data_1UF1
# 
_entry.id   1UF1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1UF1         pdb_00001uf1 10.2210/pdb1uf1/pdb 
RCSB  RCSB005752   ?            ?                   
WWPDB D_1000005752 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002001498.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UF1 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-22 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Saito, K.'                                              1 
'Kigawa, T.'                                             2 
'Koshiba, S.'                                            3 
'Inoue, M.'                                              4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the second PDZ domain of human KIAA1526 protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Saito, K.'    1 ? 
primary 'Kigawa, T.'   2 ? 
primary 'Koshiba, S.'  3 ? 
primary 'Inoue, M.'    4 ? 
primary 'Yokoyama, S.' 5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'KIAA1526 protein' 
_entity.formula_weight             13396.975 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGDRRSTLHLLQGGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSEAEGSGLKVGDQILEVNGRSFLN
ILHDEAVRLLKSSRHLILTVKDVGRLPHARTTVDETKWIASSSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGDRRSTLHLLQGGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSEAEGSGLKVGDQILEVNGRSFLN
ILHDEAVRLLKSSRHLILTVKDVGRLPHARTTVDETKWIASSSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002001498.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ASP n 
1 9   ARG n 
1 10  ARG n 
1 11  SER n 
1 12  THR n 
1 13  LEU n 
1 14  HIS n 
1 15  LEU n 
1 16  LEU n 
1 17  GLN n 
1 18  GLY n 
1 19  GLY n 
1 20  ASP n 
1 21  GLU n 
1 22  LYS n 
1 23  LYS n 
1 24  VAL n 
1 25  ASN n 
1 26  LEU n 
1 27  VAL n 
1 28  LEU n 
1 29  GLY n 
1 30  ASP n 
1 31  GLY n 
1 32  ARG n 
1 33  SER n 
1 34  LEU n 
1 35  GLY n 
1 36  LEU n 
1 37  THR n 
1 38  ILE n 
1 39  ARG n 
1 40  GLY n 
1 41  GLY n 
1 42  ALA n 
1 43  GLU n 
1 44  TYR n 
1 45  GLY n 
1 46  LEU n 
1 47  GLY n 
1 48  ILE n 
1 49  TYR n 
1 50  ILE n 
1 51  THR n 
1 52  GLY n 
1 53  VAL n 
1 54  ASP n 
1 55  PRO n 
1 56  GLY n 
1 57  SER n 
1 58  GLU n 
1 59  ALA n 
1 60  GLU n 
1 61  GLY n 
1 62  SER n 
1 63  GLY n 
1 64  LEU n 
1 65  LYS n 
1 66  VAL n 
1 67  GLY n 
1 68  ASP n 
1 69  GLN n 
1 70  ILE n 
1 71  LEU n 
1 72  GLU n 
1 73  VAL n 
1 74  ASN n 
1 75  GLY n 
1 76  ARG n 
1 77  SER n 
1 78  PHE n 
1 79  LEU n 
1 80  ASN n 
1 81  ILE n 
1 82  LEU n 
1 83  HIS n 
1 84  ASP n 
1 85  GLU n 
1 86  ALA n 
1 87  VAL n 
1 88  ARG n 
1 89  LEU n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  SER n 
1 94  ARG n 
1 95  HIS n 
1 96  LEU n 
1 97  ILE n 
1 98  LEU n 
1 99  THR n 
1 100 VAL n 
1 101 LYS n 
1 102 ASP n 
1 103 VAL n 
1 104 GLY n 
1 105 ARG n 
1 106 LEU n 
1 107 PRO n 
1 108 HIS n 
1 109 ALA n 
1 110 ARG n 
1 111 THR n 
1 112 THR n 
1 113 VAL n 
1 114 ASP n 
1 115 GLU n 
1 116 THR n 
1 117 LYS n 
1 118 TRP n 
1 119 ILE n 
1 120 ALA n 
1 121 SER n 
1 122 SER n 
1 123 SER n 
1 124 GLY n 
1 125 PRO n 
1 126 SER n 
1 127 SER n 
1 128 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'Kazusa cDNA fj04743' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASIMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P021030-47 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    WHRN_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GDRRSTLHLLQGGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSEAEGSGLKVGDQILEVNGRSFLNILHDEA
VRLLKSSRHLILTVKDVGRLPHARTTVDETKWIASS
;
_struct_ref.pdbx_align_begin           319 
_struct_ref.pdbx_db_accession          Q9P202 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UF1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 7 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 122 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9P202 
_struct_ref_seq.db_align_beg                  319 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  434 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       7 
_struct_ref_seq.pdbx_auth_seq_align_end       122 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1UF1 GLY A 1   ? UNP Q9P202 ? ? 'cloning artifact' 1   1  
1 1UF1 SER A 2   ? UNP Q9P202 ? ? 'cloning artifact' 2   2  
1 1UF1 SER A 3   ? UNP Q9P202 ? ? 'cloning artifact' 3   3  
1 1UF1 GLY A 4   ? UNP Q9P202 ? ? 'cloning artifact' 4   4  
1 1UF1 SER A 5   ? UNP Q9P202 ? ? 'cloning artifact' 5   5  
1 1UF1 SER A 6   ? UNP Q9P202 ? ? 'cloning artifact' 6   6  
1 1UF1 SER A 123 ? UNP Q9P202 ? ? 'cloning artifact' 123 7  
1 1UF1 GLY A 124 ? UNP Q9P202 ? ? 'cloning artifact' 124 8  
1 1UF1 PRO A 125 ? UNP Q9P202 ? ? 'cloning artifact' 125 9  
1 1UF1 SER A 126 ? UNP Q9P202 ? ? 'cloning artifact' 126 10 
1 1UF1 SER A 127 ? UNP Q9P202 ? ? 'cloning artifact' 127 11 
1 1UF1 GLY A 128 ? UNP Q9P202 ? ? 'cloning artifact' 128 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1mM PDZ domain U-15N,13C, 20mM d-Tris HCl, 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_ensemble.entry_id                                      1UF1 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1UF1 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6      collection           Bruker          1 
NMRPipe 20020425 processing           'Delaglio, F'   2 
NMRView 5        'data analysis'      'Johnson, B.A.' 3 
CNS     1.1      'structure solution' ?               4 
CNS     1.1      refinement           ?               5 
# 
_exptl.entry_id          1UF1 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1UF1 
_struct.title                     'Solution structure of the second PDZ domain of human KIAA1526 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UF1 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
'PDZ domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 58 ? SER A 62 ? GLU A 58 SER A 62 1 ? 5 
HELX_P HELX_P2 2 HIS A 83 ? LEU A 90 ? HIS A 83 LEU A 90 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 21 ? VAL A 27  ? GLU A 21 VAL A 27  
A 2 HIS A 95 ? LYS A 101 ? HIS A 95 LYS A 101 
A 3 GLN A 69 ? VAL A 73  ? GLN A 69 VAL A 73  
A 4 ARG A 76 ? SER A 77  ? ARG A 76 SER A 77  
B 1 LEU A 36 ? ARG A 39  ? LEU A 36 ARG A 39  
B 2 TYR A 49 ? VAL A 53  ? TYR A 49 VAL A 53  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 24 ? N VAL A 24 O LEU A 98 ? O LEU A 98 
A 2 3 O THR A 99 ? O THR A 99 N GLU A 72 ? N GLU A 72 
A 3 4 N VAL A 73 ? N VAL A 73 O ARG A 76 ? O ARG A 76 
B 1 2 N ARG A 39 ? N ARG A 39 O TYR A 49 ? O TYR A 49 
# 
_database_PDB_matrix.entry_id          1UF1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UF1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -32.249 10.058  5.228   1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -32.509 10.759  3.941   1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -33.447 9.984   3.037   1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -34.439 9.420   3.498   1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -31.341 9.553   5.183   1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1   ? -33.006 9.371   5.420   1.00 0.00 ? 1   GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1   ? -32.214 10.744  6.009   1.00 0.00 ? 1   GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1   ? -32.945 11.724  4.152   1.00 0.00 ? 1   GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1   ? -31.570 10.905  3.427   1.00 0.00 ? 1   GLY A HA3  1  
ATOM 10    N N    . SER A 1 2   ? -33.134 9.957   1.746   1.00 0.00 ? 2   SER A N    1  
ATOM 11    C CA   . SER A 1 2   ? -33.957 9.246   0.774   1.00 0.00 ? 2   SER A CA   1  
ATOM 12    C C    . SER A 1 2   ? -33.088 8.548   -0.267  1.00 0.00 ? 2   SER A C    1  
ATOM 13    O O    . SER A 1 2   ? -33.148 7.328   -0.423  1.00 0.00 ? 2   SER A O    1  
ATOM 14    C CB   . SER A 1 2   ? -34.921 10.213  0.086   1.00 0.00 ? 2   SER A CB   1  
ATOM 15    O OG   . SER A 1 2   ? -36.021 9.521   -0.480  1.00 0.00 ? 2   SER A OG   1  
ATOM 16    H H    . SER A 1 2   ? -32.330 10.426  1.439   1.00 0.00 ? 2   SER A H    1  
ATOM 17    H HA   . SER A 1 2   ? -34.528 8.501   1.307   1.00 0.00 ? 2   SER A HA   1  
ATOM 18    H HB2  . SER A 1 2   ? -35.294 10.922  0.810   1.00 0.00 ? 2   SER A HB2  1  
ATOM 19    H HB3  . SER A 1 2   ? -34.399 10.740  -0.699  1.00 0.00 ? 2   SER A HB3  1  
ATOM 20    H HG   . SER A 1 2   ? -36.525 9.096   0.217   1.00 0.00 ? 2   SER A HG   1  
ATOM 21    N N    . SER A 1 3   ? -32.282 9.329   -0.980  1.00 0.00 ? 3   SER A N    1  
ATOM 22    C CA   . SER A 1 3   ? -31.402 8.786   -2.007  1.00 0.00 ? 3   SER A CA   1  
ATOM 23    C C    . SER A 1 3   ? -29.944 8.844   -1.564  1.00 0.00 ? 3   SER A C    1  
ATOM 24    O O    . SER A 1 3   ? -29.041 9.007   -2.385  1.00 0.00 ? 3   SER A O    1  
ATOM 25    C CB   . SER A 1 3   ? -31.580 9.553   -3.319  1.00 0.00 ? 3   SER A CB   1  
ATOM 26    O OG   . SER A 1 3   ? -31.377 8.707   -4.438  1.00 0.00 ? 3   SER A OG   1  
ATOM 27    H H    . SER A 1 3   ? -32.280 10.295  -0.811  1.00 0.00 ? 3   SER A H    1  
ATOM 28    H HA   . SER A 1 3   ? -31.677 7.753   -2.166  1.00 0.00 ? 3   SER A HA   1  
ATOM 29    H HB2  . SER A 1 3   ? -32.581 9.956   -3.365  1.00 0.00 ? 3   SER A HB2  1  
ATOM 30    H HB3  . SER A 1 3   ? -30.865 10.362  -3.360  1.00 0.00 ? 3   SER A HB3  1  
ATOM 31    H HG   . SER A 1 3   ? -32.090 8.834   -5.068  1.00 0.00 ? 3   SER A HG   1  
ATOM 32    N N    . GLY A 1 4   ? -29.720 8.710   -0.261  1.00 0.00 ? 4   GLY A N    1  
ATOM 33    C CA   . GLY A 1 4   ? -28.370 8.749   0.267   1.00 0.00 ? 4   GLY A CA   1  
ATOM 34    C C    . GLY A 1 4   ? -27.842 10.165  0.409   1.00 0.00 ? 4   GLY A C    1  
ATOM 35    O O    . GLY A 1 4   ? -26.931 10.569  -0.312  1.00 0.00 ? 4   GLY A O    1  
ATOM 36    H H    . GLY A 1 4   ? -30.478 8.582   0.346   1.00 0.00 ? 4   GLY A H    1  
ATOM 37    H HA2  . GLY A 1 4   ? -28.360 8.276   1.238   1.00 0.00 ? 4   GLY A HA2  1  
ATOM 38    H HA3  . GLY A 1 4   ? -27.719 8.200   -0.396  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 39    N N    . SER A 1 5   ? -28.418 10.918  1.340   1.00 0.00 ? 5   SER A N    1  
ATOM 40    C CA   . SER A 1 5   ? -28.001 12.296  1.573   1.00 0.00 ? 5   SER A CA   1  
ATOM 41    C C    . SER A 1 5   ? -27.385 12.450  2.961   1.00 0.00 ? 5   SER A C    1  
ATOM 42    O O    . SER A 1 5   ? -27.246 11.476  3.701   1.00 0.00 ? 5   SER A O    1  
ATOM 43    C CB   . SER A 1 5   ? -29.192 13.244  1.424   1.00 0.00 ? 5   SER A CB   1  
ATOM 44    O OG   . SER A 1 5   ? -30.388 12.639  1.887   1.00 0.00 ? 5   SER A OG   1  
ATOM 45    H H    . SER A 1 5   ? -29.139 10.538  1.884   1.00 0.00 ? 5   SER A H    1  
ATOM 46    H HA   . SER A 1 5   ? -27.257 12.548  0.833   1.00 0.00 ? 5   SER A HA   1  
ATOM 47    H HB2  . SER A 1 5   ? -29.012 14.139  1.999   1.00 0.00 ? 5   SER A HB2  1  
ATOM 48    H HB3  . SER A 1 5   ? -29.315 13.503  0.383   1.00 0.00 ? 5   SER A HB3  1  
ATOM 49    H HG   . SER A 1 5   ? -31.078 13.302  1.949   1.00 0.00 ? 5   SER A HG   1  
ATOM 50    N N    . SER A 1 6   ? -27.017 13.680  3.305   1.00 0.00 ? 6   SER A N    1  
ATOM 51    C CA   . SER A 1 6   ? -26.416 13.962  4.603   1.00 0.00 ? 6   SER A CA   1  
ATOM 52    C C    . SER A 1 6   ? -26.930 15.285  5.163   1.00 0.00 ? 6   SER A C    1  
ATOM 53    O O    . SER A 1 6   ? -27.316 15.369  6.329   1.00 0.00 ? 6   SER A O    1  
ATOM 54    C CB   . SER A 1 6   ? -24.892 14.003  4.485   1.00 0.00 ? 6   SER A CB   1  
ATOM 55    O OG   . SER A 1 6   ? -24.486 14.776  3.369   1.00 0.00 ? 6   SER A OG   1  
ATOM 56    H H    . SER A 1 6   ? -27.153 14.415  2.672   1.00 0.00 ? 6   SER A H    1  
ATOM 57    H HA   . SER A 1 6   ? -26.695 13.166  5.278   1.00 0.00 ? 6   SER A HA   1  
ATOM 58    H HB2  . SER A 1 6   ? -24.474 14.440  5.381   1.00 0.00 ? 6   SER A HB2  1  
ATOM 59    H HB3  . SER A 1 6   ? -24.515 12.997  4.367   1.00 0.00 ? 6   SER A HB3  1  
ATOM 60    H HG   . SER A 1 6   ? -24.516 14.235  2.577   1.00 0.00 ? 6   SER A HG   1  
ATOM 61    N N    . GLY A 1 7   ? -26.933 16.315  4.323   1.00 0.00 ? 7   GLY A N    1  
ATOM 62    C CA   . GLY A 1 7   ? -27.402 17.619  4.753   1.00 0.00 ? 7   GLY A CA   1  
ATOM 63    C C    . GLY A 1 7   ? -28.849 17.868  4.375   1.00 0.00 ? 7   GLY A C    1  
ATOM 64    O O    . GLY A 1 7   ? -29.245 19.007  4.124   1.00 0.00 ? 7   GLY A O    1  
ATOM 65    H H    . GLY A 1 7   ? -26.614 16.189  3.406   1.00 0.00 ? 7   GLY A H    1  
ATOM 66    H HA2  . GLY A 1 7   ? -27.303 17.690  5.826   1.00 0.00 ? 7   GLY A HA2  1  
ATOM 67    H HA3  . GLY A 1 7   ? -26.786 18.379  4.295   1.00 0.00 ? 7   GLY A HA3  1  
ATOM 68    N N    . ASP A 1 8   ? -29.639 16.800  4.335   1.00 0.00 ? 8   ASP A N    1  
ATOM 69    C CA   . ASP A 1 8   ? -31.050 16.908  3.985   1.00 0.00 ? 8   ASP A CA   1  
ATOM 70    C C    . ASP A 1 8   ? -31.897 17.196  5.221   1.00 0.00 ? 8   ASP A C    1  
ATOM 71    O O    . ASP A 1 8   ? -32.810 18.021  5.181   1.00 0.00 ? 8   ASP A O    1  
ATOM 72    C CB   . ASP A 1 8   ? -31.530 15.619  3.312   1.00 0.00 ? 8   ASP A CB   1  
ATOM 73    C CG   . ASP A 1 8   ? -31.589 15.744  1.803   1.00 0.00 ? 8   ASP A CG   1  
ATOM 74    O OD1  . ASP A 1 8   ? -30.527 15.633  1.156   1.00 0.00 ? 8   ASP A OD1  1  
ATOM 75    O OD2  . ASP A 1 8   ? -32.697 15.953  1.267   1.00 0.00 ? 8   ASP A OD2  1  
ATOM 76    H H    . ASP A 1 8   ? -29.265 15.920  4.545   1.00 0.00 ? 8   ASP A H    1  
ATOM 77    H HA   . ASP A 1 8   ? -31.159 17.727  3.291   1.00 0.00 ? 8   ASP A HA   1  
ATOM 78    H HB2  . ASP A 1 8   ? -30.852 14.816  3.561   1.00 0.00 ? 8   ASP A HB2  1  
ATOM 79    H HB3  . ASP A 1 8   ? -32.518 15.375  3.674   1.00 0.00 ? 8   ASP A HB3  1  
ATOM 80    N N    . ARG A 1 9   ? -31.587 16.513  6.318   1.00 0.00 ? 9   ARG A N    1  
ATOM 81    C CA   . ARG A 1 9   ? -32.318 16.698  7.566   1.00 0.00 ? 9   ARG A CA   1  
ATOM 82    C C    . ARG A 1 9   ? -31.507 17.529  8.555   1.00 0.00 ? 9   ARG A C    1  
ATOM 83    O O    . ARG A 1 9   ? -32.025 18.458  9.174   1.00 0.00 ? 9   ARG A O    1  
ATOM 84    C CB   . ARG A 1 9   ? -32.665 15.342  8.184   1.00 0.00 ? 9   ARG A CB   1  
ATOM 85    C CG   . ARG A 1 9   ? -33.645 14.529  7.353   1.00 0.00 ? 9   ARG A CG   1  
ATOM 86    C CD   . ARG A 1 9   ? -32.972 13.319  6.722   1.00 0.00 ? 9   ARG A CD   1  
ATOM 87    N NE   . ARG A 1 9   ? -32.637 12.300  7.715   1.00 0.00 ? 9   ARG A NE   1  
ATOM 88    C CZ   . ARG A 1 9   ? -33.529 11.481  8.266   1.00 0.00 ? 9   ARG A CZ   1  
ATOM 89    N NH1  . ARG A 1 9   ? -34.810 11.555  7.925   1.00 0.00 ? 9   ARG A NH1  1  
ATOM 90    N NH2  . ARG A 1 9   ? -33.140 10.584  9.162   1.00 0.00 ? 9   ARG A NH2  1  
ATOM 91    H H    . ARG A 1 9   ? -30.848 15.871  6.288   1.00 0.00 ? 9   ARG A H    1  
ATOM 92    H HA   . ARG A 1 9   ? -33.233 17.225  7.339   1.00 0.00 ? 9   ARG A HA   1  
ATOM 93    H HB2  . ARG A 1 9   ? -31.757 14.769  8.299   1.00 0.00 ? 9   ARG A HB2  1  
ATOM 94    H HB3  . ARG A 1 9   ? -33.103 15.506  9.158   1.00 0.00 ? 9   ARG A HB3  1  
ATOM 95    H HG2  . ARG A 1 9   ? -34.447 14.189  7.990   1.00 0.00 ? 9   ARG A HG2  1  
ATOM 96    H HG3  . ARG A 1 9   ? -34.045 15.155  6.569   1.00 0.00 ? 9   ARG A HG3  1  
ATOM 97    H HD2  . ARG A 1 9   ? -33.642 12.890  5.993   1.00 0.00 ? 9   ARG A HD2  1  
ATOM 98    H HD3  . ARG A 1 9   ? -32.066 13.642  6.231   1.00 0.00 ? 9   ARG A HD3  1  
ATOM 99    H HE   . ARG A 1 9   ? -31.698 12.223  7.985   1.00 0.00 ? 9   ARG A HE   1  
ATOM 100   H HH11 . ARG A 1 9   ? -35.110 12.230  7.250   1.00 0.00 ? 9   ARG A HH11 1  
ATOM 101   H HH12 . ARG A 1 9   ? -35.475 10.936  8.342   1.00 0.00 ? 9   ARG A HH12 1  
ATOM 102   H HH21 . ARG A 1 9   ? -32.176 10.522  9.422   1.00 0.00 ? 9   ARG A HH21 1  
ATOM 103   H HH22 . ARG A 1 9   ? -33.810 9.968   9.576   1.00 0.00 ? 9   ARG A HH22 1  
ATOM 104   N N    . ARG A 1 10  ? -30.230 17.187  8.698   1.00 0.00 ? 10  ARG A N    1  
ATOM 105   C CA   . ARG A 1 10  ? -29.345 17.902  9.612   1.00 0.00 ? 10  ARG A CA   1  
ATOM 106   C C    . ARG A 1 10  ? -27.909 17.405  9.480   1.00 0.00 ? 10  ARG A C    1  
ATOM 107   O O    . ARG A 1 10  ? -26.965 18.195  9.507   1.00 0.00 ? 10  ARG A O    1  
ATOM 108   C CB   . ARG A 1 10  ? -29.825 17.737  11.055  1.00 0.00 ? 10  ARG A CB   1  
ATOM 109   C CG   . ARG A 1 10  ? -30.214 16.311  11.409  1.00 0.00 ? 10  ARG A CG   1  
ATOM 110   C CD   . ARG A 1 10  ? -30.455 16.154  12.902  1.00 0.00 ? 10  ARG A CD   1  
ATOM 111   N NE   . ARG A 1 10  ? -30.495 14.751  13.307  1.00 0.00 ? 10  ARG A NE   1  
ATOM 112   C CZ   . ARG A 1 10  ? -31.555 13.962  13.143  1.00 0.00 ? 10  ARG A CZ   1  
ATOM 113   N NH1  . ARG A 1 10  ? -32.662 14.434  12.584  1.00 0.00 ? 10  ARG A NH1  1  
ATOM 114   N NH2  . ARG A 1 10  ? -31.508 12.699  13.541  1.00 0.00 ? 10  ARG A NH2  1  
ATOM 115   H H    . ARG A 1 10  ? -29.874 16.437  8.177   1.00 0.00 ? 10  ARG A H    1  
ATOM 116   H HA   . ARG A 1 10  ? -29.376 18.949  9.349   1.00 0.00 ? 10  ARG A HA   1  
ATOM 117   H HB2  . ARG A 1 10  ? -29.035 18.048  11.722  1.00 0.00 ? 10  ARG A HB2  1  
ATOM 118   H HB3  . ARG A 1 10  ? -30.686 18.370  11.210  1.00 0.00 ? 10  ARG A HB3  1  
ATOM 119   H HG2  . ARG A 1 10  ? -31.118 16.052  10.879  1.00 0.00 ? 10  ARG A HG2  1  
ATOM 120   H HG3  . ARG A 1 10  ? -29.416 15.646  11.110  1.00 0.00 ? 10  ARG A HG3  1  
ATOM 121   H HD2  . ARG A 1 10  ? -29.659 16.650  13.437  1.00 0.00 ? 10  ARG A HD2  1  
ATOM 122   H HD3  . ARG A 1 10  ? -31.398 16.619  13.151  1.00 0.00 ? 10  ARG A HD3  1  
ATOM 123   H HE   . ARG A 1 10  ? -29.691 14.377  13.722  1.00 0.00 ? 10  ARG A HE   1  
ATOM 124   H HH11 . ARG A 1 10  ? -32.706 15.386  12.281  1.00 0.00 ? 10  ARG A HH11 1  
ATOM 125   H HH12 . ARG A 1 10  ? -33.455 13.836  12.464  1.00 0.00 ? 10  ARG A HH12 1  
ATOM 126   H HH21 . ARG A 1 10  ? -30.677 12.338  13.964  1.00 0.00 ? 10  ARG A HH21 1  
ATOM 127   H HH22 . ARG A 1 10  ? -32.305 12.105  13.419  1.00 0.00 ? 10  ARG A HH22 1  
ATOM 128   N N    . SER A 1 11  ? -27.752 16.093  9.338   1.00 0.00 ? 11  SER A N    1  
ATOM 129   C CA   . SER A 1 11  ? -26.429 15.493  9.202   1.00 0.00 ? 11  SER A CA   1  
ATOM 130   C C    . SER A 1 11  ? -26.529 14.074  8.650   1.00 0.00 ? 11  SER A C    1  
ATOM 131   O O    . SER A 1 11  ? -25.786 13.698  7.743   1.00 0.00 ? 11  SER A O    1  
ATOM 132   C CB   . SER A 1 11  ? -25.712 15.478  10.553  1.00 0.00 ? 11  SER A CB   1  
ATOM 133   O OG   . SER A 1 11  ? -26.406 14.672  11.490  1.00 0.00 ? 11  SER A OG   1  
ATOM 134   H H    . SER A 1 11  ? -28.543 15.515  9.324   1.00 0.00 ? 11  SER A H    1  
ATOM 135   H HA   . SER A 1 11  ? -25.861 16.097  8.511   1.00 0.00 ? 11  SER A HA   1  
ATOM 136   H HB2  . SER A 1 11  ? -24.716 15.082  10.425  1.00 0.00 ? 11  SER A HB2  1  
ATOM 137   H HB3  . SER A 1 11  ? -25.652 16.485  10.938  1.00 0.00 ? 11  SER A HB3  1  
ATOM 138   H HG   . SER A 1 11  ? -26.164 13.751  11.363  1.00 0.00 ? 11  SER A HG   1  
ATOM 139   N N    . THR A 1 12  ? -27.450 13.292  9.203   1.00 0.00 ? 12  THR A N    1  
ATOM 140   C CA   . THR A 1 12  ? -27.646 11.914  8.767   1.00 0.00 ? 12  THR A CA   1  
ATOM 141   C C    . THR A 1 12  ? -26.386 11.087  8.998   1.00 0.00 ? 12  THR A C    1  
ATOM 142   O O    . THR A 1 12  ? -25.348 11.333  8.384   1.00 0.00 ? 12  THR A O    1  
ATOM 143   C CB   . THR A 1 12  ? -28.032 11.876  7.287   1.00 0.00 ? 12  THR A CB   1  
ATOM 144   O OG1  . THR A 1 12  ? -28.669 13.081  6.903   1.00 0.00 ? 12  THR A OG1  1  
ATOM 145   C CG2  . THR A 1 12  ? -28.961 10.733  6.941   1.00 0.00 ? 12  THR A CG2  1  
ATOM 146   H H    . THR A 1 12  ? -28.011 13.650  9.923   1.00 0.00 ? 12  THR A H    1  
ATOM 147   H HA   . THR A 1 12  ? -28.451 11.493  9.350   1.00 0.00 ? 12  THR A HA   1  
ATOM 148   H HB   . THR A 1 12  ? -27.135 11.763  6.695   1.00 0.00 ? 12  THR A HB   1  
ATOM 149   H HG1  . THR A 1 12  ? -29.391 13.268  7.506   1.00 0.00 ? 12  THR A HG1  1  
ATOM 150   H HG21 . THR A 1 12  ? -29.936 11.126  6.689   1.00 0.00 ? 12  THR A HG21 1  
ATOM 151   H HG22 . THR A 1 12  ? -29.049 10.071  7.789   1.00 0.00 ? 12  THR A HG22 1  
ATOM 152   H HG23 . THR A 1 12  ? -28.565 10.188  6.097   1.00 0.00 ? 12  THR A HG23 1  
ATOM 153   N N    . LEU A 1 13  ? -26.485 10.104  9.887   1.00 0.00 ? 13  LEU A N    1  
ATOM 154   C CA   . LEU A 1 13  ? -25.353 9.240   10.200  1.00 0.00 ? 13  LEU A CA   1  
ATOM 155   C C    . LEU A 1 13  ? -24.186 10.051  10.754  1.00 0.00 ? 13  LEU A C    1  
ATOM 156   O O    . LEU A 1 13  ? -24.098 11.258  10.536  1.00 0.00 ? 13  LEU A O    1  
ATOM 157   C CB   . LEU A 1 13  ? -24.911 8.471   8.953   1.00 0.00 ? 13  LEU A CB   1  
ATOM 158   C CG   . LEU A 1 13  ? -26.036 7.760   8.196   1.00 0.00 ? 13  LEU A CG   1  
ATOM 159   C CD1  . LEU A 1 13  ? -26.425 8.544   6.952   1.00 0.00 ? 13  LEU A CD1  1  
ATOM 160   C CD2  . LEU A 1 13  ? -25.622 6.343   7.828   1.00 0.00 ? 13  LEU A CD2  1  
ATOM 161   H H    . LEU A 1 13  ? -27.339 9.958   10.345  1.00 0.00 ? 13  LEU A H    1  
ATOM 162   H HA   . LEU A 1 13  ? -25.673 8.534   10.951  1.00 0.00 ? 13  LEU A HA   1  
ATOM 163   H HB2  . LEU A 1 13  ? -24.434 9.168   8.278   1.00 0.00 ? 13  LEU A HB2  1  
ATOM 164   H HB3  . LEU A 1 13  ? -24.184 7.731   9.252   1.00 0.00 ? 13  LEU A HB3  1  
ATOM 165   H HG   . LEU A 1 13  ? -26.906 7.699   8.836   1.00 0.00 ? 13  LEU A HG   1  
ATOM 166   H HD11 . LEU A 1 13  ? -27.500 8.537   6.843   1.00 0.00 ? 13  LEU A HD11 1  
ATOM 167   H HD12 . LEU A 1 13  ? -25.972 8.088   6.083   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 168   H HD13 . LEU A 1 13  ? -26.080 9.563   7.046   1.00 0.00 ? 13  LEU A HD13 1  
ATOM 169   H HD21 . LEU A 1 13  ? -24.882 5.990   8.532   1.00 0.00 ? 13  LEU A HD21 1  
ATOM 170   H HD22 . LEU A 1 13  ? -25.202 6.338   6.833   1.00 0.00 ? 13  LEU A HD22 1  
ATOM 171   H HD23 . LEU A 1 13  ? -26.486 5.695   7.858   1.00 0.00 ? 13  LEU A HD23 1  
ATOM 172   N N    . HIS A 1 14  ? -23.292 9.377   11.469  1.00 0.00 ? 14  HIS A N    1  
ATOM 173   C CA   . HIS A 1 14  ? -22.129 10.035  12.055  1.00 0.00 ? 14  HIS A CA   1  
ATOM 174   C C    . HIS A 1 14  ? -20.859 9.677   11.290  1.00 0.00 ? 14  HIS A C    1  
ATOM 175   O O    . HIS A 1 14  ? -20.807 8.664   10.592  1.00 0.00 ? 14  HIS A O    1  
ATOM 176   C CB   . HIS A 1 14  ? -21.982 9.643   13.527  1.00 0.00 ? 14  HIS A CB   1  
ATOM 177   C CG   . HIS A 1 14  ? -21.718 10.805  14.432  1.00 0.00 ? 14  HIS A CG   1  
ATOM 178   N ND1  . HIS A 1 14  ? -21.159 10.672  15.685  1.00 0.00 ? 14  HIS A ND1  1  
ATOM 179   C CD2  . HIS A 1 14  ? -21.940 12.131  14.260  1.00 0.00 ? 14  HIS A CD2  1  
ATOM 180   C CE1  . HIS A 1 14  ? -21.048 11.864  16.245  1.00 0.00 ? 14  HIS A CE1  1  
ATOM 181   N NE2  . HIS A 1 14  ? -21.515 12.766  15.401  1.00 0.00 ? 14  HIS A NE2  1  
ATOM 182   H H    . HIS A 1 14  ? -23.416 8.415   11.608  1.00 0.00 ? 14  HIS A H    1  
ATOM 183   H HA   . HIS A 1 14  ? -22.285 11.101  11.989  1.00 0.00 ? 14  HIS A HA   1  
ATOM 184   H HB2  . HIS A 1 14  ? -22.894 9.167   13.857  1.00 0.00 ? 14  HIS A HB2  1  
ATOM 185   H HB3  . HIS A 1 14  ? -21.162 8.948   13.628  1.00 0.00 ? 14  HIS A HB3  1  
ATOM 186   H HD1  . HIS A 1 14  ? -20.884 9.829   16.102  1.00 0.00 ? 14  HIS A HD1  1  
ATOM 187   H HD2  . HIS A 1 14  ? -22.371 12.601  13.387  1.00 0.00 ? 14  HIS A HD2  1  
ATOM 188   H HE1  . HIS A 1 14  ? -20.644 12.067  17.226  1.00 0.00 ? 14  HIS A HE1  1  
ATOM 189   H HE2  . HIS A 1 14  ? -21.471 13.736  15.531  1.00 0.00 ? 14  HIS A HE2  1  
ATOM 190   N N    . LEU A 1 15  ? -19.835 10.515  11.425  1.00 0.00 ? 15  LEU A N    1  
ATOM 191   C CA   . LEU A 1 15  ? -18.565 10.286  10.747  1.00 0.00 ? 15  LEU A CA   1  
ATOM 192   C C    . LEU A 1 15  ? -17.443 11.077  11.410  1.00 0.00 ? 15  LEU A C    1  
ATOM 193   O O    . LEU A 1 15  ? -17.634 12.223  11.818  1.00 0.00 ? 15  LEU A O    1  
ATOM 194   C CB   . LEU A 1 15  ? -18.674 10.674  9.271   1.00 0.00 ? 15  LEU A CB   1  
ATOM 195   C CG   . LEU A 1 15  ? -17.648 10.012  8.351   1.00 0.00 ? 15  LEU A CG   1  
ATOM 196   C CD1  . LEU A 1 15  ? -17.946 8.529   8.198   1.00 0.00 ? 15  LEU A CD1  1  
ATOM 197   C CD2  . LEU A 1 15  ? -17.631 10.698  6.992   1.00 0.00 ? 15  LEU A CD2  1  
ATOM 198   H H    . LEU A 1 15  ? -19.938 11.305  11.995  1.00 0.00 ? 15  LEU A H    1  
ATOM 199   H HA   . LEU A 1 15  ? -18.338 9.233   10.817  1.00 0.00 ? 15  LEU A HA   1  
ATOM 200   H HB2  . LEU A 1 15  ? -19.663 10.410  8.924   1.00 0.00 ? 15  LEU A HB2  1  
