8.110  5.423   3.275   1.00 0.00 ? 43  GLU A N    6  
ATOM 8055  C CA   . GLU A 1 43  ? -9.555  5.549   3.202   1.00 0.00 ? 43  GLU A CA   6  
ATOM 8056  C C    . GLU A 1 43  ? -10.138 4.463   2.295   1.00 0.00 ? 43  GLU A C    6  
ATOM 8057  O O    . GLU A 1 43  ? -9.616  4.209   1.211   1.00 0.00 ? 43  GLU A O    6  
ATOM 8058  C CB   . GLU A 1 43  ? -9.961  6.943   2.719   1.00 0.00 ? 43  GLU A CB   6  
ATOM 8059  C CG   . GLU A 1 43  ? -10.036 7.927   3.888   1.00 0.00 ? 43  GLU A CG   6  
ATOM 8060  C CD   . GLU A 1 43  ? -11.444 8.513   4.021   1.00 0.00 ? 43  GLU A CD   6  
ATOM 8061  O OE1  . GLU A 1 43  ? -11.717 9.503   3.309   1.00 0.00 ? 43  GLU A OE1  6  
ATOM 8062  O OE2  . GLU A 1 43  ? -12.215 7.957   4.833   1.00 0.00 ? 43  GLU A OE2  6  
ATOM 8063  H H    . GLU A 1 43  ? -7.598  6.157   2.828   1.00 0.00 ? 43  GLU A H    6  
ATOM 8064  H HA   . GLU A 1 43  ? -9.910  5.407   4.224   1.00 0.00 ? 43  GLU A HA   6  
ATOM 8065  H HB2  . GLU A 1 43  ? -9.240  7.300   1.984   1.00 0.00 ? 43  GLU A HB2  6  
ATOM 8066  H HB3  . GLU A 1 43  ? -10.928 6.891   2.219   1.00 0.00 ? 43  GLU A HB3  6  
ATOM 8067  H HG2  . GLU A 1 43  ? -9.760  7.422   4.813   1.00 0.00 ? 43  GLU A HG2  6  
ATOM 8068  H HG3  . GLU A 1 43  ? -9.317  8.732   3.737   1.00 0.00 ? 43  GLU A HG3  6  
ATOM 8069  N N    . PRO A 1 44  ? -11.241 3.836   2.785   1.00 0.00 ? 44  PRO A N    6  
ATOM 8070  C CA   . PRO A 1 44  ? -11.900 2.783   2.031   1.00 0.00 ? 44  PRO A CA   6  
ATOM 8071  C C    . PRO A 1 44  ? -12.706 3.365   0.868   1.00 0.00 ? 44  PRO A C    6  
ATOM 8072  O O    . PRO A 1 44  ? -13.008 2.662   -0.095  1.00 0.00 ? 44  PRO A O    6  
ATOM 8073  C CB   . PRO A 1 44  ? -12.765 2.054   3.046   1.00 0.00 ? 44  PRO A CB   6  
ATOM 8074  C CG   . PRO A 1 44  ? -12.918 3.005   4.223   1.00 0.00 ? 44  PRO A CG   6  
ATOM 8075  C CD   . PRO A 1 44  ? -11.886 4.110   4.066   1.00 0.00 ? 44  PRO A CD   6  
ATOM 8076  H HA   . PRO A 1 44  ? -11.222 2.176   1.617   1.00 0.00 ? 44  PRO A HA   6  
ATOM 8077  H HB2  . PRO A 1 44  ? -13.736 1.800   2.621   1.00 0.00 ? 44  PRO A HB2  6  
ATOM 8078  H HB3  . PRO A 1 44  ? -12.298 1.120   3.357   1.00 0.00 ? 44  PRO A HB3  6  
ATOM 8079  H HG2  . PRO A 1 44  ? -13.924 3.422   4.248   1.00 0.00 ? 44  PRO A HG2  6  
ATOM 8080  H HG3  . PRO A 1 44  ? -12.768 2.475   5.164   1.00 0.00 ? 44  PRO A HG3  6  
ATOM 8081  H HD2  . PRO A 1 44  ? -12.357 5.094   4.069   1.00 0.00 ? 44  PRO A HD2  6  
ATOM 8082  H HD3  . PRO A 1 44  ? -11.166 4.099   4.883   1.00 0.00 ? 44  PRO A HD3  6  
ATOM 8083  N N    . GLY A 1 45  ? -13.030 4.643   0.995   1.00 0.00 ? 45  GLY A N    6  
ATOM 8084  C CA   . GLY A 1 45  ? -13.795 5.327   -0.034  1.00 0.00 ? 45  GLY A CA   6  
ATOM 8085  C C    . GLY A 1 45  ? -12.929 6.352   -0.770  1.00 0.00 ? 45  GLY A C    6  
ATOM 8086  O O    . GLY A 1 45  ? -13.433 7.370   -1.242  1.00 0.00 ? 45  GLY A O    6  
ATOM 8087  H H    . GLY A 1 45  ? -12.780 5.208   1.782   1.00 0.00 ? 45  GLY A H    6  
ATOM 8088  H HA2  . GLY A 1 45  ? -14.187 4.600   -0.745  1.00 0.00 ? 45  GLY A HA2  6  
ATOM 8089  H HA3  . GLY A 1 45  ? -14.652 5.826   0.417   1.00 0.00 ? 45  GLY A HA3  6  
ATOM 8090  N N    . SER A 1 46  ? -11.642 6.049   -0.843  1.00 0.00 ? 46  SER A N    6  
ATOM 8091  C CA   . SER A 1 46  ? -10.702 6.931   -1.513  1.00 0.00 ? 46  SER A CA   6  
ATOM 8092  C C    . SER A 1 46  ? -10.159 6.256   -2.775  1.00 0.00 ? 46  SER A C    6  
ATOM 8093  O O    . SER A 1 46  ? -10.532 5.127   -3.088  1.00 0.00 ? 46  SER A O    6  
ATOM 8094  C CB   . SER A 1 46  ? -9.552  7.319   -0.582  1.00 0.00 ? 46  SER A CB   6  
ATOM 8095  O OG   . SER A 1 46  ? -8.906  6.177   -0.026  1.00 0.00 ? 46  SER A OG   6  
ATOM 8096  H H    . SER A 1 46  ? -11.240 5.219   -0.456  1.00 0.00 ? 46  SER A H    6  
ATOM 8097  H HA   . SER A 1 46  ? -11.275 7.821   -1.772  1.00 0.00 ? 46  SER A HA   6  
ATOM 8098  H HB2  . SER A 1 46  ? -8.824  7.915   -1.134  1.00 0.00 ? 46  SER A HB2  6  
ATOM 8099  H HB3  . SER A 1 46  ? -9.933  7.948   0.223   1.00 0.00 ? 46  SER A HB3  6  
ATOM 8100  H HG   . SER A 1 46  ? -8.046  6.003   -0.506  1.00 0.00 ? 46  SER A HG   6  
ATOM 8101  N N    . LEU A 1 47  ? -9.287  6.977   -3.464  1.00 0.00 ? 47  LEU A N    6  
ATOM 8102  C CA   . LEU A 1 47  ? -8.689  6.463   -4.684  1.00 0.00 ? 47  LEU A CA   6  
ATOM 8103  C C    . LEU A 1 47  ? -7.541  5.517   -4.325  1.00 0.00 ? 47  LEU A C    6  
ATOM 8104  O O    . LEU A 1 47  ? -7.437  4.423   -4.877  1.00 0.00 ? 47  LEU A O    6  
ATOM 8105  C CB   . LEU A 1 47  ? -8.274  7.613   -5.604  1.00 0.00 ? 47  LEU A CB   6  
ATOM 8106  C CG   . LEU A 1 47  ? -7.602  7.211   -6.918  1.00 0.00 ? 47  LEU A CG   6  
ATOM 8107  C CD1  . LEU A 1 47  ? -8.212  5.923   -7.475  1.00 0.00 ? 47  LEU A CD1  6  
ATOM 8108  C CD2  . LEU A 1 47  ? -7.654  8.355   -7.933  1.00 0.00 ? 47  LEU A CD2  6  
ATOM 8109  H H    . LEU A 1 47  ? -8.989  7.895   -3.202  1.00 0.00 ? 47  LEU A H    6  
ATOM 8110  H HA   . LEU A 1 47  ? -9.456  5.892   -5.208  1.00 0.00 ? 47  LEU A HA   6  
ATOM 8111  H HB2  . LEU A 1 47  ? -9.160  8.203   -5.837  1.00 0.00 ? 47  LEU A HB2  6  
ATOM 8112  H HB3  . LEU A 1 47  ? -7.593  8.263   -5.055  1.00 0.00 ? 47  LEU A HB3  6  
ATOM 8113  H HG   . LEU A 1 47  ? -6.550  7.007   -6.717  1.00 0.00 ? 47  LEU A HG   6  
ATOM 8114  H HD11 . LEU A 1 47  ? -9.280  5.904   -7.258  1.00 0.00 ? 47  LEU A HD11 6  
ATOM 8115  H HD12 . LEU A 1 47  ? -8.060  5.886   -8.554  1.00 0.00 ? 47  LEU A HD12 6  
ATOM 8116  H HD13 . LEU A 1 47  ? -7.732  5.063   -7.010  1.00 0.00 ? 47  LEU A HD13 6  
ATOM 8117  H HD21 . LEU A 1 47  ? -6.968  9.145   -7.626  1.00 0.00 ? 47  LEU A HD21 6  
ATOM 8118  H HD22 . LEU A 1 47  ? -7.363  7.983   -8.915  1.00 0.00 ? 47  LEU A HD22 6  
ATOM 8119  H HD23 . LEU A 1 47  ? -8.668  8.753   -7.980  1.00 0.00 ? 47  LEU A HD23 6  
ATOM 8120  N N    . ALA A 1 48  ? -6.708  5.973   -3.401  1.00 0.00 ? 48  ALA A N    6  
ATOM 8121  C CA   . ALA A 1 48  ? -5.572  5.182   -2.962  1.00 0.00 ? 48  ALA A CA   6  
ATOM 8122  C C    . ALA A 1 48  ? -6.021  3.738   -2.727  1.00 0.00 ? 48  ALA A C    6  
ATOM 8123  O O    . ALA A 1 48  ? -5.428  2.804   -3.264  1.00 0.00 ? 48  ALA A O    6  
ATOM 8124  C CB   . ALA A 1 48  ? -4.962  5.814   -1.709  1.00 0.00 ? 48  ALA A CB   6  
ATOM 8125  H H    . ALA A 1 48  ? -6.799  6.864   -2.957  1.00 0.00 ? 48  ALA A H    6  
ATOM 8126  H HA   . ALA A 1 48  ? -4.828  5.197   -3.759  1.00 0.00 ? 48  ALA A HA   6  
ATOM 8127  H HB1  . ALA A 1 48  ? -3.876  5.820   -1.796  1.00 0.00 ? 48  ALA A HB1  6  
ATOM 8128  H HB2  . ALA A 1 48  ? -5.324  6.837   -1.606  1.00 0.00 ? 48  ALA A HB2  6  
ATOM 8129  H HB3  . ALA A 1 48  ? -5.254  5.236   -0.832  1.00 0.00 ? 48  ALA A HB3  6  
ATOM 8130  N N    . GLU A 1 49  ? -7.066  3.601   -1.924  1.00 0.00 ? 49  GLU A N    6  
ATOM 8131  C CA   . GLU A 1 49  ? -7.602  2.288   -1.611  1.00 0.00 ? 49  GLU A CA   6  
ATOM 8132  C C    . GLU A 1 49  ? -8.022  1.567   -2.894  1.00 0.00 ? 49  GLU A C    6  
ATOM 8133  O O    . GLU A 1 49  ? -7.927  0.343   -2.982  1.00 0.00 ? 49  GLU A O    6  
ATOM 8134  C CB   . GLU A 1 49  ? -8.774  2.392   -0.632  1.00 0.00 ? 49  GLU A CB   6  
ATOM 8135  C CG   . GLU A 1 49  ? -9.609  1.110   -0.638  1.00 0.00 ? 49  GLU A CG   6  
ATOM 8136  C CD   . GLU A 1 49  ? -10.565 1.085   -1.832  1.00 0.00 ? 49  GLU A CD   6  
ATOM 8137  O OE1  . GLU A 1 49  ? -11.274 2.098   -2.013  1.00 0.00 ? 49  GLU A OE1  6  
ATOM 8138  O OE2  . GLU A 1 49  ? -10.566 0.052   -2.536  1.00 0.00 ? 49  GLU A OE2  6  
ATOM 8139  H H    . GLU A 1 49  ? -7.543  4.366   -1.491  1.00 0.00 ? 49  GLU A H    6  
ATOM 8140  H HA   . GLU A 1 49  ? -6.785  1.747   -1.134  1.00 0.00 ? 49  GLU A HA   6  
ATOM 8141  H HB2  . GLU A 1 49  ? -8.396  2.580   0.373   1.00 0.00 ? 49  GLU A HB2  6  
ATOM 8142  H HB3  . GLU A 1 49  ? -9.402  3.241   -0.901  1.00 0.00 ? 49  GLU A HB3  6  
ATOM 8143  H HG2  . GLU A 1 49  ? -8.950  0.243   -0.676  1.00 0.00 ? 49  GLU A HG2  6  
ATOM 8144  H HG3  . GLU A 1 49  ? -10.177 1.038   0.289   1.00 0.00 ? 49  GLU A HG3  6  
ATOM 8145  N N    . LYS A 1 50  ? -8.478  2.355   -3.856  1.00 0.00 ? 50  LYS A N    6  
ATOM 8146  C CA   . LYS A 1 50  ? -8.913  1.807   -5.129  1.00 0.00 ? 50  LYS A CA   6  
ATOM 8147  C C    . LYS A 1 50  ? -7.688  1.379   -5.940  1.00 0.00 ? 50  LYS A C    6  
ATOM 8148  O O    . LYS A 1 50  ? -7.772  0.469   -6.763  1.00 0.00 ? 50  LYS A O    6  
ATOM 8149  C CB   . LYS A 1 50  ? -9.817  2.802   -5.860  1.00 0.00 ? 50  LYS A CB   6  
ATOM 8150  C CG   . LYS A 1 50  ? -11.138 2.995   -5.112  1.00 0.00 ? 50  LYS A CG   6  
ATOM 8151  C CD   . LYS A 1 50  ? -11.945 4.148   -5.711  1.00 0.00 ? 50  LYS A CD   6  
ATOM 8152  C CE   . LYS A 1 50  ? -13.408 3.748   -5.910  1.00 0.00 ? 50  LYS A CE   6  
ATOM 8153  N NZ   . LYS A 1 50  ? -13.918 4.271   -7.197  1.00 0.00 ? 50  LYS A NZ   6  
ATOM 8154  H H    . LYS A 1 50  ? -8.552  3.349   -3.776  1.00 0.00 ? 50  LYS A H    6  
ATOM 8155  H HA   . LYS A 1 50  ? -9.513  0.923   -4.917  1.00 0.00 ? 50  LYS A HA   6  
ATOM 8156  H HB2  . LYS A 1 50  ? -9.307  3.760   -5.957  1.00 0.00 ? 50  LYS A HB2  6  
ATOM 8157  H HB3  . LYS A 1 50  ? -10.016 2.444   -6.870  1.00 0.00 ? 50  LYS A HB3  6  
ATOM 8158  H HG2  . LYS A 1 50  ? -11.722 2.076   -5.155  1.00 0.00 ? 50  LYS A HG2  6  
ATOM 8159  H HG3  . LYS A 1 50  ? -10.937 3.195   -4.059  1.00 0.00 ? 50  LYS A HG3  6  
ATOM 8160  H HD2  . LYS A 1 50  ? -11.887 5.017   -5.056  1.00 0.00 ? 50  LYS A HD2  6  
ATOM 8161  H HD3  . LYS A 1 50  ? -11.511 4.441   -6.667  1.00 0.00 ? 50  LYS A HD3  6  
ATOM 8162  H HE2  . LYS A 1 50  ? -13.500 2.662   -5.890  1.00 0.00 ? 50  LYS A HE2  6  
ATOM 8163  H HE3  . LYS A 1 50  ? -14.012 4.134   -5.089  1.00 0.00 ? 50  LYS A HE3  6  
ATOM 8164  H HZ1  . LYS A 1 50  ? -13.296 4.975   -7.541  1.00 0.00 ? 50  LYS A HZ1  6  
ATOM 8165  H HZ2  . LYS A 1 50  ? -13.977 3.525   -7.861  1.00 0.00 ? 50  LYS A HZ2  6  
ATOM 8166  H HZ3  . LYS A 1 50  ? -14.826 4.668   -7.059  1.00 0.00 ? 50  LYS A HZ3  6  
ATOM 8167  N N    . GLU A 1 51  ? -6.579  2.056   -5.679  1.00 0.00 ? 51  GLU A N    6  
ATOM 8168  C CA   . GLU A 1 51  ? -5.339  1.757   -6.375  1.00 0.00 ? 51  GLU A CA   6  
ATOM 8169  C C    . GLU A 1 51  ? -4.700  0.491   -5.800  1.00 0.00 ? 51  GLU A C    6  
ATOM 8170  O O    . GLU A 1 51  ? -3.853  -0.127  -6.442  1.00 0.00 ? 51  GLU A O    6  
ATOM 8171  C CB   . GLU A 1 51  ? -4.372  2.940   -6.305  1.00 0.00 ? 51  GLU A CB   6  
ATOM 8172  C CG   . GLU A 1 51  ? -4.970  4.178   -6.977  1.00 0.00 ? 51  GLU A CG   6  
ATOM 8173  C CD   . GLU A 1 51  ? -5.230  3.922   -8.463  1.00 0.00 ? 51  GLU A CD   6  
ATOM 8174  O OE1  . GLU A 1 51  ? -4.280  4.128   -9.249  1.00 0.00 ? 51  GLU A OE1  6  
ATOM 8175  O OE2  . GLU A 1 51  ? -6.373  3.526   -8.780  1.00 0.00 ? 51  GLU A OE2  6  
ATOM 8176  H H    . GLU A 1 51  ? -6.520  2.795   -5.008  1.00 0.00 ? 51  GLU A H    6  
ATOM 8177  H HA   . GLU A 1 51  ? -5.623  1.589   -7.414  1.00 0.00 ? 51  GLU A HA   6  
ATOM 8178  H HB2  . GLU A 1 51  ? -4.141  3.164   -5.263  1.00 0.00 ? 51  GLU A HB2  6  
ATOM 8179  H HB3  . GLU A 1 51  ? -3.433  2.676   -6.790  1.00 0.00 ? 51  GLU A HB3  6  
ATOM 8180  H HG2  . GLU A 1 51  ? -5.902  4.450   -6.483  1.00 0.00 ? 51  GLU A HG2  6  
ATOM 8181  H HG3  . GLU A 1 51  ? -4.290  5.022   -6.863  1.00 0.00 ? 51  GLU A HG3  6  
ATOM 8182  N N    . GLY A 1 52  ? -5.130  0.144   -4.595  1.00 0.00 ? 52  GLY A N    6  
ATOM 8183  C CA   . GLY A 1 52  ? -4.610  -1.036  -3.926  1.00 0.00 ? 52  GLY A CA   6  
ATOM 8184  C C    . GLY A 1 52  ? -3.945  -0.666  -2.600  1.00 0.00 ? 52  GLY A C    6  
ATOM 8185  O O    . GLY A 1 52  ? -3.849  -1.495  -1.696  1.00 0.00 ? 52  GLY A O    6  
ATOM 8186  H H    . GLY A 1 52  ? -5.820  0.653   -4.080  1.00 0.00 ? 52  GLY A H    6  
ATOM 8187  H HA2  . GLY A 1 52  ? -5.421  -1.743  -3.746  1.00 0.00 ? 52  GLY A HA2  6  
ATOM 8188  H HA3  . GLY A 1 52  ? -3.889  -1.537  -4.572  1.00 0.00 ? 52  GLY A HA3  6  
ATOM 8189  N N    . LEU A 1 53  ? -3.502  0.580   -2.524  1.00 0.00 ? 53  LEU A N    6  
ATOM 8190  C CA   . LEU A 1 53  ? -2.847  1.071   -1.323  1.00 0.00 ? 53  LEU A CA   6  
ATOM 8191  C C    . LEU A 1 53  ? -3.585  0.539   -0.093  1.00 0.00 ? 53  LEU A C    6  
ATOM 8192  O O    . LEU A 1 53  ? -4.749  0.151   -0.182  1.00 0.00 ? 53  LEU A O    6  
ATOM 8193  C CB   . LEU A 1 53  ? -2.733  2.596   -1.360  1.00 0.00 ? 53  LEU A CB   6  
ATOM 8194  C CG   . LEU A 1 53  ? -1.405  3.181   -0.872  1.00 0.00 ? 53  LEU A CG   6  
ATOM 8195  C CD1  . LEU A 1 53  ? -0.408  3.314   -2.025  1.00 0.00 ? 53  LEU A CD1  6  
ATOM 8196  C CD2  . LEU A 1 53  ? -1.625  4.510   -0.148  1.00 0.00 ? 53  LEU A CD2  6  
ATOM 8197  H H    . LEU A 1 53  ? -3.583  1.249   -3.264  1.00 0.00 ? 53  LEU A H    6  
ATOM 8198  H HA   . LEU A 1 53  ? -1.833  0.671   -1.317  1.00 0.00 ? 53  LEU A HA   6  
ATOM 8199  H HB2  . LEU A 1 53  ? -2.898  2.928   -2.385  1.00 0.00 ? 53  LEU A HB2  6  
ATOM 8200  H HB3  . LEU A 1 53  ? -3.536  3.016   -0.755  1.00 0.00 ? 53  LEU A HB3  6  
ATOM 8201  H HG   . LEU A 1 53  ? -0.972  2.488   -0.150  1.00 0.00 ? 53  LEU A HG   6  
ATOM 8202  H HD11 . LEU A 1 53  ? -0.945  3.549   -2.944  1.00 0.00 ? 53  LEU A HD11 6  
ATOM 8203  H HD12 . LEU A 1 53  ? 0.299   4.114   -1.803  1.00 0.00 ? 53  LEU A HD12 6  
ATOM 8204  H HD13 . LEU A 1 53  ? 0.132   2.375   -2.149  1.00 0.00 ? 53  LEU A HD13 6  
ATOM 8205  H HD21 . LEU A 1 53  ? -0.712  4.794   0.375   1.00 0.00 ? 53  LEU A HD21 6  
ATOM 8206  H HD22 . LEU A 1 53  ? -1.884  5.281   -0.873  1.00 0.00 ? 53  LEU A HD22 6  
ATOM 8207  H HD23 . LEU A 1 53  ? -2.437  4.402   0.572   1.00 0.00 ? 53  LEU A HD23 6  
ATOM 8208  N N    . ARG A 1 54  ? -2.878  0.538   1.028   1.00 0.00 ? 54  ARG A N    6  
ATOM 8209  C CA   . ARG A 1 54  ? -3.451  0.061   2.274   1.00 0.00 ? 54  ARG A CA   6  
ATOM 8210  C C    . ARG A 1 54  ? -2.378  0.004   3.364   1.00 0.00 ? 54  ARG A C    6  
ATOM 8211  O O    . ARG A 1 54  ? -1.250  -0.413  3.108   1.00 0.00 ? 54  ARG A O    6  
ATOM 8212  C CB   . ARG A 1 54  ? -4.067  -1.329  2.101   1.00 0.00 ? 54  ARG A CB   6  
ATOM 8213  C CG   . ARG A 1 54  ? -5.528  -1.342  2.554   1.00 0.00 ? 54  ARG A CG   6  
ATOM 8214  C CD   . ARG A 1 54  ? -5.629  -1.336  4.081   1.00 0.00 ? 54  ARG A CD   6  
ATOM 8215  N NE   . ARG A 1 54  ? -6.781  -2.158  4.515   1.00 0.00 ? 54  ARG A NE   6  
ATOM 8216  C CZ   . ARG A 1 54  ? -6.776  -3.497  4.553   1.00 0.00 ? 54  ARG A CZ   6  
ATOM 8217  N NH1  . ARG A 1 54  ? -5.681  -4.174  4.183   1.00 0.00 ? 54  ARG A NH1  6  
ATOM 8218  N NH2  . ARG A 1 54  ? -7.867  -4.160  4.960   1.00 0.00 ? 54  ARG A NH2  6  
ATOM 8219  H H    . ARG A 1 54  ? -1.932  0.856   1.092   1.00 0.00 ? 54  ARG A H    6  
ATOM 8220  H HA   . ARG A 1 54  ? -4.224  0.788   2.523   1.00 0.00 ? 54  ARG A HA   6  
ATOM 8221  H HB2  . ARG A 1 54  ? -4.003  -1.631  1.056   1.00 0.00 ? 54  ARG A HB2  6  
ATOM 8222  H HB3  . ARG A 1 54  ? -3.497  -2.058  2.678   1.00 0.00 ? 54  ARG A HB3  6  
ATOM 8223  H HG2  . ARG A 1 54  ? -6.046  -0.473  2.149   1.00 0.00 ? 54  ARG A HG2  6  
ATOM 8224  H HG3  . ARG A 1 54  ? -6.028  -2.225  2.156   1.00 0.00 ? 54  ARG A HG3  6  
ATOM 8225  H HD2  . ARG A 1 54  ? -4.709  -1.727  4.516   1.00 0.00 ? 54  ARG A HD2  6  
ATOM 8226  H HD3  . ARG A 1 54  ? -5.744  -0.314  4.442   1.00 0.00 ? 54  ARG A HD3  6  
ATOM 8227  H HE   . ARG A 1 54  ? -7.615  -1.684  4.797   1.00 0.00 ? 54  ARG A HE   6  
ATOM 8228  H HH11 . ARG A 1 54  ? -4.866  -3.680  3.879   1.00 0.00 ? 54  ARG A HH11 6  
ATOM 8229  H HH12 . ARG A 1 54  ? -5.677  -5.174  4.211   1.00 0.00 ? 54  ARG A HH12 6  
ATOM 8230  H HH21 . ARG A 1 54  ? -8.685  -3.655  5.236   1.00 0.00 ? 54  ARG A HH21 6  
ATOM 8231  H HH22 . ARG A 1 54  ? -7.864  -5.159  4.989   1.00 0.00 ? 54  ARG A HH22 6  
ATOM 8232  N N    . VAL A 1 55  ? -2.769  0.429   4.557   1.00 0.00 ? 55  VAL A N    6  
ATOM 8233  C CA   . VAL A 1 55  ? -1.855  0.431   5.687   1.00 0.00 ? 55  VAL A CA   6  
ATOM 8234  C C    . VAL A 1 55  ? -1.058  -0.875  5.695   1.00 0.00 ? 55  VAL A C    6  
ATOM 8235  O O    . VAL A 1 55  ? -1.633  -1.957  5.793   1.00 0.00 ? 55  VAL A O    6  
ATOM 8236  C CB   . VAL A 1 55  ? -2.629  0.667   6.985   1.00 0.00 ? 55  VAL A CB   6  
ATOM 8237  C CG1  . VAL A 1 55  ? -1.718  0.505   8.204   1.00 0.00 ? 55  VAL A CG1  6  
ATOM 8238  C CG2  . VAL A 1 55  ? -3.299  2.042   6.981   1.00 0.00 ? 55  VAL A CG2  6  
ATOM 8239  H H    . VAL A 1 55  ? -3.689  0.766   4.757   1.00 0.00 ? 55  VAL A H    6  
ATOM 8240  H HA   . VAL A 1 55  ? -1.164  1.263   5.549   1.00 0.00 ? 55  VAL A HA   6  
ATOM 8241  H HB   . VAL A 1 55  ? -3.413  -0.087  7.050   1.00 0.00 ? 55  VAL A HB   6  
ATOM 8242  H HG11 . VAL A 1 55  ? -2.318  0.237   9.073   1.00 0.00 ? 55  VAL A HG11 6  
ATOM 8243  H HG12 . VAL A 1 55  ? -0.989  -0.282  8.010   1.00 0.00 ? 55  VAL A HG12 6  
ATOM 8244  H HG13 . VAL A 1 55  ? -1.197  1.443   8.396   1.00 0.00 ? 55  VAL A HG13 6  
ATOM 8245  H HG21 . VAL A 1 55  ? -4.155  2.028   6.306   1.00 0.00 ? 55  VAL A HG21 6  
ATOM 8246  H HG22 . VAL A 1 55  ? -3.636  2.285   7.989   1.00 0.00 ? 55  VAL A HG22 6  
ATOM 8247  H HG23 . VAL A 1 55  ? -2.585  2.794   6.646   1.00 0.00 ? 55  VAL A HG23 6  
ATOM 8248  N N    . GLY A 1 56  ? 0.255   -0.730  5.590   1.00 0.00 ? 56  GLY A N    6  
ATOM 8249  C CA   . GLY A 1 56  ? 1.137   -1.884  5.584   1.00 0.00 ? 56  GLY A CA   6  
ATOM 8250  C C    . GLY A 1 56  ? 2.186   -1.768  4.476   1.00 0.00 ? 56  GLY A C    6  
ATOM 8251  O O    . GLY A 1 56  ? 3.332   -2.175  4.656   1.00 0.00 ? 56  GLY A O    6  
ATOM 8252  H H    . GLY A 1 56  ? 0.716   0.154   5.510   1.00 0.00 ? 56  GLY A H    6  
ATOM 8253  H HA2  . GLY A 1 56  ? 1.633   -1.972  6.551   1.00 0.00 ? 56  GLY A HA2  6  
ATOM 8254  H HA3  . GLY A 1 56  ? 0.552   -2.793  5.442   1.00 0.00 ? 56  GLY A HA3  6  
ATOM 8255  N N    . ASP A 1 57  ? 1.755   -1.210  3.354   1.00 0.00 ? 57  ASP A N    6  
ATOM 8256  C CA   . ASP A 1 57  ? 2.642   -1.035  2.217   1.00 0.00 ? 57  ASP A CA   6  
ATOM 8257  C C    . ASP A 1 57  ? 3.914   -0.318  2.673   1.00 0.00 ? 57  ASP A C    6  
ATOM 8258  O O    . ASP A 1 57  ? 4.078   -0.031  3.858   1.00 0.00 ? 57  ASP A O    6  
ATOM 8259  C CB   . ASP A 1 57  ? 1.983   -0.182  1.131   1.00 0.00 ? 57  ASP A CB   6  
ATOM 8260  C CG   . ASP A 1 57  ? 0.806   -0.846  0.412   1.00 0.00 ? 57  ASP A CG   6  
ATOM 8261  O OD1  . ASP A 1 57  ? 0.774   -2.095  0.411   1.00 0.00 ? 57  ASP A OD1  6  
ATOM 8262  O OD2  . ASP A 1 57  ? -0.034  -0.089  -0.120  1.00 0.00 ? 57  ASP A OD2  6  
ATOM 8263  H H    . ASP A 1 57  ? 0.820   -0.881  3.216   1.00 0.00 ? 57  ASP A H    6  
ATOM 8264  H HA   . ASP A 1 57  ? 2.839   -2.042  1.850   1.00 0.00 ? 57  ASP A HA   6  
ATOM 8265  H HB2  . ASP A 1 57  ? 1.636   0.748   1.580   1.00 0.00 ? 57  ASP A HB2  6  
ATOM 8266  H HB3  . ASP A 1 57  ? 2.738   0.084   0.390   1.00 0.00 ? 57  ASP A HB3  6  
ATOM 8267  N N    . GLN A 1 58  ? 4.782   -0.049  1.709   1.00 0.00 ? 58  GLN A N    6  
ATOM 8268  C CA   . GLN A 1 58  ? 6.034   0.629   1.997   1.00 0.00 ? 58  GLN A CA   6  
ATOM 8269  C C    . GLN A 1 58  ? 6.377   1.612   0.876   1.00 0.00 ? 58  GLN A C    6  
ATOM 8270  O O    . GLN A 1 58  ? 6.670   1.202   -0.246  1.00 0.00 ? 58  GLN A O    6  
ATOM 8271  C CB   . GLN A 1 58  ? 7.167   -0.378  2.208   1.00 0.00 ? 58  GLN A CB   6  
ATOM 8272  C CG   . GLN A 1 58  ? 8.496   0.337   2.461   1.00 0.00 ? 58  GLN A CG   6  
ATOM 8273  C CD   . GLN A 1 58  ? 9.574   -0.653  2.908   1.00 0.00 ? 58  GLN A CD   6  
ATOM 8274  O OE1  . GLN A 1 58  ? 9.569   -1.819  2.550   1.00 0.00 ? 58  GLN A OE1  6  
ATOM 8275  N NE2  . GLN A 1 58  ? 10.496  -0.124  3.707   1.00 0.00 ? 58  GLN A NE2  6  
ATOM 8276  H H    . GLN A 1 58  ? 4.641   -0.285  0.748   1.00 0.00 ? 58  GLN A H    6  
ATOM 8277  H HA   . GLN A 1 58  ? 5.863   1.173   2.926   1.00 0.00 ? 58  GLN A HA   6  
ATOM 8278  H HB2  . GLN A 1 58  ? 6.931   -1.024  3.053   1.00 0.00 ? 58  GLN A HB2  6  
ATOM 8279  H HB3  . GLN A 1 58  ? 7.256   -1.019  1.331   1.00 0.00 ? 58  GLN A HB3  6  
ATOM 8280  H HG2  . GLN A 1 58  ? 8.818   0.845   1.552   1.00 0.00 ? 58  GLN A HG2  6  
ATOM 8281  H HG3  . GLN A 1 58  ? 8.362   1.103   3.225   1.00 0.00 ? 58  GLN A HG3  6  
ATOM 8282  H HE21 . GLN A 1 58  ? 10.442  0.841   3.963   1.00 0.00 ? 58  GLN A HE21 6  
ATOM 8283  H HE22 . GLN A 1 58  ? 11.243  -0.692  4.053   1.00 0.00 ? 58  GLN A HE22 6  
ATOM 8284  N N    . ILE A 1 59  ? 6.327   2.891   1.218   1.00 0.00 ? 59  ILE A N    6  
ATOM 8285  C CA   . ILE A 1 59  ? 6.628   3.936   0.253   1.00 0.00 ? 59  ILE A CA   6  
ATOM 8286  C C    . ILE A 1 59  ? 8.126   3.922   -0.056  1.00 0.00 ? 59  ILE A C    6  
ATOM 8287  O O    . ILE A 1 59  ? 8.906   4.607   0.603   1.00 0.00 ? 59  ILE A O    6  
ATOM 8288  C CB   . ILE A 1 59  ? 6.116   5.288   0.752   1.00 0.00 ? 59  ILE A CB   6  
ATOM 8289  C CG1  . ILE A 1 59  ? 4.653   5.193   1.191   1.00 0.00 ? 59  ILE A CG1  6  
ATOM 8290  C CG2  . ILE A 1 59  ? 6.328   6.377   -0.302  1.00 0.00 ? 59  ILE A CG2  6  
ATOM 8291  C CD1  . ILE A 1 59  ? 3.727   5.034   -0.017  1.00 0.00 ? 59  ILE A CD1  6  
ATOM 8292  H H    . ILE A 1 59  ? 6.087   3.217   2.132   1.00 0.00 ? 59  ILE A H    6  
ATOM 8293  H HA   . ILE A 1 59  ? 6.083   3.702   -0.662  1.00 0.00 ? 59  ILE A HA   6  
ATOM 8294  H HB   . ILE A 1 59  ? 6.697   5.572   1.629   1.00 0.00 ? 59  ILE A HB   6  
ATOM 8295  H HG12 . ILE A 1 59  ? 4.526   4.346   1.864   1.00 0.00 ? 59  ILE A HG12 6  
ATOM 8296  H HG13 . ILE A 1 59  ? 4.378   6.088   1.749   1.00 0.00 ? 59  ILE A HG13 6  
ATOM 8297  H HG21 . ILE A 1 59  ? 7.231   6.160   -0.872  1.00 0.00 ? 59  ILE A HG21 6  
ATOM 8298  H HG22 . ILE A 1 59  ? 5.471   6.404   -0.975  1.00 0.00 ? 59  ILE A HG22 6  
ATOM 8299  H HG23 . ILE A 1 59  ? 6.433   7.344   0.191   1.00 0.00 ? 59  ILE A HG23 6  
ATOM 8300  H HD11 . ILE A 1 59  ? 2.993   4.255   0.188   1.00 0.00 ? 59  ILE A HD11 6  
ATOM 8301  H HD12 . ILE A 1 59  ? 3.214   5.977   -0.208  1.00 0.00 ? 59  ILE A HD12 6  
ATOM 8302  H HD13 . ILE A 1 59  ? 4.316   4.758   -0.892  1.00 0.00 ? 59  ILE A HD13 6  
ATOM 8303  N N    . LEU A 1 60  ? 8.483   3.133   -1.060  1.00 0.00 ? 60  LEU A N    6  
ATOM 8304  C CA   . LEU A 1 60  ? 9.874   3.021   -1.465  1.00 0.00 ? 60  LEU A CA   6  
ATOM 8305  C C    . LEU A 1 60  ? 10.315  4.328   -2.125  1.00 0.00 ? 60  LEU A C    6  
ATOM 8306  O O    . LEU A 1 60  ? 11.404  4.830   -1.851  1.00 0.00 ? 60  LEU A O    6  
ATOM 8307  C CB   . LEU A 1 60  ? 10.077  1.787   -2.347  1.00 0.00 ? 60  LEU A CB   6  
ATOM 8308  C CG   . LEU A 1 60  ? 9.401   0.501   -1.867  1.00 0.00 ? 60  LEU A CG   6  
ATOM 8309  C CD1  . LEU A 1 60  ? 9.543   -0.614  -2.905  1.00 0.00 ? 60  LEU A CD1  6  
ATOM 8310  C CD2  . LEU A 1 60  ? 9.934   0.079   -0.497  1.00 0.00 ? 60  LEU A CD2  6  
ATOM 8311  H H    . LEU A 1 60  ? 7.842   2.579   -1.591  1.00 0.00 ? 60  LEU A H    6  
ATOM 8312  H HA   . LEU A 1 60  ? 10.466  2.873   -0.562  1.00 0.00 ? 60  LEU A HA   6  
ATOM 8313  H HB2  . LEU A 1 60  ? 9.710   2.016   -3.347  1.00 0.00 ? 60  LEU A HB2  6  
ATOM 8314  H HB3  . LEU A 1 60  ? 11.147  1.600   -2.435  1.00 0.00 ? 60  LEU A HB3  6  
ATOM 8315  H HG   . LEU A 1 60  ? 8.335   0.698   -1.751  1.00 0.00 ? 60  LEU A HG   6  
ATOM 8316  H HD11 . LEU A 1 60  ? 8.632   -0.675  -3.500  1.00 0.00 ? 60  LEU A HD11 6  
ATOM 8317  H HD12 . LEU A 1 60  ? 10.389  -0.396  -3.558  1.00 0.00 ? 60  LEU A HD12 6  
ATOM 8318  H HD13 . LEU A 1 60  ? 9.711   -1.564  -2.398  1.00 0.00 ? 60  LEU A HD13 6  
ATOM 8319  H HD21 . LEU A 1 60  ? 10.194  0.967   0.081   1.00 0.00 ? 60  LEU A HD21 6  
ATOM 8320  H HD22 . LEU A 1 60  ? 9.169   -0.488  0.033   1.00 0.00 ? 60  LEU A HD22 6  
ATOM 8321  H HD23 . LEU A 1 60  ? 10.821  -0.541  -0.627  1.00 0.00 ? 60  LEU A HD23 6  
ATOM 8322  N N    . ARG A 1 61  ? 9.447   4.843   -2.983  1.00 0.00 ? 61  ARG A N    6  
ATOM 8323  C CA   . ARG A 1 61  ? 9.734   6.083   -3.685  1.00 0.00 ? 61  ARG A CA   6  
ATOM 8324  C C    . ARG A 1 61  ? 8.484   6.964   -3.739  1.00 0.00 ? 61  ARG A C    6  
ATOM 8325  O O    . ARG A 1 61  ? 7.383   6.505   -3.436  1.00 0.00 ? 61  ARG A O    6  
ATOM 8326  C CB   . ARG A 1 61  ? 10.218  5.809   -5.110  1.00 0.00 ? 61  ARG A CB   6  
ATOM 8327  C CG   . ARG A 1 61  ? 11.718  5.506   -5.131  1.00 0.00 ? 61  ARG A CG   6  
ATOM 8328  C CD   . ARG A 1 61  ? 12.093  4.678   -6.361  1.00 0.00 ? 61  ARG A CD   6  
ATOM 8329  N NE   . ARG A 1 61  ? 13.384  3.991   -6.135  1.00 0.00 ? 61  ARG A NE   6  
ATOM 8330  C CZ   . ARG A 1 61  ? 14.016  3.256   -7.059  1.00 0.00 ? 61  ARG A CZ   6  
ATOM 8331  N NH1  . ARG A 1 61  ? 13.481  3.109   -8.279  1.00 0.00 ? 61  ARG A NH1  6  
ATOM 8332  N NH2  . ARG A 1 61  ? 15.184  2.668   -6.765  1.00 0.00 ? 61  ARG A NH2  6  
ATOM 8333  H H    . ARG A 1 61  ? 8.563   4.429   -3.201  1.00 0.00 ? 61  ARG A H    6  
ATOM 8334  H HA   . ARG A 1 61  ? 10.523  6.557   -3.102  1.00 0.00 ? 61  ARG A HA   6  
ATOM 8335  H HB2  . ARG A 1 61  ? 9.668   4.968   -5.530  1.00 0.00 ? 61  ARG A HB2  6  
ATOM 8336  H HB3  . ARG A 1 61  ? 10.010  6.673   -5.741  1.00 0.00 ? 61  ARG A HB3  6  
ATOM 8337  H HG2  . ARG A 1 61  ? 12.281  6.439   -5.130  1.00 0.00 ? 61  ARG A HG2  6  
ATOM 8338  H HG3  . ARG A 1 61  ? 11.996  4.966   -4.226  1.00 0.00 ? 61  ARG A HG3  6  
ATOM 8339  H HD2  . ARG A 1 61  ? 11.313  3.946   -6.569  1.00 0.00 ? 61  ARG A HD2  6  
ATOM 8340  H HD3  . ARG A 1 61  ? 12.165  5.324   -7.237  1.00 0.00 ? 61  ARG A HD3  6  
ATOM 8341  H HE   . ARG A 1 61  ? 13.810  4.080   -5.235  1.00 0.00 ? 61  ARG A HE   6  
ATOM 8342  H HH11 . ARG A 1 61  ? 12.610  3.547   -8.499  1.00 0.00 ? 61  ARG A HH11 6  
ATOM 8343  H HH12 . ARG A 1 61  ? 13.953  2.561   -8.969  1.00 0.00 ? 61  ARG A HH12 6  
ATOM 8344  H HH21 . ARG A 1 61  ? 15.583  2.778   -5.854  1.00 0.00 ? 61  ARG A HH21 6  
ATOM 8345  H HH22 . ARG A 1 61  ? 15.656  2.120   -7.455  1.00 0.00 ? 61  ARG A HH22 6  
ATOM 8346  N N    . VAL A 1 62  ? 8.695   8.213   -4.127  1.00 0.00 ? 62  VAL A N    6  
ATOM 8347  C CA   . VAL A 1 62  ? 7.600   9.162   -4.224  1.00 0.00 ? 62  VAL A CA   6  
ATOM 8348  C C    . VAL A 1 62  ? 7.833   10.083  -5.423  1.00 0.00 ? 62  VAL A C    6  
ATOM 8349  O O    . VAL A 1 62  ? 8.792   10.853  -5.441  1.00 0.00 ? 62  VAL A O    6  
ATOM 8350  C CB   . VAL A 1 62  ? 7.448   9.924   -2.906  1.00 0.00 ? 62  VAL A CB   6  
ATOM 8351  C CG1  . VAL A 1 62  ? 8.535   10.991  -2.762  1.00 0.00 ? 62  VAL A CG1  6  
ATOM 8352  C CG2  . VAL A 1 62  ? 6.053   10.541  -2.786  1.00 0.00 ? 62  VAL A CG2  6  
ATOM 8353  H H    . VAL A 1 62  ? 9.594   8.578   -4.371  1.00 0.00 ? 62  VAL A H    6  
ATOM 8354  H HA   . VAL A 1 62  ? 6.685   8.593   -4.392  1.00 0.00 ? 62  VAL A HA   6  
ATOM 8355  H HB   . VAL A 1 62  ? 7.569   9.210   -2.091  1.00 0.00 ? 62  VAL A HB   6  
ATOM 8356  H HG11 . VAL A 1 62  ? 8.752   11.149  -1.705  1.00 0.00 ? 62  VAL A HG11 6  
ATOM 8357  H HG12 . VAL A 1 62  ? 9.439   10.661  -3.273  1.00 0.00 ? 62  VAL A HG12 6  
ATOM 8358  H HG13 . VAL A 1 62  ? 8.188   11.925  -3.204  1.00 0.00 ? 62  VAL A HG13 6  
ATOM 8359  H HG21 . VAL A 1 62  ? 5.343   9.948   -3.362  1.00 0.00 ? 62  VAL A HG21 6  
ATOM 8360  H HG22 . VAL A 1 62  ? 5.751   10.555  -1.739  1.00 0.00 ? 62  VAL A HG22 6  
ATOM 8361  H HG23 . VAL A 1 62  ? 6.073   11.560  -3.173  1.00 0.00 ? 62  VAL A HG23 6  
ATOM 8362  N N    . ASN A 1 63  ? 6.940   9.974   -6.396  1.00 0.00 ? 63  ASN A N    6  
ATOM 8363  C CA   . ASN A 1 63  ? 7.037   10.787  -7.596  1.00 0.00 ? 63  ASN A CA   6  
ATOM 8364  C C    . ASN A 1 63  ? 8.153   10.240  -8.489  1.00 0.00 ? 63  ASN A C    6  
ATOM 8365  O O    . ASN A 1 63  ? 7.908   9.866   -9.635  1.00 0.00 ? 63  ASN A O    6  
ATOM 8366  C CB   . ASN A 1 63  ? 7.376   12.239  -7.251  1.00 0.00 ? 63  ASN A CB   6  
ATOM 8367  C CG   . ASN A 1 63  ? 7.006   13.176  -8.402  1.00 0.00 ? 63  ASN A CG   6  
ATOM 8368  O OD1  . ASN A 1 63  ? 7.852   13.771  -9.050  1.00 0.00 ? 63  ASN A OD1  6  
ATOM 8369  N ND2  . ASN A 1 63  ? 5.698   13.275  -8.620  1.00 0.00 ? 63  ASN A ND2  6  
ATOM 8370  H H    . ASN A 1 63  ? 6.163   9.345   -6.373  1.00 0.00 ? 63  ASN A H    6  
ATOM 8371  H HA   . ASN A 1 63  ? 6.056   10.721  -8.066  1.00 0.00 ? 63  ASN A HA   6  
ATOM 8372  H HB2  . ASN A 1 63  ? 6.843   12.536  -6.349  1.00 0.00 ? 63  ASN A HB2  6  
ATOM 8373  H HB3  . ASN A 1 63  ? 8.441   12.326  -7.035  1.00 0.00 ? 63  ASN A HB3  6  
ATOM 8374  H HD21 . ASN A 1 63  ? 5.056   12.760  -8.052  1.00 0.00 ? 63  ASN A HD21 6  
ATOM 8375  H HD22 . ASN A 1 63  ? 5.356   13.864  -9.352  1.00 0.00 ? 63  ASN A HD22 6  
ATOM 8376  N N    . ASP A 1 64  ? 9.354   10.210  -7.930  1.00 0.00 ? 64  ASP A N    6  
ATOM 8377  C CA   . ASP A 1 64  ? 10.507  9.715   -8.661  1.00 0.00 ? 64  ASP A CA   6  
ATOM 8378  C C    . ASP A 1 64  ? 11.669  9.501   -7.688  1.00 0.00 ? 64  ASP A C    6  
ATOM 8379  O O    . ASP A 1 64  ? 12.349  8.477   -7.744  1.00 0.00 ? 64  ASP A O    6  
ATOM 8380  C CB   . ASP A 1 64  ? 10.959  10.720  -9.723  1.00 0.00 ? 64  ASP A CB   6  
ATOM 8381  C CG   . ASP A 1 64  ? 12.177  10.290  -10.543 1.00 0.00 ? 64  ASP A CG   6  
ATOM 8382  O OD1  . ASP A 1 64  ? 13.279  10.265  -9.954  1.00 0.00 ? 64  ASP A OD1  6  
ATOM 8383  O OD2  . ASP A 1 64  ? 11.978  9.995   -11.742 1.00 0.00 ? 64  ASP A OD2  6  
ATOM 8384  H H    . ASP A 1 64  ? 9.544   10.516  -6.997  1.00 0.00 ? 64  ASP A H    6  
ATOM 8385  H HA   . ASP A 1 64  ? 10.175  8.787   -9.126  1.00 0.00 ? 64  ASP A HA   6  
ATOM 8386  H HB2  . ASP A 1 64  ? 10.128  10.905  -10.403 1.00 0.00 ? 64  ASP A HB2  6  
ATOM 8387  H HB3  . ASP A 1 64  ? 11.187  11.667  -9.232  1.00 0.00 ? 64  ASP A HB3  6  
ATOM 8388  N N    . LYS A 1 65  ? 11.860  10.482  -6.819  1.00 0.00 ? 65  LYS A N    6  
ATOM 8389  C CA   . LYS A 1 65  ? 12.927  10.414  -5.836  1.00 0.00 ? 65  LYS A CA   6  
ATOM 8390  C C    . LYS A 1 65  ? 12.569  9.374   -4.772  1.00 0.00 ? 65  LYS A C    6  
ATOM 8391  O O    . LYS A 1 65  ? 11.393  9.148   -4.491  1.00 0.00 ? 65  LYS A O    6  
ATOM 8392  C CB   . LYS A 1 65  ? 13.219  11.802  -5.264  1.00 0.00 ? 65  LYS A CB   6  
ATOM 8393  C CG   . LYS A 1 65  ? 13.819  12.720  -6.331  1.00 0.00 ? 65  LYS A CG   6  
ATOM 8394  C CD   . LYS A 1 65  ? 14.984  13.533  -5.763  1.00 0.00 ? 65  LYS A CD   6  
ATOM 8395  C CE   . LYS A 1 65  ? 14.639  15.023  -5.713  1.00 0.00 ? 65  LYS A CE   6  
ATOM 8396  N NZ   . LYS A 1 65  ? 15.865  15.843  -5.836  1.00 0.00 ? 65  LYS A NZ   6  
ATOM 8397  H H    . LYS A 1 65  ? 11.302  11.311  -6.780  1.00 0.00 ? 65  LYS A H    6  
ATOM 8398  H HA   . LYS A 1 65  ? 13.827  10.082  -6.353  1.00 0.00 ? 65  LYS A HA   6  
ATOM 8399  H HB2  . LYS A 1 65  ? 12.299  12.241  -4.877  1.00 0.00 ? 65  LYS A HB2  6  
ATOM 8400  H HB3  . LYS A 1 65  ? 13.908  11.716  -4.424  1.00 0.00 ? 65  LYS A HB3  6  
ATOM 8401  H HG2  . LYS A 1 65  ? 14.165  12.123  -7.175  1.00 0.00 ? 65  LYS A HG2  6  
ATOM 8402  H HG3  . LYS A 1 65  ? 13.051  13.394  -6.710  1.00 0.00 ? 65  LYS A HG3  6  
ATOM 8403  H HD2  . LYS A 1 65  ? 15.225  13.178  -4.761  1.00 0.00 ? 65  LYS A HD2  6  
ATOM 8404  H HD3  . LYS A 1 65  ? 15.871  13.382  -6.377  1.00 0.00 ? 65  LYS A HD3  6  
ATOM 8405  H HE2  . LYS A 1 65  ? 13.947  15.270  -6.518  1.00 0.00 ? 65  LYS A HE2  6  
ATOM 8406  H HE3  . LYS A 1 65  ? 14.133  15.254  -4.776  1.00 0.00 ? 65  LYS A HE3  6  
ATOM 8407  H HZ1  . LYS A 1 65  ? 15.725  16.551  -6.527  1.00 0.00 ? 65  LYS A HZ1  6  
ATOM 8408  H HZ2  . LYS A 1 65  ? 16.069  16.272  -4.955  1.00 0.00 ? 65  LYS A HZ2  6  
ATOM 8409  H HZ3  . LYS A 1 65  ? 16.631  15.259  -6.107  1.00 0.00 ? 65  LYS A HZ3  6  
ATOM 8410  N N    . SER A 1 66  ? 13.604  8.767   -4.210  1.00 0.00 ? 66  SER A N    6  
ATOM 8411  C CA   . SER A 1 66  ? 13.413  7.757   -3.184  1.00 0.00 ? 66  SER A CA   6  
ATOM 8412  C C    . SER A 1 66  ? 13.503  8.396   -1.797  1.00 0.00 ? 66  SER A C    6  
ATOM 8413  O O    . SER A 1 66  ? 14.275  9.330   -1.589  1.00 0.00 ? 66  SER A O    6  
ATOM 8414  C CB   . SER A 1 66  ? 14.443  6.633   -3.319  1.00 0.00 ? 66  SER A CB   6  
ATOM 8415  O OG   . SER A 1 66  ? 15.699  6.990   -2.748  1.00 0.00 ? 66  SER A OG   6  
ATOM 8416  H H    . SER A 1 66  ? 14.558  8.957   -4.445  1.00 0.00 ? 66  SER A H    6  
ATOM 8417  H HA   . SER A 1 66  ? 12.414  7.356   -3.356  1.00 0.00 ? 66  SER A HA   6  
ATOM 8418  H HB2  . SER A 1 66  ? 14.065  5.735   -2.832  1.00 0.00 ? 66  SER A HB2  6  
ATOM 8419  H HB3  . SER A 1 66  ? 14.580  6.391   -4.373  1.00 0.00 ? 66  SER A HB3  6  
ATOM 8420  H HG   . SER A 1 66  ? 15.879  7.962   -2.896  1.00 0.00 ? 66  SER A HG   6  
ATOM 8421  N N    . LEU A 1 67  ? 12.703  7.866   -0.883  1.00 0.00 ? 67  LEU A N    6  
ATOM 8422  C CA   . LEU A 1 67  ? 12.683  8.373   0.478   1.00 0.00 ? 67  LEU A CA   6  
ATOM 8423  C C    . LEU A 1 67  ? 13.696  7.597   1.322   1.00 0.00 ? 67  LEU A C    6  
ATOM 8424  O O    . LEU A 1 67  ? 13.403  7.216   2.455   1.00 0.00 ? 67  LEU A O    6  
ATOM 8425  C CB   . LEU A 1 67  ? 11.260  8.341   1.041   1.00 0.00 ? 67  LEU A CB   6  
ATOM 8426  C CG   . LEU A 1 67  ? 10.164  8.887   0.124   1.00 0.00 ? 67  LEU A CG   6  
ATOM 8427  C CD1  . LEU A 1 67  ? 8.790   8.352   0.534   1.00 0.00 ? 67  LEU A CD1  6  
ATOM 8428  C CD2  . LEU A 1 67  ? 10.195  10.416  0.083   1.00 0.00 ? 67  LEU A CD2  6  
ATOM 8429  H H    . LEU A 1 67  ? 12.078  7.106   -1.060  1.00 0.00 ? 67  LEU A H    6  
ATOM 8430  H HA   . LEU A 1 67  ? 12.992  9.418   0.443   1.00 0.00 ? 67  LEU A HA   6  
ATOM 8431  H HB2  . LEU A 1 67  ? 11.014  7.310   1.294   1.00 0.00 ? 67  LEU A HB2  6  
ATOM 8432  H HB3  . LEU A 1 67  ? 11.246  8.910   1.971   1.00 0.00 ? 67  LEU A HB3  6  
ATOM 8433  H HG   . LEU A 1 67  ? 10.358  8.534   -0.889  1.00 0.00 ? 67  LEU A HG   6  
ATOM 8434  H HD11 . LEU A 1 67  ? 8.198   9.161   0.962   1.00 0.00 ? 67  LEU A HD11 6  
ATOM 8435  H HD12 . LEU A 1 67  ? 8.280   7.953   -0.343  1.00 0.00 ? 67  LEU A HD12 6  
ATOM 8436  H HD13 . LEU A 1 67  ? 8.914   7.561   1.273   1.00 0.00 ? 67  LEU A HD13 6  
ATOM 8437  H HD21 . LEU A 1 67  ? 10.837  10.788  0.882   1.00 0.00 ? 67  LEU A HD21 6  
ATOM 8438  H HD22 . LEU A 1 67  ? 10.584  10.746  -0.880  1.00 0.00 ? 67  LEU A HD22 6  
ATOM 8439  H HD23 . LEU A 1 67  ? 9.185   10.804  0.219   1.00 0.00 ? 67  LEU A HD23 6  
ATOM 8440  N N    . ALA A 1 68  ? 14.866  7.385   0.738   1.00 0.00 ? 68  ALA A N    6  
ATOM 8441  C CA   . ALA A 1 68  ? 15.924  6.661   1.422   1.00 0.00 ? 68  ALA A CA   6  
ATOM 8442  C C    . ALA A 1 68  ? 16.124  7.257   2.817   1.00 0.00 ? 68  ALA A C    6  
ATOM 8443  O O    . ALA A 1 68  ? 16.850  8.237   2.979   1.00 0.00 ? 68  ALA A O    6  
ATOM 8444  C CB   . ALA A 1 68  ? 17.200  6.706   0.580   1.00 0.00 ? 68  ALA A CB   6  
ATOM 8445  H H    . ALA A 1 68  ? 15.096  7.698   -0.183  1.00 0.00 ? 68  ALA A H    6  
ATOM 8446  H HA   . ALA A 1 68  ? 15.605  5.623   1.522   1.00 0.00 ? 68  ALA A HA   6  
ATOM 8447  H HB1  . ALA A 1 68  ? 18.051  6.409   1.194   1.00 0.00 ? 68  ALA A HB1  6  
ATOM 8448  H HB2  . ALA A 1 68  ? 17.104  6.020   -0.262  1.00 0.00 ? 68  ALA A HB2  6  
ATOM 8449  H HB3  . ALA A 1 68  ? 17.355  7.718   0.208   1.00 0.00 ? 68  ALA A HB3  6  
ATOM 8450  N N    . ARG A 1 69  ? 15.468  6.641   3.789   1.00 0.00 ? 69  ARG A N    6  
ATOM 8451  C CA   . ARG A 1 69  ? 15.565  7.098   5.165   1.00 0.00 ? 69  ARG A CA   6  
ATOM 8452  C C    . ARG A 1 69  ? 15.580  8.627   5.216   1.00 0.00 ? 69  ARG A C    6  
ATOM 8453  O O    . ARG A 1 69  ? 16.644  9.243   5.165   1.00 0.00 ? 69  ARG A O    6  
ATOM 8454  C CB   . ARG A 1 69  ? 16.830  6.559   5.836   1.00 0.00 ? 69  ARG A CB   6  
ATOM 8455  C CG   . ARG A 1 69  ? 16.493  5.438   6.821   1.00 0.00 ? 69  ARG A CG   6  
ATOM 8456  C CD   . ARG A 1 69  ? 17.680  4.490   7.000   1.00 0.00 ? 69  ARG A CD   6  
ATOM 8457  N NE   . ARG A 1 69  ? 18.017  4.367   8.436   1.00 0.00 ? 69  ARG A NE   6  
ATOM 8458  C CZ   . ARG A 1 69  ? 19.011  3.605   8.912   1.00 0.00 ? 69  ARG A CZ   6  
ATOM 8459  N NH1  . ARG A 1 69  ? 19.773  2.894   8.069   1.00 0.00 ? 69  ARG A NH1  6  
ATOM 8460  N NH2  . ARG A 1 69  ? 19.245  3.554   10.230  1.00 0.00 ? 69  ARG A NH2  6  
ATOM 8461  H H    . ARG A 1 69  ? 14.879  5.844   3.649   1.00 0.00 ? 69  ARG A H    6  
ATOM 8462  H HA   . ARG A 1 69  ? 14.677  6.698   5.655   1.00 0.00 ? 69  ARG A HA   6  
ATOM 8463  H HB2  . ARG A 1 69  ? 17.518  6.187   5.077   1.00 0.00 ? 69  ARG A HB2  6  
ATOM 8464  H HB3  . ARG A 1 69  ? 17.340  7.367   6.361   1.00 0.00 ? 69  ARG A HB3  6  
ATOM 8465  H HG2  . ARG A 1 69  ? 16.215  5.866   7.784   1.00 0.00 ? 69  ARG A HG2  6  
ATOM 8466  H HG3  . ARG A 1 69  ? 15.629  4.879   6.460   1.00 0.00 ? 69  ARG A HG3  6  
ATOM 8467  H HD2  . ARG A 1 69  ? 17.439  3.510   6.589   1.00 0.00 ? 69  ARG A HD2  6  
ATOM 8468  H HD3  . ARG A 1 69  ? 18.542  4.865   6.447   1.00 0.00 ? 69  ARG A HD3  6  
ATOM 8469  H HE   . ARG A 1 69  ? 17.468  4.885   9.092   1.00 0.00 ? 69  ARG A HE   6  
ATOM 8470  H HH11 . ARG A 1 69  ? 19.599  2.932   7.085   1.00 0.00 ? 69  ARG A HH11 6  
ATOM 8471  H HH12 . ARG A 1 69  ? 20.515  2.325   8.424   1.00 0.00 ? 69  ARG A HH12 6  
ATOM 8472  H HH21 . ARG A 1 69  ? 18.677  4.085   10.859  1.00 0.00 ? 69  ARG A HH21 6  
ATOM 8473  H HH22 . ARG A 1 69  ? 19.987  2.986   10.585  1.00 0.00 ? 69  ARG A HH22 6  
ATOM 8474  N N    . VAL A 1 70  ? 14.388  9.196   5.316   1.00 0.00 ? 70  VAL A N    6  
ATOM 8475  C CA   . VAL A 1 70  ? 14.251  10.641  5.375   1.00 0.00 ? 70  VAL A CA   6  
ATOM 8476  C C    . VAL A 1 70  ? 13.213  11.008  6.437   1.00 0.00 ? 70  VAL A C    6  
ATOM 8477  O O    . VAL A 1 70  ? 12.221  10.301  6.611   1.00 0.00 ? 70  VAL A O    6  
ATOM 8478  C CB   . VAL A 1 70  ? 13.908  11.191  3.989   1.00 0.00 ? 70  VAL A CB   6  
ATOM 8479  C CG1  . VAL A 1 70  ? 15.065  10.972  3.011   1.00 0.00 ? 70  VAL A CG1  6  
ATOM 8480  C CG2  . VAL A 1 70  ? 12.615  10.570  3.457   1.00 0.00 ? 70  VAL A CG2  6  
ATOM 8481  H H    . VAL A 1 70  ? 13.527  8.688   5.357   1.00 0.00 ? 70  VAL A H    6  
ATOM 8482  H HA   . VAL A 1 70  ? 15.216  11.051  5.671   1.00 0.00 ? 70  VAL A HA   6  
ATOM 8483  H HB   . VAL A 1 70  ? 13.749  12.265  4.084   1.00 0.00 ? 70  VAL A HB   6  
ATOM 8484  H HG11 . VAL A 1 70  ? 14.669  10.655  2.046   1.00 0.00 ? 70  VAL A HG11 6  
ATOM 8485  H HG12 . VAL A 1 70  ? 15.618  11.903  2.888   1.00 0.00 ? 70  VAL A HG12 6  
ATOM 8486  H HG13 . VAL A 1 70  ? 15.730  10.203  3.402   1.00 0.00 ? 70  VAL A HG13 6  
ATOM 8487  H HG21 . VAL A 1 70  ? 12.174  9.936   4.226   1.00 0.00 ? 70  VAL A HG21 6  
ATOM 8488  H HG22 . VAL A 1 70  ? 11.914  11.362  3.192   1.00 0.00 ? 70  VAL A HG22 6  