ATOM 201   H HB3  . LEU A 1 15  ? -18.557 11.745  9.192   1.00 0.00 ? 15  LEU A HB3  1  
ATOM 202   H HG   . LEU A 1 15  ? -16.665 10.111  8.788   1.00 0.00 ? 15  LEU A HG   1  
ATOM 203   H HD11 . LEU A 1 15  ? -18.373 8.151   9.114   1.00 0.00 ? 15  LEU A HD11 1  
ATOM 204   H HD12 . LEU A 1 15  ? -17.031 7.999   7.979   1.00 0.00 ? 15  LEU A HD12 1  
ATOM 205   H HD13 . LEU A 1 15  ? -18.648 8.384   7.389   1.00 0.00 ? 15  LEU A HD13 1  
ATOM 206   H HD21 . LEU A 1 15  ? -17.174 11.672  7.086   1.00 0.00 ? 15  LEU A HD21 1  
ATOM 207   H HD22 . LEU A 1 15  ? -18.644 10.809  6.633   1.00 0.00 ? 15  LEU A HD22 1  
ATOM 208   H HD23 . LEU A 1 15  ? -17.065 10.100  6.294   1.00 0.00 ? 15  LEU A HD23 1  
ATOM 209   N N    . LEU A 1 16  ? -16.272 10.459  11.515  1.00 0.00 ? 16  LEU A N    1  
ATOM 210   C CA   . LEU A 1 16  ? -15.117 11.106  12.129  1.00 0.00 ? 16  LEU A CA   1  
ATOM 211   C C    . LEU A 1 16  ? -14.253 11.790  11.075  1.00 0.00 ? 16  LEU A C    1  
ATOM 212   O O    . LEU A 1 16  ? -14.042 11.253  9.988   1.00 0.00 ? 16  LEU A O    1  
ATOM 213   C CB   . LEU A 1 16  ? -14.286 10.081  12.906  1.00 0.00 ? 16  LEU A CB   1  
ATOM 214   C CG   . LEU A 1 16  ? -14.431 10.151  14.427  1.00 0.00 ? 16  LEU A CG   1  
ATOM 215   C CD1  . LEU A 1 16  ? -15.764 9.562   14.863  1.00 0.00 ? 16  LEU A CD1  1  
ATOM 216   C CD2  . LEU A 1 16  ? -13.278 9.425   15.106  1.00 0.00 ? 16  LEU A CD2  1  
ATOM 217   H H    . LEU A 1 16  ? -16.181 9.545   11.172  1.00 0.00 ? 16  LEU A H    1  
ATOM 218   H HA   . LEU A 1 16  ? -15.485 11.853  12.817  1.00 0.00 ? 16  LEU A HA   1  
ATOM 219   H HB2  . LEU A 1 16  ? -14.578 9.092   12.582  1.00 0.00 ? 16  LEU A HB2  1  
ATOM 220   H HB3  . LEU A 1 16  ? -13.245 10.229  12.660  1.00 0.00 ? 16  LEU A HB3  1  
ATOM 221   H HG   . LEU A 1 16  ? -14.406 11.184  14.738  1.00 0.00 ? 16  LEU A HG   1  
ATOM 222   H HD11 . LEU A 1 16  ? -16.498 10.351  14.939  1.00 0.00 ? 16  LEU A HD11 1  
ATOM 223   H HD12 . LEU A 1 16  ? -15.648 9.084   15.825  1.00 0.00 ? 16  LEU A HD12 1  
ATOM 224   H HD13 . LEU A 1 16  ? -16.091 8.834   14.136  1.00 0.00 ? 16  LEU A HD13 1  
ATOM 225   H HD21 . LEU A 1 16  ? -13.621 8.993   16.034  1.00 0.00 ? 16  LEU A HD21 1  
ATOM 226   H HD22 . LEU A 1 16  ? -12.481 10.124  15.306  1.00 0.00 ? 16  LEU A HD22 1  
ATOM 227   H HD23 . LEU A 1 16  ? -12.915 8.641   14.456  1.00 0.00 ? 16  LEU A HD23 1  
ATOM 228   N N    . GLN A 1 17  ? -13.756 12.978  11.404  1.00 0.00 ? 17  GLN A N    1  
ATOM 229   C CA   . GLN A 1 17  ? -12.914 13.736  10.486  1.00 0.00 ? 17  GLN A CA   1  
ATOM 230   C C    . GLN A 1 17  ? -11.617 14.165  11.164  1.00 0.00 ? 17  GLN A C    1  
ATOM 231   O O    . GLN A 1 17  ? -11.552 15.226  11.785  1.00 0.00 ? 17  GLN A O    1  
ATOM 232   C CB   . GLN A 1 17  ? -13.665 14.965  9.970   1.00 0.00 ? 17  GLN A CB   1  
ATOM 233   C CG   . GLN A 1 17  ? -15.000 14.635  9.322   1.00 0.00 ? 17  GLN A CG   1  
ATOM 234   C CD   . GLN A 1 17  ? -16.168 15.317  10.008  1.00 0.00 ? 17  GLN A CD   1  
ATOM 235   O OE1  . GLN A 1 17  ? -16.125 16.516  10.286  1.00 0.00 ? 17  GLN A OE1  1  
ATOM 236   N NE2  . GLN A 1 17  ? -17.219 14.554  10.287  1.00 0.00 ? 17  GLN A NE2  1  
ATOM 237   H H    . GLN A 1 17  ? -13.961 13.353  12.286  1.00 0.00 ? 17  GLN A H    1  
ATOM 238   H HA   . GLN A 1 17  ? -12.675 13.095  9.651   1.00 0.00 ? 17  GLN A HA   1  
ATOM 239   H HB2  . GLN A 1 17  ? -13.845 15.636  10.797  1.00 0.00 ? 17  GLN A HB2  1  
ATOM 240   H HB3  . GLN A 1 17  ? -13.048 15.467  9.238   1.00 0.00 ? 17  GLN A HB3  1  
ATOM 241   H HG2  . GLN A 1 17  ? -14.974 14.952  8.290   1.00 0.00 ? 17  GLN A HG2  1  
ATOM 242   H HG3  . GLN A 1 17  ? -15.151 13.566  9.365   1.00 0.00 ? 17  GLN A HG3  1  
ATOM 243   H HE21 . GLN A 1 17  ? -17.182 13.607  10.037  1.00 0.00 ? 17  GLN A HE21 1  
ATOM 244   H HE22 . GLN A 1 17  ? -17.987 14.970  10.731  1.00 0.00 ? 17  GLN A HE22 1  
ATOM 245   N N    . GLY A 1 18  ? -10.588 13.333  11.041  1.00 0.00 ? 18  GLY A N    1  
ATOM 246   C CA   . GLY A 1 18  ? -9.307  13.644  11.647  1.00 0.00 ? 18  GLY A CA   1  
ATOM 247   C C    . GLY A 1 18  ? -8.153  13.491  10.675  1.00 0.00 ? 18  GLY A C    1  
ATOM 248   O O    . GLY A 1 18  ? -7.508  12.443  10.627  1.00 0.00 ? 18  GLY A O    1  
ATOM 249   H H    . GLY A 1 18  ? -10.700 12.502  10.534  1.00 0.00 ? 18  GLY A H    1  
ATOM 250   H HA2  . GLY A 1 18  ? -9.327  14.662  12.007  1.00 0.00 ? 18  GLY A HA2  1  
ATOM 251   H HA3  . GLY A 1 18  ? -9.148  12.981  12.485  1.00 0.00 ? 18  GLY A HA3  1  
ATOM 252   N N    . GLY A 1 19  ? -7.893  14.538  9.900   1.00 0.00 ? 19  GLY A N    1  
ATOM 253   C CA   . GLY A 1 19  ? -6.810  14.495  8.935   1.00 0.00 ? 19  GLY A CA   1  
ATOM 254   C C    . GLY A 1 19  ? -7.303  14.291  7.516   1.00 0.00 ? 19  GLY A C    1  
ATOM 255   O O    . GLY A 1 19  ? -8.497  14.094  7.289   1.00 0.00 ? 19  GLY A O    1  
ATOM 256   H H    . GLY A 1 19  ? -8.441  15.346  9.983   1.00 0.00 ? 19  GLY A H    1  
ATOM 257   H HA2  . GLY A 1 19  ? -6.262  15.424  8.984   1.00 0.00 ? 19  GLY A HA2  1  
ATOM 258   H HA3  . GLY A 1 19  ? -6.145  13.684  9.193   1.00 0.00 ? 19  GLY A HA3  1  
ATOM 259   N N    . ASP A 1 20  ? -6.383  14.341  6.560   1.00 0.00 ? 20  ASP A N    1  
ATOM 260   C CA   . ASP A 1 20  ? -6.731  14.160  5.154   1.00 0.00 ? 20  ASP A CA   1  
ATOM 261   C C    . ASP A 1 20  ? -6.365  12.757  4.679   1.00 0.00 ? 20  ASP A C    1  
ATOM 262   O O    . ASP A 1 20  ? -6.027  12.555  3.513   1.00 0.00 ? 20  ASP A O    1  
ATOM 263   C CB   . ASP A 1 20  ? -6.019  15.205  4.293   1.00 0.00 ? 20  ASP A CB   1  
ATOM 264   C CG   . ASP A 1 20  ? -6.387  16.623  4.681   1.00 0.00 ? 20  ASP A CG   1  
ATOM 265   O OD1  . ASP A 1 20  ? -5.780  17.154  5.635   1.00 0.00 ? 20  ASP A OD1  1  
ATOM 266   O OD2  . ASP A 1 20  ? -7.284  17.203  4.033   1.00 0.00 ? 20  ASP A OD2  1  
ATOM 267   H H    . ASP A 1 20  ? -5.448  14.501  6.803   1.00 0.00 ? 20  ASP A H    1  
ATOM 268   H HA   . ASP A 1 20  ? -7.798  14.293  5.058   1.00 0.00 ? 20  ASP A HA   1  
ATOM 269   H HB2  . ASP A 1 20  ? -4.952  15.087  4.404   1.00 0.00 ? 20  ASP A HB2  1  
ATOM 270   H HB3  . ASP A 1 20  ? -6.289  15.052  3.259   1.00 0.00 ? 20  ASP A HB3  1  
ATOM 271   N N    . GLU A 1 21  ? -6.435  11.792  5.590   1.00 0.00 ? 21  GLU A N    1  
ATOM 272   C CA   . GLU A 1 21  ? -6.111  10.409  5.263   1.00 0.00 ? 21  GLU A CA   1  
ATOM 273   C C    . GLU A 1 21  ? -7.330  9.683   4.702   1.00 0.00 ? 21  GLU A C    1  
ATOM 274   O O    . GLU A 1 21  ? -8.466  9.986   5.063   1.00 0.00 ? 21  GLU A O    1  
ATOM 275   C CB   . GLU A 1 21  ? -5.592  9.677   6.503   1.00 0.00 ? 21  GLU A CB   1  
ATOM 276   C CG   . GLU A 1 21  ? -4.080  9.728   6.650   1.00 0.00 ? 21  GLU A CG   1  
ATOM 277   C CD   . GLU A 1 21  ? -3.634  10.615  7.797   1.00 0.00 ? 21  GLU A CD   1  
ATOM 278   O OE1  . GLU A 1 21  ? -3.845  11.843  7.715   1.00 0.00 ? 21  GLU A OE1  1  
ATOM 279   O OE2  . GLU A 1 21  ? -3.074  10.081  8.778   1.00 0.00 ? 21  GLU A OE2  1  
ATOM 280   H H    . GLU A 1 21  ? -6.711  12.015  6.503   1.00 0.00 ? 21  GLU A H    1  
ATOM 281   H HA   . GLU A 1 21  ? -5.335  10.419  4.512   1.00 0.00 ? 21  GLU A HA   1  
ATOM 282   H HB2  . GLU A 1 21  ? -6.033  10.124  7.382   1.00 0.00 ? 21  GLU A HB2  1  
ATOM 283   H HB3  . GLU A 1 21  ? -5.892  8.641   6.448   1.00 0.00 ? 21  GLU A HB3  1  
ATOM 284   H HG2  . GLU A 1 21  ? -3.714  8.727   6.828   1.00 0.00 ? 21  GLU A HG2  1  
ATOM 285   H HG3  . GLU A 1 21  ? -3.654  10.112  5.732   1.00 0.00 ? 21  GLU A HG3  1  
ATOM 286   N N    . LYS A 1 22  ? -7.084  8.722   3.816   1.00 0.00 ? 22  LYS A N    1  
ATOM 287   C CA   . LYS A 1 22  ? -8.162  7.952   3.206   1.00 0.00 ? 22  LYS A CA   1  
ATOM 288   C C    . LYS A 1 22  ? -7.762  6.489   3.045   1.00 0.00 ? 22  LYS A C    1  
ATOM 289   O O    . LYS A 1 22  ? -6.825  6.167   2.314   1.00 0.00 ? 22  LYS A O    1  
ATOM 290   C CB   . LYS A 1 22  ? -8.530  8.544   1.845   1.00 0.00 ? 22  LYS A CB   1  
ATOM 291   C CG   . LYS A 1 22  ? -9.807  7.966   1.254   1.00 0.00 ? 22  LYS A CG   1  
ATOM 292   C CD   . LYS A 1 22  ? -10.203 8.682   -0.028  1.00 0.00 ? 22  LYS A CD   1  
ATOM 293   C CE   . LYS A 1 22  ? -9.835  7.868   -1.259  1.00 0.00 ? 22  LYS A CE   1  
ATOM 294   N NZ   . LYS A 1 22  ? -11.034 7.277   -1.914  1.00 0.00 ? 22  LYS A NZ   1  
ATOM 295   H H    . LYS A 1 22  ? -6.157  8.526   3.568   1.00 0.00 ? 22  LYS A H    1  
ATOM 296   H HA   . LYS A 1 22  ? -9.020  8.009   3.858   1.00 0.00 ? 22  LYS A HA   1  
ATOM 297   H HB2  . LYS A 1 22  ? -8.661  9.612   1.952   1.00 0.00 ? 22  LYS A HB2  1  
ATOM 298   H HB3  . LYS A 1 22  ? -7.723  8.358   1.152   1.00 0.00 ? 22  LYS A HB3  1  
ATOM 299   H HG2  . LYS A 1 22  ? -9.650  6.920   1.038   1.00 0.00 ? 22  LYS A HG2  1  
ATOM 300   H HG3  . LYS A 1 22  ? -10.605 8.070   1.977   1.00 0.00 ? 22  LYS A HG3  1  
ATOM 301   H HD2  . LYS A 1 22  ? -11.270 8.843   -0.023  1.00 0.00 ? 22  LYS A HD2  1  
ATOM 302   H HD3  . LYS A 1 22  ? -9.693  9.633   -0.070  1.00 0.00 ? 22  LYS A HD3  1  
ATOM 303   H HE2  . LYS A 1 22  ? -9.333  8.513   -1.964  1.00 0.00 ? 22  LYS A HE2  1  
ATOM 304   H HE3  . LYS A 1 22  ? -9.166  7.072   -0.963  1.00 0.00 ? 22  LYS A HE3  1  
ATOM 305   H HZ1  . LYS A 1 22  ? -11.450 7.958   -2.580  1.00 0.00 ? 22  LYS A HZ1  1  
ATOM 306   H HZ2  . LYS A 1 22  ? -11.746 7.028   -1.198  1.00 0.00 ? 22  LYS A HZ2  1  
ATOM 307   H HZ3  . LYS A 1 22  ? -10.769 6.417   -2.435  1.00 0.00 ? 22  LYS A HZ3  1  
ATOM 308   N N    . LYS A 1 23  ? -8.479  5.606   3.733   1.00 0.00 ? 23  LYS A N    1  
ATOM 309   C CA   . LYS A 1 23  ? -8.200  4.176   3.665   1.00 0.00 ? 23  LYS A CA   1  
ATOM 310   C C    . LYS A 1 23  ? -8.980  3.523   2.530   1.00 0.00 ? 23  LYS A C    1  
ATOM 311   O O    . LYS A 1 23  ? -10.206 3.429   2.579   1.00 0.00 ? 23  LYS A O    1  
ATOM 312   C CB   . LYS A 1 23  ? -8.550  3.504   4.994   1.00 0.00 ? 23  LYS A CB   1  
ATOM 313   C CG   . LYS A 1 23  ? -7.847  2.174   5.207   1.00 0.00 ? 23  LYS A CG   1  
ATOM 314   C CD   . LYS A 1 23  ? -7.940  1.720   6.654   1.00 0.00 ? 23  LYS A CD   1  
ATOM 315   C CE   . LYS A 1 23  ? -6.688  2.086   7.435   1.00 0.00 ? 23  LYS A CE   1  
ATOM 316   N NZ   . LYS A 1 23  ? -6.966  2.248   8.888   1.00 0.00 ? 23  LYS A NZ   1  
ATOM 317   H H    . LYS A 1 23  ? -9.214  5.923   4.299   1.00 0.00 ? 23  LYS A H    1  
ATOM 318   H HA   . LYS A 1 23  ? -7.143  4.054   3.478   1.00 0.00 ? 23  LYS A HA   1  
ATOM 319   H HB2  . LYS A 1 23  ? -8.277  4.165   5.802   1.00 0.00 ? 23  LYS A HB2  1  
ATOM 320   H HB3  . LYS A 1 23  ? -9.616  3.332   5.026   1.00 0.00 ? 23  LYS A HB3  1  
ATOM 321   H HG2  . LYS A 1 23  ? -8.308  1.428   4.577   1.00 0.00 ? 23  LYS A HG2  1  
ATOM 322   H HG3  . LYS A 1 23  ? -6.806  2.281   4.938   1.00 0.00 ? 23  LYS A HG3  1  
ATOM 323   H HD2  . LYS A 1 23  ? -8.792  2.195   7.117   1.00 0.00 ? 23  LYS A HD2  1  
ATOM 324   H HD3  . LYS A 1 23  ? -8.067  0.647   6.678   1.00 0.00 ? 23  LYS A HD3  1  
ATOM 325   H HE2  . LYS A 1 23  ? -5.955  1.305   7.302   1.00 0.00 ? 23  LYS A HE2  1  
ATOM 326   H HE3  . LYS A 1 23  ? -6.296  3.015   7.047   1.00 0.00 ? 23  LYS A HE3  1  
ATOM 327   H HZ1  . LYS A 1 23  ? -7.816  1.710   9.152   1.00 0.00 ? 23  LYS A HZ1  1  
ATOM 328   H HZ2  . LYS A 1 23  ? -7.121  3.251   9.114   1.00 0.00 ? 23  LYS A HZ2  1  
ATOM 329   H HZ3  . LYS A 1 23  ? -6.161  1.898   9.447   1.00 0.00 ? 23  LYS A HZ3  1  
ATOM 330   N N    . VAL A 1 24  ? -8.261  3.073   1.506   1.00 0.00 ? 24  VAL A N    1  
ATOM 331   C CA   . VAL A 1 24  ? -8.886  2.429   0.359   1.00 0.00 ? 24  VAL A CA   1  
ATOM 332   C C    . VAL A 1 24  ? -8.765  0.912   0.447   1.00 0.00 ? 24  VAL A C    1  
ATOM 333   O O    . VAL A 1 24  ? -7.731  0.340   0.102   1.00 0.00 ? 24  VAL A O    1  
ATOM 334   C CB   . VAL A 1 24  ? -8.257  2.905   -0.965  1.00 0.00 ? 24  VAL A CB   1  
ATOM 335   C CG1  . VAL A 1 24  ? -9.048  2.380   -2.153  1.00 0.00 ? 24  VAL A CG1  1  
ATOM 336   C CG2  . VAL A 1 24  ? -8.174  4.423   -1.000  1.00 0.00 ? 24  VAL A CG2  1  
ATOM 337   H H    . VAL A 1 24  ? -7.287  3.177   1.525   1.00 0.00 ? 24  VAL A H    1  
ATOM 338   H HA   . VAL A 1 24  ? -9.932  2.698   0.354   1.00 0.00 ? 24  VAL A HA   1  
ATOM 339   H HB   . VAL A 1 24  ? -7.254  2.510   -1.027  1.00 0.00 ? 24  VAL A HB   1  
ATOM 340   H HG11 . VAL A 1 24  ? -8.368  2.093   -2.941  1.00 0.00 ? 24  VAL A HG11 1  
ATOM 341   H HG12 . VAL A 1 24  ? -9.712  3.152   -2.513  1.00 0.00 ? 24  VAL A HG12 1  
ATOM 342   H HG13 . VAL A 1 24  ? -9.628  1.520   -1.848  1.00 0.00 ? 24  VAL A HG13 1  
ATOM 343   H HG21 . VAL A 1 24  ? -7.271  4.746   -0.502  1.00 0.00 ? 24  VAL A HG21 1  
ATOM 344   H HG22 . VAL A 1 24  ? -9.032  4.843   -0.496  1.00 0.00 ? 24  VAL A HG22 1  
ATOM 345   H HG23 . VAL A 1 24  ? -8.159  4.759   -2.027  1.00 0.00 ? 24  VAL A HG23 1  
ATOM 346   N N    . ASN A 1 25  ? -9.829  0.264   0.912   1.00 0.00 ? 25  ASN A N    1  
ATOM 347   C CA   . ASN A 1 25  ? -9.843  -1.188  1.046   1.00 0.00 ? 25  ASN A CA   1  
ATOM 348   C C    . ASN A 1 25  ? -10.428 -1.843  -0.200  1.00 0.00 ? 25  ASN A C    1  
ATOM 349   O O    . ASN A 1 25  ? -11.568 -1.570  -0.579  1.00 0.00 ? 25  ASN A O    1  
ATOM 350   C CB   . ASN A 1 25  ? -10.647 -1.600  2.280   1.00 0.00 ? 25  ASN A CB   1  
ATOM 351   C CG   . ASN A 1 25  ? -12.039 -0.999  2.289   1.00 0.00 ? 25  ASN A CG   1  
ATOM 352   O OD1  . ASN A 1 25  ? -12.208 0.207   2.104   1.00 0.00 ? 25  ASN A OD1  1  
ATOM 353   N ND2  . ASN A 1 25  ? -13.045 -1.838  2.507   1.00 0.00 ? 25  ASN A ND2  1  
ATOM 354   H H    . ASN A 1 25  ? -10.624 0.776   1.171   1.00 0.00 ? 25  ASN A H    1  
ATOM 355   H HA   . ASN A 1 25  ? -8.822  -1.519  1.165   1.00 0.00 ? 25  ASN A HA   1  
ATOM 356   H HB2  . ASN A 1 25  ? -10.739 -2.675  2.298   1.00 0.00 ? 25  ASN A HB2  1  
ATOM 357   H HB3  . ASN A 1 25  ? -10.126 -1.271  3.167   1.00 0.00 ? 25  ASN A HB3  1  
ATOM 358   H HD21 . ASN A 1 25  ? -12.834 -2.785  2.646   1.00 0.00 ? 25  ASN A HD21 1  
ATOM 359   H HD22 . ASN A 1 25  ? -13.955 -1.476  2.519   1.00 0.00 ? 25  ASN A HD22 1  
ATOM 360   N N    . LEU A 1 26  ? -9.643  -2.708  -0.833  1.00 0.00 ? 26  LEU A N    1  
ATOM 361   C CA   . LEU A 1 26  ? -10.083 -3.403  -2.037  1.00 0.00 ? 26  LEU A CA   1  
ATOM 362   C C    . LEU A 1 26  ? -9.973  -4.914  -1.865  1.00 0.00 ? 26  LEU A C    1  
ATOM 363   O O    . LEU A 1 26  ? -9.048  -5.409  -1.220  1.00 0.00 ? 26  LEU A O    1  
ATOM 364   C CB   . LEU A 1 26  ? -9.256  -2.953  -3.242  1.00 0.00 ? 26  LEU A CB   1  
ATOM 365   C CG   . LEU A 1 26  ? -9.302  -1.452  -3.536  1.00 0.00 ? 26  LEU A CG   1  
ATOM 366   C CD1  . LEU A 1 26  ? -8.129  -1.044  -4.413  1.00 0.00 ? 26  LEU A CD1  1  
ATOM 367   C CD2  . LEU A 1 26  ? -10.620 -1.081  -4.197  1.00 0.00 ? 26  LEU A CD2  1  
ATOM 368   H H    . LEU A 1 26  ? -8.745  -2.883  -0.482  1.00 0.00 ? 26  LEU A H    1  
ATOM 369   H HA   . LEU A 1 26  ? -11.118 -3.147  -2.207  1.00 0.00 ? 26  LEU A HA   1  
ATOM 370   H HB2  . LEU A 1 26  ? -8.226  -3.234  -3.069  1.00 0.00 ? 26  LEU A HB2  1  
ATOM 371   H HB3  . LEU A 1 26  ? -9.612  -3.479  -4.114  1.00 0.00 ? 26  LEU A HB3  1  
ATOM 372   H HG   . LEU A 1 26  ? -9.228  -0.908  -2.605  1.00 0.00 ? 26  LEU A HG   1  
ATOM 373   H HD11 . LEU A 1 26  ? -8.135  -1.632  -5.318  1.00 0.00 ? 26  LEU A HD11 1  
ATOM 374   H HD12 . LEU A 1 26  ? -7.205  -1.212  -3.880  1.00 0.00 ? 26  LEU A HD12 1  
ATOM 375   H HD13 . LEU A 1 26  ? -8.214  0.004   -4.663  1.00 0.00 ? 26  LEU A HD13 1  
ATOM 376   H HD21 . LEU A 1 26  ? -11.017 -1.940  -4.717  1.00 0.00 ? 26  LEU A HD21 1  
ATOM 377   H HD22 . LEU A 1 26  ? -10.457 -0.278  -4.901  1.00 0.00 ? 26  LEU A HD22 1  
ATOM 378   H HD23 . LEU A 1 26  ? -11.323 -0.761  -3.442  1.00 0.00 ? 26  LEU A HD23 1  
ATOM 379   N N    . VAL A 1 27  ? -10.921 -5.641  -2.445  1.00 0.00 ? 27  VAL A N    1  
ATOM 380   C CA   . VAL A 1 27  ? -10.929 -7.097  -2.358  1.00 0.00 ? 27  VAL A CA   1  
ATOM 381   C C    . VAL A 1 27  ? -10.694 -7.731  -3.724  1.00 0.00 ? 27  VAL A C    1  
ATOM 382   O O    . VAL A 1 27  ? -11.496 -7.563  -4.643  1.00 0.00 ? 27  VAL A O    1  
ATOM 383   C CB   . VAL A 1 27  ? -12.262 -7.618  -1.785  1.00 0.00 ? 27  VAL A CB   1  
ATOM 384   C CG1  . VAL A 1 27  ? -12.179 -9.112  -1.515  1.00 0.00 ? 27  VAL A CG1  1  
ATOM 385   C CG2  . VAL A 1 27  ? -12.633 -6.858  -0.520  1.00 0.00 ? 27  VAL A CG2  1  
ATOM 386   H H    . VAL A 1 27  ? -11.632 -5.189  -2.946  1.00 0.00 ? 27  VAL A H    1  
ATOM 387   H HA   . VAL A 1 27  ? -10.134 -7.396  -1.691  1.00 0.00 ? 27  VAL A HA   1  
ATOM 388   H HB   . VAL A 1 27  ? -13.036 -7.450  -2.520  1.00 0.00 ? 27  VAL A HB   1  
ATOM 389   H HG11 . VAL A 1 27  ? -11.503 -9.569  -2.221  1.00 0.00 ? 27  VAL A HG11 1  
ATOM 390   H HG12 . VAL A 1 27  ? -13.160 -9.550  -1.619  1.00 0.00 ? 27  VAL A HG12 1  
ATOM 391   H HG13 . VAL A 1 27  ? -11.817 -9.276  -0.511  1.00 0.00 ? 27  VAL A HG13 1  
ATOM 392   H HG21 . VAL A 1 27  ? -11.913 -7.078  0.255   1.00 0.00 ? 27  VAL A HG21 1  
ATOM 393   H HG22 . VAL A 1 27  ? -13.616 -7.159  -0.194  1.00 0.00 ? 27  VAL A HG22 1  
ATOM 394   H HG23 . VAL A 1 27  ? -12.629 -5.797  -0.723  1.00 0.00 ? 27  VAL A HG23 1  
ATOM 395   N N    . LEU A 1 28  ? -9.591  -8.460  -3.851  1.00 0.00 ? 28  LEU A N    1  
ATOM 396   C CA   . LEU A 1 28  ? -9.250  -9.120  -5.106  1.00 0.00 ? 28  LEU A CA   1  
ATOM 397   C C    . LEU A 1 28  ? -9.699  -10.578 -5.094  1.00 0.00 ? 28  LEU A C    1  
ATOM 398   O O    . LEU A 1 28  ? -9.984  -11.141 -4.037  1.00 0.00 ? 28  LEU A O    1  
ATOM 399   C CB   . LEU A 1 28  ? -7.743  -9.039  -5.355  1.00 0.00 ? 28  LEU A CB   1  
ATOM 400   C CG   . LEU A 1 28  ? -7.139  -7.640  -5.223  1.00 0.00 ? 28  LEU A CG   1  
ATOM 401   C CD1  . LEU A 1 28  ? -5.620  -7.711  -5.229  1.00 0.00 ? 28  LEU A CD1  1  
ATOM 402   C CD2  . LEU A 1 28  ? -7.637  -6.737  -6.343  1.00 0.00 ? 28  LEU A CD2  1  
ATOM 403   H H    . LEU A 1 28  ? -8.991  -8.557  -3.082  1.00 0.00 ? 28  LEU A H    1  
ATOM 404   H HA   . LEU A 1 28  ? -9.765  -8.604  -5.901  1.00 0.00 ? 28  LEU A HA   1  
ATOM 405   H HB2  . LEU A 1 28  ? -7.247  -9.691  -4.651  1.00 0.00 ? 28  LEU A HB2  1  
ATOM 406   H HB3  . LEU A 1 28  ? -7.545  -9.399  -6.354  1.00 0.00 ? 28  LEU A HB3  1  
ATOM 407   H HG   . LEU A 1 28  ? -7.449  -7.209  -4.282  1.00 0.00 ? 28  LEU A HG   1  
ATOM 408   H HD11 . LEU A 1 28  ? -5.304  -8.711  -4.970  1.00 0.00 ? 28  LEU A HD11 1  
ATOM 409   H HD12 . LEU A 1 28  ? -5.224  -7.011  -4.507  1.00 0.00 ? 28  LEU A HD12 1  
ATOM 410   H HD13 . LEU A 1 28  ? -5.251  -7.461  -6.212  1.00 0.00 ? 28  LEU A HD13 1  
ATOM 411   H HD21 . LEU A 1 28  ? -7.116  -6.978  -7.257  1.00 0.00 ? 28  LEU A HD21 1  
ATOM 412   H HD22 . LEU A 1 28  ? -7.450  -5.706  -6.083  1.00 0.00 ? 28  LEU A HD22 1  
ATOM 413   H HD23 . LEU A 1 28  ? -8.697  -6.889  -6.481  1.00 0.00 ? 28  LEU A HD23 1  
ATOM 414   N N    . GLY A 1 29  ? -9.759  -11.182 -6.276  1.00 0.00 ? 29  GLY A N    1  
ATOM 415   C CA   . GLY A 1 29  ? -10.174 -12.570 -6.380  1.00 0.00 ? 29  GLY A CA   1  
ATOM 416   C C    . GLY A 1 29  ? -9.058  -13.475 -6.862  1.00 0.00 ? 29  GLY A C    1  
ATOM 417   O O    . GLY A 1 29  ? -8.099  -13.731 -6.135  1.00 0.00 ? 29  GLY A O    1  
ATOM 418   H H    . GLY A 1 29  ? -9.520  -10.684 -7.085  1.00 0.00 ? 29  GLY A H    1  
ATOM 419   H HA2  . GLY A 1 29  ? -10.503 -12.910 -5.406  1.00 0.00 ? 29  GLY A HA2  1  
ATOM 420   H HA3  . GLY A 1 29  ? -11.002 -12.635 -7.073  1.00 0.00 ? 29  GLY A HA3  1  
ATOM 421   N N    . ASP A 1 30  ? -9.183  -13.959 -8.094  1.00 0.00 ? 30  ASP A N    1  
ATOM 422   C CA   . ASP A 1 30  ? -8.177  -14.842 -8.674  1.00 0.00 ? 30  ASP A CA   1  
ATOM 423   C C    . ASP A 1 30  ? -7.613  -14.251 -9.963  1.00 0.00 ? 30  ASP A C    1  
ATOM 424   O O    . ASP A 1 30  ? -8.179  -14.432 -11.040 1.00 0.00 ? 30  ASP A O    1  
ATOM 425   C CB   . ASP A 1 30  ? -8.777  -16.223 -8.949  1.00 0.00 ? 30  ASP A CB   1  
ATOM 426   C CG   . ASP A 1 30  ? -7.931  -17.345 -8.380  1.00 0.00 ? 30  ASP A CG   1  
ATOM 427   O OD1  . ASP A 1 30  ? -7.263  -17.120 -7.348  1.00 0.00 ? 30  ASP A OD1  1  
ATOM 428   O OD2  . ASP A 1 30  ? -7.935  -18.448 -8.965  1.00 0.00 ? 30  ASP A OD2  1  
ATOM 429   H H    . ASP A 1 30  ? -9.970  -13.719 -8.624  1.00 0.00 ? 30  ASP A H    1  
ATOM 430   H HA   . ASP A 1 30  ? -7.374  -14.945 -7.959  1.00 0.00 ? 30  ASP A HA   1  
ATOM 431   H HB2  . ASP A 1 30  ? -9.758  -16.277 -8.502  1.00 0.00 ? 30  ASP A HB2  1  
ATOM 432   H HB3  . ASP A 1 30  ? -8.864  -16.367 -10.015 1.00 0.00 ? 30  ASP A HB3  1  
ATOM 433   N N    . GLY A 1 31  ? -6.495  -13.543 -9.842  1.00 0.00 ? 31  GLY A N    1  
ATOM 434   C CA   . GLY A 1 31  ? -5.873  -12.936 -11.005 1.00 0.00 ? 31  GLY A CA   1  
ATOM 435   C C    . GLY A 1 31  ? -6.259  -11.479 -11.176 1.00 0.00 ? 31  GLY A C    1  
ATOM 436   O O    . GLY A 1 31  ? -6.221  -10.947 -12.286 1.00 0.00 ? 31  GLY A O    1  
ATOM 437   H H    . GLY A 1 31  ? -6.088  -13.432 -8.957  1.00 0.00 ? 31  GLY A H    1  
ATOM 438   H HA2  . GLY A 1 31  ? -4.798  -13.002 -10.900 1.00 0.00 ? 31  GLY A HA2  1  
ATOM 439   H HA3  . GLY A 1 31  ? -6.176  -13.483 -11.888 1.00 0.00 ? 31  GLY A HA3  1  
ATOM 440   N N    . ARG A 1 32  ? -6.629  -10.831 -10.076 1.00 0.00 ? 32  ARG A N    1  
ATOM 441   C CA   . ARG A 1 32  ? -7.023  -9.428  -10.111 1.00 0.00 ? 32  ARG A CA   1  
ATOM 442   C C    . ARG A 1 32  ? -5.825  -8.520  -9.853  1.00 0.00 ? 32  ARG A C    1  
ATOM 443   O O    . ARG A 1 32  ? -4.701  -8.993  -9.677  1.00 0.00 ? 32  ARG A O    1  
ATOM 444   C CB   . ARG A 1 32  ? -8.116  -9.158  -9.076  1.00 0.00 ? 32  ARG A CB   1  
ATOM 445   C CG   . ARG A 1 32  ? -9.524  -9.330  -9.620  1.00 0.00 ? 32  ARG A CG   1  
ATOM 446   C CD   . ARG A 1 32  ? -10.163 -7.992  -9.958  1.00 0.00 ? 32  ARG A CD   1  
ATOM 447   N NE   . ARG A 1 32  ? -10.678 -7.962  -11.326 1.00 0.00 ? 32  ARG A NE   1  
ATOM 448   C CZ   . ARG A 1 32  ? -10.944 -6.841  -11.993 1.00 0.00 ? 32  ARG A CZ   1  
ATOM 449   N NH1  . ARG A 1 32  ? -10.746 -5.657  -11.425 1.00 0.00 ? 32  ARG A NH1  1  
ATOM 450   N NH2  . ARG A 1 32  ? -11.409 -6.904  -13.233 1.00 0.00 ? 32  ARG A NH2  1  
ATOM 451   H H    . ARG A 1 32  ? -6.639  -11.309 -9.220  1.00 0.00 ? 32  ARG A H    1  
ATOM 452   H HA   . ARG A 1 32  ? -7.412  -9.218  -11.096 1.00 0.00 ? 32  ARG A HA   1  
ATOM 453   H HB2  . ARG A 1 32  ? -7.987  -9.838  -8.248  1.00 0.00 ? 32  ARG A HB2  1  
ATOM 454   H HB3  . ARG A 1 32  ? -8.013  -8.144  -8.717  1.00 0.00 ? 32  ARG A HB3  1  
ATOM 455   H HG2  . ARG A 1 32  ? -9.483  -9.933  -10.514 1.00 0.00 ? 32  ARG A HG2  1  
ATOM 456   H HG3  . ARG A 1 32  ? -10.128 -9.829  -8.875  1.00 0.00 ? 32  ARG A HG3  1  
ATOM 457   H HD2  . ARG A 1 32  ? -10.979 -7.813  -9.274  1.00 0.00 ? 32  ARG A HD2  1  
ATOM 458   H HD3  . ARG A 1 32  ? -9.422  -7.214  -9.845  1.00 0.00 ? 32  ARG A HD3  1  
ATOM 459   H HE   . ARG A 1 32  ? -10.833 -8.821  -11.770 1.00 0.00 ? 32  ARG A HE   1  
ATOM 460   H HH11 . ARG A 1 32  ? -10.395 -5.604  -10.490 1.00 0.00 ? 32  ARG A HH11 1  
ATOM 461   H HH12 . ARG A 1 32  ? -10.947 -4.820  -11.932 1.00 0.00 ? 32  ARG A HH12 1  
ATOM 462   H HH21 . ARG A 1 32  ? -11.560 -7.791  -13.667 1.00 0.00 ? 32  ARG A HH21 1  
ATOM 463   H HH22 . ARG A 1 32  ? -11.609 -6.061  -13.735 1.00 0.00 ? 32  ARG A HH22 1  
ATOM 464   N N    . SER A 1 33  ? -6.071  -7.215  -9.830  1.00 0.00 ? 33  SER A N    1  
ATOM 465   C CA   . SER A 1 33  ? -5.012  -6.241  -9.592  1.00 0.00 ? 33  SER A CA   1  
ATOM 466   C C    . SER A 1 33  ? -5.588  -4.837  -9.443  1.00 0.00 ? 33  SER A C    1  
ATOM 467   O O    . SER A 1 33  ? -6.786  -4.623  -9.633  1.00 0.00 ? 33  SER A O    1  
ATOM 468   C CB   . SER A 1 33  ? -3.997  -6.270  -10.737 1.00 0.00 ? 33  SER A CB   1  
ATOM 469   O OG   . SER A 1 33  ? -3.072  -7.331  -10.572 1.00 0.00 ? 33  SER A OG   1  
ATOM 470   H H    . SER A 1 33  ? -6.987  -6.900  -9.977  1.00 0.00 ? 33  SER A H    1  
ATOM 471   H HA   . SER A 1 33  ? -4.513  -6.512  -8.674  1.00 0.00 ? 33  SER A HA   1  
ATOM 472   H HB2  . SER A 1 33  ? -4.518  -6.406  -11.673 1.00 0.00 ? 33  SER A HB2  1  
ATOM 473   H HB3  . SER A 1 33  ? -3.456  -5.336  -10.758 1.00 0.00 ? 33  SER A HB3  1  
ATOM 474   H HG   . SER A 1 33  ? -3.509  -8.168  -10.744 1.00 0.00 ? 33  SER A HG   1  
ATOM 475   N N    . LEU A 1 34  ? -4.728  -3.882  -9.104  1.00 0.00 ? 34  LEU A N    1  
ATOM 476   C CA   . LEU A 1 34  ? -5.151  -2.499  -8.930  1.00 0.00 ? 34  LEU A CA   1  
ATOM 477   C C    . LEU A 1 34  ? -5.023  -1.722  -10.236 1.00 0.00 ? 34  LEU A C    1  
ATOM 478   O O    . LEU A 1 34  ? -5.809  -0.815  -10.511 1.00 0.00 ? 34  LEU A O    1  
ATOM 479   C CB   . LEU A 1 34  ? -4.320  -1.822  -7.838  1.00 0.00 ? 34  LEU A CB   1  
ATOM 480   C CG   . LEU A 1 34  ? -4.356  -2.515  -6.475  1.00 0.00 ? 34  LEU A CG   1  
ATOM 481   C CD1  . LEU A 1 34  ? -3.019  -2.367  -5.765  1.00 0.00 ? 34  LEU A CD1  1  
ATOM 482   C CD2  . LEU A 1 34  ? -5.481  -1.950  -5.620  1.00 0.00 ? 34  LEU A CD2  1  
ATOM 483   H H    . LEU A 1 34  ? -3.786  -4.115  -8.966  1.00 0.00 ? 34  LEU A H    1  
ATOM 484   H HA   . LEU A 1 34  ? -6.189  -2.505  -8.629  1.00 0.00 ? 34  LEU A HA   1  
ATOM 485   H HB2  . LEU A 1 34  ? -3.291  -1.781  -8.172  1.00 0.00 ? 34  LEU A HB2  1  
ATOM 486   H HB3  . LEU A 1 34  ? -4.684  -0.810  -7.713  1.00 0.00 ? 34  LEU A HB3  1  
ATOM 487   H HG   . LEU A 1 34  ? -4.542  -3.569  -6.619  1.00 0.00 ? 34  LEU A HG   1  
ATOM 488   H HD11 . LEU A 1 34  ? -3.183  -2.294  -4.700  1.00 0.00 ? 34  LEU A HD11 1  
ATOM 489   H HD12 . LEU A 1 34  ? -2.521  -1.475  -6.116  1.00 0.00 ? 34  LEU A HD12 1  
ATOM 490   H HD13 . LEU A 1 34  ? -2.403  -3.229  -5.976  1.00 0.00 ? 34  LEU A HD13 1  
ATOM 491   H HD21 . LEU A 1 34  ? -5.683  -0.931  -5.919  1.00 0.00 ? 34  LEU A HD21 1  
ATOM 492   H HD22 . LEU A 1 34  ? -5.187  -1.968  -4.581  1.00 0.00 ? 34  LEU A HD22 1  
ATOM 493   H HD23 . LEU A 1 34  ? -6.370  -2.548  -5.753  1.00 0.00 ? 34  LEU A HD23 1  
ATOM 494   N N    . GLY A 1 35  ? -4.027  -2.084  -11.039 1.00 0.00 ? 35  GLY A N    1  
ATOM 495   C CA   . GLY A 1 35  ? -3.814  -1.411  -12.306 1.00 0.00 ? 35  GLY A CA   1  
ATOM 496   C C    . GLY A 1 35  ? -3.353  0.023   -12.130 1.00 0.00 ? 35  GLY A C    1  
ATOM 497   O O    . GLY A 1 35  ? -3.674  0.889   -12.944 1.00 0.00 ? 35  GLY A O    1  
ATOM 498   H H    . GLY A 1 35  ? -3.432  -2.814  -10.768 1.00 0.00 ? 35  GLY A H    1  
ATOM 499   H HA2  . GLY A 1 35  ? -3.064  -1.952  -12.867 1.00 0.00 ? 35  GLY A HA2  1  
ATOM 500   H HA3  . GLY A 1 35  ? -4.743  -1.414  -12.864 1.00 0.00 ? 35  GLY A HA3  1  
ATOM 501   N N    . LEU A 1 36  ? -2.599  0.273   -11.065 1.00 0.00 ? 36  LEU A N    1  
ATOM 502   C CA   . LEU A 1 36  ? -2.093  1.611   -10.783 1.00 0.00 ? 36  LEU A CA   1  
ATOM 503   C C    . LEU A 1 36  ? -0.589  1.686   -11.028 1.00 0.00 ? 36  LEU A C    1  
ATOM 504   O O    . LEU A 1 36  ? 0.179   0.894   -10.482 1.00 0.00 ? 36  LEU A O    1  
ATOM 505   C CB   . LEU A 1 36  ? -2.406  2.004   -9.338  1.00 0.00 ? 36  LEU A CB   1  
ATOM 506   C CG   . LEU A 1 36  ? -3.895  2.127   -9.009  1.00 0.00 ? 36  LEU A CG   1  
ATOM 507   C CD1  . LEU A 1 36  ? -4.089  2.518   -7.552  1.00 0.00 ? 36  LEU A CD1  1  
ATOM 508   C CD2  . LEU A 1 36  ? -4.560  3.140   -9.928  1.00 0.00 ? 36  LEU A CD2  1  
ATOM 509   H H    . LEU A 1 36  ? -2.378  -0.460  -10.453 1.00 0.00 ? 36  LEU A H    1  
ATOM 510   H HA   . LEU A 1 36  ? -2.589  2.300   -11.450 1.00 0.00 ? 36  LEU A HA   1  
ATOM 511   H HB2  . LEU A 1 36  ? -1.974  1.261   -8.683  1.00 0.00 ? 36  LEU A HB2  1  
ATOM 512   H HB3  . LEU A 1 36  ? -1.937  2.955   -9.136  1.00 0.00 ? 36  LEU A HB3  1  
ATOM 513   H HG   . LEU A 1 36  ? -4.372  1.170   -9.164  1.00 0.00 ? 36  LEU A HG   1  
ATOM 514   H HD11 . LEU A 1 36  ? -4.230  1.627   -6.957  1.00 0.00 ? 36  LEU A HD11 1  
ATOM 515   H HD12 . LEU A 1 36  ? -4.958  3.152   -7.462  1.00 0.00 ? 36  LEU A HD12 1  
ATOM 516   H HD13 . LEU A 1 36  ? -3.216  3.049   -7.203  1.00 0.00 ? 36  LEU A HD13 1  
ATOM 517   H HD21 . LEU A 1 36  ? -5.347  3.650   -9.392  1.00 0.00 ? 36  LEU A HD21 1  
ATOM 518   H HD22 . LEU A 1 36  ? -4.980  2.630   -10.783 1.00 0.00 ? 36  LEU A HD22 1  
ATOM 519   H HD23 . LEU A 1 36  ? -3.827  3.859   -10.262 1.00 0.00 ? 36  LEU A HD23 1  
ATOM 520   N N    . THR A 1 37  ? -0.175  2.642   -11.852 1.00 0.00 ? 37  THR A N    1  
ATOM 521   C CA   . THR A 1 37  ? 1.236   2.821   -12.169 1.00 0.00 ? 37  THR A CA   1  
ATOM 522   C C    . THR A 1 37  ? 1.929   3.670   -11.108 1.00 0.00 ? 37  THR A C    1  
ATOM 523   O O    . THR A 1 37  ? 2.060   4.885   -11.260 1.00 0.00 ? 37  THR A O    1  
ATOM 524   C CB   . THR A 1 37  ? 1.394   3.473   -13.544 1.00 0.00 ? 37  THR A CB   1  
ATOM 525   O OG1  . THR A 1 37  ? 0.512   2.883   -14.482 1.00 0.00 ? 37  THR A OG1  1  
ATOM 526   C CG2  . THR A 1 37  ? 2.797   3.364   -14.100 1.00 0.00 ? 37  THR A CG2  1  
ATOM 527   H H    . THR A 1 37  ? -0.836  3.243   -12.258 1.00 0.00 ? 37  THR A H    1  
ATOM 528   H HA   . THR A 1 37  ? 1.697   1.845   -12.188 1.00 0.00 ? 37  THR A HA   1  
ATOM 529   H HB   . THR A 1 37  ? 1.150   4.522   -13.463 1.00 0.00 ? 37  THR A HB   1  
ATOM 530   H HG1  . THR A 1 37  ? 0.499   3.408   -15.285 1.00 0.00 ? 37  THR A HG1  1  
ATOM 531   H HG21 . THR A 1 37  ? 3.022   2.328   -14.309 1.00 0.00 ? 37  THR A HG21 1  
ATOM 532   H HG22 . THR A 1 37  ? 3.502   3.747   -13.378 1.00 0.00 ? 37  THR A HG22 1  
ATOM 533   H HG23 . THR A 1 37  ? 2.868   3.938   -15.013 1.00 0.00 ? 37  THR A HG23 1  
ATOM 534   N N    . ILE A 1 38  ? 2.370   3.023   -10.035 1.00 0.00 ? 38  ILE A N    1  
ATOM 535   C CA   . ILE A 1 38  ? 3.050   3.720   -8.949  1.00 0.00 ? 38  ILE A CA   1  
ATOM 536   C C    . ILE A 1 38  ? 4.486   4.060   -9.327  1.00 0.00 ? 38  ILE A C    1  
ATOM 537   O O    . ILE A 1 38  ? 5.099   3.383   -10.153 1.00 0.00 ? 38  ILE A O    1  
ATOM 538   C CB   . ILE A 1 38  ? 3.056   2.879   -7.658  1.00 0.00 ? 38  ILE A CB   1  
ATOM 539   C CG1  . ILE A 1 38  ? 3.714   1.521   -7.911  1.00 0.00 ? 38  ILE A CG1  1  
ATOM 540   C CG2  . ILE A 1 38  ? 1.639   2.697   -7.137  1.00 0.00 ? 38  ILE A CG2  1  
ATOM 541   C CD1  . ILE A 1 38  ? 4.339   0.913   -6.675  1.00 0.00 ? 38  ILE A CD1  1  
ATOM 542   H H    . ILE A 1 38  ? 2.235   2.055   -9.972  1.00 0.00 ? 38  ILE A H    1  
ATOM 543   H HA   . ILE A 1 38  ? 2.512   4.636   -8.754  1.00 0.00 ? 38  ILE A HA   1  
ATOM 544   H HB   . ILE A 1 38  ? 3.622   3.412   -6.910  1.00 0.00 ? 38  ILE A HB   1  
ATOM 545   H HG12 . ILE A 1 38  ? 2.971   0.831   -8.280  1.00 0.00 ? 38  ILE A HG12 1  
ATOM 546   H HG13 . ILE A 1 38  ? 4.490   1.638   -8.653  1.00 0.00 ? 38  ILE A HG13 1  
ATOM 547   H HG21 . ILE A 1 38  ? 1.001   2.354   -7.938  1.00 0.00 ? 38  ILE A HG21 1  
ATOM 548   H HG22 . ILE A 1 38  ? 1.269   3.640   -6.763  1.00 0.00 ? 38  ILE A HG22 1  
ATOM 549   H HG23 . ILE A 1 38  ? 1.638   1.968   -6.340  1.00 0.00 ? 38  ILE A HG23 1  
ATOM 550   H HD11 . ILE A 1 38  ? 5.411   0.866   -6.799  1.00 0.00 ? 38  ILE A HD11 1  
ATOM 551   H HD12 . ILE A 1 38  ? 3.949   -0.083  -6.527  1.00 0.00 ? 38  ILE A HD12 1  
ATOM 552   H HD13 . ILE A 1 38  ? 4.104   1.523   -5.815  1.00 0.00 ? 38  ILE A HD13 1  
ATOM 553   N N    . ARG A 1 39  ? 5.020   5.113   -8.717  1.00 0.00 ? 39  ARG A N    1  
ATOM 554   C CA   . ARG A 1 39  ? 6.386   5.544   -8.989  1.00 0.00 ? 39  ARG A CA   1  
ATOM 555   C C    . ARG A 1 39  ? 7.141   5.811   -7.690  1.00 0.00 ? 39  ARG A C    1  
ATOM 556   O O    . ARG A 1 39  ? 6.544   5.865   -6.614  1.00 0.00 ? 39  ARG A O    1  
ATOM 557   C CB   . ARG A 1 39  ? 6.383   6.803   -9.858  1.00 0.00 ? 39  ARG A CB   1  
ATOM 558   C CG   . ARG A 1 39  ? 5.513   7.921   -9.306  1.00 0.00 ? 39  ARG A CG   1  
ATOM 559   C CD   . ARG A 1 39  ? 6.265   8.756   -8.283  1.00 0.00 ? 39  ARG A CD   1  
ATOM 560   N NE   . ARG A 1 39  ? 5.949   10.178  -8.397  1.00 0.00 ? 39  ARG A NE   1  
ATOM 561   C CZ   . ARG A 1 39  ? 6.476   10.982  -9.317  1.00 0.00 ? 39  ARG A CZ   1  
ATOM 562   N NH1  . ARG A 1 39  ? 7.343   10.510  -10.203 1.00 0.00 ? 39  ARG A NH1  1  
ATOM 563   N NH2  . ARG A 1 39  ? 6.134   12.263  -9.351  1.00 0.00 ? 39  ARG A NH2  1  
ATOM 564   H H    . ARG A 1 39  ? 4.481   5.612   -8.067  1.00 0.00 ? 39  ARG A H    1  
ATOM 565   H HA   . ARG A 1 39  ? 6.884   4.749   -9.524  1.00 0.00 ? 39  ARG A HA   1  
ATOM 566   H HB2  . ARG A 1 39  ? 7.394   7.170   -9.943  1.00 0.00 ? 39  ARG A HB2  1  
ATOM 567   H HB3  . ARG A 1 39  ? 6.019   6.545   -10.842 1.00 0.00 ? 39  ARG A HB3  1  
ATOM 568   H HG2  . ARG A 1 39  ? 5.206   8.560   -10.120 1.00 0.00 ? 39  ARG A HG2  1  
ATOM 569   H HG3  . ARG A 1 39  ? 4.643   7.488   -8.836  1.00 0.00 ? 39  ARG A HG3  1  
ATOM 570   H HD2  . ARG A 1 39  ? 5.996   8.417   -7.293  1.00 0.00 ? 39  ARG A HD2  1  
ATOM 571   H HD3  . ARG A 1 39  ? 7.326   8.619   -8.433  1.00 0.00 ? 39  ARG A HD3  1  
ATOM 572   H HE   . ARG A 1 39  ? 5.311   10.553  -7.754  1.00 0.00 ? 39  ARG A HE   1  
ATOM 573   H HH11 . ARG A 1 39  ? 7.605   9.546   -10.183 1.00 0.00 ? 39  ARG A HH11 1  
ATOM 574   H HH12 . ARG A 1 39  ? 7.735   11.120  -10.893 1.00 0.00 ? 39  ARG A HH12 1  
ATOM 575   H HH21 . ARG A 1 39  ? 5.481   12.624  -8.685  1.00 0.00 ? 39  ARG A HH21 1  
ATOM 576   H HH22 . ARG A 1 39  ? 6.530   12.868  -10.042 1.00 0.00 ? 39  ARG A HH22 1  
ATOM 577   N N    . GLY A 1 40  ? 8.454   5.978   -7.799  1.00 0.00 ? 40  GLY A N    1  
ATOM 578   C CA   . GLY A 1 40  ? 9.268   6.238   -6.625  1.00 0.00 ? 40  GLY A CA   1  
ATOM 579   C C    . GLY A 1 40  ? 9.607   4.972   -5.862  1.00 0.00 ? 40  GLY A C    1  
ATOM 580   O O    . GLY A 1 40  ? 8.993   3.927   -6.078  1.00 0.00 ? 40  GLY A O    1  
ATOM 581   H H    . GLY A 1 40  ? 8.875   5.925   -8.682  1.00 0.00 ? 40  GLY A H    1  
ATOM 582   H HA2  . GLY A 1 40  ? 10.186  6.714   -6.936  1.00 0.00 ? 40  GLY A HA2  1  
ATOM 583   H HA3  . GLY A 1 40  ? 8.732   6.907   -5.969  1.00 0.00 ? 40  GLY A HA3  1  
ATOM 584   N N    . GLY A 1 41  ? 10.586  5.066   -4.968  1.00 0.00 ? 41  GLY A N    1  
ATOM 585   C CA   . GLY A 1 41  ? 10.987  3.912   -4.185  1.00 0.00 ? 41  GLY A CA   1  
ATOM 586   C C    . GLY A 1 41  ? 12.168  4.209   -3.280  1.00 0.00 ? 41  GLY A C    1  
ATOM 587   O O    . GLY A 1 41  ? 12.763  5.283   -3.357  1.00 0.00 ? 41  GLY A O    1  
ATOM 588   H H    . GLY A 1 41  ? 11.039  5.925   -4.839  1.00 0.00 ? 41  GLY A H    1  
ATOM 589   H HA2  . GLY A 1 41  ? 10.151  3.596   -3.574  1.00 0.00 ? 41  GLY A HA2  1  
ATOM 590   H HA3  . GLY A 1 41  ? 11.256  3.109   -4.858  1.00 0.00 ? 41  GLY A HA3  1  
ATOM 591   N N    . ALA A 1 42  ? 12.507  3.253   -2.421  1.00 0.00 ? 42  ALA A N    1  
ATOM 592   C CA   . ALA A 1 42  ? 13.624  3.416   -1.498  1.00 0.00 ? 42  ALA A CA   1  
ATOM 593   C C    . ALA A 1 42  ? 14.954  3.420   -2.243  1.00 0.00 ? 42  ALA A C    1  
ATOM 594   O O    . ALA A 1 42  ? 15.898  4.103   -1.844  1.00 0.00 ? 42  ALA A O    1  
ATOM 595   C CB   . ALA A 1 42  ? 13.607  2.314   -0.451  1.00 0.00 ? 42  ALA A CB   1  
ATOM 596   H H    . ALA A 1 42  ? 11.994  2.418   -2.408  1.00 0.00 ? 42  ALA A H    1  
ATOM 597   H HA   . ALA A 1 42  ? 13.502  4.363   -0.992  1.00 0.00 ? 42  ALA A HA   1  
ATOM 598   H HB1  . ALA A 1 42  ? 12.669  2.339   0.084   1.00 0.00 ? 42  ALA A HB1  1  
ATOM 599   H HB2  . ALA A 1 42  ? 14.421  2.464   0.244   1.00 0.00 ? 42  ALA A HB2  1  
ATOM 600   H HB3  . ALA A 1 42  ? 13.719  1.354   -0.935  1.00 0.00 ? 42  ALA A HB3  1  
ATOM 601   N N    . GLU A 1 43  ? 15.023  2.652   -3.326  1.00 0.00 ? 43  GLU A N    1  
ATOM 602   C CA   . GLU A 1 43  ? 16.239  2.568   -4.127  1.00 0.00 ? 43  GLU A CA   1  
ATOM 603   C C    . GLU A 1 43  ? 16.619  3.936   -4.684  1.00 0.00 ? 43  GLU A C    1  
ATOM 604   O O    . GLU A 1 43  ? 17.800  4.269   -4.786  1.00 0.00 ? 43  GLU A O    1  
ATOM 605   C CB   . GLU A 1 43  ? 16.051  1.572   -5.272  1.00 0.00 ? 43  GLU A CB   1  
ATOM 606   C CG   . GLU A 1 43  ? 17.352  1.173   -5.950  1.00 0.00 ? 43  GLU A CG   1  
ATOM 607   C CD   . GLU A 1 43  ? 17.147  0.718   -7.382  1.00 0.00 ? 43  GLU A CD   1  
ATOM 608   O OE1  . GLU A 1 43  ? 16.054  0.196   -7.688  1.00 0.00 ? 43  GLU A OE1  1  
ATOM 609   O OE2  . GLU A 1 43  ? 18.079  0.883   -8.197  1.00 0.00 ? 43  GLU A OE2  1  
ATOM 610   H H    . GLU A 1 43  ? 14.238  2.132   -3.593  1.00 0.00 ? 43  GLU A H    1  
ATOM 611   H HA   . GLU A 1 43  ? 17.035  2.219   -3.485  1.00 0.00 ? 43  GLU A HA   1  
ATOM 612   H HB2  . GLU A 1 43  ? 15.584  0.679   -4.885  1.00 0.00 ? 43  GLU A HB2  1  
ATOM 613   H HB3  . GLU A 1 43  ? 15.404  2.013   -6.015  1.00 0.00 ? 43  GLU A HB3  1  
ATOM 614   H HG2  . GLU A 1 43  ? 18.018  2.022   -5.951  1.00 0.00 ? 43  GLU A HG2  1  
ATOM 615   H HG3  . GLU A 1 43  ? 17.800  0.364   -5.391  1.00 0.00 ? 43  GLU A HG3  1  
ATOM 616   N N    . TYR A 1 44  ? 15.611  4.724   -5.043  1.00 0.00 ? 44  TYR A N    1  
ATOM 617   C CA   . TYR A 1 44  ? 15.840  6.056   -5.589  1.00 0.00 ? 44  TYR A CA   1  
ATOM 618   C C    . TYR A 1 44  ? 15.741  7.116   -4.497  1.00 0.00 ? 44  TYR A C    1  
ATOM 619   O O    . TYR A 1 44  ? 16.409  8.148   -4.558  1.00 0.00 ? 44  TYR A O    1  
ATOM 620   C CB   . TYR A 1 44  ? 14.829  6.354   -6.699  1.00 0.00 ? 44  TYR A CB   1  
ATOM 621   C CG   . TYR A 1 44  ? 14.924  5.409   -7.876  1.00 0.00 ? 44  TYR A CG   1  
ATOM 622   C CD1  . TYR A 1 44  ? 15.953  5.524   -8.803  1.00 0.00 ? 44  TYR A CD1  1  
ATOM 623   C CD2  . TYR A 1 44  ? 13.985  4.402   -8.059  1.00 0.00 ? 44  TYR A CD2  1  
ATOM 624   C CE1  . TYR A 1 44  ? 16.041  4.662   -9.880  1.00 0.00 ? 44  TYR A CE1  1  
ATOM 625   C CE2  . TYR A 1 44  ? 14.068  3.535   -9.132  1.00 0.00 ? 44  TYR A CE2  1  
ATOM 626   C CZ   . TYR A 1 44  ? 15.098  3.670   -10.039 1.00 0.00 ? 44  TYR A CZ   1  
ATOM 627   O OH   . TYR A 1 44  ? 15.183  2.809   -11.110 1.00 0.00 ? 44  TYR A OH   1  
ATOM 628   H H    . TYR A 1 44  ? 14.692  4.401   -4.937  1.00 0.00 ? 44  TYR A H    1  
ATOM 629   H HA   . TYR A 1 44  ? 16.835  6.076   -6.007  1.00 0.00 ? 44  TYR A HA   1  
ATOM 630   H HB2  . TYR A 1 44  ? 13.831  6.282   -6.296  1.00 0.00 ? 44  TYR A HB2  1  
ATOM 631   H HB3  . TYR A 1 44  ? 14.993  7.358   -7.064  1.00 0.00 ? 44  TYR A HB3  1  
ATOM 632   H HD1  . TYR A 1 44  ? 16.691  6.302   -8.675  1.00 0.00 ? 44  TYR A HD1  1  
ATOM 633   H HD2  . TYR A 1 44  ? 13.179  4.299   -7.347  1.00 0.00 ? 44  TYR A HD2  1  
ATOM 634   H HE1  . TYR A 1 44  ? 16.849  4.767   -10.589 1.00 0.00 ? 44  TYR A HE1  1  
ATOM 635   H HE2  . TYR A 1 44  ? 13.328  2.758   -9.257  1.00 0.00 ? 44  TYR A HE2  1  
ATOM 636   H HH   . TYR A 1 44  ? 16.072  2.449   -11.161 1.00 0.00 ? 44  TYR A HH   1  
ATOM 637   N N    . GLY A 1 45  ? 14.903  6.854   -3.500  1.00 0.00 ? 45  GLY A N    1  
ATOM 638   C CA   . GLY A 1 45  ? 14.733  7.795   -2.409  1.00 0.00 ? 45  GLY A CA   1  
ATOM 639   C C    . GLY A 1 45  ? 13.492  8.651   -2.569  1.00 0.00 ? 45  GLY A C    1  
ATOM 640   O O    . GLY A 1 45  ? 13.444  9.782   -2.087  1.00 0.00 ? 45  GLY A O    1  
ATOM 641   H H    . GLY A 1 45  ? 14.397  6.015   -3.505  1.00 0.00 ? 45  GLY A H    1  
ATOM 642   H HA2  . GLY A 1 45  ? 14.661  7.244   -1.482  1.00 0.00 ? 45  GLY A HA2  1  
ATOM 643   H HA3  . GLY A 1 45  ? 15.598  8.440   -2.364  1.00 0.00 ? 45  GLY A HA3  1  
ATOM 644   N N    . LEU A 1 46  ? 12.486  8.109   -3.248  1.00 0.00 ? 46  LEU A N    1  
ATOM 645   C CA   . LEU A 1 46  ? 11.238  8.830   -3.470  1.00 0.00 ? 46  LEU A CA   1  
ATOM 646   C C    . LEU A 1 46  ? 10.058  8.075   -2.866  1.00 0.00 ? 46  LEU A C    1  
ATOM 647   O O    . LEU A 1 46  ? 10.088  6.851   -2.746  1.00 0.00 ? 46  LEU A O    1  
ATOM 648   C CB   . LEU A 1 46  ? 11.008  9.042   -4.968  1.00 0.00 ? 46  LEU A CB   1  
ATOM 649   C CG   . LEU A 1 46  ? 9.700   9.748   -5.328  1.00 0.00 ? 46  LEU A CG   1  
ATOM 650   C CD1  . LEU A 1 46  ? 9.746   11.208  -4.907  1.00 0.00 ? 46  LEU A CD1  1  
ATOM 651   C CD2  . LEU A 1 46  ? 9.426   9.630   -6.820  1.00 0.00 ? 46  LEU A CD2  1  
ATOM 652   H H    . LEU A 1 46  ? 12.585  7.202   -3.606  1.00 0.00 ? 46  LEU A H    1  
ATOM 653   H HA   . LEU A 1 46  ? 11.320  9.792   -2.989  1.00 0.00 ? 46  LEU A HA   1  
ATOM 654   H HB2  . LEU A 1 46  ? 11.830  9.631   -5.356  1.00 0.00 ? 46  LEU A HB2  1  
ATOM 655   H HB3  . LEU A 1 46  ? 11.016  8.075   -5.453  1.00 0.00 ? 46  LEU A HB3  1  
ATOM 656   H HG   . LEU A 1 46  ? 8.886   9.274   -4.799  1.00 0.00 ? 46  LEU A HG   1  
ATOM 657   H HD11 . LEU A 1 46  ? 8.742   11.570  -4.751  1.00 0.00 ? 46  LEU A HD11 1  
ATOM 658   H HD12 . LEU A 1 46  ? 10.224  11.791  -5.680  1.00 0.00 ? 46  LEU A HD12 1  
ATOM 659   H HD13 . LEU A 1 46  ? 10.308  11.299  -3.989  1.00 0.00 ? 46  LEU A HD13 1  
ATOM 660   H HD21 . LEU A 1 46  ? 10.362  9.631   -7.359  1.00 0.00 ? 46  LEU A HD21 1  
ATOM 661   H HD22 . LEU A 1 46  ? 8.825   10.468  -7.143  1.00 0.00 ? 46  LEU A HD22 1  
ATOM 662   H HD23 . LEU A 1 46  ? 8.897   8.710   -7.018  1.00 0.00 ? 46  LEU A HD23 1  
ATOM 663   N N    . GLY A 1 47  ? 9.021   8.815   -2.486  1.00 0.00 ? 47  GLY A N    1  
ATOM 664   C CA   . GLY A 1 47  ? 7.847   8.199   -1.898  1.00 0.00 ? 47  GLY A CA   1  
ATOM 665   C C    . GLY A 1 47  ? 7.087   7.336   -2.887  1.00 0.00 ? 47  GLY A C    1  
ATOM 666   O O    . GLY A 1 47  ? 7.518   7.161   -4.027  1.00 0.00 ? 47  GLY A O    1  
ATOM 667   H H    . GLY A 1 47  ? 9.054   9.787   -2.606  1.00 0.00 ? 47  GLY A H    1  
ATOM 668   H HA2  . GLY A 1 47  ? 8.154   7.585   -1.065  1.00 0.00 ? 47  GLY A HA2  1  
ATOM 669   H HA3  . GLY A 1 47  ? 7.189   8.976   -1.536  1.00 0.00 ? 47  GLY A HA3  1  
ATOM 670   N N    . ILE A 1 48  ? 5.953   6.798   -2.451  1.00 0.00 ? 48  ILE A N    1  
ATOM 671   C CA   . ILE A 1 48  ? 5.131   5.950   -3.306  1.00 0.00 ? 48  ILE A CA   1  
ATOM 672   C C    . ILE A 1 48  ? 3.916   6.709   -3.826  1.00 0.00 ? 48  ILE A C    1  
ATOM 673   O O    . ILE A 1 48  ? 2.895   6.807   -3.144  1.00 0.00 ? 48  ILE A O    1  
ATOM 674   C CB   . ILE A 1 48  ? 4.656   4.690   -2.558  1.00 0.00 ? 48  ILE A CB   1  
ATOM 675   C CG1  . ILE A 1 48  ? 5.834   4.007   -1.863  1.00 0.00 ? 48  ILE A CG1  1  
ATOM 676   C CG2  . ILE A 1 48  ? 3.971   3.730   -3.519  1.00 0.00 ? 48  ILE A CG2  1  
ATOM 677   C CD1  . ILE A 1 48  ? 6.874   3.470   -2.822  1.00 0.00 ? 48  ILE A CD1  1  
ATOM 678   H H    . ILE A 1 48  ? 5.662   6.976   -1.532  1.00 0.00 ? 48  ILE A H    1  
ATOM 679   H HA   . ILE A 1 48  ? 5.736   5.639   -4.146  1.00 0.00 ? 48  ILE A HA   1  
ATOM 680   H HB   . ILE A 1 48  ? 3.933   4.992   -1.814  1.00 0.00 ? 48  ILE A HB   1  
ATOM 681   H HG12 . ILE A 1 48  ? 6.321   4.718   -1.212  1.00 0.00 ? 48  ILE A HG12 1  
ATOM 682   H HG13 . ILE A 1 48  ? 5.467   3.180   -1.274  1.00 0.00 ? 48  ILE A HG13 1  
ATOM 683   H HG21 . ILE A 1 48  ? 3.572   2.891   -2.967  1.00 0.00 ? 48  ILE A HG21 1  
ATOM 684   H HG22 . ILE A 1 48  ? 4.688   3.374   -4.244  1.00 0.00 ? 48  ILE A HG22 1  
ATOM 685   H HG23 . ILE A 1 48  ? 3.168   4.241   -4.029  1.00 0.00 ? 48  ILE A HG23 1  
ATOM 686   H HD11 . ILE A 1 48  ? 6.714   3.896   -3.802  1.00 0.00 ? 48  ILE A HD11 1  
ATOM 687   H HD12 . ILE A 1 48  ? 6.792   2.395   -2.878  1.00 0.00 ? 48  ILE A HD12 1  
ATOM 688   H HD13 . ILE A 1 48  ? 7.860   3.738   -2.471  1.00 0.00 ? 48  ILE A HD13 1  
ATOM 689   N N    . TYR A 1 49  ? 4.032   7.244   -5.037  1.00 0.00 ? 49  TYR A N    1  
ATOM 690   C CA   . TYR A 1 49  ? 2.941   7.993   -5.649  1.00 0.00 ? 49  TYR A CA   1  
ATOM 691   C C    . TYR A 1 49  ? 2.292   7.192   -6.771  1.00 0.00 ? 49  TYR A C    1  
ATOM 692   O O    . TYR A 1 49  ? 2.660   6.044   -7.020  1.00 0.00 ? 49  TYR A O    1  
ATOM 693   C CB   . TYR A 1 49  ? 3.454   9.328   -6.191  1.00 0.00 ? 49  TYR A CB   1  
ATOM 694   C CG   . TYR A 1 49  ? 4.264   10.120  -5.189  1.00 0.00 ? 49  TYR A CG   1  
ATOM 695   C CD1  . TYR A 1 49  ? 5.531   9.700   -4.804  1.00 0.00 ? 49  TYR A CD1  1  
ATOM 696   C CD2  . TYR A 1 49  ? 3.762   11.288  -4.628  1.00 0.00 ? 49  TYR A CD2  1  
ATOM 697   C CE1  . TYR A 1 49  ? 6.275   10.420  -3.888  1.00 0.00 ? 49  TYR A CE1  1  
ATOM 698   C CE2  . TYR A 1 49  ? 4.499   12.013  -3.712  1.00 0.00 ? 49  TYR A CE2  1  
ATOM 699   C CZ   . TYR A 1 49  ? 5.754   11.576  -3.345  1.00 0.00 ? 49  TYR A CZ   1  
ATOM 700   O OH   . TYR A 1 49  ? 6.491   12.296  -2.433  1.00 0.00 ? 49  TYR A OH   1  
ATOM 701   H H    . TYR A 1 49  ? 4.870   7.131   -5.530  1.00 0.00 ? 49  TYR A H    1  
ATOM 702   H HA   . TYR A 1 49  ? 2.202   8.186   -4.885  1.00 0.00 ? 49  TYR A HA   1  
ATOM 703   H HB2  . TYR A 1 49  ? 4.081   9.142   -7.050  1.00 0.00 ? 49  TYR A HB2  1  
ATOM 704   H HB3  . TYR A 1 49  ? 2.612   9.935   -6.492  1.00 0.00 ? 49  TYR A HB3  1  
ATOM 705   H HD1  . TYR A 1 49  ? 5.936   8.793   -5.232  1.00 0.00 ? 49  TYR A HD1  1  
ATOM 706   H HD2  . TYR A 1 49  ? 2.778   11.627  -4.916  1.00 0.00 ? 49  TYR A HD2  1  
ATOM 707   H HE1  . TYR A 1 49  ? 7.258   10.077  -3.602  1.00 0.00 ? 49  TYR A HE1  1  
ATOM 708   H HE2  . TYR A 1 49  ? 4.091   12.919  -3.286  1.00 0.00 ? 49  TYR A HE2  1  
ATOM 709   H HH   . TYR A 1 49  ? 5.923   12.577  -1.713  1.00 0.00 ? 49  TYR A HH   1  
ATOM 710   N N    . ILE A 1 50  ? 1.323   7.803   -7.445  1.00 0.00 ? 50  ILE A N    1  
ATOM 711   C CA   . ILE A 1 50  ? 0.623   7.146   -8.541  1.00 0.00 ? 50  ILE A CA   1  
ATOM 712   C C    . ILE A 1 50  ? 0.604   8.025   -9.787  1.00 0.00 ? 50  ILE A C    1  
ATOM 713   O O    . ILE A 1 50  ? 0.327   9.223   -9.709  1.00 0.00 ? 50  ILE A O    1  
ATOM 714   C CB   . ILE A 1 50  ? -0.827  6.795   -8.154  1.00 0.00 ? 50  ILE A CB   1  
ATOM 715   C CG1  . ILE A 1 50  ? -0.859  6.072   -6.803  1.00 0.00 ? 50  ILE A CG1  1  
ATOM 716   C CG2  . ILE A 1 50  ? -1.473  5.941   -9.235  1.00 0.00 ? 50  ILE A CG2  1  
ATOM 717   C CD1  . ILE A 1 50  ? -1.632  6.820   -5.738  1.00 0.00 ? 50  ILE A CD1  1  
ATOM 718   H H    . ILE A 1 50  ? 1.073   8.718   -7.199  1.00 0.00 ? 50  ILE A H    1  
ATOM 719   H HA   . ILE A 1 50  ? 1.145   6.228   -8.768  1.00 0.00 ? 50  ILE A HA   1  
ATOM 720   H HB   . ILE A 1 50  ? -1.387  7.714   -8.075  1.00 0.00 ? 50  ILE A HB   1  
ATOM 721   H HG12 . ILE A 1 50  ? -1.322  5.105   -6.928  1.00 0.00 ? 50  ILE A HG12 1  
ATOM 722   H HG13 . ILE A 1 50  ? 0.151   5.939   -6.448  1.00 0.00 ? 50  ILE A HG13 1  
ATOM 723   H HG21 . ILE A 1 50  ? -1.796  6.574   -10.048 1.00 0.00 ? 50  ILE A HG21 1  
ATOM 724   H HG22 . ILE A 1 50  ? -2.325  5.420   -8.823  1.00 0.00 ? 50  ILE A HG22 1  
ATOM 725   H HG23 . ILE A 1 50  ? -0.755  5.222   -9.603  1.00 0.00 ? 50  ILE A HG23 1  
ATOM 726   H HD11 . ILE A 1 50  ? -1.272  6.529   -4.762  1.00 0.00 ? 50  ILE A HD11 1  
ATOM 727   H HD12 . ILE A 1 50  ? -2.682  6.581   -5.820  1.00 0.00 ? 50  ILE A HD12 1  
ATOM 728   H HD13 . ILE A 1 50  ? -1.492  7.882   -5.870  1.00 0.00 ? 50  ILE A HD13 1  
ATOM 729   N N    . THR A 1 51  ? 0.900   7.424   -10.934 1.00 0.00 ? 51  THR A N    1  
ATOM 730   C CA   . THR A 1 51  ? 0.918   8.154   -12.197 1.00 0.00 ? 51  THR A CA   1  
ATOM 731   C C    . THR A 1 51  ? 0.329   7.310   -13.322 1.00 0.00 ? 51  THR A C    1  
ATOM 732   O O    . THR A 1 51  ? 0.780   7.379   -14.465 1.00 0.00 ? 51  THR A O    1  
ATOM 733   C CB   . THR A 1 51  ? 2.347   8.569   -12.549 1.00 0.00 ? 51  THR A CB   1  
ATOM 734   O OG1  . THR A 1 51  ? 3.266   7.551   -12.197 1.00 0.00 ? 51  THR A OG1  1  
ATOM 735   C CG2  . THR A 1 51  ? 2.787   9.844   -11.861 1.00 0.00 ? 51  THR A CG2  1  
ATOM 736   H H    . THR A 1 51  ? 1.113   6.468   -10.933 1.00 0.00 ? 51  THR A H    1  
ATOM 737   H HA   . THR A 1 51  ? 0.315   9.041   -12.075 1.00 0.00 ? 51  THR A HA   1  
ATOM 738   H HB   . THR A 1 51  ? 2.411   8.730   -13.616 1.00 0.00 ? 51  THR A HB   1  
ATOM 739   H HG1  . THR A 1 51  ? 3.614   7.144   -12.994 1.00 0.00 ? 51  THR A HG1  1  
ATOM 740   H HG21 . THR A 1 51  ? 3.823   10.039  -12.094 1.00 0.00 ? 51  THR A HG21 1  
ATOM 741   H HG22 . THR A 1 51  ? 2.672   9.734   -10.793 1.00 0.00 ? 51  THR A HG22 1  
ATOM 742   H HG23 . THR A 1 51  ? 2.179   10.667  -12.206 1.00 0.00 ? 51  THR A HG23 1  
ATOM 743   N N    . GLY A 1 52  ? -0.682  6.513   -12.990 1.00 0.00 ? 52  GLY A N    1  
ATOM 744   C CA   . GLY A 1 52  ? -1.315  5.667   -13.984 1.00 0.00 ? 52  GLY A CA   1  
ATOM 745   C C    . GLY A 1 52  ? -2.509  4.914   -13.429 1.00 0.00 ? 52  GLY A C    1  
ATOM 746   O O    . GLY A 1 52  ? -2.447  4.359   -12.333 1.00 0.00 ? 52  GLY A O    1  
ATOM 747   H H    . GLY A 1 52  ? -1.000  6.500   -12.063 1.00 0.00 ? 52  GLY A H    1  
ATOM 748   H HA2  . GLY A 1 52  ? -1.644  6.284   -14.808 1.00 0.00 ? 52  GLY A HA2  1  
ATOM 749   H HA3  . GLY A 1 52  ? -0.592  4.954   -14.348 1.00 0.00 ? 52  GLY A HA3  1  