ATOM 8489  H HG23 . VAL A 1 70  ? 12.836  9.970   2.574   1.00 0.00 ? 70  VAL A HG23 6  
ATOM 8490  N N    . THR A 1 71  ? 13.476  12.113  7.120   1.00 0.00 ? 71  THR A N    6  
ATOM 8491  C CA   . THR A 1 71  ? 12.577  12.582  8.160   1.00 0.00 ? 71  THR A CA   6  
ATOM 8492  C C    . THR A 1 71  ? 11.136  12.610  7.646   1.00 0.00 ? 71  THR A C    6  
ATOM 8493  O O    . THR A 1 71  ? 10.899  12.858  6.465   1.00 0.00 ? 71  THR A O    6  
ATOM 8494  C CB   . THR A 1 71  ? 13.078  13.946  8.638   1.00 0.00 ? 71  THR A CB   6  
ATOM 8495  O OG1  . THR A 1 71  ? 13.510  14.595  7.446   1.00 0.00 ? 71  THR A OG1  6  
ATOM 8496  C CG2  . THR A 1 71  ? 14.348  13.839  9.485   1.00 0.00 ? 71  THR A CG2  6  
ATOM 8497  H H    . THR A 1 71  ? 14.285  12.682  6.972   1.00 0.00 ? 71  THR A H    6  
ATOM 8498  H HA   . THR A 1 71  ? 12.608  11.872  8.987   1.00 0.00 ? 71  THR A HA   6  
ATOM 8499  H HB   . THR A 1 71  ? 12.296  14.481  9.176   1.00 0.00 ? 71  THR A HB   6  
ATOM 8500  H HG1  . THR A 1 71  ? 13.465  15.587  7.561   1.00 0.00 ? 71  THR A HG1  6  
ATOM 8501  H HG21 . THR A 1 71  ? 14.385  12.860  9.963   1.00 0.00 ? 71  THR A HG21 6  
ATOM 8502  H HG22 . THR A 1 71  ? 15.222  13.964  8.846   1.00 0.00 ? 71  THR A HG22 6  
ATOM 8503  H HG23 . THR A 1 71  ? 14.342  14.616  10.249  1.00 0.00 ? 71  THR A HG23 6  
ATOM 8504  N N    . HIS A 1 72  ? 10.211  12.353  8.559   1.00 0.00 ? 72  HIS A N    6  
ATOM 8505  C CA   . HIS A 1 72  ? 8.800   12.346  8.214   1.00 0.00 ? 72  HIS A CA   6  
ATOM 8506  C C    . HIS A 1 72  ? 8.451   13.626  7.452   1.00 0.00 ? 72  HIS A C    6  
ATOM 8507  O O    . HIS A 1 72  ? 7.562   13.625  6.602   1.00 0.00 ? 72  HIS A O    6  
ATOM 8508  C CB   . HIS A 1 72  ? 7.936   12.144  9.460   1.00 0.00 ? 72  HIS A CB   6  
ATOM 8509  C CG   . HIS A 1 72  ? 6.603   11.490  9.184   1.00 0.00 ? 72  HIS A CG   6  
ATOM 8510  N ND1  . HIS A 1 72  ? 5.396   12.073  9.531   1.00 0.00 ? 72  HIS A ND1  6  
ATOM 8511  C CD2  . HIS A 1 72  ? 6.299   10.300  8.591   1.00 0.00 ? 72  HIS A CD2  6  
ATOM 8512  C CE1  . HIS A 1 72  ? 4.417   11.261  9.160   1.00 0.00 ? 72  HIS A CE1  6  
ATOM 8513  N NE2  . HIS A 1 72  ? 4.979   10.162  8.578   1.00 0.00 ? 72  HIS A NE2  6  
ATOM 8514  H H    . HIS A 1 72  ? 10.412  12.152  9.518   1.00 0.00 ? 72  HIS A H    6  
ATOM 8515  H HA   . HIS A 1 72  ? 8.642   11.489  7.558   1.00 0.00 ? 72  HIS A HA   6  
ATOM 8516  H HB2  . HIS A 1 72  ? 8.486   11.534  10.176  1.00 0.00 ? 72  HIS A HB2  6  
ATOM 8517  H HB3  . HIS A 1 72  ? 7.764   13.111  9.931   1.00 0.00 ? 72  HIS A HB3  6  
ATOM 8518  H HD1  . HIS A 1 72  ? 5.282   12.957  9.985   1.00 0.00 ? 72  HIS A HD1  6  
ATOM 8519  H HD2  . HIS A 1 72  ? 7.019   9.584   8.195   1.00 0.00 ? 72  HIS A HD2  6  
ATOM 8520  H HE1  . HIS A 1 72  ? 3.351   11.439  9.295   1.00 0.00 ? 72  HIS A HE1  6  
ATOM 8521  N N    . ALA A 1 73  ? 9.170   14.688  7.785   1.00 0.00 ? 73  ALA A N    6  
ATOM 8522  C CA   . ALA A 1 73  ? 8.948   15.973  7.143   1.00 0.00 ? 73  ALA A CA   6  
ATOM 8523  C C    . ALA A 1 73  ? 9.449   15.910  5.698   1.00 0.00 ? 73  ALA A C    6  
ATOM 8524  O O    . ALA A 1 73  ? 8.862   16.521  4.807   1.00 0.00 ? 73  ALA A O    6  
ATOM 8525  C CB   . ALA A 1 73  ? 9.638   17.074  7.951   1.00 0.00 ? 73  ALA A CB   6  
ATOM 8526  H H    . ALA A 1 73  ? 9.891   14.681  8.477   1.00 0.00 ? 73  ALA A H    6  
ATOM 8527  H HA   . ALA A 1 73  ? 7.875   16.161  7.139   1.00 0.00 ? 73  ALA A HA   6  
ATOM 8528  H HB1  . ALA A 1 73  ? 9.470   18.037  7.470   1.00 0.00 ? 73  ALA A HB1  6  
ATOM 8529  H HB2  . ALA A 1 73  ? 9.227   17.095  8.960   1.00 0.00 ? 73  ALA A HB2  6  
ATOM 8530  H HB3  . ALA A 1 73  ? 10.708  16.873  7.999   1.00 0.00 ? 73  ALA A HB3  6  
ATOM 8531  N N    . GLU A 1 74  ? 10.529  15.165  5.512   1.00 0.00 ? 74  GLU A N    6  
ATOM 8532  C CA   . GLU A 1 74  ? 11.115  15.014  4.191   1.00 0.00 ? 74  GLU A CA   6  
ATOM 8533  C C    . GLU A 1 74  ? 10.161  14.249  3.271   1.00 0.00 ? 74  GLU A C    6  
ATOM 8534  O O    . GLU A 1 74  ? 9.796   14.740  2.204   1.00 0.00 ? 74  GLU A O    6  
ATOM 8535  C CB   . GLU A 1 74  ? 12.475  14.318  4.271   1.00 0.00 ? 74  GLU A CB   6  
ATOM 8536  C CG   . GLU A 1 74  ? 13.588  15.323  4.573   1.00 0.00 ? 74  GLU A CG   6  
ATOM 8537  C CD   . GLU A 1 74  ? 13.750  16.324  3.427   1.00 0.00 ? 74  GLU A CD   6  
ATOM 8538  O OE1  . GLU A 1 74  ? 13.586  15.888  2.267   1.00 0.00 ? 74  GLU A OE1  6  
ATOM 8539  O OE2  . GLU A 1 74  ? 14.032  17.501  3.737   1.00 0.00 ? 74  GLU A OE2  6  
ATOM 8540  H H    . GLU A 1 74  ? 11.000  14.671  6.243   1.00 0.00 ? 74  GLU A H    6  
ATOM 8541  H HA   . GLU A 1 74  ? 11.255  16.029  3.819   1.00 0.00 ? 74  GLU A HA   6  
ATOM 8542  H HB2  . GLU A 1 74  ? 12.451  13.553  5.047   1.00 0.00 ? 74  GLU A HB2  6  
ATOM 8543  H HB3  . GLU A 1 74  ? 12.684  13.810  3.330   1.00 0.00 ? 74  GLU A HB3  6  
ATOM 8544  H HG2  . GLU A 1 74  ? 13.362  15.856  5.497   1.00 0.00 ? 74  GLU A HG2  6  
ATOM 8545  H HG3  . GLU A 1 74  ? 14.528  14.793  4.733   1.00 0.00 ? 74  GLU A HG3  6  
ATOM 8546  N N    . ALA A 1 75  ? 9.785   13.060  3.719   1.00 0.00 ? 75  ALA A N    6  
ATOM 8547  C CA   . ALA A 1 75  ? 8.880   12.223  2.949   1.00 0.00 ? 75  ALA A CA   6  
ATOM 8548  C C    . ALA A 1 75  ? 7.658   13.045  2.537   1.00 0.00 ? 75  ALA A C    6  
ATOM 8549  O O    . ALA A 1 75  ? 7.322   13.115  1.356   1.00 0.00 ? 75  ALA A O    6  
ATOM 8550  C CB   . ALA A 1 75  ? 8.503   10.989  3.771   1.00 0.00 ? 75  ALA A CB   6  
ATOM 8551  H H    . ALA A 1 75  ? 10.087  12.669  4.588   1.00 0.00 ? 75  ALA A H    6  
ATOM 8552  H HA   . ALA A 1 75  ? 9.409   11.900  2.053   1.00 0.00 ? 75  ALA A HA   6  
ATOM 8553  H HB1  . ALA A 1 75  ? 7.560   10.583  3.405   1.00 0.00 ? 75  ALA A HB1  6  
ATOM 8554  H HB2  . ALA A 1 75  ? 9.285   10.235  3.675   1.00 0.00 ? 75  ALA A HB2  6  
ATOM 8555  H HB3  . ALA A 1 75  ? 8.396   11.269  4.819   1.00 0.00 ? 75  ALA A HB3  6  
ATOM 8556  N N    . VAL A 1 76  ? 7.026   13.647  3.534   1.00 0.00 ? 76  VAL A N    6  
ATOM 8557  C CA   . VAL A 1 76  ? 5.847   14.462  3.290   1.00 0.00 ? 76  VAL A CA   6  
ATOM 8558  C C    . VAL A 1 76  ? 6.183   15.539  2.257   1.00 0.00 ? 76  VAL A C    6  
ATOM 8559  O O    . VAL A 1 76  ? 5.494   15.672  1.247   1.00 0.00 ? 76  VAL A O    6  
ATOM 8560  C CB   . VAL A 1 76  ? 5.328   15.038  4.608   1.00 0.00 ? 76  VAL A CB   6  
ATOM 8561  C CG1  . VAL A 1 76  ? 4.066   15.873  4.382   1.00 0.00 ? 76  VAL A CG1  6  
ATOM 8562  C CG2  . VAL A 1 76  ? 5.074   13.928  5.630   1.00 0.00 ? 76  VAL A CG2  6  
ATOM 8563  H H    . VAL A 1 76  ? 7.306   13.585  4.492   1.00 0.00 ? 76  VAL A H    6  
ATOM 8564  H HA   . VAL A 1 76  ? 5.076   13.810  2.879   1.00 0.00 ? 76  VAL A HA   6  
ATOM 8565  H HB   . VAL A 1 76  ? 6.097   15.696  5.013   1.00 0.00 ? 76  VAL A HB   6  
ATOM 8566  H HG11 . VAL A 1 76  ? 3.206   15.211  4.277   1.00 0.00 ? 76  VAL A HG11 6  
ATOM 8567  H HG12 . VAL A 1 76  ? 3.912   16.537  5.233   1.00 0.00 ? 76  VAL A HG12 6  
ATOM 8568  H HG13 . VAL A 1 76  ? 4.180   16.466  3.474   1.00 0.00 ? 76  VAL A HG13 6  
ATOM 8569  H HG21 . VAL A 1 76  ? 5.609   13.027  5.328   1.00 0.00 ? 76  VAL A HG21 6  
ATOM 8570  H HG22 . VAL A 1 76  ? 5.428   14.249  6.610   1.00 0.00 ? 76  VAL A HG22 6  
ATOM 8571  H HG23 . VAL A 1 76  ? 4.006   13.717  5.681   1.00 0.00 ? 76  VAL A HG23 6  
ATOM 8572  N N    . LYS A 1 77  ? 7.241   16.282  2.546   1.00 0.00 ? 77  LYS A N    6  
ATOM 8573  C CA   . LYS A 1 77  ? 7.676   17.344  1.655   1.00 0.00 ? 77  LYS A CA   6  
ATOM 8574  C C    . LYS A 1 77  ? 7.863   16.778  0.246   1.00 0.00 ? 77  LYS A C    6  
ATOM 8575  O O    . LYS A 1 77  ? 7.837   17.520  -0.734  1.00 0.00 ? 77  LYS A O    6  
ATOM 8576  C CB   . LYS A 1 77  ? 8.924   18.033  2.211   1.00 0.00 ? 77  LYS A CB   6  
ATOM 8577  C CG   . LYS A 1 77  ? 8.546   19.140  3.198   1.00 0.00 ? 77  LYS A CG   6  
ATOM 8578  C CD   . LYS A 1 77  ? 8.593   20.513  2.525   1.00 0.00 ? 77  LYS A CD   6  
ATOM 8579  C CE   . LYS A 1 77  ? 8.585   21.634  3.566   1.00 0.00 ? 77  LYS A CE   6  
ATOM 8580  N NZ   . LYS A 1 77  ? 8.795   22.947  2.915   1.00 0.00 ? 77  LYS A NZ   6  
ATOM 8581  H H    . LYS A 1 77  ? 7.796   16.168  3.370   1.00 0.00 ? 77  LYS A H    6  
ATOM 8582  H HA   . LYS A 1 77  ? 6.883   18.091  1.625   1.00 0.00 ? 77  LYS A HA   6  
ATOM 8583  H HB2  . LYS A 1 77  ? 9.558   17.299  2.709   1.00 0.00 ? 77  LYS A HB2  6  
ATOM 8584  H HB3  . LYS A 1 77  ? 9.507   18.454  1.392   1.00 0.00 ? 77  LYS A HB3  6  
ATOM 8585  H HG2  . LYS A 1 77  ? 7.546   18.957  3.589   1.00 0.00 ? 77  LYS A HG2  6  
ATOM 8586  H HG3  . LYS A 1 77  ? 9.229   19.124  4.047   1.00 0.00 ? 77  LYS A HG3  6  
ATOM 8587  H HD2  . LYS A 1 77  ? 9.489   20.590  1.909   1.00 0.00 ? 77  LYS A HD2  6  
ATOM 8588  H HD3  . LYS A 1 77  ? 7.738   20.624  1.858   1.00 0.00 ? 77  LYS A HD3  6  
ATOM 8589  H HE2  . LYS A 1 77  ? 7.635   21.635  4.101   1.00 0.00 ? 77  LYS A HE2  6  
ATOM 8590  H HE3  . LYS A 1 77  ? 9.367   21.458  4.304   1.00 0.00 ? 77  LYS A HE3  6  
ATOM 8591  H HZ1  . LYS A 1 77  ? 9.717   22.984  2.530   1.00 0.00 ? 77  LYS A HZ1  6  
ATOM 8592  H HZ2  . LYS A 1 77  ? 8.123   23.068  2.184   1.00 0.00 ? 77  LYS A HZ2  6  
ATOM 8593  H HZ3  . LYS A 1 77  ? 8.686   23.675  3.592   1.00 0.00 ? 77  LYS A HZ3  6  
ATOM 8594  N N    . ALA A 1 78  ? 8.047   15.467  0.190   1.00 0.00 ? 78  ALA A N    6  
ATOM 8595  C CA   . ALA A 1 78  ? 8.237   14.792  -1.083  1.00 0.00 ? 78  ALA A CA   6  
ATOM 8596  C C    . ALA A 1 78  ? 6.874   14.402  -1.657  1.00 0.00 ? 78  ALA A C    6  
ATOM 8597  O O    . ALA A 1 78  ? 6.647   14.520  -2.861  1.00 0.00 ? 78  ALA A O    6  
ATOM 8598  C CB   . ALA A 1 78  ? 9.155   13.583  -0.887  1.00 0.00 ? 78  ALA A CB   6  
ATOM 8599  H H    . ALA A 1 78  ? 8.066   14.870  0.992   1.00 0.00 ? 78  ALA A H    6  
ATOM 8600  H HA   . ALA A 1 78  ? 8.721   15.494  -1.761  1.00 0.00 ? 78  ALA A HA   6  
ATOM 8601  H HB1  . ALA A 1 78  ? 9.969   13.851  -0.214  1.00 0.00 ? 78  ALA A HB1  6  
ATOM 8602  H HB2  . ALA A 1 78  ? 8.585   12.759  -0.459  1.00 0.00 ? 78  ALA A HB2  6  
ATOM 8603  H HB3  . ALA A 1 78  ? 9.566   13.279  -1.850  1.00 0.00 ? 78  ALA A HB3  6  
ATOM 8604  N N    . LEU A 1 79  ? 6.003   13.944  -0.771  1.00 0.00 ? 79  LEU A N    6  
ATOM 8605  C CA   . LEU A 1 79  ? 4.668   13.536  -1.175  1.00 0.00 ? 79  LEU A CA   6  
ATOM 8606  C C    . LEU A 1 79  ? 3.929   14.738  -1.766  1.00 0.00 ? 79  LEU A C    6  
ATOM 8607  O O    . LEU A 1 79  ? 3.671   14.784  -2.968  1.00 0.00 ? 79  LEU A O    6  
ATOM 8608  C CB   . LEU A 1 79  ? 3.933   12.876  -0.007  1.00 0.00 ? 79  LEU A CB   6  
ATOM 8609  C CG   . LEU A 1 79  ? 4.221   11.389  0.212   1.00 0.00 ? 79  LEU A CG   6  
ATOM 8610  C CD1  . LEU A 1 79  ? 3.866   10.966  1.639   1.00 0.00 ? 79  LEU A CD1  6  
ATOM 8611  C CD2  . LEU A 1 79  ? 3.506   10.532  -0.834  1.00 0.00 ? 79  LEU A CD2  6  
ATOM 8612  H H    . LEU A 1 79  ? 6.195   13.851  0.206   1.00 0.00 ? 79  LEU A H    6  
ATOM 8613  H HA   . LEU A 1 79  ? 4.779   12.782  -1.954  1.00 0.00 ? 79  LEU A HA   6  
ATOM 8614  H HB2  . LEU A 1 79  ? 4.187   13.413  0.907   1.00 0.00 ? 79  LEU A HB2  6  
ATOM 8615  H HB3  . LEU A 1 79  ? 2.861   12.999  -0.162  1.00 0.00 ? 79  LEU A HB3  6  
ATOM 8616  H HG   . LEU A 1 79  ? 5.291   11.226  0.085   1.00 0.00 ? 79  LEU A HG   6  
ATOM 8617  H HD11 . LEU A 1 79  ? 4.772   10.663  2.164   1.00 0.00 ? 79  LEU A HD11 6  
ATOM 8618  H HD12 . LEU A 1 79  ? 3.406   11.804  2.162   1.00 0.00 ? 79  LEU A HD12 6  
ATOM 8619  H HD13 . LEU A 1 79  ? 3.167   10.130  1.607   1.00 0.00 ? 79  LEU A HD13 6  
ATOM 8620  H HD21 . LEU A 1 79  ? 4.049   9.597   -0.971  1.00 0.00 ? 79  LEU A HD21 6  
ATOM 8621  H HD22 . LEU A 1 79  ? 2.492   10.318  -0.497  1.00 0.00 ? 79  LEU A HD22 6  
ATOM 8622  H HD23 . LEU A 1 79  ? 3.468   11.071  -1.781  1.00 0.00 ? 79  LEU A HD23 6  
ATOM 8623  N N    . LYS A 1 80  ? 3.608   15.683  -0.893  1.00 0.00 ? 80  LYS A N    6  
ATOM 8624  C CA   . LYS A 1 80  ? 2.903   16.882  -1.314  1.00 0.00 ? 80  LYS A CA   6  
ATOM 8625  C C    . LYS A 1 80  ? 1.702   16.487  -2.176  1.00 0.00 ? 80  LYS A C    6  
ATOM 8626  O O    . LYS A 1 80  ? 1.408   15.303  -2.331  1.00 0.00 ? 80  LYS A O    6  
ATOM 8627  C CB   . LYS A 1 80  ? 3.863   17.853  -2.004  1.00 0.00 ? 80  LYS A CB   6  
ATOM 8628  C CG   . LYS A 1 80  ? 5.000   18.261  -1.065  1.00 0.00 ? 80  LYS A CG   6  
ATOM 8629  C CD   . LYS A 1 80  ? 4.459   18.985  0.169   1.00 0.00 ? 80  LYS A CD   6  
ATOM 8630  C CE   . LYS A 1 80  ? 5.477   19.993  0.704   1.00 0.00 ? 80  LYS A CE   6  
ATOM 8631  N NZ   . LYS A 1 80  ? 4.946   21.371  0.601   1.00 0.00 ? 80  LYS A NZ   6  
ATOM 8632  H H    . LYS A 1 80  ? 3.821   15.638  0.083   1.00 0.00 ? 80  LYS A H    6  
ATOM 8633  H HA   . LYS A 1 80  ? 2.536   17.377  -0.415  1.00 0.00 ? 80  LYS A HA   6  
ATOM 8634  H HB2  . LYS A 1 80  ? 4.275   17.388  -2.900  1.00 0.00 ? 80  LYS A HB2  6  
ATOM 8635  H HB3  . LYS A 1 80  ? 3.318   18.739  -2.328  1.00 0.00 ? 80  LYS A HB3  6  
ATOM 8636  H HG2  . LYS A 1 80  ? 5.557   17.376  -0.757  1.00 0.00 ? 80  LYS A HG2  6  
ATOM 8637  H HG3  . LYS A 1 80  ? 5.699   18.909  -1.594  1.00 0.00 ? 80  LYS A HG3  6  
ATOM 8638  H HD2  . LYS A 1 80  ? 3.531   19.499  -0.084  1.00 0.00 ? 80  LYS A HD2  6  
ATOM 8639  H HD3  . LYS A 1 80  ? 4.219   18.258  0.945   1.00 0.00 ? 80  LYS A HD3  6  
ATOM 8640  H HE2  . LYS A 1 80  ? 5.713   19.765  1.743   1.00 0.00 ? 80  LYS A HE2  6  
ATOM 8641  H HE3  . LYS A 1 80  ? 6.407   19.913  0.141   1.00 0.00 ? 80  LYS A HE3  6  
ATOM 8642  H HZ1  . LYS A 1 80  ? 4.706   21.566  -0.350  1.00 0.00 ? 80  LYS A HZ1  6  
ATOM 8643  H HZ2  . LYS A 1 80  ? 4.132   21.458  1.175   1.00 0.00 ? 80  LYS A HZ2  6  
ATOM 8644  H HZ3  . LYS A 1 80  ? 5.641   22.020  0.909   1.00 0.00 ? 80  LYS A HZ3  6  
ATOM 8645  N N    . GLY A 1 81  ? 1.042   17.501  -2.714  1.00 0.00 ? 81  GLY A N    6  
ATOM 8646  C CA   . GLY A 1 81  ? -0.121  17.275  -3.556  1.00 0.00 ? 81  GLY A CA   6  
ATOM 8647  C C    . GLY A 1 81  ? 0.139   17.748  -4.987  1.00 0.00 ? 81  GLY A C    6  
ATOM 8648  O O    . GLY A 1 81  ? -0.303  18.827  -5.378  1.00 0.00 ? 81  GLY A O    6  
ATOM 8649  H H    . GLY A 1 81  ? 1.288   18.462  -2.582  1.00 0.00 ? 81  GLY A H    6  
ATOM 8650  H HA2  . GLY A 1 81  ? -0.370  16.214  -3.559  1.00 0.00 ? 81  GLY A HA2  6  
ATOM 8651  H HA3  . GLY A 1 81  ? -0.981  17.804  -3.145  1.00 0.00 ? 81  GLY A HA3  6  
ATOM 8652  N N    . SER A 1 82  ? 0.855   16.917  -5.731  1.00 0.00 ? 82  SER A N    6  
ATOM 8653  C CA   . SER A 1 82  ? 1.179   17.236  -7.110  1.00 0.00 ? 82  SER A CA   6  
ATOM 8654  C C    . SER A 1 82  ? 0.083   16.712  -8.040  1.00 0.00 ? 82  SER A C    6  
ATOM 8655  O O    . SER A 1 82  ? -0.887  16.109  -7.584  1.00 0.00 ? 82  SER A O    6  
ATOM 8656  C CB   . SER A 1 82  ? 2.536   16.652  -7.507  1.00 0.00 ? 82  SER A CB   6  
ATOM 8657  O OG   . SER A 1 82  ? 3.338   17.596  -8.212  1.00 0.00 ? 82  SER A OG   6  
ATOM 8658  H H    . SER A 1 82  ? 1.211   16.041  -5.405  1.00 0.00 ? 82  SER A H    6  
ATOM 8659  H HA   . SER A 1 82  ? 1.227   18.324  -7.151  1.00 0.00 ? 82  SER A HA   6  
ATOM 8660  H HB2  . SER A 1 82  ? 3.065   16.324  -6.612  1.00 0.00 ? 82  SER A HB2  6  
ATOM 8661  H HB3  . SER A 1 82  ? 2.383   15.770  -8.129  1.00 0.00 ? 82  SER A HB3  6  
ATOM 8662  H HG   . SER A 1 82  ? 4.199   17.171  -8.493  1.00 0.00 ? 82  SER A HG   6  
ATOM 8663  N N    . LYS A 1 83  ? 0.275   16.960  -9.328  1.00 0.00 ? 83  LYS A N    6  
ATOM 8664  C CA   . LYS A 1 83  ? -0.685  16.520  -10.325 1.00 0.00 ? 83  LYS A CA   6  
ATOM 8665  C C    . LYS A 1 83  ? -0.421  15.053  -10.669 1.00 0.00 ? 83  LYS A C    6  
ATOM 8666  O O    . LYS A 1 83  ? -1.281  14.198  -10.463 1.00 0.00 ? 83  LYS A O    6  
ATOM 8667  C CB   . LYS A 1 83  ? -0.661  17.450  -11.540 1.00 0.00 ? 83  LYS A CB   6  
ATOM 8668  C CG   . LYS A 1 83  ? -1.216  18.831  -11.184 1.00 0.00 ? 83  LYS A CG   6  
ATOM 8669  C CD   . LYS A 1 83  ? -0.508  19.929  -11.980 1.00 0.00 ? 83  LYS A CD   6  
ATOM 8670  C CE   . LYS A 1 83  ? -0.731  21.301  -11.340 1.00 0.00 ? 83  LYS A CE   6  
ATOM 8671  N NZ   . LYS A 1 83  ? -0.169  22.369  -12.196 1.00 0.00 ? 83  LYS A NZ   6  
ATOM 8672  H H    . LYS A 1 83  ? 1.067   17.451  -9.691  1.00 0.00 ? 83  LYS A H    6  
ATOM 8673  H HA   . LYS A 1 83  ? -1.678  16.597  -9.881  1.00 0.00 ? 83  LYS A HA   6  
ATOM 8674  H HB2  . LYS A 1 83  ? 0.361   17.549  -11.906 1.00 0.00 ? 83  LYS A HB2  6  
ATOM 8675  H HB3  . LYS A 1 83  ? -1.248  17.015  -12.348 1.00 0.00 ? 83  LYS A HB3  6  
ATOM 8676  H HG2  . LYS A 1 83  ? -2.286  18.860  -11.391 1.00 0.00 ? 83  LYS A HG2  6  
ATOM 8677  H HG3  . LYS A 1 83  ? -1.093  19.013  -10.117 1.00 0.00 ? 83  LYS A HG3  6  
ATOM 8678  H HD2  . LYS A 1 83  ? 0.560   19.716  -12.029 1.00 0.00 ? 83  LYS A HD2  6  
ATOM 8679  H HD3  . LYS A 1 83  ? -0.878  19.937  -13.005 1.00 0.00 ? 83  LYS A HD3  6  
ATOM 8680  H HE2  . LYS A 1 83  ? -1.798  21.469  -11.191 1.00 0.00 ? 83  LYS A HE2  6  
ATOM 8681  H HE3  . LYS A 1 83  ? -0.263  21.330  -10.356 1.00 0.00 ? 83  LYS A HE3  6  
ATOM 8682  H HZ1  . LYS A 1 83  ? 0.714   22.661  -11.828 1.00 0.00 ? 83  LYS A HZ1  6  
ATOM 8683  H HZ2  . LYS A 1 83  ? -0.045  22.022  -13.125 1.00 0.00 ? 83  LYS A HZ2  6  
ATOM 8684  H HZ3  . LYS A 1 83  ? -0.797  23.148  -12.213 1.00 0.00 ? 83  LYS A HZ3  6  
ATOM 8685  N N    . LYS A 1 84  ? 0.773   14.806  -11.188 1.00 0.00 ? 84  LYS A N    6  
ATOM 8686  C CA   . LYS A 1 84  ? 1.161   13.457  -11.563 1.00 0.00 ? 84  LYS A CA   6  
ATOM 8687  C C    . LYS A 1 84  ? 2.050   12.864  -10.468 1.00 0.00 ? 84  LYS A C    6  
ATOM 8688  O O    . LYS A 1 84  ? 3.254   12.701  -10.661 1.00 0.00 ? 84  LYS A O    6  
ATOM 8689  C CB   . LYS A 1 84  ? 1.807   13.451  -12.950 1.00 0.00 ? 84  LYS A CB   6  
ATOM 8690  C CG   . LYS A 1 84  ? 1.545   12.127  -13.671 1.00 0.00 ? 84  LYS A CG   6  
ATOM 8691  C CD   . LYS A 1 84  ? 0.794   12.357  -14.984 1.00 0.00 ? 84  LYS A CD   6  
ATOM 8692  C CE   . LYS A 1 84  ? -0.673  11.942  -14.856 1.00 0.00 ? 84  LYS A CE   6  
ATOM 8693  N NZ   . LYS A 1 84  ? -1.299  11.831  -16.192 1.00 0.00 ? 84  LYS A NZ   6  
ATOM 8694  H H    . LYS A 1 84  ? 1.467   15.507  -11.353 1.00 0.00 ? 84  LYS A H    6  
ATOM 8695  H HA   . LYS A 1 84  ? 0.251   12.861  -11.629 1.00 0.00 ? 84  LYS A HA   6  
ATOM 8696  H HB2  . LYS A 1 84  ? 1.413   14.276  -13.543 1.00 0.00 ? 84  LYS A HB2  6  
ATOM 8697  H HB3  . LYS A 1 84  ? 2.881   13.611  -12.856 1.00 0.00 ? 84  LYS A HB3  6  
ATOM 8698  H HG2  . LYS A 1 84  ? 2.492   11.625  -13.873 1.00 0.00 ? 84  LYS A HG2  6  
ATOM 8699  H HG3  . LYS A 1 84  ? 0.965   11.466  -13.027 1.00 0.00 ? 84  LYS A HG3  6  
ATOM 8700  H HD2  . LYS A 1 84  ? 0.855   13.409  -15.263 1.00 0.00 ? 84  LYS A HD2  6  
ATOM 8701  H HD3  . LYS A 1 84  ? 1.268   11.788  -15.783 1.00 0.00 ? 84  LYS A HD3  6  
ATOM 8702  H HE2  . LYS A 1 84  ? -0.743  10.988  -14.334 1.00 0.00 ? 84  LYS A HE2  6  
ATOM 8703  H HE3  . LYS A 1 84  ? -1.213  12.674  -14.255 1.00 0.00 ? 84  LYS A HE3  6  
ATOM 8704  H HZ1  . LYS A 1 84  ? -2.214  11.439  -16.100 1.00 0.00 ? 84  LYS A HZ1  6  
ATOM 8705  H HZ2  . LYS A 1 84  ? -1.365  12.739  -16.606 1.00 0.00 ? 84  LYS A HZ2  6  
ATOM 8706  H HZ3  . LYS A 1 84  ? -0.740  11.240  -16.774 1.00 0.00 ? 84  LYS A HZ3  6  
ATOM 8707  N N    . LEU A 1 85  ? 1.423   12.558  -9.342  1.00 0.00 ? 85  LEU A N    6  
ATOM 8708  C CA   . LEU A 1 85  ? 2.142   11.987  -8.216  1.00 0.00 ? 85  LEU A CA   6  
ATOM 8709  C C    . LEU A 1 85  ? 2.048   10.461  -8.277  1.00 0.00 ? 85  LEU A C    6  
ATOM 8710  O O    . LEU A 1 85  ? 0.972   9.894   -8.093  1.00 0.00 ? 85  LEU A O    6  
ATOM 8711  C CB   . LEU A 1 85  ? 1.637   12.581  -6.900  1.00 0.00 ? 85  LEU A CB   6  
ATOM 8712  C CG   . LEU A 1 85  ? 2.195   11.953  -5.622  1.00 0.00 ? 85  LEU A CG   6  
ATOM 8713  C CD1  . LEU A 1 85  ? 3.660   11.550  -5.804  1.00 0.00 ? 85  LEU A CD1  6  
ATOM 8714  C CD2  . LEU A 1 85  ? 2.001   12.884  -4.423  1.00 0.00 ? 85  LEU A CD2  6  
ATOM 8715  H H    . LEU A 1 85  ? 0.443   12.693  -9.193  1.00 0.00 ? 85  LEU A H    6  
ATOM 8716  H HA   . LEU A 1 85  ? 3.189   12.273  -8.318  1.00 0.00 ? 85  LEU A HA   6  
ATOM 8717  H HB2  . LEU A 1 85  ? 1.872   13.646  -6.891  1.00 0.00 ? 85  LEU A HB2  6  
ATOM 8718  H HB3  . LEU A 1 85  ? 0.550   12.495  -6.879  1.00 0.00 ? 85  LEU A HB3  6  
ATOM 8719  H HG   . LEU A 1 85  ? 1.633   11.042  -5.416  1.00 0.00 ? 85  LEU A HG   6  
ATOM 8720  H HD11 . LEU A 1 85  ? 4.103   11.341  -4.830  1.00 0.00 ? 85  LEU A HD11 6  
ATOM 8721  H HD12 . LEU A 1 85  ? 3.716   10.657  -6.427  1.00 0.00 ? 85  LEU A HD12 6  
ATOM 8722  H HD13 . LEU A 1 85  ? 4.204   12.363  -6.284  1.00 0.00 ? 85  LEU A HD13 6  
ATOM 8723  H HD21 . LEU A 1 85  ? 2.603   12.529  -3.586  1.00 0.00 ? 85  LEU A HD21 6  
ATOM 8724  H HD22 . LEU A 1 85  ? 2.314   13.893  -4.693  1.00 0.00 ? 85  LEU A HD22 6  
ATOM 8725  H HD23 . LEU A 1 85  ? 0.950   12.894  -4.137  1.00 0.00 ? 85  LEU A HD23 6  
ATOM 8726  N N    . VAL A 1 86  ? 3.189   9.839   -8.537  1.00 0.00 ? 86  VAL A N    6  
ATOM 8727  C CA   . VAL A 1 86  ? 3.249   8.390   -8.625  1.00 0.00 ? 86  VAL A CA   6  
ATOM 8728  C C    . VAL A 1 86  ? 3.836   7.829   -7.329  1.00 0.00 ? 86  VAL A C    6  
ATOM 8729  O O    . VAL A 1 86  ? 5.048   7.870   -7.123  1.00 0.00 ? 86  VAL A O    6  
ATOM 8730  C CB   . VAL A 1 86  ? 4.037   7.974   -9.868  1.00 0.00 ? 86  VAL A CB   6  
ATOM 8731  C CG1  . VAL A 1 86  ? 4.460   6.506   -9.783  1.00 0.00 ? 86  VAL A CG1  6  
ATOM 8732  C CG2  . VAL A 1 86  ? 3.233   8.239   -11.142 1.00 0.00 ? 86  VAL A CG2  6  
ATOM 8733  H H    . VAL A 1 86  ? 4.060   10.308  -8.686  1.00 0.00 ? 86  VAL A H    6  
ATOM 8734  H HA   . VAL A 1 86  ? 2.228   8.025   -8.735  1.00 0.00 ? 86  VAL A HA   6  
ATOM 8735  H HB   . VAL A 1 86  ? 4.942   8.581   -9.911  1.00 0.00 ? 86  VAL A HB   6  
ATOM 8736  H HG11 . VAL A 1 86  ? 4.447   6.065   -10.780 1.00 0.00 ? 86  VAL A HG11 6  
ATOM 8737  H HG12 . VAL A 1 86  ? 5.467   6.441   -9.370  1.00 0.00 ? 86  VAL A HG12 6  
ATOM 8738  H HG13 . VAL A 1 86  ? 3.767   5.965   -9.138  1.00 0.00 ? 86  VAL A HG13 6  
ATOM 8739  H HG21 . VAL A 1 86  ? 2.169   8.245   -10.906 1.00 0.00 ? 86  VAL A HG21 6  
ATOM 8740  H HG22 . VAL A 1 86  ? 3.518   9.207   -11.557 1.00 0.00 ? 86  VAL A HG22 6  
ATOM 8741  H HG23 . VAL A 1 86  ? 3.439   7.456   -11.872 1.00 0.00 ? 86  VAL A HG23 6  
ATOM 8742  N N    . LEU A 1 87  ? 2.950   7.316   -6.488  1.00 0.00 ? 87  LEU A N    6  
ATOM 8743  C CA   . LEU A 1 87  ? 3.365   6.747   -5.217  1.00 0.00 ? 87  LEU A CA   6  
ATOM 8744  C C    . LEU A 1 87  ? 3.964   5.360   -5.456  1.00 0.00 ? 87  LEU A C    6  
ATOM 8745  O O    . LEU A 1 87  ? 3.297   4.475   -5.990  1.00 0.00 ? 87  LEU A O    6  
ATOM 8746  C CB   . LEU A 1 87  ? 2.203   6.752   -4.222  1.00 0.00 ? 87  LEU A CB   6  
ATOM 8747  C CG   . LEU A 1 87  ? 1.472   8.086   -4.051  1.00 0.00 ? 87  LEU A CG   6  
ATOM 8748  C CD1  . LEU A 1 87  ? 2.461   9.253   -4.019  1.00 0.00 ? 87  LEU A CD1  6  
ATOM 8749  C CD2  . LEU A 1 87  ? 0.404   8.268   -5.132  1.00 0.00 ? 87  LEU A CD2  6  
ATOM 8750  H H    . LEU A 1 87  ? 1.965   7.286   -6.663  1.00 0.00 ? 87  LEU A H    6  
ATOM 8751  H HA   . LEU A 1 87  ? 4.142   7.393   -4.808  1.00 0.00 ? 87  LEU A HA   6  
ATOM 8752  H HB2  . LEU A 1 87  ? 1.478   6.001   -4.537  1.00 0.00 ? 87  LEU A HB2  6  
ATOM 8753  H HB3  . LEU A 1 87  ? 2.582   6.441   -3.249  1.00 0.00 ? 87  LEU A HB3  6  
ATOM 8754  H HG   . LEU A 1 87  ? 0.958   8.073   -3.090  1.00 0.00 ? 87  LEU A HG   6  
ATOM 8755  H HD11 . LEU A 1 87  ? 1.958   10.145  -3.648  1.00 0.00 ? 87  LEU A HD11 6  
ATOM 8756  H HD12 . LEU A 1 87  ? 3.294   9.005   -3.362  1.00 0.00 ? 87  LEU A HD12 6  
ATOM 8757  H HD13 . LEU A 1 87  ? 2.835   9.439   -5.026  1.00 0.00 ? 87  LEU A HD13 6  
ATOM 8758  H HD21 . LEU A 1 87  ? 0.850   8.740   -6.007  1.00 0.00 ? 87  LEU A HD21 6  
ATOM 8759  H HD22 . LEU A 1 87  ? -0.001  7.296   -5.410  1.00 0.00 ? 87  LEU A HD22 6  
ATOM 8760  H HD23 . LEU A 1 87  ? -0.397  8.899   -4.747  1.00 0.00 ? 87  LEU A HD23 6  
ATOM 8761  N N    . SER A 1 88  ? 5.216   5.213   -5.049  1.00 0.00 ? 88  SER A N    6  
ATOM 8762  C CA   . SER A 1 88  ? 5.912   3.948   -5.212  1.00 0.00 ? 88  SER A CA   6  
ATOM 8763  C C    . SER A 1 88  ? 5.794   3.117   -3.933  1.00 0.00 ? 88  SER A C    6  
ATOM 8764  O O    . SER A 1 88  ? 6.357   3.477   -2.900  1.00 0.00 ? 88  SER A O    6  
ATOM 8765  C CB   . SER A 1 88  ? 7.384   4.171   -5.566  1.00 0.00 ? 88  SER A CB   6  
ATOM 8766  O OG   . SER A 1 88  ? 7.552   4.571   -6.923  1.00 0.00 ? 88  SER A OG   6  
ATOM 8767  H H    . SER A 1 88  ? 5.752   5.937   -4.615  1.00 0.00 ? 88  SER A H    6  
ATOM 8768  H HA   . SER A 1 88  ? 5.412   3.448   -6.041  1.00 0.00 ? 88  SER A HA   6  
ATOM 8769  H HB2  . SER A 1 88  ? 7.803   4.933   -4.909  1.00 0.00 ? 88  SER A HB2  6  
ATOM 8770  H HB3  . SER A 1 88  ? 7.943   3.253   -5.386  1.00 0.00 ? 88  SER A HB3  6  
ATOM 8771  H HG   . SER A 1 88  ? 6.697   4.444   -7.426  1.00 0.00 ? 88  SER A HG   6  
ATOM 8772  N N    . VAL A 1 89  ? 5.059   2.020   -4.044  1.00 0.00 ? 89  VAL A N    6  
ATOM 8773  C CA   . VAL A 1 89  ? 4.860   1.135   -2.909  1.00 0.00 ? 89  VAL A CA   6  
ATOM 8774  C C    . VAL A 1 89  ? 5.163   -0.304  -3.331  1.00 0.00 ? 89  VAL A C    6  
ATOM 8775  O O    . VAL A 1 89  ? 5.115   -0.631  -4.516  1.00 0.00 ? 89  VAL A O    6  
ATOM 8776  C CB   . VAL A 1 89  ? 3.446   1.309   -2.352  1.00 0.00 ? 89  VAL A CB   6  
ATOM 8777  C CG1  . VAL A 1 89  ? 3.425   2.340   -1.222  1.00 0.00 ? 89  VAL A CG1  6  
ATOM 8778  C CG2  . VAL A 1 89  ? 2.462   1.690   -3.460  1.00 0.00 ? 89  VAL A CG2  6  
ATOM 8779  H H    . VAL A 1 89  ? 4.605   1.734   -4.888  1.00 0.00 ? 89  VAL A H    6  
ATOM 8780  H HA   . VAL A 1 89  ? 5.567   1.429   -2.134  1.00 0.00 ? 89  VAL A HA   6  
ATOM 8781  H HB   . VAL A 1 89  ? 3.129   0.352   -1.937  1.00 0.00 ? 89  VAL A HB   6  
ATOM 8782  H HG11 . VAL A 1 89  ? 2.703   2.035   -0.465  1.00 0.00 ? 89  VAL A HG11 6  
ATOM 8783  H HG12 . VAL A 1 89  ? 4.416   2.407   -0.772  1.00 0.00 ? 89  VAL A HG12 6  
ATOM 8784  H HG13 . VAL A 1 89  ? 3.142   3.313   -1.623  1.00 0.00 ? 89  VAL A HG13 6  
ATOM 8785  H HG21 . VAL A 1 89  ? 2.791   1.255   -4.403  1.00 0.00 ? 89  VAL A HG21 6  
ATOM 8786  H HG22 . VAL A 1 89  ? 1.470   1.312   -3.211  1.00 0.00 ? 89  VAL A HG22 6  
ATOM 8787  H HG23 . VAL A 1 89  ? 2.424   2.775   -3.555  1.00 0.00 ? 89  VAL A HG23 6  
ATOM 8788  N N    . TYR A 1 90  ? 5.468   -1.127  -2.338  1.00 0.00 ? 90  TYR A N    6  
ATOM 8789  C CA   . TYR A 1 90  ? 5.778   -2.523  -2.592  1.00 0.00 ? 90  TYR A CA   6  
ATOM 8790  C C    . TYR A 1 90  ? 4.791   -3.444  -1.871  1.00 0.00 ? 90  TYR A C    6  
ATOM 8791  O O    . TYR A 1 90  ? 4.565   -3.300  -0.671  1.00 0.00 ? 90  TYR A O    6  
ATOM 8792  C CB   . TYR A 1 90  ? 7.180   -2.753  -2.024  1.00 0.00 ? 90  TYR A CB   6  
ATOM 8793  C CG   . TYR A 1 90  ? 7.493   -4.218  -1.714  1.00 0.00 ? 90  TYR A CG   6  
ATOM 8794  C CD1  . TYR A 1 90  ? 7.707   -5.111  -2.744  1.00 0.00 ? 90  TYR A CD1  6  
ATOM 8795  C CD2  . TYR A 1 90  ? 7.563   -4.647  -0.404  1.00 0.00 ? 90  TYR A CD2  6  
ATOM 8796  C CE1  . TYR A 1 90  ? 8.002   -6.490  -2.453  1.00 0.00 ? 90  TYR A CE1  6  
ATOM 8797  C CE2  . TYR A 1 90  ? 7.857   -6.026  -0.112  1.00 0.00 ? 90  TYR A CE2  6  
ATOM 8798  C CZ   . TYR A 1 90  ? 8.062   -6.880  -1.151  1.00 0.00 ? 90  TYR A CZ   6  
ATOM 8799  O OH   . TYR A 1 90  ? 8.341   -8.182  -0.876  1.00 0.00 ? 90  TYR A OH   6  
ATOM 8800  H H    . TYR A 1 90  ? 5.504   -0.853  -1.377  1.00 0.00 ? 90  TYR A H    6  
ATOM 8801  H HA   . TYR A 1 90  ? 5.706   -2.695  -3.666  1.00 0.00 ? 90  TYR A HA   6  
ATOM 8802  H HB2  . TYR A 1 90  ? 7.916   -2.378  -2.735  1.00 0.00 ? 90  TYR A HB2  6  
ATOM 8803  H HB3  . TYR A 1 90  ? 7.292   -2.168  -1.111  1.00 0.00 ? 90  TYR A HB3  6  
ATOM 8804  H HD1  . TYR A 1 90  ? 7.652   -4.772  -3.779  1.00 0.00 ? 90  TYR A HD1  6  
ATOM 8805  H HD2  . TYR A 1 90  ? 7.394   -3.942  0.410   1.00 0.00 ? 90  TYR A HD2  6  
ATOM 8806  H HE1  . TYR A 1 90  ? 8.172   -7.206  -3.257  1.00 0.00 ? 90  TYR A HE1  6  
ATOM 8807  H HE2  . TYR A 1 90  ? 7.915   -6.378  0.918   1.00 0.00 ? 90  TYR A HE2  6  
ATOM 8808  H HH   . TYR A 1 90  ? 9.254   -8.259  -0.476  1.00 0.00 ? 90  TYR A HH   6  
ATOM 8809  N N    . SER A 1 91  ? 4.231   -4.371  -2.634  1.00 0.00 ? 91  SER A N    6  
ATOM 8810  C CA   . SER A 1 91  ? 3.273   -5.315  -2.084  1.00 0.00 ? 91  SER A CA   6  
ATOM 8811  C C    . SER A 1 91  ? 3.915   -6.698  -1.960  1.00 0.00 ? 91  SER A C    6  
ATOM 8812  O O    . SER A 1 91  ? 4.909   -6.988  -2.625  1.00 0.00 ? 91  SER A O    6  
ATOM 8813  C CB   . SER A 1 91  ? 2.013   -5.390  -2.948  1.00 0.00 ? 91  SER A CB   6  
ATOM 8814  O OG   . SER A 1 91  ? 0.903   -5.921  -2.230  1.00 0.00 ? 91  SER A OG   6  
ATOM 8815  H H    . SER A 1 91  ? 4.420   -4.482  -3.610  1.00 0.00 ? 91  SER A H    6  
ATOM 8816  H HA   . SER A 1 91  ? 3.015   -4.923  -1.100  1.00 0.00 ? 91  SER A HA   6  
ATOM 8817  H HB2  . SER A 1 91  ? 1.765   -4.393  -3.314  1.00 0.00 ? 91  SER A HB2  6  
ATOM 8818  H HB3  . SER A 1 91  ? 2.210   -6.010  -3.823  1.00 0.00 ? 91  SER A HB3  6  
ATOM 8819  H HG   . SER A 1 91  ? 0.166   -6.154  -2.863  1.00 0.00 ? 91  SER A HG   6  
ATOM 8820  N N    . ALA A 1 92  ? 3.321   -7.517  -1.104  1.00 0.00 ? 92  ALA A N    6  
ATOM 8821  C CA   . ALA A 1 92  ? 3.822   -8.863  -0.885  1.00 0.00 ? 92  ALA A CA   6  
ATOM 8822  C C    . ALA A 1 92  ? 2.731   -9.873  -1.245  1.00 0.00 ? 92  ALA A C    6  
ATOM 8823  O O    . ALA A 1 92  ? 1.549   -9.534  -1.270  1.00 0.00 ? 92  ALA A O    6  
ATOM 8824  C CB   . ALA A 1 92  ? 4.290   -9.003  0.565   1.00 0.00 ? 92  ALA A CB   6  
ATOM 8825  H H    . ALA A 1 92  ? 2.513   -7.274  -0.567  1.00 0.00 ? 92  ALA A H    6  
ATOM 8826  H HA   . ALA A 1 92  ? 4.676   -9.011  -1.546  1.00 0.00 ? 92  ALA A HA   6  
ATOM 8827  H HB1  . ALA A 1 92  ? 5.353   -9.245  0.581   1.00 0.00 ? 92  ALA A HB1  6  
ATOM 8828  H HB2  . ALA A 1 92  ? 4.123   -8.065  1.094   1.00 0.00 ? 92  ALA A HB2  6  
ATOM 8829  H HB3  . ALA A 1 92  ? 3.729   -9.800  1.053   1.00 0.00 ? 92  ALA A HB3  6  
ATOM 8830  N N    . GLY A 1 93  ? 3.167   -11.095 -1.517  1.00 0.00 ? 93  GLY A N    6  
ATOM 8831  C CA   . GLY A 1 93  ? 2.242   -12.157 -1.875  1.00 0.00 ? 93  GLY A CA   6  
ATOM 8832  C C    . GLY A 1 93  ? 1.035   -12.173 -0.935  1.00 0.00 ? 93  GLY A C    6  
ATOM 8833  O O    . GLY A 1 93  ? 1.151   -12.569 0.223   1.00 0.00 ? 93  GLY A O    6  
ATOM 8834  H H    . GLY A 1 93  ? 4.130   -11.363 -1.495  1.00 0.00 ? 93  GLY A H    6  
ATOM 8835  H HA2  . GLY A 1 93  ? 1.906   -12.020 -2.903  1.00 0.00 ? 93  GLY A HA2  6  
ATOM 8836  H HA3  . GLY A 1 93  ? 2.754   -13.119 -1.832  1.00 0.00 ? 93  GLY A HA3  6  
ATOM 8837  N N    . ARG A 1 94  ? -0.096  -11.738 -1.470  1.00 0.00 ? 94  ARG A N    6  
ATOM 8838  C CA   . ARG A 1 94  ? -1.324  -11.697 -0.694  1.00 0.00 ? 94  ARG A CA   6  
ATOM 8839  C C    . ARG A 1 94  ? -2.483  -11.200 -1.560  1.00 0.00 ? 94  ARG A C    6  
ATOM 8840  O O    . ARG A 1 94  ? -2.350  -10.205 -2.271  1.00 0.00 ? 94  ARG A O    6  
ATOM 8841  C CB   . ARG A 1 94  ? -1.176  -10.781 0.523   1.00 0.00 ? 94  ARG A CB   6  
ATOM 8842  C CG   . ARG A 1 94  ? -1.188  -11.589 1.822   1.00 0.00 ? 94  ARG A CG   6  
ATOM 8843  C CD   . ARG A 1 94  ? -2.108  -10.944 2.861   1.00 0.00 ? 94  ARG A CD   6  
ATOM 8844  N NE   . ARG A 1 94  ? -1.700  -11.354 4.223   1.00 0.00 ? 94  ARG A NE   6  
ATOM 8845  C CZ   . ARG A 1 94  ? -0.598  -10.911 4.842   1.00 0.00 ? 94  ARG A CZ   6  
ATOM 8846  N NH1  . ARG A 1 94  ? 0.214   -10.041 4.225   1.00 0.00 ? 94  ARG A NH1  6  
ATOM 8847  N NH2  . ARG A 1 94  ? -0.306  -11.338 6.078   1.00 0.00 ? 94  ARG A NH2  6  
ATOM 8848  H H    . ARG A 1 94  ? -0.182  -11.417 -2.414  1.00 0.00 ? 94  ARG A H    6  
ATOM 8849  H HA   . ARG A 1 94  ? -1.486  -12.727 -0.375  1.00 0.00 ? 94  ARG A HA   6  
ATOM 8850  H HB2  . ARG A 1 94  ? -0.245  -10.219 0.448   1.00 0.00 ? 94  ARG A HB2  6  
ATOM 8851  H HB3  . ARG A 1 94  ? -1.988  -10.053 0.535   1.00 0.00 ? 94  ARG A HB3  6  
ATOM 8852  H HG2  . ARG A 1 94  ? -1.522  -12.607 1.618   1.00 0.00 ? 94  ARG A HG2  6  
ATOM 8853  H HG3  . ARG A 1 94  ? -0.176  -11.659 2.221   1.00 0.00 ? 94  ARG A HG3  6  
ATOM 8854  H HD2  . ARG A 1 94  ? -2.066  -9.858  2.771   1.00 0.00 ? 94  ARG A HD2  6  
ATOM 8855  H HD3  . ARG A 1 94  ? -3.141  -11.239 2.677   1.00 0.00 ? 94  ARG A HD3  6  
ATOM 8856  H HE   . ARG A 1 94  ? -2.284  -12.003 4.711   1.00 0.00 ? 94  ARG A HE   6  
ATOM 8857  H HH11 . ARG A 1 94  ? -0.004  -9.723  3.303   1.00 0.00 ? 94  ARG A HH11 6  
ATOM 8858  H HH12 . ARG A 1 94  ? 1.037   -9.711  4.688   1.00 0.00 ? 94  ARG A HH12 6  
ATOM 8859  H HH21 . ARG A 1 94  ? -0.912  -11.988 6.539   1.00 0.00 ? 94  ARG A HH21 6  
ATOM 8860  H HH22 . ARG A 1 94  ? 0.516   -11.008 6.541   1.00 0.00 ? 94  ARG A HH22 6  
ATOM 8861  N N    . ILE A 1 95  ? -3.595  -11.916 -1.472  1.00 0.00 ? 95  ILE A N    6  
ATOM 8862  C CA   . ILE A 1 95  ? -4.777  -11.560 -2.238  1.00 0.00 ? 95  ILE A CA   6  
ATOM 8863  C C    . ILE A 1 95  ? -5.905  -11.176 -1.279  1.00 0.00 ? 95  ILE A C    6  
ATOM 8864  O O    . ILE A 1 95  ? -6.082  -11.807 -0.238  1.00 0.00 ? 95  ILE A O    6  
ATOM 8865  C CB   . ILE A 1 95  ? -5.148  -12.687 -3.204  1.00 0.00 ? 95  ILE A CB   6  
ATOM 8866  C CG1  . ILE A 1 95  ? -6.089  -12.182 -4.300  1.00 0.00 ? 95  ILE A CG1  6  
ATOM 8867  C CG2  . ILE A 1 95  ? -5.734  -13.883 -2.452  1.00 0.00 ? 95  ILE A CG2  6  
ATOM 8868  C CD1  . ILE A 1 95  ? -6.059  -13.108 -5.518  1.00 0.00 ? 95  ILE A CD1  6  
ATOM 8869  H H    . ILE A 1 95  ? -3.695  -12.724 -0.891  1.00 0.00 ? 95  ILE A H    6  
ATOM 8870  H HA   . ILE A 1 95  ? -4.525  -10.688 -2.842  1.00 0.00 ? 95  ILE A HA   6  
ATOM 8871  H HB   . ILE A 1 95  ? -4.238  -13.030 -3.695  1.00 0.00 ? 95  ILE A HB   6  
ATOM 8872  H HG12 . ILE A 1 95  ? -7.106  -12.119 -3.911  1.00 0.00 ? 95  ILE A HG12 6  
ATOM 8873  H HG13 . ILE A 1 95  ? -5.799  -11.174 -4.597  1.00 0.00 ? 95  ILE A HG13 6  
ATOM 8874  H HG21 . ILE A 1 95  ? -4.926  -14.531 -2.113  1.00 0.00 ? 95  ILE A HG21 6  
ATOM 8875  H HG22 . ILE A 1 95  ? -6.301  -13.529 -1.591  1.00 0.00 ? 95  ILE A HG22 6  
ATOM 8876  H HG23 . ILE A 1 95  ? -6.394  -14.442 -3.115  1.00 0.00 ? 95  ILE A HG23 6  
ATOM 8877  H HD11 . ILE A 1 95  ? -5.037  -13.442 -5.695  1.00 0.00 ? 95  ILE A HD11 6  
ATOM 8878  H HD12 . ILE A 1 95  ? -6.697  -13.972 -5.333  1.00 0.00 ? 95  ILE A HD12 6  
ATOM 8879  H HD13 . ILE A 1 95  ? -6.423  -12.568 -6.393  1.00 0.00 ? 95  ILE A HD13 6  
ATOM 8880  N N    . SER A 1 96  ? -6.640  -10.142 -1.664  1.00 0.00 ? 96  SER A N    6  
ATOM 8881  C CA   . SER A 1 96  ? -7.746  -9.666  -0.851  1.00 0.00 ? 96  SER A CA   6  
ATOM 8882  C C    . SER A 1 96  ? -8.825  -9.051  -1.744  1.00 0.00 ? 96  SER A C    6  
ATOM 8883  O O    . SER A 1 96  ? -9.966  -9.511  -1.752  1.00 0.00 ? 96  SER A O    6  
ATOM 8884  C CB   . SER A 1 96  ? -7.269  -8.646  0.185   1.00 0.00 ? 96  SER A CB   6  
ATOM 8885  O OG   . SER A 1 96  ? -8.111  -8.619  1.335   1.00 0.00 ? 96  SER A OG   6  
ATOM 8886  H H    . SER A 1 96  ? -6.489  -9.634  -2.512  1.00 0.00 ? 96  SER A H    6  
ATOM 8887  H HA   . SER A 1 96  ? -8.130  -10.549 -0.340  1.00 0.00 ? 96  SER A HA   6  
ATOM 8888  H HB2  . SER A 1 96  ? -6.250  -8.886  0.488   1.00 0.00 ? 96  SER A HB2  6  
ATOM 8889  H HB3  . SER A 1 96  ? -7.242  -7.655  -0.268  1.00 0.00 ? 96  SER A HB3  6  
ATOM 8890  H HG   . SER A 1 96  ? -8.908  -9.205  1.188   1.00 0.00 ? 96  SER A HG   6  
ATOM 8891  N N    . GLY A 1 97  ? -8.426  -8.020  -2.475  1.00 0.00 ? 97  GLY A N    6  
ATOM 8892  C CA   . GLY A 1 97  ? -9.345  -7.338  -3.370  1.00 0.00 ? 97  GLY A CA   6  
ATOM 8893  C C    . GLY A 1 97  ? -10.182 -6.305  -2.613  1.00 0.00 ? 97  GLY A C    6  
ATOM 8894  O O    . GLY A 1 97  ? -10.057 -6.170  -1.397  1.00 0.00 ? 97  GLY A O    6  
ATOM 8895  H H    . GLY A 1 97  ? -7.496  -7.653  -2.463  1.00 0.00 ? 97  GLY A H    6  
ATOM 8896  H HA2  . GLY A 1 97  ? -8.785  -6.845  -4.165  1.00 0.00 ? 97  GLY A HA2  6  
ATOM 8897  H HA3  . GLY A 1 97  ? -10.002 -8.065  -3.847  1.00 0.00 ? 97  GLY A HA3  6  
ATOM 8898  N N    . PRO A 1 98  ? -11.040 -5.584  -3.383  1.00 0.00 ? 98  PRO A N    6  
ATOM 8899  C CA   . PRO A 1 98  ? -11.898 -4.568  -2.798  1.00 0.00 ? 98  PRO A CA   6  
ATOM 8900  C C    . PRO A 1 98  ? -13.062 -5.205  -2.037  1.00 0.00 ? 98  PRO A C    6  
ATOM 8901  O O    . PRO A 1 98  ? -13.297 -6.407  -2.148  1.00 0.00 ? 98  PRO A O    6  
ATOM 8902  C CB   . PRO A 1 98  ? -12.351 -3.713  -3.970  1.00 0.00 ? 98  PRO A CB   6  
ATOM 8903  C CG   . PRO A 1 98  ? -12.111 -4.551  -5.215  1.00 0.00 ? 98  PRO A CG   6  
ATOM 8904  C CD   . PRO A 1 98  ? -11.216 -5.716  -4.826  1.00 0.00 ? 98  PRO A CD   6  
ATOM 8905  H HA   . PRO A 1 98  ? -11.391 -4.032  -2.123  1.00 0.00 ? 98  PRO A HA   6  
ATOM 8906  H HB2  . PRO A 1 98  ? -13.404 -3.447  -3.875  1.00 0.00 ? 98  PRO A HB2  6  
ATOM 8907  H HB3  . PRO A 1 98  ? -11.790 -2.779  -4.013  1.00 0.00 ? 98  PRO A HB3  6  
ATOM 8908  H HG2  . PRO A 1 98  ? -13.056 -4.914  -5.619  1.00 0.00 ? 98  PRO A HG2  6  
ATOM 8909  H HG3  . PRO A 1 98  ? -11.640 -3.951  -5.994  1.00 0.00 ? 98  PRO A HG3  6  
ATOM 8910  H HD2  . PRO A 1 98  ? -11.674 -6.671  -5.084  1.00 0.00 ? 98  PRO A HD2  6  
ATOM 8911  H HD3  . PRO A 1 98  ? -10.259 -5.672  -5.347  1.00 0.00 ? 98  PRO A HD3  6  
ATOM 8912  N N    . SER A 1 99  ? -13.761 -4.370  -1.281  1.00 0.00 ? 99  SER A N    6  
ATOM 8913  C CA   . SER A 1 99  ? -14.895 -4.837  -0.502  1.00 0.00 ? 99  SER A CA   6  
ATOM 8914  C C    . SER A 1 99  ? -16.116 -3.957  -0.777  1.00 0.00 ? 99  SER A C    6  
ATOM 8915  O O    . SER A 1 99  ? -17.155 -4.450  -1.214  1.00 0.00 ? 99  SER A O    6  
ATOM 8916  C CB   . SER A 1 99  ? -14.571 -4.843  0.993   1.00 0.00 ? 99  SER A CB   6  
ATOM 8917  O OG   . SER A 1 99  ? -15.220 -5.912  1.676   1.00 0.00 ? 99  SER A OG   6  
ATOM 8918  H H    . SER A 1 99  ? -13.563 -3.394  -1.197  1.00 0.00 ? 99  SER A H    6  
ATOM 8919  H HA   . SER A 1 99  ? -15.076 -5.858  -0.838  1.00 0.00 ? 99  SER A HA   6  
ATOM 8920  H HB2  . SER A 1 99  ? -13.493 -4.927  1.130   1.00 0.00 ? 99  SER A HB2  6  
ATOM 8921  H HB3  . SER A 1 99  ? -14.876 -3.894  1.434   1.00 0.00 ? 99  SER A HB3  6  
ATOM 8922  H HG   . SER A 1 99  ? -16.205 -5.880  1.505   1.00 0.00 ? 99  SER A HG   6  
ATOM 8923  N N    . SER A 1 100 ? -15.951 -2.670  -0.510  1.00 0.00 ? 100 SER A N    6  
ATOM 8924  C CA   . SER A 1 100 ? -17.027 -1.717  -0.723  1.00 0.00 ? 100 SER A CA   6  