ATOM 750   N N    . VAL A 1 53  ? -3.599  4.896   -14.189 1.00 0.00 ? 53  VAL A N    1  
ATOM 751   C CA   . VAL A 1 53  ? -4.813  4.206   -13.768 1.00 0.00 ? 53  VAL A CA   1  
ATOM 752   C C    . VAL A 1 53  ? -5.406  3.391   -14.913 1.00 0.00 ? 53  VAL A C    1  
ATOM 753   O O    . VAL A 1 53  ? -5.671  3.921   -15.992 1.00 0.00 ? 53  VAL A O    1  
ATOM 754   C CB   . VAL A 1 53  ? -5.874  5.197   -13.255 1.00 0.00 ? 53  VAL A CB   1  
ATOM 755   C CG1  . VAL A 1 53  ? -7.043  4.451   -12.629 1.00 0.00 ? 53  VAL A CG1  1  
ATOM 756   C CG2  . VAL A 1 53  ? -5.260  6.170   -12.260 1.00 0.00 ? 53  VAL A CG2  1  
ATOM 757   H H    . VAL A 1 53  ? -3.587  5.358   -15.054 1.00 0.00 ? 53  VAL A H    1  
ATOM 758   H HA   . VAL A 1 53  ? -4.553  3.537   -12.960 1.00 0.00 ? 53  VAL A HA   1  
ATOM 759   H HB   . VAL A 1 53  ? -6.246  5.762   -14.096 1.00 0.00 ? 53  VAL A HB   1  
ATOM 760   H HG11 . VAL A 1 53  ? -7.061  3.436   -12.998 1.00 0.00 ? 53  VAL A HG11 1  
ATOM 761   H HG12 . VAL A 1 53  ? -7.967  4.945   -12.893 1.00 0.00 ? 53  VAL A HG12 1  
ATOM 762   H HG13 . VAL A 1 53  ? -6.933  4.443   -11.556 1.00 0.00 ? 53  VAL A HG13 1  
ATOM 763   H HG21 . VAL A 1 53  ? -4.965  7.073   -12.775 1.00 0.00 ? 53  VAL A HG21 1  
ATOM 764   H HG22 . VAL A 1 53  ? -4.393  5.718   -11.802 1.00 0.00 ? 53  VAL A HG22 1  
ATOM 765   H HG23 . VAL A 1 53  ? -5.985  6.411   -11.497 1.00 0.00 ? 53  VAL A HG23 1  
ATOM 766   N N    . ASP A 1 54  ? -5.612  2.101   -14.671 1.00 0.00 ? 54  ASP A N    1  
ATOM 767   C CA   . ASP A 1 54  ? -6.173  1.214   -15.682 1.00 0.00 ? 54  ASP A CA   1  
ATOM 768   C C    . ASP A 1 54  ? -7.650  1.524   -15.919 1.00 0.00 ? 54  ASP A C    1  
ATOM 769   O O    . ASP A 1 54  ? -8.385  1.829   -14.979 1.00 0.00 ? 54  ASP A O    1  
ATOM 770   C CB   . ASP A 1 54  ? -6.009  -0.247  -15.258 1.00 0.00 ? 54  ASP A CB   1  
ATOM 771   C CG   . ASP A 1 54  ? -4.718  -0.855  -15.770 1.00 0.00 ? 54  ASP A CG   1  
ATOM 772   O OD1  . ASP A 1 54  ? -3.669  -0.657  -15.120 1.00 0.00 ? 54  ASP A OD1  1  
ATOM 773   O OD2  . ASP A 1 54  ? -4.754  -1.530  -16.820 1.00 0.00 ? 54  ASP A OD2  1  
ATOM 774   H H    . ASP A 1 54  ? -5.380  1.737   -13.790 1.00 0.00 ? 54  ASP A H    1  
ATOM 775   H HA   . ASP A 1 54  ? -5.631  1.376   -16.601 1.00 0.00 ? 54  ASP A HA   1  
ATOM 776   H HB2  . ASP A 1 54  ? -6.008  -0.304  -14.180 1.00 0.00 ? 54  ASP A HB2  1  
ATOM 777   H HB3  . ASP A 1 54  ? -6.836  -0.823  -15.645 1.00 0.00 ? 54  ASP A HB3  1  
ATOM 778   N N    . PRO A 1 55  ? -8.107  1.449   -17.181 1.00 0.00 ? 55  PRO A N    1  
ATOM 779   C CA   . PRO A 1 55  ? -9.504  1.724   -17.532 1.00 0.00 ? 55  PRO A CA   1  
ATOM 780   C C    . PRO A 1 55  ? -10.437 0.586   -17.129 1.00 0.00 ? 55  PRO A C    1  
ATOM 781   O O    . PRO A 1 55  ? -10.793 -0.259  -17.950 1.00 0.00 ? 55  PRO A O    1  
ATOM 782   C CB   . PRO A 1 55  ? -9.460  1.867   -19.052 1.00 0.00 ? 55  PRO A CB   1  
ATOM 783   C CG   . PRO A 1 55  ? -8.316  1.014   -19.476 1.00 0.00 ? 55  PRO A CG   1  
ATOM 784   C CD   . PRO A 1 55  ? -7.301  1.092   -18.366 1.00 0.00 ? 55  PRO A CD   1  
ATOM 785   H HA   . PRO A 1 55  ? -9.849  2.647   -17.088 1.00 0.00 ? 55  PRO A HA   1  
ATOM 786   H HB2  . PRO A 1 55  ? -10.392 1.522   -19.476 1.00 0.00 ? 55  PRO A HB2  1  
ATOM 787   H HB3  . PRO A 1 55  ? -9.300  2.902   -19.315 1.00 0.00 ? 55  PRO A HB3  1  
ATOM 788   H HG2  . PRO A 1 55  ? -8.647  -0.006  -19.608 1.00 0.00 ? 55  PRO A HG2  1  
ATOM 789   H HG3  . PRO A 1 55  ? -7.895  1.394   -20.395 1.00 0.00 ? 55  PRO A HG3  1  
ATOM 790   H HD2  . PRO A 1 55  ? -6.818  0.137   -18.228 1.00 0.00 ? 55  PRO A HD2  1  
ATOM 791   H HD3  . PRO A 1 55  ? -6.570  1.859   -18.578 1.00 0.00 ? 55  PRO A HD3  1  
ATOM 792   N N    . GLY A 1 56  ? -10.829 0.571   -15.859 1.00 0.00 ? 56  GLY A N    1  
ATOM 793   C CA   . GLY A 1 56  ? -11.717 -0.468  -15.370 1.00 0.00 ? 56  GLY A CA   1  
ATOM 794   C C    . GLY A 1 56  ? -11.053 -1.364  -14.344 1.00 0.00 ? 56  GLY A C    1  
ATOM 795   O O    . GLY A 1 56  ? -11.241 -2.580  -14.357 1.00 0.00 ? 56  GLY A O    1  
ATOM 796   H H    . GLY A 1 56  ? -10.513 1.270   -15.250 1.00 0.00 ? 56  GLY A H    1  
ATOM 797   H HA2  . GLY A 1 56  ? -12.582 -0.003  -14.919 1.00 0.00 ? 56  GLY A HA2  1  
ATOM 798   H HA3  . GLY A 1 56  ? -12.041 -1.072  -16.204 1.00 0.00 ? 56  GLY A HA3  1  
ATOM 799   N N    . SER A 1 57  ? -10.272 -0.762  -13.451 1.00 0.00 ? 57  SER A N    1  
ATOM 800   C CA   . SER A 1 57  ? -9.578  -1.515  -12.413 1.00 0.00 ? 57  SER A CA   1  
ATOM 801   C C    . SER A 1 57  ? -10.291 -1.375  -11.072 1.00 0.00 ? 57  SER A C    1  
ATOM 802   O O    . SER A 1 57  ? -11.309 -0.693  -10.967 1.00 0.00 ? 57  SER A O    1  
ATOM 803   C CB   . SER A 1 57  ? -8.131  -1.033  -12.287 1.00 0.00 ? 57  SER A CB   1  
ATOM 804   O OG   . SER A 1 57  ? -8.076  0.290   -11.785 1.00 0.00 ? 57  SER A OG   1  
ATOM 805   H H    . SER A 1 57  ? -10.162 0.211   -13.492 1.00 0.00 ? 57  SER A H    1  
ATOM 806   H HA   . SER A 1 57  ? -9.578  -2.554  -12.701 1.00 0.00 ? 57  SER A HA   1  
ATOM 807   H HB2  . SER A 1 57  ? -7.596  -1.684  -11.609 1.00 0.00 ? 57  SER A HB2  1  
ATOM 808   H HB3  . SER A 1 57  ? -7.660  -1.057  -13.261 1.00 0.00 ? 57  SER A HB3  1  
ATOM 809   H HG   . SER A 1 57  ? -8.690  0.844   -12.274 1.00 0.00 ? 57  SER A HG   1  
ATOM 810   N N    . GLU A 1 58  ? -9.748  -2.027  -10.049 1.00 0.00 ? 58  GLU A N    1  
ATOM 811   C CA   . GLU A 1 58  ? -10.333 -1.976  -8.714  1.00 0.00 ? 58  GLU A CA   1  
ATOM 812   C C    . GLU A 1 58  ? -10.023 -0.646  -8.033  1.00 0.00 ? 58  GLU A C    1  
ATOM 813   O O    . GLU A 1 58  ? -10.800 -0.163  -7.211  1.00 0.00 ? 58  GLU A O    1  
ATOM 814   C CB   . GLU A 1 58  ? -9.809  -3.134  -7.860  1.00 0.00 ? 58  GLU A CB   1  
ATOM 815   C CG   . GLU A 1 58  ? -10.678 -4.379  -7.927  1.00 0.00 ? 58  GLU A CG   1  
ATOM 816   C CD   . GLU A 1 58  ? -11.888 -4.296  -7.017  1.00 0.00 ? 58  GLU A CD   1  
ATOM 817   O OE1  . GLU A 1 58  ? -12.834 -3.554  -7.354  1.00 0.00 ? 58  GLU A OE1  1  
ATOM 818   O OE2  . GLU A 1 58  ? -11.888 -4.971  -5.966  1.00 0.00 ? 58  GLU A OE2  1  
ATOM 819   H H    . GLU A 1 58  ? -8.936  -2.555  -10.195 1.00 0.00 ? 58  GLU A H    1  
ATOM 820   H HA   . GLU A 1 58  ? -11.403 -2.073  -8.817  1.00 0.00 ? 58  GLU A HA   1  
ATOM 821   H HB2  . GLU A 1 58  ? -8.818  -3.394  -8.198  1.00 0.00 ? 58  GLU A HB2  1  
ATOM 822   H HB3  . GLU A 1 58  ? -9.757  -2.813  -6.831  1.00 0.00 ? 58  GLU A HB3  1  
ATOM 823   H HG2  . GLU A 1 58  ? -11.020 -4.510  -8.942  1.00 0.00 ? 58  GLU A HG2  1  
ATOM 824   H HG3  . GLU A 1 58  ? -10.084 -5.232  -7.635  1.00 0.00 ? 58  GLU A HG3  1  
ATOM 825   N N    . ALA A 1 59  ? -8.882  -0.060  -8.382  1.00 0.00 ? 59  ALA A N    1  
ATOM 826   C CA   . ALA A 1 59  ? -8.470  1.214   -7.805  1.00 0.00 ? 59  ALA A CA   1  
ATOM 827   C C    . ALA A 1 59  ? -9.258  2.370   -8.411  1.00 0.00 ? 59  ALA A C    1  
ATOM 828   O O    . ALA A 1 59  ? -9.525  3.370   -7.743  1.00 0.00 ? 59  ALA A O    1  
ATOM 829   C CB   . ALA A 1 59  ? -6.977  1.426   -8.007  1.00 0.00 ? 59  ALA A CB   1  
ATOM 830   H H    . ALA A 1 59  ? -8.303  -0.494  -9.044  1.00 0.00 ? 59  ALA A H    1  
ATOM 831   H HA   . ALA A 1 59  ? -8.664  1.176   -6.743  1.00 0.00 ? 59  ALA A HA   1  
ATOM 832   H HB1  . ALA A 1 59  ? -6.763  2.485   -8.021  1.00 0.00 ? 59  ALA A HB1  1  
ATOM 833   H HB2  . ALA A 1 59  ? -6.675  0.985   -8.946  1.00 0.00 ? 59  ALA A HB2  1  
ATOM 834   H HB3  . ALA A 1 59  ? -6.435  0.959   -7.199  1.00 0.00 ? 59  ALA A HB3  1  
ATOM 835   N N    . GLU A 1 60  ? -9.626  2.228   -9.680  1.00 0.00 ? 60  GLU A N    1  
ATOM 836   C CA   . GLU A 1 60  ? -10.384 3.260   -10.376 1.00 0.00 ? 60  GLU A CA   1  
ATOM 837   C C    . GLU A 1 60  ? -11.788 3.389   -9.797  1.00 0.00 ? 60  GLU A C    1  
ATOM 838   O O    . GLU A 1 60  ? -12.271 4.495   -9.552  1.00 0.00 ? 60  GLU A O    1  
ATOM 839   C CB   . GLU A 1 60  ? -10.463 2.943   -11.871 1.00 0.00 ? 60  GLU A CB   1  
ATOM 840   C CG   . GLU A 1 60  ? -11.221 3.986   -12.676 1.00 0.00 ? 60  GLU A CG   1  
ATOM 841   C CD   . GLU A 1 60  ? -10.439 5.274   -12.843 1.00 0.00 ? 60  GLU A CD   1  
ATOM 842   O OE1  . GLU A 1 60  ? -9.921  5.791   -11.830 1.00 0.00 ? 60  GLU A OE1  1  
ATOM 843   O OE2  . GLU A 1 60  ? -10.345 5.768   -13.987 1.00 0.00 ? 60  GLU A OE2  1  
ATOM 844   H H    . GLU A 1 60  ? -9.383  1.408   -10.159 1.00 0.00 ? 60  GLU A H    1  
ATOM 845   H HA   . GLU A 1 60  ? -9.865  4.198   -10.244 1.00 0.00 ? 60  GLU A HA   1  
ATOM 846   H HB2  . GLU A 1 60  ? -9.460  2.872   -12.266 1.00 0.00 ? 60  GLU A HB2  1  
ATOM 847   H HB3  . GLU A 1 60  ? -10.957 1.991   -12.000 1.00 0.00 ? 60  GLU A HB3  1  
ATOM 848   H HG2  . GLU A 1 60  ? -11.433 3.583   -13.655 1.00 0.00 ? 60  GLU A HG2  1  
ATOM 849   H HG3  . GLU A 1 60  ? -12.148 4.208   -12.171 1.00 0.00 ? 60  GLU A HG3  1  
ATOM 850   N N    . GLY A 1 61  ? -12.440 2.251   -9.580  1.00 0.00 ? 61  GLY A N    1  
ATOM 851   C CA   . GLY A 1 61  ? -13.783 2.259   -9.032  1.00 0.00 ? 61  GLY A CA   1  
ATOM 852   C C    . GLY A 1 61  ? -13.841 2.867   -7.643  1.00 0.00 ? 61  GLY A C    1  
ATOM 853   O O    . GLY A 1 61  ? -14.733 3.659   -7.342  1.00 0.00 ? 61  GLY A O    1  
ATOM 854   H H    . GLY A 1 61  ? -12.005 1.400   -9.795  1.00 0.00 ? 61  GLY A H    1  
ATOM 855   H HA2  . GLY A 1 61  ? -14.425 2.827   -9.688  1.00 0.00 ? 61  GLY A HA2  1  
ATOM 856   H HA3  . GLY A 1 61  ? -14.146 1.243   -8.982  1.00 0.00 ? 61  GLY A HA3  1  
ATOM 857   N N    . SER A 1 62  ? -12.886 2.495   -6.797  1.00 0.00 ? 62  SER A N    1  
ATOM 858   C CA   . SER A 1 62  ? -12.832 3.010   -5.434  1.00 0.00 ? 62  SER A CA   1  
ATOM 859   C C    . SER A 1 62  ? -12.688 4.527   -5.430  1.00 0.00 ? 62  SER A C    1  
ATOM 860   O O    . SER A 1 62  ? -13.308 5.218   -4.621  1.00 0.00 ? 62  SER A O    1  
ATOM 861   C CB   . SER A 1 62  ? -11.666 2.374   -4.673  1.00 0.00 ? 62  SER A CB   1  
ATOM 862   O OG   . SER A 1 62  ? -11.757 2.640   -3.284  1.00 0.00 ? 62  SER A OG   1  
ATOM 863   H H    . SER A 1 62  ? -12.202 1.861   -7.097  1.00 0.00 ? 62  SER A H    1  
ATOM 864   H HA   . SER A 1 62  ? -13.756 2.746   -4.943  1.00 0.00 ? 62  SER A HA   1  
ATOM 865   H HB2  . SER A 1 62  ? -11.682 1.305   -4.823  1.00 0.00 ? 62  SER A HB2  1  
ATOM 866   H HB3  . SER A 1 62  ? -10.735 2.775   -5.045  1.00 0.00 ? 62  SER A HB3  1  
ATOM 867   H HG   . SER A 1 62  ? -12.660 2.503   -2.990  1.00 0.00 ? 62  SER A HG   1  
ATOM 868   N N    . GLY A 1 63  ? -11.866 5.041   -6.339  1.00 0.00 ? 63  GLY A N    1  
ATOM 869   C CA   . GLY A 1 63  ? -11.656 6.475   -6.423  1.00 0.00 ? 63  GLY A CA   1  
ATOM 870   C C    . GLY A 1 63  ? -10.189 6.853   -6.330  1.00 0.00 ? 63  GLY A C    1  
ATOM 871   O O    . GLY A 1 63  ? -9.834  7.831   -5.673  1.00 0.00 ? 63  GLY A O    1  
ATOM 872   H H    . GLY A 1 63  ? -11.398 4.443   -6.957  1.00 0.00 ? 63  GLY A H    1  
ATOM 873   H HA2  . GLY A 1 63  ? -12.048 6.830   -7.364  1.00 0.00 ? 63  GLY A HA2  1  
ATOM 874   H HA3  . GLY A 1 63  ? -12.191 6.955   -5.618  1.00 0.00 ? 63  GLY A HA3  1  
ATOM 875   N N    . LEU A 1 64  ? -9.338  6.077   -6.992  1.00 0.00 ? 64  LEU A N    1  
ATOM 876   C CA   . LEU A 1 64  ? -7.902  6.334   -6.981  1.00 0.00 ? 64  LEU A CA   1  
ATOM 877   C C    . LEU A 1 64  ? -7.446  6.926   -8.312  1.00 0.00 ? 64  LEU A C    1  
ATOM 878   O O    . LEU A 1 64  ? -7.802  6.426   -9.379  1.00 0.00 ? 64  LEU A O    1  
ATOM 879   C CB   . LEU A 1 64  ? -7.133  5.043   -6.693  1.00 0.00 ? 64  LEU A CB   1  
ATOM 880   C CG   . LEU A 1 64  ? -7.233  4.538   -5.253  1.00 0.00 ? 64  LEU A CG   1  
ATOM 881   C CD1  . LEU A 1 64  ? -6.893  3.058   -5.184  1.00 0.00 ? 64  LEU A CD1  1  
ATOM 882   C CD2  . LEU A 1 64  ? -6.315  5.341   -4.343  1.00 0.00 ? 64  LEU A CD2  1  
ATOM 883   H H    . LEU A 1 64  ? -9.682  5.312   -7.499  1.00 0.00 ? 64  LEU A H    1  
ATOM 884   H HA   . LEU A 1 64  ? -7.699  7.047   -6.196  1.00 0.00 ? 64  LEU A HA   1  
ATOM 885   H HB2  . LEU A 1 64  ? -7.507  4.273   -7.351  1.00 0.00 ? 64  LEU A HB2  1  
ATOM 886   H HB3  . LEU A 1 64  ? -6.090  5.212   -6.920  1.00 0.00 ? 64  LEU A HB3  1  
ATOM 887   H HG   . LEU A 1 64  ? -8.247  4.664   -4.904  1.00 0.00 ? 64  LEU A HG   1  
ATOM 888   H HD11 . LEU A 1 64  ? -7.730  2.479   -5.547  1.00 0.00 ? 64  LEU A HD11 1  
ATOM 889   H HD12 . LEU A 1 64  ? -6.683  2.784   -4.160  1.00 0.00 ? 64  LEU A HD12 1  
ATOM 890   H HD13 . LEU A 1 64  ? -6.025  2.858   -5.796  1.00 0.00 ? 64  LEU A HD13 1  
ATOM 891   H HD21 . LEU A 1 64  ? -6.243  6.354   -4.709  1.00 0.00 ? 64  LEU A HD21 1  
ATOM 892   H HD22 . LEU A 1 64  ? -5.334  4.890   -4.333  1.00 0.00 ? 64  LEU A HD22 1  
ATOM 893   H HD23 . LEU A 1 64  ? -6.719  5.347   -3.341  1.00 0.00 ? 64  LEU A HD23 1  
ATOM 894   N N    . LYS A 1 65  ? -6.657  7.993   -8.240  1.00 0.00 ? 65  LYS A N    1  
ATOM 895   C CA   . LYS A 1 65  ? -6.152  8.653   -9.438  1.00 0.00 ? 65  LYS A CA   1  
ATOM 896   C C    . LYS A 1 65  ? -4.678  9.012   -9.282  1.00 0.00 ? 65  LYS A C    1  
ATOM 897   O O    . LYS A 1 65  ? -4.083  8.786   -8.229  1.00 0.00 ? 65  LYS A O    1  
ATOM 898   C CB   . LYS A 1 65  ? -6.968  9.912   -9.734  1.00 0.00 ? 65  LYS A CB   1  
ATOM 899   C CG   . LYS A 1 65  ? -8.318  9.626   -10.374 1.00 0.00 ? 65  LYS A CG   1  
ATOM 900   C CD   . LYS A 1 65  ? -9.456  10.260  -9.590  1.00 0.00 ? 65  LYS A CD   1  
ATOM 901   C CE   . LYS A 1 65  ? -10.517 10.838  -10.513 1.00 0.00 ? 65  LYS A CE   1  
ATOM 902   N NZ   . LYS A 1 65  ? -11.894 10.558  -10.020 1.00 0.00 ? 65  LYS A NZ   1  
ATOM 903   H H    . LYS A 1 65  ? -6.409  8.346   -7.359  1.00 0.00 ? 65  LYS A H    1  
ATOM 904   H HA   . LYS A 1 65  ? -6.257  7.964   -10.263 1.00 0.00 ? 65  LYS A HA   1  
ATOM 905   H HB2  . LYS A 1 65  ? -7.136  10.444  -8.809  1.00 0.00 ? 65  LYS A HB2  1  
ATOM 906   H HB3  . LYS A 1 65  ? -6.403  10.544  -10.403 1.00 0.00 ? 65  LYS A HB3  1  
ATOM 907   H HG2  . LYS A 1 65  ? -8.321  10.026  -11.377 1.00 0.00 ? 65  LYS A HG2  1  
ATOM 908   H HG3  . LYS A 1 65  ? -8.469  8.557   -10.409 1.00 0.00 ? 65  LYS A HG3  1  
ATOM 909   H HD2  . LYS A 1 65  ? -9.910  9.509   -8.962  1.00 0.00 ? 65  LYS A HD2  1  
ATOM 910   H HD3  . LYS A 1 65  ? -9.058  11.053  -8.973  1.00 0.00 ? 65  LYS A HD3  1  
ATOM 911   H HE2  . LYS A 1 65  ? -10.378 11.906  -10.576 1.00 0.00 ? 65  LYS A HE2  1  
ATOM 912   H HE3  . LYS A 1 65  ? -10.399 10.401  -11.494 1.00 0.00 ? 65  LYS A HE3  1  
ATOM 913   H HZ1  . LYS A 1 65  ? -12.543 10.434  -10.824 1.00 0.00 ? 65  LYS A HZ1  1  
ATOM 914   H HZ2  . LYS A 1 65  ? -12.232 11.347  -9.435  1.00 0.00 ? 65  LYS A HZ2  1  
ATOM 915   H HZ3  . LYS A 1 65  ? -11.899 9.690   -9.447  1.00 0.00 ? 65  LYS A HZ3  1  
ATOM 916   N N    . VAL A 1 66  ? -4.096  9.571   -10.338 1.00 0.00 ? 66  VAL A N    1  
ATOM 917   C CA   . VAL A 1 66  ? -2.692  9.961   -10.318 1.00 0.00 ? 66  VAL A CA   1  
ATOM 918   C C    . VAL A 1 66  ? -2.460  11.134  -9.370  1.00 0.00 ? 66  VAL A C    1  
ATOM 919   O O    . VAL A 1 66  ? -3.367  11.924  -9.111  1.00 0.00 ? 66  VAL A O    1  
ATOM 920   C CB   . VAL A 1 66  ? -2.195  10.347  -11.724 1.00 0.00 ? 66  VAL A CB   1  
ATOM 921   C CG1  . VAL A 1 66  ? -2.229  9.143   -12.652 1.00 0.00 ? 66  VAL A CG1  1  
ATOM 922   C CG2  . VAL A 1 66  ? -3.027  11.489  -12.289 1.00 0.00 ? 66  VAL A CG2  1  
ATOM 923   H H    . VAL A 1 66  ? -4.624  9.725   -11.149 1.00 0.00 ? 66  VAL A H    1  
ATOM 924   H HA   . VAL A 1 66  ? -2.115  9.114   -9.975  1.00 0.00 ? 66  VAL A HA   1  
ATOM 925   H HB   . VAL A 1 66  ? -1.172  10.683  -11.642 1.00 0.00 ? 66  VAL A HB   1  
ATOM 926   H HG11 . VAL A 1 66  ? -3.215  9.045   -13.080 1.00 0.00 ? 66  VAL A HG11 1  
ATOM 927   H HG12 . VAL A 1 66  ? -1.987  8.251   -12.093 1.00 0.00 ? 66  VAL A HG12 1  
ATOM 928   H HG13 . VAL A 1 66  ? -1.506  9.278   -13.443 1.00 0.00 ? 66  VAL A HG13 1  
ATOM 929   H HG21 . VAL A 1 66  ? -3.994  11.503  -11.807 1.00 0.00 ? 66  VAL A HG21 1  
ATOM 930   H HG22 . VAL A 1 66  ? -3.157  11.348  -13.352 1.00 0.00 ? 66  VAL A HG22 1  
ATOM 931   H HG23 . VAL A 1 66  ? -2.521  12.426  -12.109 1.00 0.00 ? 66  VAL A HG23 1  
ATOM 932   N N    . GLY A 1 67  ? -1.240  11.239  -8.855  1.00 0.00 ? 67  GLY A N    1  
ATOM 933   C CA   . GLY A 1 67  ? -0.911  12.317  -7.942  1.00 0.00 ? 67  GLY A CA   1  
ATOM 934   C C    . GLY A 1 67  ? -1.016  11.899  -6.489  1.00 0.00 ? 67  GLY A C    1  
ATOM 935   O O    . GLY A 1 67  ? -0.322  12.440  -5.627  1.00 0.00 ? 67  GLY A O    1  
ATOM 936   H H    . GLY A 1 67  ? -0.556  10.579  -9.097  1.00 0.00 ? 67  GLY A H    1  
ATOM 937   H HA2  . GLY A 1 67  ? 0.102   12.645  -8.138  1.00 0.00 ? 67  GLY A HA2  1  
ATOM 938   H HA3  . GLY A 1 67  ? -1.588  13.143  -8.118  1.00 0.00 ? 67  GLY A HA3  1  
ATOM 939   N N    . ASP A 1 68  ? -1.886  10.932  -6.214  1.00 0.00 ? 68  ASP A N    1  
ATOM 940   C CA   . ASP A 1 68  ? -2.079  10.442  -4.855  1.00 0.00 ? 68  ASP A CA   1  
ATOM 941   C C    . ASP A 1 68  ? -0.787  9.851   -4.300  1.00 0.00 ? 68  ASP A C    1  
ATOM 942   O O    . ASP A 1 68  ? 0.031   9.311   -5.046  1.00 0.00 ? 68  ASP A O    1  
ATOM 943   C CB   . ASP A 1 68  ? -3.193  9.391   -4.824  1.00 0.00 ? 68  ASP A CB   1  
ATOM 944   C CG   . ASP A 1 68  ? -4.465  9.918   -4.188  1.00 0.00 ? 68  ASP A CG   1  
ATOM 945   O OD1  . ASP A 1 68  ? -4.368  10.796  -3.305  1.00 0.00 ? 68  ASP A OD1  1  
ATOM 946   O OD2  . ASP A 1 68  ? -5.558  9.450   -4.572  1.00 0.00 ? 68  ASP A OD2  1  
ATOM 947   H H    . ASP A 1 68  ? -2.410  10.540  -6.943  1.00 0.00 ? 68  ASP A H    1  
ATOM 948   H HA   . ASP A 1 68  ? -2.371  11.280  -4.239  1.00 0.00 ? 68  ASP A HA   1  
ATOM 949   H HB2  . ASP A 1 68  ? -3.419  9.086   -5.837  1.00 0.00 ? 68  ASP A HB2  1  
ATOM 950   H HB3  . ASP A 1 68  ? -2.857  8.532   -4.257  1.00 0.00 ? 68  ASP A HB3  1  
ATOM 951   N N    . GLN A 1 69  ? -0.609  9.957   -2.988  1.00 0.00 ? 69  GLN A N    1  
ATOM 952   C CA   . GLN A 1 69  ? 0.583   9.433   -2.332  1.00 0.00 ? 69  GLN A CA   1  
ATOM 953   C C    . GLN A 1 69  ? 0.225   8.297   -1.380  1.00 0.00 ? 69  GLN A C    1  
ATOM 954   O O    . GLN A 1 69  ? -0.411  8.514   -0.349  1.00 0.00 ? 69  GLN A O    1  
ATOM 955   C CB   . GLN A 1 69  ? 1.301   10.548  -1.568  1.00 0.00 ? 69  GLN A CB   1  
ATOM 956   C CG   . GLN A 1 69  ? 2.815   10.417  -1.582  1.00 0.00 ? 69  GLN A CG   1  
ATOM 957   C CD   . GLN A 1 69  ? 3.348   9.688   -0.363  1.00 0.00 ? 69  GLN A CD   1  
ATOM 958   O OE1  . GLN A 1 69  ? 3.172   10.136  0.769   1.00 0.00 ? 69  GLN A OE1  1  
ATOM 959   N NE2  . GLN A 1 69  ? 4.005   8.556   -0.592  1.00 0.00 ? 69  GLN A NE2  1  
ATOM 960   H H    . GLN A 1 69  ? -1.298  10.398  -2.447  1.00 0.00 ? 69  GLN A H    1  
ATOM 961   H HA   . GLN A 1 69  ? 1.242   9.051   -3.097  1.00 0.00 ? 69  GLN A HA   1  
ATOM 962   H HB2  . GLN A 1 69  ? 1.039   11.498  -2.010  1.00 0.00 ? 69  GLN A HB2  1  
ATOM 963   H HB3  . GLN A 1 69  ? 0.969   10.535  -0.540  1.00 0.00 ? 69  GLN A HB3  1  
ATOM 964   H HG2  . GLN A 1 69  ? 3.108   9.870   -2.465  1.00 0.00 ? 69  GLN A HG2  1  
ATOM 965   H HG3  . GLN A 1 69  ? 3.249   11.406  -1.609  1.00 0.00 ? 69  GLN A HG3  1  
ATOM 966   H HE21 . GLN A 1 69  ? 4.108   8.259   -1.519  1.00 0.00 ? 69  GLN A HE21 1  
ATOM 967   H HE22 . GLN A 1 69  ? 4.360   8.064   0.178   1.00 0.00 ? 69  GLN A HE22 1  
ATOM 968   N N    . ILE A 1 70  ? 0.639   7.084   -1.732  1.00 0.00 ? 70  ILE A N    1  
ATOM 969   C CA   . ILE A 1 70  ? 0.362   5.913   -0.908  1.00 0.00 ? 70  ILE A CA   1  
ATOM 970   C C    . ILE A 1 70  ? 1.228   5.909   0.347   1.00 0.00 ? 70  ILE A C    1  
ATOM 971   O O    . ILE A 1 70  ? 2.450   5.779   0.270   1.00 0.00 ? 70  ILE A O    1  
ATOM 972   C CB   . ILE A 1 70  ? 0.604   4.607   -1.689  1.00 0.00 ? 70  ILE A CB   1  
ATOM 973   C CG1  . ILE A 1 70  ? -0.112  4.654   -3.041  1.00 0.00 ? 70  ILE A CG1  1  
ATOM 974   C CG2  . ILE A 1 70  ? 0.135   3.409   -0.877  1.00 0.00 ? 70  ILE A CG2  1  
ATOM 975   C CD1  . ILE A 1 70  ? 0.174   3.455   -3.918  1.00 0.00 ? 70  ILE A CD1  1  
ATOM 976   H H    . ILE A 1 70  ? 1.143   6.974   -2.566  1.00 0.00 ? 70  ILE A H    1  
ATOM 977   H HA   . ILE A 1 70  ? -0.677  5.948   -0.618  1.00 0.00 ? 70  ILE A HA   1  
ATOM 978   H HB   . ILE A 1 70  ? 1.666   4.503   -1.856  1.00 0.00 ? 70  ILE A HB   1  
ATOM 979   H HG12 . ILE A 1 70  ? -1.178  4.695   -2.874  1.00 0.00 ? 70  ILE A HG12 1  
ATOM 980   H HG13 . ILE A 1 70  ? 0.199   5.539   -3.575  1.00 0.00 ? 70  ILE A HG13 1  
ATOM 981   H HG21 . ILE A 1 70  ? 0.540   3.470   0.122   1.00 0.00 ? 70  ILE A HG21 1  
ATOM 982   H HG22 . ILE A 1 70  ? 0.474   2.499   -1.349  1.00 0.00 ? 70  ILE A HG22 1  
ATOM 983   H HG23 . ILE A 1 70  ? -0.944  3.408   -0.827  1.00 0.00 ? 70  ILE A HG23 1  
ATOM 984   H HD11 . ILE A 1 70  ? -0.729  3.164   -4.435  1.00 0.00 ? 70  ILE A HD11 1  
ATOM 985   H HD12 . ILE A 1 70  ? 0.520   2.635   -3.306  1.00 0.00 ? 70  ILE A HD12 1  
ATOM 986   H HD13 . ILE A 1 70  ? 0.936   3.711   -4.640  1.00 0.00 ? 70  ILE A HD13 1  
ATOM 987   N N    . LEU A 1 71  ? 0.587   6.052   1.502   1.00 0.00 ? 71  LEU A N    1  
ATOM 988   C CA   . LEU A 1 71  ? 1.299   6.065   2.774   1.00 0.00 ? 71  LEU A CA   1  
ATOM 989   C C    . LEU A 1 71  ? 1.681   4.651   3.198   1.00 0.00 ? 71  LEU A C    1  
ATOM 990   O O    . LEU A 1 71  ? 2.862   4.329   3.327   1.00 0.00 ? 71  LEU A O    1  
ATOM 991   C CB   . LEU A 1 71  ? 0.438   6.719   3.857   1.00 0.00 ? 71  LEU A CB   1  
ATOM 992   C CG   . LEU A 1 71  ? -0.020  8.145   3.546   1.00 0.00 ? 71  LEU A CG   1  
ATOM 993   C CD1  . LEU A 1 71  ? -0.906  8.676   4.662   1.00 0.00 ? 71  LEU A CD1  1  
ATOM 994   C CD2  . LEU A 1 71  ? 1.181   9.055   3.337   1.00 0.00 ? 71  LEU A CD2  1  
ATOM 995   H H    . LEU A 1 71  ? -0.388  6.151   1.498   1.00 0.00 ? 71  LEU A H    1  
ATOM 996   H HA   . LEU A 1 71  ? 2.200   6.645   2.644   1.00 0.00 ? 71  LEU A HA   1  
ATOM 997   H HB2  . LEU A 1 71  ? -0.438  6.106   4.010   1.00 0.00 ? 71  LEU A HB2  1  
ATOM 998   H HB3  . LEU A 1 71  ? 1.006   6.740   4.775   1.00 0.00 ? 71  LEU A HB3  1  
ATOM 999   H HG   . LEU A 1 71  ? -0.600  8.139   2.635   1.00 0.00 ? 71  LEU A HG   1  
ATOM 1000  H HD11 . LEU A 1 71  ? -0.300  8.893   5.530   1.00 0.00 ? 71  LEU A HD11 1  
ATOM 1001  H HD12 . LEU A 1 71  ? -1.647  7.934   4.917   1.00 0.00 ? 71  LEU A HD12 1  
ATOM 1002  H HD13 . LEU A 1 71  ? -1.399  9.579   4.332   1.00 0.00 ? 71  LEU A HD13 1  
ATOM 1003  H HD21 . LEU A 1 71  ? 1.709   9.174   4.271   1.00 0.00 ? 71  LEU A HD21 1  
ATOM 1004  H HD22 . LEU A 1 71  ? 0.845   10.021  2.987   1.00 0.00 ? 71  LEU A HD22 1  
ATOM 1005  H HD23 . LEU A 1 71  ? 1.841   8.617   2.603   1.00 0.00 ? 71  LEU A HD23 1  
ATOM 1006  N N    . GLU A 1 72  ? 0.675   3.810   3.415   1.00 0.00 ? 72  GLU A N    1  
ATOM 1007  C CA   . GLU A 1 72  ? 0.907   2.430   3.825   1.00 0.00 ? 72  GLU A CA   1  
ATOM 1008  C C    . GLU A 1 72  ? -0.130  1.497   3.209   1.00 0.00 ? 72  GLU A C    1  
ATOM 1009  O O    . GLU A 1 72  ? -1.214  1.929   2.818   1.00 0.00 ? 72  GLU A O    1  
ATOM 1010  C CB   . GLU A 1 72  ? 0.871   2.316   5.351   1.00 0.00 ? 72  GLU A CB   1  
ATOM 1011  C CG   . GLU A 1 72  ? -0.469  2.699   5.957   1.00 0.00 ? 72  GLU A CG   1  
ATOM 1012  C CD   . GLU A 1 72  ? -0.386  3.940   6.824   1.00 0.00 ? 72  GLU A CD   1  
ATOM 1013  O OE1  . GLU A 1 72  ? 0.196   3.858   7.926   1.00 0.00 ? 72  GLU A OE1  1  
ATOM 1014  O OE2  . GLU A 1 72  ? -0.903  4.996   6.401   1.00 0.00 ? 72  GLU A OE2  1  
ATOM 1015  H H    . GLU A 1 72  ? -0.245  4.125   3.296   1.00 0.00 ? 72  GLU A H    1  
ATOM 1016  H HA   . GLU A 1 72  ? 1.886   2.141   3.475   1.00 0.00 ? 72  GLU A HA   1  
ATOM 1017  H HB2  . GLU A 1 72  ? 1.090   1.296   5.628   1.00 0.00 ? 72  GLU A HB2  1  
ATOM 1018  H HB3  . GLU A 1 72  ? 1.629   2.964   5.766   1.00 0.00 ? 72  GLU A HB3  1  
ATOM 1019  H HG2  . GLU A 1 72  ? -1.172  2.882   5.159   1.00 0.00 ? 72  GLU A HG2  1  
ATOM 1020  H HG3  . GLU A 1 72  ? -0.822  1.877   6.564   1.00 0.00 ? 72  GLU A HG3  1  
ATOM 1021  N N    . VAL A 1 73  ? 0.210   0.215   3.126   1.00 0.00 ? 73  VAL A N    1  
ATOM 1022  C CA   . VAL A 1 73  ? -0.692  -0.780  2.559   1.00 0.00 ? 73  VAL A CA   1  
ATOM 1023  C C    . VAL A 1 73  ? -0.627  -2.088  3.339   1.00 0.00 ? 73  VAL A C    1  
ATOM 1024  O O    . VAL A 1 73  ? 0.455   -2.616  3.598   1.00 0.00 ? 73  VAL A O    1  
ATOM 1025  C CB   . VAL A 1 73  ? -0.360  -1.060  1.081   1.00 0.00 ? 73  VAL A CB   1  
ATOM 1026  C CG1  . VAL A 1 73  ? -1.426  -1.945  0.453   1.00 0.00 ? 73  VAL A CG1  1  
ATOM 1027  C CG2  . VAL A 1 73  ? -0.215  0.243   0.310   1.00 0.00 ? 73  VAL A CG2  1  
ATOM 1028  H H    . VAL A 1 73  ? 1.088   -0.068  3.456   1.00 0.00 ? 73  VAL A H    1  
ATOM 1029  H HA   . VAL A 1 73  ? -1.697  -0.389  2.613   1.00 0.00 ? 73  VAL A HA   1  
ATOM 1030  H HB   . VAL A 1 73  ? 0.582   -1.586  1.038   1.00 0.00 ? 73  VAL A HB   1  
ATOM 1031  H HG11 . VAL A 1 73  ? -1.111  -2.977  0.500   1.00 0.00 ? 73  VAL A HG11 1  
ATOM 1032  H HG12 . VAL A 1 73  ? -1.569  -1.658  -0.579  1.00 0.00 ? 73  VAL A HG12 1  
ATOM 1033  H HG13 . VAL A 1 73  ? -2.355  -1.826  0.991   1.00 0.00 ? 73  VAL A HG13 1  
ATOM 1034  H HG21 . VAL A 1 73  ? -0.582  0.109   -0.696  1.00 0.00 ? 73  VAL A HG21 1  
ATOM 1035  H HG22 . VAL A 1 73  ? 0.826   0.529   0.279   1.00 0.00 ? 73  VAL A HG22 1  
ATOM 1036  H HG23 . VAL A 1 73  ? -0.787  1.017   0.801   1.00 0.00 ? 73  VAL A HG23 1  
ATOM 1037  N N    . ASN A 1 74  ? -1.792  -2.608  3.711   1.00 0.00 ? 74  ASN A N    1  
ATOM 1038  C CA   . ASN A 1 74  ? -1.867  -3.856  4.463   1.00 0.00 ? 74  ASN A CA   1  
ATOM 1039  C C    . ASN A 1 74  ? -1.145  -3.727  5.801   1.00 0.00 ? 74  ASN A C    1  
ATOM 1040  O O    . ASN A 1 74  ? -0.601  -4.702  6.320   1.00 0.00 ? 74  ASN A O    1  
ATOM 1041  C CB   . ASN A 1 74  ? -1.264  -5.002  3.650   1.00 0.00 ? 74  ASN A CB   1  
ATOM 1042  C CG   . ASN A 1 74  ? -2.311  -5.772  2.870   1.00 0.00 ? 74  ASN A CG   1  
ATOM 1043  O OD1  . ASN A 1 74  ? -2.832  -6.784  3.339   1.00 0.00 ? 74  ASN A OD1  1  
ATOM 1044  N ND2  . ASN A 1 74  ? -2.625  -5.294  1.672   1.00 0.00 ? 74  ASN A ND2  1  
ATOM 1045  H H    . ASN A 1 74  ? -2.621  -2.142  3.476   1.00 0.00 ? 74  ASN A H    1  
ATOM 1046  H HA   . ASN A 1 74  ? -2.909  -4.068  4.649   1.00 0.00 ? 74  ASN A HA   1  
ATOM 1047  H HB2  . ASN A 1 74  ? -0.544  -4.599  2.949   1.00 0.00 ? 74  ASN A HB2  1  
ATOM 1048  H HB3  . ASN A 1 74  ? -0.763  -5.688  4.321   1.00 0.00 ? 74  ASN A HB3  1  
ATOM 1049  H HD21 . ASN A 1 74  ? -2.170  -4.483  1.362   1.00 0.00 ? 74  ASN A HD21 1  
ATOM 1050  H HD22 . ASN A 1 74  ? -3.301  -5.772  1.145   1.00 0.00 ? 74  ASN A HD22 1  
ATOM 1051  N N    . GLY A 1 75  ? -1.144  -2.519  6.355   1.00 0.00 ? 75  GLY A N    1  
ATOM 1052  C CA   . GLY A 1 75  ? -0.486  -2.287  7.627   1.00 0.00 ? 75  GLY A CA   1  
ATOM 1053  C C    . GLY A 1 75  ? 1.025   -2.285  7.506   1.00 0.00 ? 75  GLY A C    1  
ATOM 1054  O O    . GLY A 1 75  ? 1.731   -2.618  8.458   1.00 0.00 ? 75  GLY A O    1  
ATOM 1055  H H    . GLY A 1 75  ? -1.594  -1.779  5.896   1.00 0.00 ? 75  GLY A H    1  
ATOM 1056  H HA2  . GLY A 1 75  ? -0.806  -1.332  8.016   1.00 0.00 ? 75  GLY A HA2  1  
ATOM 1057  H HA3  . GLY A 1 75  ? -0.780  -3.063  8.319   1.00 0.00 ? 75  GLY A HA3  1  
ATOM 1058  N N    . ARG A 1 76  ? 1.522   -1.908  6.332   1.00 0.00 ? 76  ARG A N    1  
ATOM 1059  C CA   . ARG A 1 76  ? 2.960   -1.864  6.089   1.00 0.00 ? 76  ARG A CA   1  
ATOM 1060  C C    . ARG A 1 76  ? 3.393   -0.473  5.639   1.00 0.00 ? 76  ARG A C    1  
ATOM 1061  O O    . ARG A 1 76  ? 2.786   0.119   4.745   1.00 0.00 ? 76  ARG A O    1  
ATOM 1062  C CB   . ARG A 1 76  ? 3.350   -2.899  5.032   1.00 0.00 ? 76  ARG A CB   1  
ATOM 1063  C CG   . ARG A 1 76  ? 4.852   -3.091  4.894   1.00 0.00 ? 76  ARG A CG   1  
ATOM 1064  C CD   . ARG A 1 76  ? 5.200   -4.512  4.480   1.00 0.00 ? 76  ARG A CD   1  
ATOM 1065  N NE   . ARG A 1 76  ? 6.125   -5.144  5.417   1.00 0.00 ? 76  ARG A NE   1  
ATOM 1066  C CZ   . ARG A 1 76  ? 7.436   -4.914  5.433   1.00 0.00 ? 76  ARG A CZ   1  
ATOM 1067  N NH1  . ARG A 1 76  ? 7.979   -4.069  4.565   1.00 0.00 ? 76  ARG A NH1  1  
ATOM 1068  N NH2  . ARG A 1 76  ? 8.206   -5.531  6.319   1.00 0.00 ? 76  ARG A NH2  1  
ATOM 1069  H H    . ARG A 1 76  ? 0.908   -1.654  5.612   1.00 0.00 ? 76  ARG A H    1  
ATOM 1070  H HA   . ARG A 1 76  ? 3.461   -2.102  7.015   1.00 0.00 ? 76  ARG A HA   1  
ATOM 1071  H HB2  . ARG A 1 76  ? 2.911   -3.849  5.296   1.00 0.00 ? 76  ARG A HB2  1  
ATOM 1072  H HB3  . ARG A 1 76  ? 2.959   -2.585  4.076   1.00 0.00 ? 76  ARG A HB3  1  
ATOM 1073  H HG2  . ARG A 1 76  ? 5.224   -2.408  4.145   1.00 0.00 ? 76  ARG A HG2  1  
ATOM 1074  H HG3  . ARG A 1 76  ? 5.321   -2.877  5.844   1.00 0.00 ? 76  ARG A HG3  1  
ATOM 1075  H HD2  . ARG A 1 76  ? 4.291   -5.095  4.439   1.00 0.00 ? 76  ARG A HD2  1  
ATOM 1076  H HD3  . ARG A 1 76  ? 5.654   -4.487  3.501   1.00 0.00 ? 76  ARG A HD3  1  
ATOM 1077  H HE   . ARG A 1 76  ? 5.750   -5.772  6.069   1.00 0.00 ? 76  ARG A HE   1  
ATOM 1078  H HH11 . ARG A 1 76  ? 7.404   -3.601  3.894   1.00 0.00 ? 76  ARG A HH11 1  
ATOM 1079  H HH12 . ARG A 1 76  ? 8.965   -3.901  4.582   1.00 0.00 ? 76  ARG A HH12 1  
ATOM 1080  H HH21 . ARG A 1 76  ? 7.801   -6.168  6.975   1.00 0.00 ? 76  ARG A HH21 1  
ATOM 1081  H HH22 . ARG A 1 76  ? 9.191   -5.359  6.330   1.00 0.00 ? 76  ARG A HH22 1  
ATOM 1082  N N    . SER A 1 77  ? 4.445   0.045   6.263   1.00 0.00 ? 77  SER A N    1  
ATOM 1083  C CA   . SER A 1 77  ? 4.960   1.367   5.926   1.00 0.00 ? 77  SER A CA   1  
ATOM 1084  C C    . SER A 1 77  ? 5.474   1.401   4.491   1.00 0.00 ? 77  SER A C    1  
ATOM 1085  O O    . SER A 1 77  ? 6.461   0.745   4.159   1.00 0.00 ? 77  SER A O    1  
ATOM 1086  C CB   . SER A 1 77  ? 6.079   1.763   6.891   1.00 0.00 ? 77  SER A CB   1  
ATOM 1087  O OG   . SER A 1 77  ? 5.573   1.987   8.195   1.00 0.00 ? 77  SER A OG   1  
ATOM 1088  H H    . SER A 1 77  ? 4.887   -0.474  6.967   1.00 0.00 ? 77  SER A H    1  
ATOM 1089  H HA   . SER A 1 77  ? 4.149   2.073   6.022   1.00 0.00 ? 77  SER A HA   1  
ATOM 1090  H HB2  . SER A 1 77  ? 6.811   0.970   6.935   1.00 0.00 ? 77  SER A HB2  1  
ATOM 1091  H HB3  . SER A 1 77  ? 6.551   2.669   6.540   1.00 0.00 ? 77  SER A HB3  1  
ATOM 1092  H HG   . SER A 1 77  ? 5.947   2.797   8.550   1.00 0.00 ? 77  SER A HG   1  
ATOM 1093  N N    . PHE A 1 78  ? 4.798   2.169   3.644   1.00 0.00 ? 78  PHE A N    1  
ATOM 1094  C CA   . PHE A 1 78  ? 5.186   2.288   2.242   1.00 0.00 ? 78  PHE A CA   1  
ATOM 1095  C C    . PHE A 1 78  ? 5.999   3.558   2.009   1.00 0.00 ? 78  PHE A C    1  
ATOM 1096  O O    . PHE A 1 78  ? 5.958   4.144   0.927   1.00 0.00 ? 78  PHE A O    1  
ATOM 1097  C CB   . PHE A 1 78  ? 3.944   2.288   1.348   1.00 0.00 ? 78  PHE A CB   1  
ATOM 1098  C CG   . PHE A 1 78  ? 3.647   0.950   0.733   1.00 0.00 ? 78  PHE A CG   1  
ATOM 1099  C CD1  . PHE A 1 78  ? 3.413   -0.157  1.533   1.00 0.00 ? 78  PHE A CD1  1  
ATOM 1100  C CD2  . PHE A 1 78  ? 3.602   0.800   -0.644  1.00 0.00 ? 78  PHE A CD2  1  
ATOM 1101  C CE1  . PHE A 1 78  ? 3.139   -1.390  0.971   1.00 0.00 ? 78  PHE A CE1  1  
ATOM 1102  C CE2  . PHE A 1 78  ? 3.329   -0.430  -1.212  1.00 0.00 ? 78  PHE A CE2  1  
ATOM 1103  C CZ   . PHE A 1 78  ? 3.098   -1.526  -0.403  1.00 0.00 ? 78  PHE A CZ   1  
ATOM 1104  H H    . PHE A 1 78  ? 4.019   2.667   3.968   1.00 0.00 ? 78  PHE A H    1  
ATOM 1105  H HA   . PHE A 1 78  ? 5.796   1.433   1.995   1.00 0.00 ? 78  PHE A HA   1  
ATOM 1106  H HB2  . PHE A 1 78  ? 3.086   2.581   1.934   1.00 0.00 ? 78  PHE A HB2  1  
ATOM 1107  H HB3  . PHE A 1 78  ? 4.085   2.999   0.546   1.00 0.00 ? 78  PHE A HB3  1  
ATOM 1108  H HD1  . PHE A 1 78  ? 3.445   -0.051  2.607   1.00 0.00 ? 78  PHE A HD1  1  
ATOM 1109  H HD2  . PHE A 1 78  ? 3.783   1.656   -1.277  1.00 0.00 ? 78  PHE A HD2  1  
ATOM 1110  H HE1  . PHE A 1 78  ? 2.960   -2.245  1.605   1.00 0.00 ? 78  PHE A HE1  1  
ATOM 1111  H HE2  . PHE A 1 78  ? 3.297   -0.535  -2.286  1.00 0.00 ? 78  PHE A HE2  1  
ATOM 1112  H HZ   . PHE A 1 78  ? 2.884   -2.489  -0.845  1.00 0.00 ? 78  PHE A HZ   1  
ATOM 1113  N N    . LEU A 1 79  ? 6.738   3.978   3.031   1.00 0.00 ? 79  LEU A N    1  
ATOM 1114  C CA   . LEU A 1 79  ? 7.561   5.179   2.936   1.00 0.00 ? 79  LEU A CA   1  
ATOM 1115  C C    . LEU A 1 79  ? 8.978   4.832   2.490   1.00 0.00 ? 79  LEU A C    1  
ATOM 1116  O O    . LEU A 1 79  ? 9.638   5.621   1.815   1.00 0.00 ? 79  LEU A O    1  
ATOM 1117  C CB   . LEU A 1 79  ? 7.600   5.904   4.283   1.00 0.00 ? 79  LEU A CB   1  
ATOM 1118  C CG   . LEU A 1 79  ? 6.423   6.844   4.546   1.00 0.00 ? 79  LEU A CG   1  
ATOM 1119  C CD1  . LEU A 1 79  ? 6.435   7.322   5.990   1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1120  C CD2  . LEU A 1 79  ? 6.464   8.028   3.590   1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1121  H H    . LEU A 1 79  ? 6.730   3.470   3.869   1.00 0.00 ? 79  LEU A H    1  
ATOM 1122  H HA   . LEU A 1 79  ? 7.114   5.830   2.200   1.00 0.00 ? 79  LEU A HA   1  
ATOM 1123  H HB2  . LEU A 1 79  ? 7.624   5.161   5.067   1.00 0.00 ? 79  LEU A HB2  1  
ATOM 1124  H HB3  . LEU A 1 79  ? 8.510   6.482   4.330   1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1125  H HG   . LEU A 1 79  ? 5.499   6.310   4.379   1.00 0.00 ? 79  LEU A HG   1  
ATOM 1126  H HD11 . LEU A 1 79  ? 6.233   6.489   6.646   1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1127  H HD12 . LEU A 1 79  ? 5.676   8.079   6.124   1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1128  H HD13 . LEU A 1 79  ? 7.404   7.738   6.223   1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1129  H HD21 . LEU A 1 79  ? 5.457   8.289   3.298   1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1130  H HD22 . LEU A 1 79  ? 7.034   7.762   2.712   1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1131  H HD23 . LEU A 1 79  ? 6.928   8.870   4.080   1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1132  N N    . ASN A 1 80  ? 9.439   3.646   2.873   1.00 0.00 ? 80  ASN A N    1  
ATOM 1133  C CA   . ASN A 1 80  ? 10.779  3.194   2.513   1.00 0.00 ? 80  ASN A CA   1  
ATOM 1134  C C    . ASN A 1 80  ? 10.727  1.833   1.827   1.00 0.00 ? 80  ASN A C    1  
ATOM 1135  O O    . ASN A 1 80  ? 11.597  0.988   2.035   1.00 0.00 ? 80  ASN A O    1  
ATOM 1136  C CB   . ASN A 1 80  ? 11.667  3.118   3.756   1.00 0.00 ? 80  ASN A CB   1  
ATOM 1137  C CG   . ASN A 1 80  ? 10.990  2.401   4.909   1.00 0.00 ? 80  ASN A CG   1  
ATOM 1138  O OD1  . ASN A 1 80  ? 10.305  3.019   5.723   1.00 0.00 ? 80  ASN A OD1  1  
ATOM 1139  N ND2  . ASN A 1 80  ? 11.180  1.089   4.981   1.00 0.00 ? 80  ASN A ND2  1  
ATOM 1140  H H    . ASN A 1 80  ? 8.867   3.061   3.411   1.00 0.00 ? 80  ASN A H    1  
ATOM 1141  H HA   . ASN A 1 80  ? 11.199  3.914   1.826   1.00 0.00 ? 80  ASN A HA   1  
ATOM 1142  H HB2  . ASN A 1 80  ? 12.574  2.589   3.511   1.00 0.00 ? 80  ASN A HB2  1  
ATOM 1143  H HB3  . ASN A 1 80  ? 11.915  4.120   4.076   1.00 0.00 ? 80  ASN A HB3  1  
ATOM 1144  H HD21 . ASN A 1 80  ? 11.738  0.663   4.298   1.00 0.00 ? 80  ASN A HD21 1  
ATOM 1145  H HD22 . ASN A 1 80  ? 10.754  0.600   5.716   1.00 0.00 ? 80  ASN A HD22 1  
ATOM 1146  N N    . ILE A 1 81  ? 9.700   1.628   1.008   1.00 0.00 ? 81  ILE A N    1  
ATOM 1147  C CA   . ILE A 1 81  ? 9.533   0.370   0.291   1.00 0.00 ? 81  ILE A CA   1  
ATOM 1148  C C    . ILE A 1 81  ? 10.127  0.457   -1.113  1.00 0.00 ? 81  ILE A C    1  
ATOM 1149  O O    . ILE A 1 81  ? 9.960   1.459   -1.807  1.00 0.00 ? 81  ILE A O    1  
ATOM 1150  C CB   . ILE A 1 81  ? 8.046   -0.026  0.192   1.00 0.00 ? 81  ILE A CB   1  
ATOM 1151  C CG1  . ILE A 1 81  ? 7.901   -1.412  -0.444  1.00 0.00 ? 81  ILE A CG1  1  
ATOM 1152  C CG2  . ILE A 1 81  ? 7.267   1.014   -0.602  1.00 0.00 ? 81  ILE A CG2  1  
ATOM 1153  C CD1  . ILE A 1 81  ? 7.653   -2.515  0.561   1.00 0.00 ? 81  ILE A CD1  1  
ATOM 1154  H H    . ILE A 1 81  ? 9.039   2.340   0.884   1.00 0.00 ? 81  ILE A H    1  
ATOM 1155  H HA   . ILE A 1 81  ? 10.053  -0.399  0.844   1.00 0.00 ? 81  ILE A HA   1  
ATOM 1156  H HB   . ILE A 1 81  ? 7.639   -0.054  1.191   1.00 0.00 ? 81  ILE A HB   1  
ATOM 1157  H HG12 . ILE A 1 81  ? 7.071   -1.399  -1.134  1.00 0.00 ? 81  ILE A HG12 1  
ATOM 1158  H HG13 . ILE A 1 81  ? 8.806   -1.650  -0.983  1.00 0.00 ? 81  ILE A HG13 1  
ATOM 1159  H HG21 . ILE A 1 81  ? 7.343   1.972   -0.111  1.00 0.00 ? 81  ILE A HG21 1  
ATOM 1160  H HG22 . ILE A 1 81  ? 6.230   0.720   -0.662  1.00 0.00 ? 81  ILE A HG22 1  
ATOM 1161  H HG23 . ILE A 1 81  ? 7.678   1.087   -1.599  1.00 0.00 ? 81  ILE A HG23 1  
ATOM 1162  H HD11 . ILE A 1 81  ? 6.589   -2.640  0.702   1.00 0.00 ? 81  ILE A HD11 1  
ATOM 1163  H HD12 . ILE A 1 81  ? 8.112   -2.253  1.503   1.00 0.00 ? 81  ILE A HD12 1  
ATOM 1164  H HD13 . ILE A 1 81  ? 8.078   -3.437  0.196   1.00 0.00 ? 81  ILE A HD13 1  
ATOM 1165  N N    . LEU A 1 82  ? 10.820  -0.601  -1.523  1.00 0.00 ? 82  LEU A N    1  
ATOM 1166  C CA   . LEU A 1 82  ? 11.439  -0.645  -2.844  1.00 0.00 ? 82  LEU A CA   1  
ATOM 1167  C C    . LEU A 1 82  ? 10.394  -0.468  -3.940  1.00 0.00 ? 82  LEU A C    1  
ATOM 1168  O O    . LEU A 1 82  ? 9.199   -0.655  -3.710  1.00 0.00 ? 82  LEU A O    1  
ATOM 1169  C CB   . LEU A 1 82  ? 12.180  -1.969  -3.039  1.00 0.00 ? 82  LEU A CB   1  
ATOM 1170  C CG   . LEU A 1 82  ? 13.623  -1.982  -2.532  1.00 0.00 ? 82  LEU A CG   1  
ATOM 1171  C CD1  . LEU A 1 82  ? 14.072  -3.406  -2.238  1.00 0.00 ? 82  LEU A CD1  1  
ATOM 1172  C CD2  . LEU A 1 82  ? 14.549  -1.329  -3.547  1.00 0.00 ? 82  LEU A CD2  1  
ATOM 1173  H H    . LEU A 1 82  ? 10.917  -1.370  -0.924  1.00 0.00 ? 82  LEU A H    1  
ATOM 1174  H HA   . LEU A 1 82  ? 12.147  0.167   -2.904  1.00 0.00 ? 82  LEU A HA   1  
ATOM 1175  H HB2  . LEU A 1 82  ? 11.631  -2.744  -2.523  1.00 0.00 ? 82  LEU A HB2  1  
ATOM 1176  H HB3  . LEU A 1 82  ? 12.190  -2.199  -4.093  1.00 0.00 ? 82  LEU A HB3  1  
ATOM 1177  H HG   . LEU A 1 82  ? 13.681  -1.418  -1.613  1.00 0.00 ? 82  LEU A HG   1  
ATOM 1178  H HD11 . LEU A 1 82  ? 15.034  -3.386  -1.750  1.00 0.00 ? 82  LEU A HD11 1  
ATOM 1179  H HD12 . LEU A 1 82  ? 14.149  -3.957  -3.164  1.00 0.00 ? 82  LEU A HD12 1  
ATOM 1180  H HD13 . LEU A 1 82  ? 13.350  -3.884  -1.593  1.00 0.00 ? 82  LEU A HD13 1  
ATOM 1181  H HD21 . LEU A 1 82  ? 13.979  -0.661  -4.176  1.00 0.00 ? 82  LEU A HD21 1  
ATOM 1182  H HD22 . LEU A 1 82  ? 15.011  -2.090  -4.156  1.00 0.00 ? 82  LEU A HD22 1  
ATOM 1183  H HD23 . LEU A 1 82  ? 15.313  -0.769  -3.028  1.00 0.00 ? 82  LEU A HD23 1  
ATOM 1184  N N    . HIS A 1 83  ? 10.852  -0.105  -5.135  1.00 0.00 ? 83  HIS A N    1  
ATOM 1185  C CA   . HIS A 1 83  ? 9.957   0.098   -6.267  1.00 0.00 ? 83  HIS A CA   1  
ATOM 1186  C C    . HIS A 1 83  ? 9.373   -1.229  -6.745  1.00 0.00 ? 83  HIS A C    1  
ATOM 1187  O O    . HIS A 1 83  ? 8.158   -1.370  -6.884  1.00 0.00 ? 83  HIS A O    1  
ATOM 1188  C CB   . HIS A 1 83  ? 10.700  0.784   -7.415  1.00 0.00 ? 83  HIS A CB   1  
ATOM 1189  C CG   . HIS A 1 83  ? 9.806   1.202   -8.541  1.00 0.00 ? 83  HIS A CG   1  
ATOM 1190  N ND1  . HIS A 1 83  ? 8.695   1.999   -8.364  1.00 0.00 ? 83  HIS A ND1  1  
ATOM 1191  C CD2  . HIS A 1 83  ? 9.865   0.930   -9.867  1.00 0.00 ? 83  HIS A CD2  1  
ATOM 1192  C CE1  . HIS A 1 83  ? 8.108   2.198   -9.532  1.00 0.00 ? 83  HIS A CE1  1  
ATOM 1193  N NE2  . HIS A 1 83  ? 8.799   1.560   -10.459 1.00 0.00 ? 83  HIS A NE2  1  
ATOM 1194  H H    . HIS A 1 83  ? 11.815  0.029   -5.256  1.00 0.00 ? 83  HIS A H    1  
ATOM 1195  H HA   . HIS A 1 83  ? 9.149   0.735   -5.941  1.00 0.00 ? 83  HIS A HA   1  
ATOM 1196  H HB2  . HIS A 1 83  ? 11.192  1.669   -7.036  1.00 0.00 ? 83  HIS A HB2  1  
ATOM 1197  H HB3  . HIS A 1 83  ? 11.442  0.103   -7.812  1.00 0.00 ? 83  HIS A HB3  1  
ATOM 1198  H HD1  . HIS A 1 83  ? 8.383   2.365   -7.510  1.00 0.00 ? 83  HIS A HD1  1  
ATOM 1199  H HD2  . HIS A 1 83  ? 10.612  0.328   -10.365 1.00 0.00 ? 83  HIS A HD2  1  
ATOM 1200  H HE1  . HIS A 1 83  ? 7.216   2.783   -9.699  1.00 0.00 ? 83  HIS A HE1  1  
ATOM 1201  H HE2  . HIS A 1 83  ? 8.631   1.611   -11.422 1.00 0.00 ? 83  HIS A HE2  1  
ATOM 1202  N N    . ASP A 1 84  ? 10.248  -2.198  -6.996  1.00 0.00 ? 84  ASP A N    1  
ATOM 1203  C CA   . ASP A 1 84  ? 9.819   -3.513  -7.459  1.00 0.00 ? 84  ASP A CA   1  
ATOM 1204  C C    . ASP A 1 84  ? 9.011   -4.232  -6.383  1.00 0.00 ? 84  ASP A C    1  
ATOM 1205  O O    . ASP A 1 84  ? 8.107   -5.011  -6.689  1.00 0.00 ? 84  ASP A O    1  
ATOM 1206  C CB   . ASP A 1 84  ? 11.031  -4.358  -7.853  1.00 0.00 ? 84  ASP A CB   1  
ATOM 1207  C CG   . ASP A 1 84  ? 12.095  -4.383  -6.773  1.00 0.00 ? 84  ASP A CG   1  
ATOM 1208  O OD1  . ASP A 1 84  ? 12.725  -3.331  -6.536  1.00 0.00 ? 84  ASP A OD1  1  
ATOM 1209  O OD2  . ASP A 1 84  ? 12.297  -5.454  -6.162  1.00 0.00 ? 84  ASP A OD2  1  
ATOM 1210  H H    . ASP A 1 84  ? 11.204  -2.025  -6.866  1.00 0.00 ? 84  ASP A H    1  
ATOM 1211  H HA   . ASP A 1 84  ? 9.193   -3.371  -8.327  1.00 0.00 ? 84  ASP A HA   1  
ATOM 1212  H HB2  . ASP A 1 84  ? 10.711  -5.372  -8.038  1.00 0.00 ? 84  ASP A HB2  1  
ATOM 1213  H HB3  . ASP A 1 84  ? 11.468  -3.953  -8.753  1.00 0.00 ? 84  ASP A HB3  1  
ATOM 1214  N N    . GLU A 1 85  ? 9.342   -3.966  -5.124  1.00 0.00 ? 85  GLU A N    1  
ATOM 1215  C CA   . GLU A 1 85  ? 8.647   -4.588  -4.003  1.00 0.00 ? 85  GLU A CA   1  
ATOM 1216  C C    . GLU A 1 85  ? 7.257   -3.986  -3.824  1.00 0.00 ? 85  GLU A C    1  
ATOM 1217  O O    . GLU A 1 85  ? 6.316   -4.678  -3.436  1.00 0.00 ? 85  GLU A O    1  
ATOM 1218  C CB   . GLU A 1 85  ? 9.459   -4.421  -2.717  1.00 0.00 ? 85  GLU A CB   1  
ATOM 1219  C CG   . GLU A 1 85  ? 9.199   -5.510  -1.689  1.00 0.00 ? 85  GLU A CG   1  
ATOM 1220  C CD   . GLU A 1 85  ? 9.878   -5.231  -0.362  1.00 0.00 ? 85  GLU A CD   1  
ATOM 1221  O OE1  . GLU A 1 85  ? 11.074  -4.874  -0.370  1.00 0.00 ? 85  GLU A OE1  1  
ATOM 1222  O OE2  . GLU A 1 85  ? 9.212   -5.370  0.686   1.00 0.00 ? 85  GLU A OE2  1  
ATOM 1223  H H    . GLU A 1 85  ? 10.072  -3.337  -4.945  1.00 0.00 ? 85  GLU A H    1  
ATOM 1224  H HA   . GLU A 1 85  ? 8.545   -5.641  -4.219  1.00 0.00 ? 85  GLU A HA   1  
ATOM 1225  H HB2  . GLU A 1 85  ? 10.510  -4.431  -2.964  1.00 0.00 ? 85  GLU A HB2  1  
ATOM 1226  H HB3  . GLU A 1 85  ? 9.212   -3.468  -2.271  1.00 0.00 ? 85  GLU A HB3  1  
ATOM 1227  H HG2  . GLU A 1 85  ? 8.135   -5.585  -1.522  1.00 0.00 ? 85  GLU A HG2  1  
ATOM 1228  H HG3  . GLU A 1 85  ? 9.570   -6.448  -2.077  1.00 0.00 ? 85  GLU A HG3  1  
ATOM 1229  N N    . ALA A 1 86  ? 7.137   -2.694  -4.107  1.00 0.00 ? 86  ALA A N    1  
ATOM 1230  C CA   . ALA A 1 86  ? 5.863   -1.998  -3.977  1.00 0.00 ? 86  ALA A CA   1  
ATOM 1231  C C    . ALA A 1 86  ? 4.906   -2.389  -5.098  1.00 0.00 ? 86  ALA A C    1  
ATOM 1232  O O    . ALA A 1 86  ? 3.690   -2.408  -4.912  1.00 0.00 ? 86  ALA A O    1  
ATOM 1233  C CB   . ALA A 1 86  ? 6.082   -0.493  -3.969  1.00 0.00 ? 86  ALA A CB   1  
ATOM 1234  H H    . ALA A 1 86  ? 7.924   -2.195  -4.412  1.00 0.00 ? 86  ALA A H    1  
ATOM 1235  H HA   . ALA A 1 86  ? 5.425   -2.279  -3.030  1.00 0.00 ? 86  ALA A HA   1  
ATOM 1236  H HB1  . ALA A 1 86  ? 5.134   0.008   -3.843  1.00 0.00 ? 86  ALA A HB1  1  
ATOM 1237  H HB2  . ALA A 1 86  ? 6.528   -0.189  -4.905  1.00 0.00 ? 86  ALA A HB2  1  
ATOM 1238  H HB3  . ALA A 1 86  ? 6.741   -0.229  -3.155  1.00 0.00 ? 86  ALA A HB3  1  
ATOM 1239  N N    . VAL A 1 87  ? 5.465   -2.701  -6.264  1.00 0.00 ? 87  VAL A N    1  
ATOM 1240  C CA   . VAL A 1 87  ? 4.662   -3.092  -7.415  1.00 0.00 ? 87  VAL A CA   1  
ATOM 1241  C C    . VAL A 1 87  ? 4.229   -4.551  -7.314  1.00 0.00 ? 87  VAL A C    1  
ATOM 1242  O O    . VAL A 1 87  ? 3.164   -4.929  -7.800  1.00 0.00 ? 87  VAL A O    1  
ATOM 1243  C CB   . VAL A 1 87  ? 5.431   -2.887  -8.735  1.00 0.00 ? 87  VAL A CB   1  
ATOM 1244  C CG1  . VAL A 1 87  ? 4.528   -3.153  -9.929  1.00 0.00 ? 87  VAL A CG1  1  
ATOM 1245  C CG2  . VAL A 1 87  ? 6.014   -1.482  -8.803  1.00 0.00 ? 87  VAL A CG2  1  
ATOM 1246  H H    . VAL A 1 87  ? 6.440   -2.668  -6.351  1.00 0.00 ? 87  VAL A H    1  
ATOM 1247  H HA   . VAL A 1 87  ? 3.781   -2.467  -7.436  1.00 0.00 ? 87  VAL A HA   1  
ATOM 1248  H HB   . VAL A 1 87  ? 6.248   -3.593  -8.766  1.00 0.00 ? 87  VAL A HB   1  
ATOM 1249  H HG11 . VAL A 1 87  ? 4.836   -2.534  -10.759 1.00 0.00 ? 87  VAL A HG11 1  
ATOM 1250  H HG12 . VAL A 1 87  ? 3.507   -2.922  -9.667  1.00 0.00 ? 87  VAL A HG12 1  
ATOM 1251  H HG13 . VAL A 1 87  ? 4.601   -4.193  -10.210 1.00 0.00 ? 87  VAL A HG13 1  
ATOM 1252  H HG21 . VAL A 1 87  ? 5.373   -0.856  -9.407  1.00 0.00 ? 87  VAL A HG21 1  
ATOM 1253  H HG22 . VAL A 1 87  ? 6.998   -1.522  -9.243  1.00 0.00 ? 87  VAL A HG22 1  
ATOM 1254  H HG23 . VAL A 1 87  ? 6.081   -1.071  -7.806  1.00 0.00 ? 87  VAL A HG23 1  
ATOM 1255  N N    . ARG A 1 88  ? 5.065   -5.368  -6.679  1.00 0.00 ? 88  ARG A N    1  
ATOM 1256  C CA   . ARG A 1 88  ? 4.768   -6.786  -6.515  1.00 0.00 ? 88  ARG A CA   1  
ATOM 1257  C C    . ARG A 1 88  ? 3.940   -7.027  -5.258  1.00 0.00 ? 88  ARG A C    1  
ATOM 1258  O O    . ARG A 1 88  ? 3.002   -7.826  -5.264  1.00 0.00 ? 88  ARG A O    1  
ATOM 1259  C CB   . ARG A 1 88  ? 6.066   -7.594  -6.447  1.00 0.00 ? 88  ARG A CB   1  
ATOM 1260  C CG   . ARG A 1 88  ? 6.575   -8.043  -7.807  1.00 0.00 ? 88  ARG A CG   1  
ATOM 1261  C CD   . ARG A 1 88  ? 8.014   -8.528  -7.730  1.00 0.00 ? 88  ARG A CD   1  
ATOM 1262  N NE   . ARG A 1 88  ? 8.281   -9.603  -8.681  1.00 0.00 ? 88  ARG A NE   1  
ATOM 1263  C CZ   . ARG A 1 88  ? 9.467   -10.193 -8.819  1.00 0.00 ? 88  ARG A CZ   1  
ATOM 1264  N NH1  . ARG A 1 88  ? 10.495  -9.814  -8.071  1.00 0.00 ? 88  ARG A NH1  1  
ATOM 1265  N NH2  . ARG A 1 88  ? 9.623   -11.165 -9.709  1.00 0.00 ? 88  ARG A NH2  1  
ATOM 1266  H H    . ARG A 1 88  ? 5.899   -5.008  -6.314  1.00 0.00 ? 88  ARG A H    1  
ATOM 1267  H HA   . ARG A 1 88  ? 4.200   -7.108  -7.374  1.00 0.00 ? 88  ARG A HA   1  
ATOM 1268  H HB2  . ARG A 1 88  ? 6.830   -6.989  -5.982  1.00 0.00 ? 88  ARG A HB2  1  
ATOM 1269  H HB3  . ARG A 1 88  ? 5.897   -8.473  -5.841  1.00 0.00 ? 88  ARG A HB3  1  
ATOM 1270  H HG2  . ARG A 1 88  ? 5.953   -8.853  -8.164  1.00 0.00 ? 88  ARG A HG2  1  
ATOM 1271  H HG3  . ARG A 1 88  ? 6.519   -7.210  -8.494  1.00 0.00 ? 88  ARG A HG3  1  
ATOM 1272  H HD2  . ARG A 1 88  ? 8.671   -7.697  -7.945  1.00 0.00 ? 88  ARG A HD2  1  
ATOM 1273  H HD3  . ARG A 1 88  ? 8.206   -8.886  -6.730  1.00 0.00 ? 88  ARG A HD3  1  
ATOM 1274  H HE   . ARG A 1 88  ? 7.539   -9.901  -9.247  1.00 0.00 ? 88  ARG A HE   1  
ATOM 1275  H HH11 . ARG A 1 88  ? 10.383  -9.083  -7.399  1.00 0.00 ? 88  ARG A HH11 1  
ATOM 1276  H HH12 . ARG A 1 88  ? 11.382  -10.262 -8.180  1.00 0.00 ? 88  ARG A HH12 1  
ATOM 1277  H HH21 . ARG A 1 88  ? 8.851   -11.453 -10.275 1.00 0.00 ? 88  ARG A HH21 1  
ATOM 1278  H HH22 . ARG A 1 88  ? 10.513  -11.607 -9.813  1.00 0.00 ? 88  ARG A HH22 1  
ATOM 1279  N N    . LEU A 1 89  ? 4.290   -6.333  -4.181  1.00 0.00 ? 89  LEU A N    1  
ATOM 1280  C CA   . LEU A 1 89  ? 3.578   -6.471  -2.916  1.00 0.00 ? 89  LEU A CA   1  
ATOM 1281  C C    . LEU A 1 89  ? 2.107   -6.102  -3.075  1.00 0.00 ? 89  LEU A C    1  
ATOM 1282  O O    . LEU A 1 89  ? 1.243   -6.643  -2.385  1.00 0.00 ? 89  LEU A O    1  
ATOM 1283  C CB   . LEU A 1 89  ? 4.224   -5.592  -1.843  1.00 0.00 ? 89  LEU A CB   1  
ATOM 1284  C CG   . LEU A 1 89  ? 3.624   -5.732  -0.444  1.00 0.00 ? 89  LEU A CG   1  
ATOM 1285  C CD1  . LEU A 1 89  ? 3.810   -7.148  0.078   1.00 0.00 ? 89  LEU A CD1  1  
ATOM 1286  C CD2  . LEU A 1 89  ? 4.251   -4.724  0.506   1.00 0.00 ? 89  LEU A CD2  1  
ATOM 1287  H H    . LEU A 1 89  ? 5.046   -5.711  -4.238  1.00 0.00 ? 89  LEU A H    1  
ATOM 1288  H HA   . LEU A 1 89  ? 3.646   -7.505  -2.610  1.00 0.00 ? 89  LEU A HA   1  
ATOM 1289  H HB2  . LEU A 1 89  ? 5.274   -5.840  -1.789  1.00 0.00 ? 89  LEU A HB2  1  
ATOM 1290  H HB3  . LEU A 1 89  ? 4.130   -4.561  -2.149  1.00 0.00 ? 89  LEU A HB3  1  
ATOM 1291  H HG   . LEU A 1 89  ? 2.563   -5.532  -0.493  1.00 0.00 ? 89  LEU A HG   1  
ATOM 1292  H HD11 . LEU A 1 89  ? 3.109   -7.808  -0.412  1.00 0.00 ? 89  LEU A HD11 1  
ATOM 1293  H HD12 . LEU A 1 89  ? 3.635   -7.165  1.144   1.00 0.00 ? 89  LEU A HD12 1  
ATOM 1294  H HD13 . LEU A 1 89  ? 4.817   -7.477  -0.127  1.00 0.00 ? 89  LEU A HD13 1  
ATOM 1295  H HD21 . LEU A 1 89  ? 5.278   -4.551  0.221   1.00 0.00 ? 89  LEU A HD21 1  
ATOM 1296  H HD22 . LEU A 1 89  ? 4.219   -5.112  1.515   1.00 0.00 ? 89  LEU A HD22 1  
ATOM 1297  H HD23 . LEU A 1 89  ? 3.703   -3.796  0.461   1.00 0.00 ? 89  LEU A HD23 1  