ATOM 8925  C C    . SER A 1 100 ? -17.182 -1.429  -2.218  1.00 0.00 ? 100 SER A C    6  
ATOM 8926  O O    . SER A 1 100 ? -16.197 -1.397  -2.953  1.00 0.00 ? 100 SER A O    6  
ATOM 8927  C CB   . SER A 1 100 ? -16.772 -0.418  0.044   1.00 0.00 ? 100 SER A CB   6  
ATOM 8928  O OG   . SER A 1 100 ? -17.955 0.075   0.666   1.00 0.00 ? 100 SER A OG   6  
ATOM 8929  H H    . SER A 1 100 ? -15.103 -2.277  -0.155  1.00 0.00 ? 100 SER A H    6  
ATOM 8930  H HA   . SER A 1 100 ? -17.922 -2.200  -0.332  1.00 0.00 ? 100 SER A HA   6  
ATOM 8931  H HB2  . SER A 1 100 ? -16.008 -0.589  0.802   1.00 0.00 ? 100 SER A HB2  6  
ATOM 8932  H HB3  . SER A 1 100 ? -16.380 0.335   -0.639  1.00 0.00 ? 100 SER A HB3  6  
ATOM 8933  H HG   . SER A 1 100 ? -18.408 -0.659  1.171   1.00 0.00 ? 100 SER A HG   6  
ATOM 8934  N N    . GLY A 1 101 ? -18.428 -1.228  -2.623  1.00 0.00 ? 101 GLY A N    6  
ATOM 8935  C CA   . GLY A 1 101 ? -18.725 -0.944  -4.016  1.00 0.00 ? 101 GLY A CA   6  
ATOM 8936  C C    . GLY A 1 101 ? -20.020 -0.140  -4.148  1.00 0.00 ? 101 GLY A C    6  
ATOM 8937  O O    . GLY A 1 101 ? -20.489 0.451   -3.177  1.00 0.00 ? 101 GLY A O    6  
ATOM 8938  H H    . GLY A 1 101 ? -19.224 -1.256  -2.018  1.00 0.00 ? 101 GLY A H    6  
ATOM 8939  H HA2  . GLY A 1 101 ? -17.900 -0.387  -4.462  1.00 0.00 ? 101 GLY A HA2  6  
ATOM 8940  H HA3  . GLY A 1 101 ? -18.814 -1.878  -4.571  1.00 0.00 ? 101 GLY A HA3  6  
ATOM 8941  N N    . GLY A 1 1   ? 8.831   -18.629 -19.255 1.00 0.00 ? 1   GLY A N    7  
ATOM 8942  C CA   . GLY A 1 1   ? 8.351   -18.509 -17.889 1.00 0.00 ? 1   GLY A CA   7  
ATOM 8943  C C    . GLY A 1 1   ? 9.171   -19.384 -16.940 1.00 0.00 ? 1   GLY A C    7  
ATOM 8944  O O    . GLY A 1 1   ? 10.400  -19.330 -16.946 1.00 0.00 ? 1   GLY A O    7  
ATOM 8945  H H1   . GLY A 1 1   ? 9.121   -17.771 -19.678 1.00 0.00 ? 1   GLY A H1   7  
ATOM 8946  H HA2  . GLY A 1 1   ? 8.408   -17.468 -17.570 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 8947  H HA3  . GLY A 1 1   ? 7.301   -18.799 -17.842 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 8948  N N    . SER A 1 2   ? 8.459   -20.170 -16.146 1.00 0.00 ? 2   SER A N    7  
ATOM 8949  C CA   . SER A 1 2   ? 9.106   -21.055 -15.193 1.00 0.00 ? 2   SER A CA   7  
ATOM 8950  C C    . SER A 1 2   ? 9.729   -20.239 -14.059 1.00 0.00 ? 2   SER A C    7  
ATOM 8951  O O    . SER A 1 2   ? 9.350   -20.392 -12.898 1.00 0.00 ? 2   SER A O    7  
ATOM 8952  C CB   . SER A 1 2   ? 10.172  -21.915 -15.875 1.00 0.00 ? 2   SER A CB   7  
ATOM 8953  O OG   . SER A 1 2   ? 9.718   -22.441 -17.119 1.00 0.00 ? 2   SER A OG   7  
ATOM 8954  H H    . SER A 1 2   ? 7.460   -20.207 -16.146 1.00 0.00 ? 2   SER A H    7  
ATOM 8955  H HA   . SER A 1 2   ? 8.312   -21.698 -14.811 1.00 0.00 ? 2   SER A HA   7  
ATOM 8956  H HB2  . SER A 1 2   ? 11.069  -21.317 -16.041 1.00 0.00 ? 2   SER A HB2  7  
ATOM 8957  H HB3  . SER A 1 2   ? 10.454  -22.735 -15.215 1.00 0.00 ? 2   SER A HB3  7  
ATOM 8958  H HG   . SER A 1 2   ? 9.133   -23.237 -16.961 1.00 0.00 ? 2   SER A HG   7  
ATOM 8959  N N    . SER A 1 3   ? 10.674  -19.389 -14.434 1.00 0.00 ? 3   SER A N    7  
ATOM 8960  C CA   . SER A 1 3   ? 11.352  -18.548 -13.463 1.00 0.00 ? 3   SER A CA   7  
ATOM 8961  C C    . SER A 1 3   ? 10.332  -17.920 -12.511 1.00 0.00 ? 3   SER A C    7  
ATOM 8962  O O    . SER A 1 3   ? 9.246   -17.524 -12.932 1.00 0.00 ? 3   SER A O    7  
ATOM 8963  C CB   . SER A 1 3   ? 12.173  -17.458 -14.156 1.00 0.00 ? 3   SER A CB   7  
ATOM 8964  O OG   . SER A 1 3   ? 13.284  -17.998 -14.866 1.00 0.00 ? 3   SER A OG   7  
ATOM 8965  H H    . SER A 1 3   ? 10.976  -19.271 -15.380 1.00 0.00 ? 3   SER A H    7  
ATOM 8966  H HA   . SER A 1 3   ? 12.021  -19.216 -12.920 1.00 0.00 ? 3   SER A HA   7  
ATOM 8967  H HB2  . SER A 1 3   ? 11.534  -16.907 -14.846 1.00 0.00 ? 3   SER A HB2  7  
ATOM 8968  H HB3  . SER A 1 3   ? 12.529  -16.745 -13.413 1.00 0.00 ? 3   SER A HB3  7  
ATOM 8969  H HG   . SER A 1 3   ? 13.899  -18.469 -14.234 1.00 0.00 ? 3   SER A HG   7  
ATOM 8970  N N    . GLY A 1 4   ? 10.718  -17.847 -11.245 1.00 0.00 ? 4   GLY A N    7  
ATOM 8971  C CA   . GLY A 1 4   ? 9.851   -17.274 -10.231 1.00 0.00 ? 4   GLY A CA   7  
ATOM 8972  C C    . GLY A 1 4   ? 10.441  -15.977 -9.674  1.00 0.00 ? 4   GLY A C    7  
ATOM 8973  O O    . GLY A 1 4   ? 11.174  -15.998 -8.686  1.00 0.00 ? 4   GLY A O    7  
ATOM 8974  H H    . GLY A 1 4   ? 11.603  -18.171 -10.911 1.00 0.00 ? 4   GLY A H    7  
ATOM 8975  H HA2  . GLY A 1 4   ? 8.867   -17.076 -10.657 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 8976  H HA3  . GLY A 1 4   ? 9.709   -17.990 -9.421  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 8977  N N    . SER A 1 5   ? 10.099  -14.879 -10.332 1.00 0.00 ? 5   SER A N    7  
ATOM 8978  C CA   . SER A 1 5   ? 10.587  -13.575 -9.915  1.00 0.00 ? 5   SER A CA   7  
ATOM 8979  C C    . SER A 1 5   ? 10.214  -13.319 -8.453  1.00 0.00 ? 5   SER A C    7  
ATOM 8980  O O    . SER A 1 5   ? 9.364   -14.012 -7.896  1.00 0.00 ? 5   SER A O    7  
ATOM 8981  C CB   . SER A 1 5   ? 10.025  -12.466 -10.807 1.00 0.00 ? 5   SER A CB   7  
ATOM 8982  O OG   . SER A 1 5   ? 11.001  -11.968 -11.719 1.00 0.00 ? 5   SER A OG   7  
ATOM 8983  H H    . SER A 1 5   ? 9.503   -14.870 -11.134 1.00 0.00 ? 5   SER A H    7  
ATOM 8984  H HA   . SER A 1 5   ? 11.669  -13.620 -10.031 1.00 0.00 ? 5   SER A HA   7  
ATOM 8985  H HB2  . SER A 1 5   ? 9.170   -12.848 -11.365 1.00 0.00 ? 5   SER A HB2  7  
ATOM 8986  H HB3  . SER A 1 5   ? 9.660   -11.649 -10.185 1.00 0.00 ? 5   SER A HB3  7  
ATOM 8987  H HG   . SER A 1 5   ? 11.460  -11.171 -11.327 1.00 0.00 ? 5   SER A HG   7  
ATOM 8988  N N    . SER A 1 6   ? 10.867  -12.323 -7.874  1.00 0.00 ? 6   SER A N    7  
ATOM 8989  C CA   . SER A 1 6   ? 10.615  -11.967 -6.488  1.00 0.00 ? 6   SER A CA   7  
ATOM 8990  C C    . SER A 1 6   ? 10.619  -10.446 -6.329  1.00 0.00 ? 6   SER A C    7  
ATOM 8991  O O    . SER A 1 6   ? 11.656  -9.804  -6.486  1.00 0.00 ? 6   SER A O    7  
ATOM 8992  C CB   . SER A 1 6   ? 11.652  -12.601 -5.560  1.00 0.00 ? 6   SER A CB   7  
ATOM 8993  O OG   . SER A 1 6   ? 11.621  -12.029 -4.255  1.00 0.00 ? 6   SER A OG   7  
ATOM 8994  H H    . SER A 1 6   ? 11.557  -11.764 -8.335  1.00 0.00 ? 6   SER A H    7  
ATOM 8995  H HA   . SER A 1 6   ? 9.629   -12.373 -6.261  1.00 0.00 ? 6   SER A HA   7  
ATOM 8996  H HB2  . SER A 1 6   ? 11.470  -13.673 -5.490  1.00 0.00 ? 6   SER A HB2  7  
ATOM 8997  H HB3  . SER A 1 6   ? 12.647  -12.474 -5.987  1.00 0.00 ? 6   SER A HB3  7  
ATOM 8998  H HG   . SER A 1 6   ? 10.901  -12.458 -3.710  1.00 0.00 ? 6   SER A HG   7  
ATOM 8999  N N    . GLY A 1 7   ? 9.446   -9.912  -6.020  1.00 0.00 ? 7   GLY A N    7  
ATOM 9000  C CA   . GLY A 1 7   ? 9.301   -8.478  -5.838  1.00 0.00 ? 7   GLY A CA   7  
ATOM 9001  C C    . GLY A 1 7   ? 8.405   -7.875  -6.922  1.00 0.00 ? 7   GLY A C    7  
ATOM 9002  O O    . GLY A 1 7   ? 8.730   -7.940  -8.107  1.00 0.00 ? 7   GLY A O    7  
ATOM 9003  H H    . GLY A 1 7   ? 8.607   -10.441 -5.894  1.00 0.00 ? 7   GLY A H    7  
ATOM 9004  H HA2  . GLY A 1 7   ? 8.876   -8.273  -4.855  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 9005  H HA3  . GLY A 1 7   ? 10.282  -8.003  -5.866  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 9006  N N    . GLU A 1 8   ? 7.296   -7.303  -6.477  1.00 0.00 ? 8   GLU A N    7  
ATOM 9007  C CA   . GLU A 1 8   ? 6.351   -6.689  -7.395  1.00 0.00 ? 8   GLU A CA   7  
ATOM 9008  C C    . GLU A 1 8   ? 5.904   -5.326  -6.863  1.00 0.00 ? 8   GLU A C    7  
ATOM 9009  O O    . GLU A 1 8   ? 4.866   -5.219  -6.213  1.00 0.00 ? 8   GLU A O    7  
ATOM 9010  C CB   . GLU A 1 8   ? 5.149   -7.604  -7.637  1.00 0.00 ? 8   GLU A CB   7  
ATOM 9011  C CG   . GLU A 1 8   ? 4.079   -6.895  -8.470  1.00 0.00 ? 8   GLU A CG   7  
ATOM 9012  C CD   . GLU A 1 8   ? 2.762   -7.673  -8.449  1.00 0.00 ? 8   GLU A CD   7  
ATOM 9013  O OE1  . GLU A 1 8   ? 2.840   -8.921  -8.484  1.00 0.00 ? 8   GLU A OE1  7  
ATOM 9014  O OE2  . GLU A 1 8   ? 1.708   -7.004  -8.397  1.00 0.00 ? 8   GLU A OE2  7  
ATOM 9015  H H    . GLU A 1 8   ? 7.040   -7.254  -5.512  1.00 0.00 ? 8   GLU A H    7  
ATOM 9016  H HA   . GLU A 1 8   ? 6.897   -6.561  -8.330  1.00 0.00 ? 8   GLU A HA   7  
ATOM 9017  H HB2  . GLU A 1 8   ? 5.474   -8.509  -8.151  1.00 0.00 ? 8   GLU A HB2  7  
ATOM 9018  H HB3  . GLU A 1 8   ? 4.725   -7.914  -6.682  1.00 0.00 ? 8   GLU A HB3  7  
ATOM 9019  H HG2  . GLU A 1 8   ? 3.918   -5.889  -8.081  1.00 0.00 ? 8   GLU A HG2  7  
ATOM 9020  H HG3  . GLU A 1 8   ? 4.426   -6.787  -9.498  1.00 0.00 ? 8   GLU A HG3  7  
ATOM 9021  N N    . VAL A 1 9   ? 6.711   -4.317  -7.161  1.00 0.00 ? 9   VAL A N    7  
ATOM 9022  C CA   . VAL A 1 9   ? 6.411   -2.965  -6.721  1.00 0.00 ? 9   VAL A CA   7  
ATOM 9023  C C    . VAL A 1 9   ? 5.362   -2.352  -7.650  1.00 0.00 ? 9   VAL A C    7  
ATOM 9024  O O    . VAL A 1 9   ? 5.552   -2.311  -8.865  1.00 0.00 ? 9   VAL A O    7  
ATOM 9025  C CB   . VAL A 1 9   ? 7.699   -2.142  -6.646  1.00 0.00 ? 9   VAL A CB   7  
ATOM 9026  C CG1  . VAL A 1 9   ? 7.388   -0.649  -6.520  1.00 0.00 ? 9   VAL A CG1  7  
ATOM 9027  C CG2  . VAL A 1 9   ? 8.587   -2.617  -5.495  1.00 0.00 ? 9   VAL A CG2  7  
ATOM 9028  H H    . VAL A 1 9   ? 7.553   -4.412  -7.691  1.00 0.00 ? 9   VAL A H    7  
ATOM 9029  H HA   . VAL A 1 9   ? 5.994   -3.031  -5.716  1.00 0.00 ? 9   VAL A HA   7  
ATOM 9030  H HB   . VAL A 1 9   ? 8.247   -2.292  -7.577  1.00 0.00 ? 9   VAL A HB   7  
ATOM 9031  H HG11 . VAL A 1 9   ? 6.679   -0.358  -7.295  1.00 0.00 ? 9   VAL A HG11 7  
ATOM 9032  H HG12 . VAL A 1 9   ? 6.956   -0.450  -5.539  1.00 0.00 ? 9   VAL A HG12 7  
ATOM 9033  H HG13 . VAL A 1 9   ? 8.308   -0.075  -6.635  1.00 0.00 ? 9   VAL A HG13 7  
ATOM 9034  H HG21 . VAL A 1 9   ? 9.595   -2.224  -5.629  1.00 0.00 ? 9   VAL A HG21 7  
ATOM 9035  H HG22 . VAL A 1 9   ? 8.180   -2.258  -4.550  1.00 0.00 ? 9   VAL A HG22 7  
ATOM 9036  H HG23 . VAL A 1 9   ? 8.620   -3.706  -5.487  1.00 0.00 ? 9   VAL A HG23 7  
ATOM 9037  N N    . ARG A 1 10  ? 4.279   -1.889  -7.044  1.00 0.00 ? 10  ARG A N    7  
ATOM 9038  C CA   . ARG A 1 10  ? 3.199   -1.280  -7.802  1.00 0.00 ? 10  ARG A CA   7  
ATOM 9039  C C    . ARG A 1 10  ? 3.368   0.240   -7.838  1.00 0.00 ? 10  ARG A C    7  
ATOM 9040  O O    . ARG A 1 10  ? 4.137   0.802   -7.059  1.00 0.00 ? 10  ARG A O    7  
ATOM 9041  C CB   . ARG A 1 10  ? 1.838   -1.621  -7.194  1.00 0.00 ? 10  ARG A CB   7  
ATOM 9042  C CG   . ARG A 1 10  ? 1.763   -1.173  -5.732  1.00 0.00 ? 10  ARG A CG   7  
ATOM 9043  C CD   . ARG A 1 10  ? 1.368   -2.338  -4.822  1.00 0.00 ? 10  ARG A CD   7  
ATOM 9044  N NE   . ARG A 1 10  ? 2.057   -2.216  -3.518  1.00 0.00 ? 10  ARG A NE   7  
ATOM 9045  C CZ   . ARG A 1 10  ? 1.615   -2.770  -2.380  1.00 0.00 ? 10  ARG A CZ   7  
ATOM 9046  N NH1  . ARG A 1 10  ? 0.483   -3.487  -2.380  1.00 0.00 ? 10  ARG A NH1  7  
ATOM 9047  N NH2  . ARG A 1 10  ? 2.306   -2.607  -1.243  1.00 0.00 ? 10  ARG A NH2  7  
ATOM 9048  H H    . ARG A 1 10  ? 4.132   -1.926  -6.055  1.00 0.00 ? 10  ARG A H    7  
ATOM 9049  H HA   . ARG A 1 10  ? 3.285   -1.707  -8.801  1.00 0.00 ? 10  ARG A HA   7  
ATOM 9050  H HB2  . ARG A 1 10  ? 1.047   -1.136  -7.767  1.00 0.00 ? 10  ARG A HB2  7  
ATOM 9051  H HB3  . ARG A 1 10  ? 1.665   -2.695  -7.258  1.00 0.00 ? 10  ARG A HB3  7  
ATOM 9052  H HG2  . ARG A 1 10  ? 2.728   -0.774  -5.421  1.00 0.00 ? 10  ARG A HG2  7  
ATOM 9053  H HG3  . ARG A 1 10  ? 1.037   -0.366  -5.632  1.00 0.00 ? 10  ARG A HG3  7  
ATOM 9054  H HD2  . ARG A 1 10  ? 0.288   -2.344  -4.673  1.00 0.00 ? 10  ARG A HD2  7  
ATOM 9055  H HD3  . ARG A 1 10  ? 1.630   -3.284  -5.294  1.00 0.00 ? 10  ARG A HD3  7  
ATOM 9056  H HE   . ARG A 1 10  ? 2.905   -1.688  -3.483  1.00 0.00 ? 10  ARG A HE   7  
ATOM 9057  H HH11 . ARG A 1 10  ? -0.032  -3.608  -3.228  1.00 0.00 ? 10  ARG A HH11 7  
ATOM 9058  H HH12 . ARG A 1 10  ? 0.154   -3.900  -1.531  1.00 0.00 ? 10  ARG A HH12 7  
ATOM 9059  H HH21 . ARG A 1 10  ? 3.151   -2.072  -1.244  1.00 0.00 ? 10  ARG A HH21 7  
ATOM 9060  H HH22 . ARG A 1 10  ? 1.976   -3.021  -0.395  1.00 0.00 ? 10  ARG A HH22 7  
ATOM 9061  N N    . LEU A 1 11  ? 2.637   0.864   -8.750  1.00 0.00 ? 11  LEU A N    7  
ATOM 9062  C CA   . LEU A 1 11  ? 2.696   2.308   -8.897  1.00 0.00 ? 11  LEU A CA   7  
ATOM 9063  C C    . LEU A 1 11  ? 1.299   2.896   -8.689  1.00 0.00 ? 11  LEU A C    7  
ATOM 9064  O O    . LEU A 1 11  ? 0.439   2.786   -9.562  1.00 0.00 ? 11  LEU A O    7  
ATOM 9065  C CB   . LEU A 1 11  ? 3.327   2.685   -10.239 1.00 0.00 ? 11  LEU A CB   7  
ATOM 9066  C CG   . LEU A 1 11  ? 4.810   2.344   -10.401 1.00 0.00 ? 11  LEU A CG   7  
ATOM 9067  C CD1  . LEU A 1 11  ? 5.292   2.655   -11.820 1.00 0.00 ? 11  LEU A CD1  7  
ATOM 9068  C CD2  . LEU A 1 11  ? 5.655   3.053   -9.341  1.00 0.00 ? 11  LEU A CD2  7  
ATOM 9069  H H    . LEU A 1 11  ? 2.014   0.400   -9.380  1.00 0.00 ? 11  LEU A H    7  
ATOM 9070  H HA   . LEU A 1 11  ? 3.351   2.690   -8.114  1.00 0.00 ? 11  LEU A HA   7  
ATOM 9071  H HB2  . LEU A 1 11  ? 2.771   2.186   -11.032 1.00 0.00 ? 11  LEU A HB2  7  
ATOM 9072  H HB3  . LEU A 1 11  ? 3.203   3.757   -10.388 1.00 0.00 ? 11  LEU A HB3  7  
ATOM 9073  H HG   . LEU A 1 11  ? 4.933   1.272   -10.247 1.00 0.00 ? 11  LEU A HG   7  
ATOM 9074  H HD11 . LEU A 1 11  ? 4.790   3.551   -12.186 1.00 0.00 ? 11  LEU A HD11 7  
ATOM 9075  H HD12 . LEU A 1 11  ? 6.369   2.820   -11.810 1.00 0.00 ? 11  LEU A HD12 7  
ATOM 9076  H HD13 . LEU A 1 11  ? 5.059   1.815   -12.475 1.00 0.00 ? 11  LEU A HD13 7  
ATOM 9077  H HD21 . LEU A 1 11  ? 5.255   4.051   -9.165  1.00 0.00 ? 11  LEU A HD21 7  
ATOM 9078  H HD22 . LEU A 1 11  ? 5.627   2.482   -8.413  1.00 0.00 ? 11  LEU A HD22 7  
ATOM 9079  H HD23 . LEU A 1 11  ? 6.685   3.130   -9.689  1.00 0.00 ? 11  LEU A HD23 7  
ATOM 9080  N N    . VAL A 1 12  ? 1.115   3.506   -7.527  1.00 0.00 ? 12  VAL A N    7  
ATOM 9081  C CA   . VAL A 1 12  ? -0.163  4.110   -7.193  1.00 0.00 ? 12  VAL A CA   7  
ATOM 9082  C C    . VAL A 1 12  ? -0.127  5.599   -7.547  1.00 0.00 ? 12  VAL A C    7  
ATOM 9083  O O    . VAL A 1 12  ? 0.911   6.246   -7.415  1.00 0.00 ? 12  VAL A O    7  
ATOM 9084  C CB   . VAL A 1 12  ? -0.495  3.854   -5.722  1.00 0.00 ? 12  VAL A CB   7  
ATOM 9085  C CG1  . VAL A 1 12  ? -1.726  4.654   -5.290  1.00 0.00 ? 12  VAL A CG1  7  
ATOM 9086  C CG2  . VAL A 1 12  ? -0.692  2.360   -5.457  1.00 0.00 ? 12  VAL A CG2  7  
ATOM 9087  H H    . VAL A 1 12  ? 1.819   3.590   -6.822  1.00 0.00 ? 12  VAL A H    7  
ATOM 9088  H HA   . VAL A 1 12  ? -0.926  3.624   -7.801  1.00 0.00 ? 12  VAL A HA   7  
ATOM 9089  H HB   . VAL A 1 12  ? 0.351   4.191   -5.123  1.00 0.00 ? 12  VAL A HB   7  
ATOM 9090  H HG11 . VAL A 1 12  ? -2.629  4.110   -5.567  1.00 0.00 ? 12  VAL A HG11 7  
ATOM 9091  H HG12 . VAL A 1 12  ? -1.705  4.797   -4.209  1.00 0.00 ? 12  VAL A HG12 7  
ATOM 9092  H HG13 . VAL A 1 12  ? -1.720  5.625   -5.785  1.00 0.00 ? 12  VAL A HG13 7  
ATOM 9093  H HG21 . VAL A 1 12  ? -0.565  1.806   -6.387  1.00 0.00 ? 12  VAL A HG21 7  
ATOM 9094  H HG22 . VAL A 1 12  ? 0.045   2.020   -4.729  1.00 0.00 ? 12  VAL A HG22 7  
ATOM 9095  H HG23 . VAL A 1 12  ? -1.695  2.189   -5.066  1.00 0.00 ? 12  VAL A HG23 7  
ATOM 9096  N N    . SER A 1 13  ? -1.272  6.097   -7.989  1.00 0.00 ? 13  SER A N    7  
ATOM 9097  C CA   . SER A 1 13  ? -1.384  7.497   -8.362  1.00 0.00 ? 13  SER A CA   7  
ATOM 9098  C C    . SER A 1 13  ? -2.581  8.134   -7.654  1.00 0.00 ? 13  SER A C    7  
ATOM 9099  O O    . SER A 1 13  ? -3.709  7.662   -7.789  1.00 0.00 ? 13  SER A O    7  
ATOM 9100  C CB   . SER A 1 13  ? -1.519  7.654   -9.878  1.00 0.00 ? 13  SER A CB   7  
ATOM 9101  O OG   . SER A 1 13  ? -2.860  7.457   -10.318 1.00 0.00 ? 13  SER A OG   7  
ATOM 9102  H H    . SER A 1 13  ? -2.111  5.564   -8.093  1.00 0.00 ? 13  SER A H    7  
ATOM 9103  H HA   . SER A 1 13  ? -0.454  7.959   -8.031  1.00 0.00 ? 13  SER A HA   7  
ATOM 9104  H HB2  . SER A 1 13  ? -1.184  8.649   -10.171 1.00 0.00 ? 13  SER A HB2  7  
ATOM 9105  H HB3  . SER A 1 13  ? -0.865  6.938   -10.376 1.00 0.00 ? 13  SER A HB3  7  
ATOM 9106  H HG   . SER A 1 13  ? -2.906  6.671   -10.935 1.00 0.00 ? 13  SER A HG   7  
ATOM 9107  N N    . LEU A 1 14  ? -2.295  9.195   -6.915  1.00 0.00 ? 14  LEU A N    7  
ATOM 9108  C CA   . LEU A 1 14  ? -3.335  9.901   -6.185  1.00 0.00 ? 14  LEU A CA   7  
ATOM 9109  C C    . LEU A 1 14  ? -3.365  11.363  -6.635  1.00 0.00 ? 14  LEU A C    7  
ATOM 9110  O O    . LEU A 1 14  ? -2.430  12.118  -6.368  1.00 0.00 ? 14  LEU A O    7  
ATOM 9111  C CB   . LEU A 1 14  ? -3.145  9.725   -4.677  1.00 0.00 ? 14  LEU A CB   7  
ATOM 9112  C CG   . LEU A 1 14  ? -3.753  8.461   -4.067  1.00 0.00 ? 14  LEU A CG   7  
ATOM 9113  C CD1  . LEU A 1 14  ? -5.251  8.375   -4.364  1.00 0.00 ? 14  LEU A CD1  7  
ATOM 9114  C CD2  . LEU A 1 14  ? -3.003  7.212   -4.534  1.00 0.00 ? 14  LEU A CD2  7  
ATOM 9115  H H    . LEU A 1 14  ? -1.375  9.573   -6.810  1.00 0.00 ? 14  LEU A H    7  
ATOM 9116  H HA   . LEU A 1 14  ? -4.287  9.440   -6.446  1.00 0.00 ? 14  LEU A HA   7  
ATOM 9117  H HB2  . LEU A 1 14  ? -2.076  9.731   -4.463  1.00 0.00 ? 14  LEU A HB2  7  
ATOM 9118  H HB3  . LEU A 1 14  ? -3.575  10.591  -4.173  1.00 0.00 ? 14  LEU A HB3  7  
ATOM 9119  H HG   . LEU A 1 14  ? -3.642  8.517   -2.984  1.00 0.00 ? 14  LEU A HG   7  
ATOM 9120  H HD11 . LEU A 1 14  ? -5.803  8.298   -3.428  1.00 0.00 ? 14  LEU A HD11 7  
ATOM 9121  H HD12 . LEU A 1 14  ? -5.567  9.270   -4.899  1.00 0.00 ? 14  LEU A HD12 7  
ATOM 9122  H HD13 . LEU A 1 14  ? -5.450  7.496   -4.977  1.00 0.00 ? 14  LEU A HD13 7  
ATOM 9123  H HD21 . LEU A 1 14  ? -2.344  7.472   -5.362  1.00 0.00 ? 14  LEU A HD21 7  
ATOM 9124  H HD22 . LEU A 1 14  ? -2.412  6.813   -3.710  1.00 0.00 ? 14  LEU A HD22 7  
ATOM 9125  H HD23 . LEU A 1 14  ? -3.721  6.460   -4.864  1.00 0.00 ? 14  LEU A HD23 7  
ATOM 9126  N N    . ARG A 1 15  ? -4.448  11.719  -7.310  1.00 0.00 ? 15  ARG A N    7  
ATOM 9127  C CA   . ARG A 1 15  ? -4.611  13.078  -7.799  1.00 0.00 ? 15  ARG A CA   7  
ATOM 9128  C C    . ARG A 1 15  ? -6.015  13.593  -7.475  1.00 0.00 ? 15  ARG A C    7  
ATOM 9129  O O    . ARG A 1 15  ? -7.001  13.112  -8.031  1.00 0.00 ? 15  ARG A O    7  
ATOM 9130  C CB   . ARG A 1 15  ? -4.386  13.149  -9.311  1.00 0.00 ? 15  ARG A CB   7  
ATOM 9131  C CG   . ARG A 1 15  ? -3.226  14.088  -9.648  1.00 0.00 ? 15  ARG A CG   7  
ATOM 9132  C CD   . ARG A 1 15  ? -3.742  15.440  -10.146 1.00 0.00 ? 15  ARG A CD   7  
ATOM 9133  N NE   . ARG A 1 15  ? -2.871  15.946  -11.231 1.00 0.00 ? 15  ARG A NE   7  
ATOM 9134  C CZ   . ARG A 1 15  ? -2.733  15.350  -12.423 1.00 0.00 ? 15  ARG A CZ   7  
ATOM 9135  N NH1  . ARG A 1 15  ? -3.407  14.224  -12.691 1.00 0.00 ? 15  ARG A NH1  7  
ATOM 9136  N NH2  . ARG A 1 15  ? -1.920  15.881  -13.347 1.00 0.00 ? 15  ARG A NH2  7  
ATOM 9137  H H    . ARG A 1 15  ? -5.203  11.100  -7.523  1.00 0.00 ? 15  ARG A H    7  
ATOM 9138  H HA   . ARG A 1 15  ? -3.850  13.656  -7.276  1.00 0.00 ? 15  ARG A HA   7  
ATOM 9139  H HB2  . ARG A 1 15  ? -4.176  12.152  -9.699  1.00 0.00 ? 15  ARG A HB2  7  
ATOM 9140  H HB3  . ARG A 1 15  ? -5.295  13.497  -9.802  1.00 0.00 ? 15  ARG A HB3  7  
ATOM 9141  H HG2  . ARG A 1 15  ? -2.604  14.235  -8.766  1.00 0.00 ? 15  ARG A HG2  7  
ATOM 9142  H HG3  . ARG A 1 15  ? -2.595  13.633  -10.411 1.00 0.00 ? 15  ARG A HG3  7  
ATOM 9143  H HD2  . ARG A 1 15  ? -4.765  15.337  -10.508 1.00 0.00 ? 15  ARG A HD2  7  
ATOM 9144  H HD3  . ARG A 1 15  ? -3.765  16.155  -9.324  1.00 0.00 ? 15  ARG A HD3  7  
ATOM 9145  H HE   . ARG A 1 15  ? -2.353  16.785  -11.063 1.00 0.00 ? 15  ARG A HE   7  
ATOM 9146  H HH11 . ARG A 1 15  ? -4.014  13.828  -12.001 1.00 0.00 ? 15  ARG A HH11 7  
ATOM 9147  H HH12 . ARG A 1 15  ? -3.304  13.779  -13.581 1.00 0.00 ? 15  ARG A HH12 7  
ATOM 9148  H HH21 . ARG A 1 15  ? -1.417  16.721  -13.147 1.00 0.00 ? 15  ARG A HH21 7  
ATOM 9149  H HH22 . ARG A 1 15  ? -1.817  15.436  -14.236 1.00 0.00 ? 15  ARG A HH22 7  
ATOM 9150  N N    . ARG A 1 16  ? -6.060  14.566  -6.576  1.00 0.00 ? 16  ARG A N    7  
ATOM 9151  C CA   . ARG A 1 16  ? -7.327  15.152  -6.171  1.00 0.00 ? 16  ARG A CA   7  
ATOM 9152  C C    . ARG A 1 16  ? -7.155  15.942  -4.872  1.00 0.00 ? 16  ARG A C    7  
ATOM 9153  O O    . ARG A 1 16  ? -7.366  15.408  -3.784  1.00 0.00 ? 16  ARG A O    7  
ATOM 9154  C CB   . ARG A 1 16  ? -8.392  14.073  -5.967  1.00 0.00 ? 16  ARG A CB   7  
ATOM 9155  C CG   . ARG A 1 16  ? -9.508  14.201  -7.006  1.00 0.00 ? 16  ARG A CG   7  
ATOM 9156  C CD   . ARG A 1 16  ? -10.025 12.824  -7.427  1.00 0.00 ? 16  ARG A CD   7  
ATOM 9157  N NE   . ARG A 1 16  ? -11.478 12.891  -7.702  1.00 0.00 ? 16  ARG A NE   7  
ATOM 9158  C CZ   . ARG A 1 16  ? -12.188 11.890  -8.241  1.00 0.00 ? 16  ARG A CZ   7  
ATOM 9159  N NH1  . ARG A 1 16  ? -11.583 10.739  -8.565  1.00 0.00 ? 16  ARG A NH1  7  
ATOM 9160  N NH2  . ARG A 1 16  ? -13.502 12.040  -8.454  1.00 0.00 ? 16  ARG A NH2  7  
ATOM 9161  H H    . ARG A 1 16  ? -5.254  14.952  -6.129  1.00 0.00 ? 16  ARG A H    7  
ATOM 9162  H HA   . ARG A 1 16  ? -7.606  15.808  -6.995  1.00 0.00 ? 16  ARG A HA   7  
ATOM 9163  H HB2  . ARG A 1 16  ? -7.935  13.087  -6.039  1.00 0.00 ? 16  ARG A HB2  7  
ATOM 9164  H HB3  . ARG A 1 16  ? -8.813  14.158  -4.965  1.00 0.00 ? 16  ARG A HB3  7  
ATOM 9165  H HG2  . ARG A 1 16  ? -10.327 14.791  -6.596  1.00 0.00 ? 16  ARG A HG2  7  
ATOM 9166  H HG3  . ARG A 1 16  ? -9.136  14.736  -7.880  1.00 0.00 ? 16  ARG A HG3  7  
ATOM 9167  H HD2  . ARG A 1 16  ? -9.494  12.482  -8.316  1.00 0.00 ? 16  ARG A HD2  7  
ATOM 9168  H HD3  . ARG A 1 16  ? -9.829  12.096  -6.639  1.00 0.00 ? 16  ARG A HD3  7  
ATOM 9169  H HE   . ARG A 1 16  ? -11.960 13.736  -7.471  1.00 0.00 ? 16  ARG A HE   7  
ATOM 9170  H HH11 . ARG A 1 16  ? -10.603 10.627  -8.406  1.00 0.00 ? 16  ARG A HH11 7  
ATOM 9171  H HH12 . ARG A 1 16  ? -12.113 9.992   -8.967  1.00 0.00 ? 16  ARG A HH12 7  
ATOM 9172  H HH21 . ARG A 1 16  ? -13.953 12.899  -8.212  1.00 0.00 ? 16  ARG A HH21 7  
ATOM 9173  H HH22 . ARG A 1 16  ? -14.032 11.294  -8.856  1.00 0.00 ? 16  ARG A HH22 7  
ATOM 9174  N N    . ALA A 1 17  ? -6.773  17.201  -5.029  1.00 0.00 ? 17  ALA A N    7  
ATOM 9175  C CA   . ALA A 1 17  ? -6.570  18.069  -3.882  1.00 0.00 ? 17  ALA A CA   7  
ATOM 9176  C C    . ALA A 1 17  ? -6.251  19.484  -4.369  1.00 0.00 ? 17  ALA A C    7  
ATOM 9177  O O    . ALA A 1 17  ? -5.397  19.668  -5.235  1.00 0.00 ? 17  ALA A O    7  
ATOM 9178  C CB   . ALA A 1 17  ? -5.464  17.495  -2.995  1.00 0.00 ? 17  ALA A CB   7  
ATOM 9179  H H    . ALA A 1 17  ? -6.603  17.627  -5.917  1.00 0.00 ? 17  ALA A H    7  
ATOM 9180  H HA   . ALA A 1 17  ? -7.500  18.091  -3.313  1.00 0.00 ? 17  ALA A HA   7  
ATOM 9181  H HB1  . ALA A 1 17  ? -5.019  18.295  -2.405  1.00 0.00 ? 17  ALA A HB1  7  
ATOM 9182  H HB2  . ALA A 1 17  ? -5.886  16.743  -2.328  1.00 0.00 ? 17  ALA A HB2  7  
ATOM 9183  H HB3  . ALA A 1 17  ? -4.698  17.036  -3.621  1.00 0.00 ? 17  ALA A HB3  7  
ATOM 9184  N N    . LYS A 1 18  ? -6.955  20.447  -3.792  1.00 0.00 ? 18  LYS A N    7  
ATOM 9185  C CA   . LYS A 1 18  ? -6.757  21.840  -4.157  1.00 0.00 ? 18  LYS A CA   7  
ATOM 9186  C C    . LYS A 1 18  ? -6.726  22.695  -2.889  1.00 0.00 ? 18  LYS A C    7  
ATOM 9187  O O    . LYS A 1 18  ? -5.846  23.539  -2.726  1.00 0.00 ? 18  LYS A O    7  
ATOM 9188  C CB   . LYS A 1 18  ? -7.812  22.283  -5.172  1.00 0.00 ? 18  LYS A CB   7  
ATOM 9189  C CG   . LYS A 1 18  ? -9.222  22.148  -4.592  1.00 0.00 ? 18  LYS A CG   7  
ATOM 9190  C CD   . LYS A 1 18  ? -10.276 22.602  -5.604  1.00 0.00 ? 18  LYS A CD   7  
ATOM 9191  C CE   . LYS A 1 18  ? -11.338 21.520  -5.812  1.00 0.00 ? 18  LYS A CE   7  
ATOM 9192  N NZ   . LYS A 1 18  ? -11.248 20.962  -7.179  1.00 0.00 ? 18  LYS A NZ   7  
ATOM 9193  H H    . LYS A 1 18  ? -7.648  20.289  -3.089  1.00 0.00 ? 18  LYS A H    7  
ATOM 9194  H HA   . LYS A 1 18  ? -5.786  21.914  -4.648  1.00 0.00 ? 18  LYS A HA   7  
ATOM 9195  H HB2  . LYS A 1 18  ? -7.632  23.318  -5.463  1.00 0.00 ? 18  LYS A HB2  7  
ATOM 9196  H HB3  . LYS A 1 18  ? -7.728  21.680  -6.076  1.00 0.00 ? 18  LYS A HB3  7  
ATOM 9197  H HG2  . LYS A 1 18  ? -9.405  21.112  -4.310  1.00 0.00 ? 18  LYS A HG2  7  
ATOM 9198  H HG3  . LYS A 1 18  ? -9.303  22.745  -3.684  1.00 0.00 ? 18  LYS A HG3  7  
ATOM 9199  H HD2  . LYS A 1 18  ? -10.750 23.519  -5.253  1.00 0.00 ? 18  LYS A HD2  7  
ATOM 9200  H HD3  . LYS A 1 18  ? -9.797  22.834  -6.555  1.00 0.00 ? 18  LYS A HD3  7  
ATOM 9201  H HE2  . LYS A 1 18  ? -11.204 20.725  -5.078  1.00 0.00 ? 18  LYS A HE2  7  
ATOM 9202  H HE3  . LYS A 1 18  ? -12.330 21.940  -5.649  1.00 0.00 ? 18  LYS A HE3  7  
ATOM 9203  H HZ1  . LYS A 1 18  ? -10.942 20.011  -7.131  1.00 0.00 ? 18  LYS A HZ1  7  
ATOM 9204  H HZ2  . LYS A 1 18  ? -12.147 21.001  -7.615  1.00 0.00 ? 18  LYS A HZ2  7  
ATOM 9205  H HZ3  . LYS A 1 18  ? -10.593 21.495  -7.715  1.00 0.00 ? 18  LYS A HZ3  7  
ATOM 9206  N N    . ALA A 1 19  ? -7.698  22.448  -2.023  1.00 0.00 ? 19  ALA A N    7  
ATOM 9207  C CA   . ALA A 1 19  ? -7.794  23.185  -0.775  1.00 0.00 ? 19  ALA A CA   7  
ATOM 9208  C C    . ALA A 1 19  ? -8.506  22.322  0.269   1.00 0.00 ? 19  ALA A C    7  
ATOM 9209  O O    . ALA A 1 19  ? -9.176  22.844  1.159   1.00 0.00 ? 19  ALA A O    7  
ATOM 9210  C CB   . ALA A 1 19  ? -8.511  24.514  -1.020  1.00 0.00 ? 19  ALA A CB   7  
ATOM 9211  H H    . ALA A 1 19  ? -8.410  21.760  -2.163  1.00 0.00 ? 19  ALA A H    7  
ATOM 9212  H HA   . ALA A 1 19  ? -6.779  23.391  -0.433  1.00 0.00 ? 19  ALA A HA   7  
ATOM 9213  H HB1  . ALA A 1 19  ? -9.555  24.323  -1.267  1.00 0.00 ? 19  ALA A HB1  7  
ATOM 9214  H HB2  . ALA A 1 19  ? -8.457  25.127  -0.120  1.00 0.00 ? 19  ALA A HB2  7  
ATOM 9215  H HB3  . ALA A 1 19  ? -8.032  25.039  -1.846  1.00 0.00 ? 19  ALA A HB3  7  
ATOM 9216  N N    . HIS A 1 20  ? -8.336  21.016  0.125   1.00 0.00 ? 20  HIS A N    7  
ATOM 9217  C CA   . HIS A 1 20  ? -8.955  20.076  1.045   1.00 0.00 ? 20  HIS A CA   7  
ATOM 9218  C C    . HIS A 1 20  ? -8.643  18.645  0.602   1.00 0.00 ? 20  HIS A C    7  
ATOM 9219  O O    . HIS A 1 20  ? -8.674  18.339  -0.589  1.00 0.00 ? 20  HIS A O    7  
ATOM 9220  C CB   . HIS A 1 20  ? -10.456 20.344  1.169   1.00 0.00 ? 20  HIS A CB   7  
ATOM 9221  C CG   . HIS A 1 20  ? -11.173 20.448  -0.156  1.00 0.00 ? 20  HIS A CG   7  
ATOM 9222  N ND1  . HIS A 1 20  ? -10.866 19.643  -1.240  1.00 0.00 ? 20  HIS A ND1  7  
ATOM 9223  C CD2  . HIS A 1 20  ? -12.184 21.268  -0.561  1.00 0.00 ? 20  HIS A CD2  7  
ATOM 9224  C CE1  . HIS A 1 20  ? -11.663 19.973  -2.245  1.00 0.00 ? 20  HIS A CE1  7  
ATOM 9225  N NE2  . HIS A 1 20  ? -12.479 20.981  -1.823  1.00 0.00 ? 20  HIS A NE2  7  
ATOM 9226  H H    . HIS A 1 20  ? -7.790  20.599  -0.601  1.00 0.00 ? 20  HIS A H    7  
ATOM 9227  H HA   . HIS A 1 20  ? -8.504  20.251  2.021   1.00 0.00 ? 20  HIS A HA   7  
ATOM 9228  H HB2  . HIS A 1 20  ? -10.910 19.545  1.754   1.00 0.00 ? 20  HIS A HB2  7  
ATOM 9229  H HB3  . HIS A 1 20  ? -10.604 21.270  1.724   1.00 0.00 ? 20  HIS A HB3  7  
ATOM 9230  H HD1  . HIS A 1 20  ? -10.163 18.932  -1.260  1.00 0.00 ? 20  HIS A HD1  7  
ATOM 9231  H HD2  . HIS A 1 20  ? -12.668 22.031  0.050   1.00 0.00 ? 20  HIS A HD2  7  
ATOM 9232  H HE1  . HIS A 1 20  ? -11.666 19.519  -3.236  1.00 0.00 ? 20  HIS A HE1  7  
ATOM 9233  N N    . GLU A 1 21  ? -8.350  17.806  1.584   1.00 0.00 ? 21  GLU A N    7  
ATOM 9234  C CA   . GLU A 1 21  ? -8.033  16.414  1.311   1.00 0.00 ? 21  GLU A CA   7  
ATOM 9235  C C    . GLU A 1 21  ? -6.711  16.311  0.547   1.00 0.00 ? 21  GLU A C    7  
ATOM 9236  O O    . GLU A 1 21  ? -6.355  17.214  -0.209  1.00 0.00 ? 21  GLU A O    7  
ATOM 9237  C CB   . GLU A 1 21  ? -9.166  15.735  0.540   1.00 0.00 ? 21  GLU A CB   7  
ATOM 9238  C CG   . GLU A 1 21  ? -9.923  14.750  1.433   1.00 0.00 ? 21  GLU A CG   7  
ATOM 9239  C CD   . GLU A 1 21  ? -11.124 15.426  2.100   1.00 0.00 ? 21  GLU A CD   7  
ATOM 9240  O OE1  . GLU A 1 21  ? -10.906 16.055  3.158   1.00 0.00 ? 21  GLU A OE1  7  
ATOM 9241  O OE2  . GLU A 1 21  ? -12.232 15.297  1.536   1.00 0.00 ? 21  GLU A OE2  7  
ATOM 9242  H H    . GLU A 1 21  ? -8.327  18.062  2.551   1.00 0.00 ? 21  GLU A H    7  
ATOM 9243  H HA   . GLU A 1 21  ? -7.933  15.943  2.288   1.00 0.00 ? 21  GLU A HA   7  
ATOM 9244  H HB2  . GLU A 1 21  ? -9.855  16.489  0.159   1.00 0.00 ? 21  GLU A HB2  7  
ATOM 9245  H HB3  . GLU A 1 21  ? -8.760  15.209  -0.324  1.00 0.00 ? 21  GLU A HB3  7  
ATOM 9246  H HG2  . GLU A 1 21  ? -10.263 13.902  0.839   1.00 0.00 ? 21  GLU A HG2  7  
ATOM 9247  H HG3  . GLU A 1 21  ? -9.253  14.357  2.197   1.00 0.00 ? 21  GLU A HG3  7  
ATOM 9248  N N    . GLY A 1 22  ? -6.020  15.203  0.770   1.00 0.00 ? 22  GLY A N    7  
ATOM 9249  C CA   . GLY A 1 22  ? -4.746  14.971  0.112   1.00 0.00 ? 22  GLY A CA   7  
ATOM 9250  C C    . GLY A 1 22  ? -4.803  13.721  -0.768  1.00 0.00 ? 22  GLY A C    7  
ATOM 9251  O O    . GLY A 1 22  ? -5.761  13.527  -1.515  1.00 0.00 ? 22  GLY A O    7  
ATOM 9252  H H    . GLY A 1 22  ? -6.317  14.474  1.387   1.00 0.00 ? 22  GLY A H    7  
ATOM 9253  H HA2  . GLY A 1 22  ? -4.483  15.836  -0.496  1.00 0.00 ? 22  GLY A HA2  7  
ATOM 9254  H HA3  . GLY A 1 22  ? -3.961  14.857  0.860   1.00 0.00 ? 22  GLY A HA3  7  
ATOM 9255  N N    . LEU A 1 23  ? -3.766  12.905  -0.650  1.00 0.00 ? 23  LEU A N    7  
ATOM 9256  C CA   . LEU A 1 23  ? -3.686  11.679  -1.426  1.00 0.00 ? 23  LEU A CA   7  
ATOM 9257  C C    . LEU A 1 23  ? -4.815  10.737  -1.001  1.00 0.00 ? 23  LEU A C    7  
ATOM 9258  O O    . LEU A 1 23  ? -5.354  9.997   -1.823  1.00 0.00 ? 23  LEU A O    7  
ATOM 9259  C CB   . LEU A 1 23  ? -2.292  11.060  -1.308  1.00 0.00 ? 23  LEU A CB   7  
ATOM 9260  C CG   . LEU A 1 23  ? -1.148  12.034  -1.019  1.00 0.00 ? 23  LEU A CG   7  
ATOM 9261  C CD1  . LEU A 1 23  ? 0.210   11.360  -1.223  1.00 0.00 ? 23  LEU A CD1  7  
ATOM 9262  C CD2  . LEU A 1 23  ? -1.288  13.307  -1.855  1.00 0.00 ? 23  LEU A CD2  7  
ATOM 9263  H H    . LEU A 1 23  ? -2.991  13.070  -0.040  1.00 0.00 ? 23  LEU A H    7  
ATOM 9264  H HA   . LEU A 1 23  ? -3.834  11.944  -2.473  1.00 0.00 ? 23  LEU A HA   7  
ATOM 9265  H HB2  . LEU A 1 23  ? -2.314  10.311  -0.517  1.00 0.00 ? 23  LEU A HB2  7  
ATOM 9266  H HB3  . LEU A 1 23  ? -2.070  10.535  -2.237  1.00 0.00 ? 23  LEU A HB3  7  
ATOM 9267  H HG   . LEU A 1 23  ? -1.207  12.328  0.029   1.00 0.00 ? 23  LEU A HG   7  
ATOM 9268  H HD11 . LEU A 1 23  ? 0.788   11.922  -1.957  1.00 0.00 ? 23  LEU A HD11 7  
ATOM 9269  H HD12 . LEU A 1 23  ? 0.750   11.336  -0.276  1.00 0.00 ? 23  LEU A HD12 7  
ATOM 9270  H HD13 . LEU A 1 23  ? 0.061   10.342  -1.581  1.00 0.00 ? 23  LEU A HD13 7  
ATOM 9271  H HD21 . LEU A 1 23  ? -1.948  13.116  -2.701  1.00 0.00 ? 23  LEU A HD21 7  
ATOM 9272  H HD22 . LEU A 1 23  ? -1.708  14.102  -1.238  1.00 0.00 ? 23  LEU A HD22 7  
ATOM 9273  H HD23 . LEU A 1 23  ? -0.307  13.611  -2.220  1.00 0.00 ? 23  LEU A HD23 7  
ATOM 9274  N N    . GLY A 1 24  ? -5.140  10.796  0.282   1.00 0.00 ? 24  GLY A N    7  
ATOM 9275  C CA   . GLY A 1 24  ? -6.194  9.958   0.827   1.00 0.00 ? 24  GLY A CA   7  
ATOM 9276  C C    . GLY A 1 24  ? -5.621  8.900   1.772   1.00 0.00 ? 24  GLY A C    7  
ATOM 9277  O O    . GLY A 1 24  ? -6.370  8.182   2.433   1.00 0.00 ? 24  GLY A O    7  
ATOM 9278  H H    . GLY A 1 24  ? -4.696  11.401  0.944   1.00 0.00 ? 24  GLY A H    7  
ATOM 9279  H HA2  . GLY A 1 24  ? -6.916  10.576  1.361   1.00 0.00 ? 24  GLY A HA2  7  
ATOM 9280  H HA3  . GLY A 1 24  ? -6.733  9.471   0.014   1.00 0.00 ? 24  GLY A HA3  7  
ATOM 9281  N N    . PHE A 1 25  ? -4.298  8.837   1.806   1.00 0.00 ? 25  PHE A N    7  
ATOM 9282  C CA   . PHE A 1 25  ? -3.616  7.879   2.660   1.00 0.00 ? 25  PHE A CA   7  
ATOM 9283  C C    . PHE A 1 25  ? -2.517  8.560   3.479   1.00 0.00 ? 25  PHE A C    7  
ATOM 9284  O O    . PHE A 1 25  ? -1.734  9.342   2.944   1.00 0.00 ? 25  PHE A O    7  
ATOM 9285  C CB   . PHE A 1 25  ? -2.978  6.836   1.740   1.00 0.00 ? 25  PHE A CB   7  
ATOM 9286  C CG   . PHE A 1 25  ? -1.738  7.336   0.998   1.00 0.00 ? 25  PHE A CG   7  
ATOM 9287  C CD1  . PHE A 1 25  ? -0.528  7.340   1.621   1.00 0.00 ? 25  PHE A CD1  7  
ATOM 9288  C CD2  . PHE A 1 25  ? -1.844  7.776   -0.285  1.00 0.00 ? 25  PHE A CD2  7  
ATOM 9289  C CE1  . PHE A 1 25  ? 0.623   7.804   0.931   1.00 0.00 ? 25  PHE A CE1  7  
ATOM 9290  C CE2  . PHE A 1 25  ? -0.692  8.240   -0.974  1.00 0.00 ? 25  PHE A CE2  7  
ATOM 9291  C CZ   . PHE A 1 25  ? 0.517   8.244   -0.351  1.00 0.00 ? 25  PHE A CZ   7  
ATOM 9292  H H    . PHE A 1 25  ? -3.696  9.425   1.265   1.00 0.00 ? 25  PHE A H    7  
ATOM 9293  H HA   . PHE A 1 25  ? -4.362  7.459   3.334   1.00 0.00 ? 25  PHE A HA   7  
ATOM 9294  H HB2  . PHE A 1 25  ? -2.707  5.962   2.333   1.00 0.00 ? 25  PHE A HB2  7  
ATOM 9295  H HB3  . PHE A 1 25  ? -3.719  6.509   1.010   1.00 0.00 ? 25  PHE A HB3  7  
ATOM 9296  H HD1  . PHE A 1 25  ? -0.443  6.988   2.648   1.00 0.00 ? 25  PHE A HD1  7  
ATOM 9297  H HD2  . PHE A 1 25  ? -2.813  7.772   -0.784  1.00 0.00 ? 25  PHE A HD2  7  
ATOM 9298  H HE1  . PHE A 1 25  ? 1.592   7.808   1.430   1.00 0.00 ? 25  PHE A HE1  7  
ATOM 9299  H HE2  . PHE A 1 25  ? -0.777  8.592   -2.002  1.00 0.00 ? 25  PHE A HE2  7  
ATOM 9300  H HZ   . PHE A 1 25  ? 1.401   8.600   -0.880  1.00 0.00 ? 25  PHE A HZ   7  
ATOM 9301  N N    . SER A 1 26  ? -2.495  8.237   4.763   1.00 0.00 ? 26  SER A N    7  
ATOM 9302  C CA   . SER A 1 26  ? -1.506  8.807   5.662   1.00 0.00 ? 26  SER A CA   7  
ATOM 9303  C C    . SER A 1 26  ? -0.254  7.928   5.687   1.00 0.00 ? 26  SER A C    7  
ATOM 9304  O O    . SER A 1 26  ? -0.328  6.729   5.423   1.00 0.00 ? 26  SER A O    7  
ATOM 9305  C CB   . SER A 1 26  ? -2.071  8.966   7.074   1.00 0.00 ? 26  SER A CB   7  
ATOM 9306  O OG   . SER A 1 26  ? -2.278  10.334  7.415   1.00 0.00 ? 26  SER A OG   7  
ATOM 9307  H H    . SER A 1 26  ? -3.137  7.599   5.191   1.00 0.00 ? 26  SER A H    7  
ATOM 9308  H HA   . SER A 1 26  ? -1.275  9.789   5.250   1.00 0.00 ? 26  SER A HA   7  
ATOM 9309  H HB2  . SER A 1 26  ? -3.015  8.427   7.150   1.00 0.00 ? 26  SER A HB2  7  
ATOM 9310  H HB3  . SER A 1 26  ? -1.387  8.513   7.792   1.00 0.00 ? 26  SER A HB3  7  
ATOM 9311  H HG   . SER A 1 26  ? -1.779  10.924  6.781   1.00 0.00 ? 26  SER A HG   7  
ATOM 9312  N N    . ILE A 1 27  ? 0.867   8.558   6.007   1.00 0.00 ? 27  ILE A N    7  
ATOM 9313  C CA   . ILE A 1 27  ? 2.133   7.848   6.070   1.00 0.00 ? 27  ILE A CA   7  
ATOM 9314  C C    . ILE A 1 27  ? 2.687   7.927   7.494   1.00 0.00 ? 27  ILE A C    7  
ATOM 9315  O O    . ILE A 1 27  ? 2.224   8.734   8.300   1.00 0.00 ? 27  ILE A O    7  
ATOM 9316  C CB   . ILE A 1 27  ? 3.097   8.376   5.005   1.00 0.00 ? 27  ILE A CB   7  
ATOM 9317  C CG1  . ILE A 1 27  ? 3.511   9.818   5.307   1.00 0.00 ? 27  ILE A CG1  7  
ATOM 9318  C CG2  . ILE A 1 27  ? 2.499   8.232   3.604   1.00 0.00 ? 27  ILE A CG2  7  
ATOM 9319  C CD1  . ILE A 1 27  ? 5.010   10.017  5.076   1.00 0.00 ? 27  ILE A CD1  7  
ATOM 9320  H H    . ILE A 1 27  ? 0.918   9.534   6.220   1.00 0.00 ? 27  ILE A H    7  
ATOM 9321  H HA   . ILE A 1 27  ? 1.933   6.803   5.834   1.00 0.00 ? 27  ILE A HA   7  
ATOM 9322  H HB   . ILE A 1 27  ? 4.002   7.769   5.033   1.00 0.00 ? 27  ILE A HB   7  
ATOM 9323  H HG12 . ILE A 1 27  ? 2.947   10.502  4.672   1.00 0.00 ? 27  ILE A HG12 7  
ATOM 9324  H HG13 . ILE A 1 27  ? 3.262   10.063  6.339   1.00 0.00 ? 27  ILE A HG13 7  
ATOM 9325  H HG21 . ILE A 1 27  ? 2.276   7.183   3.410   1.00 0.00 ? 27  ILE A HG21 7  
ATOM 9326  H HG22 . ILE A 1 27  ? 1.580   8.816   3.540   1.00 0.00 ? 27  ILE A HG22 7  
ATOM 9327  H HG23 . ILE A 1 27  ? 3.213   8.595   2.865   1.00 0.00 ? 27  ILE A HG23 7  
ATOM 9328  H HD11 . ILE A 1 27  ? 5.570   9.321   5.701   1.00 0.00 ? 27  ILE A HD11 7  
ATOM 9329  H HD12 . ILE A 1 27  ? 5.244   9.833   4.028   1.00 0.00 ? 27  ILE A HD12 7  
ATOM 9330  H HD13 . ILE A 1 27  ? 5.284   11.040  5.336   1.00 0.00 ? 27  ILE A HD13 7  
ATOM 9331  N N    . ARG A 1 28  ? 3.669   7.079   7.761   1.00 0.00 ? 28  ARG A N    7  
ATOM 9332  C CA   . ARG A 1 28  ? 4.290   7.043   9.074   1.00 0.00 ? 28  ARG A CA   7  
ATOM 9333  C C    . ARG A 1 28  ? 5.764   6.651   8.952   1.00 0.00 ? 28  ARG A C    7  
ATOM 9334  O O    . ARG A 1 28  ? 6.172   6.056   7.956   1.00 0.00 ? 28  ARG A O    7  
ATOM 9335  C CB   . ARG A 1 28  ? 3.579   6.047   9.992   1.00 0.00 ? 28  ARG A CB   7  
ATOM 9336  C CG   . ARG A 1 28  ? 3.605   4.637   9.399   1.00 0.00 ? 28  ARG A CG   7  
ATOM 9337  C CD   . ARG A 1 28  ? 3.619   3.578   10.503  1.00 0.00 ? 28  ARG A CD   7  
ATOM 9338  N NE   . ARG A 1 28  ? 2.613   3.911   11.536  1.00 0.00 ? 28  ARG A NE   7  
ATOM 9339  C CZ   . ARG A 1 28  ? 2.366   3.155   12.615  1.00 0.00 ? 28  ARG A CZ   7  
ATOM 9340  N NH1  . ARG A 1 28  ? 3.051   2.020   12.809  1.00 0.00 ? 28  ARG A NH1  7  
ATOM 9341  N NH2  . ARG A 1 28  ? 1.435   3.536   13.500  1.00 0.00 ? 28  ARG A NH2  7  
ATOM 9342  H H    . ARG A 1 28  ? 4.039   6.426   7.100   1.00 0.00 ? 28  ARG A H    7  
ATOM 9343  H HA   . ARG A 1 28  ? 4.184   8.056   9.460   1.00 0.00 ? 28  ARG A HA   7  
ATOM 9344  H HB2  . ARG A 1 28  ? 4.059   6.043   10.971  1.00 0.00 ? 28  ARG A HB2  7  
ATOM 9345  H HB3  . ARG A 1 28  ? 2.546   6.362   10.145  1.00 0.00 ? 28  ARG A HB3  7  
ATOM 9346  H HG2  . ARG A 1 28  ? 2.734   4.491   8.760   1.00 0.00 ? 28  ARG A HG2  7  
ATOM 9347  H HG3  . ARG A 1 28  ? 4.486   4.521   8.768   1.00 0.00 ? 28  ARG A HG3  7  
ATOM 9348  H HD2  . ARG A 1 28  ? 3.407   2.597   10.079  1.00 0.00 ? 28  ARG A HD2  7  
ATOM 9349  H HD3  . ARG A 1 28  ? 4.610   3.523   10.953  1.00 0.00 ? 28  ARG A HD3  7  
ATOM 9350  H HE   . ARG A 1 28  ? 2.084   4.752   11.422  1.00 0.00 ? 28  ARG A HE   7  
ATOM 9351  H HH11 . ARG A 1 28  ? 3.745   1.736   12.148  1.00 0.00 ? 28  ARG A HH11 7  
ATOM 9352  H HH12 . ARG A 1 28  ? 2.866   1.456   13.614  1.00 0.00 ? 28  ARG A HH12 7  
ATOM 9353  H HH21 . ARG A 1 28  ? 0.924   4.383   13.356  1.00 0.00 ? 28  ARG A HH21 7  
ATOM 9354  H HH22 . ARG A 1 28  ? 1.251   2.972   14.305  1.00 0.00 ? 28  ARG A HH22 7  
ATOM 9355  N N    . GLY A 1 29  ? 6.523   6.999   9.981   1.00 0.00 ? 29  GLY A N    7  
ATOM 9356  C CA   . GLY A 1 29  ? 7.943   6.691   10.003  1.00 0.00 ? 29  GLY A CA   7  
ATOM 9357  C C    . GLY A 1 29  ? 8.782   7.970   9.985   1.00 0.00 ? 29  GLY A C    7  