ATOM 1298  N N    . LEU A 1 90  ? 1.828   -5.177  -3.988  1.00 0.00 ? 90  LEU A N    1  
ATOM 1299  C CA   . LEU A 1 90  ? 0.462   -4.736  -4.237  1.00 0.00 ? 90  LEU A CA   1  
ATOM 1300  C C    . LEU A 1 90  ? -0.305  -5.774  -5.050  1.00 0.00 ? 90  LEU A C    1  
ATOM 1301  O O    . LEU A 1 90  ? -1.507  -5.963  -4.859  1.00 0.00 ? 90  LEU A O    1  
ATOM 1302  C CB   . LEU A 1 90  ? 0.462   -3.393  -4.972  1.00 0.00 ? 90  LEU A CB   1  
ATOM 1303  C CG   . LEU A 1 90  ? 0.568   -2.162  -4.071  1.00 0.00 ? 90  LEU A CG   1  
ATOM 1304  C CD1  . LEU A 1 90  ? 0.864   -0.921  -4.896  1.00 0.00 ? 90  LEU A CD1  1  
ATOM 1305  C CD2  . LEU A 1 90  ? -0.711  -1.980  -3.268  1.00 0.00 ? 90  LEU A CD2  1  
ATOM 1306  H H    . LEU A 1 90  ? 2.560   -4.782  -4.507  1.00 0.00 ? 90  LEU A H    1  
ATOM 1307  H HA   . LEU A 1 90  ? -0.026  -4.613  -3.282  1.00 0.00 ? 90  LEU A HA   1  
ATOM 1308  H HB2  . LEU A 1 90  ? 1.296   -3.384  -5.659  1.00 0.00 ? 90  LEU A HB2  1  
ATOM 1309  H HB3  . LEU A 1 90  ? -0.452  -3.318  -5.540  1.00 0.00 ? 90  LEU A HB3  1  
ATOM 1310  H HG   . LEU A 1 90  ? 1.383   -2.303  -3.375  1.00 0.00 ? 90  LEU A HG   1  
ATOM 1311  H HD11 . LEU A 1 90  ? 1.679   -1.126  -5.576  1.00 0.00 ? 90  LEU A HD11 1  
ATOM 1312  H HD12 . LEU A 1 90  ? 1.141   -0.109  -4.240  1.00 0.00 ? 90  LEU A HD12 1  
ATOM 1313  H HD13 . LEU A 1 90  ? -0.014  -0.645  -5.460  1.00 0.00 ? 90  LEU A HD13 1  
ATOM 1314  H HD21 . LEU A 1 90  ? -1.383  -1.327  -3.806  1.00 0.00 ? 90  LEU A HD21 1  
ATOM 1315  H HD22 . LEU A 1 90  ? -0.475  -1.542  -2.309  1.00 0.00 ? 90  LEU A HD22 1  
ATOM 1316  H HD23 . LEU A 1 90  ? -1.184  -2.940  -3.120  1.00 0.00 ? 90  LEU A HD23 1  
ATOM 1317  N N    . LYS A 1 91  ? 0.397   -6.444  -5.959  1.00 0.00 ? 91  LYS A N    1  
ATOM 1318  C CA   . LYS A 1 91  ? -0.217  -7.463  -6.800  1.00 0.00 ? 91  LYS A CA   1  
ATOM 1319  C C    . LYS A 1 91  ? 0.045   -8.858  -6.243  1.00 0.00 ? 91  LYS A C    1  
ATOM 1320  O O    . LYS A 1 91  ? 0.250   -9.810  -6.996  1.00 0.00 ? 91  LYS A O    1  
ATOM 1321  C CB   . LYS A 1 91  ? 0.315   -7.363  -8.231  1.00 0.00 ? 91  LYS A CB   1  
ATOM 1322  C CG   . LYS A 1 91  ? 0.382   -5.938  -8.757  1.00 0.00 ? 91  LYS A CG   1  
ATOM 1323  C CD   . LYS A 1 91  ? -1.002  -5.320  -8.866  1.00 0.00 ? 91  LYS A CD   1  
ATOM 1324  C CE   . LYS A 1 91  ? -1.006  -4.126  -9.806  1.00 0.00 ? 91  LYS A CE   1  
ATOM 1325  N NZ   . LYS A 1 91  ? -0.799  -2.843  -9.078  1.00 0.00 ? 91  LYS A NZ   1  
ATOM 1326  H H    . LYS A 1 91  ? 1.351   -6.248  -6.064  1.00 0.00 ? 91  LYS A H    1  
ATOM 1327  H HA   . LYS A 1 91  ? -1.284  -7.287  -6.810  1.00 0.00 ? 91  LYS A HA   1  
ATOM 1328  H HB2  . LYS A 1 91  ? 1.311   -7.782  -8.262  1.00 0.00 ? 91  LYS A HB2  1  
ATOM 1329  H HB3  . LYS A 1 91  ? -0.327  -7.936  -8.884  1.00 0.00 ? 91  LYS A HB3  1  
ATOM 1330  H HG2  . LYS A 1 91  ? 0.979   -5.343  -8.084  1.00 0.00 ? 91  LYS A HG2  1  
ATOM 1331  H HG3  . LYS A 1 91  ? 0.840   -5.948  -9.736  1.00 0.00 ? 91  LYS A HG3  1  
ATOM 1332  H HD2  . LYS A 1 91  ? -1.690  -6.062  -9.241  1.00 0.00 ? 91  LYS A HD2  1  
ATOM 1333  H HD3  . LYS A 1 91  ? -1.318  -4.995  -7.885  1.00 0.00 ? 91  LYS A HD3  1  
ATOM 1334  H HE2  . LYS A 1 91  ? -0.213  -4.250  -10.529 1.00 0.00 ? 91  LYS A HE2  1  
ATOM 1335  H HE3  . LYS A 1 91  ? -1.956  -4.091  -10.318 1.00 0.00 ? 91  LYS A HE3  1  
ATOM 1336  H HZ1  . LYS A 1 91  ? 0.216   -2.641  -8.992  1.00 0.00 ? 91  LYS A HZ1  1  
ATOM 1337  H HZ2  . LYS A 1 91  ? -1.212  -2.904  -8.126  1.00 0.00 ? 91  LYS A HZ2  1  
ATOM 1338  H HZ3  . LYS A 1 91  ? -1.255  -2.063  -9.592  1.00 0.00 ? 91  LYS A HZ3  1  
ATOM 1339  N N    . SER A 1 92  ? 0.037   -8.971  -4.919  1.00 0.00 ? 92  SER A N    1  
ATOM 1340  C CA   . SER A 1 92  ? 0.274   -10.249 -4.259  1.00 0.00 ? 92  SER A CA   1  
ATOM 1341  C C    . SER A 1 92  ? -0.759  -10.498 -3.165  1.00 0.00 ? 92  SER A C    1  
ATOM 1342  O O    . SER A 1 92  ? -1.335  -11.582 -3.076  1.00 0.00 ? 92  SER A O    1  
ATOM 1343  C CB   . SER A 1 92  ? 1.683   -10.287 -3.664  1.00 0.00 ? 92  SER A CB   1  
ATOM 1344  O OG   . SER A 1 92  ? 2.139   -11.620 -3.516  1.00 0.00 ? 92  SER A OG   1  
ATOM 1345  H H    . SER A 1 92  ? -0.133  -8.176  -4.372  1.00 0.00 ? 92  SER A H    1  
ATOM 1346  H HA   . SER A 1 92  ? 0.186   -11.027 -5.003  1.00 0.00 ? 92  SER A HA   1  
ATOM 1347  H HB2  . SER A 1 92  ? 2.361   -9.759  -4.318  1.00 0.00 ? 92  SER A HB2  1  
ATOM 1348  H HB3  . SER A 1 92  ? 1.675   -9.811  -2.695  1.00 0.00 ? 92  SER A HB3  1  
ATOM 1349  H HG   . SER A 1 92  ? 2.872   -11.777 -4.116  1.00 0.00 ? 92  SER A HG   1  
ATOM 1350  N N    . SER A 1 93  ? -0.989  -9.485  -2.335  1.00 0.00 ? 93  SER A N    1  
ATOM 1351  C CA   . SER A 1 93  ? -1.954  -9.594  -1.247  1.00 0.00 ? 93  SER A CA   1  
ATOM 1352  C C    . SER A 1 93  ? -3.383  -9.512  -1.775  1.00 0.00 ? 93  SER A C    1  
ATOM 1353  O O    . SER A 1 93  ? -3.653  -8.817  -2.755  1.00 0.00 ? 93  SER A O    1  
ATOM 1354  C CB   . SER A 1 93  ? -1.716  -8.490  -0.214  1.00 0.00 ? 93  SER A CB   1  
ATOM 1355  O OG   . SER A 1 93  ? -2.614  -8.610  0.876   1.00 0.00 ? 93  SER A OG   1  
ATOM 1356  H H    . SER A 1 93  ? -0.499  -8.646  -2.457  1.00 0.00 ? 93  SER A H    1  
ATOM 1357  H HA   . SER A 1 93  ? -1.813  -10.554 -0.773  1.00 0.00 ? 93  SER A HA   1  
ATOM 1358  H HB2  . SER A 1 93  ? -0.704  -8.561  0.160   1.00 0.00 ? 93  SER A HB2  1  
ATOM 1359  H HB3  . SER A 1 93  ? -1.862  -7.525  -0.682  1.00 0.00 ? 93  SER A HB3  1  
ATOM 1360  H HG   . SER A 1 93  ? -2.946  -7.741  1.114   1.00 0.00 ? 93  SER A HG   1  
ATOM 1361  N N    . ARG A 1 94  ? -4.292  -10.226 -1.121  1.00 0.00 ? 94  ARG A N    1  
ATOM 1362  C CA   . ARG A 1 94  ? -5.693  -10.235 -1.526  1.00 0.00 ? 94  ARG A CA   1  
ATOM 1363  C C    . ARG A 1 94  ? -6.372  -8.919  -1.161  1.00 0.00 ? 94  ARG A C    1  
ATOM 1364  O O    . ARG A 1 94  ? -6.829  -8.181  -2.034  1.00 0.00 ? 94  ARG A O    1  
ATOM 1365  C CB   . ARG A 1 94  ? -6.429  -11.403 -0.867  1.00 0.00 ? 94  ARG A CB   1  
ATOM 1366  C CG   . ARG A 1 94  ? -5.987  -12.765 -1.377  1.00 0.00 ? 94  ARG A CG   1  
ATOM 1367  C CD   . ARG A 1 94  ? -4.820  -13.310 -0.569  1.00 0.00 ? 94  ARG A CD   1  
ATOM 1368  N NE   . ARG A 1 94  ? -4.941  -14.747 -0.335  1.00 0.00 ? 94  ARG A NE   1  
ATOM 1369  C CZ   . ARG A 1 94  ? -4.250  -15.409 0.591   1.00 0.00 ? 94  ARG A CZ   1  
ATOM 1370  N NH1  . ARG A 1 94  ? -3.388  -14.766 1.370   1.00 0.00 ? 94  ARG A NH1  1  
ATOM 1371  N NH2  . ARG A 1 94  ? -4.419  -16.715 0.738   1.00 0.00 ? 94  ARG A NH2  1  
ATOM 1372  H H    . ARG A 1 94  ? -4.015  -10.761 -0.347  1.00 0.00 ? 94  ARG A H    1  
ATOM 1373  H HA   . ARG A 1 94  ? -5.727  -10.358 -2.598  1.00 0.00 ? 94  ARG A HA   1  
ATOM 1374  H HB2  . ARG A 1 94  ? -6.254  -11.367 0.200   1.00 0.00 ? 94  ARG A HB2  1  
ATOM 1375  H HB3  . ARG A 1 94  ? -7.490  -11.298 -1.057  1.00 0.00 ? 94  ARG A HB3  1  
ATOM 1376  H HG2  . ARG A 1 94  ? -6.816  -13.452 -1.302  1.00 0.00 ? 94  ARG A HG2  1  
ATOM 1377  H HG3  . ARG A 1 94  ? -5.686  -12.672 -2.410  1.00 0.00 ? 94  ARG A HG3  1  
ATOM 1378  H HD2  . ARG A 1 94  ? -3.905  -13.120 -1.109  1.00 0.00 ? 94  ARG A HD2  1  
ATOM 1379  H HD3  . ARG A 1 94  ? -4.788  -12.801 0.383   1.00 0.00 ? 94  ARG A HD3  1  
ATOM 1380  H HE   . ARG A 1 94  ? -5.569  -15.246 -0.897  1.00 0.00 ? 94  ARG A HE   1  
ATOM 1381  H HH11 . ARG A 1 94  ? -3.255  -13.781 1.265   1.00 0.00 ? 94  ARG A HH11 1  
ATOM 1382  H HH12 . ARG A 1 94  ? -2.872  -15.268 2.064   1.00 0.00 ? 94  ARG A HH12 1  
ATOM 1383  H HH21 . ARG A 1 94  ? -5.067  -17.204 0.154   1.00 0.00 ? 94  ARG A HH21 1  
ATOM 1384  H HH22 . ARG A 1 94  ? -3.900  -17.212 1.433   1.00 0.00 ? 94  ARG A HH22 1  
ATOM 1385  N N    . HIS A 1 95  ? -6.436  -8.631  0.135   1.00 0.00 ? 95  HIS A N    1  
ATOM 1386  C CA   . HIS A 1 95  ? -7.060  -7.404  0.615   1.00 0.00 ? 95  HIS A CA   1  
ATOM 1387  C C    . HIS A 1 95  ? -6.062  -6.250  0.621   1.00 0.00 ? 95  HIS A C    1  
ATOM 1388  O O    . HIS A 1 95  ? -5.235  -6.136  1.525   1.00 0.00 ? 95  HIS A O    1  
ATOM 1389  C CB   . HIS A 1 95  ? -7.627  -7.613  2.022   1.00 0.00 ? 95  HIS A CB   1  
ATOM 1390  C CG   . HIS A 1 95  ? -8.987  -7.016  2.213   1.00 0.00 ? 95  HIS A CG   1  
ATOM 1391  N ND1  . HIS A 1 95  ? -10.012 -7.671  2.863   1.00 0.00 ? 95  HIS A ND1  1  
ATOM 1392  C CD2  . HIS A 1 95  ? -9.489  -5.815  1.838   1.00 0.00 ? 95  HIS A CD2  1  
ATOM 1393  C CE1  . HIS A 1 95  ? -11.085 -6.900  2.878   1.00 0.00 ? 95  HIS A CE1  1  
ATOM 1394  N NE2  . HIS A 1 95  ? -10.794 -5.769  2.262   1.00 0.00 ? 95  HIS A NE2  1  
ATOM 1395  H H    . HIS A 1 95  ? -6.054  -9.258  0.783   1.00 0.00 ? 95  HIS A H    1  
ATOM 1396  H HA   . HIS A 1 95  ? -7.870  -7.160  -0.056  1.00 0.00 ? 95  HIS A HA   1  
ATOM 1397  H HB2  . HIS A 1 95  ? -7.699  -8.672  2.220   1.00 0.00 ? 95  HIS A HB2  1  
ATOM 1398  H HB3  . HIS A 1 95  ? -6.960  -7.162  2.743   1.00 0.00 ? 95  HIS A HB3  1  
ATOM 1399  H HD1  . HIS A 1 95  ? -9.960  -8.567  3.255   1.00 0.00 ? 95  HIS A HD1  1  
ATOM 1400  H HD2  . HIS A 1 95  ? -8.960  -5.039  1.302   1.00 0.00 ? 95  HIS A HD2  1  
ATOM 1401  H HE1  . HIS A 1 95  ? -12.038 -7.153  3.319   1.00 0.00 ? 95  HIS A HE1  1  
ATOM 1402  H HE2  . HIS A 1 95  ? -11.435 -5.059  2.053   1.00 0.00 ? 95  HIS A HE2  1  
ATOM 1403  N N    . LEU A 1 96  ? -6.146  -5.397  -0.395  1.00 0.00 ? 96  LEU A N    1  
ATOM 1404  C CA   . LEU A 1 96  ? -5.249  -4.253  -0.507  1.00 0.00 ? 96  LEU A CA   1  
ATOM 1405  C C    . LEU A 1 96  ? -5.882  -3.003  0.098   1.00 0.00 ? 96  LEU A C    1  
ATOM 1406  O O    . LEU A 1 96  ? -6.825  -2.442  -0.458  1.00 0.00 ? 96  LEU A O    1  
ATOM 1407  C CB   . LEU A 1 96  ? -4.894  -3.998  -1.973  1.00 0.00 ? 96  LEU A CB   1  
ATOM 1408  C CG   . LEU A 1 96  ? -4.295  -5.196  -2.712  1.00 0.00 ? 96  LEU A CG   1  
ATOM 1409  C CD1  . LEU A 1 96  ? -3.893  -4.806  -4.125  1.00 0.00 ? 96  LEU A CD1  1  
ATOM 1410  C CD2  . LEU A 1 96  ? -3.099  -5.748  -1.950  1.00 0.00 ? 96  LEU A CD2  1  
ATOM 1411  H H    . LEU A 1 96  ? -6.827  -5.541  -1.085  1.00 0.00 ? 96  LEU A H    1  
ATOM 1412  H HA   . LEU A 1 96  ? -4.347  -4.484  0.037   1.00 0.00 ? 96  LEU A HA   1  
ATOM 1413  H HB2  . LEU A 1 96  ? -5.795  -3.695  -2.493  1.00 0.00 ? 96  LEU A HB2  1  
ATOM 1414  H HB3  . LEU A 1 96  ? -4.180  -3.186  -2.013  1.00 0.00 ? 96  LEU A HB3  1  
ATOM 1415  H HG   . LEU A 1 96  ? -5.038  -5.977  -2.780  1.00 0.00 ? 96  LEU A HG   1  
ATOM 1416  H HD11 . LEU A 1 96  ? -3.735  -5.697  -4.715  1.00 0.00 ? 96  LEU A HD11 1  
ATOM 1417  H HD12 . LEU A 1 96  ? -2.980  -4.228  -4.094  1.00 0.00 ? 96  LEU A HD12 1  
ATOM 1418  H HD13 . LEU A 1 96  ? -4.678  -4.213  -4.572  1.00 0.00 ? 96  LEU A HD13 1  
ATOM 1419  H HD21 . LEU A 1 96  ? -2.746  -6.646  -2.433  1.00 0.00 ? 96  LEU A HD21 1  
ATOM 1420  H HD22 . LEU A 1 96  ? -3.393  -5.976  -0.936  1.00 0.00 ? 96  LEU A HD22 1  
ATOM 1421  H HD23 . LEU A 1 96  ? -2.309  -5.011  -1.937  1.00 0.00 ? 96  LEU A HD23 1  
ATOM 1422  N N    . ILE A 1 97  ? -5.355  -2.574  1.240   1.00 0.00 ? 97  ILE A N    1  
ATOM 1423  C CA   . ILE A 1 97  ? -5.867  -1.391  1.921   1.00 0.00 ? 97  ILE A CA   1  
ATOM 1424  C C    . ILE A 1 97  ? -4.948  -0.193  1.702   1.00 0.00 ? 97  ILE A C    1  
ATOM 1425  O O    . ILE A 1 97  ? -4.210  0.210   2.602   1.00 0.00 ? 97  ILE A O    1  
ATOM 1426  C CB   . ILE A 1 97  ? -6.025  -1.636  3.434   1.00 0.00 ? 97  ILE A CB   1  
ATOM 1427  C CG1  . ILE A 1 97  ? -6.767  -2.950  3.686   1.00 0.00 ? 97  ILE A CG1  1  
ATOM 1428  C CG2  . ILE A 1 97  ? -6.760  -0.473  4.084   1.00 0.00 ? 97  ILE A CG2  1  
ATOM 1429  C CD1  . ILE A 1 97  ? -5.848  -4.140  3.858   1.00 0.00 ? 97  ILE A CD1  1  
ATOM 1430  H H    . ILE A 1 97  ? -4.604  -3.064  1.634   1.00 0.00 ? 97  ILE A H    1  
ATOM 1431  H HA   . ILE A 1 97  ? -6.840  -1.165  1.509   1.00 0.00 ? 97  ILE A HA   1  
ATOM 1432  H HB   . ILE A 1 97  ? -5.041  -1.697  3.871   1.00 0.00 ? 97  ILE A HB   1  
ATOM 1433  H HG12 . ILE A 1 97  ? -7.358  -2.856  4.584   1.00 0.00 ? 97  ILE A HG12 1  
ATOM 1434  H HG13 . ILE A 1 97  ? -7.421  -3.153  2.849   1.00 0.00 ? 97  ILE A HG13 1  
ATOM 1435  H HG21 . ILE A 1 97  ? -6.043  0.232   4.477   1.00 0.00 ? 97  ILE A HG21 1  
ATOM 1436  H HG22 . ILE A 1 97  ? -7.379  -0.843  4.888   1.00 0.00 ? 97  ILE A HG22 1  
ATOM 1437  H HG23 . ILE A 1 97  ? -7.381  0.017   3.349   1.00 0.00 ? 97  ILE A HG23 1  
ATOM 1438  H HD11 . ILE A 1 97  ? -6.238  -4.980  3.302   1.00 0.00 ? 97  ILE A HD11 1  
ATOM 1439  H HD12 . ILE A 1 97  ? -5.786  -4.398  4.905   1.00 0.00 ? 97  ILE A HD12 1  
ATOM 1440  H HD13 . ILE A 1 97  ? -4.864  -3.890  3.490   1.00 0.00 ? 97  ILE A HD13 1  
ATOM 1441  N N    . LEU A 1 98  ? -4.997  0.371   0.500   1.00 0.00 ? 98  LEU A N    1  
ATOM 1442  C CA   . LEU A 1 98  ? -4.168  1.523   0.163   1.00 0.00 ? 98  LEU A CA   1  
ATOM 1443  C C    . LEU A 1 98  ? -4.638  2.769   0.906   1.00 0.00 ? 98  LEU A C    1  
ATOM 1444  O O    . LEU A 1 98  ? -5.748  3.254   0.685   1.00 0.00 ? 98  LEU A O    1  
ATOM 1445  C CB   . LEU A 1 98  ? -4.198  1.774   -1.347  1.00 0.00 ? 98  LEU A CB   1  
ATOM 1446  C CG   . LEU A 1 98  ? -3.140  1.013   -2.150  1.00 0.00 ? 98  LEU A CG   1  
ATOM 1447  C CD1  . LEU A 1 98  ? -3.707  -0.301  -2.666  1.00 0.00 ? 98  LEU A CD1  1  
ATOM 1448  C CD2  . LEU A 1 98  ? -2.632  1.865   -3.304  1.00 0.00 ? 98  LEU A CD2  1  
ATOM 1449  H H    . LEU A 1 98  ? -5.604  0.005   -0.177  1.00 0.00 ? 98  LEU A H    1  
ATOM 1450  H HA   . LEU A 1 98  ? -3.155  1.301   0.461   1.00 0.00 ? 98  LEU A HA   1  
ATOM 1451  H HB2  . LEU A 1 98  ? -5.173  1.494   -1.718  1.00 0.00 ? 98  LEU A HB2  1  
ATOM 1452  H HB3  . LEU A 1 98  ? -4.055  2.831   -1.518  1.00 0.00 ? 98  LEU A HB3  1  
ATOM 1453  H HG   . LEU A 1 98  ? -2.304  0.786   -1.507  1.00 0.00 ? 98  LEU A HG   1  
ATOM 1454  H HD11 . LEU A 1 98  ? -3.481  -1.090  -1.965  1.00 0.00 ? 98  LEU A HD11 1  
ATOM 1455  H HD12 . LEU A 1 98  ? -3.265  -0.533  -3.624  1.00 0.00 ? 98  LEU A HD12 1  
ATOM 1456  H HD13 . LEU A 1 98  ? -4.777  -0.213  -2.775  1.00 0.00 ? 98  LEU A HD13 1  
ATOM 1457  H HD21 . LEU A 1 98  ? -2.194  2.772   -2.916  1.00 0.00 ? 98  LEU A HD21 1  
ATOM 1458  H HD22 . LEU A 1 98  ? -3.455  2.114   -3.958  1.00 0.00 ? 98  LEU A HD22 1  
ATOM 1459  H HD23 . LEU A 1 98  ? -1.887  1.313   -3.858  1.00 0.00 ? 98  LEU A HD23 1  
ATOM 1460  N N    . THR A 1 99  ? -3.786  3.282   1.788   1.00 0.00 ? 99  THR A N    1  
ATOM 1461  C CA   . THR A 1 99  ? -4.114  4.471   2.564   1.00 0.00 ? 99  THR A CA   1  
ATOM 1462  C C    . THR A 1 99  ? -3.404  5.700   2.003   1.00 0.00 ? 99  THR A C    1  
ATOM 1463  O O    . THR A 1 99  ? -2.290  6.026   2.413   1.00 0.00 ? 99  THR A O    1  
ATOM 1464  C CB   . THR A 1 99  ? -3.727  4.271   4.030   1.00 0.00 ? 99  THR A CB   1  
ATOM 1465  O OG1  . THR A 1 99  ? -4.168  3.008   4.498   1.00 0.00 ? 99  THR A OG1  1  
ATOM 1466  C CG2  . THR A 1 99  ? -4.302  5.327   4.950   1.00 0.00 ? 99  THR A CG2  1  
ATOM 1467  H H    . THR A 1 99  ? -2.916  2.850   1.919   1.00 0.00 ? 99  THR A H    1  
ATOM 1468  H HA   . THR A 1 99  ? -5.180  4.626   2.500   1.00 0.00 ? 99  THR A HA   1  
ATOM 1469  H HB   . THR A 1 99  ? -2.651  4.308   4.116   1.00 0.00 ? 99  THR A HB   1  
ATOM 1470  H HG1  . THR A 1 99  ? -3.408  2.464   4.713   1.00 0.00 ? 99  THR A HG1  1  
ATOM 1471  H HG21 . THR A 1 99  ? -5.171  5.772   4.489   1.00 0.00 ? 99  THR A HG21 1  
ATOM 1472  H HG22 . THR A 1 99  ? -3.559  6.090   5.130   1.00 0.00 ? 99  THR A HG22 1  
ATOM 1473  H HG23 . THR A 1 99  ? -4.585  4.872   5.888   1.00 0.00 ? 99  THR A HG23 1  
ATOM 1474  N N    . VAL A 1 100 ? -4.056  6.376   1.063   1.00 0.00 ? 100 VAL A N    1  
ATOM 1475  C CA   . VAL A 1 100 ? -3.488  7.568   0.445   1.00 0.00 ? 100 VAL A CA   1  
ATOM 1476  C C    . VAL A 1 100 ? -4.119  8.835   1.012   1.00 0.00 ? 100 VAL A C    1  
ATOM 1477  O O    . VAL A 1 100 ? -5.169  8.785   1.653   1.00 0.00 ? 100 VAL A O    1  
ATOM 1478  C CB   . VAL A 1 100 ? -3.675  7.553   -1.084  1.00 0.00 ? 100 VAL A CB   1  
ATOM 1479  C CG1  . VAL A 1 100 ? -2.917  6.387   -1.702  1.00 0.00 ? 100 VAL A CG1  1  
ATOM 1480  C CG2  . VAL A 1 100 ? -5.153  7.493   -1.445  1.00 0.00 ? 100 VAL A CG2  1  
ATOM 1481  H H    . VAL A 1 100 ? -4.942  6.066   0.778   1.00 0.00 ? 100 VAL A H    1  
ATOM 1482  H HA   . VAL A 1 100 ? -2.428  7.580   0.657   1.00 0.00 ? 100 VAL A HA   1  
ATOM 1483  H HB   . VAL A 1 100 ? -3.266  8.469   -1.485  1.00 0.00 ? 100 VAL A HB   1  
ATOM 1484  H HG11 . VAL A 1 100 ? -3.472  6.005   -2.547  1.00 0.00 ? 100 VAL A HG11 1  
ATOM 1485  H HG12 . VAL A 1 100 ? -2.797  5.606   -0.967  1.00 0.00 ? 100 VAL A HG12 1  
ATOM 1486  H HG13 . VAL A 1 100 ? -1.945  6.724   -2.032  1.00 0.00 ? 100 VAL A HG13 1  
ATOM 1487  H HG21 . VAL A 1 100 ? -5.735  7.309   -0.553  1.00 0.00 ? 100 VAL A HG21 1  
ATOM 1488  H HG22 . VAL A 1 100 ? -5.320  6.695   -2.153  1.00 0.00 ? 100 VAL A HG22 1  
ATOM 1489  H HG23 . VAL A 1 100 ? -5.455  8.431   -1.885  1.00 0.00 ? 100 VAL A HG23 1  
ATOM 1490  N N    . LYS A 1 101 ? -3.472  9.971   0.771   1.00 0.00 ? 101 LYS A N    1  
ATOM 1491  C CA   . LYS A 1 101 ? -3.970  11.252  1.258   1.00 0.00 ? 101 LYS A CA   1  
ATOM 1492  C C    . LYS A 1 101 ? -4.397  12.146  0.098   1.00 0.00 ? 101 LYS A C    1  
ATOM 1493  O O    . LYS A 1 101 ? -3.943  11.971  -1.033  1.00 0.00 ? 101 LYS A O    1  
ATOM 1494  C CB   . LYS A 1 101 ? -2.898  11.957  2.092   1.00 0.00 ? 101 LYS A CB   1  
ATOM 1495  C CG   . LYS A 1 101 ? -1.631  12.271  1.313   1.00 0.00 ? 101 LYS A CG   1  
ATOM 1496  C CD   . LYS A 1 101 ? -0.529  12.784  2.226   1.00 0.00 ? 101 LYS A CD   1  
ATOM 1497  C CE   . LYS A 1 101 ? 0.273   13.892  1.562   1.00 0.00 ? 101 LYS A CE   1  
ATOM 1498  N NZ   . LYS A 1 101 ? 1.531   14.186  2.302   1.00 0.00 ? 101 LYS A NZ   1  
ATOM 1499  H H    . LYS A 1 101 ? -2.640  9.947   0.254   1.00 0.00 ? 101 LYS A H    1  
ATOM 1500  H HA   . LYS A 1 101 ? -4.829  11.059  1.883   1.00 0.00 ? 101 LYS A HA   1  
ATOM 1501  H HB2  . LYS A 1 101 ? -3.303  12.885  2.468   1.00 0.00 ? 101 LYS A HB2  1  
ATOM 1502  H HB3  . LYS A 1 101 ? -2.634  11.324  2.926   1.00 0.00 ? 101 LYS A HB3  1  
ATOM 1503  H HG2  . LYS A 1 101 ? -1.289  11.372  0.822   1.00 0.00 ? 101 LYS A HG2  1  
ATOM 1504  H HG3  . LYS A 1 101 ? -1.853  13.025  0.572   1.00 0.00 ? 101 LYS A HG3  1  
ATOM 1505  H HD2  . LYS A 1 101 ? -0.974  13.169  3.131   1.00 0.00 ? 101 LYS A HD2  1  
ATOM 1506  H HD3  . LYS A 1 101 ? 0.134   11.966  2.468   1.00 0.00 ? 101 LYS A HD3  1  
ATOM 1507  H HE2  . LYS A 1 101 ? 0.522   13.585  0.556   1.00 0.00 ? 101 LYS A HE2  1  
ATOM 1508  H HE3  . LYS A 1 101 ? -0.332  14.786  1.526   1.00 0.00 ? 101 LYS A HE3  1  
ATOM 1509  H HZ1  . LYS A 1 101 ? 1.321   14.735  3.160   1.00 0.00 ? 101 LYS A HZ1  1  
ATOM 1510  H HZ2  . LYS A 1 101 ? 2.179   14.736  1.702   1.00 0.00 ? 101 LYS A HZ2  1  
ATOM 1511  H HZ3  . LYS A 1 101 ? 2.001   13.299  2.576   1.00 0.00 ? 101 LYS A HZ3  1  
ATOM 1512  N N    . ASP A 1 102 ? -5.272  13.104  0.387   1.00 0.00 ? 102 ASP A N    1  
ATOM 1513  C CA   . ASP A 1 102 ? -5.759  14.026  -0.633  1.00 0.00 ? 102 ASP A CA   1  
ATOM 1514  C C    . ASP A 1 102 ? -4.669  15.010  -1.044  1.00 0.00 ? 102 ASP A C    1  
ATOM 1515  O O    . ASP A 1 102 ? -4.526  16.077  -0.449  1.00 0.00 ? 102 ASP A O    1  
ATOM 1516  C CB   . ASP A 1 102 ? -6.983  14.787  -0.118  1.00 0.00 ? 102 ASP A CB   1  
ATOM 1517  C CG   . ASP A 1 102 ? -8.286  14.130  -0.528  1.00 0.00 ? 102 ASP A CG   1  
ATOM 1518  O OD1  . ASP A 1 102 ? -8.372  13.651  -1.678  1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1519  O OD2  . ASP A 1 102 ? -9.220  14.096  0.300   1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1520  H H    . ASP A 1 102 ? -5.596  13.193  1.307   1.00 0.00 ? 102 ASP A H    1  
ATOM 1521  H HA   . ASP A 1 102 ? -6.046  13.444  -1.496  1.00 0.00 ? 102 ASP A HA   1  
ATOM 1522  H HB2  . ASP A 1 102 ? -6.946  14.827  0.962   1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1523  H HB3  . ASP A 1 102 ? -6.967  15.794  -0.515  1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1524  N N    . VAL A 1 103 ? -3.901  14.641  -2.065  1.00 0.00 ? 103 VAL A N    1  
ATOM 1525  C CA   . VAL A 1 103 ? -2.823  15.490  -2.555  1.00 0.00 ? 103 VAL A CA   1  
ATOM 1526  C C    . VAL A 1 103 ? -3.282  16.330  -3.742  1.00 0.00 ? 103 VAL A C    1  
ATOM 1527  O O    . VAL A 1 103 ? -3.046  15.973  -4.896  1.00 0.00 ? 103 VAL A O    1  
ATOM 1528  C CB   . VAL A 1 103 ? -1.598  14.657  -2.974  1.00 0.00 ? 103 VAL A CB   1  
ATOM 1529  C CG1  . VAL A 1 103 ? -0.420  15.563  -3.298  1.00 0.00 ? 103 VAL A CG1  1  
ATOM 1530  C CG2  . VAL A 1 103 ? -1.230  13.662  -1.883  1.00 0.00 ? 103 VAL A CG2  1  
ATOM 1531  H H    . VAL A 1 103 ? -4.064  13.777  -2.498  1.00 0.00 ? 103 VAL A H    1  
ATOM 1532  H HA   . VAL A 1 103 ? -2.527  16.151  -1.752  1.00 0.00 ? 103 VAL A HA   1  
ATOM 1533  H HB   . VAL A 1 103 ? -1.852  14.103  -3.866  1.00 0.00 ? 103 VAL A HB   1  
ATOM 1534  H HG11 . VAL A 1 103 ? -0.536  15.962  -4.295  1.00 0.00 ? 103 VAL A HG11 1  
ATOM 1535  H HG12 . VAL A 1 103 ? 0.497   14.996  -3.240  1.00 0.00 ? 103 VAL A HG12 1  
ATOM 1536  H HG13 . VAL A 1 103 ? -0.385  16.376  -2.587  1.00 0.00 ? 103 VAL A HG13 1  
ATOM 1537  H HG21 . VAL A 1 103 ? -0.594  12.894  -2.295  1.00 0.00 ? 103 VAL A HG21 1  
ATOM 1538  H HG22 . VAL A 1 103 ? -2.129  13.212  -1.489  1.00 0.00 ? 103 VAL A HG22 1  
ATOM 1539  H HG23 . VAL A 1 103 ? -0.706  14.176  -1.089  1.00 0.00 ? 103 VAL A HG23 1  
ATOM 1540  N N    . GLY A 1 104 ? -3.938  17.449  -3.451  1.00 0.00 ? 104 GLY A N    1  
ATOM 1541  C CA   . GLY A 1 104 ? -4.419  18.323  -4.505  1.00 0.00 ? 104 GLY A CA   1  
ATOM 1542  C C    . GLY A 1 104 ? -5.900  18.624  -4.380  1.00 0.00 ? 104 GLY A C    1  
ATOM 1543  O O    . GLY A 1 104 ? -6.723  18.019  -5.067  1.00 0.00 ? 104 GLY A O    1  
ATOM 1544  H H    . GLY A 1 104 ? -4.096  17.683  -2.512  1.00 0.00 ? 104 GLY A H    1  
ATOM 1545  H HA2  . GLY A 1 104 ? -3.870  19.252  -4.466  1.00 0.00 ? 104 GLY A HA2  1  
ATOM 1546  H HA3  . GLY A 1 104 ? -4.238  17.851  -5.460  1.00 0.00 ? 104 GLY A HA3  1  
ATOM 1547  N N    . ARG A 1 105 ? -6.239  19.561  -3.500  1.00 0.00 ? 105 ARG A N    1  
ATOM 1548  C CA   . ARG A 1 105 ? -7.630  19.942  -3.288  1.00 0.00 ? 105 ARG A CA   1  
ATOM 1549  C C    . ARG A 1 105 ? -7.797  21.457  -3.366  1.00 0.00 ? 105 ARG A C    1  
ATOM 1550  O O    . ARG A 1 105 ? -8.567  21.966  -4.180  1.00 0.00 ? 105 ARG A O    1  
ATOM 1551  C CB   . ARG A 1 105 ? -8.120  19.430  -1.932  1.00 0.00 ? 105 ARG A CB   1  
ATOM 1552  C CG   . ARG A 1 105 ? -8.910  18.133  -2.020  1.00 0.00 ? 105 ARG A CG   1  
ATOM 1553  C CD   . ARG A 1 105 ? -10.313 18.374  -2.554  1.00 0.00 ? 105 ARG A CD   1  
ATOM 1554  N NE   . ARG A 1 105 ? -10.936 17.140  -3.028  1.00 0.00 ? 105 ARG A NE   1  
ATOM 1555  C CZ   . ARG A 1 105 ? -10.677 16.586  -4.211  1.00 0.00 ? 105 ARG A CZ   1  
ATOM 1556  N NH1  . ARG A 1 105 ? -9.809  17.150  -5.041  1.00 0.00 ? 105 ARG A NH1  1  
ATOM 1557  N NH2  . ARG A 1 105 ? -11.290 15.463  -4.564  1.00 0.00 ? 105 ARG A NH2  1  
ATOM 1558  H H    . ARG A 1 105 ? -5.537  20.008  -2.983  1.00 0.00 ? 105 ARG A H    1  
ATOM 1559  H HA   . ARG A 1 105 ? -8.221  19.487  -4.069  1.00 0.00 ? 105 ARG A HA   1  
ATOM 1560  H HB2  . ARG A 1 105 ? -7.264  19.261  -1.294  1.00 0.00 ? 105 ARG A HB2  1  
ATOM 1561  H HB3  . ARG A 1 105 ? -8.752  20.181  -1.481  1.00 0.00 ? 105 ARG A HB3  1  
ATOM 1562  H HG2  . ARG A 1 105 ? -8.395  17.455  -2.683  1.00 0.00 ? 105 ARG A HG2  1  
ATOM 1563  H HG3  . ARG A 1 105 ? -8.978  17.697  -1.034  1.00 0.00 ? 105 ARG A HG3  1  
ATOM 1564  H HD2  . ARG A 1 105 ? -10.919 18.790  -1.763  1.00 0.00 ? 105 ARG A HD2  1  
ATOM 1565  H HD3  . ARG A 1 105 ? -10.258 19.076  -3.372  1.00 0.00 ? 105 ARG A HD3  1  
ATOM 1566  H HE   . ARG A 1 105 ? -11.582 16.703  -2.435  1.00 0.00 ? 105 ARG A HE   1  
ATOM 1567  H HH11 . ARG A 1 105 ? -9.344  17.996  -4.780  1.00 0.00 ? 105 ARG A HH11 1  
ATOM 1568  H HH12 . ARG A 1 105 ? -9.619  16.728  -5.927  1.00 0.00 ? 105 ARG A HH12 1  
ATOM 1569  H HH21 . ARG A 1 105 ? -11.945 15.034  -3.943  1.00 0.00 ? 105 ARG A HH21 1  
ATOM 1570  H HH22 . ARG A 1 105 ? -11.096 15.047  -5.453  1.00 0.00 ? 105 ARG A HH22 1  
ATOM 1571  N N    . LEU A 1 106 ? -7.071  22.171  -2.512  1.00 0.00 ? 106 LEU A N    1  