ATOM 9358  O O    . GLY A 1 29  ? 8.326   9.021   10.433  1.00 0.00 ? 29  GLY A O    7  
ATOM 9359  H H    . GLY A 1 29  ? 6.183   7.482   10.788  1.00 0.00 ? 29  GLY A H    7  
ATOM 9360  H HA2  . GLY A 1 29  ? 8.179   6.109   10.894  1.00 0.00 ? 29  GLY A HA2  7  
ATOM 9361  H HA3  . GLY A 1 29  ? 8.197   6.073   9.142   1.00 0.00 ? 29  GLY A HA3  7  
ATOM 9362  N N    . GLY A 1 30  ? 9.992   7.839   9.463   1.00 0.00 ? 30  GLY A N    7  
ATOM 9363  C CA   . GLY A 1 30  ? 10.899  8.971   9.381   1.00 0.00 ? 30  GLY A CA   7  
ATOM 9364  C C    . GLY A 1 30  ? 12.308  8.579   9.829   1.00 0.00 ? 30  GLY A C    7  
ATOM 9365  O O    . GLY A 1 30  ? 12.471  7.752   10.725  1.00 0.00 ? 30  GLY A O    7  
ATOM 9366  H H    . GLY A 1 30  ? 10.355  6.980   9.101   1.00 0.00 ? 30  GLY A H    7  
ATOM 9367  H HA2  . GLY A 1 30  ? 10.929  9.344   8.358   1.00 0.00 ? 30  GLY A HA2  7  
ATOM 9368  H HA3  . GLY A 1 30  ? 10.528  9.784   10.006  1.00 0.00 ? 30  GLY A HA3  7  
ATOM 9369  N N    . SER A 1 31  ? 13.291  9.190   9.185   1.00 0.00 ? 31  SER A N    7  
ATOM 9370  C CA   . SER A 1 31  ? 14.681  8.915   9.506   1.00 0.00 ? 31  SER A CA   7  
ATOM 9371  C C    . SER A 1 31  ? 14.960  9.267   10.968  1.00 0.00 ? 31  SER A C    7  
ATOM 9372  O O    . SER A 1 31  ? 15.784  8.624   11.619  1.00 0.00 ? 31  SER A O    7  
ATOM 9373  C CB   . SER A 1 31  ? 15.624  9.692   8.584   1.00 0.00 ? 31  SER A CB   7  
ATOM 9374  O OG   . SER A 1 31  ? 16.988  9.342   8.798   1.00 0.00 ? 31  SER A OG   7  
ATOM 9375  H H    . SER A 1 31  ? 13.150  9.862   8.457   1.00 0.00 ? 31  SER A H    7  
ATOM 9376  H HA   . SER A 1 31  ? 14.810  7.846   9.338   1.00 0.00 ? 31  SER A HA   7  
ATOM 9377  H HB2  . SER A 1 31  ? 15.357  9.496   7.545   1.00 0.00 ? 31  SER A HB2  7  
ATOM 9378  H HB3  . SER A 1 31  ? 15.493  10.761  8.750   1.00 0.00 ? 31  SER A HB3  7  
ATOM 9379  H HG   . SER A 1 31  ? 17.586  10.047  8.416   1.00 0.00 ? 31  SER A HG   7  
ATOM 9380  N N    . GLU A 1 32  ? 14.259  10.285  11.443  1.00 0.00 ? 32  GLU A N    7  
ATOM 9381  C CA   . GLU A 1 32  ? 14.421  10.730  12.817  1.00 0.00 ? 32  GLU A CA   7  
ATOM 9382  C C    . GLU A 1 32  ? 14.008  9.620   13.786  1.00 0.00 ? 32  GLU A C    7  
ATOM 9383  O O    . GLU A 1 32  ? 14.365  9.654   14.963  1.00 0.00 ? 32  GLU A O    7  
ATOM 9384  C CB   . GLU A 1 32  ? 13.623  12.009  13.077  1.00 0.00 ? 32  GLU A CB   7  
ATOM 9385  C CG   . GLU A 1 32  ? 12.123  11.766  12.896  1.00 0.00 ? 32  GLU A CG   7  
ATOM 9386  C CD   . GLU A 1 32  ? 11.334  13.068  13.055  1.00 0.00 ? 32  GLU A CD   7  
ATOM 9387  O OE1  . GLU A 1 32  ? 11.905  14.124  12.708  1.00 0.00 ? 32  GLU A OE1  7  
ATOM 9388  O OE2  . GLU A 1 32  ? 10.177  12.977  13.519  1.00 0.00 ? 32  GLU A OE2  7  
ATOM 9389  H H    . GLU A 1 32  ? 13.591  10.802  10.908  1.00 0.00 ? 32  GLU A H    7  
ATOM 9390  H HA   . GLU A 1 32  ? 15.484  10.943  12.929  1.00 0.00 ? 32  GLU A HA   7  
ATOM 9391  H HB2  . GLU A 1 32  ? 13.818  12.364  14.089  1.00 0.00 ? 32  GLU A HB2  7  
ATOM 9392  H HB3  . GLU A 1 32  ? 13.953  12.793  12.395  1.00 0.00 ? 32  GLU A HB3  7  
ATOM 9393  H HG2  . GLU A 1 32  ? 11.936  11.341  11.910  1.00 0.00 ? 32  GLU A HG2  7  
ATOM 9394  H HG3  . GLU A 1 32  ? 11.778  11.036  13.629  1.00 0.00 ? 32  GLU A HG3  7  
ATOM 9395  N N    . HIS A 1 33  ? 13.262  8.662   13.256  1.00 0.00 ? 33  HIS A N    7  
ATOM 9396  C CA   . HIS A 1 33  ? 12.798  7.544   14.059  1.00 0.00 ? 33  HIS A CA   7  
ATOM 9397  C C    . HIS A 1 33  ? 13.685  6.324   13.803  1.00 0.00 ? 33  HIS A C    7  
ATOM 9398  O O    . HIS A 1 33  ? 13.794  5.442   14.653  1.00 0.00 ? 33  HIS A O    7  
ATOM 9399  C CB   . HIS A 1 33  ? 11.316  7.265   13.797  1.00 0.00 ? 33  HIS A CB   7  
ATOM 9400  C CG   . HIS A 1 33  ? 10.385  7.897   14.804  1.00 0.00 ? 33  HIS A CG   7  
ATOM 9401  N ND1  . HIS A 1 33  ? 10.708  8.029   16.144  1.00 0.00 ? 33  HIS A ND1  7  
ATOM 9402  C CD2  . HIS A 1 33  ? 9.139   8.430   14.654  1.00 0.00 ? 33  HIS A CD2  7  
ATOM 9403  C CE1  . HIS A 1 33  ? 9.694   8.617   16.762  1.00 0.00 ? 33  HIS A CE1  7  
ATOM 9404  N NE2  . HIS A 1 33  ? 8.723   8.864   15.838  1.00 0.00 ? 33  HIS A NE2  7  
ATOM 9405  H H    . HIS A 1 33  ? 12.976  8.642   12.298  1.00 0.00 ? 33  HIS A H    7  
ATOM 9406  H HA   . HIS A 1 33  ? 12.900  7.844   15.102  1.00 0.00 ? 33  HIS A HA   7  
ATOM 9407  H HB2  . HIS A 1 33  ? 11.059  7.629   12.802  1.00 0.00 ? 33  HIS A HB2  7  
ATOM 9408  H HB3  . HIS A 1 33  ? 11.155  6.187   13.794  1.00 0.00 ? 33  HIS A HB3  7  
ATOM 9409  H HD1  . HIS A 1 33  ? 11.562  7.732   16.572  1.00 0.00 ? 33  HIS A HD1  7  
ATOM 9410  H HD2  . HIS A 1 33  ? 8.580   8.490   13.720  1.00 0.00 ? 33  HIS A HD2  7  
ATOM 9411  H HE1  . HIS A 1 33  ? 9.646   8.860   17.824  1.00 0.00 ? 33  HIS A HE1  7  
ATOM 9412  N N    . GLY A 1 34  ? 14.296  6.313   12.627  1.00 0.00 ? 34  GLY A N    7  
ATOM 9413  C CA   . GLY A 1 34  ? 15.170  5.216   12.248  1.00 0.00 ? 34  GLY A CA   7  
ATOM 9414  C C    . GLY A 1 34  ? 14.454  4.245   11.308  1.00 0.00 ? 34  GLY A C    7  
ATOM 9415  O O    . GLY A 1 34  ? 14.980  3.178   10.994  1.00 0.00 ? 34  GLY A O    7  
ATOM 9416  H H    . GLY A 1 34  ? 14.202  7.035   11.942  1.00 0.00 ? 34  GLY A H    7  
ATOM 9417  H HA2  . GLY A 1 34  ? 16.062  5.609   11.760  1.00 0.00 ? 34  GLY A HA2  7  
ATOM 9418  H HA3  . GLY A 1 34  ? 15.502  4.686   13.141  1.00 0.00 ? 34  GLY A HA3  7  
ATOM 9419  N N    . VAL A 1 35  ? 13.265  4.648   10.885  1.00 0.00 ? 35  VAL A N    7  
ATOM 9420  C CA   . VAL A 1 35  ? 12.472  3.826   9.987   1.00 0.00 ? 35  VAL A CA   7  
ATOM 9421  C C    . VAL A 1 35  ? 12.190  4.608   8.702   1.00 0.00 ? 35  VAL A C    7  
ATOM 9422  O O    . VAL A 1 35  ? 12.348  5.827   8.666   1.00 0.00 ? 35  VAL A O    7  
ATOM 9423  C CB   . VAL A 1 35  ? 11.198  3.359   10.694  1.00 0.00 ? 35  VAL A CB   7  
ATOM 9424  C CG1  . VAL A 1 35  ? 11.473  3.038   12.164  1.00 0.00 ? 35  VAL A CG1  7  
ATOM 9425  C CG2  . VAL A 1 35  ? 10.083  4.398   10.559  1.00 0.00 ? 35  VAL A CG2  7  
ATOM 9426  H H    . VAL A 1 35  ? 12.845  5.517   11.145  1.00 0.00 ? 35  VAL A H    7  
ATOM 9427  H HA   . VAL A 1 35  ? 13.063  2.945   9.739   1.00 0.00 ? 35  VAL A HA   7  
ATOM 9428  H HB   . VAL A 1 35  ? 10.862  2.443   10.208  1.00 0.00 ? 35  VAL A HB   7  
ATOM 9429  H HG11 . VAL A 1 35  ? 11.304  3.929   12.768  1.00 0.00 ? 35  VAL A HG11 7  
ATOM 9430  H HG12 . VAL A 1 35  ? 10.804  2.243   12.494  1.00 0.00 ? 35  VAL A HG12 7  
ATOM 9431  H HG13 . VAL A 1 35  ? 12.507  2.713   12.278  1.00 0.00 ? 35  VAL A HG13 7  
ATOM 9432  H HG21 . VAL A 1 35  ? 9.751   4.442   9.521   1.00 0.00 ? 35  VAL A HG21 7  
ATOM 9433  H HG22 . VAL A 1 35  ? 9.245   4.118   11.197  1.00 0.00 ? 35  VAL A HG22 7  
ATOM 9434  H HG23 . VAL A 1 35  ? 10.459  5.376   10.861  1.00 0.00 ? 35  VAL A HG23 7  
ATOM 9435  N N    . GLY A 1 36  ? 11.779  3.874   7.679   1.00 0.00 ? 36  GLY A N    7  
ATOM 9436  C CA   . GLY A 1 36  ? 11.474  4.483   6.396   1.00 0.00 ? 36  GLY A CA   7  
ATOM 9437  C C    . GLY A 1 36  ? 10.085  5.123   6.409   1.00 0.00 ? 36  GLY A C    7  
ATOM 9438  O O    . GLY A 1 36  ? 9.749   5.868   7.328   1.00 0.00 ? 36  GLY A O    7  
ATOM 9439  H H    . GLY A 1 36  ? 11.654  2.882   7.717   1.00 0.00 ? 36  GLY A H    7  
ATOM 9440  H HA2  . GLY A 1 36  ? 12.224  5.238   6.160   1.00 0.00 ? 36  GLY A HA2  7  
ATOM 9441  H HA3  . GLY A 1 36  ? 11.523  3.729   5.610   1.00 0.00 ? 36  GLY A HA3  7  
ATOM 9442  N N    . ILE A 1 37  ? 9.314   4.810   5.378   1.00 0.00 ? 37  ILE A N    7  
ATOM 9443  C CA   . ILE A 1 37  ? 7.968   5.345   5.259   1.00 0.00 ? 37  ILE A CA   7  
ATOM 9444  C C    . ILE A 1 37  ? 6.993   4.203   4.968   1.00 0.00 ? 37  ILE A C    7  
ATOM 9445  O O    . ILE A 1 37  ? 7.357   3.220   4.323   1.00 0.00 ? 37  ILE A O    7  
ATOM 9446  C CB   . ILE A 1 37  ? 7.928   6.468   4.221   1.00 0.00 ? 37  ILE A CB   7  
ATOM 9447  C CG1  . ILE A 1 37  ? 9.139   7.392   4.365   1.00 0.00 ? 37  ILE A CG1  7  
ATOM 9448  C CG2  . ILE A 1 37  ? 6.608   7.238   4.296   1.00 0.00 ? 37  ILE A CG2  7  
ATOM 9449  C CD1  . ILE A 1 37  ? 8.994   8.299   5.589   1.00 0.00 ? 37  ILE A CD1  7  
ATOM 9450  H H    . ILE A 1 37  ? 9.594   4.203   4.634   1.00 0.00 ? 37  ILE A H    7  
ATOM 9451  H HA   . ILE A 1 37  ? 7.706   5.786   6.221   1.00 0.00 ? 37  ILE A HA   7  
ATOM 9452  H HB   . ILE A 1 37  ? 7.982   6.019   3.229   1.00 0.00 ? 37  ILE A HB   7  
ATOM 9453  H HG12 . ILE A 1 37  ? 10.047  6.796   4.455   1.00 0.00 ? 37  ILE A HG12 7  
ATOM 9454  H HG13 . ILE A 1 37  ? 9.246   8.001   3.468   1.00 0.00 ? 37  ILE A HG13 7  
ATOM 9455  H HG21 . ILE A 1 37  ? 5.792   6.591   3.975   1.00 0.00 ? 37  ILE A HG21 7  
ATOM 9456  H HG22 . ILE A 1 37  ? 6.433   7.560   5.323   1.00 0.00 ? 37  ILE A HG22 7  
ATOM 9457  H HG23 . ILE A 1 37  ? 6.658   8.110   3.645   1.00 0.00 ? 37  ILE A HG23 7  
ATOM 9458  H HD11 . ILE A 1 37  ? 8.851   7.687   6.480   1.00 0.00 ? 37  ILE A HD11 7  
ATOM 9459  H HD12 . ILE A 1 37  ? 9.896   8.901   5.704   1.00 0.00 ? 37  ILE A HD12 7  
ATOM 9460  H HD13 . ILE A 1 37  ? 8.134   8.954   5.456   1.00 0.00 ? 37  ILE A HD13 7  
ATOM 9461  N N    . TYR A 1 38  ? 5.773   4.370   5.457   1.00 0.00 ? 38  TYR A N    7  
ATOM 9462  C CA   . TYR A 1 38  ? 4.743   3.365   5.256   1.00 0.00 ? 38  TYR A CA   7  
ATOM 9463  C C    . TYR A 1 38  ? 3.352   3.947   5.514   1.00 0.00 ? 38  TYR A C    7  
ATOM 9464  O O    . TYR A 1 38  ? 3.212   4.939   6.227   1.00 0.00 ? 38  TYR A O    7  
ATOM 9465  C CB   . TYR A 1 38  ? 5.021   2.266   6.284   1.00 0.00 ? 38  TYR A CB   7  
ATOM 9466  C CG   . TYR A 1 38  ? 6.467   1.767   6.286   1.00 0.00 ? 38  TYR A CG   7  
ATOM 9467  C CD1  . TYR A 1 38  ? 6.840   0.729   5.456   1.00 0.00 ? 38  TYR A CD1  7  
ATOM 9468  C CD2  . TYR A 1 38  ? 7.399   2.355   7.118   1.00 0.00 ? 38  TYR A CD2  7  
ATOM 9469  C CE1  . TYR A 1 38  ? 8.202   0.260   5.458   1.00 0.00 ? 38  TYR A CE1  7  
ATOM 9470  C CE2  . TYR A 1 38  ? 8.760   1.886   7.120   1.00 0.00 ? 38  TYR A CE2  7  
ATOM 9471  C CZ   . TYR A 1 38  ? 9.094   0.861   6.290   1.00 0.00 ? 38  TYR A CZ   7  
ATOM 9472  O OH   . TYR A 1 38  ? 10.380  0.418   6.292   1.00 0.00 ? 38  TYR A OH   7  
ATOM 9473  H H    . TYR A 1 38  ? 5.485   5.172   5.980   1.00 0.00 ? 38  TYR A H    7  
ATOM 9474  H HA   . TYR A 1 38  ? 4.801   3.025   4.222   1.00 0.00 ? 38  TYR A HA   7  
ATOM 9475  H HB2  . TYR A 1 38  ? 4.775   2.641   7.277   1.00 0.00 ? 38  TYR A HB2  7  
ATOM 9476  H HB3  . TYR A 1 38  ? 4.357   1.423   6.088   1.00 0.00 ? 38  TYR A HB3  7  
ATOM 9477  H HD1  . TYR A 1 38  ? 6.105   0.265   4.799   1.00 0.00 ? 38  TYR A HD1  7  
ATOM 9478  H HD2  . TYR A 1 38  ? 7.103   3.174   7.773   1.00 0.00 ? 38  TYR A HD2  7  
ATOM 9479  H HE1  . TYR A 1 38  ? 8.510   -0.559  4.808   1.00 0.00 ? 38  TYR A HE1  7  
ATOM 9480  H HE2  . TYR A 1 38  ? 9.505   2.341   7.771   1.00 0.00 ? 38  TYR A HE2  7  
ATOM 9481  H HH   . TYR A 1 38  ? 10.440  -0.461  5.818   1.00 0.00 ? 38  TYR A HH   7  
ATOM 9482  N N    . VAL A 1 39  ? 2.357   3.305   4.919   1.00 0.00 ? 39  VAL A N    7  
ATOM 9483  C CA   . VAL A 1 39  ? 0.981   3.746   5.075   1.00 0.00 ? 39  VAL A CA   7  
ATOM 9484  C C    . VAL A 1 39  ? 0.422   3.204   6.392   1.00 0.00 ? 39  VAL A C    7  
ATOM 9485  O O    . VAL A 1 39  ? 0.566   2.020   6.690   1.00 0.00 ? 39  VAL A O    7  
ATOM 9486  C CB   . VAL A 1 39  ? 0.156   3.327   3.857   1.00 0.00 ? 39  VAL A CB   7  
ATOM 9487  C CG1  . VAL A 1 39  ? -1.270  3.876   3.945   1.00 0.00 ? 39  VAL A CG1  7  
ATOM 9488  C CG2  . VAL A 1 39  ? 0.833   3.766   2.557   1.00 0.00 ? 39  VAL A CG2  7  
ATOM 9489  H H    . VAL A 1 39  ? 2.479   2.498   4.341   1.00 0.00 ? 39  VAL A H    7  
ATOM 9490  H HA   . VAL A 1 39  ? 0.989   4.835   5.119   1.00 0.00 ? 39  VAL A HA   7  
ATOM 9491  H HB   . VAL A 1 39  ? 0.096   2.238   3.852   1.00 0.00 ? 39  VAL A HB   7  
ATOM 9492  H HG11 . VAL A 1 39  ? -1.930  3.109   4.350   1.00 0.00 ? 39  VAL A HG11 7  
ATOM 9493  H HG12 . VAL A 1 39  ? -1.283  4.748   4.599   1.00 0.00 ? 39  VAL A HG12 7  
ATOM 9494  H HG13 . VAL A 1 39  ? -1.611  4.161   2.950   1.00 0.00 ? 39  VAL A HG13 7  
ATOM 9495  H HG21 . VAL A 1 39  ? 0.383   4.696   2.210   1.00 0.00 ? 39  VAL A HG21 7  
ATOM 9496  H HG22 . VAL A 1 39  ? 1.897   3.922   2.737   1.00 0.00 ? 39  VAL A HG22 7  
ATOM 9497  H HG23 . VAL A 1 39  ? 0.702   2.994   1.800   1.00 0.00 ? 39  VAL A HG23 7  
ATOM 9498  N N    . SER A 1 40  ? -0.204  4.097   7.144   1.00 0.00 ? 40  SER A N    7  
ATOM 9499  C CA   . SER A 1 40  ? -0.785  3.723   8.422   1.00 0.00 ? 40  SER A CA   7  
ATOM 9500  C C    . SER A 1 40  ? -2.305  3.894   8.376   1.00 0.00 ? 40  SER A C    7  
ATOM 9501  O O    . SER A 1 40  ? -3.015  3.414   9.258   1.00 0.00 ? 40  SER A O    7  
ATOM 9502  C CB   . SER A 1 40  ? -0.192  4.553   9.562   1.00 0.00 ? 40  SER A CB   7  
ATOM 9503  O OG   . SER A 1 40  ? -0.931  5.749   9.792   1.00 0.00 ? 40  SER A OG   7  
ATOM 9504  H H    . SER A 1 40  ? -0.317  5.058   6.894   1.00 0.00 ? 40  SER A H    7  
ATOM 9505  H HA   . SER A 1 40  ? -0.523  2.674   8.563   1.00 0.00 ? 40  SER A HA   7  
ATOM 9506  H HB2  . SER A 1 40  ? -0.174  3.957   10.474  1.00 0.00 ? 40  SER A HB2  7  
ATOM 9507  H HB3  . SER A 1 40  ? 0.842   4.806   9.326   1.00 0.00 ? 40  SER A HB3  7  
ATOM 9508  H HG   . SER A 1 40  ? -0.907  5.985   10.763  1.00 0.00 ? 40  SER A HG   7  
ATOM 9509  N N    . LEU A 1 41  ? -2.760  4.581   7.338   1.00 0.00 ? 41  LEU A N    7  
ATOM 9510  C CA   . LEU A 1 41  ? -4.182  4.822   7.165   1.00 0.00 ? 41  LEU A CA   7  
ATOM 9511  C C    . LEU A 1 41  ? -4.486  5.015   5.678   1.00 0.00 ? 41  LEU A C    7  
ATOM 9512  O O    . LEU A 1 41  ? -3.704  5.633   4.957   1.00 0.00 ? 41  LEU A O    7  
ATOM 9513  C CB   . LEU A 1 41  ? -4.638  5.989   8.042   1.00 0.00 ? 41  LEU A CB   7  
ATOM 9514  C CG   . LEU A 1 41  ? -6.073  6.473   7.823   1.00 0.00 ? 41  LEU A CG   7  
ATOM 9515  C CD1  . LEU A 1 41  ? -6.206  7.207   6.487   1.00 0.00 ? 41  LEU A CD1  7  
ATOM 9516  C CD2  . LEU A 1 41  ? -7.066  5.315   7.942   1.00 0.00 ? 41  LEU A CD2  7  
ATOM 9517  H H    . LEU A 1 41  ? -2.176  4.968   6.624   1.00 0.00 ? 41  LEU A H    7  
ATOM 9518  H HA   . LEU A 1 41  ? -4.709  3.933   7.513   1.00 0.00 ? 41  LEU A HA   7  
ATOM 9519  H HB2  . LEU A 1 41  ? -4.530  5.697   9.087   1.00 0.00 ? 41  LEU A HB2  7  
ATOM 9520  H HB3  . LEU A 1 41  ? -3.963  6.829   7.875   1.00 0.00 ? 41  LEU A HB3  7  
ATOM 9521  H HG   . LEU A 1 41  ? -6.317  7.188   8.608   1.00 0.00 ? 41  LEU A HG   7  
ATOM 9522  H HD11 . LEU A 1 41  ? -6.757  6.583   5.783   1.00 0.00 ? 41  LEU A HD11 7  
ATOM 9523  H HD12 . LEU A 1 41  ? -6.741  8.144   6.639   1.00 0.00 ? 41  LEU A HD12 7  
ATOM 9524  H HD13 . LEU A 1 41  ? -5.213  7.416   6.087   1.00 0.00 ? 41  LEU A HD13 7  
ATOM 9525  H HD21 . LEU A 1 41  ? -6.547  4.426   8.298   1.00 0.00 ? 41  LEU A HD21 7  
ATOM 9526  H HD22 . LEU A 1 41  ? -7.854  5.583   8.646   1.00 0.00 ? 41  LEU A HD22 7  
ATOM 9527  H HD23 . LEU A 1 41  ? -7.506  5.112   6.965   1.00 0.00 ? 41  LEU A HD23 7  
ATOM 9528  N N    . VAL A 1 42  ? -5.622  4.474   5.264   1.00 0.00 ? 42  VAL A N    7  
ATOM 9529  C CA   . VAL A 1 42  ? -6.038  4.579   3.876   1.00 0.00 ? 42  VAL A CA   7  
ATOM 9530  C C    . VAL A 1 42  ? -7.532  4.905   3.819   1.00 0.00 ? 42  VAL A C    7  
ATOM 9531  O O    . VAL A 1 42  ? -8.349  4.192   4.399   1.00 0.00 ? 42  VAL A O    7  
ATOM 9532  C CB   . VAL A 1 42  ? -5.677  3.297   3.122   1.00 0.00 ? 42  VAL A CB   7  
ATOM 9533  C CG1  . VAL A 1 42  ? -6.649  3.047   1.968   1.00 0.00 ? 42  VAL A CG1  7  
ATOM 9534  C CG2  . VAL A 1 42  ? -4.232  3.344   2.622   1.00 0.00 ? 42  VAL A CG2  7  
ATOM 9535  H H    . VAL A 1 42  ? -6.252  3.973   5.857   1.00 0.00 ? 42  VAL A H    7  
ATOM 9536  H HA   . VAL A 1 42  ? -5.482  5.402   3.427   1.00 0.00 ? 42  VAL A HA   7  
ATOM 9537  H HB   . VAL A 1 42  ? -5.763  2.464   3.819   1.00 0.00 ? 42  VAL A HB   7  
ATOM 9538  H HG11 . VAL A 1 42  ? -7.663  2.963   2.358   1.00 0.00 ? 42  VAL A HG11 7  
ATOM 9539  H HG12 . VAL A 1 42  ? -6.599  3.879   1.264   1.00 0.00 ? 42  VAL A HG12 7  
ATOM 9540  H HG13 . VAL A 1 42  ? -6.377  2.123   1.458   1.00 0.00 ? 42  VAL A HG13 7  
ATOM 9541  H HG21 . VAL A 1 42  ? -3.594  2.779   3.302   1.00 0.00 ? 42  VAL A HG21 7  
ATOM 9542  H HG22 . VAL A 1 42  ? -4.178  2.907   1.625   1.00 0.00 ? 42  VAL A HG22 7  
ATOM 9543  H HG23 . VAL A 1 42  ? -3.894  4.380   2.584   1.00 0.00 ? 42  VAL A HG23 7  
ATOM 9544  N N    . GLU A 1 43  ? -7.844  5.983   3.114   1.00 0.00 ? 43  GLU A N    7  
ATOM 9545  C CA   . GLU A 1 43  ? -9.225  6.412   2.974   1.00 0.00 ? 43  GLU A CA   7  
ATOM 9546  C C    . GLU A 1 43  ? -10.017 5.392   2.153   1.00 0.00 ? 43  GLU A C    7  
ATOM 9547  O O    . GLU A 1 43  ? -9.600  5.010   1.061   1.00 0.00 ? 43  GLU A O    7  
ATOM 9548  C CB   . GLU A 1 43  ? -9.306  7.804   2.344   1.00 0.00 ? 43  GLU A CB   7  
ATOM 9549  C CG   . GLU A 1 43  ? -9.366  8.890   3.420   1.00 0.00 ? 43  GLU A CG   7  
ATOM 9550  C CD   . GLU A 1 43  ? -8.679  10.172  2.944   1.00 0.00 ? 43  GLU A CD   7  
ATOM 9551  O OE1  . GLU A 1 43  ? -9.061  10.649  1.854   1.00 0.00 ? 43  GLU A OE1  7  
ATOM 9552  O OE2  . GLU A 1 43  ? -7.788  10.645  3.681   1.00 0.00 ? 43  GLU A OE2  7  
ATOM 9553  H H    . GLU A 1 43  ? -7.173  6.557   2.645   1.00 0.00 ? 43  GLU A H    7  
ATOM 9554  H HA   . GLU A 1 43  ? -9.619  6.456   3.989   1.00 0.00 ? 43  GLU A HA   7  
ATOM 9555  H HB2  . GLU A 1 43  ? -8.438  7.968   1.704   1.00 0.00 ? 43  GLU A HB2  7  
ATOM 9556  H HB3  . GLU A 1 43  ? -10.188 7.868   1.707   1.00 0.00 ? 43  GLU A HB3  7  
ATOM 9557  H HG2  . GLU A 1 43  ? -10.406 9.101   3.670   1.00 0.00 ? 43  GLU A HG2  7  
ATOM 9558  H HG3  . GLU A 1 43  ? -8.886  8.532   4.330   1.00 0.00 ? 43  GLU A HG3  7  
ATOM 9559  N N    . PRO A 1 44  ? -11.175 4.968   2.726   1.00 0.00 ? 44  PRO A N    7  
ATOM 9560  C CA   . PRO A 1 44  ? -12.029 4.000   2.059   1.00 0.00 ? 44  PRO A CA   7  
ATOM 9561  C C    . PRO A 1 44  ? -12.796 4.648   0.905   1.00 0.00 ? 44  PRO A C    7  
ATOM 9562  O O    . PRO A 1 44  ? -12.907 5.871   0.838   1.00 0.00 ? 44  PRO A O    7  
ATOM 9563  C CB   . PRO A 1 44  ? -12.941 3.462   3.150   1.00 0.00 ? 44  PRO A CB   7  
ATOM 9564  C CG   . PRO A 1 44  ? -12.881 4.477   4.281   1.00 0.00 ? 44  PRO A CG   7  
ATOM 9565  C CD   . PRO A 1 44  ? -11.701 5.398   4.018   1.00 0.00 ? 44  PRO A CD   7  
ATOM 9566  H HA   . PRO A 1 44  ? -11.477 3.275   1.647   1.00 0.00 ? 44  PRO A HA   7  
ATOM 9567  H HB2  . PRO A 1 44  ? -13.961 3.345   2.785   1.00 0.00 ? 44  PRO A HB2  7  
ATOM 9568  H HB3  . PRO A 1 44  ? -12.609 2.481   3.489   1.00 0.00 ? 44  PRO A HB3  7  
ATOM 9569  H HG2  . PRO A 1 44  ? -13.808 5.048   4.331   1.00 0.00 ? 44  PRO A HG2  7  
ATOM 9570  H HG3  . PRO A 1 44  ? -12.765 3.973   5.240   1.00 0.00 ? 44  PRO A HG3  7  
ATOM 9571  H HD2  . PRO A 1 44  ? -12.012 6.443   3.991   1.00 0.00 ? 44  PRO A HD2  7  
ATOM 9572  H HD3  . PRO A 1 44  ? -10.948 5.310   4.801   1.00 0.00 ? 44  PRO A HD3  7  
ATOM 9573  N N    . GLY A 1 45  ? -13.306 3.799   0.025   1.00 0.00 ? 45  GLY A N    7  
ATOM 9574  C CA   . GLY A 1 45  ? -14.060 4.274   -1.123  1.00 0.00 ? 45  GLY A CA   7  
ATOM 9575  C C    . GLY A 1 45  ? -13.325 5.417   -1.827  1.00 0.00 ? 45  GLY A C    7  
ATOM 9576  O O    . GLY A 1 45  ? -13.943 6.224   -2.519  1.00 0.00 ? 45  GLY A O    7  
ATOM 9577  H H    . GLY A 1 45  ? -13.212 2.806   0.087   1.00 0.00 ? 45  GLY A H    7  
ATOM 9578  H HA2  . GLY A 1 45  ? -14.219 3.454   -1.823  1.00 0.00 ? 45  GLY A HA2  7  
ATOM 9579  H HA3  . GLY A 1 45  ? -15.044 4.614   -0.801  1.00 0.00 ? 45  GLY A HA3  7  
ATOM 9580  N N    . SER A 1 46  ? -12.016 5.449   -1.625  1.00 0.00 ? 46  SER A N    7  
ATOM 9581  C CA   . SER A 1 46  ? -11.190 6.479   -2.232  1.00 0.00 ? 46  SER A CA   7  
ATOM 9582  C C    . SER A 1 46  ? -10.398 5.893   -3.402  1.00 0.00 ? 46  SER A C    7  
ATOM 9583  O O    . SER A 1 46  ? -10.540 4.715   -3.724  1.00 0.00 ? 46  SER A O    7  
ATOM 9584  C CB   . SER A 1 46  ? -10.241 7.099   -1.205  1.00 0.00 ? 46  SER A CB   7  
ATOM 9585  O OG   . SER A 1 46  ? -9.008  6.390   -1.121  1.00 0.00 ? 46  SER A OG   7  
ATOM 9586  H H    . SER A 1 46  ? -11.521 4.788   -1.061  1.00 0.00 ? 46  SER A H    7  
ATOM 9587  H HA   . SER A 1 46  ? -11.889 7.238   -2.585  1.00 0.00 ? 46  SER A HA   7  
ATOM 9588  H HB2  . SER A 1 46  ? -10.044 8.137   -1.473  1.00 0.00 ? 46  SER A HB2  7  
ATOM 9589  H HB3  . SER A 1 46  ? -10.721 7.109   -0.226  1.00 0.00 ? 46  SER A HB3  7  
ATOM 9590  H HG   . SER A 1 46  ? -9.050  5.717   -0.383  1.00 0.00 ? 46  SER A HG   7  
ATOM 9591  N N    . LEU A 1 47  ? -9.580  6.743   -4.006  1.00 0.00 ? 47  LEU A N    7  
ATOM 9592  C CA   . LEU A 1 47  ? -8.764  6.325   -5.133  1.00 0.00 ? 47  LEU A CA   7  
ATOM 9593  C C    . LEU A 1 47  ? -7.656  5.394   -4.637  1.00 0.00 ? 47  LEU A C    7  
ATOM 9594  O O    . LEU A 1 47  ? -7.498  4.285   -5.146  1.00 0.00 ? 47  LEU A O    7  
ATOM 9595  C CB   . LEU A 1 47  ? -8.247  7.542   -5.902  1.00 0.00 ? 47  LEU A CB   7  
ATOM 9596  C CG   . LEU A 1 47  ? -7.344  7.245   -7.100  1.00 0.00 ? 47  LEU A CG   7  
ATOM 9597  C CD1  . LEU A 1 47  ? -7.805  5.984   -7.834  1.00 0.00 ? 47  LEU A CD1  7  
ATOM 9598  C CD2  . LEU A 1 47  ? -7.257  8.453   -8.034  1.00 0.00 ? 47  LEU A CD2  7  
ATOM 9599  H H    . LEU A 1 47  ? -9.470  7.700   -3.737  1.00 0.00 ? 47  LEU A H    7  
ATOM 9600  H HA   . LEU A 1 47  ? -9.408  5.765   -5.812  1.00 0.00 ? 47  LEU A HA   7  
ATOM 9601  H HB2  . LEU A 1 47  ? -9.104  8.117   -6.252  1.00 0.00 ? 47  LEU A HB2  7  
ATOM 9602  H HB3  . LEU A 1 47  ? -7.698  8.179   -5.207  1.00 0.00 ? 47  LEU A HB3  7  
ATOM 9603  H HG   . LEU A 1 47  ? -6.337  7.051   -6.729  1.00 0.00 ? 47  LEU A HG   7  
ATOM 9604  H HD11 . LEU A 1 47  ? -7.134  5.785   -8.671  1.00 0.00 ? 47  LEU A HD11 7  
ATOM 9605  H HD12 . LEU A 1 47  ? -7.790  5.138   -7.148  1.00 0.00 ? 47  LEU A HD12 7  
ATOM 9606  H HD13 . LEU A 1 47  ? -8.818  6.131   -8.208  1.00 0.00 ? 47  LEU A HD13 7  
ATOM 9607  H HD21 . LEU A 1 47  ? -8.259  8.834   -8.230  1.00 0.00 ? 47  LEU A HD21 7  
ATOM 9608  H HD22 . LEU A 1 47  ? -6.657  9.233   -7.565  1.00 0.00 ? 47  LEU A HD22 7  
ATOM 9609  H HD23 . LEU A 1 47  ? -6.792  8.153   -8.974  1.00 0.00 ? 47  LEU A HD23 7  
ATOM 9610  N N    . ALA A 1 48  ? -6.917  5.879   -3.650  1.00 0.00 ? 48  ALA A N    7  
ATOM 9611  C CA   . ALA A 1 48  ? -5.828  5.104   -3.080  1.00 0.00 ? 48  ALA A CA   7  
ATOM 9612  C C    . ALA A 1 48  ? -6.283  3.655   -2.891  1.00 0.00 ? 48  ALA A C    7  
ATOM 9613  O O    . ALA A 1 48  ? -5.797  2.755   -3.574  1.00 0.00 ? 48  ALA A O    7  
ATOM 9614  C CB   . ALA A 1 48  ? -5.375  5.748   -1.769  1.00 0.00 ? 48  ALA A CB   7  
ATOM 9615  H H    . ALA A 1 48  ? -7.052  6.782   -3.242  1.00 0.00 ? 48  ALA A H    7  
ATOM 9616  H HA   . ALA A 1 48  ? -4.999  5.127   -3.788  1.00 0.00 ? 48  ALA A HA   7  
ATOM 9617  H HB1  . ALA A 1 48  ? -5.809  5.206   -0.929  1.00 0.00 ? 48  ALA A HB1  7  
ATOM 9618  H HB2  . ALA A 1 48  ? -4.287  5.711   -1.703  1.00 0.00 ? 48  ALA A HB2  7  
ATOM 9619  H HB3  . ALA A 1 48  ? -5.705  6.787   -1.741  1.00 0.00 ? 48  ALA A HB3  7  
ATOM 9620  N N    . GLU A 1 49  ? -7.210  3.476   -1.962  1.00 0.00 ? 49  GLU A N    7  
ATOM 9621  C CA   . GLU A 1 49  ? -7.735  2.152   -1.674  1.00 0.00 ? 49  GLU A CA   7  
ATOM 9622  C C    . GLU A 1 49  ? -8.147  1.452   -2.971  1.00 0.00 ? 49  GLU A C    7  
ATOM 9623  O O    . GLU A 1 49  ? -8.034  0.232   -3.085  1.00 0.00 ? 49  GLU A O    7  
ATOM 9624  C CB   . GLU A 1 49  ? -8.909  2.229   -0.696  1.00 0.00 ? 49  GLU A CB   7  
ATOM 9625  C CG   . GLU A 1 49  ? -9.434  0.832   -0.359  1.00 0.00 ? 49  GLU A CG   7  
ATOM 9626  C CD   . GLU A 1 49  ? -8.901  0.357   0.994   1.00 0.00 ? 49  GLU A CD   7  
ATOM 9627  O OE1  . GLU A 1 49  ? -9.198  1.045   1.994   1.00 0.00 ? 49  GLU A OE1  7  
ATOM 9628  O OE2  . GLU A 1 49  ? -8.207  -0.683  0.997   1.00 0.00 ? 49  GLU A OE2  7  
ATOM 9629  H H    . GLU A 1 49  ? -7.599  4.214   -1.411  1.00 0.00 ? 49  GLU A H    7  
ATOM 9630  H HA   . GLU A 1 49  ? -6.914  1.610   -1.205  1.00 0.00 ? 49  GLU A HA   7  
ATOM 9631  H HB2  . GLU A 1 49  ? -8.594  2.733   0.217   1.00 0.00 ? 49  GLU A HB2  7  
ATOM 9632  H HB3  . GLU A 1 49  ? -9.710  2.828   -1.130  1.00 0.00 ? 49  GLU A HB3  7  
ATOM 9633  H HG2  . GLU A 1 49  ? -10.524 0.844   -0.340  1.00 0.00 ? 49  GLU A HG2  7  
ATOM 9634  H HG3  . GLU A 1 49  ? -9.137  0.130   -1.138  1.00 0.00 ? 49  GLU A HG3  7  
ATOM 9635  N N    . LYS A 1 50  ? -8.616  2.253   -3.916  1.00 0.00 ? 50  LYS A N    7  
ATOM 9636  C CA   . LYS A 1 50  ? -9.045  1.726   -5.200  1.00 0.00 ? 50  LYS A CA   7  
ATOM 9637  C C    . LYS A 1 50  ? -7.818  1.284   -6.001  1.00 0.00 ? 50  LYS A C    7  
ATOM 9638  O O    . LYS A 1 50  ? -7.887  0.329   -6.773  1.00 0.00 ? 50  LYS A O    7  
ATOM 9639  C CB   . LYS A 1 50  ? -9.923  2.743   -5.931  1.00 0.00 ? 50  LYS A CB   7  
ATOM 9640  C CG   . LYS A 1 50  ? -11.401 2.534   -5.595  1.00 0.00 ? 50  LYS A CG   7  
ATOM 9641  C CD   . LYS A 1 50  ? -12.300 3.239   -6.613  1.00 0.00 ? 50  LYS A CD   7  
ATOM 9642  C CE   . LYS A 1 50  ? -13.695 3.483   -6.035  1.00 0.00 ? 50  LYS A CE   7  
ATOM 9643  N NZ   . LYS A 1 50  ? -14.138 4.867   -6.317  1.00 0.00 ? 50  LYS A NZ   7  
ATOM 9644  H H    . LYS A 1 50  ? -8.705  3.244   -3.815  1.00 0.00 ? 50  LYS A H    7  
ATOM 9645  H HA   . LYS A 1 50  ? -9.663  0.849   -5.003  1.00 0.00 ? 50  LYS A HA   7  
ATOM 9646  H HB2  . LYS A 1 50  ? -9.623  3.754   -5.654  1.00 0.00 ? 50  LYS A HB2  7  
ATOM 9647  H HB3  . LYS A 1 50  ? -9.774  2.651   -7.007  1.00 0.00 ? 50  LYS A HB3  7  
ATOM 9648  H HG2  . LYS A 1 50  ? -11.627 1.467   -5.582  1.00 0.00 ? 50  LYS A HG2  7  
ATOM 9649  H HG3  . LYS A 1 50  ? -11.608 2.915   -4.596  1.00 0.00 ? 50  LYS A HG3  7  
ATOM 9650  H HD2  . LYS A 1 50  ? -11.851 4.189   -6.903  1.00 0.00 ? 50  LYS A HD2  7  
ATOM 9651  H HD3  . LYS A 1 50  ? -12.376 2.634   -7.516  1.00 0.00 ? 50  LYS A HD3  7  
ATOM 9652  H HE2  . LYS A 1 50  ? -14.402 2.774   -6.466  1.00 0.00 ? 50  LYS A HE2  7  
ATOM 9653  H HE3  . LYS A 1 50  ? -13.686 3.309   -4.959  1.00 0.00 ? 50  LYS A HE3  7  
ATOM 9654  H HZ1  . LYS A 1 50  ? -13.513 5.290   -6.972  1.00 0.00 ? 50  LYS A HZ1  7  
ATOM 9655  H HZ2  . LYS A 1 50  ? -15.061 4.850   -6.700  1.00 0.00 ? 50  LYS A HZ2  7  
ATOM 9656  H HZ3  . LYS A 1 50  ? -14.140 5.395   -5.468  1.00 0.00 ? 50  LYS A HZ3  7  
ATOM 9657  N N    . GLU A 1 51  ? -6.724  2.000   -5.789  1.00 0.00 ? 51  GLU A N    7  
ATOM 9658  C CA   . GLU A 1 51  ? -5.483  1.694   -6.481  1.00 0.00 ? 51  GLU A CA   7  
ATOM 9659  C C    . GLU A 1 51  ? -4.866  0.411   -5.922  1.00 0.00 ? 51  GLU A C    7  
ATOM 9660  O O    . GLU A 1 51  ? -4.022  -0.209  -6.568  1.00 0.00 ? 51  GLU A O    7  
ATOM 9661  C CB   . GLU A 1 51  ? -4.500  2.862   -6.386  1.00 0.00 ? 51  GLU A CB   7  
ATOM 9662  C CG   . GLU A 1 51  ? -5.022  4.082   -7.146  1.00 0.00 ? 51  GLU A CG   7  
ATOM 9663  C CD   . GLU A 1 51  ? -5.205  3.766   -8.632  1.00 0.00 ? 51  GLU A CD   7  
ATOM 9664  O OE1  . GLU A 1 51  ? -4.207  3.913   -9.371  1.00 0.00 ? 51  GLU A OE1  7  
ATOM 9665  O OE2  . GLU A 1 51  ? -6.338  3.383   -8.995  1.00 0.00 ? 51  GLU A OE2  7  
ATOM 9666  H H    . GLU A 1 51  ? -6.676  2.775   -5.159  1.00 0.00 ? 51  GLU A H    7  
ATOM 9667  H HA   . GLU A 1 51  ? -5.763  1.547   -7.524  1.00 0.00 ? 51  GLU A HA   7  
ATOM 9668  H HB2  . GLU A 1 51  ? -4.339  3.123   -5.339  1.00 0.00 ? 51  GLU A HB2  7  
ATOM 9669  H HB3  . GLU A 1 51  ? -3.533  2.563   -6.791  1.00 0.00 ? 51  GLU A HB3  7  
ATOM 9670  H HG2  . GLU A 1 51  ? -5.973  4.402   -6.719  1.00 0.00 ? 51  GLU A HG2  7  
ATOM 9671  H HG3  . GLU A 1 51  ? -4.326  4.913   -7.031  1.00 0.00 ? 51  GLU A HG3  7  
ATOM 9672  N N    . GLY A 1 52  ? -5.311  0.049   -4.727  1.00 0.00 ? 52  GLY A N    7  
ATOM 9673  C CA   . GLY A 1 52  ? -4.813  -1.149  -4.074  1.00 0.00 ? 52  GLY A CA   7  
ATOM 9674  C C    . GLY A 1 52  ? -4.028  -0.798  -2.809  1.00 0.00 ? 52  GLY A C    7  
ATOM 9675  O O    . GLY A 1 52  ? -3.705  -1.677  -2.011  1.00 0.00 ? 52  GLY A O    7  
ATOM 9676  H H    . GLY A 1 52  ? -5.998  0.559   -4.209  1.00 0.00 ? 52  GLY A H    7  
ATOM 9677  H HA2  . GLY A 1 52  ? -5.648  -1.802  -3.820  1.00 0.00 ? 52  GLY A HA2  7  
ATOM 9678  H HA3  . GLY A 1 52  ? -4.173  -1.703  -4.761  1.00 0.00 ? 52  GLY A HA3  7  
ATOM 9679  N N    . LEU A 1 53  ? -3.745  0.488   -2.664  1.00 0.00 ? 53  LEU A N    7  
ATOM 9680  C CA   . LEU A 1 53  ? -3.004  0.966   -1.509  1.00 0.00 ? 53  LEU A CA   7  
ATOM 9681  C C    . LEU A 1 53  ? -3.695  0.485   -0.231  1.00 0.00 ? 53  LEU A C    7  
ATOM 9682  O O    . LEU A 1 53  ? -4.831  0.017   -0.274  1.00 0.00 ? 53  LEU A O    7  
ATOM 9683  C CB   . LEU A 1 53  ? -2.825  2.484   -1.578  1.00 0.00 ? 53  LEU A CB   7  
ATOM 9684  C CG   . LEU A 1 53  ? -1.494  3.027   -1.054  1.00 0.00 ? 53  LEU A CG   7  
ATOM 9685  C CD1  . LEU A 1 53  ? -0.519  3.289   -2.203  1.00 0.00 ? 53  LEU A CD1  7  
ATOM 9686  C CD2  . LEU A 1 53  ? -1.712  4.272   -0.192  1.00 0.00 ? 53  LEU A CD2  7  
ATOM 9687  H H    . LEU A 1 53  ? -4.012  1.196   -3.318  1.00 0.00 ? 53  LEU A H    7  
ATOM 9688  H HA   . LEU A 1 53  ? -2.010  0.522   -1.552  1.00 0.00 ? 53  LEU A HA   7  
ATOM 9689  H HB2  . LEU A 1 53  ? -2.939  2.796   -2.616  1.00 0.00 ? 53  LEU A HB2  7  
ATOM 9690  H HB3  . LEU A 1 53  ? -3.633  2.951   -1.014  1.00 0.00 ? 53  LEU A HB3  7  
ATOM 9691  H HG   . LEU A 1 53  ? -1.043  2.267   -0.415  1.00 0.00 ? 53  LEU A HG   7  
ATOM 9692  H HD11 . LEU A 1 53  ? -0.923  2.871   -3.125  1.00 0.00 ? 53  LEU A HD11 7  
ATOM 9693  H HD12 . LEU A 1 53  ? -0.377  4.363   -2.322  1.00 0.00 ? 53  LEU A HD12 7  
ATOM 9694  H HD13 . LEU A 1 53  ? 0.439   2.819   -1.980  1.00 0.00 ? 53  LEU A HD13 7  
ATOM 9695  H HD21 . LEU A 1 53  ? -2.556  4.108   0.477   1.00 0.00 ? 53  LEU A HD21 7  
ATOM 9696  H HD22 . LEU A 1 53  ? -0.815  4.467   0.397   1.00 0.00 ? 53  LEU A HD22 7  
ATOM 9697  H HD23 . LEU A 1 53  ? -1.918  5.128   -0.834  1.00 0.00 ? 53  LEU A HD23 7  
ATOM 9698  N N    . ARG A 1 54  ? -2.979  0.618   0.876   1.00 0.00 ? 54  ARG A N    7  
ATOM 9699  C CA   . ARG A 1 54  ? -3.509  0.203   2.163   1.00 0.00 ? 54  ARG A CA   7  
ATOM 9700  C C    . ARG A 1 54  ? -2.390  0.151   3.206   1.00 0.00 ? 54  ARG A C    7  
ATOM 9701  O O    . ARG A 1 54  ? -1.300  -0.347  2.927   1.00 0.00 ? 54  ARG A O    7  
ATOM 9702  C CB   . ARG A 1 54  ? -4.173  -1.172  2.069   1.00 0.00 ? 54  ARG A CB   7  
ATOM 9703  C CG   . ARG A 1 54  ? -5.675  -1.076  2.344   1.00 0.00 ? 54  ARG A CG   7  
ATOM 9704  C CD   . ARG A 1 54  ? -6.027  -1.713  3.690   1.00 0.00 ? 54  ARG A CD   7  
ATOM 9705  N NE   . ARG A 1 54  ? -7.243  -2.545  3.553   1.00 0.00 ? 54  ARG A NE   7  
ATOM 9706  C CZ   . ARG A 1 54  ? -7.729  -3.332  4.523   1.00 0.00 ? 54  ARG A CZ   7  
ATOM 9707  N NH1  . ARG A 1 54  ? -7.104  -3.399  5.706   1.00 0.00 ? 54  ARG A NH1  7  
ATOM 9708  N NH2  . ARG A 1 54  ? -8.839  -4.052  4.309   1.00 0.00 ? 54  ARG A NH2  7  
ATOM 9709  H H    . ARG A 1 54  ? -2.055  1.000   0.902   1.00 0.00 ? 54  ARG A H    7  
ATOM 9710  H HA   . ARG A 1 54  ? -4.247  0.963   2.419   1.00 0.00 ? 54  ARG A HA   7  
ATOM 9711  H HB2  . ARG A 1 54  ? -4.007  -1.592  1.077   1.00 0.00 ? 54  ARG A HB2  7  
ATOM 9712  H HB3  . ARG A 1 54  ? -3.711  -1.853  2.784   1.00 0.00 ? 54  ARG A HB3  7  
ATOM 9713  H HG2  . ARG A 1 54  ? -5.982  -0.030  2.341   1.00 0.00 ? 54  ARG A HG2  7  
ATOM 9714  H HG3  . ARG A 1 54  ? -6.227  -1.573  1.546   1.00 0.00 ? 54  ARG A HG3  7  
ATOM 9715  H HD2  . ARG A 1 54  ? -5.196  -2.324  4.041   1.00 0.00 ? 54  ARG A HD2  7  
ATOM 9716  H HD3  . ARG A 1 54  ? -6.190  -0.937  4.437   1.00 0.00 ? 54  ARG A HD3  7  
ATOM 9717  H HE   . ARG A 1 54  ? -7.734  -2.519  2.681   1.00 0.00 ? 54  ARG A HE   7  
ATOM 9718  H HH11 . ARG A 1 54  ? -6.276  -2.861  5.866   1.00 0.00 ? 54  ARG A HH11 7  
ATOM 9719  H HH12 . ARG A 1 54  ? -7.467  -3.986  6.430   1.00 0.00 ? 54  ARG A HH12 7  
ATOM 9720  H HH21 . ARG A 1 54  ? -9.305  -4.002  3.426   1.00 0.00 ? 54  ARG A HH21 7  
ATOM 9721  H HH22 . ARG A 1 54  ? -9.201  -4.639  5.033   1.00 0.00 ? 54  ARG A HH22 7  
ATOM 9722  N N    . VAL A 1 55  ? -2.698  0.672   4.384   1.00 0.00 ? 55  VAL A N    7  
ATOM 9723  C CA   . VAL A 1 55  ? -1.732  0.691   5.470   1.00 0.00 ? 55  VAL A CA   7  
ATOM 9724  C C    . VAL A 1 55  ? -0.941  -0.619  5.466   1.00 0.00 ? 55  VAL A C    7  
ATOM 9725  O O    . VAL A 1 55  ? -1.486  -1.676  5.151   1.00 0.00 ? 55  VAL A O    7  
ATOM 9726  C CB   . VAL A 1 55  ? -2.442  0.957   6.798   1.00 0.00 ? 55  VAL A CB   7  
ATOM 9727  C CG1  . VAL A 1 55  ? -3.838  0.329   6.809   1.00 0.00 ? 55  VAL A CG1  7  
ATOM 9728  C CG2  . VAL A 1 55  ? -1.607  0.454   7.977   1.00 0.00 ? 55  VAL A CG2  7  
ATOM 9729  H H    . VAL A 1 55  ? -3.586  1.075   4.603   1.00 0.00 ? 55  VAL A H    7  
ATOM 9730  H HA   . VAL A 1 55  ? -1.044  1.516   5.284   1.00 0.00 ? 55  VAL A HA   7  
ATOM 9731  H HB   . VAL A 1 55  ? -2.559  2.035   6.906   1.00 0.00 ? 55  VAL A HB   7  
ATOM 9732  H HG11 . VAL A 1 55  ? -4.159  0.175   7.839   1.00 0.00 ? 55  VAL A HG11 7  
ATOM 9733  H HG12 . VAL A 1 55  ? -4.539  0.995   6.305   1.00 0.00 ? 55  VAL A HG12 7  
ATOM 9734  H HG13 . VAL A 1 55  ? -3.809  -0.629  6.290   1.00 0.00 ? 55  VAL A HG13 7  
ATOM 9735  H HG21 . VAL A 1 55  ? -1.924  -0.554  8.245   1.00 0.00 ? 55  VAL A HG21 7  
ATOM 9736  H HG22 . VAL A 1 55  ? -0.553  0.441   7.696   1.00 0.00 ? 55  VAL A HG22 7  
ATOM 9737  H HG23 . VAL A 1 55  ? -1.746  1.118   8.831   1.00 0.00 ? 55  VAL A HG23 7  
ATOM 9738  N N    . GLY A 1 56  ? 0.331   -0.507  5.820   1.00 0.00 ? 56  GLY A N    7  
ATOM 9739  C CA   . GLY A 1 56  ? 1.202   -1.669  5.861   1.00 0.00 ? 56  GLY A CA   7  
ATOM 9740  C C    . GLY A 1 56  ? 2.219   -1.633  4.719   1.00 0.00 ? 56  GLY A C    7  
ATOM 9741  O O    . GLY A 1 56  ? 3.347   -2.100  4.872   1.00 0.00 ? 56  GLY A O    7  
ATOM 9742  H H    . GLY A 1 56  ? 0.766   0.357   6.074   1.00 0.00 ? 56  GLY A H    7  
ATOM 9743  H HA2  . GLY A 1 56  ? 1.724   -1.702  6.817   1.00 0.00 ? 56  GLY A HA2  7  
ATOM 9744  H HA3  . GLY A 1 56  ? 0.604   -2.578  5.792   1.00 0.00 ? 56  GLY A HA3  7  
ATOM 9745  N N    . ASP A 1 57  ? 1.784   -1.074  3.599   1.00 0.00 ? 57  ASP A N    7  
ATOM 9746  C CA   . ASP A 1 57  ? 2.643   -0.971  2.432   1.00 0.00 ? 57  ASP A CA   7  
ATOM 9747  C C    . ASP A 1 57  ? 3.906   -0.191  2.800   1.00 0.00 ? 57  ASP A C    7  
ATOM 9748  O O    . ASP A 1 57  ? 4.090   0.189   3.956   1.00 0.00 ? 57  ASP A O    7  
ATOM 9749  C CB   . ASP A 1 57  ? 1.941   -0.224  1.296   1.00 0.00 ? 57  ASP A CB   7  
ATOM 9750  C CG   . ASP A 1 57  ? 0.937   -1.058  0.497   1.00 0.00 ? 57  ASP A CG   7  
ATOM 9751  O OD1  . ASP A 1 57  ? 0.573   -2.143  1.000   1.00 0.00 ? 57  ASP A OD1  7  
ATOM 9752  O OD2  . ASP A 1 57  ? 0.556   -0.591  -0.598  1.00 0.00 ? 57  ASP A OD2  7  
ATOM 9753  H H    . ASP A 1 57  ? 0.865   -0.697  3.483   1.00 0.00 ? 57  ASP A H    7  
ATOM 9754  H HA   . ASP A 1 57  ? 2.857   -2.000  2.142   1.00 0.00 ? 57  ASP A HA   7  
ATOM 9755  H HB2  . ASP A 1 57  ? 1.422   0.639   1.714   1.00 0.00 ? 57  ASP A HB2  7  
ATOM 9756  H HB3  . ASP A 1 57  ? 2.697   0.160   0.611   1.00 0.00 ? 57  ASP A HB3  7  
ATOM 9757  N N    . GLN A 1 58  ? 4.744   0.025   1.797   1.00 0.00 ? 58  GLN A N    7  
ATOM 9758  C CA   . GLN A 1 58  ? 5.985   0.753   2.001   1.00 0.00 ? 58  GLN A CA   7  
ATOM 9759  C C    . GLN A 1 58  ? 6.237   1.710   0.834   1.00 0.00 ? 58  GLN A C    7  
ATOM 9760  O O    . GLN A 1 58  ? 6.516   1.274   -0.282  1.00 0.00 ? 58  GLN A O    7  
ATOM 9761  C CB   . GLN A 1 58  ? 7.160   -0.208  2.186   1.00 0.00 ? 58  GLN A CB   7  
ATOM 9762  C CG   . GLN A 1 58  ? 8.481   0.556   2.300   1.00 0.00 ? 58  GLN A CG   7  
ATOM 9763  C CD   . GLN A 1 58  ? 9.624   -0.380  2.696   1.00 0.00 ? 58  GLN A CD   7  
ATOM 9764  O OE1  . GLN A 1 58  ? 9.720   -1.510  2.247   1.00 0.00 ? 58  GLN A OE1  7  
ATOM 9765  N NE2  . GLN A 1 58  ? 10.483  0.151   3.562   1.00 0.00 ? 58  GLN A NE2  7  
ATOM 9766  H H    . GLN A 1 58  ? 4.587   -0.287  0.860   1.00 0.00 ? 58  GLN A H    7  
ATOM 9767  H HA   . GLN A 1 58  ? 5.839   1.321   2.920   1.00 0.00 ? 58  GLN A HA   7  
ATOM 9768  H HB2  . GLN A 1 58  ? 7.006   -0.809  3.082   1.00 0.00 ? 58  GLN A HB2  7  
ATOM 9769  H HB3  . GLN A 1 58  ? 7.207   -0.898  1.344   1.00 0.00 ? 58  GLN A HB3  7  
ATOM 9770  H HG2  . GLN A 1 58  ? 8.711   1.035   1.348   1.00 0.00 ? 58  GLN A HG2  7  
ATOM 9771  H HG3  . GLN A 1 58  ? 8.383   1.350   3.040   1.00 0.00 ? 58  GLN A HG3  7  
ATOM 9772  H HE21 . GLN A 1 58  ? 10.347  1.085   3.892   1.00 0.00 ? 58  GLN A HE21 7  
ATOM 9773  H HE22 . GLN A 1 58  ? 11.265  -0.384  3.882   1.00 0.00 ? 58  GLN A HE22 7  
ATOM 9774  N N    . ILE A 1 59  ? 6.130   2.997   1.132   1.00 0.00 ? 59  ILE A N    7  
ATOM 9775  C CA   . ILE A 1 59  ? 6.344   4.019   0.121   1.00 0.00 ? 59  ILE A CA   7  
ATOM 9776  C C    . ILE A 1 59  ? 7.833   4.089   -0.221  1.00 0.00 ? 59  ILE A C    7  
ATOM 9777  O O    . ILE A 1 59  ? 8.540   4.981   0.245   1.00 0.00 ? 59  ILE A O    7  
ATOM 9778  C CB   . ILE A 1 59  ? 5.754   5.355   0.578   1.00 0.00 ? 59  ILE A CB   7  
ATOM 9779  C CG1  . ILE A 1 59  ? 4.286   5.198   0.979   1.00 0.00 ? 59  ILE A CG1  7  
ATOM 9780  C CG2  . ILE A 1 59  ? 5.944   6.432   -0.492  1.00 0.00 ? 59  ILE A CG2  7  
ATOM 9781  C CD1  . ILE A 1 59  ? 3.401   4.983   -0.250  1.00 0.00 ? 59  ILE A CD1  7  
ATOM 9782  H H    . ILE A 1 59  ? 5.904   3.343   2.042   1.00 0.00 ? 59  ILE A H    7  
ATOM 9783  H HA   . ILE A 1 59  ? 5.798   3.714   -0.772  1.00 0.00 ? 59  ILE A HA   7  
ATOM 9784  H HB   . ILE A 1 59  ? 6.297   5.683   1.464   1.00 0.00 ? 59  ILE A HB   7  
ATOM 9785  H HG12 . ILE A 1 59  ? 4.180   4.353   1.660   1.00 0.00 ? 59  ILE A HG12 7  
ATOM 9786  H HG13 . ILE A 1 59  ? 3.956   6.085   1.519   1.00 0.00 ? 59  ILE A HG13 7  
ATOM 9787  H HG21 . ILE A 1 59  ? 6.692   6.101   -1.213  1.00 0.00 ? 59  ILE A HG21 7  
ATOM 9788  H HG22 . ILE A 1 59  ? 4.998   6.605   -1.005  1.00 0.00 ? 59  ILE A HG22 7  
ATOM 9789  H HG23 . ILE A 1 59  ? 6.277   7.357   -0.022  1.00 0.00 ? 59  ILE A HG23 7  
ATOM 9790  H HD11 . ILE A 1 59  ? 2.693   4.179   -0.052  1.00 0.00 ? 59  ILE A HD11 7  
ATOM 9791  H HD12 . ILE A 1 59  ? 2.856   5.901   -0.471  1.00 0.00 ? 59  ILE A HD12 7  
ATOM 9792  H HD13 . ILE A 1 59  ? 4.024   4.716   -1.104  1.00 0.00 ? 59  ILE A HD13 7  
ATOM 9793  N N    . LEU A 1 60  ? 8.267   3.135   -1.032  1.00 0.00 ? 60  LEU A N    7  
ATOM 9794  C CA   . LEU A 1 60  ? 9.660   3.077   -1.442  1.00 0.00 ? 60  LEU A CA   7  
ATOM 9795  C C    . LEU A 1 60  ? 10.064  4.422   -2.049  1.00 0.00 ? 60  LEU A C    7  
ATOM 9796  O O    . LEU A 1 60  ? 10.940  5.106   -1.522  1.00 0.00 ? 60  LEU A O    7  
ATOM 9797  C CB   . LEU A 1 60  ? 9.895   1.886   -2.373  1.00 0.00 ? 60  LEU A CB   7  
ATOM 9798  C CG   . LEU A 1 60  ? 9.458   0.521   -1.840  1.00 0.00 ? 60  LEU A CG   7  
ATOM 9799  C CD1  . LEU A 1 60  ? 9.484   -0.535  -2.947  1.00 0.00 ? 60  LEU A CD1  7  
ATOM 9800  C CD2  . LEU A 1 60  ? 10.303  0.107   -0.633  1.00 0.00 ? 60  LEU A CD2  7  
ATOM 9801  H H    . LEU A 1 60  ? 7.686   2.412   -1.407  1.00 0.00 ? 60  LEU A H    7  
ATOM 9802  H HA   . LEU A 1 60  ? 10.257  2.909   -0.546  1.00 0.00 ? 60  LEU A HA   7  
ATOM 9803  H HB2  . LEU A 1 60  ? 9.370   2.073   -3.310  1.00 0.00 ? 60  LEU A HB2  7  
ATOM 9804  H HB3  . LEU A 1 60  ? 10.959  1.839   -2.608  1.00 0.00 ? 60  LEU A HB3  7  
ATOM 9805  H HG   . LEU A 1 60  ? 8.426   0.602   -1.497  1.00 0.00 ? 60  LEU A HG   7  
ATOM 9806  H HD11 . LEU A 1 60  ? 10.083  -0.171  -3.781  1.00 0.00 ? 60  LEU A HD11 7  
ATOM 9807  H HD12 . LEU A 1 60  ? 9.920   -1.456  -2.561  1.00 0.00 ? 60  LEU A HD12 7  
ATOM 9808  H HD13 . LEU A 1 60  ? 8.467   -0.729  -3.288  1.00 0.00 ? 60  LEU A HD13 7  
ATOM 9809  H HD21 . LEU A 1 60  ? 10.630  0.997   -0.096  1.00 0.00 ? 60  LEU A HD21 7  
ATOM 9810  H HD22 . LEU A 1 60  ? 9.707   -0.520  0.030   1.00 0.00 ? 60  LEU A HD22 7  
ATOM 9811  H HD23 . LEU A 1 60  ? 11.175  -0.452  -0.975  1.00 0.00 ? 60  LEU A HD23 7  
ATOM 9812  N N    . ARG A 1 61  ? 9.408   4.760   -3.149  1.00 0.00 ? 61  ARG A N    7  
ATOM 9813  C CA   . ARG A 1 61  ? 9.688   6.011   -3.833  1.00 0.00 ? 61  ARG A CA   7  
ATOM 9814  C C    . ARG A 1 61  ? 8.451   6.911   -3.821  1.00 0.00 ? 61  ARG A C    7  
ATOM 9815  O O    . ARG A 1 61  ? 7.352   6.459   -3.503  1.00 0.00 ? 61  ARG A O    7  
ATOM 9816  C CB   . ARG A 1 61  ? 10.116  5.763   -5.281  1.00 0.00 ? 61  ARG A CB   7  
ATOM 9817  C CG   . ARG A 1 61  ? 11.623  5.518   -5.373  1.00 0.00 ? 61  ARG A CG   7  
ATOM 9818  C CD   . ARG A 1 61  ? 11.993  4.872   -6.710  1.00 0.00 ? 61  ARG A CD   7  
ATOM 9819  N NE   . ARG A 1 61  ? 12.767  3.632   -6.476  1.00 0.00 ? 61  ARG A NE   7  
ATOM 9820  C CZ   . ARG A 1 61  ? 12.988  2.697   -7.410  1.00 0.00 ? 61  ARG A CZ   7  
ATOM 9821  N NH1  . ARG A 1 61  ? 12.496  2.856   -8.646  1.00 0.00 ? 61  ARG A NH1  7  
ATOM 9822  N NH2  . ARG A 1 61  ? 13.702  1.604   -7.108  1.00 0.00 ? 61  ARG A NH2  7  
ATOM 9823  H H    . ARG A 1 61  ? 8.697   4.198   -3.571  1.00 0.00 ? 61  ARG A H    7  
ATOM 9824  H HA   . ARG A 1 61  ? 10.505  6.460   -3.269  1.00 0.00 ? 61  ARG A HA   7  
ATOM 9825  H HB2  . ARG A 1 61  ? 9.579   4.902   -5.680  1.00 0.00 ? 61  ARG A HB2  7  
ATOM 9826  H HB3  . ARG A 1 61  ? 9.845   6.621   -5.896  1.00 0.00 ? 61  ARG A HB3  7  
ATOM 9827  H HG2  . ARG A 1 61  ? 12.156  6.462   -5.261  1.00 0.00 ? 61  ARG A HG2  7  
ATOM 9828  H HG3  . ARG A 1 61  ? 11.941  4.873   -4.553  1.00 0.00 ? 61  ARG A HG3  7  
ATOM 9829  H HD2  . ARG A 1 61  ? 11.090  4.645   -7.276  1.00 0.00 ? 61  ARG A HD2  7  
ATOM 9830  H HD3  . ARG A 1 61  ? 12.579  5.568   -7.310  1.00 0.00 ? 61  ARG A HD3  7  
ATOM 9831  H HE   . ARG A 1 61  ? 13.149  3.483   -5.564  1.00 0.00 ? 61  ARG A HE   7  
ATOM 9832  H HH11 . ARG A 1 61  ? 11.963  3.671   -8.872  1.00 0.00 ? 61  ARG A HH11 7  
ATOM 9833  H HH12 . ARG A 1 61  ? 12.661  2.158   -9.343  1.00 0.00 ? 61  ARG A HH12 7  
ATOM 9834  H HH21 . ARG A 1 61  ? 14.070  1.486   -6.186  1.00 0.00 ? 61  ARG A HH21 7  
ATOM 9835  H HH22 . ARG A 1 61  ? 13.867  0.907   -7.805  1.00 0.00 ? 61  ARG A HH22 7  
ATOM 9836  N N    . VAL A 1 62  ? 8.671   8.170   -4.172  1.00 0.00 ? 62  VAL A N    7  
ATOM 9837  C CA   . VAL A 1 62  ? 7.588   9.138   -4.206  1.00 0.00 ? 62  VAL A CA   7  
ATOM 9838  C C    . VAL A 1 62  ? 7.799   10.092  -5.383  1.00 0.00 ? 62  VAL A C    7  
ATOM 9839  O O    . VAL A 1 62  ? 8.730   10.897  -5.375  1.00 0.00 ? 62  VAL A O    7  
ATOM 9840  C CB   . VAL A 1 62  ? 7.490   9.860   -2.861  1.00 0.00 ? 62  VAL A CB   7  
ATOM 9841  C CG1  . VAL A 1 62  ? 8.641   10.852  -2.686  1.00 0.00 ? 62  VAL A CG1  7  
ATOM 9842  C CG2  . VAL A 1 62  ? 6.137   10.559  -2.711  1.00 0.00 ? 62  VAL A CG2  7  
ATOM 9843  H H    . VAL A 1 62  ? 9.568   8.530   -4.430  1.00 0.00 ? 62  VAL A H    7  
ATOM 9844  H HA   . VAL A 1 62  ? 6.660   8.588   -4.363  1.00 0.00 ? 62  VAL A HA   7  
ATOM 9845  H HB   . VAL A 1 62  ? 7.569   9.112   -2.072  1.00 0.00 ? 62  VAL A HB   7  
ATOM 9846  H HG11 . VAL A 1 62  ? 9.583   10.364  -2.938  1.00 0.00 ? 62  VAL A HG11 7  
ATOM 9847  H HG12 . VAL A 1 62  ? 8.487   11.707  -3.344  1.00 0.00 ? 62  VAL A HG12 7  
ATOM 9848  H HG13 . VAL A 1 62  ? 8.674   11.192  -1.651  1.00 0.00 ? 62  VAL A HG13 7  
ATOM 9849  H HG21 . VAL A 1 62  ? 5.863   10.599  -1.657  1.00 0.00 ? 62  VAL A HG21 7  
ATOM 9850  H HG22 . VAL A 1 62  ? 6.205   11.572  -3.108  1.00 0.00 ? 62  VAL A HG22 7  
ATOM 9851  H HG23 . VAL A 1 62  ? 5.378   10.003  -3.263  1.00 0.00 ? 62  VAL A HG23 7  
ATOM 9852  N N    . ASN A 1 63  ? 6.920   9.971   -6.367  1.00 0.00 ? 63  ASN A N    7  
ATOM 9853  C CA   . ASN A 1 63  ? 6.999   10.813  -7.549  1.00 0.00 ? 63  ASN A CA   7  
ATOM 9854  C C    . ASN A 1 63  ? 8.140   10.325  -8.442  1.00 0.00 ? 63  ASN A C    7  
ATOM 9855  O O    . ASN A 1 63  ? 7.921   9.980   -9.603  1.00 0.00 ? 63  ASN A O    7  
ATOM 9856  C CB   . ASN A 1 63  ? 7.283   12.268  -7.171  1.00 0.00 ? 63  ASN A CB   7  
ATOM 9857  C CG   . ASN A 1 63  ? 6.523   13.231  -8.085  1.00 0.00 ? 63  ASN A CG   7  
ATOM 9858  O OD1  . ASN A 1 63  ? 6.753   13.305  -9.280  1.00 0.00 ? 63  ASN A OD1  7  
ATOM 9859  N ND2  . ASN A 1 63  ? 5.606   13.962  -7.457  1.00 0.00 ? 63  ASN A ND2  7  
ATOM 9860  H H    . ASN A 1 63  ? 6.166   9.314   -6.366  1.00 0.00 ? 63  ASN A H    7  
ATOM 9861  H HA   . ASN A 1 63  ? 6.025   10.723  -8.030  1.00 0.00 ? 63  ASN A HA   7  
ATOM 9862  H HB2  . ASN A 1 63  ? 6.995   12.441  -6.134  1.00 0.00 ? 63  ASN A HB2  7  
ATOM 9863  H HB3  . ASN A 1 63  ? 8.353   12.463  -7.241  1.00 0.00 ? 63  ASN A HB3  7  
ATOM 9864  H HD21 . ASN A 1 63  ? 5.467   13.852  -6.473  1.00 0.00 ? 63  ASN A HD21 7  
ATOM 9865  H HD22 . ASN A 1 63  ? 5.056   14.622  -7.969  1.00 0.00 ? 63  ASN A HD22 7  
ATOM 9866  N N    . ASP A 1 64  ? 9.334   10.311  -7.868  1.00 0.00 ? 64  ASP A N    7  
ATOM 9867  C CA   . ASP A 1 64  ? 10.511  9.871   -8.598  1.00 0.00 ? 64  ASP A CA   7  
ATOM 9868  C C    . ASP A 1 64  ? 11.657  9.630   -7.613  1.00 0.00 ? 64  ASP A C    7  
ATOM 9869  O O    . ASP A 1 64  ? 12.338  8.609   -7.686  1.00 0.00 ? 64  ASP A O    7  
ATOM 9870  C CB   . ASP A 1 64  ? 10.966  10.933  -9.601  1.00 0.00 ? 64  ASP A CB   7  
ATOM 9871  C CG   . ASP A 1 64  ? 12.053  10.478  -10.577 1.00 0.00 ? 64  ASP A CG   7  
ATOM 9872  O OD1  . ASP A 1 64  ? 13.029  9.864   -10.093 1.00 0.00 ? 64  ASP A OD1  7  
ATOM 9873  O OD2  . ASP A 1 64  ? 11.884  10.754  -11.784 1.00 0.00 ? 64  ASP A OD2  7  
ATOM 9874  H H    . ASP A 1 64  ? 9.504   10.594  -6.924  1.00 0.00 ? 64  ASP A H    7  
ATOM 9875  H HA   . ASP A 1 64  ? 10.205  8.961   -9.113  1.00 0.00 ? 64  ASP A HA   7  
ATOM 9876  H HB2  . ASP A 1 64  ? 10.100  11.264  -10.175 1.00 0.00 ? 64  ASP A HB2  7  
ATOM 9877  H HB3  . ASP A 1 64  ? 11.333  11.799  -9.050  1.00 0.00 ? 64  ASP A HB3  7  
ATOM 9878  N N    . LYS A 1 65  ? 11.833  10.587  -6.714  1.00 0.00 ? 65  LYS A N    7  
ATOM 9879  C CA   . LYS A 1 65  ? 12.884  10.491  -5.716  1.00 0.00 ? 65  LYS A CA   7  
ATOM 9880  C C    . LYS A 1 65  ? 12.539  9.379   -4.724  1.00 0.00 ? 65  LYS A C    7  
ATOM 9881  O O    . LYS A 1 65  ? 11.374  9.014   -4.575  1.00 0.00 ? 65  LYS A O    7  
ATOM 9882  C CB   . LYS A 1 65  ? 13.122  11.851  -5.056  1.00 0.00 ? 65  LYS A CB   7  
ATOM 9883  C CG   . LYS A 1 65  ? 13.906  12.781  -5.985  1.00 0.00 ? 65  LYS A CG   7  
ATOM 9884  C CD   . LYS A 1 65  ? 15.306  13.055  -5.432  1.00 0.00 ? 65  LYS A CD   7  
ATOM 9885  C CE   . LYS A 1 65  ? 15.923  14.292  -6.088  1.00 0.00 ? 65  LYS A CE   7  
ATOM 9886  N NZ   . LYS A 1 65  ? 17.200  14.646  -5.429  1.00 0.00 ? 65  LYS A NZ   7  
ATOM 9887  H H    . LYS A 1 65  ? 11.274  11.415  -6.661  1.00 0.00 ? 65  LYS A H    7  
ATOM 9888  H HA   . LYS A 1 65  ? 13.804  10.219  -6.234  1.00 0.00 ? 65  LYS A HA   7  
ATOM 9889  H HB2  . LYS A 1 65  ? 12.166  12.309  -4.801  1.00 0.00 ? 65  LYS A HB2  7  
ATOM 9890  H HB3  . LYS A 1 65  ? 13.670  11.716  -4.124  1.00 0.00 ? 65  LYS A HB3  7  
ATOM 9891  H HG2  . LYS A 1 65  ? 13.984  12.331  -6.974  1.00 0.00 ? 65  LYS A HG2  7  
ATOM 9892  H HG3  . LYS A 1 65  ? 13.368  13.721  -6.103  1.00 0.00 ? 65  LYS A HG3  7  
ATOM 9893  H HD2  . LYS A 1 65  ? 15.253  13.200  -4.352  1.00 0.00 ? 65  LYS A HD2  7  
ATOM 9894  H HD3  . LYS A 1 65  ? 15.946  12.190  -5.606  1.00 0.00 ? 65  LYS A HD3  7  
ATOM 9895  H HE2  . LYS A 1 65  ? 16.094  14.102  -7.147  1.00 0.00 ? 65  LYS A HE2  7  
ATOM 9896  H HE3  . LYS A 1 65  ? 15.229  15.130  -6.023  1.00 0.00 ? 65  LYS A HE3  7  
ATOM 9897  H HZ1  . LYS A 1 65  ? 17.744  15.219  -6.042  1.00 0.00 ? 65  LYS A HZ1  7  
ATOM 9898  H HZ2  . LYS A 1 65  ? 17.012  15.147  -4.585  1.00 0.00 ? 65  LYS A HZ2  7  
ATOM 9899  H HZ3  . LYS A 1 65  ? 17.708  13.811  -5.215  1.00 0.00 ? 65  LYS A HZ3  7  
ATOM 9900  N N    . SER A 1 66  ? 13.574  8.871   -4.070  1.00 0.00 ? 66  SER A N    7  
ATOM 9901  C CA   . SER A 1 66  ? 13.395  7.807   -3.096  1.00 0.00 ? 66  SER A CA   7  
ATOM 9902  C C    . SER A 1 66  ? 13.500  8.373   -1.679  1.00 0.00 ? 66  SER A C    7  
ATOM 9903  O O    . SER A 1 66  ? 14.297  9.274   -1.423  1.00 0.00 ? 66  SER A O    7  
ATOM 9904  C CB   . SER A 1 66  ? 14.425  6.694   -3.301  1.00 0.00 ? 66  SER A CB   7  
ATOM 9905  O OG   . SER A 1 66  ? 15.737  7.106   -2.927  1.00 0.00 ? 66  SER A OG   7  
ATOM 9906  H H    . SER A 1 66  ? 14.519  9.173   -4.197  1.00 0.00 ? 66  SER A H    7  
ATOM 9907  H HA   . SER A 1 66  ? 12.395  7.414   -3.279  1.00 0.00 ? 66  SER A HA   7  
ATOM 9908  H HB2  . SER A 1 66  ? 14.137  5.822   -2.713  1.00 0.00 ? 66  SER A HB2  7  
ATOM 9909  H HB3  . SER A 1 66  ? 14.425  6.388   -4.347  1.00 0.00 ? 66  SER A HB3  7  
ATOM 9910  H HG   . SER A 1 66  ? 16.390  6.858   -3.643  1.00 0.00 ? 66  SER A HG   7  
ATOM 9911  N N    . LEU A 1 67  ? 12.683  7.821   -0.794  1.00 0.00 ? 67  LEU A N    7  
ATOM 9912  C CA   . LEU A 1 67  ? 12.673  8.259   0.592   1.00 0.00 ? 67  LEU A CA   7  
ATOM 9913  C C    . LEU A 1 67  ? 13.720  7.468   1.379   1.00 0.00 ? 67  LEU A C    7  
ATOM 9914  O O    . LEU A 1 67  ? 13.439  6.975   2.470   1.00 0.00 ? 67  LEU A O    7  
ATOM 9915  C CB   . LEU A 1 67  ? 11.262  8.161   1.175   1.00 0.00 ? 67  LEU A CB   7  
ATOM 9916  C CG   . LEU A 1 67  ? 10.128  8.649   0.271   1.00 0.00 ? 67  LEU A CG   7  
ATOM 9917  C CD1  . LEU A 1 67  ? 8.801   7.991   0.653   1.00 0.00 ? 67  LEU A CD1  7  
ATOM 9918  C CD2  . LEU A 1 67  ? 10.035  10.176  0.283   1.00 0.00 ? 67  LEU A CD2  7  
ATOM 9919  H H    . LEU A 1 67  ? 12.037  7.088   -1.010  1.00 0.00 ? 67  LEU A H    7  
ATOM 9920  H HA   . LEU A 1 67  ? 12.955  9.312   0.603   1.00 0.00 ? 67  LEU A HA   7  
ATOM 9921  H HB2  . LEU A 1 67  ? 11.069  7.121   1.437   1.00 0.00 ? 67  LEU A HB2  7  
ATOM 9922  H HB3  . LEU A 1 67  ? 11.233  8.734   2.102   1.00 0.00 ? 67  LEU A HB3  7  
ATOM 9923  H HG   . LEU A 1 67  ? 10.353  8.349   -0.752  1.00 0.00 ? 67  LEU A HG   7  
ATOM 9924  H HD11 . LEU A 1 67  ? 8.203   8.691   1.237   1.00 0.00 ? 67  LEU A HD11 7  
ATOM 9925  H HD12 . LEU A 1 67  ? 8.258   7.715   -0.251  1.00 0.00 ? 67  LEU A HD12 7  
ATOM 9926  H HD13 . LEU A 1 67  ? 8.996   7.097   1.246   1.00 0.00 ? 67  LEU A HD13 7  
ATOM 9927  H HD21 . LEU A 1 67  ? 10.551  10.565  1.161   1.00 0.00 ? 67  LEU A HD21 7  
ATOM 9928  H HD22 . LEU A 1 67  ? 10.499  10.576  -0.618  1.00 0.00 ? 67  LEU A HD22 7  
ATOM 9929  H HD23 . LEU A 1 67  ? 8.987   10.476  0.316   1.00 0.00 ? 67  LEU A HD23 7  
ATOM 9930  N N    . ALA A 1 68  ? 14.905  7.373   0.796   1.00 0.00 ? 68  ALA A N    7  
ATOM 9931  C CA   . ALA A 1 68  ? 15.996  6.651   1.429   1.00 0.00 ? 68  ALA A CA   7  
ATOM 9932  C C    . ALA A 1 68  ? 16.256  7.243   2.816   1.00 0.00 ? 68  ALA A C    7  
ATOM 9933  O O    . ALA A 1 68  ? 17.043  8.177   2.958   1.00 0.00 ? 68  ALA A O    7  
ATOM 9934  C CB   . ALA A 1 68  ? 17.233  6.704   0.531   1.00 0.00 ? 68  ALA A CB   7  
ATOM 9935  H H    . ALA A 1 68  ? 15.126  7.777   -0.092  1.00 0.00 ? 68  ALA A H    7  
ATOM 9936  H HA   . ALA A 1 68  ? 15.686  5.612   1.539   1.00 0.00 ? 68  ALA A HA   7  
ATOM 9937  H HB1  . ALA A 1 68  ? 18.131  6.671   1.148   1.00 0.00 ? 68  ALA A HB1  7  
ATOM 9938  H HB2  . ALA A 1 68  ? 17.227  5.851   -0.147  1.00 0.00 ? 68  ALA A HB2  7  
ATOM 9939  H HB3  . ALA A 1 68  ? 17.223  7.628   -0.047  1.00 0.00 ? 68  ALA A HB3  7  
ATOM 9940  N N    . ARG A 1 69  ? 15.579  6.675   3.803   1.00 0.00 ? 69  ARG A N    7  
ATOM 9941  C CA   . ARG A 1 69  ? 15.727  7.134   5.174   1.00 0.00 ? 69  ARG A CA   7  
ATOM 9942  C C    . ARG A 1 69  ? 15.748  8.663   5.221   1.00 0.00 ? 69  ARG A C    7  
ATOM 9943  O O    . ARG A 1 69  ? 16.814  9.275   5.169   1.00 0.00 ? 69  ARG A O    7  
ATOM 9944  C CB   . ARG A 1 69  ? 17.014  6.594   5.800   1.00 0.00 ? 69  ARG A CB   7  
ATOM 9945  C CG   . ARG A 1 69  ? 16.901  5.094   6.078   1.00 0.00 ? 69  ARG A CG   7  
ATOM 9946  C CD   . ARG A 1 69  ? 18.156  4.570   6.779   1.00 0.00 ? 69  ARG A CD   7  
ATOM 9947  N NE   . ARG A 1 69  ? 17.798  3.466   7.699   1.00 0.00 ? 69  ARG A NE   7  
ATOM 9948  C CZ   . ARG A 1 69  ? 18.683  2.603   8.216   1.00 0.00 ? 69  ARG A CZ   7  
ATOM 9949  N NH1  . ARG A 1 69  ? 19.983  2.710   7.907   1.00 0.00 ? 69  ARG A NH1  7  
ATOM 9950  N NH2  . ARG A 1 69  ? 18.269  1.633   9.042   1.00 0.00 ? 69  ARG A NH2  7  
ATOM 9951  H H    . ARG A 1 69  ? 14.941  5.915   3.679   1.00 0.00 ? 69  ARG A H    7  
ATOM 9952  H HA   . ARG A 1 69  ? 14.857  6.737   5.696   1.00 0.00 ? 69  ARG A HA   7  
ATOM 9953  H HB2  . ARG A 1 69  ? 17.855  6.781   5.131   1.00 0.00 ? 69  ARG A HB2  7  
ATOM 9954  H HB3  . ARG A 1 69  ? 17.222  7.125   6.729   1.00 0.00 ? 69  ARG A HB3  7  
ATOM 9955  H HG2  . ARG A 1 69  ? 16.026  4.901   6.699   1.00 0.00 ? 69  ARG A HG2  7  
ATOM 9956  H HG3  . ARG A 1 69  ? 16.752  4.557   5.142   1.00 0.00 ? 69  ARG A HG3  7  
ATOM 9957  H HD2  . ARG A 1 69  ? 18.876  4.219   6.040   1.00 0.00 ? 69  ARG A HD2  7  
ATOM 9958  H HD3  . ARG A 1 69  ? 18.636  5.376   7.334   1.00 0.00 ? 69  ARG A HD3  7  
ATOM 9959  H HE   . ARG A 1 69  ? 16.836  3.358   7.950   1.00 0.00 ? 69  ARG A HE   7  
ATOM 9960  H HH11 . ARG A 1 69  ? 20.292  3.434   7.290   1.00 0.00 ? 69  ARG A HH11 7  
ATOM 9961  H HH12 . ARG A 1 69  ? 20.643  2.065   8.292   1.00 0.00 ? 69  ARG A HH12 7  
ATOM 9962  H HH21 . ARG A 1 69  ? 17.299  1.553   9.273   1.00 0.00 ? 69  ARG A HH21 7  
ATOM 9963  H HH22 . ARG A 1 69  ? 18.929  0.988   9.427   1.00 0.00 ? 69  ARG A HH22 7  
ATOM 9964  N N    . VAL A 1 70  ? 14.558  9.237   5.319   1.00 0.00 ? 70  VAL A N    7  
ATOM 9965  C CA   . VAL A 1 70  ? 14.426  10.683  5.374   1.00 0.00 ? 70  VAL A CA   7  
ATOM 9966  C C    . VAL A 1 70  ? 13.407  11.057  6.453   1.00 0.00 ? 70  VAL A C    7  
ATOM 9967  O O    . VAL A 1 70  ? 12.483  10.295  6.730   1.00 0.00 ? 70  VAL A O    7  
ATOM 9968  C CB   . VAL A 1 70  ? 14.061  11.228  3.992   1.00 0.00 ? 70  VAL A CB   7  
ATOM 9969  C CG1  . VAL A 1 70  ? 15.183  10.967  2.986   1.00 0.00 ? 70  VAL A CG1  7  
ATOM 9970  C CG2  . VAL A 1 70  ? 12.737  10.638  3.502   1.00 0.00 ? 70  VAL A CG2  7  
ATOM 9971  H H    . VAL A 1 70  ? 13.696  8.732   5.361   1.00 0.00 ? 70  VAL A H    7  
ATOM 9972  H HA   . VAL A 1 70  ? 15.397  11.091  5.652   1.00 0.00 ? 70  VAL A HA   7  
ATOM 9973  H HB   . VAL A 1 70  ? 13.934  12.307  4.080   1.00 0.00 ? 70  VAL A HB   7  
ATOM 9974  H HG11 . VAL A 1 70  ? 15.618  11.917  2.672   1.00 0.00 ? 70  VAL A HG11 7  
ATOM 9975  H HG12 . VAL A 1 70  ? 15.953  10.352  3.451   1.00 0.00 ? 70  VAL A HG12 7  
ATOM 9976  H HG13 . VAL A 1 70  ? 14.779  10.449  2.117   1.00 0.00 ? 70  VAL A HG13 7  
ATOM 9977  H HG21 . VAL A 1 70  ? 12.929  9.942   2.685   1.00 0.00 ? 70  VAL A HG21 7  
ATOM 9978  H HG22 . VAL A 1 70  ? 12.249  10.110  4.322   1.00 0.00 ? 70  VAL A HG22 7  
ATOM 9979  H HG23 . VAL A 1 70  ? 12.089  11.441  3.151   1.00 0.00 ? 70  VAL A HG23 7  
ATOM 9980  N N    . THR A 1 71  ? 13.612  12.231  7.033   1.00 0.00 ? 71  THR A N    7  
ATOM 9981  C CA   . THR A 1 71  ? 12.723  12.715  8.075   1.00 0.00 ? 71  THR A CA   7  
ATOM 9982  C C    . THR A 1 71  ? 11.285  12.790  7.558   1.00 0.00 ? 71  THR A C    7  
ATOM 9983  O O    . THR A 1 71  ? 11.060  12.992  6.365   1.00 0.00 ? 71  THR A O    7  
ATOM 9984  C CB   . THR A 1 71  ? 13.261  14.060  8.569   1.00 0.00 ? 71  THR A CB   7  
ATOM 9985  O OG1  . THR A 1 71  ? 13.216  14.896  7.416   1.00 0.00 ? 71  THR A OG1  7  
ATOM 9986  C CG2  . THR A 1 71  ? 14.748  13.999  8.927   1.00 0.00 ? 71  THR A CG2  7  
ATOM 9987  H H    . THR A 1 71  ? 14.366  12.845  6.802   1.00 0.00 ? 71  THR A H    7  
ATOM 9988  H HA   . THR A 1 71  ? 12.731  11.997  8.895   1.00 0.00 ? 71  THR A HA   7  
ATOM 9989  H HB   . THR A 1 71  ? 12.673  14.430  9.408   1.00 0.00 ? 71  THR A HB   7  
ATOM 9990  H HG1  . THR A 1 71  ? 13.151  14.337  6.590   1.00 0.00 ? 71  THR A HG1  7  
ATOM 9991  H HG21 . THR A 1 71  ? 15.342  13.992  8.013   1.00 0.00 ? 71  THR A HG21 7  
ATOM 9992  H HG22 . THR A 1 71  ? 15.013  14.870  9.527   1.00 0.00 ? 71  THR A HG22 7  
ATOM 9993  H HG23 . THR A 1 71  ? 14.947  13.091  9.497   1.00 0.00 ? 71  THR A HG23 7  
ATOM 9994  N N    . HIS A 1 72  ? 10.348  12.622  8.480   1.00 0.00 ? 72  HIS A N    7  
ATOM 9995  C CA   . HIS A 1 72  ? 8.939   12.668  8.132   1.00 0.00 ? 72  HIS A CA   7  
ATOM 9996  C C    . HIS A 1 72  ? 8.648   13.941  7.334   1.00 0.00 ? 72  HIS A C    7  
ATOM 9997  O O    . HIS A 1 72  ? 7.745   13.962  6.499   1.00 0.00 ? 72  HIS A O    7  
ATOM 9998  C CB   . HIS A 1 72  ? 8.066   12.539  9.382   1.00 0.00 ? 72  HIS A CB   7  
ATOM 9999  C CG   . HIS A 1 72  ? 6.737   11.865  9.136   1.00 0.00 ? 72  HIS A CG   7  
ATOM 10000 N ND1  . HIS A 1 72  ? 5.525   12.491  9.366   1.00 0.00 ? 72  HIS A ND1  7  
ATOM 10001 C CD2  . HIS A 1 72  ? 6.444   10.614  8.678   1.00 0.00 ? 72  HIS A CD2  7  
ATOM 10002 C CE1  . HIS A 1 72  ? 4.552   11.646  9.058   1.00 0.00 ? 72  HIS A CE1  7  
ATOM 10003 N NE2  . HIS A 1 72  ? 5.124   10.483  8.632   1.00 0.00 ? 72  HIS A NE2  7  
ATOM 10004 H H    . HIS A 1 72  ? 10.540  12.458  9.447   1.00 0.00 ? 72  HIS A H    7  
ATOM 10005 H HA   . HIS A 1 72  ? 8.744   11.801  7.500   1.00 0.00 ? 72  HIS A HA   7  
ATOM 10006 H HB2  . HIS A 1 72  ? 8.613   11.976  10.138  1.00 0.00 ? 72  HIS A HB2  7  
ATOM 10007 H HB3  . HIS A 1 72  ? 7.887   13.533  9.791   1.00 0.00 ? 72  HIS A HB3  7  
ATOM 10008 H HD1  . HIS A 1 72  ? 5.403   13.423  9.707   1.00 0.00 ? 72  HIS A HD1  7  
ATOM 10009 H HD2  . HIS A 1 72  ? 7.170   9.851   8.398   1.00 0.00 ? 72  HIS A HD2  7  
ATOM 10010 H HE1  . HIS A 1 72  ? 3.483   11.845  9.131   1.00 0.00 ? 72  HIS A HE1  7  
ATOM 10011 N N    . ALA A 1 73  ? 9.430   14.971  7.620   1.00 0.00 ? 73  ALA A N    7  
ATOM 10012 C CA   . ALA A 1 73  ? 9.269   16.245  6.940   1.00 0.00 ? 73  ALA A CA   7  
ATOM 10013 C C    . ALA A 1 73  ? 9.709   16.099  5.482   1.00 0.00 ? 73  ALA A C    7  
ATOM 10014 O O    . ALA A 1 73  ? 9.116   16.701  4.587   1.00 0.00 ? 73  ALA A O    7  
ATOM 10015 C CB   . ALA A 1 73  ? 10.058  17.324  7.682   1.00 0.00 ? 73  ALA A CB   7  
ATOM 10016 H H    . ALA A 1 73  ? 10.163  14.946  8.300   1.00 0.00 ? 73  ALA A H    7  
ATOM 10017 H HA   . ALA A 1 73  ? 8.210   16.503  6.967   1.00 0.00 ? 73  ALA A HA   7  
ATOM 10018 H HB1  . ALA A 1 73  ? 9.512   18.267  7.643   1.00 0.00 ? 73  ALA A HB1  7  
ATOM 10019 H HB2  . ALA A 1 73  ? 10.193  17.026  8.722   1.00 0.00 ? 73  ALA A HB2  7  
ATOM 10020 H HB3  . ALA A 1 73  ? 11.033  17.450  7.212   1.00 0.00 ? 73  ALA A HB3  7  
ATOM 10021 N N    . GLU A 1 74  ? 10.745  15.297  5.287   1.00 0.00 ? 74  GLU A N    7  
ATOM 10022 C CA   . GLU A 1 74  ? 11.272  15.065  3.953   1.00 0.00 ? 74  GLU A CA   7  
ATOM 10023 C C    . GLU A 1 74  ? 10.245  14.318  3.100   1.00 0.00 ? 74  GLU A C    7  
ATOM 10024 O O    . GLU A 1 74  ? 9.854   14.794  2.035   1.00 0.00 ? 74  GLU A O    7  
ATOM 10025 C CB   . GLU A 1 74  ? 12.596  14.301  4.012   1.00 0.00 ? 74  GLU A CB   7  
ATOM 10026 C CG   . GLU A 1 74  ? 13.772  15.257  4.220   1.00 0.00 ? 74  GLU A CG   7  
ATOM 10027 C CD   . GLU A 1 74  ? 13.930  16.200  3.026   1.00 0.00 ? 74  GLU A CD   7  
ATOM 10028 O OE1  . GLU A 1 74  ? 13.616  15.751  1.903   1.00 0.00 ? 74  GLU A OE1  7  
ATOM 10029 O OE2  . GLU A 1 74  ? 14.362  17.349  3.264   1.00 0.00 ? 74  GLU A OE2  7  
ATOM 10030 H H    . GLU A 1 74  ? 11.222  14.812  6.020   1.00 0.00 ? 74  GLU A H    7  
ATOM 10031 H HA   . GLU A 1 74  ? 11.450  16.056  3.535   1.00 0.00 ? 74  GLU A HA   7  
ATOM 10032 H HB2  . GLU A 1 74  ? 12.565  13.574  4.824   1.00 0.00 ? 74  GLU A HB2  7  
ATOM 10033 H HB3  . GLU A 1 74  ? 12.738  13.740  3.088   1.00 0.00 ? 74  GLU A HB3  7  
ATOM 10034 H HG2  . GLU A 1 74  ? 13.617  15.838  5.129   1.00 0.00 ? 74  GLU A HG2  7  
ATOM 10035 H HG3  . GLU A 1 74  ? 14.690  14.685  4.360   1.00 0.00 ? 74  GLU A HG3  7  
ATOM 10036 N N    . ALA A 1 75  ? 9.838   13.161  3.599   1.00 0.00 ? 75  ALA A N    7  
ATOM 10037 C CA   . ALA A 1 75  ? 8.864   12.344  2.896   1.00 0.00 ? 75  ALA A CA   7  
ATOM 10038 C C    . ALA A 1 75  ? 7.661   13.208  2.512   1.00 0.00 ? 75  ALA A C    7  
ATOM 10039 O O    . ALA A 1 75  ? 7.244   13.220  1.354   1.00 0.00 ? 75  ALA A O    7  
ATOM 10040 C CB   . ALA A 1 75  ? 8.470   11.152  3.771   1.00 0.00 ? 75  ALA A CB   7  
ATOM 10041 H H    . ALA A 1 75  ? 10.161  12.781  4.466   1.00 0.00 ? 75  ALA A H    7  
ATOM 10042 H HA   . ALA A 1 75  ? 9.337   11.971  1.987   1.00 0.00 ? 75  ALA A HA   7  
ATOM 10043 H HB1  . ALA A 1 75  ? 9.004   10.263  3.436   1.00 0.00 ? 75  ALA A HB1  7  
ATOM 10044 H HB2  . ALA A 1 75  ? 8.728   11.362  4.808   1.00 0.00 ? 75  ALA A HB2  7  
ATOM 10045 H HB3  . ALA A 1 75  ? 7.396   10.982  3.691   1.00 0.00 ? 75  ALA A HB3  7  
ATOM 10046 N N    . VAL A 1 76  ? 7.137   13.911  3.505   1.00 0.00 ? 76  VAL A N    7  
ATOM 10047 C CA   . VAL A 1 76  ? 5.991   14.776  3.286   1.00 0.00 ? 76  VAL A CA   7  
ATOM 10048 C C    . VAL A 1 76  ? 6.318   15.779  2.177   1.00 0.00 ? 76  VAL A C    7  
ATOM 10049 O O    . VAL A 1 76  ? 5.661   15.798  1.138   1.00 0.00 ? 76  VAL A O    7  
ATOM 10050 C CB   . VAL A 1 76  ? 5.584   15.449  4.599   1.00 0.00 ? 76  VAL A CB   7  
ATOM 10051 C CG1  . VAL A 1 76  ? 4.416   16.413  4.382   1.00 0.00 ? 76  VAL A CG1  7  
ATOM 10052 C CG2  . VAL A 1 76  ? 5.244   14.406  5.666   1.00 0.00 ? 76  VAL A CG2  7  
ATOM 10053 H H    . VAL A 1 76  ? 7.482   13.896  4.444   1.00 0.00 ? 76  VAL A H    7  
ATOM 10054 H HA   . VAL A 1 76  ? 5.162   14.148  2.957   1.00 0.00 ? 76  VAL A HA   7  
ATOM 10055 H HB   . VAL A 1 76  ? 6.435   16.028  4.956   1.00 0.00 ? 76  VAL A HB   7  
ATOM 10056 H HG11 . VAL A 1 76  ? 4.397   17.148  5.187   1.00 0.00 ? 76  VAL A HG11 7  
ATOM 10057 H HG12 . VAL A 1 76  ? 4.538   16.923  3.427   1.00 0.00 ? 76  VAL A HG12 7  
ATOM 10058 H HG13 . VAL A 1 76  ? 3.480   15.854  4.379   1.00 0.00 ? 76  VAL A HG13 7  
ATOM 10059 H HG21 . VAL A 1 76  ? 4.163   14.281  5.720   1.00 0.00 ? 76  VAL A HG21 7  
ATOM 10060 H HG22 . VAL A 1 76  ? 5.707   13.455  5.405   1.00 0.00 ? 76  VAL A HG22 7  
ATOM 10061 H HG23 . VAL A 1 76  ? 5.620   14.740  6.633   1.00 0.00 ? 76  VAL A HG23 7  
ATOM 10062 N N    . LYS A 1 77  ? 7.335   16.588  2.437   1.00 0.00 ? 77  LYS A N    7  
ATOM 10063 C CA   . LYS A 1 77  ? 7.758   17.591  1.474   1.00 0.00 ? 77  LYS A CA   7  
ATOM 10064 C C    . LYS A 1 77  ? 8.068   16.911  0.139   1.00 0.00 ? 77  LYS A C    7  
ATOM 10065 O O    . LYS A 1 77  ? 8.052   17.555  -0.908  1.00 0.00 ? 77  LYS A O    7  
ATOM 10066 C CB   . LYS A 1 77  ? 8.922   18.412  2.032   1.00 0.00 ? 77  LYS A CB   7  
ATOM 10067 C CG   . LYS A 1 77  ? 8.413   19.621  2.819   1.00 0.00 ? 77  LYS A CG   7  
ATOM 10068 C CD   . LYS A 1 77  ? 9.166   19.770  4.143   1.00 0.00 ? 77  LYS A CD   7  
ATOM 10069 C CE   . LYS A 1 77  ? 9.765   21.171  4.278   1.00 0.00 ? 77  LYS A CE   7  
ATOM 10070 N NZ   . LYS A 1 77  ? 11.239  21.119  4.152   1.00 0.00 ? 77  LYS A NZ   7  
ATOM 10071 H H    . LYS A 1 77  ? 7.865   16.566  3.285   1.00 0.00 ? 77  LYS A H    7  
ATOM 10072 H HA   . LYS A 1 77  ? 6.922   18.275  1.327   1.00 0.00 ? 77  LYS A HA   7  
ATOM 10073 H HB2  . LYS A 1 77  ? 9.537   17.785  2.678   1.00 0.00 ? 77  LYS A HB2  7  
ATOM 10074 H HB3  . LYS A 1 77  ? 9.559   18.748  1.214   1.00 0.00 ? 77  LYS A HB3  7  
ATOM 10075 H HG2  . LYS A 1 77  ? 8.536   20.525  2.223   1.00 0.00 ? 77  LYS A HG2  7  
ATOM 10076 H HG3  . LYS A 1 77  ? 7.346   19.510  3.014   1.00 0.00 ? 77  LYS A HG3  7  
ATOM 10077 H HD2  . LYS A 1 77  ? 8.488   19.578  4.975   1.00 0.00 ? 77  LYS A HD2  7  
ATOM 10078 H HD3  . LYS A 1 77  ? 9.959   19.024  4.200   1.00 0.00 ? 77  LYS A HD3  7  
ATOM 10079 H HE2  . LYS A 1 77  ? 9.352   21.825  3.511   1.00 0.00 ? 77  LYS A HE2  7  
ATOM 10080 H HE3  . LYS A 1 77  ? 9.492   21.598  5.243   1.00 0.00 ? 77  LYS A HE3  7  
ATOM 10081 H HZ1  . LYS A 1 77  ? 11.543  21.815  3.501   1.00 0.00 ? 77  LYS A HZ1  7  
ATOM 10082 H HZ2  . LYS A 1 77  ? 11.656  21.293  5.044   1.00 0.00 ? 77  LYS A HZ2  7  
ATOM 10083 H HZ3  . LYS A 1 77  ? 11.514  20.215  3.826   1.00 0.00 ? 77  LYS A HZ3  7  
ATOM 10084 N N    . ALA A 1 78  ? 8.344   15.617  0.220   1.00 0.00 ? 78  ALA A N    7  
ATOM 10085 C CA   . ALA A 1 78  ? 8.658   14.843  -0.968  1.00 0.00 ? 78  ALA A CA   7  
ATOM 10086 C C    . ALA A 1 78  ? 7.358   14.372  -1.623  1.00 0.00 ? 78  ALA A C    7  
ATOM 10087 O O    . ALA A 1 78  ? 7.294   14.215  -2.841  1.00 0.00 ? 78  ALA A O    7  
ATOM 10088 C CB   . ALA A 1 78  ? 9.577   13.679  -0.592  1.00 0.00 ? 78  ALA A CB   7  
ATOM 10089 H H    . ALA A 1 78  ? 8.356   15.101  1.076   1.00 0.00 ? 78  ALA A H    7  
ATOM 10090 H HA   . ALA A 1 78  ? 9.188   15.498  -1.661  1.00 0.00 ? 78  ALA A HA   7  
ATOM 10091 H HB1  . ALA A 1 78  ? 9.122   13.104  0.216   1.00 0.00 ? 78  ALA A HB1  7  
ATOM 10092 H HB2  . ALA A 1 78  ? 9.721   13.035  -1.459  1.00 0.00 ? 78  ALA A HB2  7  
ATOM 10093 H HB3  . ALA A 1 78  ? 10.540  14.068  -0.263  1.00 0.00 ? 78  ALA A HB3  7  
ATOM 10094 N N    . LEU A 1 79  ? 6.354   14.160  -0.785  1.00 0.00 ? 79  LEU A N    7  
ATOM 10095 C CA   . LEU A 1 79  ? 5.059   13.710  -1.267  1.00 0.00 ? 79  LEU A CA   7  
ATOM 10096 C C    . LEU A 1 79  ? 4.408   14.827  -2.085  1.00 0.00 ? 79  LEU A C    7  
ATOM 10097 O O    . LEU A 1 79  ? 4.026   14.617  -3.235  1.00 0.00 ? 79  LEU A O    7  
ATOM 10098 C CB   . LEU A 1 79  ? 4.196   13.217  -0.104  1.00 0.00 ? 79  LEU A CB   7  
ATOM 10099 C CG   . LEU A 1 79  ? 4.374   11.748  0.288   1.00 0.00 ? 79  LEU A CG   7  
ATOM 10100 C CD1  . LEU A 1 79  ? 4.100   11.541  1.779   1.00 0.00 ? 79  LEU A CD1  7  
ATOM 10101 C CD2  . LEU A 1 79  ? 3.508   10.839  -0.586  1.00 0.00 ? 79  LEU A CD2  7  
ATOM 10102 H H    . LEU A 1 79  ? 6.415   14.290  0.205   1.00 0.00 ? 79  LEU A H    7  
ATOM 10103 H HA   . LEU A 1 79  ? 5.233   12.857  -1.923  1.00 0.00 ? 79  LEU A HA   7  
ATOM 10104 H HB2  . LEU A 1 79  ? 4.411   13.833  0.769   1.00 0.00 ? 79  LEU A HB2  7  
ATOM 10105 H HB3  . LEU A 1 79  ? 3.150   13.380  -0.359  1.00 0.00 ? 79  LEU A HB3  7  
ATOM 10106 H HG   . LEU A 1 79  ? 5.413   11.471  0.110   1.00 0.00 ? 79  LEU A HG   7  
ATOM 10107 H HD11 . LEU A 1 79  ? 3.540   12.392  2.167   1.00 0.00 ? 79  LEU A HD11 7  
ATOM 10108 H HD12 . LEU A 1 79  ? 3.519   10.630  1.918   1.00 0.00 ? 79  LEU A HD12 7  
ATOM 10109 H HD13 . LEU A 1 79  ? 5.046   11.455  2.313   1.00 0.00 ? 79  LEU A HD13 7  
ATOM 10110 H HD21 . LEU A 1 79  ? 4.081   9.958   -0.874  1.00 0.00 ? 79  LEU A HD21 7  
ATOM 10111 H HD22 . LEU A 1 79  ? 2.624   10.532  -0.026  1.00 0.00 ? 79  LEU A HD22 7  
ATOM 10112 H HD23 . LEU A 1 79  ? 3.200   11.381  -1.481  1.00 0.00 ? 79  LEU A HD23 7  
ATOM 10113 N N    . LYS A 1 80  ? 4.302   15.990  -1.460  1.00 0.00 ? 80  LYS A N    7  
ATOM 10114 C CA   . LYS A 1 80  ? 3.704   17.140  -2.116  1.00 0.00 ? 80  LYS A CA   7  
ATOM 10115 C C    . LYS A 1 80  ? 4.703   17.731  -3.113  1.00 0.00 ? 80  LYS A C    7  
ATOM 10116 O O    . LYS A 1 80  ? 5.894   17.426  -3.058  1.00 0.00 ? 80  LYS A O    7  
ATOM 10117 C CB   . LYS A 1 80  ? 3.202   18.147  -1.079  1.00 0.00 ? 80  LYS A CB   7  
ATOM 10118 C CG   . LYS A 1 80  ? 1.784   17.801  -0.620  1.00 0.00 ? 80  LYS A CG   7  
ATOM 10119 C CD   . LYS A 1 80  ? 1.721   17.650  0.901   1.00 0.00 ? 80  LYS A CD   7  
ATOM 10120 C CE   . LYS A 1 80  ? 0.418   16.974  1.331   1.00 0.00 ? 80  LYS A CE   7  
ATOM 10121 N NZ   . LYS A 1 80  ? -0.044  17.517  2.628   1.00 0.00 ? 80  LYS A NZ   7  
ATOM 10122 H H    . LYS A 1 80  ? 4.616   16.153  -0.524  1.00 0.00 ? 80  LYS A H    7  
ATOM 10123 H HA   . LYS A 1 80  ? 2.834   16.786  -2.668  1.00 0.00 ? 80  LYS A HA   7  
ATOM 10124 H HB2  . LYS A 1 80  ? 3.873   18.157  -0.220  1.00 0.00 ? 80  LYS A HB2  7  
ATOM 10125 H HB3  . LYS A 1 80  ? 3.216   19.151  -1.505  1.00 0.00 ? 80  LYS A HB3  7  
ATOM 10126 H HG2  . LYS A 1 80  ? 1.094   18.582  -0.940  1.00 0.00 ? 80  LYS A HG2  7  
ATOM 10127 H HG3  . LYS A 1 80  ? 1.460   16.875  -1.095  1.00 0.00 ? 80  LYS A HG3  7  
ATOM 10128 H HD2  . LYS A 1 80  ? 2.571   17.062  1.247   1.00 0.00 ? 80  LYS A HD2  7  
ATOM 10129 H HD3  . LYS A 1 80  ? 1.799   18.630  1.371   1.00 0.00 ? 80  LYS A HD3  7  
ATOM 10130 H HE2  . LYS A 1 80  ? -0.348  17.131  0.571   1.00 0.00 ? 80  LYS A HE2  7  
ATOM 10131 H HE3  . LYS A 1 80  ? 0.569   15.898  1.414   1.00 0.00 ? 80  LYS A HE3  7  
ATOM 10132 H HZ1  . LYS A 1 80  ? 0.449   18.364  2.829   1.00 0.00 ? 80  LYS A HZ1  7  
ATOM 10133 H HZ2  . LYS A 1 80  ? -1.025  17.706  2.581   1.00 0.00 ? 80  LYS A HZ2  7  
ATOM 10134 H HZ3  . LYS A 1 80  ? 0.132   16.849  3.351   1.00 0.00 ? 80  LYS A HZ3  7  
ATOM 10135 N N    . GLY A 1 81  ? 4.183   18.565  -4.000  1.00 0.00 ? 81  GLY A N    7  
ATOM 10136 C CA   . GLY A 1 81  ? 5.015   19.201  -5.007  1.00 0.00 ? 81  GLY A CA   7  
ATOM 10137 C C    . GLY A 1 81  ? 5.127   18.326  -6.258  1.00 0.00 ? 81  GLY A C    7  
ATOM 10138 O O    . GLY A 1 81  ? 5.132   17.100  -6.163  1.00 0.00 ? 81  GLY A O    7  
ATOM 10139 H H    . GLY A 1 81  ? 3.213   18.808  -4.038  1.00 0.00 ? 81  GLY A H    7  
ATOM 10140 H HA2  . GLY A 1 81  ? 4.593   20.170  -5.274  1.00 0.00 ? 81  GLY A HA2  7  
ATOM 10141 H HA3  . GLY A 1 81  ? 6.008   19.388  -4.599  1.00 0.00 ? 81  GLY A HA3  7  
ATOM 10142 N N    . SER A 1 82  ? 5.214   18.991  -7.400  1.00 0.00 ? 82  SER A N    7  
ATOM 10143 C CA   . SER A 1 82  ? 5.326   18.289  -8.668  1.00 0.00 ? 82  SER A CA   7  
ATOM 10144 C C    . SER A 1 82  ? 4.054   17.481  -8.932  1.00 0.00 ? 82  SER A C    7  
ATOM 10145 O O    . SER A 1 82  ? 3.752   16.537  -8.204  1.00 0.00 ? 82  SER A O    7  
ATOM 10146 C CB   . SER A 1 82  ? 6.551   17.373  -8.683  1.00 0.00 ? 82  SER A CB   7  
ATOM 10147 O OG   . SER A 1 82  ? 7.268   17.461  -9.911  1.00 0.00 ? 82  SER A OG   7  
ATOM 10148 H H    . SER A 1 82  ? 5.209   19.989  -7.469  1.00 0.00 ? 82  SER A H    7  
ATOM 10149 H HA   . SER A 1 82  ? 5.447   19.069  -9.420  1.00 0.00 ? 82  SER A HA   7  
ATOM 10150 H HB2  . SER A 1 82  ? 7.212   17.636  -7.857  1.00 0.00 ? 82  SER A HB2  7  
ATOM 10151 H HB3  . SER A 1 82  ? 6.234   16.342  -8.522  1.00 0.00 ? 82  SER A HB3  7  
ATOM 10152 H HG   . SER A 1 82  ? 8.155   17.007  -9.823  1.00 0.00 ? 82  SER A HG   7  
ATOM 10153 N N    . LYS A 1 83  ? 3.344   17.881  -9.976  1.00 0.00 ? 83  LYS A N    7  
ATOM 10154 C CA   . LYS A 1 83  ? 2.112   17.206  -10.346 1.00 0.00 ? 83  LYS A CA   7  
ATOM 10155 C C    . LYS A 1 83  ? 2.392   15.715  -10.545 1.00 0.00 ? 83  LYS A C    7  
ATOM 10156 O O    . LYS A 1 83  ? 3.505   15.251  -10.301 1.00 0.00 ? 83  LYS A O    7  
ATOM 10157 C CB   . LYS A 1 83  ? 1.476   17.880  -11.564 1.00 0.00 ? 83  LYS A CB   7  
ATOM 10158 C CG   . LYS A 1 83  ? 2.389   17.776  -12.787 1.00 0.00 ? 83  LYS A CG   7  
ATOM 10159 C CD   . LYS A 1 83  ? 2.305   19.042  -13.643 1.00 0.00 ? 83  LYS A CD   7  
ATOM 10160 C CE   . LYS A 1 83  ? 3.675   19.408  -14.216 1.00 0.00 ? 83  LYS A CE   7  
ATOM 10161 N NZ   . LYS A 1 83  ? 3.703   20.830  -14.625 1.00 0.00 ? 83  LYS A NZ   7  
ATOM 10162 H H    . LYS A 1 83  ? 3.597   18.650  -10.563 1.00 0.00 ? 83  LYS A H    7  
ATOM 10163 H HA   . LYS A 1 83  ? 1.415   17.319  -9.515  1.00 0.00 ? 83  LYS A HA   7  
ATOM 10164 H HB2  . LYS A 1 83  ? 0.515   17.413  -11.783 1.00 0.00 ? 83  LYS A HB2  7  
ATOM 10165 H HB3  . LYS A 1 83  ? 1.277   18.928  -11.341 1.00 0.00 ? 83  LYS A HB3  7  
ATOM 10166 H HG2  . LYS A 1 83  ? 3.419   17.619  -12.464 1.00 0.00 ? 83  LYS A HG2  7  
ATOM 10167 H HG3  . LYS A 1 83  ? 2.107   16.910  -13.384 1.00 0.00 ? 83  LYS A HG3  7  
ATOM 10168 H HD2  . LYS A 1 83  ? 1.596   18.889  -14.456 1.00 0.00 ? 83  LYS A HD2  7  
ATOM 10169 H HD3  . LYS A 1 83  ? 1.927   19.868  -13.040 1.00 0.00 ? 83  LYS A HD3  7  
ATOM 10170 H HE2  . LYS A 1 83  ? 4.449   19.222  -13.472 1.00 0.00 ? 83  LYS A HE2  7  
ATOM 10171 H HE3  . LYS A 1 83  ? 3.899   18.773  -15.073 1.00 0.00 ? 83  LYS A HE3  7  
ATOM 10172 H HZ1  . LYS A 1 83  ? 4.619   21.066  -14.951 1.00 0.00 ? 83  LYS A HZ1  7  
ATOM 10173 H HZ2  . LYS A 1 83  ? 3.039   20.979  -15.358 1.00 0.00 ? 83  LYS A HZ2  7  
ATOM 10174 H HZ3  . LYS A 1 83  ? 3.470   21.407  -13.842 1.00 0.00 ? 83  LYS A HZ3  7  
ATOM 10175 N N    . LYS A 1 84  ? 1.363   15.005  -10.985 1.00 0.00 ? 84  LYS A N    7  
ATOM 10176 C CA   . LYS A 1 84  ? 1.485   13.577  -11.219 1.00 0.00 ? 84  LYS A CA   7  
ATOM 10177 C C    . LYS A 1 84  ? 2.309   12.948  -10.093 1.00 0.00 ? 84  LYS A C    7  
ATOM 10178 O O    . LYS A 1 84  ? 3.518   12.770  -10.229 1.00 0.00 ? 84  LYS A O    7  
ATOM 10179 C CB   . LYS A 1 84  ? 2.049   13.309  -12.616 1.00 0.00 ? 84  LYS A CB   7  
ATOM 10180 C CG   . LYS A 1 84  ? 1.491   12.005  -13.192 1.00 0.00 ? 84  LYS A CG   7  
ATOM 10181 C CD   . LYS A 1 84  ? 2.155   11.667  -14.528 1.00 0.00 ? 84  LYS A CD   7  
ATOM 10182 C CE   . LYS A 1 84  ? 2.084   10.166  -14.812 1.00 0.00 ? 84  LYS A CE   7  
ATOM 10183 N NZ   . LYS A 1 84  ? 3.122   9.773   -15.790 1.00 0.00 ? 84  LYS A NZ   7  
ATOM 10184 H H    . LYS A 1 84  ? 0.461   15.390  -11.181 1.00 0.00 ? 84  LYS A H    7  
ATOM 10185 H HA   . LYS A 1 84  ? 0.481   13.154  -11.190 1.00 0.00 ? 84  LYS A HA   7  
ATOM 10186 H HB2  . LYS A 1 84  ? 1.800   14.138  -13.278 1.00 0.00 ? 84  LYS A HB2  7  
ATOM 10187 H HB3  . LYS A 1 84  ? 3.136   13.254  -12.570 1.00 0.00 ? 84  LYS A HB3  7  
ATOM 10188 H HG2  . LYS A 1 84  ? 1.654   11.192  -12.485 1.00 0.00 ? 84  LYS A HG2  7  
ATOM 10189 H HG3  . LYS A 1 84  ? 0.414   12.096  -13.330 1.00 0.00 ? 84  LYS A HG3  7  
ATOM 10190 H HD2  . LYS A 1 84  ? 1.664   12.217  -15.331 1.00 0.00 ? 84  LYS A HD2  7  
ATOM 10191 H HD3  . LYS A 1 84  ? 3.197   11.989  -14.512 1.00 0.00 ? 84  LYS A HD3  7  
ATOM 10192 H HE2  . LYS A 1 84  ? 2.219   9.608   -13.885 1.00 0.00 ? 84  LYS A HE2  7  
ATOM 10193 H HE3  . LYS A 1 84  ? 1.097   9.909   -15.197 1.00 0.00 ? 84  LYS A HE3  7  
ATOM 10194 H HZ1  . LYS A 1 84  ? 2.807   9.985   -16.715 1.00 0.00 ? 84  LYS A HZ1  7  
ATOM 10195 H HZ2  . LYS A 1 84  ? 3.966   10.276  -15.601 1.00 0.00 ? 84  LYS A HZ2  7  
ATOM 10196 H HZ3  . LYS A 1 84  ? 3.297   8.791   -15.714 1.00 0.00 ? 84  LYS A HZ3  7  
ATOM 10197 N N    . LEU A 1 85  ? 1.621   12.630  -9.007  1.00 0.00 ? 85  LEU A N    7  
ATOM 10198 C CA   . LEU A 1 85  ? 2.273   12.025  -7.858  1.00 0.00 ? 85  LEU A CA   7  
ATOM 10199 C C    . LEU A 1 85  ? 2.181   10.502  -7.968  1.00 0.00 ? 85  LEU A C    7  
ATOM 10200 O O    . LEU A 1 85  ? 1.118   9.924   -7.747  1.00 0.00 ? 85  LEU A O    7  
ATOM 10201 C CB   . LEU A 1 85  ? 1.694   12.585  -6.557  1.00 0.00 ? 85  LEU A CB   7  
ATOM 10202 C CG   . LEU A 1 85  ? 2.182   11.922  -5.267  1.00 0.00 ? 85  LEU A CG   7  
ATOM 10203 C CD1  . LEU A 1 85  ? 3.644   11.489  -5.391  1.00 0.00 ? 85  LEU A CD1  7  
ATOM 10204 C CD2  . LEU A 1 85  ? 1.956   12.837  -4.061  1.00 0.00 ? 85  LEU A CD2  7  
ATOM 10205 H H    . LEU A 1 85  ? 0.637   12.779  -8.904  1.00 0.00 ? 85  LEU A H    7  
ATOM 10206 H HA   . LEU A 1 85  ? 3.325   12.311  -7.892  1.00 0.00 ? 85  LEU A HA   7  
ATOM 10207 H HB2  . LEU A 1 85  ? 1.927   13.648  -6.506  1.00 0.00 ? 85  LEU A HB2  7  
ATOM 10208 H HB3  . LEU A 1 85  ? 0.609   12.498  -6.599  1.00 0.00 ? 85  LEU A HB3  7  
ATOM 10209 H HG   . LEU A 1 85  ? 1.592   11.021  -5.101  1.00 0.00 ? 85  LEU A HG   7  
ATOM 10210 H HD11 . LEU A 1 85  ? 3.713   10.631  -6.060  1.00 0.00 ? 85  LEU A HD11 7  
ATOM 10211 H HD12 . LEU A 1 85  ? 4.234   12.312  -5.794  1.00 0.00 ? 85  LEU A HD12 7  
ATOM 10212 H HD13 . LEU A 1 85  ? 4.026   11.215  -4.408  1.00 0.00 ? 85  LEU A HD13 7  
ATOM 10213 H HD21 . LEU A 1 85  ? 2.540   12.475  -3.216  1.00 0.00 ? 85  LEU A HD21 7  
ATOM 10214 H HD22 . LEU A 1 85  ? 2.268   13.851  -4.312  1.00 0.00 ? 85  LEU A HD22 7  
ATOM 10215 H HD23 . LEU A 1 85  ? 0.898   12.837  -3.798  1.00 0.00 ? 85  LEU A HD23 7  
ATOM 10216 N N    . VAL A 1 86  ? 3.308   9.896   -8.309  1.00 0.00 ? 86  VAL A N    7  
ATOM 10217 C CA   . VAL A 1 86  ? 3.368   8.451   -8.450  1.00 0.00 ? 86  VAL A CA   7  
ATOM 10218 C C    . VAL A 1 86  ? 3.897   7.837   -7.153  1.00 0.00 ? 86  VAL A C    7  
ATOM 10219 O O    . VAL A 1 86  ? 5.076   7.977   -6.831  1.00 0.00 ? 86  VAL A O    7  
ATOM 10220 C CB   . VAL A 1 86  ? 4.208   8.079   -9.674  1.00 0.00 ? 86  VAL A CB   7  
ATOM 10221 C CG1  . VAL A 1 86  ? 4.512   6.580   -9.695  1.00 0.00 ? 86  VAL A CG1  7  
ATOM 10222 C CG2  . VAL A 1 86  ? 3.517   8.517   -10.967 1.00 0.00 ? 86  VAL A CG2  7  
ATOM 10223 H H    . VAL A 1 86  ? 4.169   10.373  -8.487  1.00 0.00 ? 86  VAL A H    7  
ATOM 10224 H HA   . VAL A 1 86  ? 2.351   8.095   -8.618  1.00 0.00 ? 86  VAL A HA   7  
ATOM 10225 H HB   . VAL A 1 86  ? 5.156   8.612   -9.604  1.00 0.00 ? 86  VAL A HB   7  
ATOM 10226 H HG11 . VAL A 1 86  ? 4.092   6.137   -10.599 1.00 0.00 ? 86  VAL A HG11 7  
ATOM 10227 H HG12 . VAL A 1 86  ? 5.591   6.427   -9.683  1.00 0.00 ? 86  VAL A HG12 7  
ATOM 10228 H HG13 . VAL A 1 86  ? 4.068   6.106   -8.819  1.00 0.00 ? 86  VAL A HG13 7  