ATOM 1572  C CA   . LEU A 1 106 ? -7.137  23.628  -2.486  1.00 0.00 ? 106 LEU A CA   1  
ATOM 1573  C C    . LEU A 1 106 ? -5.907  24.240  -3.153  1.00 0.00 ? 106 LEU A C    1  
ATOM 1574  O O    . LEU A 1 106 ? -4.797  23.724  -3.016  1.00 0.00 ? 106 LEU A O    1  
ATOM 1575  C CB   . LEU A 1 106 ? -7.256  24.127  -1.043  1.00 0.00 ? 106 LEU A CB   1  
ATOM 1576  C CG   . LEU A 1 106 ? -8.669  24.537  -0.613  1.00 0.00 ? 106 LEU A CG   1  
ATOM 1577  C CD1  . LEU A 1 106 ? -9.106  23.752  0.613   1.00 0.00 ? 106 LEU A CD1  1  
ATOM 1578  C CD2  . LEU A 1 106 ? -8.732  26.033  -0.342  1.00 0.00 ? 106 LEU A CD2  1  
ATOM 1579  H H    . LEU A 1 106 ? -6.475  21.709  -1.887  1.00 0.00 ? 106 LEU A H    1  
ATOM 1580  H HA   . LEU A 1 106 ? -8.017  23.928  -3.034  1.00 0.00 ? 106 LEU A HA   1  
ATOM 1581  H HB2  . LEU A 1 106 ? -6.914  23.340  -0.384  1.00 0.00 ? 106 LEU A HB2  1  
ATOM 1582  H HB3  . LEU A 1 106 ? -6.605  24.981  -0.923  1.00 0.00 ? 106 LEU A HB3  1  
ATOM 1583  H HG   . LEU A 1 106 ? -9.359  24.312  -1.414  1.00 0.00 ? 106 LEU A HG   1  
ATOM 1584  H HD11 . LEU A 1 106 ? -8.444  23.973  1.438   1.00 0.00 ? 106 LEU A HD11 1  
ATOM 1585  H HD12 . LEU A 1 106 ? -9.072  22.694  0.397   1.00 0.00 ? 106 LEU A HD12 1  
ATOM 1586  H HD13 . LEU A 1 106 ? -10.116 24.031  0.879   1.00 0.00 ? 106 LEU A HD13 1  
ATOM 1587  H HD21 . LEU A 1 106 ? -8.156  26.560  -1.087  1.00 0.00 ? 106 LEU A HD21 1  
ATOM 1588  H HD22 . LEU A 1 106 ? -8.325  26.238  0.638   1.00 0.00 ? 106 LEU A HD22 1  
ATOM 1589  H HD23 . LEU A 1 106 ? -9.760  26.362  -0.381  1.00 0.00 ? 106 LEU A HD23 1  
ATOM 1590  N N    . PRO A 1 107 ? -6.084  25.354  -3.886  1.00 0.00 ? 107 PRO A N    1  
ATOM 1591  C CA   . PRO A 1 107 ? -4.979  26.029  -4.572  1.00 0.00 ? 107 PRO A CA   1  
ATOM 1592  C C    . PRO A 1 107 ? -3.991  26.662  -3.598  1.00 0.00 ? 107 PRO A C    1  
ATOM 1593  O O    . PRO A 1 107 ? -2.784  26.435  -3.688  1.00 0.00 ? 107 PRO A O    1  
ATOM 1594  C CB   . PRO A 1 107 ? -5.675  27.108  -5.406  1.00 0.00 ? 107 PRO A CB   1  
ATOM 1595  C CG   . PRO A 1 107 ? -6.972  27.351  -4.716  1.00 0.00 ? 107 PRO A CG   1  
ATOM 1596  C CD   . PRO A 1 107 ? -7.372  26.038  -4.103  1.00 0.00 ? 107 PRO A CD   1  
ATOM 1597  H HA   . PRO A 1 107 ? -4.450  25.351  -5.226  1.00 0.00 ? 107 PRO A HA   1  
ATOM 1598  H HB2  . PRO A 1 107 ? -5.063  28.001  -5.425  1.00 0.00 ? 107 PRO A HB2  1  
ATOM 1599  H HB3  . PRO A 1 107 ? -5.828  26.745  -6.413  1.00 0.00 ? 107 PRO A HB3  1  
ATOM 1600  H HG2  . PRO A 1 107 ? -6.845  28.099  -3.947  1.00 0.00 ? 107 PRO A HG2  1  
ATOM 1601  H HG3  . PRO A 1 107 ? -7.715  27.671  -5.431  1.00 0.00 ? 107 PRO A HG3  1  
ATOM 1602  H HD2  . PRO A 1 107 ? -7.886  26.199  -3.165  1.00 0.00 ? 107 PRO A HD2  1  
ATOM 1603  H HD3  . PRO A 1 107 ? -7.996  25.477  -4.786  1.00 0.00 ? 107 PRO A HD3  1  
ATOM 1604  N N    . HIS A 1 108 ? -4.510  27.456  -2.666  1.00 0.00 ? 108 HIS A N    1  
ATOM 1605  C CA   . HIS A 1 108 ? -3.673  28.123  -1.673  1.00 0.00 ? 108 HIS A CA   1  
ATOM 1606  C C    . HIS A 1 108 ? -4.514  29.011  -0.763  1.00 0.00 ? 108 HIS A C    1  
ATOM 1607  O O    . HIS A 1 108 ? -5.050  30.031  -1.196  1.00 0.00 ? 108 HIS A O    1  
ATOM 1608  C CB   . HIS A 1 108 ? -2.591  28.958  -2.360  1.00 0.00 ? 108 HIS A CB   1  
ATOM 1609  C CG   . HIS A 1 108 ? -3.123  29.876  -3.417  1.00 0.00 ? 108 HIS A CG   1  
ATOM 1610  N ND1  . HIS A 1 108 ? -2.330  30.768  -4.108  1.00 0.00 ? 108 HIS A ND1  1  
ATOM 1611  C CD2  . HIS A 1 108 ? -4.378  30.037  -3.901  1.00 0.00 ? 108 HIS A CD2  1  
ATOM 1612  C CE1  . HIS A 1 108 ? -3.075  31.438  -4.970  1.00 0.00 ? 108 HIS A CE1  1  
ATOM 1613  N NE2  . HIS A 1 108 ? -4.320  31.014  -4.865  1.00 0.00 ? 108 HIS A NE2  1  
ATOM 1614  H H    . HIS A 1 108 ? -5.479  27.598  -2.645  1.00 0.00 ? 108 HIS A H    1  
ATOM 1615  H HA   . HIS A 1 108 ? -3.199  27.360  -1.074  1.00 0.00 ? 108 HIS A HA   1  
ATOM 1616  H HB2  . HIS A 1 108 ? -2.088  29.562  -1.620  1.00 0.00 ? 108 HIS A HB2  1  
ATOM 1617  H HB3  . HIS A 1 108 ? -1.874  28.297  -2.823  1.00 0.00 ? 108 HIS A HB3  1  
ATOM 1618  H HD1  . HIS A 1 108 ? -1.367  30.893  -3.985  1.00 0.00 ? 108 HIS A HD1  1  
ATOM 1619  H HD2  . HIS A 1 108 ? -5.260  29.497  -3.587  1.00 0.00 ? 108 HIS A HD2  1  
ATOM 1620  H HE1  . HIS A 1 108 ? -2.723  32.202  -5.647  1.00 0.00 ? 108 HIS A HE1  1  
ATOM 1621  H HE2  . HIS A 1 108 ? -5.059  31.280  -5.450  1.00 0.00 ? 108 HIS A HE2  1  
ATOM 1622  N N    . ALA A 1 109 ? -4.626  28.617  0.502   1.00 0.00 ? 109 ALA A N    1  
ATOM 1623  C CA   . ALA A 1 109 ? -5.403  29.378  1.473   1.00 0.00 ? 109 ALA A CA   1  
ATOM 1624  C C    . ALA A 1 109 ? -4.626  29.566  2.771   1.00 0.00 ? 109 ALA A C    1  
ATOM 1625  O O    . ALA A 1 109 ? -3.499  29.091  2.907   1.00 0.00 ? 109 ALA A O    1  
ATOM 1626  C CB   . ALA A 1 109 ? -6.730  28.687  1.745   1.00 0.00 ? 109 ALA A CB   1  
ATOM 1627  H H    . ALA A 1 109 ? -4.176  27.795  0.789   1.00 0.00 ? 109 ALA A H    1  
ATOM 1628  H HA   . ALA A 1 109 ? -5.609  30.349  1.046   1.00 0.00 ? 109 ALA A HA   1  
ATOM 1629  H HB1  . ALA A 1 109 ? -7.162  28.358  0.811   1.00 0.00 ? 109 ALA A HB1  1  
ATOM 1630  H HB2  . ALA A 1 109 ? -7.404  29.380  2.228   1.00 0.00 ? 109 ALA A HB2  1  
ATOM 1631  H HB3  . ALA A 1 109 ? -6.568  27.836  2.387   1.00 0.00 ? 109 ALA A HB3  1  
ATOM 1632  N N    . ARG A 1 110 ? -5.238  30.261  3.725   1.00 0.00 ? 110 ARG A N    1  
ATOM 1633  C CA   . ARG A 1 110 ? -4.605  30.512  5.015   1.00 0.00 ? 110 ARG A CA   1  
ATOM 1634  C C    . ARG A 1 110 ? -5.652  30.756  6.096   1.00 0.00 ? 110 ARG A C    1  
ATOM 1635  O O    . ARG A 1 110 ? -5.573  30.197  7.189   1.00 0.00 ? 110 ARG A O    1  
ATOM 1636  C CB   . ARG A 1 110 ? -3.660  31.713  4.917   1.00 0.00 ? 110 ARG A CB   1  
ATOM 1637  C CG   . ARG A 1 110 ? -2.225  31.392  5.306   1.00 0.00 ? 110 ARG A CG   1  
ATOM 1638  C CD   . ARG A 1 110 ? -1.814  32.107  6.585   1.00 0.00 ? 110 ARG A CD   1  
ATOM 1639  N NE   . ARG A 1 110 ? -1.725  31.192  7.719   1.00 0.00 ? 110 ARG A NE   1  
ATOM 1640  C CZ   . ARG A 1 110 ? -1.062  31.463  8.841   1.00 0.00 ? 110 ARG A CZ   1  
ATOM 1641  N NH1  . ARG A 1 110 ? -0.432  32.623  8.984   1.00 0.00 ? 110 ARG A NH1  1  
ATOM 1642  N NH2  . ARG A 1 110 ? -1.030  30.574  9.824   1.00 0.00 ? 110 ARG A NH2  1  
ATOM 1643  H H    . ARG A 1 110 ? -6.136  30.614  3.557   1.00 0.00 ? 110 ARG A H    1  
ATOM 1644  H HA   . ARG A 1 110 ? -4.031  29.636  5.277   1.00 0.00 ? 110 ARG A HA   1  
ATOM 1645  H HB2  . ARG A 1 110 ? -3.662  32.074  3.898   1.00 0.00 ? 110 ARG A HB2  1  
ATOM 1646  H HB3  . ARG A 1 110 ? -4.022  32.497  5.566   1.00 0.00 ? 110 ARG A HB3  1  
ATOM 1647  H HG2  . ARG A 1 110 ? -2.134  30.327  5.457   1.00 0.00 ? 110 ARG A HG2  1  
ATOM 1648  H HG3  . ARG A 1 110 ? -1.569  31.700  4.505   1.00 0.00 ? 110 ARG A HG3  1  
ATOM 1649  H HD2  . ARG A 1 110 ? -0.849  32.567  6.429   1.00 0.00 ? 110 ARG A HD2  1  
ATOM 1650  H HD3  . ARG A 1 110 ? -2.544  32.871  6.807   1.00 0.00 ? 110 ARG A HD3  1  
ATOM 1651  H HE   . ARG A 1 110 ? -2.181  30.327  7.640   1.00 0.00 ? 110 ARG A HE   1  
ATOM 1652  H HH11 . ARG A 1 110 ? -0.453  33.298  8.246   1.00 0.00 ? 110 ARG A HH11 1  
ATOM 1653  H HH12 . ARG A 1 110 ? 0.062   32.822  9.829   1.00 0.00 ? 110 ARG A HH12 1  
ATOM 1654  H HH21 . ARG A 1 110 ? -1.503  29.699  9.722   1.00 0.00 ? 110 ARG A HH21 1  
ATOM 1655  H HH22 . ARG A 1 110 ? -0.533  30.778  10.667  1.00 0.00 ? 110 ARG A HH22 1  
ATOM 1656  N N    . THR A 1 111 ? -6.635  31.594  5.782   1.00 0.00 ? 111 THR A N    1  
ATOM 1657  C CA   . THR A 1 111 ? -7.700  31.913  6.726   1.00 0.00 ? 111 THR A CA   1  
ATOM 1658  C C    . THR A 1 111 ? -9.071  31.753  6.075   1.00 0.00 ? 111 THR A C    1  
ATOM 1659  O O    . THR A 1 111 ? -9.728  32.736  5.740   1.00 0.00 ? 111 THR A O    1  
ATOM 1660  C CB   . THR A 1 111 ? -7.534  33.339  7.251   1.00 0.00 ? 111 THR A CB   1  
ATOM 1661  O OG1  . THR A 1 111 ? -7.532  34.270  6.184   1.00 0.00 ? 111 THR A OG1  1  
ATOM 1662  C CG2  . THR A 1 111 ? -6.258  33.543  8.041   1.00 0.00 ? 111 THR A CG2  1  
ATOM 1663  H H    . THR A 1 111 ? -6.645  32.009  4.894   1.00 0.00 ? 111 THR A H    1  
ATOM 1664  H HA   . THR A 1 111 ? -7.625  31.224  7.554   1.00 0.00 ? 111 THR A HA   1  
ATOM 1665  H HB   . THR A 1 111 ? -8.365  33.572  7.902   1.00 0.00 ? 111 THR A HB   1  
ATOM 1666  H HG1  . THR A 1 111 ? -7.660  35.156  6.530   1.00 0.00 ? 111 THR A HG1  1  
ATOM 1667  H HG21 . THR A 1 111 ? -5.847  34.515  7.815   1.00 0.00 ? 111 THR A HG21 1  
ATOM 1668  H HG22 . THR A 1 111 ? -5.545  32.778  7.772   1.00 0.00 ? 111 THR A HG22 1  
ATOM 1669  H HG23 . THR A 1 111 ? -6.475  33.479  9.096   1.00 0.00 ? 111 THR A HG23 1  
ATOM 1670  N N    . THR A 1 112 ? -9.494  30.505  5.900   1.00 0.00 ? 112 THR A N    1  
ATOM 1671  C CA   . THR A 1 112 ? -10.786 30.215  5.289   1.00 0.00 ? 112 THR A CA   1  
ATOM 1672  C C    . THR A 1 112 ? -11.711 29.510  6.277   1.00 0.00 ? 112 THR A C    1  
ATOM 1673  O O    . THR A 1 112 ? -12.587 28.743  5.881   1.00 0.00 ? 112 THR A O    1  
ATOM 1674  C CB   . THR A 1 112 ? -10.600 29.350  4.041   1.00 0.00 ? 112 THR A CB   1  
ATOM 1675  O OG1  . THR A 1 112 ? -9.486  29.791  3.286   1.00 0.00 ? 112 THR A OG1  1  
ATOM 1676  C CG2  . THR A 1 112 ? -11.805 29.354  3.126   1.00 0.00 ? 112 THR A CG2  1  
ATOM 1677  H H    . THR A 1 112 ? -8.924  29.762  6.187   1.00 0.00 ? 112 THR A H    1  
ATOM 1678  H HA   . THR A 1 112 ? -11.235 31.154  5.002   1.00 0.00 ? 112 THR A HA   1  
ATOM 1679  H HB   . THR A 1 112 ? -10.420 28.330  4.347   1.00 0.00 ? 112 THR A HB   1  
ATOM 1680  H HG1  . THR A 1 112 ? -8.680  29.640  3.786   1.00 0.00 ? 112 THR A HG1  1  
ATOM 1681  H HG21 . THR A 1 112 ? -12.705 29.446  3.716   1.00 0.00 ? 112 THR A HG21 1  
ATOM 1682  H HG22 . THR A 1 112 ? -11.834 28.431  2.564   1.00 0.00 ? 112 THR A HG22 1  
ATOM 1683  H HG23 . THR A 1 112 ? -11.736 30.188  2.444   1.00 0.00 ? 112 THR A HG23 1  
ATOM 1684  N N    . VAL A 1 113 ? -11.509 29.776  7.564   1.00 0.00 ? 113 VAL A N    1  
ATOM 1685  C CA   . VAL A 1 113 ? -12.326 29.168  8.608   1.00 0.00 ? 113 VAL A CA   1  
ATOM 1686  C C    . VAL A 1 113 ? -12.231 29.960  9.908   1.00 0.00 ? 113 VAL A C    1  
ATOM 1687  O O    . VAL A 1 113 ? -11.193 29.964  10.568  1.00 0.00 ? 113 VAL A O    1  
ATOM 1688  C CB   . VAL A 1 113 ? -11.905 27.711  8.877   1.00 0.00 ? 113 VAL A CB   1  
ATOM 1689  C CG1  . VAL A 1 113 ? -12.438 26.790  7.791   1.00 0.00 ? 113 VAL A CG1  1  
ATOM 1690  C CG2  . VAL A 1 113 ? -10.391 27.601  8.983   1.00 0.00 ? 113 VAL A CG2  1  
ATOM 1691  H H    . VAL A 1 113 ? -10.796 30.398  7.818   1.00 0.00 ? 113 VAL A H    1  
ATOM 1692  H HA   . VAL A 1 113 ? -13.353 29.170  8.271   1.00 0.00 ? 113 VAL A HA   1  
ATOM 1693  H HB   . VAL A 1 113 ? -12.333 27.403  9.820   1.00 0.00 ? 113 VAL A HB   1  
ATOM 1694  H HG11 . VAL A 1 113 ? -11.730 26.744  6.978   1.00 0.00 ? 113 VAL A HG11 1  
ATOM 1695  H HG12 . VAL A 1 113 ? -13.382 27.171  7.427   1.00 0.00 ? 113 VAL A HG12 1  
ATOM 1696  H HG13 . VAL A 1 113 ? -12.584 25.799  8.198   1.00 0.00 ? 113 VAL A HG13 1  
ATOM 1697  H HG21 . VAL A 1 113 ? -10.115 26.568  9.136   1.00 0.00 ? 113 VAL A HG21 1  
ATOM 1698  H HG22 . VAL A 1 113 ? -10.045 28.194  9.817   1.00 0.00 ? 113 VAL A HG22 1  
ATOM 1699  H HG23 . VAL A 1 113 ? -9.939  27.963  8.073   1.00 0.00 ? 113 VAL A HG23 1  
ATOM 1700  N N    . ASP A 1 114 ? -13.322 30.628  10.270  1.00 0.00 ? 114 ASP A N    1  
ATOM 1701  C CA   . ASP A 1 114 ? -13.359 31.422  11.492  1.00 0.00 ? 114 ASP A CA   1  
ATOM 1702  C C    . ASP A 1 114 ? -14.747 32.014  11.716  1.00 0.00 ? 114 ASP A C    1  
ATOM 1703  O O    . ASP A 1 114 ? -15.094 33.045  11.139  1.00 0.00 ? 114 ASP A O    1  
ATOM 1704  C CB   . ASP A 1 114 ? -12.316 32.540  11.431  1.00 0.00 ? 114 ASP A CB   1  
ATOM 1705  C CG   . ASP A 1 114 ? -11.466 32.608  12.685  1.00 0.00 ? 114 ASP A CG   1  
ATOM 1706  O OD1  . ASP A 1 114 ? -11.965 33.113  13.714  1.00 0.00 ? 114 ASP A OD1  1  
ATOM 1707  O OD2  . ASP A 1 114 ? -10.304 32.156  12.639  1.00 0.00 ? 114 ASP A OD2  1  
ATOM 1708  H H    . ASP A 1 114 ? -14.119 30.585  9.702   1.00 0.00 ? 114 ASP A H    1  
ATOM 1709  H HA   . ASP A 1 114 ? -13.123 30.768  12.319  1.00 0.00 ? 114 ASP A HA   1  
ATOM 1710  H HB2  . ASP A 1 114 ? -11.664 32.370  10.587  1.00 0.00 ? 114 ASP A HB2  1  
ATOM 1711  H HB3  . ASP A 1 114 ? -12.819 33.489  11.307  1.00 0.00 ? 114 ASP A HB3  1  
ATOM 1712  N N    . GLU A 1 115 ? -15.537 31.356  12.558  1.00 0.00 ? 115 GLU A N    1  
ATOM 1713  C CA   . GLU A 1 115 ? -16.887 31.817  12.859  1.00 0.00 ? 115 GLU A CA   1  
ATOM 1714  C C    . GLU A 1 115 ? -16.850 33.101  13.683  1.00 0.00 ? 115 GLU A C    1  
ATOM 1715  O O    . GLU A 1 115 ? -17.614 34.033  13.433  1.00 0.00 ? 115 GLU A O    1  
ATOM 1716  C CB   . GLU A 1 115 ? -17.660 30.735  13.615  1.00 0.00 ? 115 GLU A CB   1  
ATOM 1717  C CG   . GLU A 1 115 ? -17.006 30.322  14.923  1.00 0.00 ? 115 GLU A CG   1  
ATOM 1718  C CD   . GLU A 1 115 ? -17.788 29.248  15.654  1.00 0.00 ? 115 GLU A CD   1  
ATOM 1719  O OE1  . GLU A 1 115 ? -17.783 28.090  15.187  1.00 0.00 ? 115 GLU A OE1  1  
ATOM 1720  O OE2  . GLU A 1 115 ? -18.404 29.566  16.692  1.00 0.00 ? 115 GLU A OE2  1  
ATOM 1721  H H    . GLU A 1 115 ? -15.203 30.540  12.987  1.00 0.00 ? 115 GLU A H    1  
ATOM 1722  H HA   . GLU A 1 115 ? -17.387 32.017  11.923  1.00 0.00 ? 115 GLU A HA   1  
ATOM 1723  H HB2  . GLU A 1 115 ? -18.651 31.104  13.835  1.00 0.00 ? 115 GLU A HB2  1  
ATOM 1724  H HB3  . GLU A 1 115 ? -17.742 29.861  12.987  1.00 0.00 ? 115 GLU A HB3  1  
ATOM 1725  H HG2  . GLU A 1 115 ? -16.015 29.944  14.712  1.00 0.00 ? 115 GLU A HG2  1  
ATOM 1726  H HG3  . GLU A 1 115 ? -16.928 31.189  15.563  1.00 0.00 ? 115 GLU A HG3  1  
ATOM 1727  N N    . THR A 1 116 ? -15.956 33.140  14.666  1.00 0.00 ? 116 THR A N    1  
ATOM 1728  C CA   . THR A 1 116 ? -15.818 34.308  15.528  1.00 0.00 ? 116 THR A CA   1  
ATOM 1729  C C    . THR A 1 116 ? -15.018 35.407  14.834  1.00 0.00 ? 116 THR A C    1  
ATOM 1730  O O    . THR A 1 116 ? -15.206 36.592  15.109  1.00 0.00 ? 116 THR A O    1  
ATOM 1731  C CB   . THR A 1 116 ? -15.140 33.920  16.843  1.00 0.00 ? 116 THR A CB   1  
ATOM 1732  O OG1  . THR A 1 116 ? -13.822 33.457  16.609  1.00 0.00 ? 116 THR A OG1  1  
ATOM 1733  C CG2  . THR A 1 116 ? -15.880 32.839  17.601  1.00 0.00 ? 116 THR A CG2  1  
ATOM 1734  H H    . THR A 1 116 ? -15.376 32.365  14.815  1.00 0.00 ? 116 THR A H    1  
ATOM 1735  H HA   . THR A 1 116 ? -16.808 34.681  15.741  1.00 0.00 ? 116 THR A HA   1  
ATOM 1736  H HB   . THR A 1 116 ? -15.085 34.792  17.479  1.00 0.00 ? 116 THR A HB   1  
ATOM 1737  H HG1  . THR A 1 116 ? -13.855 32.617  16.145  1.00 0.00 ? 116 THR A HG1  1  
ATOM 1738  H HG21 . THR A 1 116 ? -15.689 31.881  17.140  1.00 0.00 ? 116 THR A HG21 1  
ATOM 1739  H HG22 . THR A 1 116 ? -16.940 33.044  17.578  1.00 0.00 ? 116 THR A HG22 1  
ATOM 1740  H HG23 . THR A 1 116 ? -15.538 32.820  18.625  1.00 0.00 ? 116 THR A HG23 1  
ATOM 1741  N N    . LYS A 1 117 ? -14.123 35.006  13.936  1.00 0.00 ? 117 LYS A N    1  
ATOM 1742  C CA   . LYS A 1 117 ? -13.294 35.958  13.205  1.00 0.00 ? 117 LYS A CA   1  
ATOM 1743  C C    . LYS A 1 117 ? -12.380 36.725  14.155  1.00 0.00 ? 117 LYS A C    1  
ATOM 1744  O O    . LYS A 1 117 ? -12.577 37.915  14.399  1.00 0.00 ? 117 LYS A O    1  
ATOM 1745  C CB   . LYS A 1 117 ? -14.172 36.935  12.420  1.00 0.00 ? 117 LYS A CB   1  
ATOM 1746  C CG   . LYS A 1 117 ? -13.505 37.481  11.167  1.00 0.00 ? 117 LYS A CG   1  
ATOM 1747  C CD   . LYS A 1 117 ? -14.523 38.080  10.210  1.00 0.00 ? 117 LYS A CD   1  
ATOM 1748  C CE   . LYS A 1 117 ? -13.861 38.988  9.185   1.00 0.00 ? 117 LYS A CE   1  
ATOM 1749  N NZ   . LYS A 1 117 ? -14.298 38.670  7.798   1.00 0.00 ? 117 LYS A NZ   1  
ATOM 1750  H H    . LYS A 1 117 ? -14.018 34.048  13.760  1.00 0.00 ? 117 LYS A H    1  
ATOM 1751  H HA   . LYS A 1 117 ? -12.684 35.399  12.511  1.00 0.00 ? 117 LYS A HA   1  
ATOM 1752  H HB2  . LYS A 1 117 ? -15.080 36.429  12.126  1.00 0.00 ? 117 LYS A HB2  1  
ATOM 1753  H HB3  . LYS A 1 117 ? -14.424 37.768  13.060  1.00 0.00 ? 117 LYS A HB3  1  
ATOM 1754  H HG2  . LYS A 1 117 ? -12.800 38.247  11.452  1.00 0.00 ? 117 LYS A HG2  1  
ATOM 1755  H HG3  . LYS A 1 117 ? -12.985 36.676  10.668  1.00 0.00 ? 117 LYS A HG3  1  
ATOM 1756  H HD2  . LYS A 1 117 ? -15.030 37.280  9.692   1.00 0.00 ? 117 LYS A HD2  1  
ATOM 1757  H HD3  . LYS A 1 117 ? -15.240 38.656  10.777  1.00 0.00 ? 117 LYS A HD3  1  
ATOM 1758  H HE2  . LYS A 1 117 ? -14.121 40.011  9.409   1.00 0.00 ? 117 LYS A HE2  1  
ATOM 1759  H HE3  . LYS A 1 117 ? -12.789 38.867  9.253   1.00 0.00 ? 117 LYS A HE3  1  
ATOM 1760  H HZ1  . LYS A 1 117 ? -15.225 38.198  7.814   1.00 0.00 ? 117 LYS A HZ1  1  
ATOM 1761  H HZ2  . LYS A 1 117 ? -13.608 38.040  7.341   1.00 0.00 ? 117 LYS A HZ2  1  
ATOM 1762  H HZ3  . LYS A 1 117 ? -14.375 39.543  7.238   1.00 0.00 ? 117 LYS A HZ3  1  
ATOM 1763  N N    . TRP A 1 118 ? -11.378 36.034  14.689  1.00 0.00 ? 118 TRP A N    1  
ATOM 1764  C CA   . TRP A 1 118 ? -10.431 36.649  15.614  1.00 0.00 ? 118 TRP A CA   1  
ATOM 1765  C C    . TRP A 1 118 ? -11.148 37.201  16.841  1.00 0.00 ? 118 TRP A C    1  
ATOM 1766  O O    . TRP A 1 118 ? -11.835 38.220  16.765  1.00 0.00 ? 118 TRP A O    1  
ATOM 1767  C CB   . TRP A 1 118 ? -9.657  37.768  14.914  1.00 0.00 ? 118 TRP A CB   1  
ATOM 1768  C CG   . TRP A 1 118 ? -8.721  37.272  13.855  1.00 0.00 ? 118 TRP A CG   1  
ATOM 1769  C CD1  . TRP A 1 118 ? -9.060  36.745  12.643  1.00 0.00 ? 118 TRP A CD1  1  
ATOM 1770  C CD2  . TRP A 1 118 ? -7.290  37.256  13.914  1.00 0.00 ? 118 TRP A CD2  1  
ATOM 1771  N NE1  . TRP A 1 118 ? -7.928  36.402  11.944  1.00 0.00 ? 118 TRP A NE1  1  
ATOM 1772  C CE2  . TRP A 1 118 ? -6.829  36.706  12.703  1.00 0.00 ? 118 TRP A CE2  1  
ATOM 1773  C CE3  . TRP A 1 118 ? -6.354  37.653  14.873  1.00 0.00 ? 118 TRP A CE3  1  
ATOM 1774  C CZ2  . TRP A 1 118 ? -5.474  36.545  12.426  1.00 0.00 ? 118 TRP A CZ2  1  
ATOM 1775  C CZ3  . TRP A 1 118 ? -5.009  37.492  14.597  1.00 0.00 ? 118 TRP A CZ3  1  
ATOM 1776  C CH2  . TRP A 1 118 ? -4.579  36.943  13.383  1.00 0.00 ? 118 TRP A CH2  1  
ATOM 1777  H H    . TRP A 1 118 ? -11.272 35.088  14.457  1.00 0.00 ? 118 TRP A H    1  
ATOM 1778  H HA   . TRP A 1 118 ? -9.735  35.887  15.931  1.00 0.00 ? 118 TRP A HA   1  
ATOM 1779  H HB2  . TRP A 1 118 ? -10.357 38.444  14.449  1.00 0.00 ? 118 TRP A HB2  1  
ATOM 1780  H HB3  . TRP A 1 118 ? -9.076  38.307  15.649  1.00 0.00 ? 118 TRP A HB3  1  
ATOM 1781  H HD1  . TRP A 1 118 ? -10.076 36.621  12.296  1.00 0.00 ? 118 TRP A HD1  1  
ATOM 1782  H HE1  . TRP A 1 118 ? -7.911  36.006  11.047  1.00 0.00 ? 118 TRP A HE1  1  
ATOM 1783  H HE3  . TRP A 1 118 ? -6.665  38.080  15.815  1.00 0.00 ? 118 TRP A HE3  1  
ATOM 1784  H HZ2  . TRP A 1 118 ? -5.126  36.123  11.494  1.00 0.00 ? 118 TRP A HZ2  1  
ATOM 1785  H HZ3  . TRP A 1 118 ? -4.271  37.794  15.326  1.00 0.00 ? 118 TRP A HZ3  1  
ATOM 1786  H HH2  . TRP A 1 118 ? -3.518  36.835  13.210  1.00 0.00 ? 118 TRP A HH2  1  
ATOM 1787  N N    . ILE A 1 119 ? -10.985 36.523  17.972  1.00 0.00 ? 119 ILE A N    1  
ATOM 1788  C CA   . ILE A 1 119 ? -11.617 36.947  19.215  1.00 0.00 ? 119 ILE A CA   1  
ATOM 1789  C C    . ILE A 1 119 ? -10.854 38.101  19.853  1.00 0.00 ? 119 ILE A C    1  
ATOM 1790  O O    . ILE A 1 119 ? -9.802  38.510  19.362  1.00 0.00 ? 119 ILE A O    1  
ATOM 1791  C CB   . ILE A 1 119 ? -11.709 35.786  20.224  1.00 0.00 ? 119 ILE A CB   1  
ATOM 1792  C CG1  . ILE A 1 119 ? -10.336 35.138  20.416  1.00 0.00 ? 119 ILE A CG1  1  
ATOM 1793  C CG2  . ILE A 1 119 ? -12.726 34.756  19.758  1.00 0.00 ? 119 ILE A CG2  1  
ATOM 1794  C CD1  . ILE A 1 119 ? -10.254 34.247  21.636  1.00 0.00 ? 119 ILE A CD1  1  
ATOM 1795  H H    . ILE A 1 119 ? -10.426 35.718  17.970  1.00 0.00 ? 119 ILE A H    1  
ATOM 1796  H HA   . ILE A 1 119 ? -12.620 37.275  18.984  1.00 0.00 ? 119 ILE A HA   1  
ATOM 1797  H HB   . ILE A 1 119 ? -12.045 36.186  21.169  1.00 0.00 ? 119 ILE A HB   1  
ATOM 1798  H HG12 . ILE A 1 119 ? -10.106 34.535  19.550  1.00 0.00 ? 119 ILE A HG12 1  
ATOM 1799  H HG13 . ILE A 1 119 ? -9.590  35.912  20.519  1.00 0.00 ? 119 ILE A HG13 1  
ATOM 1800  H HG21 . ILE A 1 119 ? -12.576 34.551  18.707  1.00 0.00 ? 119 ILE A HG21 1  
ATOM 1801  H HG22 . ILE A 1 119 ? -13.724 35.142  19.909  1.00 0.00 ? 119 ILE A HG22 1  
ATOM 1802  H HG23 . ILE A 1 119 ? -12.603 33.845  20.324  1.00 0.00 ? 119 ILE A HG23 1  
ATOM 1803  H HD11 . ILE A 1 119 ? -10.404 33.218  21.341  1.00 0.00 ? 119 ILE A HD11 1  
ATOM 1804  H HD12 . ILE A 1 119 ? -11.018 34.534  22.343  1.00 0.00 ? 119 ILE A HD12 1  
ATOM 1805  H HD13 . ILE A 1 119 ? -9.282  34.352  22.094  1.00 0.00 ? 119 ILE A HD13 1  
ATOM 1806  N N    . ALA A 1 120 ? -11.389 38.623  20.952  1.00 0.00 ? 120 ALA A N    1  
ATOM 1807  C CA   . ALA A 1 120 ? -10.758 39.732  21.657  1.00 0.00 ? 120 ALA A CA   1  
ATOM 1808  C C    . ALA A 1 120 ? -10.786 39.510  23.165  1.00 0.00 ? 120 ALA A C    1  
ATOM 1809  O O    . ALA A 1 120 ? -11.851 39.334  23.757  1.00 0.00 ? 120 ALA A O    1  
ATOM 1810  C CB   . ALA A 1 120 ? -11.443 41.043  21.302  1.00 0.00 ? 120 ALA A CB   1  
ATOM 1811  H H    . ALA A 1 120 ? -12.230 38.255  21.296  1.00 0.00 ? 120 ALA A H    1  
ATOM 1812  H HA   . ALA A 1 120 ? -9.729  39.791  21.332  1.00 0.00 ? 120 ALA A HA   1  
ATOM 1813  H HB1  . ALA A 1 120 ? -11.461 41.160  20.228  1.00 0.00 ? 120 ALA A HB1  1  
ATOM 1814  H HB2  . ALA A 1 120 ? -10.901 41.864  21.746  1.00 0.00 ? 120 ALA A HB2  1  
ATOM 1815  H HB3  . ALA A 1 120 ? -12.454 41.034  21.680  1.00 0.00 ? 120 ALA A HB3  1  
ATOM 1816  N N    . SER A 1 121 ? -9.609  39.519  23.782  1.00 0.00 ? 121 SER A N    1  
ATOM 1817  C CA   . SER A 1 121 ? -9.497  39.320  25.222  1.00 0.00 ? 121 SER A CA   1  
ATOM 1818  C C    . SER A 1 121 ? -8.976  40.579  25.907  1.00 0.00 ? 121 SER A C    1  
ATOM 1819  O O    . SER A 1 121 ? -8.571  41.534  25.246  1.00 0.00 ? 121 SER A O    1  
ATOM 1820  C CB   . SER A 1 121 ? -8.571  38.140  25.525  1.00 0.00 ? 121 SER A CB   1  
ATOM 1821  O OG   . SER A 1 121 ? -9.160  36.914  25.125  1.00 0.00 ? 121 SER A OG   1  
ATOM 1822  H H    . SER A 1 121 ? -8.795  39.665  23.256  1.00 0.00 ? 121 SER A H    1  
ATOM 1823  H HA   . SER A 1 121 ? -10.483 39.100  25.604  1.00 0.00 ? 121 SER A HA   1  
ATOM 1824  H HB2  . SER A 1 121 ? -7.642  38.269  24.991  1.00 0.00 ? 121 SER A HB2  1  
ATOM 1825  H HB3  . SER A 1 121 ? -8.375  38.102  26.586  1.00 0.00 ? 121 SER A HB3  1  
ATOM 1826  H HG   . SER A 1 121 ? -8.805  36.651  24.272  1.00 0.00 ? 121 SER A HG   1  
ATOM 1827  N N    . SER A 1 122 ? -8.989  40.572  27.236  1.00 0.00 ? 122 SER A N    1  
ATOM 1828  C CA   . SER A 1 122 ? -8.517  41.713  28.012  1.00 0.00 ? 122 SER A CA   1  
ATOM 1829  C C    . SER A 1 122 ? -9.336  42.961  27.694  1.00 0.00 ? 122 SER A C    1  
ATOM 1830  O O    . SER A 1 122 ? -9.005  43.716  26.780  1.00 0.00 ? 122 SER A O    1  
ATOM 1831  C CB   . SER A 1 122 ? -7.035  41.971  27.727  1.00 0.00 ? 122 SER A CB   1  
ATOM 1832  O OG   . SER A 1 122 ? -6.236  41.647  28.852  1.00 0.00 ? 122 SER A OG   1  
ATOM 1833  H H    . SER A 1 122 ? -9.323  39.779  27.707  1.00 0.00 ? 122 SER A H    1  
ATOM 1834  H HA   . SER A 1 122 ? -8.636  41.475  29.058  1.00 0.00 ? 122 SER A HA   1  
ATOM 1835  H HB2  . SER A 1 122 ? -6.719  41.364  26.892  1.00 0.00 ? 122 SER A HB2  1  
ATOM 1836  H HB3  . SER A 1 122 ? -6.890  43.015  27.488  1.00 0.00 ? 122 SER A HB3  1  
ATOM 1837  H HG   . SER A 1 122 ? -6.494  40.786  29.191  1.00 0.00 ? 122 SER A HG   1  
ATOM 1838  N N    . SER A 1 123 ? -10.403 43.171  28.457  1.00 0.00 ? 123 SER A N    1  
ATOM 1839  C CA   . SER A 1 123 ? -11.268 44.327  28.257  1.00 0.00 ? 123 SER A CA   1  
ATOM 1840  C C    . SER A 1 123 ? -11.734 44.896  29.594  1.00 0.00 ? 123 SER A C    1  
ATOM 1841  O O    . SER A 1 123 ? -11.554 44.274  30.641  1.00 0.00 ? 123 SER A O    1  
ATOM 1842  C CB   . SER A 1 123 ? -12.480 43.944  27.405  1.00 0.00 ? 123 SER A CB   1  
ATOM 1843  O OG   . SER A 1 123 ? -12.094 43.142  26.301  1.00 0.00 ? 123 SER A OG   1  
ATOM 1844  H H    . SER A 1 123 ? -10.614 42.533  29.170  1.00 0.00 ? 123 SER A H    1  
ATOM 1845  H HA   . SER A 1 123 ? -10.699 45.082  27.737  1.00 0.00 ? 123 SER A HA   1  
ATOM 1846  H HB2  . SER A 1 123 ? -13.181 43.387  28.009  1.00 0.00 ? 123 SER A HB2  1  