ATOM 10229 H HG21 . VAL A 1 86  ? 2.439   8.545   -10.811 1.00 0.00 ? 86  VAL A HG21 7  
ATOM 10230 H HG22 . VAL A 1 86  ? 3.869   9.510   -11.248 1.00 0.00 ? 86  VAL A HG22 7  
ATOM 10231 H HG23 . VAL A 1 86  ? 3.752   7.810   -11.762 1.00 0.00 ? 86  VAL A HG23 7  
ATOM 10232 N N    . LEU A 1 87  ? 3.000   7.169   -6.442  1.00 0.00 ? 87  LEU A N    7  
ATOM 10233 C CA   . LEU A 1 87  ? 3.362   6.533   -5.187  1.00 0.00 ? 87  LEU A CA   7  
ATOM 10234 C C    . LEU A 1 87  ? 3.953   5.151   -5.472  1.00 0.00 ? 87  LEU A C    7  
ATOM 10235 O O    . LEU A 1 87  ? 3.296   4.303   -6.073  1.00 0.00 ? 87  LEU A O    7  
ATOM 10236 C CB   . LEU A 1 87  ? 2.164   6.505   -4.236  1.00 0.00 ? 87  LEU A CB   7  
ATOM 10237 C CG   . LEU A 1 87  ? 1.402   7.823   -4.077  1.00 0.00 ? 87  LEU A CG   7  
ATOM 10238 C CD1  . LEU A 1 87  ? 2.368   8.999   -3.919  1.00 0.00 ? 87  LEU A CD1  7  
ATOM 10239 C CD2  . LEU A 1 87  ? 0.426   8.035   -5.236  1.00 0.00 ? 87  LEU A CD2  7  
ATOM 10240 H H    . LEU A 1 87  ? 2.043   7.060   -6.711  1.00 0.00 ? 87  LEU A H    7  
ATOM 10241 H HA   . LEU A 1 87  ? 4.131   7.148   -4.719  1.00 0.00 ? 87  LEU A HA   7  
ATOM 10242 H HB2  . LEU A 1 87  ? 1.466   5.745   -4.585  1.00 0.00 ? 87  LEU A HB2  7  
ATOM 10243 H HB3  . LEU A 1 87  ? 2.513   6.190   -3.252  1.00 0.00 ? 87  LEU A HB3  7  
ATOM 10244 H HG   . LEU A 1 87  ? 0.810   7.768   -3.164  1.00 0.00 ? 87  LEU A HG   7  
ATOM 10245 H HD11 . LEU A 1 87  ? 1.874   9.804   -3.376  1.00 0.00 ? 87  LEU A HD11 7  
ATOM 10246 H HD12 . LEU A 1 87  ? 3.249   8.674   -3.366  1.00 0.00 ? 87  LEU A HD12 7  
ATOM 10247 H HD13 . LEU A 1 87  ? 2.669   9.357   -4.904  1.00 0.00 ? 87  LEU A HD13 7  
ATOM 10248 H HD21 . LEU A 1 87  ? -0.404  8.658   -4.903  1.00 0.00 ? 87  LEU A HD21 7  
ATOM 10249 H HD22 . LEU A 1 87  ? 0.942   8.526   -6.061  1.00 0.00 ? 87  LEU A HD22 7  
ATOM 10250 H HD23 . LEU A 1 87  ? 0.044   7.070   -5.570  1.00 0.00 ? 87  LEU A HD23 7  
ATOM 10251 N N    . SER A 1 88  ? 5.188   4.968   -5.028  1.00 0.00 ? 88  SER A N    7  
ATOM 10252 C CA   . SER A 1 88  ? 5.875   3.703   -5.228  1.00 0.00 ? 88  SER A CA   7  
ATOM 10253 C C    . SER A 1 88  ? 5.759   2.840   -3.970  1.00 0.00 ? 88  SER A C    7  
ATOM 10254 O O    . SER A 1 88  ? 6.407   3.117   -2.961  1.00 0.00 ? 88  SER A O    7  
ATOM 10255 C CB   . SER A 1 88  ? 7.346   3.926   -5.586  1.00 0.00 ? 88  SER A CB   7  
ATOM 10256 O OG   . SER A 1 88  ? 7.541   4.040   -6.992  1.00 0.00 ? 88  SER A OG   7  
ATOM 10257 H H    . SER A 1 88  ? 5.715   5.663   -4.540  1.00 0.00 ? 88  SER A H    7  
ATOM 10258 H HA   . SER A 1 88  ? 5.366   3.228   -6.066  1.00 0.00 ? 88  SER A HA   7  
ATOM 10259 H HB2  . SER A 1 88  ? 7.705   4.831   -5.095  1.00 0.00 ? 88  SER A HB2  7  
ATOM 10260 H HB3  . SER A 1 88  ? 7.941   3.098   -5.202  1.00 0.00 ? 88  SER A HB3  7  
ATOM 10261 H HG   . SER A 1 88  ? 6.745   4.473   -7.415  1.00 0.00 ? 88  SER A HG   7  
ATOM 10262 N N    . VAL A 1 89  ? 4.930   1.812   -4.070  1.00 0.00 ? 89  VAL A N    7  
ATOM 10263 C CA   . VAL A 1 89  ? 4.722   0.907   -2.952  1.00 0.00 ? 89  VAL A CA   7  
ATOM 10264 C C    . VAL A 1 89  ? 5.095   -0.515  -3.377  1.00 0.00 ? 89  VAL A C    7  
ATOM 10265 O O    . VAL A 1 89  ? 4.843   -0.914  -4.513  1.00 0.00 ? 89  VAL A O    7  
ATOM 10266 C CB   . VAL A 1 89  ? 3.282   1.021   -2.448  1.00 0.00 ? 89  VAL A CB   7  
ATOM 10267 C CG1  . VAL A 1 89  ? 3.194   1.972   -1.252  1.00 0.00 ? 89  VAL A CG1  7  
ATOM 10268 C CG2  . VAL A 1 89  ? 2.341   1.464   -3.570  1.00 0.00 ? 89  VAL A CG2  7  
ATOM 10269 H H    . VAL A 1 89  ? 4.407   1.594   -4.894  1.00 0.00 ? 89  VAL A H    7  
ATOM 10270 H HA   . VAL A 1 89  ? 5.387   1.219   -2.148  1.00 0.00 ? 89  VAL A HA   7  
ATOM 10271 H HB   . VAL A 1 89  ? 2.964   0.033   -2.115  1.00 0.00 ? 89  VAL A HB   7  
ATOM 10272 H HG11 . VAL A 1 89  ? 4.089   1.867   -0.638  1.00 0.00 ? 89  VAL A HG11 7  
ATOM 10273 H HG12 . VAL A 1 89  ? 3.116   2.999   -1.609  1.00 0.00 ? 89  VAL A HG12 7  
ATOM 10274 H HG13 . VAL A 1 89  ? 2.314   1.727   -0.657  1.00 0.00 ? 89  VAL A HG13 7  
ATOM 10275 H HG21 . VAL A 1 89  ? 2.419   2.542   -3.705  1.00 0.00 ? 89  VAL A HG21 7  
ATOM 10276 H HG22 . VAL A 1 89  ? 2.619   0.961   -4.497  1.00 0.00 ? 89  VAL A HG22 7  
ATOM 10277 H HG23 . VAL A 1 89  ? 1.316   1.203   -3.309  1.00 0.00 ? 89  VAL A HG23 7  
ATOM 10278 N N    . TYR A 1 90  ? 5.691   -1.240  -2.441  1.00 0.00 ? 90  TYR A N    7  
ATOM 10279 C CA   . TYR A 1 90  ? 6.101   -2.609  -2.704  1.00 0.00 ? 90  TYR A CA   7  
ATOM 10280 C C    . TYR A 1 90  ? 5.012   -3.598  -2.286  1.00 0.00 ? 90  TYR A C    7  
ATOM 10281 O O    . TYR A 1 90  ? 4.591   -3.612  -1.130  1.00 0.00 ? 90  TYR A O    7  
ATOM 10282 C CB   . TYR A 1 90  ? 7.346   -2.847  -1.847  1.00 0.00 ? 90  TYR A CB   7  
ATOM 10283 C CG   . TYR A 1 90  ? 7.557   -4.310  -1.449  1.00 0.00 ? 90  TYR A CG   7  
ATOM 10284 C CD1  . TYR A 1 90  ? 7.837   -5.254  -2.416  1.00 0.00 ? 90  TYR A CD1  7  
ATOM 10285 C CD2  . TYR A 1 90  ? 7.468   -4.684  -0.124  1.00 0.00 ? 90  TYR A CD2  7  
ATOM 10286 C CE1  . TYR A 1 90  ? 8.035   -6.631  -2.041  1.00 0.00 ? 90  TYR A CE1  7  
ATOM 10287 C CE2  . TYR A 1 90  ? 7.666   -6.060  0.250   1.00 0.00 ? 90  TYR A CE2  7  
ATOM 10288 C CZ   . TYR A 1 90  ? 7.940   -6.965  -0.727  1.00 0.00 ? 90  TYR A CZ   7  
ATOM 10289 O OH   . TYR A 1 90  ? 8.127   -8.265  -0.373  1.00 0.00 ? 90  TYR A OH   7  
ATOM 10290 H H    . TYR A 1 90  ? 5.892   -0.908  -1.520  1.00 0.00 ? 90  TYR A H    7  
ATOM 10291 H HA   . TYR A 1 90  ? 6.279   -2.707  -3.775  1.00 0.00 ? 90  TYR A HA   7  
ATOM 10292 H HB2  . TYR A 1 90  ? 8.223   -2.500  -2.394  1.00 0.00 ? 90  TYR A HB2  7  
ATOM 10293 H HB3  . TYR A 1 90  ? 7.274   -2.242  -0.943  1.00 0.00 ? 90  TYR A HB3  7  
ATOM 10294 H HD1  . TYR A 1 90  ? 7.907   -4.959  -3.463  1.00 0.00 ? 90  TYR A HD1  7  
ATOM 10295 H HD2  . TYR A 1 90  ? 7.247   -3.938  0.639   1.00 0.00 ? 90  TYR A HD2  7  
ATOM 10296 H HE1  . TYR A 1 90  ? 8.256   -7.387  -2.795  1.00 0.00 ? 90  TYR A HE1  7  
ATOM 10297 H HE2  . TYR A 1 90  ? 7.598   -6.369  1.293   1.00 0.00 ? 90  TYR A HE2  7  
ATOM 10298 H HH   . TYR A 1 90  ? 7.890   -8.395  0.590   1.00 0.00 ? 90  TYR A HH   7  
ATOM 10299 N N    . SER A 1 91  ? 4.586   -4.402  -3.249  1.00 0.00 ? 91  SER A N    7  
ATOM 10300 C CA   . SER A 1 91  ? 3.554   -5.393  -2.995  1.00 0.00 ? 91  SER A CA   7  
ATOM 10301 C C    . SER A 1 91  ? 4.185   -6.777  -2.836  1.00 0.00 ? 91  SER A C    7  
ATOM 10302 O O    . SER A 1 91  ? 5.206   -7.073  -3.454  1.00 0.00 ? 91  SER A O    7  
ATOM 10303 C CB   . SER A 1 91  ? 2.517   -5.408  -4.120  1.00 0.00 ? 91  SER A CB   7  
ATOM 10304 O OG   . SER A 1 91  ? 1.957   -6.704  -4.313  1.00 0.00 ? 91  SER A OG   7  
ATOM 10305 H H    . SER A 1 91  ? 4.934   -4.385  -4.187  1.00 0.00 ? 91  SER A H    7  
ATOM 10306 H HA   . SER A 1 91  ? 3.076   -5.081  -2.067  1.00 0.00 ? 91  SER A HA   7  
ATOM 10307 H HB2  . SER A 1 91  ? 1.721   -4.700  -3.889  1.00 0.00 ? 91  SER A HB2  7  
ATOM 10308 H HB3  . SER A 1 91  ? 2.982   -5.072  -5.047  1.00 0.00 ? 91  SER A HB3  7  
ATOM 10309 H HG   . SER A 1 91  ? 1.920   -6.919  -5.289  1.00 0.00 ? 91  SER A HG   7  
ATOM 10310 N N    . ALA A 1 92  ? 3.549   -7.590  -2.004  1.00 0.00 ? 92  ALA A N    7  
ATOM 10311 C CA   . ALA A 1 92  ? 4.036   -8.936  -1.756  1.00 0.00 ? 92  ALA A CA   7  
ATOM 10312 C C    . ALA A 1 92  ? 2.900   -9.935  -1.986  1.00 0.00 ? 92  ALA A C    7  
ATOM 10313 O O    . ALA A 1 92  ? 1.733   -9.549  -2.052  1.00 0.00 ? 92  ALA A O    7  
ATOM 10314 C CB   . ALA A 1 92  ? 4.607   -9.020  -0.339  1.00 0.00 ? 92  ALA A CB   7  
ATOM 10315 H H    . ALA A 1 92  ? 2.719   -7.342  -1.506  1.00 0.00 ? 92  ALA A H    7  
ATOM 10316 H HA   . ALA A 1 92  ? 4.835   -9.137  -2.469  1.00 0.00 ? 92  ALA A HA   7  
ATOM 10317 H HB1  . ALA A 1 92  ? 5.383   -8.264  -0.215  1.00 0.00 ? 92  ALA A HB1  7  
ATOM 10318 H HB2  . ALA A 1 92  ? 3.811   -8.845  0.385   1.00 0.00 ? 92  ALA A HB2  7  
ATOM 10319 H HB3  . ALA A 1 92  ? 5.035   -10.009 -0.177  1.00 0.00 ? 92  ALA A HB3  7  
ATOM 10320 N N    . GLY A 1 93  ? 3.280   -11.199 -2.101  1.00 0.00 ? 93  GLY A N    7  
ATOM 10321 C CA   . GLY A 1 93  ? 2.307   -12.255 -2.322  1.00 0.00 ? 93  GLY A CA   7  
ATOM 10322 C C    . GLY A 1 93  ? 1.271   -12.291 -1.198  1.00 0.00 ? 93  GLY A C    7  
ATOM 10323 O O    . GLY A 1 93  ? 1.552   -12.779 -0.104  1.00 0.00 ? 93  GLY A O    7  
ATOM 10324 H H    . GLY A 1 93  ? 4.230   -11.504 -2.046  1.00 0.00 ? 93  GLY A H    7  
ATOM 10325 H HA2  . GLY A 1 93  ? 1.807   -12.100 -3.278  1.00 0.00 ? 93  GLY A HA2  7  
ATOM 10326 H HA3  . GLY A 1 93  ? 2.817   -13.217 -2.382  1.00 0.00 ? 93  GLY A HA3  7  
ATOM 10327 N N    . ARG A 1 94  ? 0.093   -11.767 -1.505  1.00 0.00 ? 94  ARG A N    7  
ATOM 10328 C CA   . ARG A 1 94  ? -0.987  -11.732 -0.534  1.00 0.00 ? 94  ARG A CA   7  
ATOM 10329 C C    . ARG A 1 94  ? -1.166  -13.108 0.110   1.00 0.00 ? 94  ARG A C    7  
ATOM 10330 O O    . ARG A 1 94  ? -1.397  -14.097 -0.583  1.00 0.00 ? 94  ARG A O    7  
ATOM 10331 C CB   . ARG A 1 94  ? -2.303  -11.309 -1.189  1.00 0.00 ? 94  ARG A CB   7  
ATOM 10332 C CG   . ARG A 1 94  ? -2.672  -9.875  -0.801  1.00 0.00 ? 94  ARG A CG   7  
ATOM 10333 C CD   . ARG A 1 94  ? -2.513  -8.927  -1.991  1.00 0.00 ? 94  ARG A CD   7  
ATOM 10334 N NE   . ARG A 1 94  ? -2.199  -7.562  -1.513  1.00 0.00 ? 94  ARG A NE   7  
ATOM 10335 C CZ   . ARG A 1 94  ? -2.068  -6.497  -2.315  1.00 0.00 ? 94  ARG A CZ   7  
ATOM 10336 N NH1  . ARG A 1 94  ? -2.222  -6.632  -3.639  1.00 0.00 ? 94  ARG A NH1  7  
ATOM 10337 N NH2  . ARG A 1 94  ? -1.782  -5.296  -1.792  1.00 0.00 ? 94  ARG A NH2  7  
ATOM 10338 H H    . ARG A 1 94  ? -0.128  -11.372 -2.397  1.00 0.00 ? 94  ARG A H    7  
ATOM 10339 H HA   . ARG A 1 94  ? -0.676  -10.992 0.203   1.00 0.00 ? 94  ARG A HA   7  
ATOM 10340 H HB2  . ARG A 1 94  ? -2.215  -11.385 -2.273  1.00 0.00 ? 94  ARG A HB2  7  
ATOM 10341 H HB3  . ARG A 1 94  ? -3.100  -11.988 -0.885  1.00 0.00 ? 94  ARG A HB3  7  
ATOM 10342 H HG2  . ARG A 1 94  ? -3.701  -9.845  -0.443  1.00 0.00 ? 94  ARG A HG2  7  
ATOM 10343 H HG3  . ARG A 1 94  ? -2.038  -9.542  0.021   1.00 0.00 ? 94  ARG A HG3  7  
ATOM 10344 H HD2  . ARG A 1 94  ? -1.718  -9.283  -2.647  1.00 0.00 ? 94  ARG A HD2  7  
ATOM 10345 H HD3  . ARG A 1 94  ? -3.430  -8.913  -2.581  1.00 0.00 ? 94  ARG A HD3  7  
ATOM 10346 H HE   . ARG A 1 94  ? -2.077  -7.427  -0.530  1.00 0.00 ? 94  ARG A HE   7  
ATOM 10347 H HH11 . ARG A 1 94  ? -2.436  -7.527  -4.029  1.00 0.00 ? 94  ARG A HH11 7  
ATOM 10348 H HH12 . ARG A 1 94  ? -2.124  -5.836  -4.237  1.00 0.00 ? 94  ARG A HH12 7  
ATOM 10349 H HH21 . ARG A 1 94  ? -1.666  -5.196  -0.804  1.00 0.00 ? 94  ARG A HH21 7  
ATOM 10350 H HH22 . ARG A 1 94  ? -1.683  -4.501  -2.391  1.00 0.00 ? 94  ARG A HH22 7  
ATOM 10351 N N    . ILE A 1 95  ? -1.052  -13.128 1.430   1.00 0.00 ? 95  ILE A N    7  
ATOM 10352 C CA   . ILE A 1 95  ? -1.198  -14.366 2.176   1.00 0.00 ? 95  ILE A CA   7  
ATOM 10353 C C    . ILE A 1 95  ? -2.585  -14.956 1.910   1.00 0.00 ? 95  ILE A C    7  
ATOM 10354 O O    . ILE A 1 95  ? -2.741  -16.174 1.837   1.00 0.00 ? 95  ILE A O    7  
ATOM 10355 C CB   . ILE A 1 95  ? -0.903  -14.136 3.660   1.00 0.00 ? 95  ILE A CB   7  
ATOM 10356 C CG1  . ILE A 1 95  ? -0.874  -15.461 4.424   1.00 0.00 ? 95  ILE A CG1  7  
ATOM 10357 C CG2  . ILE A 1 95  ? -1.895  -13.144 4.269   1.00 0.00 ? 95  ILE A CG2  7  
ATOM 10358 C CD1  . ILE A 1 95  ? -0.001  -15.353 5.677   1.00 0.00 ? 95  ILE A CD1  7  
ATOM 10359 H H    . ILE A 1 95  ? -0.864  -12.319 1.987   1.00 0.00 ? 95  ILE A H    7  
ATOM 10360 H HA   . ILE A 1 95  ? -0.449  -15.063 1.802   1.00 0.00 ? 95  ILE A HA   7  
ATOM 10361 H HB   . ILE A 1 95  ? 0.089   -13.693 3.745   1.00 0.00 ? 95  ILE A HB   7  
ATOM 10362 H HG12 . ILE A 1 95  ? -1.888  -15.744 4.707   1.00 0.00 ? 95  ILE A HG12 7  
ATOM 10363 H HG13 . ILE A 1 95  ? -0.492  -16.251 3.778   1.00 0.00 ? 95  ILE A HG13 7  
ATOM 10364 H HG21 . ILE A 1 95  ? -1.955  -12.257 3.639   1.00 0.00 ? 95  ILE A HG21 7  
ATOM 10365 H HG22 . ILE A 1 95  ? -2.879  -13.609 4.337   1.00 0.00 ? 95  ILE A HG22 7  
ATOM 10366 H HG23 . ILE A 1 95  ? -1.558  -12.859 5.266   1.00 0.00 ? 95  ILE A HG23 7  
ATOM 10367 H HD11 . ILE A 1 95  ? -0.635  -15.359 6.563   1.00 0.00 ? 95  ILE A HD11 7  
ATOM 10368 H HD12 . ILE A 1 95  ? 0.686   -16.198 5.715   1.00 0.00 ? 95  ILE A HD12 7  
ATOM 10369 H HD13 . ILE A 1 95  ? 0.567   -14.423 5.643   1.00 0.00 ? 95  ILE A HD13 7  
ATOM 10370 N N    . SER A 1 96  ? -3.555  -14.065 1.771   1.00 0.00 ? 96  SER A N    7  
ATOM 10371 C CA   . SER A 1 96  ? -4.923  -14.483 1.514   1.00 0.00 ? 96  SER A CA   7  
ATOM 10372 C C    . SER A 1 96  ? -5.832  -13.257 1.399   1.00 0.00 ? 96  SER A C    7  
ATOM 10373 O O    . SER A 1 96  ? -5.756  -12.345 2.221   1.00 0.00 ? 96  SER A O    7  
ATOM 10374 C CB   . SER A 1 96  ? -5.430  -15.417 2.615   1.00 0.00 ? 96  SER A CB   7  
ATOM 10375 O OG   . SER A 1 96  ? -6.826  -15.676 2.494   1.00 0.00 ? 96  SER A OG   7  
ATOM 10376 H H    . SER A 1 96  ? -3.420  -13.076 1.832   1.00 0.00 ? 96  SER A H    7  
ATOM 10377 H HA   . SER A 1 96  ? -4.887  -15.022 0.568   1.00 0.00 ? 96  SER A HA   7  
ATOM 10378 H HB2  . SER A 1 96  ? -4.881  -16.358 2.572   1.00 0.00 ? 96  SER A HB2  7  
ATOM 10379 H HB3  . SER A 1 96  ? -5.226  -14.974 3.589   1.00 0.00 ? 96  SER A HB3  7  
ATOM 10380 H HG   . SER A 1 96  ? -7.343  -14.831 2.627   1.00 0.00 ? 96  SER A HG   7  
ATOM 10381 N N    . GLY A 1 97  ? -6.669  -13.275 0.373   1.00 0.00 ? 97  GLY A N    7  
ATOM 10382 C CA   . GLY A 1 97  ? -7.591  -12.176 0.140   1.00 0.00 ? 97  GLY A CA   7  
ATOM 10383 C C    . GLY A 1 97  ? -9.005  -12.541 0.596   1.00 0.00 ? 97  GLY A C    7  
ATOM 10384 O O    . GLY A 1 97  ? -9.338  -13.718 0.719   1.00 0.00 ? 97  GLY A O    7  
ATOM 10385 H H    . GLY A 1 97  ? -6.724  -14.021 -0.291  1.00 0.00 ? 97  GLY A H    7  
ATOM 10386 H HA2  . GLY A 1 97  ? -7.249  -11.290 0.675   1.00 0.00 ? 97  GLY A HA2  7  
ATOM 10387 H HA3  . GLY A 1 97  ? -7.601  -11.924 -0.921  1.00 0.00 ? 97  GLY A HA3  7  
ATOM 10388 N N    . PRO A 1 98  ? -9.821  -11.481 0.842   1.00 0.00 ? 98  PRO A N    7  
ATOM 10389 C CA   . PRO A 1 98  ? -11.192 -11.677 1.282   1.00 0.00 ? 98  PRO A CA   7  
ATOM 10390 C C    . PRO A 1 98  ? -12.079 -12.136 0.123   1.00 0.00 ? 98  PRO A C    7  
ATOM 10391 O O    . PRO A 1 98  ? -11.983 -11.609 -0.984  1.00 0.00 ? 98  PRO A O    7  
ATOM 10392 C CB   . PRO A 1 98  ? -11.615 -10.337 1.860   1.00 0.00 ? 98  PRO A CB   7  
ATOM 10393 C CG   . PRO A 1 98  ? -10.637 -9.315  1.304   1.00 0.00 ? 98  PRO A CG   7  
ATOM 10394 C CD   . PRO A 1 98  ? -9.462  -10.072 0.707   1.00 0.00 ? 98  PRO A CD   7  
ATOM 10395 H HA   . PRO A 1 98  ? -11.236 -12.406 1.965   1.00 0.00 ? 98  PRO A HA   7  
ATOM 10396 H HB2  . PRO A 1 98  ? -12.639 -10.094 1.573   1.00 0.00 ? 98  PRO A HB2  7  
ATOM 10397 H HB3  . PRO A 1 98  ? -11.585 -10.354 2.949   1.00 0.00 ? 98  PRO A HB3  7  
ATOM 10398 H HG2  . PRO A 1 98  ? -11.119 -8.699  0.545   1.00 0.00 ? 98  PRO A HG2  7  
ATOM 10399 H HG3  . PRO A 1 98  ? -10.298 -8.643  2.092   1.00 0.00 ? 98  PRO A HG3  7  
ATOM 10400 H HD2  . PRO A 1 98  ? -9.305  -9.801  -0.337  1.00 0.00 ? 98  PRO A HD2  7  
ATOM 10401 H HD3  . PRO A 1 98  ? -8.536  -9.847  1.237   1.00 0.00 ? 98  PRO A HD3  7  
ATOM 10402 N N    . SER A 1 99  ? -12.924 -13.114 0.418   1.00 0.00 ? 99  SER A N    7  
ATOM 10403 C CA   . SER A 1 99  ? -13.828 -13.649 -0.585  1.00 0.00 ? 99  SER A CA   7  
ATOM 10404 C C    . SER A 1 99  ? -15.113 -12.821 -0.627  1.00 0.00 ? 99  SER A C    7  
ATOM 10405 O O    . SER A 1 99  ? -15.786 -12.660 0.390   1.00 0.00 ? 99  SER A O    7  
ATOM 10406 C CB   . SER A 1 99  ? -14.152 -15.119 -0.307  1.00 0.00 ? 99  SER A CB   7  
ATOM 10407 O OG   . SER A 1 99  ? -14.225 -15.886 -1.505  1.00 0.00 ? 99  SER A OG   7  
ATOM 10408 H H    . SER A 1 99  ? -12.996 -13.537 1.321   1.00 0.00 ? 99  SER A H    7  
ATOM 10409 H HA   . SER A 1 99  ? -13.290 -13.570 -1.530  1.00 0.00 ? 99  SER A HA   7  
ATOM 10410 H HB2  . SER A 1 99  ? -13.388 -15.540 0.348   1.00 0.00 ? 99  SER A HB2  7  
ATOM 10411 H HB3  . SER A 1 99  ? -15.100 -15.186 0.226   1.00 0.00 ? 99  SER A HB3  7  
ATOM 10412 H HG   . SER A 1 99  ? -13.876 -15.352 -2.275  1.00 0.00 ? 99  SER A HG   7  
ATOM 10413 N N    . SER A 1 100 ? -15.417 -12.317 -1.815  1.00 0.00 ? 100 SER A N    7  
ATOM 10414 C CA   . SER A 1 100 ? -16.610 -11.510 -2.002  1.00 0.00 ? 100 SER A CA   7  
ATOM 10415 C C    . SER A 1 100 ? -17.640 -12.282 -2.829  1.00 0.00 ? 100 SER A C    7  
ATOM 10416 O O    . SER A 1 100 ? -17.294 -12.906 -3.831  1.00 0.00 ? 100 SER A O    7  
ATOM 10417 C CB   . SER A 1 100 ? -16.274 -10.180 -2.680  1.00 0.00 ? 100 SER A CB   7  
ATOM 10418 O OG   . SER A 1 100 ? -16.527 -9.067  -1.827  1.00 0.00 ? 100 SER A OG   7  
ATOM 10419 H H    . SER A 1 100 ? -14.864 -12.453 -2.637  1.00 0.00 ? 100 SER A H    7  
ATOM 10420 H HA   . SER A 1 100 ? -16.990 -11.319 -0.999  1.00 0.00 ? 100 SER A HA   7  
ATOM 10421 H HB2  . SER A 1 100 ? -15.225 -10.179 -2.977  1.00 0.00 ? 100 SER A HB2  7  
ATOM 10422 H HB3  . SER A 1 100 ? -16.863 -10.079 -3.592  1.00 0.00 ? 100 SER A HB3  7  
ATOM 10423 H HG   . SER A 1 100 ? -16.155 -9.243  -0.916  1.00 0.00 ? 100 SER A HG   7  
ATOM 10424 N N    . GLY A 1 101 ? -18.884 -12.214 -2.379  1.00 0.00 ? 101 GLY A N    7  
ATOM 10425 C CA   . GLY A 1 101 ? -19.966 -12.899 -3.065  1.00 0.00 ? 101 GLY A CA   7  
ATOM 10426 C C    . GLY A 1 101 ? -20.609 -11.993 -4.117  1.00 0.00 ? 101 GLY A C    7  
ATOM 10427 O O    . GLY A 1 101 ? -21.671 -12.312 -4.650  1.00 0.00 ? 101 GLY A O    7  
ATOM 10428 H H    . GLY A 1 101 ? -19.156 -11.704 -1.563  1.00 0.00 ? 101 GLY A H    7  
ATOM 10429 H HA2  . GLY A 1 101 ? -19.586 -13.803 -3.541  1.00 0.00 ? 101 GLY A HA2  7  
ATOM 10430 H HA3  . GLY A 1 101 ? -20.719 -13.213 -2.342  1.00 0.00 ? 101 GLY A HA3  7  
ATOM 10431 N N    . GLY A 1 1   ? 13.400  -14.795 -15.175 1.00 0.00 ? 1   GLY A N    8  
ATOM 10432 C CA   . GLY A 1 1   ? 12.130  -14.991 -15.854 1.00 0.00 ? 1   GLY A CA   8  
ATOM 10433 C C    . GLY A 1 1   ? 11.423  -16.248 -15.342 1.00 0.00 ? 1   GLY A C    8  
ATOM 10434 O O    . GLY A 1 1   ? 12.053  -17.120 -14.746 1.00 0.00 ? 1   GLY A O    8  
ATOM 10435 H H1   . GLY A 1 1   ? 14.040  -15.560 -15.248 1.00 0.00 ? 1   GLY A H1   8  
ATOM 10436 H HA2  . GLY A 1 1   ? 11.492  -14.121 -15.698 1.00 0.00 ? 1   GLY A HA2  8  
ATOM 10437 H HA3  . GLY A 1 1   ? 12.296  -15.075 -16.928 1.00 0.00 ? 1   GLY A HA3  8  
ATOM 10438 N N    . SER A 1 2   ? 10.123  -16.300 -15.593 1.00 0.00 ? 2   SER A N    8  
ATOM 10439 C CA   . SER A 1 2   ? 9.324   -17.436 -15.165 1.00 0.00 ? 2   SER A CA   8  
ATOM 10440 C C    . SER A 1 2   ? 9.242   -17.472 -13.637 1.00 0.00 ? 2   SER A C    8  
ATOM 10441 O O    . SER A 1 2   ? 10.097  -16.912 -12.953 1.00 0.00 ? 2   SER A O    8  
ATOM 10442 C CB   . SER A 1 2   ? 9.902   -18.748 -15.697 1.00 0.00 ? 2   SER A CB   8  
ATOM 10443 O OG   . SER A 1 2   ? 9.037   -19.367 -16.645 1.00 0.00 ? 2   SER A OG   8  
ATOM 10444 H H    . SER A 1 2   ? 9.618   -15.587 -16.078 1.00 0.00 ? 2   SER A H    8  
ATOM 10445 H HA   . SER A 1 2   ? 8.336   -17.273 -15.597 1.00 0.00 ? 2   SER A HA   8  
ATOM 10446 H HB2  . SER A 1 2   ? 10.870  -18.557 -16.159 1.00 0.00 ? 2   SER A HB2  8  
ATOM 10447 H HB3  . SER A 1 2   ? 10.076  -19.431 -14.865 1.00 0.00 ? 2   SER A HB3  8  
ATOM 10448 H HG   . SER A 1 2   ? 9.225   -20.348 -16.690 1.00 0.00 ? 2   SER A HG   8  
ATOM 10449 N N    . SER A 1 3   ? 8.206   -18.137 -13.147 1.00 0.00 ? 3   SER A N    8  
ATOM 10450 C CA   . SER A 1 3   ? 8.001   -18.253 -11.714 1.00 0.00 ? 3   SER A CA   8  
ATOM 10451 C C    . SER A 1 3   ? 9.332   -18.548 -11.018 1.00 0.00 ? 3   SER A C    8  
ATOM 10452 O O    . SER A 1 3   ? 10.231  -19.138 -11.614 1.00 0.00 ? 3   SER A O    8  
ATOM 10453 C CB   . SER A 1 3   ? 6.980   -19.345 -11.390 1.00 0.00 ? 3   SER A CB   8  
ATOM 10454 O OG   . SER A 1 3   ? 5.647   -18.931 -11.677 1.00 0.00 ? 3   SER A OG   8  
ATOM 10455 H H    . SER A 1 3   ? 7.515   -18.590 -13.711 1.00 0.00 ? 3   SER A H    8  
ATOM 10456 H HA   . SER A 1 3   ? 7.611   -17.286 -11.398 1.00 0.00 ? 3   SER A HA   8  
ATOM 10457 H HB2  . SER A 1 3   ? 7.212   -20.241 -11.965 1.00 0.00 ? 3   SER A HB2  8  
ATOM 10458 H HB3  . SER A 1 3   ? 7.057   -19.613 -10.336 1.00 0.00 ? 3   SER A HB3  8  
ATOM 10459 H HG   . SER A 1 3   ? 5.602   -17.933 -11.726 1.00 0.00 ? 3   SER A HG   8  
ATOM 10460 N N    . GLY A 1 4   ? 9.415   -18.124 -9.765  1.00 0.00 ? 4   GLY A N    8  
ATOM 10461 C CA   . GLY A 1 4   ? 10.620  -18.335 -8.982  1.00 0.00 ? 4   GLY A CA   8  
ATOM 10462 C C    . GLY A 1 4   ? 10.656  -17.402 -7.770  1.00 0.00 ? 4   GLY A C    8  
ATOM 10463 O O    . GLY A 1 4   ? 10.339  -17.814 -6.655  1.00 0.00 ? 4   GLY A O    8  
ATOM 10464 H H    . GLY A 1 4   ? 8.678   -17.645 -9.287  1.00 0.00 ? 4   GLY A H    8  
ATOM 10465 H HA2  . GLY A 1 4   ? 10.664  -19.372 -8.649  1.00 0.00 ? 4   GLY A HA2  8  
ATOM 10466 H HA3  . GLY A 1 4   ? 11.498  -18.163 -9.605  1.00 0.00 ? 4   GLY A HA3  8  
ATOM 10467 N N    . SER A 1 5   ? 11.047  -16.163 -8.029  1.00 0.00 ? 5   SER A N    8  
ATOM 10468 C CA   . SER A 1 5   ? 11.129  -15.168 -6.973  1.00 0.00 ? 5   SER A CA   8  
ATOM 10469 C C    . SER A 1 5   ? 9.817   -14.385 -6.889  1.00 0.00 ? 5   SER A C    8  
ATOM 10470 O O    . SER A 1 5   ? 8.995   -14.444 -7.802  1.00 0.00 ? 5   SER A O    8  
ATOM 10471 C CB   . SER A 1 5   ? 12.303  -14.215 -7.205  1.00 0.00 ? 5   SER A CB   8  
ATOM 10472 O OG   . SER A 1 5   ? 13.533  -14.758 -6.733  1.00 0.00 ? 5   SER A OG   8  
ATOM 10473 H H    . SER A 1 5   ? 11.303  -15.836 -8.938  1.00 0.00 ? 5   SER A H    8  
ATOM 10474 H HA   . SER A 1 5   ? 11.296  -15.733 -6.056  1.00 0.00 ? 5   SER A HA   8  
ATOM 10475 H HB2  . SER A 1 5   ? 12.387  -13.996 -8.269  1.00 0.00 ? 5   SER A HB2  8  
ATOM 10476 H HB3  . SER A 1 5   ? 12.107  -13.269 -6.700  1.00 0.00 ? 5   SER A HB3  8  
ATOM 10477 H HG   . SER A 1 5   ? 14.167  -14.880 -7.496  1.00 0.00 ? 5   SER A HG   8  
ATOM 10478 N N    . SER A 1 6   ? 9.663   -13.669 -5.785  1.00 0.00 ? 6   SER A N    8  
ATOM 10479 C CA   . SER A 1 6   ? 8.465   -12.875 -5.569  1.00 0.00 ? 6   SER A CA   8  
ATOM 10480 C C    . SER A 1 6   ? 8.825   -11.389 -5.516  1.00 0.00 ? 6   SER A C    8  
ATOM 10481 O O    . SER A 1 6   ? 9.999   -11.034 -5.425  1.00 0.00 ? 6   SER A O    8  
ATOM 10482 C CB   . SER A 1 6   ? 7.750   -13.294 -4.284  1.00 0.00 ? 6   SER A CB   8  
ATOM 10483 O OG   . SER A 1 6   ? 6.467   -12.686 -4.164  1.00 0.00 ? 6   SER A OG   8  
ATOM 10484 H H    . SER A 1 6   ? 10.336  -13.626 -5.047  1.00 0.00 ? 6   SER A H    8  
ATOM 10485 H HA   . SER A 1 6   ? 7.823   -13.082 -6.426  1.00 0.00 ? 6   SER A HA   8  
ATOM 10486 H HB2  . SER A 1 6   ? 7.640   -14.378 -4.267  1.00 0.00 ? 6   SER A HB2  8  
ATOM 10487 H HB3  . SER A 1 6   ? 8.361   -13.023 -3.423  1.00 0.00 ? 6   SER A HB3  8  
ATOM 10488 H HG   . SER A 1 6   ? 6.329   -12.359 -3.229  1.00 0.00 ? 6   SER A HG   8  
ATOM 10489 N N    . GLY A 1 7   ? 7.793   -10.560 -5.574  1.00 0.00 ? 7   GLY A N    8  
ATOM 10490 C CA   . GLY A 1 7   ? 7.986   -9.120  -5.533  1.00 0.00 ? 7   GLY A CA   8  
ATOM 10491 C C    . GLY A 1 7   ? 7.303   -8.442  -6.723  1.00 0.00 ? 7   GLY A C    8  
ATOM 10492 O O    . GLY A 1 7   ? 7.564   -8.789  -7.873  1.00 0.00 ? 7   GLY A O    8  
ATOM 10493 H H    . GLY A 1 7   ? 6.841   -10.857 -5.647  1.00 0.00 ? 7   GLY A H    8  
ATOM 10494 H HA2  . GLY A 1 7   ? 7.583   -8.722  -4.602  1.00 0.00 ? 7   GLY A HA2  8  
ATOM 10495 H HA3  . GLY A 1 7   ? 9.052   -8.892  -5.542  1.00 0.00 ? 7   GLY A HA3  8  
ATOM 10496 N N    . GLU A 1 8   ? 6.443   -7.486  -6.404  1.00 0.00 ? 8   GLU A N    8  
ATOM 10497 C CA   . GLU A 1 8   ? 5.721   -6.755  -7.432  1.00 0.00 ? 8   GLU A CA   8  
ATOM 10498 C C    . GLU A 1 8   ? 5.390   -5.343  -6.946  1.00 0.00 ? 8   GLU A C    8  
ATOM 10499 O O    . GLU A 1 8   ? 4.339   -5.119  -6.347  1.00 0.00 ? 8   GLU A O    8  
ATOM 10500 C CB   . GLU A 1 8   ? 4.453   -7.503  -7.847  1.00 0.00 ? 8   GLU A CB   8  
ATOM 10501 C CG   . GLU A 1 8   ? 4.627   -8.157  -9.220  1.00 0.00 ? 8   GLU A CG   8  
ATOM 10502 C CD   . GLU A 1 8   ? 3.318   -8.791  -9.695  1.00 0.00 ? 8   GLU A CD   8  
ATOM 10503 O OE1  . GLU A 1 8   ? 2.878   -9.752  -9.028  1.00 0.00 ? 8   GLU A OE1  8  
ATOM 10504 O OE2  . GLU A 1 8   ? 2.787   -8.301  -10.715 1.00 0.00 ? 8   GLU A OE2  8  
ATOM 10505 H H    . GLU A 1 8   ? 6.237   -7.209  -5.465  1.00 0.00 ? 8   GLU A H    8  
ATOM 10506 H HA   . GLU A 1 8   ? 6.401   -6.704  -8.282  1.00 0.00 ? 8   GLU A HA   8  
ATOM 10507 H HB2  . GLU A 1 8   ? 4.216   -8.266  -7.105  1.00 0.00 ? 8   GLU A HB2  8  
ATOM 10508 H HB3  . GLU A 1 8   ? 3.611   -6.812  -7.874  1.00 0.00 ? 8   GLU A HB3  8  
ATOM 10509 H HG2  . GLU A 1 8   ? 4.957   -7.410  -9.943  1.00 0.00 ? 8   GLU A HG2  8  
ATOM 10510 H HG3  . GLU A 1 8   ? 5.406   -8.917  -9.169  1.00 0.00 ? 8   GLU A HG3  8  
ATOM 10511 N N    . VAL A 1 9   ? 6.307   -4.427  -7.221  1.00 0.00 ? 9   VAL A N    8  
ATOM 10512 C CA   . VAL A 1 9   ? 6.126   -3.042  -6.819  1.00 0.00 ? 9   VAL A CA   8  
ATOM 10513 C C    . VAL A 1 9   ? 5.097   -2.380  -7.739  1.00 0.00 ? 9   VAL A C    8  
ATOM 10514 O O    . VAL A 1 9   ? 5.257   -2.382  -8.958  1.00 0.00 ? 9   VAL A O    8  
ATOM 10515 C CB   . VAL A 1 9   ? 7.474   -2.319  -6.811  1.00 0.00 ? 9   VAL A CB   8  
ATOM 10516 C CG1  . VAL A 1 9   ? 7.282   -0.803  -6.724  1.00 0.00 ? 9   VAL A CG1  8  
ATOM 10517 C CG2  . VAL A 1 9   ? 8.361   -2.826  -5.672  1.00 0.00 ? 9   VAL A CG2  8  
ATOM 10518 H H    . VAL A 1 9   ? 7.159   -4.617  -7.708  1.00 0.00 ? 9   VAL A H    8  
ATOM 10519 H HA   . VAL A 1 9   ? 5.737   -3.043  -5.801  1.00 0.00 ? 9   VAL A HA   8  
ATOM 10520 H HB   . VAL A 1 9   ? 7.978   -2.539  -7.752  1.00 0.00 ? 9   VAL A HB   8  
ATOM 10521 H HG11 . VAL A 1 9   ? 6.227   -0.579  -6.569  1.00 0.00 ? 9   VAL A HG11 8  
ATOM 10522 H HG12 . VAL A 1 9   ? 7.863   -0.411  -5.889  1.00 0.00 ? 9   VAL A HG12 8  
ATOM 10523 H HG13 . VAL A 1 9   ? 7.620   -0.341  -7.651  1.00 0.00 ? 9   VAL A HG13 8  
ATOM 10524 H HG21 . VAL A 1 9   ? 8.671   -3.850  -5.882  1.00 0.00 ? 9   VAL A HG21 8  
ATOM 10525 H HG22 . VAL A 1 9   ? 9.242   -2.190  -5.587  1.00 0.00 ? 9   VAL A HG22 8  
ATOM 10526 H HG23 . VAL A 1 9   ? 7.802   -2.800  -4.737  1.00 0.00 ? 9   VAL A HG23 8  
ATOM 10527 N N    . ARG A 1 10  ? 4.065   -1.828  -7.118  1.00 0.00 ? 10  ARG A N    8  
ATOM 10528 C CA   . ARG A 1 10  ? 3.011   -1.163  -7.865  1.00 0.00 ? 10  ARG A CA   8  
ATOM 10529 C C    . ARG A 1 10  ? 3.215   0.353   -7.835  1.00 0.00 ? 10  ARG A C    8  
ATOM 10530 O O    . ARG A 1 10  ? 3.961   0.867   -7.004  1.00 0.00 ? 10  ARG A O    8  
ATOM 10531 C CB   . ARG A 1 10  ? 1.633   -1.497  -7.290  1.00 0.00 ? 10  ARG A CB   8  
ATOM 10532 C CG   . ARG A 1 10  ? 1.567   -1.167  -5.797  1.00 0.00 ? 10  ARG A CG   8  
ATOM 10533 C CD   . ARG A 1 10  ? 1.251   -2.417  -4.973  1.00 0.00 ? 10  ARG A CD   8  
ATOM 10534 N NE   . ARG A 1 10  ? -0.210  -2.654  -4.954  1.00 0.00 ? 10  ARG A NE   8  
ATOM 10535 C CZ   . ARG A 1 10  ? -0.774  -3.852  -4.754  1.00 0.00 ? 10  ARG A CZ   8  
ATOM 10536 N NH1  . ARG A 1 10  ? -0.004  -4.931  -4.556  1.00 0.00 ? 10  ARG A NH1  8  
ATOM 10537 N NH2  . ARG A 1 10  ? -2.109  -3.973  -4.753  1.00 0.00 ? 10  ARG A NH2  8  
ATOM 10538 H H    . ARG A 1 10  ? 3.943   -1.830  -6.126  1.00 0.00 ? 10  ARG A H    8  
ATOM 10539 H HA   . ARG A 1 10  ? 3.101   -1.551  -8.880  1.00 0.00 ? 10  ARG A HA   8  
ATOM 10540 H HB2  . ARG A 1 10  ? 0.866   -0.936  -7.824  1.00 0.00 ? 10  ARG A HB2  8  
ATOM 10541 H HB3  . ARG A 1 10  ? 1.418   -2.555  -7.442  1.00 0.00 ? 10  ARG A HB3  8  
ATOM 10542 H HG2  . ARG A 1 10  ? 2.518   -0.744  -5.472  1.00 0.00 ? 10  ARG A HG2  8  
ATOM 10543 H HG3  . ARG A 1 10  ? 0.805   -0.409  -5.622  1.00 0.00 ? 10  ARG A HG3  8  
ATOM 10544 H HD2  . ARG A 1 10  ? 1.762   -3.281  -5.397  1.00 0.00 ? 10  ARG A HD2  8  
ATOM 10545 H HD3  . ARG A 1 10  ? 1.621   -2.295  -3.956  1.00 0.00 ? 10  ARG A HD3  8  
ATOM 10546 H HE   . ARG A 1 10  ? -0.814  -1.870  -5.099  1.00 0.00 ? 10  ARG A HE   8  
ATOM 10547 H HH11 . ARG A 1 10  ? 0.992   -4.841  -4.557  1.00 0.00 ? 10  ARG A HH11 8  
ATOM 10548 H HH12 . ARG A 1 10  ? -0.425  -5.825  -4.407  1.00 0.00 ? 10  ARG A HH12 8  
ATOM 10549 H HH21 . ARG A 1 10  ? -2.684  -3.168  -4.901  1.00 0.00 ? 10  ARG A HH21 8  
ATOM 10550 H HH22 . ARG A 1 10  ? -2.530  -4.868  -4.604  1.00 0.00 ? 10  ARG A HH22 8  
ATOM 10551 N N    . LEU A 1 11  ? 2.537   1.027   -8.753  1.00 0.00 ? 11  LEU A N    8  
ATOM 10552 C CA   . LEU A 1 11  ? 2.634   2.474   -8.842  1.00 0.00 ? 11  LEU A CA   8  
ATOM 10553 C C    . LEU A 1 11  ? 1.252   3.089   -8.613  1.00 0.00 ? 11  LEU A C    8  
ATOM 10554 O O    . LEU A 1 11  ? 0.385   3.017   -9.482  1.00 0.00 ? 11  LEU A O    8  
ATOM 10555 C CB   . LEU A 1 11  ? 3.279   2.888   -10.166 1.00 0.00 ? 11  LEU A CB   8  
ATOM 10556 C CG   . LEU A 1 11  ? 4.749   2.503   -10.345 1.00 0.00 ? 11  LEU A CG   8  
ATOM 10557 C CD1  . LEU A 1 11  ? 5.242   2.860   -11.749 1.00 0.00 ? 11  LEU A CD1  8  
ATOM 10558 C CD2  . LEU A 1 11  ? 5.617   3.134   -9.255  1.00 0.00 ? 11  LEU A CD2  8  
ATOM 10559 H H    . LEU A 1 11  ? 1.932   0.602   -9.426  1.00 0.00 ? 11  LEU A H    8  
ATOM 10560 H HA   . LEU A 1 11  ? 3.297   2.807   -8.043  1.00 0.00 ? 11  LEU A HA   8  
ATOM 10561 H HB2  . LEU A 1 11  ? 2.706   2.444   -10.981 1.00 0.00 ? 11  LEU A HB2  8  
ATOM 10562 H HB3  . LEU A 1 11  ? 3.192   3.969   -10.268 1.00 0.00 ? 11  LEU A HB3  8  
ATOM 10563 H HG   . LEU A 1 11  ? 4.834   1.421   -10.240 1.00 0.00 ? 11  LEU A HG   8  
ATOM 10564 H HD11 . LEU A 1 11  ? 4.449   2.668   -12.472 1.00 0.00 ? 11  LEU A HD11 8  
ATOM 10565 H HD12 . LEU A 1 11  ? 5.516   3.914   -11.781 1.00 0.00 ? 11  LEU A HD12 8  
ATOM 10566 H HD13 . LEU A 1 11  ? 6.112   2.251   -11.994 1.00 0.00 ? 11  LEU A HD13 8  
ATOM 10567 H HD21 . LEU A 1 11  ? 5.857   2.383   -8.502  1.00 0.00 ? 11  LEU A HD21 8  
ATOM 10568 H HD22 . LEU A 1 11  ? 6.539   3.511   -9.698  1.00 0.00 ? 11  LEU A HD22 8  
ATOM 10569 H HD23 . LEU A 1 11  ? 5.075   3.956   -8.789  1.00 0.00 ? 11  LEU A HD23 8  
ATOM 10570 N N    . VAL A 1 12  ? 1.089   3.680   -7.438  1.00 0.00 ? 12  VAL A N    8  
ATOM 10571 C CA   . VAL A 1 12  ? -0.173  4.307   -7.084  1.00 0.00 ? 12  VAL A CA   8  
ATOM 10572 C C    . VAL A 1 12  ? -0.109  5.798   -7.421  1.00 0.00 ? 12  VAL A C    8  
ATOM 10573 O O    . VAL A 1 12  ? 0.931   6.432   -7.250  1.00 0.00 ? 12  VAL A O    8  
ATOM 10574 C CB   . VAL A 1 12  ? -0.495  4.039   -5.612  1.00 0.00 ? 12  VAL A CB   8  
ATOM 10575 C CG1  . VAL A 1 12  ? -1.734  4.821   -5.171  1.00 0.00 ? 12  VAL A CG1  8  
ATOM 10576 C CG2  . VAL A 1 12  ? -0.670  2.542   -5.352  1.00 0.00 ? 12  VAL A CG2  8  
ATOM 10577 H H    . VAL A 1 12  ? 1.800   3.734   -6.736  1.00 0.00 ? 12  VAL A H    8  
ATOM 10578 H HA   . VAL A 1 12  ? -0.952  3.843   -7.689  1.00 0.00 ? 12  VAL A HA   8  
ATOM 10579 H HB   . VAL A 1 12  ? 0.349   4.386   -5.016  1.00 0.00 ? 12  VAL A HB   8  
ATOM 10580 H HG11 . VAL A 1 12  ? -2.621  4.201   -5.305  1.00 0.00 ? 12  VAL A HG11 8  
ATOM 10581 H HG12 . VAL A 1 12  ? -1.637  5.094   -4.121  1.00 0.00 ? 12  VAL A HG12 8  
ATOM 10582 H HG13 . VAL A 1 12  ? -1.828  5.724   -5.775  1.00 0.00 ? 12  VAL A HG13 8  
ATOM 10583 H HG21 . VAL A 1 12  ? -0.334  1.980   -6.224  1.00 0.00 ? 12  VAL A HG21 8  
ATOM 10584 H HG22 . VAL A 1 12  ? -0.079  2.252   -4.483  1.00 0.00 ? 12  VAL A HG22 8  
ATOM 10585 H HG23 . VAL A 1 12  ? -1.722  2.326   -5.164  1.00 0.00 ? 12  VAL A HG23 8  
ATOM 10586 N N    . SER A 1 13  ? -1.234  6.314   -7.893  1.00 0.00 ? 13  SER A N    8  
ATOM 10587 C CA   . SER A 1 13  ? -1.319  7.718   -8.255  1.00 0.00 ? 13  SER A CA   8  
ATOM 10588 C C    . SER A 1 13  ? -2.533  8.360   -7.581  1.00 0.00 ? 13  SER A C    8  
ATOM 10589 O O    . SER A 1 13  ? -3.667  7.938   -7.802  1.00 0.00 ? 13  SER A O    8  
ATOM 10590 C CB   . SER A 1 13  ? -1.403  7.891   -9.773  1.00 0.00 ? 13  SER A CB   8  
ATOM 10591 O OG   . SER A 1 13  ? -2.734  7.731   -10.257 1.00 0.00 ? 13  SER A OG   8  
ATOM 10592 H H    . SER A 1 13  ? -2.075  5.790   -8.029  1.00 0.00 ? 13  SER A H    8  
ATOM 10593 H HA   . SER A 1 13  ? -0.396  8.167   -7.889  1.00 0.00 ? 13  SER A HA   8  
ATOM 10594 H HB2  . SER A 1 13  ? -1.035  8.880   -10.046 1.00 0.00 ? 13  SER A HB2  8  
ATOM 10595 H HB3  . SER A 1 13  ? -0.751  7.164   -10.258 1.00 0.00 ? 13  SER A HB3  8  
ATOM 10596 H HG   . SER A 1 13  ? -3.016  8.549   -10.759 1.00 0.00 ? 13  SER A HG   8  
ATOM 10597 N N    . LEU A 1 14  ? -2.254  9.371   -6.770  1.00 0.00 ? 14  LEU A N    8  
ATOM 10598 C CA   . LEU A 1 14  ? -3.309  10.075  -6.062  1.00 0.00 ? 14  LEU A CA   8  
ATOM 10599 C C    . LEU A 1 14  ? -3.323  11.540  -6.502  1.00 0.00 ? 14  LEU A C    8  
ATOM 10600 O O    . LEU A 1 14  ? -2.282  12.100  -6.841  1.00 0.00 ? 14  LEU A O    8  
ATOM 10601 C CB   . LEU A 1 14  ? -3.156  9.889   -4.551  1.00 0.00 ? 14  LEU A CB   8  
ATOM 10602 C CG   . LEU A 1 14  ? -3.696  8.577   -3.979  1.00 0.00 ? 14  LEU A CG   8  
ATOM 10603 C CD1  . LEU A 1 14  ? -5.148  8.350   -4.404  1.00 0.00 ? 14  LEU A CD1  8  
ATOM 10604 C CD2  . LEU A 1 14  ? -2.796  7.400   -4.361  1.00 0.00 ? 14  LEU A CD2  8  
ATOM 10605 H H    . LEU A 1 14  ? -1.329  9.708   -6.596  1.00 0.00 ? 14  LEU A H    8  
ATOM 10606 H HA   . LEU A 1 14  ? -4.256  9.619   -6.348  1.00 0.00 ? 14  LEU A HA   8  
ATOM 10607 H HB2  . LEU A 1 14  ? -2.098  9.963   -4.301  1.00 0.00 ? 14  LEU A HB2  8  
ATOM 10608 H HB3  . LEU A 1 14  ? -3.660  10.715  -4.050  1.00 0.00 ? 14  LEU A HB3  8  
ATOM 10609 H HG   . LEU A 1 14  ? -3.687  8.649   -2.891  1.00 0.00 ? 14  LEU A HG   8  
ATOM 10610 H HD11 . LEU A 1 14  ? -5.706  7.915   -3.574  1.00 0.00 ? 14  LEU A HD11 8  
ATOM 10611 H HD12 . LEU A 1 14  ? -5.597  9.302   -4.685  1.00 0.00 ? 14  LEU A HD12 8  
ATOM 10612 H HD13 . LEU A 1 14  ? -5.175  7.670   -5.255  1.00 0.00 ? 14  LEU A HD13 8  
ATOM 10613 H HD21 . LEU A 1 14  ? -2.326  7.600   -5.324  1.00 0.00 ? 14  LEU A HD21 8  
ATOM 10614 H HD22 . LEU A 1 14  ? -2.026  7.270   -3.601  1.00 0.00 ? 14  LEU A HD22 8  
ATOM 10615 H HD23 . LEU A 1 14  ? -3.395  6.492   -4.431  1.00 0.00 ? 14  LEU A HD23 8  
ATOM 10616 N N    . ARG A 1 15  ? -4.515  12.119  -6.484  1.00 0.00 ? 15  ARG A N    8  
ATOM 10617 C CA   . ARG A 1 15  ? -4.678  13.508  -6.878  1.00 0.00 ? 15  ARG A CA   8  
ATOM 10618 C C    . ARG A 1 15  ? -4.433  14.431  -5.682  1.00 0.00 ? 15  ARG A C    8  
ATOM 10619 O O    . ARG A 1 15  ? -5.196  14.419  -4.717  1.00 0.00 ? 15  ARG A O    8  
ATOM 10620 C CB   . ARG A 1 15  ? -6.082  13.762  -7.430  1.00 0.00 ? 15  ARG A CB   8  
ATOM 10621 C CG   . ARG A 1 15  ? -6.183  15.157  -8.051  1.00 0.00 ? 15  ARG A CG   8  
ATOM 10622 C CD   . ARG A 1 15  ? -5.489  15.201  -9.414  1.00 0.00 ? 15  ARG A CD   8  
ATOM 10623 N NE   . ARG A 1 15  ? -6.235  16.088  -10.334 1.00 0.00 ? 15  ARG A NE   8  
ATOM 10624 C CZ   . ARG A 1 15  ? -7.494  15.866  -10.735 1.00 0.00 ? 15  ARG A CZ   8  
ATOM 10625 N NH1  . ARG A 1 15  ? -8.155  14.785  -10.300 1.00 0.00 ? 15  ARG A NH1  8  
ATOM 10626 N NH2  . ARG A 1 15  ? -8.092  16.726  -11.571 1.00 0.00 ? 15  ARG A NH2  8  
ATOM 10627 H H    . ARG A 1 15  ? -5.357  11.656  -6.207  1.00 0.00 ? 15  ARG A H    8  
ATOM 10628 H HA   . ARG A 1 15  ? -3.931  13.667  -7.655  1.00 0.00 ? 15  ARG A HA   8  
ATOM 10629 H HB2  . ARG A 1 15  ? -6.324  13.008  -8.179  1.00 0.00 ? 15  ARG A HB2  8  
ATOM 10630 H HB3  . ARG A 1 15  ? -6.815  13.663  -6.629  1.00 0.00 ? 15  ARG A HB3  8  
ATOM 10631 H HG2  . ARG A 1 15  ? -7.231  15.434  -8.164  1.00 0.00 ? 15  ARG A HG2  8  
ATOM 10632 H HG3  . ARG A 1 15  ? -5.729  15.890  -7.384  1.00 0.00 ? 15  ARG A HG3  8  
ATOM 10633 H HD2  . ARG A 1 15  ? -4.466  15.560  -9.299  1.00 0.00 ? 15  ARG A HD2  8  
ATOM 10634 H HD3  . ARG A 1 15  ? -5.429  14.197  -9.834  1.00 0.00 ? 15  ARG A HD3  8  
ATOM 10635 H HE   . ARG A 1 15  ? -5.771  16.905  -10.677 1.00 0.00 ? 15  ARG A HE   8  
ATOM 10636 H HH11 . ARG A 1 15  ? -7.709  14.143  -9.676  1.00 0.00 ? 15  ARG A HH11 8  
ATOM 10637 H HH12 . ARG A 1 15  ? -9.095  14.619  -10.599 1.00 0.00 ? 15  ARG A HH12 8  
ATOM 10638 H HH21 . ARG A 1 15  ? -7.599  17.533  -11.896 1.00 0.00 ? 15  ARG A HH21 8  
ATOM 10639 H HH22 . ARG A 1 15  ? -9.032  16.560  -11.870 1.00 0.00 ? 15  ARG A HH22 8  
ATOM 10640 N N    . ARG A 1 16  ? -3.366  15.209  -5.785  1.00 0.00 ? 16  ARG A N    8  
ATOM 10641 C CA   . ARG A 1 16  ? -3.010  16.136  -4.724  1.00 0.00 ? 16  ARG A CA   8  
ATOM 10642 C C    . ARG A 1 16  ? -3.743  17.466  -4.914  1.00 0.00 ? 16  ARG A C    8  
ATOM 10643 O O    . ARG A 1 16  ? -3.119  18.486  -5.204  1.00 0.00 ? 16  ARG A O    8  
ATOM 10644 C CB   . ARG A 1 16  ? -1.502  16.391  -4.698  1.00 0.00 ? 16  ARG A CB   8  
ATOM 10645 C CG   . ARG A 1 16  ? -0.997  16.543  -3.262  1.00 0.00 ? 16  ARG A CG   8  
ATOM 10646 C CD   . ARG A 1 16  ? -1.148  17.986  -2.777  1.00 0.00 ? 16  ARG A CD   8  
ATOM 10647 N NE   . ARG A 1 16  ? -0.238  18.873  -3.536  1.00 0.00 ? 16  ARG A NE   8  
ATOM 10648 C CZ   . ARG A 1 16  ? -0.307  20.211  -3.520  1.00 0.00 ? 16  ARG A CZ   8  
ATOM 10649 N NH1  . ARG A 1 16  ? -1.244  20.825  -2.785  1.00 0.00 ? 16  ARG A NH1  8  
ATOM 10650 N NH2  . ARG A 1 16  ? 0.560   20.935  -4.240  1.00 0.00 ? 16  ARG A NH2  8  
ATOM 10651 H H    . ARG A 1 16  ? -2.750  15.212  -6.573  1.00 0.00 ? 16  ARG A H    8  
ATOM 10652 H HA   . ARG A 1 16  ? -3.326  15.642  -3.805  1.00 0.00 ? 16  ARG A HA   8  
ATOM 10653 H HB2  . ARG A 1 16  ? -0.982  15.567  -5.185  1.00 0.00 ? 16  ARG A HB2  8  
ATOM 10654 H HB3  . ARG A 1 16  ? -1.272  17.293  -5.265  1.00 0.00 ? 16  ARG A HB3  8  
ATOM 10655 H HG2  . ARG A 1 16  ? -1.552  15.874  -2.604  1.00 0.00 ? 16  ARG A HG2  8  
ATOM 10656 H HG3  . ARG A 1 16  ? 0.051   16.245  -3.208  1.00 0.00 ? 16  ARG A HG3  8  
ATOM 10657 H HD2  . ARG A 1 16  ? -2.179  18.315  -2.904  1.00 0.00 ? 16  ARG A HD2  8  
ATOM 10658 H HD3  . ARG A 1 16  ? -0.923  18.046  -1.712  1.00 0.00 ? 16  ARG A HD3  8  
ATOM 10659 H HE   . ARG A 1 16  ? 0.473   18.447  -4.095  1.00 0.00 ? 16  ARG A HE   8  
ATOM 10660 H HH11 . ARG A 1 16  ? -1.892  20.284  -2.248  1.00 0.00 ? 16  ARG A HH11 8  
ATOM 10661 H HH12 . ARG A 1 16  ? -1.296  21.824  -2.774  1.00 0.00 ? 16  ARG A HH12 8  
ATOM 10662 H HH21 . ARG A 1 16  ? 1.260   20.477  -4.789  1.00 0.00 ? 16  ARG A HH21 8  
ATOM 10663 H HH22 . ARG A 1 16  ? 0.508   21.934  -4.229  1.00 0.00 ? 16  ARG A HH22 8  
ATOM 10664 N N    . ALA A 1 17  ? -5.055  17.412  -4.743  1.00 0.00 ? 17  ALA A N    8  
ATOM 10665 C CA   . ALA A 1 17  ? -5.879  18.599  -4.892  1.00 0.00 ? 17  ALA A CA   8  
ATOM 10666 C C    . ALA A 1 17  ? -7.347  18.228  -4.673  1.00 0.00 ? 17  ALA A C    8  
ATOM 10667 O O    . ALA A 1 17  ? -8.159  18.323  -5.592  1.00 0.00 ? 17  ALA A O    8  
ATOM 10668 C CB   . ALA A 1 17  ? -5.635  19.221  -6.269  1.00 0.00 ? 17  ALA A CB   8  
ATOM 10669 H H    . ALA A 1 17  ? -5.555  16.578  -4.507  1.00 0.00 ? 17  ALA A H    8  
ATOM 10670 H HA   . ALA A 1 17  ? -5.575  19.313  -4.126  1.00 0.00 ? 17  ALA A HA   8  
ATOM 10671 H HB1  . ALA A 1 17  ? -5.221  20.222  -6.147  1.00 0.00 ? 17  ALA A HB1  8  
ATOM 10672 H HB2  . ALA A 1 17  ? -4.931  18.603  -6.827  1.00 0.00 ? 17  ALA A HB2  8  
ATOM 10673 H HB3  . ALA A 1 17  ? -6.577  19.280  -6.813  1.00 0.00 ? 17  ALA A HB3  8  
ATOM 10674 N N    . LYS A 1 18  ? -7.642  17.812  -3.450  1.00 0.00 ? 18  LYS A N    8  
ATOM 10675 C CA   . LYS A 1 18  ? -8.998  17.425  -3.098  1.00 0.00 ? 18  LYS A CA   8  
ATOM 10676 C C    . LYS A 1 18  ? -9.259  17.773  -1.631  1.00 0.00 ? 18  LYS A C    8  
ATOM 10677 O O    . LYS A 1 18  ? -9.873  18.795  -1.332  1.00 0.00 ? 18  LYS A O    8  
ATOM 10678 C CB   . LYS A 1 18  ? -9.239  15.952  -3.433  1.00 0.00 ? 18  LYS A CB   8  
ATOM 10679 C CG   . LYS A 1 18  ? -10.125 15.809  -4.672  1.00 0.00 ? 18  LYS A CG   8  
ATOM 10680 C CD   . LYS A 1 18  ? -9.534  14.797  -5.655  1.00 0.00 ? 18  LYS A CD   8  
ATOM 10681 C CE   . LYS A 1 18  ? -10.476 14.567  -6.839  1.00 0.00 ? 18  LYS A CE   8  
ATOM 10682 N NZ   . LYS A 1 18  ? -9.991  13.448  -7.677  1.00 0.00 ? 18  LYS A NZ   8  
ATOM 10683 H H    . LYS A 1 18  ? -6.976  17.737  -2.708  1.00 0.00 ? 18  LYS A H    8  
ATOM 10684 H HA   . LYS A 1 18  ? -9.676  18.012  -3.718  1.00 0.00 ? 18  LYS A HA   8  
ATOM 10685 H HB2  . LYS A 1 18  ? -8.286  15.453  -3.604  1.00 0.00 ? 18  LYS A HB2  8  
ATOM 10686 H HB3  . LYS A 1 18  ? -9.711  15.455  -2.585  1.00 0.00 ? 18  LYS A HB3  8  
ATOM 10687 H HG2  . LYS A 1 18  ? -11.124 15.492  -4.375  1.00 0.00 ? 18  LYS A HG2  8  
ATOM 10688 H HG3  . LYS A 1 18  ? -10.231 16.777  -5.162  1.00 0.00 ? 18  LYS A HG3  8  
ATOM 10689 H HD2  . LYS A 1 18  ? -8.571  15.156  -6.017  1.00 0.00 ? 18  LYS A HD2  8  
ATOM 10690 H HD3  . LYS A 1 18  ? -9.350  13.852  -5.143  1.00 0.00 ? 18  LYS A HD3  8  
ATOM 10691 H HE2  . LYS A 1 18  ? -11.480 14.348  -6.474  1.00 0.00 ? 18  LYS A HE2  8  
ATOM 10692 H HE3  . LYS A 1 18  ? -10.546 15.475  -7.438  1.00 0.00 ? 18  LYS A HE3  8  
ATOM 10693 H HZ1  . LYS A 1 18  ? -9.265  13.775  -8.282  1.00 0.00 ? 18  LYS A HZ1  8  
ATOM 10694 H HZ2  . LYS A 1 18  ? -9.634  12.722  -7.090  1.00 0.00 ? 18  LYS A HZ2  8  
ATOM 10695 H HZ3  . LYS A 1 18  ? -10.747 13.091  -8.226  1.00 0.00 ? 18  LYS A HZ3  8  
ATOM 10696 N N    . ALA A 1 19  ? -8.777  16.903  -0.755  1.00 0.00 ? 19  ALA A N    8  
ATOM 10697 C CA   . ALA A 1 19  ? -8.950  17.105  0.673   1.00 0.00 ? 19  ALA A CA   8  
ATOM 10698 C C    . ALA A 1 19  ? -8.707  15.783  1.404   1.00 0.00 ? 19  ALA A C    8  
ATOM 10699 O O    . ALA A 1 19  ? -8.291  15.778  2.562   1.00 0.00 ? 19  ALA A O    8  
ATOM 10700 C CB   . ALA A 1 19  ? -10.346 17.672  0.943   1.00 0.00 ? 19  ALA A CB   8  
ATOM 10701 H H    . ALA A 1 19  ? -8.278  16.074  -1.007  1.00 0.00 ? 19  ALA A H    8  
ATOM 10702 H HA   . ALA A 1 19  ? -8.207  17.833  0.998   1.00 0.00 ? 19  ALA A HA   8  
ATOM 10703 H HB1  . ALA A 1 19  ? -10.695 17.329  1.917   1.00 0.00 ? 19  ALA A HB1  8  
ATOM 10704 H HB2  . ALA A 1 19  ? -10.302 18.761  0.936   1.00 0.00 ? 19  ALA A HB2  8  
ATOM 10705 H HB3  . ALA A 1 19  ? -11.033 17.331  0.169   1.00 0.00 ? 19  ALA A HB3  8  
ATOM 10706 N N    . HIS A 1 20  ? -8.977  14.695  0.698   1.00 0.00 ? 20  HIS A N    8  
ATOM 10707 C CA   . HIS A 1 20  ? -8.792  13.370  1.266   1.00 0.00 ? 20  HIS A CA   8  
ATOM 10708 C C    . HIS A 1 20  ? -7.541  13.359  2.146   1.00 0.00 ? 20  HIS A C    8  
ATOM 10709 O O    . HIS A 1 20  ? -6.515  13.931  1.781   1.00 0.00 ? 20  HIS A O    8  
ATOM 10710 C CB   . HIS A 1 20  ? -8.752  12.308  0.165   1.00 0.00 ? 20  HIS A CB   8  
ATOM 10711 C CG   . HIS A 1 20  ? -10.110 11.939  -0.382  1.00 0.00 ? 20  HIS A CG   8  
ATOM 10712 N ND1  . HIS A 1 20  ? -10.687 12.590  -1.459  1.00 0.00 ? 20  HIS A ND1  8  
ATOM 10713 C CD2  . HIS A 1 20  ? -10.998 10.981  0.009   1.00 0.00 ? 20  HIS A CD2  8  
ATOM 10714 C CE1  . HIS A 1 20  ? -11.869 12.040  -1.696  1.00 0.00 ? 20  HIS A CE1  8  
ATOM 10715 N NE2  . HIS A 1 20  ? -12.060 11.043  -0.784  1.00 0.00 ? 20  HIS A NE2  8  
ATOM 10716 H H    . HIS A 1 20  ? -9.315  14.708  -0.243  1.00 0.00 ? 20  HIS A H    8  
ATOM 10717 H HA   . HIS A 1 20  ? -9.665  13.172  1.887   1.00 0.00 ? 20  HIS A HA   8  
ATOM 10718 H HB2  . HIS A 1 20  ? -8.129  12.671  -0.653  1.00 0.00 ? 20  HIS A HB2  8  
ATOM 10719 H HB3  . HIS A 1 20  ? -8.273  11.411  0.557   1.00 0.00 ? 20  HIS A HB3  8  
ATOM 10720 H HD1  . HIS A 1 20  ? -10.280 13.346  -1.972  1.00 0.00 ? 20  HIS A HD1  8  
ATOM 10721 H HD2  . HIS A 1 20  ? -10.859 10.282  0.835   1.00 0.00 ? 20  HIS A HD2  8  
ATOM 10722 H HE1  . HIS A 1 20  ? -12.566 12.332  -2.481  1.00 0.00 ? 20  HIS A HE1  8  
ATOM 10723 N N    . GLU A 1 21  ? -7.667  12.701  3.289   1.00 0.00 ? 21  GLU A N    8  
ATOM 10724 C CA   . GLU A 1 21  ? -6.559  12.607  4.225   1.00 0.00 ? 21  GLU A CA   8  
ATOM 10725 C C    . GLU A 1 21  ? -5.282  12.187  3.495   1.00 0.00 ? 21  GLU A C    8  
ATOM 10726 O O    . GLU A 1 21  ? -5.148  11.035  3.084   1.00 0.00 ? 21  GLU A O    8  
ATOM 10727 C CB   . GLU A 1 21  ? -6.883  11.639  5.364   1.00 0.00 ? 21  GLU A CB   8  
ATOM 10728 C CG   . GLU A 1 21  ? -7.325  12.396  6.618   1.00 0.00 ? 21  GLU A CG   8  
ATOM 10729 C CD   . GLU A 1 21  ? -7.826  11.430  7.693   1.00 0.00 ? 21  GLU A CD   8  
ATOM 10730 O OE1  . GLU A 1 21  ? -7.057  10.501  8.025   1.00 0.00 ? 21  GLU A OE1  8  
ATOM 10731 O OE2  . GLU A 1 21  ? -8.966  11.641  8.160   1.00 0.00 ? 21  GLU A OE2  8  
ATOM 10732 H H    . GLU A 1 21  ? -8.504  12.238  3.579   1.00 0.00 ? 21  GLU A H    8  
ATOM 10733 H HA   . GLU A 1 21  ? -6.438  13.611  4.633   1.00 0.00 ? 21  GLU A HA   8  
ATOM 10734 H HB2  . GLU A 1 21  ? -7.672  10.955  5.051   1.00 0.00 ? 21  GLU A HB2  8  
ATOM 10735 H HB3  . GLU A 1 21  ? -6.007  11.032  5.591   1.00 0.00 ? 21  GLU A HB3  8  
ATOM 10736 H HG2  . GLU A 1 21  ? -6.491  12.979  7.008   1.00 0.00 ? 21  GLU A HG2  8  
ATOM 10737 H HG3  . GLU A 1 21  ? -8.116  13.101  6.361   1.00 0.00 ? 21  GLU A HG3  8  
ATOM 10738 N N    . GLY A 1 22  ? -4.375  13.143  3.355   1.00 0.00 ? 22  GLY A N    8  
ATOM 10739 C CA   . GLY A 1 22  ? -3.114  12.887  2.682   1.00 0.00 ? 22  GLY A CA   8  
ATOM 10740 C C    . GLY A 1 22  ? -3.303  11.918  1.513   1.00 0.00 ? 22  GLY A C    8  
ATOM 10741 O O    . GLY A 1 22  ? -3.115  10.712  1.665   1.00 0.00 ? 22  GLY A O    8  
ATOM 10742 H H    . GLY A 1 22  ? -4.492  14.078  3.693   1.00 0.00 ? 22  GLY A H    8  
ATOM 10743 H HA2  . GLY A 1 22  ? -2.695  13.825  2.318   1.00 0.00 ? 22  GLY A HA2  8  
ATOM 10744 H HA3  . GLY A 1 22  ? -2.397  12.471  3.391   1.00 0.00 ? 22  GLY A HA3  8  
ATOM 10745 N N    . LEU A 1 23  ? -3.673  12.482  0.373   1.00 0.00 ? 23  LEU A N    8  
ATOM 10746 C CA   . LEU A 1 23  ? -3.890  11.683  -0.822  1.00 0.00 ? 23  LEU A CA   8  
ATOM 10747 C C    . LEU A 1 23  ? -4.784  10.491  -0.477  1.00 0.00 ? 23  LEU A C    8  
ATOM 10748 O O    . LEU A 1 23  ? -4.777  9.481   -1.180  1.00 0.00 ? 23  LEU A O    8  
ATOM 10749 C CB   . LEU A 1 23  ? -2.553  11.288  -1.452  1.00 0.00 ? 23  LEU A CB   8  
ATOM 10750 C CG   . LEU A 1 23  ? -1.324  12.048  -0.949  1.00 0.00 ? 23  LEU A CG   8  
ATOM 10751 C CD1  . LEU A 1 23  ? -0.033  11.362  -1.401  1.00 0.00 ? 23  LEU A CD1  8  
ATOM 10752 C CD2  . LEU A 1 23  ? -1.373  13.516  -1.378  1.00 0.00 ? 23  LEU A CD2  8  
ATOM 10753 H H    . LEU A 1 23  ? -3.823  13.464  0.258   1.00 0.00 ? 23  LEU A H    8  
ATOM 10754 H HA   . LEU A 1 23  ? -4.413  12.310  -1.543  1.00 0.00 ? 23  LEU A HA   8  
ATOM 10755 H HB2  . LEU A 1 23  ? -2.393  10.224  -1.279  1.00 0.00 ? 23  LEU A HB2  8  
ATOM 10756 H HB3  . LEU A 1 23  ? -2.627  11.428  -2.530  1.00 0.00 ? 23  LEU A HB3  8  
ATOM 10757 H HG   . LEU A 1 23  ? -1.333  12.030  0.140   1.00 0.00 ? 23  LEU A HG   8  
ATOM 10758 H HD11 . LEU A 1 23  ? 0.731   11.483  -0.633  1.00 0.00 ? 23  LEU A HD11 8  
ATOM 10759 H HD12 . LEU A 1 23  ? -0.222  10.301  -1.563  1.00 0.00 ? 23  LEU A HD12 8  
ATOM 10760 H HD13 . LEU A 1 23  ? 0.313   11.815  -2.331  1.00 0.00 ? 23  LEU A HD13 8  
ATOM 10761 H HD21 . LEU A 1 23  ? -2.189  14.018  -0.858  1.00 0.00 ? 23  LEU A HD21 8  
ATOM 10762 H HD22 . LEU A 1 23  ? -0.430  14.000  -1.126  1.00 0.00 ? 23  LEU A HD22 8  
ATOM 10763 H HD23 . LEU A 1 23  ? -1.537  13.575  -2.454  1.00 0.00 ? 23  LEU A HD23 8  
ATOM 10764 N N    . GLY A 1 24  ? -5.532  10.646  0.605   1.00 0.00 ? 24  GLY A N    8  
ATOM 10765 C CA   . GLY A 1 24  ? -6.430  9.595   1.052   1.00 0.00 ? 24  GLY A CA   8  
ATOM 10766 C C    . GLY A 1 24  ? -5.702  8.601   1.959   1.00 0.00 ? 24  GLY A C    8  
ATOM 10767 O O    . GLY A 1 24  ? -6.310  8.004   2.846   1.00 0.00 ? 24  GLY A O    8  
ATOM 10768 H H    . GLY A 1 24  ? -5.532  11.471  1.172   1.00 0.00 ? 24  GLY A H    8  
ATOM 10769 H HA2  . GLY A 1 24  ? -7.271  10.033  1.589   1.00 0.00 ? 24  GLY A HA2  8  
ATOM 10770 H HA3  . GLY A 1 24  ? -6.841  9.072   0.189   1.00 0.00 ? 24  GLY A HA3  8  
ATOM 10771 N N    . PHE A 1 25  ? -4.410  8.453   1.704   1.00 0.00 ? 25  PHE A N    8  
ATOM 10772 C CA   . PHE A 1 25  ? -3.592  7.541   2.486   1.00 0.00 ? 25  PHE A CA   8  
ATOM 10773 C C    . PHE A 1 25  ? -2.484  8.295   3.223   1.00 0.00 ? 25  PHE A C    8  
ATOM 10774 O O    . PHE A 1 25  ? -1.720  9.039   2.610   1.00 0.00 ? 25  PHE A O    8  
ATOM 10775 C CB   . PHE A 1 25  ? -2.957  6.556   1.504   1.00 0.00 ? 25  PHE A CB   8  
ATOM 10776 C CG   . PHE A 1 25  ? -1.711  7.096   0.799   1.00 0.00 ? 25  PHE A CG   8  
ATOM 10777 C CD1  . PHE A 1 25  ? -0.513  7.098   1.442   1.00 0.00 ? 25  PHE A CD1  8  
ATOM 10778 C CD2  . PHE A 1 25  ? -1.802  7.574   -0.471  1.00 0.00 ? 25  PHE A CD2  8  
ATOM 10779 C CE1  . PHE A 1 25  ? 0.644   7.599   0.787   1.00 0.00 ? 25  PHE A CE1  8  
ATOM 10780 C CE2  . PHE A 1 25  ? -0.645  8.075   -1.126  1.00 0.00 ? 25  PHE A CE2  8  
ATOM 10781 C CZ   . PHE A 1 25  ? 0.553   8.077   -0.483  1.00 0.00 ? 25  PHE A CZ   8  
ATOM 10782 H H    . PHE A 1 25  ? -3.923  8.942   0.980   1.00 0.00 ? 25  PHE A H    8  
ATOM 10783 H HA   . PHE A 1 25  ? -4.248  7.061   3.212   1.00 0.00 ? 25  PHE A HA   8  
ATOM 10784 H HB2  . PHE A 1 25  ? -2.692  5.644   2.039   1.00 0.00 ? 25  PHE A HB2  8  
ATOM 10785 H HB3  . PHE A 1 25  ? -3.696  6.280   0.752   1.00 0.00 ? 25  PHE A HB3  8  
ATOM 10786 H HD1  . PHE A 1 25  ? -0.440  6.714   2.460   1.00 0.00 ? 25  PHE A HD1  8  
ATOM 10787 H HD2  . PHE A 1 25  ? -2.762  7.572   -0.987  1.00 0.00 ? 25  PHE A HD2  8  
ATOM 10788 H HE1  . PHE A 1 25  ? 1.604   7.600   1.303   1.00 0.00 ? 25  PHE A HE1  8  
ATOM 10789 H HE2  . PHE A 1 25  ? -0.718  8.458   -2.143  1.00 0.00 ? 25  PHE A HE2  8  
ATOM 10790 H HZ   . PHE A 1 25  ? 1.440   8.462   -0.985  1.00 0.00 ? 25  PHE A HZ   8  
ATOM 10791 N N    . SER A 1 26  ? -2.430  8.075   4.529   1.00 0.00 ? 26  SER A N    8  
ATOM 10792 C CA   . SER A 1 26  ? -1.428  8.724   5.357   1.00 0.00 ? 26  SER A CA   8  
ATOM 10793 C C    . SER A 1 26  ? -0.163  7.865   5.417   1.00 0.00 ? 26  SER A C    8  
ATOM 10794 O O    . SER A 1 26  ? -0.207  6.670   5.130   1.00 0.00 ? 26  SER A O    8  
ATOM 10795 C CB   . SER A 1 26  ? -1.961  8.983   6.767   1.00 0.00 ? 26  SER A CB   8  
ATOM 10796 O OG   . SER A 1 26  ? -1.891  10.362  7.120   1.00 0.00 ? 26  SER A OG   8  
ATOM 10797 H H    . SER A 1 26  ? -3.056  7.468   5.020   1.00 0.00 ? 26  SER A H    8  
ATOM 10798 H HA   . SER A 1 26  ? -1.221  9.675   4.867   1.00 0.00 ? 26  SER A HA   8  
ATOM 10799 H HB2  . SER A 1 26  ? -2.996  8.645   6.831   1.00 0.00 ? 26  SER A HB2  8  
ATOM 10800 H HB3  . SER A 1 26  ? -1.389  8.396   7.485   1.00 0.00 ? 26  SER A HB3  8  
ATOM 10801 H HG   . SER A 1 26  ? -2.449  10.537  7.931   1.00 0.00 ? 26  SER A HG   8  
ATOM 10802 N N    . ILE A 1 27  ? 0.933   8.507   5.793   1.00 0.00 ? 27  ILE A N    8  
ATOM 10803 C CA   . ILE A 1 27  ? 2.207   7.817   5.894   1.00 0.00 ? 27  ILE A CA   8  
ATOM 10804 C C    . ILE A 1 27  ? 2.746   7.957   7.320   1.00 0.00 ? 27  ILE A C    8  
ATOM 10805 O O    . ILE A 1 27  ? 2.294   8.815   8.076   1.00 0.00 ? 27  ILE A O    8  
ATOM 10806 C CB   . ILE A 1 27  ? 3.175   8.316   4.820   1.00 0.00 ? 27  ILE A CB   8  
ATOM 10807 C CG1  . ILE A 1 27  ? 3.598   9.761   5.091   1.00 0.00 ? 27  ILE A CG1  8  
ATOM 10808 C CG2  . ILE A 1 27  ? 2.576   8.148   3.422   1.00 0.00 ? 27  ILE A CG2  8  
ATOM 10809 C CD1  . ILE A 1 27  ? 4.987   10.043  4.517   1.00 0.00 ? 27  ILE A CD1  8  
ATOM 10810 H H    . ILE A 1 27  ? 0.959   9.480   6.024   1.00 0.00 ? 27  ILE A H    8  
ATOM 10811 H HA   . ILE A 1 27  ? 2.023   6.761   5.697   1.00 0.00 ? 27  ILE A HA   8  
ATOM 10812 H HB   . ILE A 1 27  ? 4.076   7.704   4.860   1.00 0.00 ? 27  ILE A HB   8  
ATOM 10813 H HG12 . ILE A 1 27  ? 2.872   10.445  4.651   1.00 0.00 ? 27  ILE A HG12 8  
ATOM 10814 H HG13 . ILE A 1 27  ? 3.600   9.948   6.165   1.00 0.00 ? 27  ILE A HG13 8  
ATOM 10815 H HG21 . ILE A 1 27  ? 2.024   9.048   3.152   1.00 0.00 ? 27  ILE A HG21 8  
ATOM 10816 H HG22 . ILE A 1 27  ? 3.377   7.983   2.701   1.00 0.00 ? 27  ILE A HG22 8  
ATOM 10817 H HG23 . ILE A 1 27  ? 1.901   7.292   3.416   1.00 0.00 ? 27  ILE A HG23 8  
ATOM 10818 H HD11 . ILE A 1 27  ? 5.313   11.037  4.826   1.00 0.00 ? 27  ILE A HD11 8  
ATOM 10819 H HD12 . ILE A 1 27  ? 5.691   9.298   4.886   1.00 0.00 ? 27  ILE A HD12 8  
ATOM 10820 H HD13 . ILE A 1 27  ? 4.947   9.996   3.428   1.00 0.00 ? 27  ILE A HD13 8  
ATOM 10821 N N    . ARG A 1 28  ? 3.704   7.100   7.643   1.00 0.00 ? 28  ARG A N    8  
ATOM 10822 C CA   . ARG A 1 28  ? 4.309   7.118   8.964   1.00 0.00 ? 28  ARG A CA   8  
ATOM 10823 C C    . ARG A 1 28  ? 5.782   6.716   8.878   1.00 0.00 ? 28  ARG A C    8  
ATOM 10824 O O    . ARG A 1 28  ? 6.271   6.359   7.807   1.00 0.00 ? 28  ARG A O    8  
ATOM 10825 C CB   . ARG A 1 28  ? 3.582   6.165   9.915   1.00 0.00 ? 28  ARG A CB   8  
ATOM 10826 C CG   . ARG A 1 28  ? 3.371   4.796   9.265   1.00 0.00 ? 28  ARG A CG   8  
ATOM 10827 C CD   . ARG A 1 28  ? 2.816   3.789   10.274  1.00 0.00 ? 28  ARG A CD   8  
ATOM 10828 N NE   . ARG A 1 28  ? 3.166   2.412   9.860   1.00 0.00 ? 28  ARG A NE   8  
ATOM 10829 C CZ   . ARG A 1 28  ? 4.375   1.860   10.033  1.00 0.00 ? 28  ARG A CZ   8  
ATOM 10830 N NH1  . ARG A 1 28  ? 5.356   2.564   10.613  1.00 0.00 ? 28  ARG A NH1  8  
ATOM 10831 N NH2  . ARG A 1 28  ? 4.602   0.603   9.626   1.00 0.00 ? 28  ARG A NH2  8  
ATOM 10832 H H    . ARG A 1 28  ? 4.065   6.405   7.022   1.00 0.00 ? 28  ARG A H    8  
ATOM 10833 H HA   . ARG A 1 28  ? 4.202   8.147   9.306   1.00 0.00 ? 28  ARG A HA   8  
ATOM 10834 H HB2  . ARG A 1 28  ? 4.159   6.050   10.832  1.00 0.00 ? 28  ARG A HB2  8  
ATOM 10835 H HB3  . ARG A 1 28  ? 2.618   6.590   10.196  1.00 0.00 ? 28  ARG A HB3  8  
ATOM 10836 H HG2  . ARG A 1 28  ? 2.684   4.890   8.424   1.00 0.00 ? 28  ARG A HG2  8  
ATOM 10837 H HG3  . ARG A 1 28  ? 4.317   4.430   8.864   1.00 0.00 ? 28  ARG A HG3  8  
ATOM 10838 H HD2  . ARG A 1 28  ? 3.221   3.994   11.265  1.00 0.00 ? 28  ARG A HD2  8  
ATOM 10839 H HD3  . ARG A 1 28  ? 1.733   3.892   10.344  1.00 0.00 ? 28  ARG A HD3  8  
ATOM 10840 H HE   . ARG A 1 28  ? 2.456   1.859   9.424   1.00 0.00 ? 28  ARG A HE   8  
ATOM 10841 H HH11 . ARG A 1 28  ? 5.186   3.502   10.917  1.00 0.00 ? 28  ARG A HH11 8  
ATOM 10842 H HH12 . ARG A 1 28  ? 6.258   2.152   10.743  1.00 0.00 ? 28  ARG A HH12 8  
ATOM 10843 H HH21 . ARG A 1 28  ? 3.869   0.078   9.193   1.00 0.00 ? 28  ARG A HH21 8  
ATOM 10844 H HH22 . ARG A 1 28  ? 5.504   0.191   9.756   1.00 0.00 ? 28  ARG A HH22 8  
ATOM 10845 N N    . GLY A 1 29  ? 6.450   6.787   10.021  1.00 0.00 ? 29  GLY A N    8  
ATOM 10846 C CA   . GLY A 1 29  ? 7.858   6.435   10.088  1.00 0.00 ? 29  GLY A CA   8  
ATOM 10847 C C    . GLY A 1 29  ? 8.740   7.638   9.748   1.00 0.00 ? 29  GLY A C    8  
ATOM 10848 O O    . GLY A 1 29  ? 8.458   8.759   10.169  1.00 0.00 ? 29  GLY A O    8  
ATOM 10849 H H    . GLY A 1 29  ? 6.045   7.078   10.887  1.00 0.00 ? 29  GLY A H    8  
ATOM 10850 H HA2  . GLY A 1 29  ? 8.099   6.074   11.088  1.00 0.00 ? 29  GLY A HA2  8  
ATOM 10851 H HA3  . GLY A 1 29  ? 8.066   5.620   9.396   1.00 0.00 ? 29  GLY A HA3  8  
ATOM 10852 N N    . GLY A 1 30  ? 9.791   7.365   8.988   1.00 0.00 ? 30  GLY A N    8  
ATOM 10853 C CA   . GLY A 1 30  ? 10.717  8.410   8.587   1.00 0.00 ? 30  GLY A CA   8  
ATOM 10854 C C    . GLY A 1 30  ? 12.082  8.218   9.249   1.00 0.00 ? 30  GLY A C    8  
ATOM 10855 O O    . GLY A 1 30  ? 12.181  7.597   10.306  1.00 0.00 ? 30  GLY A O    8  
ATOM 10856 H H    . GLY A 1 30  ? 10.013  6.450   8.650   1.00 0.00 ? 30  GLY A H    8  
ATOM 10857 H HA2  . GLY A 1 30  ? 10.830  8.404   7.503   1.00 0.00 ? 30  GLY A HA2  8  
ATOM 10858 H HA3  . GLY A 1 30  ? 10.311  9.384   8.859   1.00 0.00 ? 30  GLY A HA3  8  
ATOM 10859 N N    . SER A 1 31  ? 13.101  8.761   8.600   1.00 0.00 ? 31  SER A N    8  
ATOM 10860 C CA   . SER A 1 31  ? 14.457  8.657   9.112   1.00 0.00 ? 31  SER A CA   8  
ATOM 10861 C C    . SER A 1 31  ? 14.481  9.009   10.601  1.00 0.00 ? 31  SER A C    8  
ATOM 10862 O O    . SER A 1 31  ? 15.371  8.575   11.331  1.00 0.00 ? 31  SER A O    8  
ATOM 10863 C CB   . SER A 1 31  ? 15.411  9.567   8.336   1.00 0.00 ? 31  SER A CB   8  
ATOM 10864 O OG   . SER A 1 31  ? 16.755  9.097   8.384   1.00 0.00 ? 31  SER A OG   8  
ATOM 10865 H H    . SER A 1 31  ? 13.012  9.265   7.740   1.00 0.00 ? 31  SER A H    8  
ATOM 10866 H HA   . SER A 1 31  ? 14.744  7.617   8.960   1.00 0.00 ? 31  SER A HA   8  
ATOM 10867 H HB2  . SER A 1 31  ? 15.086  9.631   7.298   1.00 0.00 ? 31  SER A HB2  8  
ATOM 10868 H HB3  . SER A 1 31  ? 15.365  10.576  8.747   1.00 0.00 ? 31  SER A HB3  8  
ATOM 10869 H HG   . SER A 1 31  ? 17.342  9.783   8.812   1.00 0.00 ? 31  SER A HG   8  
ATOM 10870 N N    . GLU A 1 32  ? 13.494  9.793   11.008  1.00 0.00 ? 32  GLU A N    8  
ATOM 10871 C CA   . GLU A 1 32  ? 13.391  10.208  12.397  1.00 0.00 ? 32  GLU A CA   8  
ATOM 10872 C C    . GLU A 1 32  ? 13.276  8.985   13.309  1.00 0.00 ? 32  GLU A C    8  
ATOM 10873 O O    . GLU A 1 32  ? 13.954  8.904   14.332  1.00 0.00 ? 32  GLU A O    8  
ATOM 10874 C CB   . GLU A 1 32  ? 12.208  11.157  12.599  1.00 0.00 ? 32  GLU A CB   8  
ATOM 10875 C CG   . GLU A 1 32  ? 11.841  11.267  14.081  1.00 0.00 ? 32  GLU A CG   8  
ATOM 10876 C CD   . GLU A 1 32  ? 11.362  12.679  14.423  1.00 0.00 ? 32  GLU A CD   8  
ATOM 10877 O OE1  . GLU A 1 32  ? 11.991  13.631  13.913  1.00 0.00 ? 32  GLU A OE1  8  
ATOM 10878 O OE2  . GLU A 1 32  ? 10.377  12.774  15.188  1.00 0.00 ? 32  GLU A OE2  8  
ATOM 10879 H H    . GLU A 1 32  ? 12.774  10.142  10.408  1.00 0.00 ? 32  GLU A H    8  
ATOM 10880 H HA   . GLU A 1 32  ? 14.317  10.742  12.609  1.00 0.00 ? 32  GLU A HA   8  
ATOM 10881 H HB2  . GLU A 1 32  ? 12.457  12.143  12.209  1.00 0.00 ? 32  GLU A HB2  8  
ATOM 10882 H HB3  . GLU A 1 32  ? 11.348  10.798  12.034  1.00 0.00 ? 32  GLU A HB3  8  
ATOM 10883 H HG2  . GLU A 1 32  ? 11.059  10.546  14.320  1.00 0.00 ? 32  GLU A HG2  8  
ATOM 10884 H HG3  . GLU A 1 32  ? 12.706  11.013  14.693  1.00 0.00 ? 32  GLU A HG3  8  
ATOM 10885 N N    . HIS A 1 33  ? 12.412  8.065   12.906  1.00 0.00 ? 33  HIS A N    8  
ATOM 10886 C CA   . HIS A 1 33  ? 12.200  6.850   13.674  1.00 0.00 ? 33  HIS A CA   8  
ATOM 10887 C C    . HIS A 1 33  ? 13.212  5.787   13.244  1.00 0.00 ? 33  HIS A C    8  
ATOM 10888 O O    . HIS A 1 33  ? 13.193  4.666   13.749  1.00 0.00 ? 33  HIS A O    8  
ATOM 10889 C CB   . HIS A 1 33  ? 10.751  6.375   13.549  1.00 0.00 ? 33  HIS A CB   8  
ATOM 10890 C CG   . HIS A 1 33  ? 9.932   6.562   14.804  1.00 0.00 ? 33  HIS A CG   8  
ATOM 10891 N ND1  . HIS A 1 33  ? 9.526   5.504   15.598  1.00 0.00 ? 33  HIS A ND1  8  
ATOM 10892 C CD2  . HIS A 1 33  ? 9.451   7.693   15.394  1.00 0.00 ? 33  HIS A CD2  8  
ATOM 10893 C CE1  . HIS A 1 33  ? 8.830   5.988   16.617  1.00 0.00 ? 33  HIS A CE1  8  
ATOM 10894 N NE2  . HIS A 1 33  ? 8.784   7.346   16.488  1.00 0.00 ? 33  HIS A NE2  8  
ATOM 10895 H H    . HIS A 1 33  ? 11.864  8.139   12.073  1.00 0.00 ? 33  HIS A H    8  
ATOM 10896 H HA   . HIS A 1 33  ? 12.376  7.106   14.719  1.00 0.00 ? 33  HIS A HA   8  
ATOM 10897 H HB2  . HIS A 1 33  ? 10.272  6.913   12.731  1.00 0.00 ? 33  HIS A HB2  8  
ATOM 10898 H HB3  . HIS A 1 33  ? 10.748  5.318   13.280  1.00 0.00 ? 33  HIS A HB3  8  
ATOM 10899 H HD1  . HIS A 1 33  ? 9.723   4.538   15.432  1.00 0.00 ? 33  HIS A HD1  8  
ATOM 10900 H HD2  . HIS A 1 33  ? 9.590   8.711   15.028  1.00 0.00 ? 33  HIS A HD2  8  
ATOM 10901 H HE1  . HIS A 1 33  ? 8.375   5.405   17.417  1.00 0.00 ? 33  HIS A HE1  8  
ATOM 10902 N N    . GLY A 1 34  ? 14.073  6.177   12.315  1.00 0.00 ? 34  GLY A N    8  
ATOM 10903 C CA   . GLY A 1 34  ? 15.091  5.271   11.811  1.00 0.00 ? 34  GLY A CA   8  
ATOM 10904 C C    . GLY A 1 34  ? 14.484  4.240   10.857  1.00 0.00 ? 34  GLY A C    8  
ATOM 10905 O O    . GLY A 1 34  ? 15.064  3.178   10.635  1.00 0.00 ? 34  GLY A O    8  
ATOM 10906 H H    . GLY A 1 34  ? 14.081  7.091   11.909  1.00 0.00 ? 34  GLY A H    8  
ATOM 10907 H HA2  . GLY A 1 34  ? 15.864  5.839   11.294  1.00 0.00 ? 34  GLY A HA2  8  
ATOM 10908 H HA3  . GLY A 1 34  ? 15.574  4.761   12.644  1.00 0.00 ? 34  GLY A HA3  8  
ATOM 10909 N N    . VAL A 1 35  ? 13.325  4.589   10.319  1.00 0.00 ? 35  VAL A N    8  
ATOM 10910 C CA   . VAL A 1 35  ? 12.633  3.707   9.394   1.00 0.00 ? 35  VAL A CA   8  
ATOM 10911 C C    . VAL A 1 35  ? 12.291  4.480   8.119   1.00 0.00 ? 35  VAL A C    8  
ATOM 10912 O O    . VAL A 1 35  ? 12.321  5.710   8.107   1.00 0.00 ? 35  VAL A O    8  
ATOM 10913 C CB   . VAL A 1 35  ? 11.405  3.098   10.072  1.00 0.00 ? 35  VAL A CB   8  
ATOM 10914 C CG1  . VAL A 1 35  ? 11.698  2.759   11.535  1.00 0.00 ? 35  VAL A CG1  8  
ATOM 10915 C CG2  . VAL A 1 35  ? 10.196  4.029   9.957   1.00 0.00 ? 35  VAL A CG2  8  
ATOM 10916 H H    . VAL A 1 35  ? 12.860  5.455   10.505  1.00 0.00 ? 35  VAL A H    8  
ATOM 10917 H HA   . VAL A 1 35  ? 13.316  2.896   9.140   1.00 0.00 ? 35  VAL A HA   8  
ATOM 10918 H HB   . VAL A 1 35  ? 11.163  2.169   9.555   1.00 0.00 ? 35  VAL A HB   8  
ATOM 10919 H HG11 . VAL A 1 35  ? 11.183  1.836   11.805  1.00 0.00 ? 35  VAL A HG11 8  
ATOM 10920 H HG12 . VAL A 1 35  ? 12.771  2.628   11.670  1.00 0.00 ? 35  VAL A HG12 8  
ATOM 10921 H HG13 . VAL A 1 35  ? 11.348  3.570   12.173  1.00 0.00 ? 35  VAL A HG13 8  
ATOM 10922 H HG21 . VAL A 1 35  ? 10.455  5.010   10.353  1.00 0.00 ? 35  VAL A HG21 8  
ATOM 10923 H HG22 . VAL A 1 35  ? 9.910   4.124   8.909   1.00 0.00 ? 35  VAL A HG22 8  
ATOM 10924 H HG23 . VAL A 1 35  ? 9.363   3.615   10.525  1.00 0.00 ? 35  VAL A HG23 8  
ATOM 10925 N N    . GLY A 1 36  ? 11.972  3.727   7.076   1.00 0.00 ? 36  GLY A N    8  
ATOM 10926 C CA   . GLY A 1 36  ? 11.624  4.326   5.799   1.00 0.00 ? 36  GLY A CA   8  
ATOM 10927 C C    . GLY A 1 36  ? 10.255  5.005   5.867   1.00 0.00 ? 36  GLY A C    8  
ATOM 10928 O O    . GLY A 1 36  ? 9.976   5.757   6.800   1.00 0.00 ? 36  GLY A O    8  
ATOM 10929 H H    . GLY A 1 36  ? 11.950  2.727   7.094   1.00 0.00 ? 36  GLY A H    8  
ATOM 10930 H HA2  . GLY A 1 36  ? 12.383  5.056   5.517   1.00 0.00 ? 36  GLY A HA2  8  
ATOM 10931 H HA3  . GLY A 1 36  ? 11.616  3.559   5.024   1.00 0.00 ? 36  GLY A HA3  8  
ATOM 10932 N N    . ILE A 1 37  ? 9.436   4.716   4.866   1.00 0.00 ? 37  ILE A N    8  
ATOM 10933 C CA   . ILE A 1 37  ? 8.103   5.289   4.801   1.00 0.00 ? 37  ILE A CA   8  
ATOM 10934 C C    . ILE A 1 37  ? 7.087   4.178   4.527   1.00 0.00 ? 37  ILE A C    8  
ATOM 10935 O O    . ILE A 1 37  ? 7.304   3.334   3.658   1.00 0.00 ? 37  ILE A O    8  
ATOM 10936 C CB   . ILE A 1 37  ? 8.059   6.428   3.779   1.00 0.00 ? 37  ILE A CB   8  
ATOM 10937 C CG1  . ILE A 1 37  ? 9.226   7.395   3.986   1.00 0.00 ? 37  ILE A CG1  8  
ATOM 10938 C CG2  . ILE A 1 37  ? 6.707   7.144   3.814   1.00 0.00 ? 37  ILE A CG2  8  
ATOM 10939 C CD1  . ILE A 1 37  ? 9.003   8.265   5.225   1.00 0.00 ? 37  ILE A CD1  8  
ATOM 10940 H H    . ILE A 1 37  ? 9.670   4.103   4.111   1.00 0.00 ? 37  ILE A H    8  
ATOM 10941 H HA   . ILE A 1 37  ? 7.885   5.723   5.777   1.00 0.00 ? 37  ILE A HA   8  
ATOM 10942 H HB   . ILE A 1 37  ? 8.169   5.998   2.784   1.00 0.00 ? 37  ILE A HB   8  
ATOM 10943 H HG12 . ILE A 1 37  ? 10.154  6.834   4.093   1.00 0.00 ? 37  ILE A HG12 8  
ATOM 10944 H HG13 . ILE A 1 37  ? 9.337   8.030   3.107   1.00 0.00 ? 37  ILE A HG13 8  
ATOM 10945 H HG21 . ILE A 1 37  ? 6.475   7.432   4.839   1.00 0.00 ? 37  ILE A HG21 8  
ATOM 10946 H HG22 . ILE A 1 37  ? 6.751   8.034   3.187   1.00 0.00 ? 37  ILE A HG22 8  
ATOM 10947 H HG23 . ILE A 1 37  ? 5.932   6.475   3.441   1.00 0.00 ? 37  ILE A HG23 8  
ATOM 10948 H HD11 . ILE A 1 37  ? 8.442   9.157   4.946   1.00 0.00 ? 37  ILE A HD11 8  
ATOM 10949 H HD12 . ILE A 1 37  ? 8.442   7.701   5.969   1.00 0.00 ? 37  ILE A HD12 8  
ATOM 10950 H HD13 . ILE A 1 37  ? 9.967   8.558   5.641   1.00 0.00 ? 37  ILE A HD13 8  
ATOM 10951 N N    . TYR A 1 38  ? 6.001   4.213   5.285   1.00 0.00 ? 38  TYR A N    8  
ATOM 10952 C CA   . TYR A 1 38  ? 4.951   3.220   5.135   1.00 0.00 ? 38  TYR A CA   8  
ATOM 10953 C C    . TYR A 1 38  ? 3.572   3.838   5.374   1.00 0.00 ? 38  TYR A C    8  
ATOM 10954 O O    . TYR A 1 38  ? 3.449   4.830   6.091   1.00 0.00 ? 38  TYR A O    8  
ATOM 10955 C CB   . TYR A 1 38  ? 5.215   2.162   6.208   1.00 0.00 ? 38  TYR A CB   8  
ATOM 10956 C CG   . TYR A 1 38  ? 6.602   1.521   6.122   1.00 0.00 ? 38  TYR A CG   8  
ATOM 10957 C CD1  . TYR A 1 38  ? 7.690   2.151   6.693   1.00 0.00 ? 38  TYR A CD1  8  
ATOM 10958 C CD2  . TYR A 1 38  ? 6.765   0.314   5.474   1.00 0.00 ? 38  TYR A CD2  8  
ATOM 10959 C CE1  . TYR A 1 38  ? 8.995   1.547   6.612   1.00 0.00 ? 38  TYR A CE1  8  
ATOM 10960 C CE2  . TYR A 1 38  ? 8.070   -0.290  5.393   1.00 0.00 ? 38  TYR A CE2  8  
ATOM 10961 C CZ   . TYR A 1 38  ? 9.120   0.357   5.966   1.00 0.00 ? 38  TYR A CZ   8  
ATOM 10962 O OH   . TYR A 1 38  ? 10.353  -0.213  5.890   1.00 0.00 ? 38  TYR A OH   8  
ATOM 10963 H H    . TYR A 1 38  ? 5.832   4.903   5.989   1.00 0.00 ? 38  TYR A H    8  
ATOM 10964 H HA   . TYR A 1 38  ? 4.996   2.834   4.117   1.00 0.00 ? 38  TYR A HA   8  
ATOM 10965 H HB2  . TYR A 1 38  ? 5.098   2.619   7.191   1.00 0.00 ? 38  TYR A HB2  8  
ATOM 10966 H HB3  . TYR A 1 38  ? 4.460   1.381   6.128   1.00 0.00 ? 38  TYR A HB3  8  
ATOM 10967 H HD1  . TYR A 1 38  ? 7.561   3.104   7.204   1.00 0.00 ? 38  TYR A HD1  8  
ATOM 10968 H HD2  . TYR A 1 38  ? 5.906   -0.184  5.024   1.00 0.00 ? 38  TYR A HD2  8  
ATOM 10969 H HE1  . TYR A 1 38  ? 9.862   2.034   7.058   1.00 0.00 ? 38  TYR A HE1  8  
ATOM 10970 H HE2  . TYR A 1 38  ? 8.213   -1.243  4.885   1.00 0.00 ? 38  TYR A HE2  8  
ATOM 10971 H HH   . TYR A 1 38  ? 10.584  -0.645  6.761   1.00 0.00 ? 38  TYR A HH   8  
ATOM 10972 N N    . VAL A 1 39  ? 2.570   3.228   4.759   1.00 0.00 ? 39  VAL A N    8  
ATOM 10973 C CA   . VAL A 1 39  ? 1.205   3.706   4.895   1.00 0.00 ? 39  VAL A CA   8  
ATOM 10974 C C    . VAL A 1 39  ? 0.763   3.564   6.353   1.00 0.00 ? 39  VAL A C    8  
ATOM 10975 O O    . VAL A 1 39  ? 1.058   2.560   7.000   1.00 0.00 ? 39  VAL A O    8  
ATOM 10976 C CB   . VAL A 1 39  ? 0.290   2.964   3.919   1.00 0.00 ? 39  VAL A CB   8  
ATOM 10977 C CG1  . VAL A 1 39  ? -1.151  3.464   4.030   1.00 0.00 ? 39  VAL A CG1  8  
ATOM 10978 C CG2  . VAL A 1 39  ? 0.805   3.089   2.483   1.00 0.00 ? 39  VAL A CG2  8  
ATOM 10979 H H    . VAL A 1 39  ? 2.680   2.422   4.177   1.00 0.00 ? 39  VAL A H    8  
ATOM 10980 H HA   . VAL A 1 39  ? 1.199   4.762   4.628   1.00 0.00 ? 39  VAL A HA   8  
ATOM 10981 H HB   . VAL A 1 39  ? 0.300   1.908   4.187   1.00 0.00 ? 39  VAL A HB   8  
ATOM 10982 H HG11 . VAL A 1 39  ? -1.168  4.550   3.931   1.00 0.00 ? 39  VAL A HG11 8  
ATOM 10983 H HG12 . VAL A 1 39  ? -1.753  3.018   3.238   1.00 0.00 ? 39  VAL A HG12 8  
ATOM 10984 H HG13 . VAL A 1 39  ? -1.560  3.182   5.000   1.00 0.00 ? 39  VAL A HG13 8  
ATOM 10985 H HG21 . VAL A 1 39  ? 0.696   2.131   1.974   1.00 0.00 ? 39  VAL A HG21 8  
ATOM 10986 H HG22 . VAL A 1 39  ? 0.229   3.849   1.956   1.00 0.00 ? 39  VAL A HG22 8  
ATOM 10987 H HG23 . VAL A 1 39  ? 1.857   3.375   2.498   1.00 0.00 ? 39  VAL A HG23 8  
ATOM 10988 N N    . SER A 1 40  ? 0.064   4.584   6.828   1.00 0.00 ? 40  SER A N    8  
ATOM 10989 C CA   . SER A 1 40  ? -0.421  4.586   8.198   1.00 0.00 ? 40  SER A CA   8  
ATOM 10990 C C    . SER A 1 40  ? -1.944  4.441   8.213   1.00 0.00 ? 40  SER A C    8  
ATOM 10991 O O    . SER A 1 40  ? -2.496  3.740   9.060   1.00 0.00 ? 40  SER A O    8  
ATOM 10992 C CB   . SER A 1 40  ? -0.002  5.863   8.929   1.00 0.00 ? 40  SER A CB   8  
ATOM 10993 O OG   . SER A 1 40  ? -0.858  6.153   10.031  1.00 0.00 ? 40  SER A OG   8  
ATOM 10994 H H    . SER A 1 40  ? -0.171  5.397   6.295   1.00 0.00 ? 40  SER A H    8  
ATOM 10995 H HA   . SER A 1 40  ? 0.049   3.725   8.672   1.00 0.00 ? 40  SER A HA   8  
ATOM 10996 H HB2  . SER A 1 40  ? 1.023   5.756   9.285   1.00 0.00 ? 40  SER A HB2  8  
ATOM 10997 H HB3  . SER A 1 40  ? -0.012  6.700   8.232   1.00 0.00 ? 40  SER A HB3  8  
ATOM 10998 H HG   . SER A 1 40  ? -0.405  5.913   10.889  1.00 0.00 ? 40  SER A HG   8  
ATOM 10999 N N    . LEU A 1 41  ? -2.581  5.117   7.268   1.00 0.00 ? 41  LEU A N    8  
ATOM 11000 C CA   . LEU A 1 41  ? -4.029  5.072   7.162   1.00 0.00 ? 41  LEU A CA   8  
ATOM 11001 C C    . LEU A 1 41  ? -4.431  5.122   5.686   1.00 0.00 ? 41  LEU A C    8  
ATOM 11002 O O    . LEU A 1 41  ? -3.729  5.716   4.869   1.00 0.00 ? 41  LEU A O    8  
ATOM 11003 C CB   . LEU A 1 41  ? -4.662  6.178   8.009   1.00 0.00 ? 41  LEU A CB   8  
ATOM 11004 C CG   . LEU A 1 41  ? -6.155  6.426   7.782   1.00 0.00 ? 41  LEU A CG   8  
ATOM 11005 C CD1  . LEU A 1 41  ? -6.406  7.023   6.395   1.00 0.00 ? 41  LEU A CD1  8  
ATOM 11006 C CD2  . LEU A 1 41  ? -6.965  5.148   8.011   1.00 0.00 ? 41  LEU A CD2  8  
ATOM 11007 H H    . LEU A 1 41  ? -2.125  5.685   6.583   1.00 0.00 ? 41  LEU A H    8  
ATOM 11008 H HA   . LEU A 1 41  ? -4.358  4.120   7.577   1.00 0.00 ? 41  LEU A HA   8  
ATOM 11009 H HB2  . LEU A 1 41  ? -4.511  5.934   9.061   1.00 0.00 ? 41  LEU A HB2  8  
ATOM 11010 H HB3  . LEU A 1 41  ? -4.126  7.107   7.818   1.00 0.00 ? 41  LEU A HB3  8  
ATOM 11011 H HG   . LEU A 1 41  ? -6.495  7.158   8.514   1.00 0.00 ? 41  LEU A HG   8  
ATOM 11012 H HD11 . LEU A 1 41  ? -7.015  7.922   6.492   1.00 0.00 ? 41  LEU A HD11 8  
ATOM 11013 H HD12 . LEU A 1 41  ? -5.453  7.278   5.932   1.00 0.00 ? 41  LEU A HD12 8  
ATOM 11014 H HD13 . LEU A 1 41  ? -6.928  6.294   5.775   1.00 0.00 ? 41  LEU A HD13 8  
ATOM 11015 H HD21 . LEU A 1 41  ? -7.669  5.012   7.190   1.00 0.00 ? 41  LEU A HD21 8  
ATOM 11016 H HD22 . LEU A 1 41  ? -6.289  4.293   8.056   1.00 0.00 ? 41  LEU A HD22 8  
ATOM 11017 H HD23 . LEU A 1 41  ? -7.512  5.228   8.949   1.00 0.00 ? 41  LEU A HD23 8  
ATOM 11018 N N    . VAL A 1 42  ? -5.557  4.491   5.391   1.00 0.00 ? 42  VAL A N    8  
ATOM 11019 C CA   . VAL A 1 42  ? -6.060  4.456   4.028   1.00 0.00 ? 42  VAL A CA   8  
ATOM 11020 C C    . VAL A 1 42  ? -7.569  4.708   4.039   1.00 0.00 ? 42  VAL A C    8  
ATOM 11021 O O    . VAL A 1 42  ? -8.325  3.950   4.646   1.00 0.00 ? 42  VAL A O    8  
ATOM 11022 C CB   . VAL A 1 42  ? -5.681  3.131   3.364   1.00 0.00 ? 42  VAL A CB   8  
ATOM 11023 C CG1  . VAL A 1 42  ? -6.648  2.790   2.228   1.00 0.00 ? 42  VAL A CG1  8  
ATOM 11024 C CG2  . VAL A 1 42  ? -4.236  3.164   2.862   1.00 0.00 ? 42  VAL A CG2  8  
ATOM 11025 H H    . VAL A 1 42  ? -6.122  4.011   6.062   1.00 0.00 ? 42  VAL A H    8  
ATOM 11026 H HA   . VAL A 1 42  ? -5.574  5.262   3.477   1.00 0.00 ? 42  VAL A HA   8  
ATOM 11027 H HB   . VAL A 1 42  ? -5.756  2.346   4.116   1.00 0.00 ? 42  VAL A HB   8  
ATOM 11028 H HG11 . VAL A 1 42  ? -6.136  2.177   1.487   1.00 0.00 ? 42  VAL A HG11 8  
ATOM 11029 H HG12 . VAL A 1 42  ? -7.499  2.241   2.629   1.00 0.00 ? 42  VAL A HG12 8  
ATOM 11030 H HG13 . VAL A 1 42  ? -6.997  3.710   1.760   1.00 0.00 ? 42  VAL A HG13 8  
ATOM 11031 H HG21 . VAL A 1 42  ? -3.658  2.390   3.367   1.00 0.00 ? 42  VAL A HG21 8  
ATOM 11032 H HG22 . VAL A 1 42  ? -4.220  2.985   1.787   1.00 0.00 ? 42  VAL A HG22 8  
ATOM 11033 H HG23 . VAL A 1 42  ? -3.799  4.140   3.074   1.00 0.00 ? 42  VAL A HG23 8  
ATOM 11034 N N    . GLU A 1 43  ? -7.964  5.777   3.362   1.00 0.00 ? 43  GLU A N    8  
ATOM 11035 C CA   . GLU A 1 43  ? -9.369  6.138   3.287   1.00 0.00 ? 43  GLU A CA   8  
ATOM 11036 C C    . GLU A 1 43  ? -10.145 5.088   2.489   1.00 0.00 ? 43  GLU A C    8  
ATOM 11037 O O    . GLU A 1 43  ? -9.662  4.595   1.471   1.00 0.00 ? 43  GLU A O    8  
ATOM 11038 C CB   . GLU A 1 43  ? -9.545  7.530   2.677   1.00 0.00 ? 43  GLU A CB   8  
ATOM 11039 C CG   . GLU A 1 43  ? -9.141  8.620   3.673   1.00 0.00 ? 43  GLU A CG   8  
ATOM 11040 C CD   . GLU A 1 43  ? -10.297 9.590   3.924   1.00 0.00 ? 43  GLU A CD   8  
ATOM 11041 O OE1  . GLU A 1 43  ? -11.220 9.191   4.667   1.00 0.00 ? 43  GLU A OE1  8  
ATOM 11042 O OE2  . GLU A 1 43  ? -10.232 10.707  3.368   1.00 0.00 ? 43  GLU A OE2  8  
ATOM 11043 H H    . GLU A 1 43  ? -7.343  6.388   2.872   1.00 0.00 ? 43  GLU A H    8  
ATOM 11044 H HA   . GLU A 1 43  ? -9.720  6.153   4.318   1.00 0.00 ? 43  GLU A HA   8  
ATOM 11045 H HB2  . GLU A 1 43  ? -8.941  7.615   1.774   1.00 0.00 ? 43  GLU A HB2  8  
ATOM 11046 H HB3  . GLU A 1 43  ? -10.584 7.672   2.380   1.00 0.00 ? 43  GLU A HB3  8  
ATOM 11047 H HG2  . GLU A 1 43  ? -8.834  8.162   4.613   1.00 0.00 ? 43  GLU A HG2  8  
ATOM 11048 H HG3  . GLU A 1 43  ? -8.280  9.167   3.289   1.00 0.00 ? 43  GLU A HG3  8  
ATOM 11049 N N    . PRO A 1 44  ? -11.367 4.769   2.994   1.00 0.00 ? 44  PRO A N    8  
ATOM 11050 C CA   . PRO A 1 44  ? -12.214 3.787   2.340   1.00 0.00 ? 44  PRO A CA   8  
ATOM 11051 C C    . PRO A 1 44  ? -12.851 4.368   1.075   1.00 0.00 ? 44  PRO A C    8  
ATOM 11052 O O    . PRO A 1 44  ? -12.877 5.584   0.891   1.00 0.00 ? 44  PRO A O    8  
ATOM 11053 C CB   . PRO A 1 44  ? -13.238 3.388   3.390   1.00 0.00 ? 44  PRO A CB   8  
ATOM 11054 C CG   . PRO A 1 44  ? -13.215 4.493   4.434   1.00 0.00 ? 44  PRO A CG   8  
ATOM 11055 C CD   . PRO A 1 44  ? -11.971 5.333   4.198   1.00 0.00 ? 44  PRO A CD   8  
ATOM 11056 H HA   . PRO A 1 44  ? -11.669 3.005   2.037   1.00 0.00 ? 44  PRO A HA   8  
ATOM 11057 H HB2  . PRO A 1 44  ? -14.230 3.287   2.951   1.00 0.00 ? 44  PRO A HB2  8  
ATOM 11058 H HB3  . PRO A 1 44  ? -12.986 2.426   3.835   1.00 0.00 ? 44  PRO A HB3  8  
ATOM 11059 H HG2  . PRO A 1 44  ? -14.112 5.108   4.358   1.00 0.00 ? 44  PRO A HG2  8  
ATOM 11060 H HG3  . PRO A 1 44  ? -13.204 4.069   5.439   1.00 0.00 ? 44  PRO A HG3  8  
ATOM 11061 H HD2  . PRO A 1 44  ? -12.224 6.384   4.059   1.00 0.00 ? 44  PRO A HD2  8  
ATOM 11062 H HD3  . PRO A 1 44  ? -11.289 5.279   5.046   1.00 0.00 ? 44  PRO A HD3  8  
ATOM 11063 N N    . GLY A 1 45  ? -13.348 3.471   0.236   1.00 0.00 ? 45  GLY A N    8  
ATOM 11064 C CA   . GLY A 1 45  ? -13.983 3.879   -1.005  1.00 0.00 ? 45  GLY A CA   8  
ATOM 11065 C C    . GLY A 1 45  ? -13.253 5.070   -1.629  1.00 0.00 ? 45  GLY A C    8  
ATOM 11066 O O    . GLY A 1 45  ? -13.869 5.902   -2.294  1.00 0.00 ? 45  GLY A O    8  
ATOM 11067 H H    . GLY A 1 45  ? -13.323 2.484   0.394   1.00 0.00 ? 45  GLY A H    8  
ATOM 11068 H HA2  . GLY A 1 45  ? -13.988 3.044   -1.706  1.00 0.00 ? 45  GLY A HA2  8  
ATOM 11069 H HA3  . GLY A 1 45  ? -15.023 4.144   -0.816  1.00 0.00 ? 45  GLY A HA3  8  
ATOM 11070 N N    . SER A 1 46  ? -11.950 5.115   -1.392  1.00 0.00 ? 46  SER A N    8  
ATOM 11071 C CA   . SER A 1 46  ? -11.129 6.191   -1.921  1.00 0.00 ? 46  SER A CA   8  
ATOM 11072 C C    . SER A 1 46  ? -10.369 5.708   -3.158  1.00 0.00 ? 46  SER A C    8  
ATOM 11073 O O    . SER A 1 46  ? -10.470 4.542   -3.538  1.00 0.00 ? 46  SER A O    8  
ATOM 11074 C CB   . SER A 1 46  ? -10.151 6.708   -0.865  1.00 0.00 ? 46  SER A CB   8  
ATOM 11075 O OG   . SER A 1 46  ? -8.995  5.882   -0.757  1.00 0.00 ? 46  SER A OG   8  
ATOM 11076 H H    . SER A 1 46  ? -11.456 4.434   -0.850  1.00 0.00 ? 46  SER A H    8  
ATOM 11077 H HA   . SER A 1 46  ? -11.829 6.983   -2.187  1.00 0.00 ? 46  SER A HA   8  
ATOM 11078 H HB2  . SER A 1 46  ? -9.847  7.724   -1.119  1.00 0.00 ? 46  SER A HB2  8  
ATOM 11079 H HB3  . SER A 1 46  ? -10.653 6.758   0.101   1.00 0.00 ? 46  SER A HB3  8  
ATOM 11080 H HG   . SER A 1 46  ? -9.049  5.325   0.072   1.00 0.00 ? 46  SER A HG   8  
ATOM 11081 N N    . LEU A 1 47  ? -9.624  6.629   -3.753  1.00 0.00 ? 47  LEU A N    8  
ATOM 11082 C CA   . LEU A 1 47  ? -8.847  6.312   -4.939  1.00 0.00 ? 47  LEU A CA   8  
ATOM 11083 C C    . LEU A 1 47  ? -7.670  5.417   -4.547  1.00 0.00 ? 47  LEU A C    8  
ATOM 11084 O O    . LEU A 1 47  ? -7.445  4.376   -5.164  1.00 0.00 ? 47  LEU A O    8  
ATOM 11085 C CB   . LEU A 1 47  ? -8.431  7.593   -5.664  1.00 0.00 ? 47  LEU A CB   8  
ATOM 11086 C CG   . LEU A 1 47  ? -7.593  7.404   -6.931  1.00 0.00 ? 47  LEU A CG   8  
ATOM 11087 C CD1  . LEU A 1 47  ? -8.050  6.170   -7.711  1.00 0.00 ? 47  LEU A CD1  8  
ATOM 11088 C CD2  . LEU A 1 47  ? -7.613  8.667   -7.794  1.00 0.00 ? 47  LEU A CD2  8  
ATOM 11089 H H    . LEU A 1 47  ? -9.548  7.575   -3.438  1.00 0.00 ? 47  LEU A H    8  
ATOM 11090 H HA   . LEU A 1 47  ? -9.495  5.755   -5.615  1.00 0.00 ? 47  LEU A HA   8  
ATOM 11091 H HB2  . LEU A 1 47  ? -9.332  8.147   -5.928  1.00 0.00 ? 47  LEU A HB2  8  
ATOM 11092 H HB3  . LEU A 1 47  ? -7.866  8.214   -4.969  1.00 0.00 ? 47  LEU A HB3  8  
ATOM 11093 H HG   . LEU A 1 47  ? -6.559  7.233   -6.634  1.00 0.00 ? 47  LEU A HG   8  
ATOM 11094 H HD11 . LEU A 1 47  ? -7.343  5.967   -8.515  1.00 0.00 ? 47  LEU A HD11 8  
ATOM 11095 H HD12 . LEU A 1 47  ? -8.093  5.312   -7.040  1.00 0.00 ? 47  LEU A HD12 8  
ATOM 11096 H HD13 . LEU A 1 47  ? -9.038  6.352   -8.133  1.00 0.00 ? 47  LEU A HD13 8  
ATOM 11097 H HD21 . LEU A 1 47  ? -8.637  9.028   -7.888  1.00 0.00 ? 47  LEU A HD21 8  
ATOM 11098 H HD22 . LEU A 1 47  ? -6.998  9.437   -7.326  1.00 0.00 ? 47  LEU A HD22 8  
ATOM 11099 H HD23 . LEU A 1 47  ? -7.216  8.437   -8.783  1.00 0.00 ? 47  LEU A HD23 8  
ATOM 11100 N N    . ALA A 1 48  ? -6.950  5.853   -3.524  1.00 0.00 ? 48  ALA A N    8  
ATOM 11101 C CA   . ALA A 1 48  ? -5.802  5.104   -3.044  1.00 0.00 ? 48  ALA A CA   8  
ATOM 11102 C C    . ALA A 1 48  ? -6.197  3.638   -2.855  1.00 0.00 ? 48  ALA A C    8  
ATOM 11103 O O    . ALA A 1 48  ? -5.700  2.762   -3.561  1.00 0.00 ? 48  ALA A O    8  
ATOM 11104 C CB   . ALA A 1 48  ? -5.283  5.738   -1.752  1.00 0.00 ? 48  ALA A CB   8  
ATOM 11105 H H    . ALA A 1 48  ? -7.140  6.700   -3.028  1.00 0.00 ? 48  ALA A H    8  
ATOM 11106 H HA   . ALA A 1 48  ? -5.023  5.167   -3.803  1.00 0.00 ? 48  ALA A HA   8  
ATOM 11107 H HB1  . ALA A 1 48  ? -5.774  6.698   -1.595  1.00 0.00 ? 48  ALA A HB1  8  
ATOM 11108 H HB2  . ALA A 1 48  ? -5.498  5.078   -0.911  1.00 0.00 ? 48  ALA A HB2  8  
ATOM 11109 H HB3  . ALA A 1 48  ? -4.206  5.890   -1.828  1.00 0.00 ? 48  ALA A HB3  8  
ATOM 11110 N N    . GLU A 1 49  ? -7.088  3.416   -1.900  1.00 0.00 ? 49  GLU A N    8  
ATOM 11111 C CA   . GLU A 1 49  ? -7.555  2.071   -1.610  1.00 0.00 ? 49  GLU A CA   8  
ATOM 11112 C C    . GLU A 1 49  ? -7.981  1.368   -2.900  1.00 0.00 ? 49  GLU A C    8  
ATOM 11113 O O    . GLU A 1 49  ? -7.831  0.153   -3.027  1.00 0.00 ? 49  GLU A O    8  
ATOM 11114 C CB   . GLU A 1 49  ? -8.700  2.096   -0.595  1.00 0.00 ? 49  GLU A CB   8  
ATOM 11115 C CG   . GLU A 1 49  ? -9.175  0.678   -0.270  1.00 0.00 ? 49  GLU A CG   8  
ATOM 11116 C CD   . GLU A 1 49  ? -9.061  0.392   1.229   1.00 0.00 ? 49  GLU A CD   8  
ATOM 11117 O OE1  . GLU A 1 49  ? -9.566  1.231   2.006   1.00 0.00 ? 49  GLU A OE1  8  
ATOM 11118 O OE2  . GLU A 1 49  ? -8.472  -0.658  1.563   1.00 0.00 ? 49  GLU A OE2  8  
ATOM 11119 H H    . GLU A 1 49  ? -7.487  4.134   -1.330  1.00 0.00 ? 49  GLU A H    8  
ATOM 11120 H HA   . GLU A 1 49  ? -6.701  1.556   -1.171  1.00 0.00 ? 49  GLU A HA   8  
ATOM 11121 H HB2  . GLU A 1 49  ? -8.372  2.592   0.318   1.00 0.00 ? 49  GLU A HB2  8  
ATOM 11122 H HB3  . GLU A 1 49  ? -9.531  2.679   -0.993  1.00 0.00 ? 49  GLU A HB3  8  
ATOM 11123 H HG2  . GLU A 1 49  ? -10.210 0.555   -0.590  1.00 0.00 ? 49  GLU A HG2  8  
ATOM 11124 H HG3  . GLU A 1 49  ? -8.581  -0.045  -0.828  1.00 0.00 ? 49  GLU A HG3  8  
ATOM 11125 N N    . LYS A 1 50  ? -8.502  2.161   -3.825  1.00 0.00 ? 50  LYS A N    8  
ATOM 11126 C CA   . LYS A 1 50  ? -8.950  1.629   -5.100  1.00 0.00 ? 50  LYS A CA   8  
ATOM 11127 C C    . LYS A 1 50  ? -7.733  1.226   -5.936  1.00 0.00 ? 50  LYS A C    8  
ATOM 11128 O O    . LYS A 1 50  ? -7.799  0.281   -6.720  1.00 0.00 ? 50  LYS A O    8  
ATOM 11129 C CB   . LYS A 1 50  ? -9.875  2.626   -5.802  1.00 0.00 ? 50  LYS A CB   8  
ATOM 11130 C CG   . LYS A 1 50  ? -11.302 2.523   -5.262  1.00 0.00 ? 50  LYS A CG   8  
ATOM 11131 C CD   . LYS A 1 50  ? -12.110 3.776   -5.606  1.00 0.00 ? 50  LYS A CD   8  
ATOM 11132 C CE   . LYS A 1 50  ? -13.069 3.509   -6.768  1.00 0.00 ? 50  LYS A CE   8  
ATOM 11133 N NZ   . LYS A 1 50  ? -14.373 4.166   -6.527  1.00 0.00 ? 50  LYS A NZ   8  
ATOM 11134 H H    . LYS A 1 50  ? -8.620  3.147   -3.713  1.00 0.00 ? 50  LYS A H    8  
ATOM 11135 H HA   . LYS A 1 50  ? -9.538  0.735   -4.893  1.00 0.00 ? 50  LYS A HA   8  
ATOM 11136 H HB2  . LYS A 1 50  ? -9.500  3.639   -5.657  1.00 0.00 ? 50  LYS A HB2  8  
ATOM 11137 H HB3  . LYS A 1 50  ? -9.873  2.436   -6.875  1.00 0.00 ? 50  LYS A HB3  8  
ATOM 11138 H HG2  . LYS A 1 50  ? -11.791 1.644   -5.682  1.00 0.00 ? 50  LYS A HG2  8  
ATOM 11139 H HG3  . LYS A 1 50  ? -11.277 2.387   -4.181  1.00 0.00 ? 50  LYS A HG3  8  
ATOM 11140 H HD2  . LYS A 1 50  ? -12.675 4.100   -4.732  1.00 0.00 ? 50  LYS A HD2  8  
ATOM 11141 H HD3  . LYS A 1 50  ? -11.433 4.589   -5.868  1.00 0.00 ? 50  LYS A HD3  8  
ATOM 11142 H HE2  . LYS A 1 50  ? -12.635 3.878   -7.697  1.00 0.00 ? 50  LYS A HE2  8  
ATOM 11143 H HE3  . LYS A 1 50  ? -13.213 2.435   -6.889  1.00 0.00 ? 50  LYS A HE3  8  
ATOM 11144 H HZ1  . LYS A 1 50  ? -14.221 5.107   -6.225  1.00 0.00 ? 50  LYS A HZ1  8  
ATOM 11145 H HZ2  . LYS A 1 50  ? -14.906 4.168   -7.372  1.00 0.00 ? 50  LYS A HZ2  8  
ATOM 11146 H HZ3  . LYS A 1 50  ? -14.872 3.665   -5.819  1.00 0.00 ? 50  LYS A HZ3  8  
ATOM 11147 N N    . GLU A 1 51  ? -6.650  1.963   -5.739  1.00 0.00 ? 51  GLU A N    8  
ATOM 11148 C CA   . GLU A 1 51  ? -5.420  1.695   -6.464  1.00 0.00 ? 51  GLU A CA   8  
ATOM 11149 C C    . GLU A 1 51  ? -4.763  0.416   -5.941  1.00 0.00 ? 51  GLU A C    8  
ATOM 11150 O O    . GLU A 1 51  ? -3.955  -0.200  -6.634  1.00 0.00 ? 51  GLU A O    8  
ATOM 11151 C CB   . GLU A 1 51  ? -4.459  2.882   -6.372  1.00 0.00 ? 51  GLU A CB   8  
ATOM 11152 C CG   . GLU A 1 51  ? -4.979  4.072   -7.180  1.00 0.00 ? 51  GLU A CG   8  
ATOM 11153 C CD   . GLU A 1 51  ? -5.230  3.679   -8.637  1.00 0.00 ? 51  GLU A CD   8  
ATOM 11154 O OE1  . GLU A 1 51  ? -6.364  3.236   -8.918  1.00 0.00 ? 51  GLU A OE1  8  
ATOM 11155 O OE2  . GLU A 1 51  ? -4.281  3.831   -9.437  1.00 0.00 ? 51  GLU A OE2  8  
ATOM 11156 H H    . GLU A 1 51  ? -6.604  2.730   -5.098  1.00 0.00 ? 51  GLU A H    8  
ATOM 11157 H HA   . GLU A 1 51  ? -5.720  1.558   -7.503  1.00 0.00 ? 51  GLU A HA   8  
ATOM 11158 H HB2  . GLU A 1 51  ? -4.333  3.172   -5.329  1.00 0.00 ? 51  GLU A HB2  8  
ATOM 11159 H HB3  . GLU A 1 51  ? -3.476  2.588   -6.742  1.00 0.00 ? 51  GLU A HB3  8  
ATOM 11160 H HG2  . GLU A 1 51  ? -5.903  4.442   -6.735  1.00 0.00 ? 51  GLU A HG2  8  
ATOM 11161 H HG3  . GLU A 1 51  ? -4.257  4.888   -7.138  1.00 0.00 ? 51  GLU A HG3  8  
ATOM 11162 N N    . GLY A 1 52  ? -5.136  0.054   -4.722  1.00 0.00 ? 52  GLY A N    8  
ATOM 11163 C CA   . GLY A 1 52  ? -4.593  -1.141  -4.097  1.00 0.00 ? 52  GLY A CA   8  
ATOM 11164 C C    . GLY A 1 52  ? -3.904  -0.803  -2.774  1.00 0.00 ? 52  GLY A C    8  
ATOM 11165 O O    . GLY A 1 52  ? -3.686  -1.682  -1.941  1.00 0.00 ? 52  GLY A O    8  
ATOM 11166 H H    . GLY A 1 52  ? -5.794  0.560   -4.165  1.00 0.00 ? 52  GLY A H    8  
ATOM 11167 H HA2  . GLY A 1 52  ? -5.393  -1.859  -3.922  1.00 0.00 ? 52  GLY A HA2  8  
ATOM 11168 H HA3  . GLY A 1 52  ? -3.880  -1.616  -4.771  1.00 0.00 ? 52  GLY A HA3  8  
ATOM 11169 N N    . LEU A 1 53  ? -3.580  0.473   -2.621  1.00 0.00 ? 53  LEU A N    8  
ATOM 11170 C CA   . LEU A 1 53  ? -2.920  0.938   -1.412  1.00 0.00 ? 53  LEU A CA   8  
ATOM 11171 C C    . LEU A 1 53  ? -3.667  0.401   -0.190  1.00 0.00 ? 53  LEU A C    8  
ATOM 11172 O O    . LEU A 1 53  ? -4.809  -0.042  -0.301  1.00 0.00 ? 53  LEU A O    8  
ATOM 11173 C CB   . LEU A 1 53  ? -2.783  2.461   -1.429  1.00 0.00 ? 53  LEU A CB   8  
ATOM 11174 C CG   . LEU A 1 53  ? -1.465  3.022   -0.893  1.00 0.00 ? 53  LEU A CG   8  
ATOM 11175 C CD1  . LEU A 1 53  ? -0.465  3.253   -2.028  1.00 0.00 ? 53  LEU A CD1  8  
ATOM 11176 C CD2  . LEU A 1 53  ? -1.702  4.291   -0.071  1.00 0.00 ? 53  LEU A CD2  8  
ATOM 11177 H H    . LEU A 1 53  ? -3.761  1.181   -3.303  1.00 0.00 ? 53  LEU A H    8  
ATOM 11178 H HA   . LEU A 1 53  ? -1.912  0.523   -1.411  1.00 0.00 ? 53  LEU A HA   8  
ATOM 11179 H HB2  . LEU A 1 53  ? -2.912  2.807   -2.455  1.00 0.00 ? 53  LEU A HB2  8  
ATOM 11180 H HB3  . LEU A 1 53  ? -3.600  2.886   -0.845  1.00 0.00 ? 53  LEU A HB3  8  
ATOM 11181 H HG   . LEU A 1 53  ? -1.026  2.282   -0.223  1.00 0.00 ? 53  LEU A HG   8  
ATOM 11182 H HD11 . LEU A 1 53  ? -0.989  3.230   -2.984  1.00 0.00 ? 53  LEU A HD11 8  
ATOM 11183 H HD12 . LEU A 1 53  ? 0.013   4.224   -1.899  1.00 0.00 ? 53  LEU A HD12 8  
ATOM 11184 H HD13 . LEU A 1 53  ? 0.292   2.470   -2.010  1.00 0.00 ? 53  LEU A HD13 8  
ATOM 11185 H HD21 . LEU A 1 53  ? -0.766  4.605   0.391   1.00 0.00 ? 53  LEU A HD21 8  
ATOM 11186 H HD22 . LEU A 1 53  ? -2.068  5.083   -0.724  1.00 0.00 ? 53  LEU A HD22 8  
ATOM 11187 H HD23 . LEU A 1 53  ? -2.441  4.088   0.704   1.00 0.00 ? 53  LEU A HD23 8  
ATOM 11188 N N    . ARG A 1 54  ? -2.992  0.457   0.949   1.00 0.00 ? 54  ARG A N    8  
ATOM 11189 C CA   . ARG A 1 54  ? -3.577  -0.018  2.191   1.00 0.00 ? 54  ARG A CA   8  
ATOM 11190 C C    . ARG A 1 54  ? -2.506  -0.113  3.280   1.00 0.00 ? 54  ARG A C    8  
ATOM 11191 O O    . ARG A 1 54  ? -1.400  -0.588  3.028   1.00 0.00 ? 54  ARG A O    8  
ATOM 11192 C CB   . ARG A 1 54  ? -4.227  -1.390  2.004   1.00 0.00 ? 54  ARG A CB   8  
ATOM 11193 C CG   . ARG A 1 54  ? -5.707  -1.352  2.390   1.00 0.00 ? 54  ARG A CG   8  
ATOM 11194 C CD   . ARG A 1 54  ? -5.983  -2.256  3.593   1.00 0.00 ? 54  ARG A CD   8  
ATOM 11195 N NE   . ARG A 1 54  ? -6.548  -3.546  3.138   1.00 0.00 ? 54  ARG A NE   8  
ATOM 11196 C CZ   . ARG A 1 54  ? -7.057  -4.475  3.959   1.00 0.00 ? 54  ARG A CZ   8  
ATOM 11197 N NH1  . ARG A 1 54  ? -7.077  -4.261  5.282   1.00 0.00 ? 54  ARG A NH1  8  
ATOM 11198 N NH2  . ARG A 1 54  ? -7.548  -5.616  3.458   1.00 0.00 ? 54  ARG A NH2  8  
ATOM 11199 H H    . ARG A 1 54  ? -2.063  0.819   1.030   1.00 0.00 ? 54  ARG A H    8  
ATOM 11200 H HA   . ARG A 1 54  ? -4.331  0.727   2.446   1.00 0.00 ? 54  ARG A HA   8  
ATOM 11201 H HB2  . ARG A 1 54  ? -4.127  -1.705  0.965   1.00 0.00 ? 54  ARG A HB2  8  
ATOM 11202 H HB3  . ARG A 1 54  ? -3.707  -2.129  2.613   1.00 0.00 ? 54  ARG A HB3  8  
ATOM 11203 H HG2  . ARG A 1 54  ? -6.000  -0.329  2.625   1.00 0.00 ? 54  ARG A HG2  8  
ATOM 11204 H HG3  . ARG A 1 54  ? -6.316  -1.671  1.544   1.00 0.00 ? 54  ARG A HG3  8  
ATOM 11205 H HD2  . ARG A 1 54  ? -5.060  -2.429  4.148   1.00 0.00 ? 54  ARG A HD2  8  
ATOM 11206 H HD3  . ARG A 1 54  ? -6.678  -1.766  4.275   1.00 0.00 ? 54  ARG A HD3  8  
ATOM 11207 H HE   . ARG A 1 54  ? -6.549  -3.737  2.157   1.00 0.00 ? 54  ARG A HE   8  
ATOM 11208 H HH11 . ARG A 1 54  ? -6.710  -3.409  5.657   1.00 0.00 ? 54  ARG A HH11 8  
ATOM 11209 H HH12 . ARG A 1 54  ? -7.457  -4.954  5.895   1.00 0.00 ? 54  ARG A HH12 8  
ATOM 11210 H HH21 . ARG A 1 54  ? -7.534  -5.775  2.470   1.00 0.00 ? 54  ARG A HH21 8  
ATOM 11211 H HH22 . ARG A 1 54  ? -7.929  -6.309  4.070   1.00 0.00 ? 54  ARG A HH22 8  
ATOM 11212 N N    . VAL A 1 55  ? -2.873  0.348   4.467   1.00 0.00 ? 55  VAL A N    8  
ATOM 11213 C CA   . VAL A 1 55  ? -1.958  0.321   5.595   1.00 0.00 ? 55  VAL A CA   8  
ATOM 11214 C C    . VAL A 1 55  ? -1.183  -0.999  5.586   1.00 0.00 ? 55  VAL A C    8  
ATOM 11215 O O    . VAL A 1 55  ? -1.771  -2.069  5.734   1.00 0.00 ? 55  VAL A O    8  
ATOM 11216 C CB   . VAL A 1 55  ? -2.726  0.554   6.898   1.00 0.00 ? 55  VAL A CB   8  
ATOM 11217 C CG1  . VAL A 1 55  ? -1.820  0.346   8.113   1.00 0.00 ? 55  VAL A CG1  8  
ATOM 11218 C CG2  . VAL A 1 55  ? -3.361  1.946   6.918   1.00 0.00 ? 55  VAL A CG2  8  
ATOM 11219 H H    . VAL A 1 55  ? -3.775  0.733   4.663   1.00 0.00 ? 55  VAL A H    8  
ATOM 11220 H HA   . VAL A 1 55  ? -1.253  1.142   5.467   1.00 0.00 ? 55  VAL A HA   8  
ATOM 11221 H HB   . VAL A 1 55  ? -3.529  -0.181  6.949   1.00 0.00 ? 55  VAL A HB   8  
ATOM 11222 H HG11 . VAL A 1 55  ? -1.550  1.315   8.534   1.00 0.00 ? 55  VAL A HG11 8  
ATOM 11223 H HG12 . VAL A 1 55  ? -2.348  -0.242  8.864   1.00 0.00 ? 55  VAL A HG12 8  
ATOM 11224 H HG13 . VAL A 1 55  ? -0.917  -0.181  7.807   1.00 0.00 ? 55  VAL A HG13 8  
ATOM 11225 H HG21 . VAL A 1 55  ? -3.715  2.169   7.925   1.00 0.00 ? 55  VAL A HG21 8  
ATOM 11226 H HG22 . VAL A 1 55  ? -2.620  2.687   6.620   1.00 0.00 ? 55  VAL A HG22 8  
ATOM 11227 H HG23 . VAL A 1 55  ? -4.201  1.972   6.224   1.00 0.00 ? 55  VAL A HG23 8  
ATOM 11228 N N    . GLY A 1 56  ? 0.125   -0.878  5.412   1.00 0.00 ? 56  GLY A N    8  
ATOM 11229 C CA   . GLY A 1 56  ? 0.987   -2.048  5.381   1.00 0.00 ? 56  GLY A CA   8  
ATOM 11230 C C    . GLY A 1 56  ? 2.074   -1.900  4.316   1.00 0.00 ? 56  GLY A C    8  
ATOM 11231 O O    . GLY A 1 56  ? 3.238   -2.211  4.564   1.00 0.00 ? 56  GLY A O    8  
ATOM 11232 H H    . GLY A 1 56  ? 0.595   -0.004  5.292   1.00 0.00 ? 56  GLY A H    8  
ATOM 11233 H HA2  . GLY A 1 56  ? 1.447   -2.190  6.359   1.00 0.00 ? 56  GLY A HA2  8  
ATOM 11234 H HA3  . GLY A 1 56  ? 0.391   -2.938  5.177   1.00 0.00 ? 56  GLY A HA3  8  
ATOM 11235 N N    . ASP A 1 57  ? 1.657   -1.426  3.151   1.00 0.00 ? 57  ASP A N    8  
ATOM 11236 C CA   . ASP A 1 57  ? 2.581   -1.233  2.047   1.00 0.00 ? 57  ASP A CA   8  
ATOM 11237 C C    . ASP A 1 57  ? 3.791   -0.432  2.534   1.00 0.00 ? 57  ASP A C    8  
ATOM 11238 O O    . ASP A 1 57  ? 3.865   -0.063  3.705   1.00 0.00 ? 57  ASP A O    8  
ATOM 11239 C CB   . ASP A 1 57  ? 1.924   -0.451  0.908   1.00 0.00 ? 57  ASP A CB   8  
ATOM 11240 C CG   . ASP A 1 57  ? 0.642   -1.074  0.352   1.00 0.00 ? 57  ASP A CG   8  
ATOM 11241 O OD1  . ASP A 1 57  ? 0.120   -1.991  1.021   1.00 0.00 ? 57  ASP A OD1  8  
ATOM 11242 O OD2  . ASP A 1 57  ? 0.213   -0.618  -0.730  1.00 0.00 ? 57  ASP A OD2  8  
ATOM 11243 H H    . ASP A 1 57  ? 0.709   -1.175  2.957   1.00 0.00 ? 57  ASP A H    8  
ATOM 11244 H HA   . ASP A 1 57  ? 2.850   -2.237  1.720   1.00 0.00 ? 57  ASP A HA   8  
ATOM 11245 H HB2  . ASP A 1 57  ? 1.697   0.555   1.262   1.00 0.00 ? 57  ASP A HB2  8  
ATOM 11246 H HB3  . ASP A 1 57  ? 2.642   -0.348  0.095   1.00 0.00 ? 57  ASP A HB3  8  
ATOM 11247 N N    . GLN A 1 58  ? 4.708   -0.187  1.610   1.00 0.00 ? 58  GLN A N    8  
ATOM 11248 C CA   . GLN A 1 58  ? 5.911   0.564   1.930   1.00 0.00 ? 58  GLN A CA   8  
ATOM 11249 C C    . GLN A 1 58  ? 6.240   1.545   0.804   1.00 0.00 ? 58  GLN A C    8  
ATOM 11250 O O    . GLN A 1 58  ? 6.602   1.133   -0.297  1.00 0.00 ? 58  GLN A O    8  
ATOM 11251 C CB   . GLN A 1 58  ? 7.088   -0.376  2.200   1.00 0.00 ? 58  GLN A CB   8  
ATOM 11252 C CG   . GLN A 1 58  ? 8.349   0.413   2.556   1.00 0.00 ? 58  GLN A CG   8  
ATOM 11253 C CD   . GLN A 1 58  ? 9.531   -0.526  2.805   1.00 0.00 ? 58  GLN A CD   8  
ATOM 11254 O OE1  . GLN A 1 58  ? 9.454   -1.728  2.613   1.00 0.00 ? 58  GLN A OE1  8  
ATOM 11255 N NE2  . GLN A 1 58  ? 10.626  0.088   3.243   1.00 0.00 ? 58  GLN A NE2  8  
ATOM 11256 H H    . GLN A 1 58  ? 4.640   -0.490  0.659   1.00 0.00 ? 58  GLN A H    8  
ATOM 11257 H HA   . GLN A 1 58  ? 5.676   1.112   2.842   1.00 0.00 ? 58  GLN A HA   8  
ATOM 11258 H HB2  . GLN A 1 58  ? 6.837   -1.055  3.015   1.00 0.00 ? 58  GLN A HB2  8  
ATOM 11259 H HB3  . GLN A 1 58  ? 7.276   -0.991  1.320   1.00 0.00 ? 58  GLN A HB3  8  
ATOM 11260 H HG2  . GLN A 1 58  ? 8.592   1.102   1.747   1.00 0.00 ? 58  GLN A HG2  8  
ATOM 11261 H HG3  . GLN A 1 58  ? 8.166   1.017   3.445   1.00 0.00 ? 58  GLN A HG3  8  
ATOM 11262 H HE21 . GLN A 1 58  ? 10.623  1.079   3.381   1.00 0.00 ? 58  GLN A HE21 8  
ATOM 11263 H HE22 . GLN A 1 58  ? 11.453  -0.440  3.436   1.00 0.00 ? 58  GLN A HE22 8  
ATOM 11264 N N    . ILE A 1 59  ? 6.102   2.825   1.118   1.00 0.00 ? 59  ILE A N    8  
ATOM 11265 C CA   . ILE A 1 59  ? 6.379   3.869   0.146   1.00 0.00 ? 59  ILE A CA   8  
ATOM 11266 C C    . ILE A 1 59  ? 7.881   3.900   -0.146  1.00 0.00 ? 59  ILE A C    8  
ATOM 11267 O O    . ILE A 1 59  ? 8.620   4.671   0.465   1.00 0.00 ? 59  ILE A O    8  
ATOM 11268 C CB   . ILE A 1 59  ? 5.818   5.209   0.624   1.00 0.00 ? 59  ILE A CB   8  
ATOM 11269 C CG1  . ILE A 1 59  ? 4.344   5.078   1.014   1.00 0.00 ? 59  ILE A CG1  8  
ATOM 11270 C CG2  . ILE A 1 59  ? 6.038   6.301   -0.425  1.00 0.00 ? 59  ILE A CG2  8  
ATOM 11271 C CD1  . ILE A 1 59  ? 3.460   4.923   -0.226  1.00 0.00 ? 59  ILE A CD1  8  
ATOM 11272 H H    . ILE A 1 59  ? 5.806   3.151   2.016   1.00 0.00 ? 59  ILE A H    8  
ATOM 11273 H HA   . ILE A 1 59  ? 5.854   3.608   -0.773  1.00 0.00 ? 59  ILE A HA   8  
ATOM 11274 H HB   . ILE A 1 59  ? 6.362   5.508   1.519   1.00 0.00 ? 59  ILE A HB   8  
ATOM 11275 H HG12 . ILE A 1 59  ? 4.213   4.216   1.668   1.00 0.00 ? 59  ILE A HG12 8  
ATOM 11276 H HG13 . ILE A 1 59  ? 4.034   5.958   1.578   1.00 0.00 ? 59  ILE A HG13 8  
ATOM 11277 H HG21 . ILE A 1 59  ? 6.773   5.961   -1.155  1.00 0.00 ? 59  ILE A HG21 8  
ATOM 11278 H HG22 . ILE A 1 59  ? 5.096   6.515   -0.931  1.00 0.00 ? 59  ILE A HG22 8  
ATOM 11279 H HG23 . ILE A 1 59  ? 6.402   7.205   0.063   1.00 0.00 ? 59  ILE A HG23 8  
ATOM 11280 H HD11 . ILE A 1 59  ? 3.027   5.889   -0.486  1.00 0.00 ? 59  ILE A HD11 8  
ATOM 11281 H HD12 . ILE A 1 59  ? 4.063   4.559   -1.058  1.00 0.00 ? 59  ILE A HD12 8  
ATOM 11282 H HD13 . ILE A 1 59  ? 2.662   4.211   -0.016  1.00 0.00 ? 59  ILE A HD13 8  
ATOM 11283 N N    . LEU A 1 60  ? 8.287   3.054   -1.081  1.00 0.00 ? 60  LEU A N    8  
ATOM 11284 C CA   . LEU A 1 60  ? 9.687   2.975   -1.462  1.00 0.00 ? 60  LEU A CA   8  
ATOM 11285 C C    . LEU A 1 60  ? 10.116  4.303   -2.090  1.00 0.00 ? 60  LEU A C    8  
ATOM 11286 O O    . LEU A 1 60  ? 11.065  4.935   -1.628  1.00 0.00 ? 60  LEU A O    8  
ATOM 11287 C CB   . LEU A 1 60  ? 9.930   1.762   -2.363  1.00 0.00 ? 60  LEU A CB   8  
ATOM 11288 C CG   . LEU A 1 60  ? 9.298   0.448   -1.902  1.00 0.00 ? 60  LEU A CG   8  
ATOM 11289 C CD1  . LEU A 1 60  ? 9.605   -0.683  -2.886  1.00 0.00 ? 60  LEU A CD1  8  
ATOM 11290 C CD2  . LEU A 1 60  ? 9.732   0.100   -0.476  1.00 0.00 ? 60  LEU A CD2  8  
ATOM 11291 H H    . LEU A 1 60  ? 7.680   2.431   -1.574  1.00 0.00 ? 60  LEU A H    8  
ATOM 11292 H HA   . LEU A 1 60  ? 10.266  2.821   -0.551  1.00 0.00 ? 60  LEU A HA   8  
ATOM 11293 H HB2  . LEU A 1 60  ? 9.555   1.993   -3.359  1.00 0.00 ? 60  LEU A HB2  8  
ATOM 11294 H HB3  . LEU A 1 60  ? 11.006  1.613   -2.454  1.00 0.00 ? 60  LEU A HB3  8  
ATOM 11295 H HG   . LEU A 1 60  ? 8.216   0.576   -1.886  1.00 0.00 ? 60  LEU A HG   8  
ATOM 11296 H HD11 . LEU A 1 60  ? 10.518  -0.450  -3.434  1.00 0.00 ? 60  LEU A HD11 8  
ATOM 11297 H HD12 . LEU A 1 60  ? 9.738   -1.616  -2.338  1.00 0.00 ? 60  LEU A HD12 8  
ATOM 11298 H HD13 . LEU A 1 60  ? 8.777   -0.789  -3.587  1.00 0.00 ? 60  LEU A HD13 8  
ATOM 11299 H HD21 . LEU A 1 60  ? 9.026   -0.608  -0.044  1.00 0.00 ? 60  LEU A HD21 8  
ATOM 11300 H HD22 . LEU A 1 60  ? 10.727  -0.346  -0.498  1.00 0.00 ? 60  LEU A HD22 8  
ATOM 11301 H HD23 . LEU A 1 60  ? 9.754   1.007   0.128   1.00 0.00 ? 60  LEU A HD23 8  
ATOM 11302 N N    . ARG A 1 61  ? 9.395   4.687   -3.134  1.00 0.00 ? 61  ARG A N    8  
ATOM 11303 C CA   . ARG A 1 61  ? 9.689   5.928   -3.830  1.00 0.00 ? 61  ARG A CA   8  
ATOM 11304 C C    . ARG A 1 61  ? 8.455   6.833   -3.846  1.00 0.00 ? 61  ARG A C    8  
ATOM 11305 O O    . ARG A 1 61  ? 7.345   6.379   -3.575  1.00 0.00 ? 61  ARG A O    8  
ATOM 11306 C CB   . ARG A 1 61  ? 10.135  5.660   -5.269  1.00 0.00 ? 61  ARG A CB   8  
ATOM 11307 C CG   . ARG A 1 61  ? 11.646  5.434   -5.342  1.00 0.00 ? 61  ARG A CG   8  
ATOM 11308 C CD   . ARG A 1 61  ? 12.038  4.770   -6.663  1.00 0.00 ? 61  ARG A CD   8  
ATOM 11309 N NE   . ARG A 1 61  ? 13.467  4.385   -6.632  1.00 0.00 ? 61  ARG A NE   8  
ATOM 11310 C CZ   . ARG A 1 61  ? 14.032  3.525   -7.491  1.00 0.00 ? 61  ARG A CZ   8  
ATOM 11311 N NH1  . ARG A 1 61  ? 13.293  2.956   -8.453  1.00 0.00 ? 61  ARG A NH1  8  
ATOM 11312 N NH2  . ARG A 1 61  ? 15.336  3.235   -7.388  1.00 0.00 ? 61  ARG A NH2  8  
ATOM 11313 H H    . ARG A 1 61  ? 8.625   4.167   -3.503  1.00 0.00 ? 61  ARG A H    8  
ATOM 11314 H HA   . ARG A 1 61  ? 10.501  6.381   -3.261  1.00 0.00 ? 61  ARG A HA   8  
ATOM 11315 H HB2  . ARG A 1 61  ? 9.613   4.786   -5.658  1.00 0.00 ? 61  ARG A HB2  8  
ATOM 11316 H HB3  . ARG A 1 61  ? 9.859   6.504   -5.902  1.00 0.00 ? 61  ARG A HB3  8  
ATOM 11317 H HG2  . ARG A 1 61  ? 12.166  6.386   -5.241  1.00 0.00 ? 61  ARG A HG2  8  
ATOM 11318 H HG3  . ARG A 1 61  ? 11.964  4.807   -4.508  1.00 0.00 ? 61  ARG A HG3  8  
ATOM 11319 H HD2  . ARG A 1 61  ? 11.419  3.889   -6.835  1.00 0.00 ? 61  ARG A HD2  8  
ATOM 11320 H HD3  . ARG A 1 61  ? 11.855  5.454   -7.492  1.00 0.00 ? 61  ARG A HD3  8  
ATOM 11321 H HE   . ARG A 1 61  ? 14.047  4.791   -5.926  1.00 0.00 ? 61  ARG A HE   8  
ATOM 11322 H HH11 . ARG A 1 61  ? 12.320  3.173   -8.531  1.00 0.00 ? 61  ARG A HH11 8  
ATOM 11323 H HH12 . ARG A 1 61  ? 13.715  2.315   -9.094  1.00 0.00 ? 61  ARG A HH12 8  
ATOM 11324 H HH21 . ARG A 1 61  ? 15.887  3.660   -6.670  1.00 0.00 ? 61  ARG A HH21 8  
ATOM 11325 H HH22 . ARG A 1 61  ? 15.758  2.593   -8.029  1.00 0.00 ? 61  ARG A HH22 8  
ATOM 11326 N N    . VAL A 1 62  ? 8.692   8.097   -4.165  1.00 0.00 ? 62  VAL A N    8  
ATOM 11327 C CA   . VAL A 1 62  ? 7.614   9.069   -4.220  1.00 0.00 ? 62  VAL A CA   8  
ATOM 11328 C C    . VAL A 1 62  ? 7.871   10.046  -5.369  1.00 0.00 ? 62  VAL A C    8  
ATOM 11329 O O    . VAL A 1 62  ? 8.760   10.891  -5.283  1.00 0.00 ? 62  VAL A O    8  
ATOM 11330 C CB   . VAL A 1 62  ? 7.468   9.766   -2.865  1.00 0.00 ? 62  VAL A CB   8  
ATOM 11331 C CG1  . VAL A 1 62  ? 8.581   10.795  -2.656  1.00 0.00 ? 62  VAL A CG1  8  
ATOM 11332 C CG2  . VAL A 1 62  ? 6.089   10.413  -2.726  1.00 0.00 ? 62  VAL A CG2  8  
ATOM 11333 H H    . VAL A 1 62  ? 9.598   8.458   -4.384  1.00 0.00 ? 62  VAL A H    8  
ATOM 11334 H HA   . VAL A 1 62  ? 6.690   8.526   -4.420  1.00 0.00 ? 62  VAL A HA   8  
ATOM 11335 H HB   . VAL A 1 62  ? 7.562   9.008   -2.087  1.00 0.00 ? 62  VAL A HB   8  
ATOM 11336 H HG11 . VAL A 1 62  ? 8.631   11.066  -1.601  1.00 0.00 ? 62  VAL A HG11 8  
ATOM 11337 H HG12 . VAL A 1 62  ? 9.534   10.368  -2.967  1.00 0.00 ? 62  VAL A HG12 8  
ATOM 11338 H HG13 . VAL A 1 62  ? 8.369   11.684  -3.250  1.00 0.00 ? 62  VAL A HG13 8  
ATOM 11339 H HG21 . VAL A 1 62  ? 6.070   11.351  -3.282  1.00 0.00 ? 62  VAL A HG21 8  
ATOM 11340 H HG22 . VAL A 1 62  ? 5.330   9.739   -3.125  1.00 0.00 ? 62  VAL A HG22 8  
ATOM 11341 H HG23 . VAL A 1 62  ? 5.884   10.609  -1.674  1.00 0.00 ? 62  VAL A HG23 8  
ATOM 11342 N N    . ASN A 1 63  ? 7.076   9.896   -6.419  1.00 0.00 ? 63  ASN A N    8  
ATOM 11343 C CA   . ASN A 1 63  ? 7.206   10.754  -7.584  1.00 0.00 ? 63  ASN A CA   8  
ATOM 11344 C C    . ASN A 1 63  ? 8.404   10.295  -8.419  1.00 0.00 ? 63  ASN A C    8  
ATOM 11345 O O    . ASN A 1 63  ? 8.256   9.968   -9.595  1.00 0.00 ? 63  ASN A O    8  
ATOM 11346 C CB   . ASN A 1 63  ? 7.446   12.208  -7.173  1.00 0.00 ? 63  ASN A CB   8  
ATOM 11347 C CG   . ASN A 1 63  ? 6.565   13.160  -7.986  1.00 0.00 ? 63  ASN A CG   8  
ATOM 11348 O OD1  . ASN A 1 63  ? 6.601   13.192  -9.205  1.00 0.00 ? 63  ASN A OD1  8  
ATOM 11349 N ND2  . ASN A 1 63  ? 5.774   13.931  -7.245  1.00 0.00 ? 63  ASN A ND2  8  
ATOM 11350 H H    . ASN A 1 63  ? 6.355   9.206   -6.481  1.00 0.00 ? 63  ASN A H    8  
ATOM 11351 H HA   . ASN A 1 63  ? 6.262   10.655  -8.120  1.00 0.00 ? 63  ASN A HA   8  
ATOM 11352 H HB2  . ASN A 1 63  ? 7.235   12.329  -6.111  1.00 0.00 ? 63  ASN A HB2  8  
ATOM 11353 H HB3  . ASN A 1 63  ? 8.495   12.464  -7.321  1.00 0.00 ? 63  ASN A HB3  8  
ATOM 11354 H HD21 . ASN A 1 63  ? 5.794   13.854  -6.248  1.00 0.00 ? 63  ASN A HD21 8  
ATOM 11355 H HD22 . ASN A 1 63  ? 5.160   14.586  -7.684  1.00 0.00 ? 63  ASN A HD22 8  
ATOM 11356 N N    . ASP A 1 64  ? 9.563   10.286  -7.777  1.00 0.00 ? 64  ASP A N    8  
ATOM 11357 C CA   . ASP A 1 64  ? 10.785  9.873   -8.445  1.00 0.00 ? 64  ASP A CA   8  
ATOM 11358 C C    . ASP A 1 64  ? 11.883  9.656   -7.402  1.00 0.00 ? 64  ASP A C    8  
ATOM 11359 O O    . ASP A 1 64  ? 12.620  8.673   -7.467  1.00 0.00 ? 64  ASP A O    8  
ATOM 11360 C CB   . ASP A 1 64  ? 11.268  10.945  -9.424  1.00 0.00 ? 64  ASP A CB   8  
ATOM 11361 C CG   . ASP A 1 64  ? 11.983  10.412  -10.667 1.00 0.00 ? 64  ASP A CG   8  
ATOM 11362 O OD1  . ASP A 1 64  ? 12.643  9.359   -10.534 1.00 0.00 ? 64  ASP A OD1  8  
ATOM 11363 O OD2  . ASP A 1 64  ? 11.853  11.070  -11.722 1.00 0.00 ? 64  ASP A OD2  8  
ATOM 11364 H H    . ASP A 1 64  ? 9.674   10.554  -6.820  1.00 0.00 ? 64  ASP A H    8  
ATOM 11365 H HA   . ASP A 1 64  ? 10.526  8.956   -8.975  1.00 0.00 ? 64  ASP A HA   8  
ATOM 11366 H HB2  . ASP A 1 64  ? 10.410  11.537  -9.742  1.00 0.00 ? 64  ASP A HB2  8  
ATOM 11367 H HB3  . ASP A 1 64  ? 11.942  11.620  -8.896  1.00 0.00 ? 64  ASP A HB3  8  
ATOM 11368 N N    . LYS A 1 65  ? 11.958  10.590  -6.465  1.00 0.00 ? 65  LYS A N    8  
ATOM 11369 C CA   . LYS A 1 65  ? 12.954  10.513  -5.410  1.00 0.00 ? 65  LYS A CA   8  
ATOM 11370 C C    . LYS A 1 65  ? 12.579  9.389   -4.442  1.00 0.00 ? 65  LYS A C    8  
ATOM 11371 O O    . LYS A 1 65  ? 11.403  9.187   -4.146  1.00 0.00 ? 65  LYS A O    8  
ATOM 11372 C CB   . LYS A 1 65  ? 13.125  11.875  -4.735  1.00 0.00 ? 65  LYS A CB   8  
ATOM 11373 C CG   . LYS A 1 65  ? 14.549  12.050  -4.204  1.00 0.00 ? 65  LYS A CG   8  
ATOM 11374 C CD   . LYS A 1 65  ? 15.517  12.401  -5.336  1.00 0.00 ? 65  LYS A CD   8  
ATOM 11375 C CE   . LYS A 1 65  ? 16.887  11.762  -5.104  1.00 0.00 ? 65  LYS A CE   8  
ATOM 11376 N NZ   . LYS A 1 65  ? 17.854  12.771  -4.616  1.00 0.00 ? 65  LYS A NZ   8  
ATOM 11377 H H    . LYS A 1 65  ? 11.355  11.386  -6.420  1.00 0.00 ? 65  LYS A H    8  
ATOM 11378 H HA   . LYS A 1 65  ? 13.907  10.264  -5.877  1.00 0.00 ? 65  LYS A HA   8  
ATOM 11379 H HB2  . LYS A 1 65  ? 12.898  12.670  -5.446  1.00 0.00 ? 65  LYS A HB2  8  
ATOM 11380 H HB3  . LYS A 1 65  ? 12.413  11.971  -3.914  1.00 0.00 ? 65  LYS A HB3  8  
ATOM 11381 H HG2  . LYS A 1 65  ? 14.566  12.835  -3.449  1.00 0.00 ? 65  LYS A HG2  8  
ATOM 11382 H HG3  . LYS A 1 65  ? 14.874  11.131  -3.715  1.00 0.00 ? 65  LYS A HG3  8  
ATOM 11383 H HD2  . LYS A 1 65  ? 15.109  12.060  -6.287  1.00 0.00 ? 65  LYS A HD2  8  
ATOM 11384 H HD3  . LYS A 1 65  ? 15.624  13.484  -5.405  1.00 0.00 ? 65  LYS A HD3  8  
ATOM 11385 H HE2  . LYS A 1 65  ? 16.800  10.953  -4.379  1.00 0.00 ? 65  LYS A HE2  8  
ATOM 11386 H HE3  . LYS A 1 65  ? 17.251  11.321  -6.032  1.00 0.00 ? 65  LYS A HE3  8  
ATOM 11387 H HZ1  . LYS A 1 65  ? 18.695  12.715  -5.154  1.00 0.00 ? 65  LYS A HZ1  8  
ATOM 11388 H HZ2  . LYS A 1 65  ? 17.458  13.685  -4.710  1.00 0.00 ? 65  LYS A HZ2  8  
ATOM 11389 H HZ3  . LYS A 1 65  ? 18.062  12.595  -3.654  1.00 0.00 ? 65  LYS A HZ3  8  
ATOM 11390 N N    . SER A 1 66  ? 13.602  8.688   -3.975  1.00 0.00 ? 66  SER A N    8  
ATOM 11391 C CA   . SER A 1 66  ? 13.395  7.590   -3.047  1.00 0.00 ? 66  SER A CA   8  
ATOM 11392 C C    . SER A 1 66  ? 13.511  8.094   -1.606  1.00 0.00 ? 66  SER A C    8  
ATOM 11393 O O    . SER A 1 66  ? 14.392  8.892   -1.293  1.00 0.00 ? 66  SER A O    8  
ATOM 11394 C CB   . SER A 1 66  ? 14.397  6.461   -3.296  1.00 0.00 ? 66  SER A CB   8  
ATOM 11395 O OG   . SER A 1 66  ? 15.738  6.874   -3.049  1.00 0.00 ? 66  SER A OG   8  
ATOM 11396 H H    . SER A 1 66  ? 14.556  8.859   -4.221  1.00 0.00 ? 66  SER A H    8  
ATOM 11397 H HA   . SER A 1 66  ? 12.386  7.230   -3.246  1.00 0.00 ? 66  SER A HA   8  
ATOM 11398 H HB2  . SER A 1 66  ? 14.155  5.613   -2.655  1.00 0.00 ? 66  SER A HB2  8  
ATOM 11399 H HB3  . SER A 1 66  ? 14.307  6.118   -4.327  1.00 0.00 ? 66  SER A HB3  8  
ATOM 11400 H HG   . SER A 1 66  ? 16.375  6.281   -3.543  1.00 0.00 ? 66  SER A HG   8  
ATOM 11401 N N    . LEU A 1 67  ? 12.607  7.606   -0.769  1.00 0.00 ? 67  LEU A N    8  
ATOM 11402 C CA   . LEU A 1 67  ? 12.597  7.997   0.631   1.00 0.00 ? 67  LEU A CA   8  
ATOM 11403 C C    . LEU A 1 67  ? 13.471  7.030   1.432   1.00 0.00 ? 67  LEU A C    8  
ATOM 11404 O O    . LEU A 1 67  ? 13.052  6.525   2.473   1.00 0.00 ? 67  LEU A O    8  
ATOM 11405 C CB   . LEU A 1 67  ? 11.161  8.100   1.148   1.00 0.00 ? 67  LEU A CB   8  
ATOM 11406 C CG   . LEU A 1 67  ? 10.156  8.771   0.209   1.00 0.00 ? 67  LEU A CG   8  
ATOM 11407 C CD1  . LEU A 1 67  ? 8.719   8.480   0.645   1.00 0.00 ? 67  LEU A CD1  8  
ATOM 11408 C CD2  . LEU A 1 67  ? 10.429  10.272  0.097   1.00 0.00 ? 67  LEU A CD2  8  
ATOM 11409 H H    . LEU A 1 67  ? 11.894  6.957   -1.031  1.00 0.00 ? 67  LEU A H    8  
ATOM 11410 H HA   . LEU A 1 67  ? 13.035  8.993   0.695   1.00 0.00 ? 67  LEU A HA   8  
ATOM 11411 H HB2  . LEU A 1 67  ? 10.803  7.095   1.372   1.00 0.00 ? 67  LEU A HB2  8  
ATOM 11412 H HB3  . LEU A 1 67  ? 11.173  8.651   2.088   1.00 0.00 ? 67  LEU A HB3  8  
ATOM 11413 H HG   . LEU A 1 67  ? 10.283  8.346   -0.787  1.00 0.00 ? 67  LEU A HG   8  
ATOM 11414 H HD11 . LEU A 1 67  ? 8.342   9.316   1.233   1.00 0.00 ? 67  LEU A HD11 8  
ATOM 11415 H HD12 . LEU A 1 67  ? 8.093   8.344   -0.237  1.00 0.00 ? 67  LEU A HD12 8  
ATOM 11416 H HD13 . LEU A 1 67  ? 8.699   7.572   1.248   1.00 0.00 ? 67  LEU A HD13 8  
ATOM 11417 H HD21 . LEU A 1 67  ? 10.789  10.503  -0.906  1.00 0.00 ? 67  LEU A HD21 8  
ATOM 11418 H HD22 . LEU A 1 67  ? 9.508   10.824  0.288   1.00 0.00 ? 67  LEU A HD22 8  
ATOM 11419 H HD23 . LEU A 1 67  ? 11.183  10.560  0.829   1.00 0.00 ? 67  LEU A HD23 8  
ATOM 11420 N N    . ALA A 1 68  ? 14.670  6.802   0.918   1.00 0.00 ? 68  ALA A N    8  
ATOM 11421 C CA   . ALA A 1 68  ? 15.607  5.904   1.572   1.00 0.00 ? 68  ALA A CA   8  
ATOM 11422 C C    . ALA A 1 68  ? 15.546  6.126   3.085   1.00 0.00 ? 68  ALA A C    8  
ATOM 11423 O O    . ALA A 1 68  ? 15.015  5.292   3.817   1.00 0.00 ? 68  ALA A O    8  
ATOM 11424 C CB   . ALA A 1 68  ? 17.011  6.130   1.006   1.00 0.00 ? 68  ALA A CB   8  
ATOM 11425 H H    . ALA A 1 68  ? 15.004  7.217   0.071   1.00 0.00 ? 68  ALA A H    8  
ATOM 11426 H HA   . ALA A 1 68  ? 15.299  4.883   1.350   1.00 0.00 ? 68  ALA A HA   8  
ATOM 11427 H HB1  . ALA A 1 68  ? 17.299  5.273   0.397   1.00 0.00 ? 68  ALA A HB1  8  
ATOM 11428 H HB2  . ALA A 1 68  ? 17.015  7.030   0.392   1.00 0.00 ? 68  ALA A HB2  8  
ATOM 11429 H HB3  . ALA A 1 68  ? 17.719  6.246   1.827   1.00 0.00 ? 68  ALA A HB3  8  
ATOM 11430 N N    . ARG A 1 69  ? 16.098  7.254   3.509   1.00 0.00 ? 69  ARG A N    8  
ATOM 11431 C CA   . ARG A 1 69  ? 16.113  7.595   4.921   1.00 0.00 ? 69  ARG A CA   8  
ATOM 11432 C C    . ARG A 1 69  ? 15.926  9.102   5.105   1.00 0.00 ? 69  ARG A C    8  
ATOM 11433 O O    . ARG A 1 69  ? 16.896  9.833   5.300   1.00 0.00 ? 69  ARG A O    8  
ATOM 11434 C CB   . ARG A 1 69  ? 17.427  7.167   5.577   1.00 0.00 ? 69  ARG A CB   8  
ATOM 11435 C CG   . ARG A 1 69  ? 17.215  5.961   6.494   1.00 0.00 ? 69  ARG A CG   8  
ATOM 11436 C CD   . ARG A 1 69  ? 18.401  5.779   7.444   1.00 0.00 ? 69  ARG A CD   8  
ATOM 11437 N NE   . ARG A 1 69  ? 18.187  4.589   8.298   1.00 0.00 ? 69  ARG A NE   8  
ATOM 11438 C CZ   . ARG A 1 69  ? 18.384  3.328   7.891   1.00 0.00 ? 69  ARG A CZ   8  
ATOM 11439 N NH1  . ARG A 1 69  ? 18.800  3.084   6.641   1.00 0.00 ? 69  ARG A NH1  8  
ATOM 11440 N NH2  . ARG A 1 69  ? 18.165  2.310   8.735   1.00 0.00 ? 69  ARG A NH2  8  
ATOM 11441 H H    . ARG A 1 69  ? 16.528  7.926   2.907   1.00 0.00 ? 69  ARG A H    8  
ATOM 11442 H HA   . ARG A 1 69  ? 15.278  7.041   5.350   1.00 0.00 ? 69  ARG A HA   8  
ATOM 11443 H HB2  . ARG A 1 69  ? 18.158  6.919   4.807   1.00 0.00 ? 69  ARG A HB2  8  
ATOM 11444 H HB3  . ARG A 1 69  ? 17.838  7.998   6.151   1.00 0.00 ? 69  ARG A HB3  8  
ATOM 11445 H HG2  . ARG A 1 69  ? 16.300  6.095   7.071   1.00 0.00 ? 69  ARG A HG2  8  
ATOM 11446 H HG3  . ARG A 1 69  ? 17.084  5.061   5.893   1.00 0.00 ? 69  ARG A HG3  8  
ATOM 11447 H HD2  . ARG A 1 69  ? 19.321  5.666   6.872   1.00 0.00 ? 69  ARG A HD2  8  
ATOM 11448 H HD3  . ARG A 1 69  ? 18.519  6.667   8.066   1.00 0.00 ? 69  ARG A HD3  8  
ATOM 11449 H HE   . ARG A 1 69  ? 17.877  4.736   9.237   1.00 0.00 ? 69  ARG A HE   8  
ATOM 11450 H HH11 . ARG A 1 69  ? 18.963  3.844   6.011   1.00 0.00 ? 69  ARG A HH11 8  
ATOM 11451 H HH12 . ARG A 1 69  ? 18.947  2.143   6.337   1.00 0.00 ? 69  ARG A HH12 8  
ATOM 11452 H HH21 . ARG A 1 69  ? 17.855  2.492   9.668   1.00 0.00 ? 69  ARG A HH21 8  
ATOM 11453 H HH22 . ARG A 1 69  ? 18.312  1.369   8.431   1.00 0.00 ? 69  ARG A HH22 8  
ATOM 11454 N N    . VAL A 1 70  ? 14.671  9.524   5.036   1.00 0.00 ? 70  VAL A N    8  
ATOM 11455 C CA   . VAL A 1 70  ? 14.345  10.931  5.192   1.00 0.00 ? 70  VAL A CA   8  
ATOM 11456 C C    . VAL A 1 70  ? 13.284  11.085  6.284   1.00 0.00 ? 70  VAL A C    8  
ATOM 11457 O O    . VAL A 1 70  ? 12.480  10.181  6.506   1.00 0.00 ? 70  VAL A O    8  
ATOM 11458 C CB   . VAL A 1 70  ? 13.911  11.520  3.849   1.00 0.00 ? 70  VAL A CB   8  
ATOM 11459 C CG1  . VAL A 1 70  ? 15.008  11.351  2.796   1.00 0.00 ? 70  VAL A CG1  8  
ATOM 11460 C CG2  . VAL A 1 70  ? 12.597  10.895  3.375   1.00 0.00 ? 70  VAL A CG2  8  
ATOM 11461 H H    . VAL A 1 70  ? 13.888  8.923   4.877   1.00 0.00 ? 70  VAL A H    8  
ATOM 11462 H HA   . VAL A 1 70  ? 15.252  11.446  5.509   1.00 0.00 ? 70  VAL A HA   8  
ATOM 11463 H HB   . VAL A 1 70  ? 13.743  12.587  3.989   1.00 0.00 ? 70  VAL A HB   8  
ATOM 11464 H HG11 . VAL A 1 70  ? 14.831  12.043  1.972   1.00 0.00 ? 70  VAL A HG11 8  
ATOM 11465 H HG12 . VAL A 1 70  ? 15.979  11.563  3.246   1.00 0.00 ? 70  VAL A HG12 8  
ATOM 11466 H HG13 . VAL A 1 70  ? 14.997  10.328  2.420   1.00 0.00 ? 70  VAL A HG13 8  
ATOM 11467 H HG21 . VAL A 1 70  ? 12.261  10.159  4.105   1.00 0.00 ? 70  VAL A HG21 8  
ATOM 11468 H HG22 . VAL A 1 70  ? 11.841  11.674  3.271   1.00 0.00 ? 70  VAL A HG22 8  
ATOM 11469 H HG23 . VAL A 1 70  ? 12.751  10.409  2.412   1.00 0.00 ? 70  VAL A HG23 8  
ATOM 11470 N N    . THR A 1 71  ? 13.315  12.238  6.936   1.00 0.00 ? 71  THR A N    8  
ATOM 11471 C CA   . THR A 1 71  ? 12.366  12.523  7.999   1.00 0.00 ? 71  THR A CA   8  
ATOM 11472 C C    . THR A 1 71  ? 10.944  12.589  7.440   1.00 0.00 ? 71  THR A C    8  
ATOM 11473 O O    . THR A 1 71  ? 10.752  12.794  6.242   1.00 0.00 ? 71  THR A O    8  
ATOM 11474 C CB   . THR A 1 71  ? 12.807  13.813  8.693   1.00 0.00 ? 71  THR A CB   8  
ATOM 11475 O OG1  . THR A 1 71  ? 12.970  14.743  7.626   1.00 0.00 ? 71  THR A OG1  8  
ATOM 11476 C CG2  . THR A 1 71  ? 14.204  13.700  9.306   1.00 0.00 ? 71  THR A CG2  8  
ATOM 11477 H H    . THR A 1 71  ? 13.972  12.969  6.749   1.00 0.00 ? 71  THR A H    8  
ATOM 11478 H HA   . THR A 1 71  ? 12.391  11.699  8.712   1.00 0.00 ? 71  THR A HA   8  
ATOM 11479 H HB   . THR A 1 71  ? 12.077  14.121  9.441   1.00 0.00 ? 71  THR A HB   8  
ATOM 11480 H HG1  . THR A 1 71  ? 13.197  15.646  7.991   1.00 0.00 ? 71  THR A HG1  8  
ATOM 11481 H HG21 . THR A 1 71  ? 14.448  14.627  9.827   1.00 0.00 ? 71  THR A HG21 8  
ATOM 11482 H HG22 . THR A 1 71  ? 14.225  12.870  10.013  1.00 0.00 ? 71  THR A HG22 8  
ATOM 11483 H HG23 . THR A 1 71  ? 14.934  13.524  8.516   1.00 0.00 ? 71  THR A HG23 8  
ATOM 11484 N N    . HIS A 1 72  ? 9.982   12.411  8.333   1.00 0.00 ? 72  HIS A N    8  
ATOM 11485 C CA   . HIS A 1 72  ? 8.582   12.448  7.944   1.00 0.00 ? 72  HIS A CA   8  
ATOM 11486 C C    . HIS A 1 72  ? 8.280   13.774  7.243   1.00 0.00 ? 72  HIS A C    8  
ATOM 11487 O O    . HIS A 1 72  ? 7.430   13.830  6.355   1.00 0.00 ? 72  HIS A O    8  
ATOM 11488 C CB   . HIS A 1 72  ? 7.676   12.196  9.151   1.00 0.00 ? 72  HIS A CB   8  
ATOM 11489 C CG   . HIS A 1 72  ? 6.392   11.476  8.814   1.00 0.00 ? 72  HIS A CG   8  
ATOM 11490 N ND1  . HIS A 1 72  ? 5.144   12.054  8.977   1.00 0.00 ? 72  HIS A ND1  8  
ATOM 11491 C CD2  . HIS A 1 72  ? 6.175   10.223  8.322   1.00 0.00 ? 72  HIS A CD2  8  
ATOM 11492 C CE1  . HIS A 1 72  ? 4.225   11.178  8.598   1.00 0.00 ? 72  HIS A CE1  8  
ATOM 11493 N NE2  . HIS A 1 72  ? 4.866   10.044  8.192   1.00 0.00 ? 72  HIS A NE2  8  
ATOM 11494 H H    . HIS A 1 72  ? 10.146  12.245  9.306   1.00 0.00 ? 72  HIS A H    8  
ATOM 11495 H HA   . HIS A 1 72  ? 8.432   11.631  7.239   1.00 0.00 ? 72  HIS A HA   8  
ATOM 11496 H HB2  . HIS A 1 72  ? 8.225   11.611  9.889   1.00 0.00 ? 72  HIS A HB2  8  
ATOM 11497 H HB3  . HIS A 1 72  ? 7.434   13.151  9.617   1.00 0.00 ? 72  HIS A HB3  8  
ATOM 11498 H HD1  . HIS A 1 72  ? 4.967   12.975  9.323   1.00 0.00 ? 72  HIS A HD1  8  
ATOM 11499 H HD2  . HIS A 1 72  ? 6.946   9.493   8.077   1.00 0.00 ? 72  HIS A HD2  8  
ATOM 11500 H HE1  . HIS A 1 72  ? 3.147   11.336  8.608   1.00 0.00 ? 72  HIS A HE1  8  
ATOM 11501 N N    . ALA A 1 73  ? 8.992   14.807  7.667   1.00 0.00 ? 73  ALA A N    8  
ATOM 11502 C CA   . ALA A 1 73  ? 8.810   16.128  7.090   1.00 0.00 ? 73  ALA A CA   8  
ATOM 11503 C C    . ALA A 1 73  ? 9.323   16.126  5.649   1.00 0.00 ? 73  ALA A C    8  
ATOM 11504 O O    . ALA A 1 73  ? 8.796   16.841  4.798   1.00 0.00 ? 73  ALA A O    8  
ATOM 11505 C CB   . ALA A 1 73  ? 9.521   17.167  7.960   1.00 0.00 ? 73  ALA A CB   8  
ATOM 11506 H H    . ALA A 1 73  ? 9.681   14.752  8.389   1.00 0.00 ? 73  ALA A H    8  
ATOM 11507 H HA   . ALA A 1 73  ? 7.742   16.345  7.087   1.00 0.00 ? 73  ALA A HA   8  
ATOM 11508 H HB1  . ALA A 1 73  ? 9.421   16.892  9.010   1.00 0.00 ? 73  ALA A HB1  8  
ATOM 11509 H HB2  . ALA A 1 73  ? 10.577  17.203  7.693   1.00 0.00 ? 73  ALA A HB2  8  
ATOM 11510 H HB3  . ALA A 1 73  ? 9.071   18.147  7.797   1.00 0.00 ? 73  ALA A HB3  8  
ATOM 11511 N N    . GLU A 1 74  ? 10.344  15.314  5.419   1.00 0.00 ? 74  GLU A N    8  
ATOM 11512 C CA   . GLU A 1 74  ? 10.934  15.209  4.095   1.00 0.00 ? 74  GLU A CA   8  
ATOM 11513 C C    . GLU A 1 74  ? 9.983   14.474  3.147   1.00 0.00 ? 74  GLU A C    8  
ATOM 11514 O O    . GLU A 1 74  ? 9.543   15.036  2.145   1.00 0.00 ? 74  GLU A O    8  
ATOM 11515 C CB   . GLU A 1 74  ? 12.295  14.513  4.155   1.00 0.00 ? 74  GLU A CB   8  
ATOM 11516 C CG   . GLU A 1 74  ? 13.387  15.483  4.611   1.00 0.00 ? 74  GLU A CG   8  
ATOM 11517 C CD   . GLU A 1 74  ? 13.557  16.628  3.611   1.00 0.00 ? 74  GLU A CD   8  
ATOM 11518 O OE1  . GLU A 1 74  ? 14.100  16.352  2.519   1.00 0.00 ? 74  GLU A OE1  8  
ATOM 11519 O OE2  . GLU A 1 74  ? 13.140  17.753  3.960   1.00 0.00 ? 74  GLU A OE2  8  
ATOM 11520 H H    . GLU A 1 74  ? 10.767  14.736  6.117   1.00 0.00 ? 74  GLU A H    8  
ATOM 11521 H HA   . GLU A 1 74  ? 11.072  16.236  3.757   1.00 0.00 ? 74  GLU A HA   8  
ATOM 11522 H HB2  . GLU A 1 74  ? 12.245  13.667  4.840   1.00 0.00 ? 74  GLU A HB2  8  
ATOM 11523 H HB3  . GLU A 1 74  ? 12.546  14.114  3.172   1.00 0.00 ? 74  GLU A HB3  8  
ATOM 11524 H HG2  . GLU A 1 74  ? 13.133  15.886  5.592   1.00 0.00 ? 74  GLU A HG2  8  
ATOM 11525 H HG3  . GLU A 1 74  ? 14.330  14.948  4.721   1.00 0.00 ? 74  GLU A HG3  8  
ATOM 11526 N N    . ALA A 1 75  ? 9.695   13.230  3.498   1.00 0.00 ? 75  ALA A N    8  
ATOM 11527 C CA   . ALA A 1 75  ? 8.804   12.413  2.691   1.00 0.00 ? 75  ALA A CA   8  
ATOM 11528 C C    . ALA A 1 75  ? 7.558   13.225  2.333   1.00 0.00 ? 75  ALA A C    8  
ATOM 11529 O O    . ALA A 1 75  ? 7.118   13.217  1.184   1.00 0.00 ? 75  ALA A O    8  
ATOM 11530 C CB   . ALA A 1 75  ? 8.465   11.127  3.448   1.00 0.00 ? 75  ALA A CB   8  
ATOM 11531 H H    . ALA A 1 75  ? 10.057  12.781  4.315   1.00 0.00 ? 75  ALA A H    8  
ATOM 11532 H HA   . ALA A 1 75  ? 9.333   12.151  1.775   1.00 0.00 ? 75  ALA A HA   8  
ATOM 11533 H HB1  . ALA A 1 75  ? 7.392   10.943  3.389   1.00 0.00 ? 75  ALA