ATOM 1847  H HB3  . SER A 1 123 ? -12.956 44.839  27.035  1.00 0.00 ? 123 SER A HB3  1  
ATOM 1848  H HG   . SER A 1 123 ? -12.800 43.130  25.652  1.00 0.00 ? 123 SER A HG   1  
ATOM 1849  N N    . GLY A 1 124 ? -12.332 46.082  29.551  1.00 0.00 ? 124 GLY A N    1  
ATOM 1850  C CA   . GLY A 1 124 ? -12.813 46.714  30.765  1.00 0.00 ? 124 GLY A CA   1  
ATOM 1851  C C    . GLY A 1 124 ? -13.838 47.798  30.489  1.00 0.00 ? 124 GLY A C    1  
ATOM 1852  O O    . GLY A 1 124 ? -15.021 47.624  30.783  1.00 0.00 ? 124 GLY A O    1  
ATOM 1853  H H    . GLY A 1 124 ? -12.447 46.531  28.688  1.00 0.00 ? 124 GLY A H    1  
ATOM 1854  H HA2  . GLY A 1 124 ? -13.262 45.962  31.396  1.00 0.00 ? 124 GLY A HA2  1  
ATOM 1855  H HA3  . GLY A 1 124 ? -11.975 47.153  31.286  1.00 0.00 ? 124 GLY A HA3  1  
ATOM 1856  N N    . PRO A 1 125 ? -13.412 48.938  29.917  1.00 0.00 ? 125 PRO A N    1  
ATOM 1857  C CA   . PRO A 1 125 ? -14.315 50.050  29.604  1.00 0.00 ? 125 PRO A CA   1  
ATOM 1858  C C    . PRO A 1 125 ? -15.524 49.603  28.791  1.00 0.00 ? 125 PRO A C    1  
ATOM 1859  O O    . PRO A 1 125 ? -15.413 48.751  27.910  1.00 0.00 ? 125 PRO A O    1  
ATOM 1860  C CB   . PRO A 1 125 ? -13.441 51.000  28.784  1.00 0.00 ? 125 PRO A CB   1  
ATOM 1861  C CG   . PRO A 1 125 ? -12.047 50.700  29.216  1.00 0.00 ? 125 PRO A CG   1  
ATOM 1862  C CD   . PRO A 1 125 ? -12.019 49.230  29.532  1.00 0.00 ? 125 PRO A CD   1  
ATOM 1863  H HA   . PRO A 1 125 ? -14.651 50.549  30.502  1.00 0.00 ? 125 PRO A HA   1  
ATOM 1864  H HB2  . PRO A 1 125 ? -13.581 50.803  27.731  1.00 0.00 ? 125 PRO A HB2  1  
ATOM 1865  H HB3  . PRO A 1 125 ? -13.709 52.022  29.003  1.00 0.00 ? 125 PRO A HB3  1  
ATOM 1866  H HG2  . PRO A 1 125 ? -11.358 50.924  28.413  1.00 0.00 ? 125 PRO A HG2  1  
ATOM 1867  H HG3  . PRO A 1 125 ? -11.802 51.277  30.095  1.00 0.00 ? 125 PRO A HG3  1  
ATOM 1868  H HD2  . PRO A 1 125 ? -11.732 48.661  28.659  1.00 0.00 ? 125 PRO A HD2  1  
ATOM 1869  H HD3  . PRO A 1 125 ? -11.344 49.033  30.352  1.00 0.00 ? 125 PRO A HD3  1  
ATOM 1870  N N    . SER A 1 126 ? -16.681 50.184  29.092  1.00 0.00 ? 126 SER A N    1  
ATOM 1871  C CA   . SER A 1 126 ? -17.913 49.846  28.388  1.00 0.00 ? 126 SER A CA   1  
ATOM 1872  C C    . SER A 1 126 ? -18.904 51.004  28.438  1.00 0.00 ? 126 SER A C    1  
ATOM 1873  O O    . SER A 1 126 ? -20.117 50.797  28.451  1.00 0.00 ? 126 SER A O    1  
ATOM 1874  C CB   . SER A 1 126 ? -18.545 48.592  28.997  1.00 0.00 ? 126 SER A CB   1  
ATOM 1875  O OG   . SER A 1 126 ? -17.979 47.416  28.446  1.00 0.00 ? 126 SER A OG   1  
ATOM 1876  H H    . SER A 1 126 ? -16.707 50.857  29.804  1.00 0.00 ? 126 SER A H    1  
ATOM 1877  H HA   . SER A 1 126 ? -17.662 49.647  27.358  1.00 0.00 ? 126 SER A HA   1  
ATOM 1878  H HB2  . SER A 1 126 ? -18.379 48.590  30.064  1.00 0.00 ? 126 SER A HB2  1  
ATOM 1879  H HB3  . SER A 1 126 ? -19.607 48.594  28.797  1.00 0.00 ? 126 SER A HB3  1  
ATOM 1880  H HG   . SER A 1 126 ? -17.028 47.427  28.574  1.00 0.00 ? 126 SER A HG   1  
ATOM 1881  N N    . SER A 1 127 ? -18.378 52.225  28.465  1.00 0.00 ? 127 SER A N    1  
ATOM 1882  C CA   . SER A 1 127 ? -19.216 53.417  28.513  1.00 0.00 ? 127 SER A CA   1  
ATOM 1883  C C    . SER A 1 127 ? -19.166 54.171  27.189  1.00 0.00 ? 127 SER A C    1  
ATOM 1884  O O    . SER A 1 127 ? -20.202 54.517  26.620  1.00 0.00 ? 127 SER A O    1  
ATOM 1885  C CB   . SER A 1 127 ? -18.769 54.334  29.653  1.00 0.00 ? 127 SER A CB   1  
ATOM 1886  O OG   . SER A 1 127 ? -19.483 54.053  30.844  1.00 0.00 ? 127 SER A OG   1  
ATOM 1887  H H    . SER A 1 127 ? -17.403 52.326  28.453  1.00 0.00 ? 127 SER A H    1  
ATOM 1888  H HA   . SER A 1 127 ? -20.232 53.101  28.696  1.00 0.00 ? 127 SER A HA   1  
ATOM 1889  H HB2  . SER A 1 127 ? -17.715 54.188  29.837  1.00 0.00 ? 127 SER A HB2  1  
ATOM 1890  H HB3  . SER A 1 127 ? -18.947 55.363  29.375  1.00 0.00 ? 127 SER A HB3  1  
ATOM 1891  H HG   . SER A 1 127 ? -19.521 54.843  31.389  1.00 0.00 ? 127 SER A HG   1  
ATOM 1892  N N    . GLY A 1 128 ? -17.955 54.424  26.703  1.00 0.00 ? 128 GLY A N    1  
ATOM 1893  C CA   . GLY A 1 128 ? -17.792 55.135  25.449  1.00 0.00 ? 128 GLY A CA   1  
ATOM 1894  C C    . GLY A 1 128 ? -16.336 55.354  25.090  1.00 0.00 ? 128 GLY A C    1  
ATOM 1895  O O    . GLY A 1 128 ? -15.970 56.503  24.766  1.00 0.00 ? 128 GLY A O    1  
ATOM 1896  O OXT  . GLY A 1 128 ? -15.561 54.375  25.135  1.00 0.00 ? 128 GLY A OXT  1  
ATOM 1897  H H    . GLY A 1 128 ? -17.166 54.124  27.200  1.00 0.00 ? 128 GLY A H    1  
ATOM 1898  H HA2  . GLY A 1 128 ? -18.265 54.568  24.661  1.00 0.00 ? 128 GLY A HA2  1  
ATOM 1899  H HA3  . GLY A 1 128 ? -18.280 56.096  25.527  1.00 0.00 ? 128 GLY A HA3  1  
ATOM 1900  N N    . GLY A 1 1   ? 17.500  17.725  -1.023  1.00 0.00 ? 1   GLY A N    2  
ATOM 1901  C CA   . GLY A 1 1   ? 18.460  18.618  -1.729  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1902  C C    . GLY A 1 1   ? 19.470  19.244  -0.788  1.00 0.00 ? 1   GLY A C    2  
ATOM 1903  O O    . GLY A 1 1   ? 20.421  18.589  -0.362  1.00 0.00 ? 1   GLY A O    2  
ATOM 1904  H H1   . GLY A 1 1   ? 18.015  17.054  -0.417  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1905  H H2   . GLY A 1 1   ? 16.936  17.189  -1.712  1.00 0.00 ? 1   GLY A H2   2  
ATOM 1906  H H3   . GLY A 1 1   ? 16.858  18.289  -0.429  1.00 0.00 ? 1   GLY A H3   2  
ATOM 1907  H HA2  . GLY A 1 1   ? 18.988  18.042  -2.474  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1908  H HA3  . GLY A 1 1   ? 17.907  19.405  -2.222  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1909  N N    . SER A 1 2   ? 19.263  20.516  -0.463  1.00 0.00 ? 2   SER A N    2  
ATOM 1910  C CA   . SER A 1 2   ? 20.162  21.232  0.435   1.00 0.00 ? 2   SER A CA   2  
ATOM 1911  C C    . SER A 1 2   ? 19.593  21.285  1.848   1.00 0.00 ? 2   SER A C    2  
ATOM 1912  O O    . SER A 1 2   ? 19.022  22.294  2.261   1.00 0.00 ? 2   SER A O    2  
ATOM 1913  C CB   . SER A 1 2   ? 20.408  22.651  -0.083  1.00 0.00 ? 2   SER A CB   2  
ATOM 1914  O OG   . SER A 1 2   ? 20.992  23.465  0.920   1.00 0.00 ? 2   SER A OG   2  
ATOM 1915  H H    . SER A 1 2   ? 18.486  20.984  -0.835  1.00 0.00 ? 2   SER A H    2  
ATOM 1916  H HA   . SER A 1 2   ? 21.101  20.699  0.456   1.00 0.00 ? 2   SER A HA   2  
ATOM 1917  H HB2  . SER A 1 2   ? 21.076  22.612  -0.930  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1918  H HB3  . SER A 1 2   ? 19.468  23.090  -0.384  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1919  H HG   . SER A 1 2   ? 20.310  23.997  1.338   1.00 0.00 ? 2   SER A HG   2  
ATOM 1920  N N    . SER A 1 3   ? 19.753  20.191  2.585   1.00 0.00 ? 3   SER A N    2  
ATOM 1921  C CA   . SER A 1 3   ? 19.255  20.112  3.953   1.00 0.00 ? 3   SER A CA   2  
ATOM 1922  C C    . SER A 1 3   ? 20.377  20.364  4.957   1.00 0.00 ? 3   SER A C    2  
ATOM 1923  O O    . SER A 1 3   ? 20.928  19.428  5.534   1.00 0.00 ? 3   SER A O    2  
ATOM 1924  C CB   . SER A 1 3   ? 18.624  18.743  4.211   1.00 0.00 ? 3   SER A CB   2  
ATOM 1925  O OG   . SER A 1 3   ? 17.319  18.672  3.661   1.00 0.00 ? 3   SER A OG   2  
ATOM 1926  H H    . SER A 1 3   ? 20.217  19.418  2.200   1.00 0.00 ? 3   SER A H    2  
ATOM 1927  H HA   . SER A 1 3   ? 18.501  20.875  4.077   1.00 0.00 ? 3   SER A HA   2  
ATOM 1928  H HB2  . SER A 1 3   ? 19.233  17.976  3.757   1.00 0.00 ? 3   SER A HB2  2  
ATOM 1929  H HB3  . SER A 1 3   ? 18.563  18.571  5.276   1.00 0.00 ? 3   SER A HB3  2  
ATOM 1930  H HG   . SER A 1 3   ? 16.874  17.888  3.993   1.00 0.00 ? 3   SER A HG   2  
ATOM 1931  N N    . GLY A 1 4   ? 20.708  21.635  5.158   1.00 0.00 ? 4   GLY A N    2  
ATOM 1932  C CA   . GLY A 1 4   ? 21.763  21.987  6.090   1.00 0.00 ? 4   GLY A CA   2  
ATOM 1933  C C    . GLY A 1 4   ? 21.551  23.351  6.717   1.00 0.00 ? 4   GLY A C    2  
ATOM 1934  O O    . GLY A 1 4   ? 22.215  24.319  6.350   1.00 0.00 ? 4   GLY A O    2  
ATOM 1935  H H    . GLY A 1 4   ? 20.234  22.339  4.669   1.00 0.00 ? 4   GLY A H    2  
ATOM 1936  H HA2  . GLY A 1 4   ? 21.797  21.244  6.874   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1937  H HA3  . GLY A 1 4   ? 22.707  21.986  5.567   1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1938  N N    . SER A 1 5   ? 20.623  23.426  7.665   1.00 0.00 ? 5   SER A N    2  
ATOM 1939  C CA   . SER A 1 5   ? 20.324  24.683  8.344   1.00 0.00 ? 5   SER A CA   2  
ATOM 1940  C C    . SER A 1 5   ? 20.857  24.667  9.773   1.00 0.00 ? 5   SER A C    2  
ATOM 1941  O O    . SER A 1 5   ? 20.650  23.706  10.514  1.00 0.00 ? 5   SER A O    2  
ATOM 1942  C CB   . SER A 1 5   ? 18.816  24.936  8.354   1.00 0.00 ? 5   SER A CB   2  
ATOM 1943  O OG   . SER A 1 5   ? 18.529  26.313  8.182   1.00 0.00 ? 5   SER A OG   2  
ATOM 1944  H H    . SER A 1 5   ? 20.125  22.619  7.914   1.00 0.00 ? 5   SER A H    2  
ATOM 1945  H HA   . SER A 1 5   ? 20.811  25.477  7.800   1.00 0.00 ? 5   SER A HA   2  
ATOM 1946  H HB2  . SER A 1 5   ? 18.355  24.382  7.548   1.00 0.00 ? 5   SER A HB2  2  
ATOM 1947  H HB3  . SER A 1 5   ? 18.404  24.610  9.297   1.00 0.00 ? 5   SER A HB3  2  
ATOM 1948  H HG   . SER A 1 5   ? 19.057  26.830  8.795   1.00 0.00 ? 5   SER A HG   2  
ATOM 1949  N N    . SER A 1 6   ? 21.545  25.739  10.154  1.00 0.00 ? 6   SER A N    2  
ATOM 1950  C CA   . SER A 1 6   ? 22.108  25.850  11.495  1.00 0.00 ? 6   SER A CA   2  
ATOM 1951  C C    . SER A 1 6   ? 21.336  26.870  12.325  1.00 0.00 ? 6   SER A C    2  
ATOM 1952  O O    . SER A 1 6   ? 21.902  27.533  13.196  1.00 0.00 ? 6   SER A O    2  
ATOM 1953  C CB   . SER A 1 6   ? 23.583  26.247  11.420  1.00 0.00 ? 6   SER A CB   2  
ATOM 1954  O OG   . SER A 1 6   ? 24.197  26.171  12.695  1.00 0.00 ? 6   SER A OG   2  
ATOM 1955  H H    . SER A 1 6   ? 21.677  26.474  9.518   1.00 0.00 ? 6   SER A H    2  
ATOM 1956  H HA   . SER A 1 6   ? 22.028  24.884  11.968  1.00 0.00 ? 6   SER A HA   2  
ATOM 1957  H HB2  . SER A 1 6   ? 24.099  25.581  10.746  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1958  H HB3  . SER A 1 6   ? 23.662  27.261  11.056  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1959  H HG   . SER A 1 6   ? 23.997  25.322  13.096  1.00 0.00 ? 6   SER A HG   2  
ATOM 1960  N N    . GLY A 1 7   ? 20.042  26.992  12.051  1.00 0.00 ? 7   GLY A N    2  
ATOM 1961  C CA   . GLY A 1 7   ? 19.214  27.934  12.782  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1962  C C    . GLY A 1 7   ? 17.762  27.503  12.845  1.00 0.00 ? 7   GLY A C    2  
ATOM 1963  O O    . GLY A 1 7   ? 16.919  28.031  12.118  1.00 0.00 ? 7   GLY A O    2  
ATOM 1964  H H    . GLY A 1 7   ? 19.645  26.439  11.347  1.00 0.00 ? 7   GLY A H    2  
ATOM 1965  H HA2  . GLY A 1 7   ? 19.595  28.025  13.788  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1966  H HA3  . GLY A 1 7   ? 19.272  28.898  12.298  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1967  N N    . ASP A 1 8   ? 17.468  26.544  13.716  1.00 0.00 ? 8   ASP A N    2  
ATOM 1968  C CA   . ASP A 1 8   ? 16.107  26.043  13.872  1.00 0.00 ? 8   ASP A CA   2  
ATOM 1969  C C    . ASP A 1 8   ? 15.632  26.200  15.312  1.00 0.00 ? 8   ASP A C    2  
ATOM 1970  O O    . ASP A 1 8   ? 15.640  25.244  16.088  1.00 0.00 ? 8   ASP A O    2  
ATOM 1971  C CB   . ASP A 1 8   ? 16.032  24.573  13.455  1.00 0.00 ? 8   ASP A CB   2  
ATOM 1972  C CG   . ASP A 1 8   ? 15.959  24.403  11.950  1.00 0.00 ? 8   ASP A CG   2  
ATOM 1973  O OD1  . ASP A 1 8   ? 16.678  25.132  11.234  1.00 0.00 ? 8   ASP A OD1  2  
ATOM 1974  O OD2  . ASP A 1 8   ? 15.183  23.539  11.487  1.00 0.00 ? 8   ASP A OD2  2  
ATOM 1975  H H    . ASP A 1 8   ? 18.184  26.164  14.268  1.00 0.00 ? 8   ASP A H    2  
ATOM 1976  H HA   . ASP A 1 8   ? 15.464  26.625  13.228  1.00 0.00 ? 8   ASP A HA   2  
ATOM 1977  H HB2  . ASP A 1 8   ? 16.909  24.058  13.814  1.00 0.00 ? 8   ASP A HB2  2  
ATOM 1978  H HB3  . ASP A 1 8   ? 15.151  24.126  13.892  1.00 0.00 ? 8   ASP A HB3  2  
ATOM 1979  N N    . ARG A 1 9   ? 15.218  27.413  15.664  1.00 0.00 ? 9   ARG A N    2  
ATOM 1980  C CA   . ARG A 1 9   ? 14.739  27.696  17.012  1.00 0.00 ? 9   ARG A CA   2  
ATOM 1981  C C    . ARG A 1 9   ? 13.220  27.844  17.029  1.00 0.00 ? 9   ARG A C    2  
ATOM 1982  O O    . ARG A 1 9   ? 12.551  27.363  17.943  1.00 0.00 ? 9   ARG A O    2  
ATOM 1983  C CB   . ARG A 1 9   ? 15.397  28.970  17.550  1.00 0.00 ? 9   ARG A CB   2  
ATOM 1984  C CG   . ARG A 1 9   ? 16.176  28.754  18.838  1.00 0.00 ? 9   ARG A CG   2  
ATOM 1985  C CD   . ARG A 1 9   ? 17.311  29.755  18.976  1.00 0.00 ? 9   ARG A CD   2  
ATOM 1986  N NE   . ARG A 1 9   ? 16.950  30.878  19.837  1.00 0.00 ? 9   ARG A NE   2  
ATOM 1987  C CZ   . ARG A 1 9   ? 17.598  32.041  19.851  1.00 0.00 ? 9   ARG A CZ   2  
ATOM 1988  N NH1  . ARG A 1 9   ? 18.640  32.237  19.052  1.00 0.00 ? 9   ARG A NH1  2  
ATOM 1989  N NH2  . ARG A 1 9   ? 17.203  33.010  20.665  1.00 0.00 ? 9   ARG A NH2  2  
ATOM 1990  H H    . ARG A 1 9   ? 15.236  28.135  15.001  1.00 0.00 ? 9   ARG A H    2  
ATOM 1991  H HA   . ARG A 1 9   ? 15.015  26.865  17.643  1.00 0.00 ? 9   ARG A HA   2  
ATOM 1992  H HB2  . ARG A 1 9   ? 16.077  29.353  16.804  1.00 0.00 ? 9   ARG A HB2  2  
ATOM 1993  H HB3  . ARG A 1 9   ? 14.631  29.708  17.739  1.00 0.00 ? 9   ARG A HB3  2  
ATOM 1994  H HG2  . ARG A 1 9   ? 15.505  28.867  19.677  1.00 0.00 ? 9   ARG A HG2  2  
ATOM 1995  H HG3  . ARG A 1 9   ? 16.587  27.755  18.835  1.00 0.00 ? 9   ARG A HG3  2  
ATOM 1996  H HD2  . ARG A 1 9   ? 18.169  29.252  19.399  1.00 0.00 ? 9   ARG A HD2  2  
ATOM 1997  H HD3  . ARG A 1 9   ? 17.563  30.132  17.996  1.00 0.00 ? 9   ARG A HD3  2  
ATOM 1998  H HE   . ARG A 1 9   ? 16.184  30.761  20.436  1.00 0.00 ? 9   ARG A HE   2  
ATOM 1999  H HH11 . ARG A 1 9   ? 18.943  31.511  18.436  1.00 0.00 ? 9   ARG A HH11 2  
ATOM 2000  H HH12 . ARG A 1 9   ? 19.123  33.112  19.067  1.00 0.00 ? 9   ARG A HH12 2  
ATOM 2001  H HH21 . ARG A 1 9   ? 16.418  32.869  21.268  1.00 0.00 ? 9   ARG A HH21 2  
ATOM 2002  H HH22 . ARG A 1 9   ? 17.690  33.884  20.675  1.00 0.00 ? 9   ARG A HH22 2  
ATOM 2003  N N    . ARG A 1 10  ? 12.685  28.512  16.013  1.00 0.00 ? 10  ARG A N    2  
ATOM 2004  C CA   . ARG A 1 10  ? 11.246  28.723  15.910  1.00 0.00 ? 10  ARG A CA   2  
ATOM 2005  C C    . ARG A 1 10  ? 10.802  28.742  14.451  1.00 0.00 ? 10  ARG A C    2  
ATOM 2006  O O    . ARG A 1 10  ? 10.655  29.805  13.850  1.00 0.00 ? 10  ARG A O    2  
ATOM 2007  C CB   . ARG A 1 10  ? 10.853  30.036  16.591  1.00 0.00 ? 10  ARG A CB   2  
ATOM 2008  C CG   . ARG A 1 10  ? 9.352   30.255  16.671  1.00 0.00 ? 10  ARG A CG   2  
ATOM 2009  C CD   . ARG A 1 10  ? 8.995   31.285  17.731  1.00 0.00 ? 10  ARG A CD   2  
ATOM 2010  N NE   . ARG A 1 10  ? 7.774   30.929  18.452  1.00 0.00 ? 10  ARG A NE   2  
ATOM 2011  C CZ   . ARG A 1 10  ? 7.218   31.692  19.389  1.00 0.00 ? 10  ARG A CZ   2  
ATOM 2012  N NH1  . ARG A 1 10  ? 7.768   32.853  19.724  1.00 0.00 ? 10  ARG A NH1  2  
ATOM 2013  N NH2  . ARG A 1 10  ? 6.107   31.293  19.995  1.00 0.00 ? 10  ARG A NH2  2  
ATOM 2014  H H    . ARG A 1 10  ? 13.272  28.872  15.314  1.00 0.00 ? 10  ARG A H    2  
ATOM 2015  H HA   . ARG A 1 10  ? 10.754  27.905  16.414  1.00 0.00 ? 10  ARG A HA   2  
ATOM 2016  H HB2  . ARG A 1 10  ? 11.250  30.039  17.596  1.00 0.00 ? 10  ARG A HB2  2  
ATOM 2017  H HB3  . ARG A 1 10  ? 11.286  30.858  16.040  1.00 0.00 ? 10  ARG A HB3  2  
ATOM 2018  H HG2  . ARG A 1 10  ? 8.997   30.603  15.713  1.00 0.00 ? 10  ARG A HG2  2  
ATOM 2019  H HG3  . ARG A 1 10  ? 8.873   29.318  16.917  1.00 0.00 ? 10  ARG A HG3  2  
ATOM 2020  H HD2  . ARG A 1 10  ? 9.809   31.355  18.436  1.00 0.00 ? 10  ARG A HD2  2  
ATOM 2021  H HD3  . ARG A 1 10  ? 8.852   32.242  17.251  1.00 0.00 ? 10  ARG A HD3  2  
ATOM 2022  H HE   . ARG A 1 10  ? 7.347   30.077  18.224  1.00 0.00 ? 10  ARG A HE   2  
ATOM 2023  H HH11 . ARG A 1 10  ? 8.605   33.159  19.271  1.00 0.00 ? 10  ARG A HH11 2  
ATOM 2024  H HH12 . ARG A 1 10  ? 7.345   33.420  20.429  1.00 0.00 ? 10  ARG A HH12 2  
ATOM 2025  H HH21 . ARG A 1 10  ? 5.689   30.420  19.746  1.00 0.00 ? 10  ARG A HH21 2  
ATOM 2026  H HH22 . ARG A 1 10  ? 5.689   31.866  20.700  1.00 0.00 ? 10  ARG A HH22 2  
ATOM 2027  N N    . SER A 1 11  ? 10.590  27.557  13.887  1.00 0.00 ? 11  SER A N    2  
ATOM 2028  C CA   . SER A 1 11  ? 10.164  27.437  12.498  1.00 0.00 ? 11  SER A CA   2  
ATOM 2029  C C    . SER A 1 11  ? 8.878   26.621  12.391  1.00 0.00 ? 11  SER A C    2  
ATOM 2030  O O    . SER A 1 11  ? 7.831   27.143  12.012  1.00 0.00 ? 11  SER A O    2  
ATOM 2031  C CB   . SER A 1 11  ? 11.266  26.786  11.659  1.00 0.00 ? 11  SER A CB   2  
ATOM 2032  O OG   . SER A 1 11  ? 11.218  27.238  10.316  1.00 0.00 ? 11  SER A OG   2  
ATOM 2033  H H    . SER A 1 11  ? 10.725  26.744  14.418  1.00 0.00 ? 11  SER A H    2  
ATOM 2034  H HA   . SER A 1 11  ? 9.976   28.431  12.121  1.00 0.00 ? 11  SER A HA   2  
ATOM 2035  H HB2  . SER A 1 11  ? 12.229  27.039  12.076  1.00 0.00 ? 11  SER A HB2  2  
ATOM 2036  H HB3  . SER A 1 11  ? 11.138  25.714  11.670  1.00 0.00 ? 11  SER A HB3  2  
ATOM 2037  H HG   . SER A 1 11  ? 10.351  27.055  9.947   1.00 0.00 ? 11  SER A HG   2  
ATOM 2038  N N    . THR A 1 12  ? 8.968   25.338  12.726  1.00 0.00 ? 12  THR A N    2  
ATOM 2039  C CA   . THR A 1 12  ? 7.812   24.450  12.667  1.00 0.00 ? 12  THR A CA   2  
ATOM 2040  C C    . THR A 1 12  ? 7.968   23.287  13.640  1.00 0.00 ? 12  THR A C    2  
ATOM 2041  O O    . THR A 1 12  ? 8.468   22.222  13.275  1.00 0.00 ? 12  THR A O    2  
ATOM 2042  C CB   . THR A 1 12  ? 7.623   23.920  11.245  1.00 0.00 ? 12  THR A CB   2  
ATOM 2043  O OG1  . THR A 1 12  ? 8.865   23.852  10.566  1.00 0.00 ? 12  THR A OG1  2  
ATOM 2044  C CG2  . THR A 1 12  ? 6.689   24.768  10.409  1.00 0.00 ? 12  THR A CG2  2  
ATOM 2045  H H    . THR A 1 12  ? 9.831   24.980  13.020  1.00 0.00 ? 12  THR A H    2  
ATOM 2046  H HA   . THR A 1 12  ? 6.940   25.024  12.946  1.00 0.00 ? 12  THR A HA   2  
ATOM 2047  H HB   . THR A 1 12  ? 7.209   22.923  11.295  1.00 0.00 ? 12  THR A HB   2  
ATOM 2048  H HG1  . THR A 1 12  ? 9.196   24.740  10.414  1.00 0.00 ? 12  THR A HG1  2  
ATOM 2049  H HG21 . THR A 1 12  ? 7.139   24.957  9.445   1.00 0.00 ? 12  THR A HG21 2  
ATOM 2050  H HG22 . THR A 1 12  ? 6.507   25.706  10.911  1.00 0.00 ? 12  THR A HG22 2  
ATOM 2051  H HG23 . THR A 1 12  ? 5.754   24.245  10.272  1.00 0.00 ? 12  THR A HG23 2  
ATOM 2052  N N    . LEU A 1 13  ? 7.536   23.496  14.880  1.00 0.00 ? 13  LEU A N    2  
ATOM 2053  C CA   . LEU A 1 13  ? 7.627   22.464  15.905  1.00 0.00 ? 13  LEU A CA   2  
ATOM 2054  C C    . LEU A 1 13  ? 6.285   22.272  16.605  1.00 0.00 ? 13  LEU A C    2  
ATOM 2055  O O    . LEU A 1 13  ? 6.234   21.939  17.790  1.00 0.00 ? 13  LEU A O    2  
ATOM 2056  C CB   . LEU A 1 13  ? 8.703   22.826  16.930  1.00 0.00 ? 13  LEU A CB   2  
ATOM 2057  C CG   . LEU A 1 13  ? 10.125  22.914  16.374  1.00 0.00 ? 13  LEU A CG   2  
ATOM 2058  C CD1  . LEU A 1 13  ? 10.464  24.349  15.999  1.00 0.00 ? 13  LEU A CD1  2  
ATOM 2059  C CD2  . LEU A 1 13  ? 11.128  22.375  17.384  1.00 0.00 ? 13  LEU A CD2  2  
ATOM 2060  H H    . LEU A 1 13  ? 7.146   24.365  15.110  1.00 0.00 ? 13  LEU A H    2  
ATOM 2061  H HA   . LEU A 1 13  ? 7.901   21.538  15.421  1.00 0.00 ? 13  LEU A HA   2  
ATOM 2062  H HB2  . LEU A 1 13  ? 8.448   23.782  17.365  1.00 0.00 ? 13  LEU A HB2  2  
ATOM 2063  H HB3  . LEU A 1 13  ? 8.692   22.081  17.712  1.00 0.00 ? 13  LEU A HB3  2  
ATOM 2064  H HG   . LEU A 1 13  ? 10.192  22.311  15.479  1.00 0.00 ? 13  LEU A HG   2  
ATOM 2065  H HD11 . LEU A 1 13  ? 11.017  24.810  16.804  1.00 0.00 ? 13  LEU A HD11 2  
ATOM 2066  H HD12 . LEU A 1 13  ? 9.551   24.900  15.827  1.00 0.00 ? 13  LEU A HD12 2  
ATOM 2067  H HD13 . LEU A 1 13  ? 11.064  24.354  15.101  1.00 0.00 ? 13  LEU A HD13 2  
ATOM 2068  H HD21 . LEU A 1 13  ? 10.729  22.485  18.381  1.00 0.00 ? 13  LEU A HD21 2  
ATOM 2069  H HD22 . LEU A 1 13  ? 12.053  22.926  17.303  1.00 0.00 ? 13  LEU A HD22 2  
ATOM 2070  H HD23 . LEU A 1 13  ? 11.313  21.329  17.183  1.00 0.00 ? 13  LEU A HD23 2  
ATOM 2071  N N    . HIS A 1 14  ? 5.202   22.484  15.865  1.00 0.00 ? 14  HIS A N    2  
ATOM 2072  C CA   . HIS A 1 14  ? 3.860   22.336  16.415  1.00 0.00 ? 14  HIS A CA   2  
ATOM 2073  C C    . HIS A 1 14  ? 3.221   21.033  15.947  1.00 0.00 ? 14  HIS A C    2  
ATOM 2074  O O    . HIS A 1 14  ? 3.066   20.803  14.747  1.00 0.00 ? 14  HIS A O    2  
ATOM 2075  C CB   . HIS A 1 14  ? 2.985   23.523  16.009  1.00 0.00 ? 14  HIS A CB   2  
ATOM 2076  C CG   . HIS A 1 14  ? 3.349   24.799  16.703  1.00 0.00 ? 14  HIS A CG   2  
ATOM 2077  N ND1  . HIS A 1 14  ? 4.652   25.177  16.949  1.00 0.00 ? 14  HIS A ND1  2  
ATOM 2078  C CD2  . HIS A 1 14  ? 2.571   25.787  17.204  1.00 0.00 ? 14  HIS A CD2  2  
ATOM 2079  C CE1  . HIS A 1 14  ? 4.660   26.342  17.572  1.00 0.00 ? 14  HIS A CE1  2  
ATOM 2080  N NE2  . HIS A 1 14  ? 3.410   26.733  17.738  1.00 0.00 ? 14  HIS A NE2  2  
ATOM 2081  H H    . HIS A 1 14  ? 5.308   22.748  14.927  1.00 0.00 ? 14  HIS A H    2  
ATOM 2082  H HA   . HIS A 1 14  ? 3.944   22.314  17.492  1.00 0.00 ? 14  HIS A HA   2  
ATOM 2083  H HB2  . HIS A 1 14  ? 3.081   23.684  14.946  1.00 0.00 ? 14  HIS A HB2  2  
ATOM 2084  H HB3  . HIS A 1 14  ? 1.954   23.297  16.243  1.00 0.00 ? 14  HIS A HB3  2  
ATOM 2085  H HD1  . HIS A 1 14  ? 5.452   24.667  16.704  1.00 0.00 ? 14  HIS A HD1  2  
ATOM 2086  H HD2  . HIS A 1 14  ? 1.491   25.825  17.187  1.00 0.00 ? 14  HIS A HD2  2  
ATOM 2087  H HE1  . HIS A 1 14  ? 5.539   26.882  17.890  1.00 0.00 ? 14  HIS A HE1  2  
ATOM 2088  H HE2  . HIS A 1 14  ? 3.135   27.602  18.098  1.00 0.00 ? 14  HIS A HE2  2  
ATOM 2089  N N    . LEU A 1 15  ? 2.853   20.184  16.900  1.00 0.00 ? 15  LEU A N    2  
ATOM 2090  C CA   . LEU A 1 15  ? 2.230   18.903  16.584  1.00 0.00 ? 15  LEU A CA   2  
ATOM 2091  C C    . LEU A 1 15  ? 0.716   19.045  16.479  1.00 0.00 ? 15  LEU A C    2  
ATOM 2092  O O    . LEU A 1 15  ? 0.121   19.932  17.090  1.00 0.00 ? 15  LEU A O    2  
ATOM 2093  C CB   . LEU A 1 15  ? 2.584   17.864  17.652  1.00 0.00 ? 15  LEU A CB   2  
ATOM 2094  C CG   . LEU A 1 15  ? 4.063   17.809  18.036  1.00 0.00 ? 15  LEU A CG   2  
ATOM 2095  C CD1  . LEU A 1 15  ? 4.221   17.388  19.489  1.00 0.00 ? 15  LEU A CD1  2  
ATOM 2096  C CD2  . LEU A 1 15  ? 4.816   16.858  17.118  1.00 0.00 ? 15  LEU A CD2  2  
ATOM 2097  H H    . LEU A 1 15  ? 3.003   20.424  17.838  1.00 0.00 ? 15  LEU A H    2  
ATOM 2098  H HA   . LEU A 1 15  ? 2.616   18.573  15.632  1.00 0.00 ? 15  LEU A HA   2  
ATOM 2099  H HB2  . LEU A 1 15  ? 2.009   18.083  18.540  1.00 0.00 ? 15  LEU A HB2  2  
ATOM 2100  H HB3  . LEU A 1 15  ? 2.294   16.891  17.286  1.00 0.00 ? 15  LEU A HB3  2  
ATOM 2101  H HG   . LEU A 1 15  ? 4.494   18.794  17.926  1.00 0.00 ? 15  LEU A HG   2  
ATOM 2102  H HD11 . LEU A 1 15  ? 5.044   17.928  19.933  1.00 0.00 ? 15  LEU A HD11 2  
ATOM 2103  H HD12 . LEU A 1 15  ? 4.419   16.327  19.537  1.00 0.00 ? 15  LEU A HD12 2  
ATOM 2104  H HD13 . LEU A 1 15  ? 3.312   17.609  20.029  1.00 0.00 ? 15  LEU A HD13 2  
ATOM 2105  H HD21 . LEU A 1 15  ? 5.239   17.413  16.294  1.00 0.00 ? 15  LEU A HD21 2  
ATOM 2106  H HD22 . LEU A 1 15  ? 4.135   16.110  16.738  1.00 0.00 ? 15  LEU A HD22 2  
ATOM 2107  H HD23 . LEU A 1 15  ? 5.608   16.375  17.671  1.00 0.00 ? 15  LEU A HD23 2  
ATOM 2108  N N    . LEU A 1 16  ? 0.097   18.164  15.698  1.00 0.00 ? 16  LEU A N    2  
ATOM 2109  C CA   . LEU A 1 16  ? -1.349  18.191  15.512  1.00 0.00 ? 16  LEU A CA   2  
ATOM 2110  C C    . LEU A 1 16  ? -2.010  17.005  16.209  1.00 0.00 ? 16  LEU A C    2  
ATOM 2111  O O    . LEU A 1 16  ? -3.158  17.091  16.645  1.00 0.00 ? 16  LEU A O    2  
ATOM 2112  C CB   . LEU A 1 16  ? -1.692  18.178  14.021  1.00 0.00 ? 16  LEU A CB   2  
ATOM 2113  C CG   . LEU A 1 16  ? -2.890  19.042  13.625  1.00 0.00 ? 16  LEU A CG   2  
ATOM 2114  C CD1  . LEU A 1 16  ? -2.594  20.513  13.875  1.00 0.00 ? 16  LEU A CD1  2  
ATOM 2115  C CD2  . LEU A 1 16  ? -3.254  18.811  12.166  1.00 0.00 ? 16  LEU A CD2  2  
ATOM 2116  H H    . LEU A 1 16  ? 0.626   17.480  15.237  1.00 0.00 ? 16  LEU A H    2  
ATOM 2117  H HA   . LEU A 1 16  ? -1.723  19.104  15.950  1.00 0.00 ? 16  LEU A HA   2  
ATOM 2118  H HB2  . LEU A 1 16  ? -0.827  18.523  13.471  1.00 0.00 ? 16  LEU A HB2  2  
ATOM 2119  H HB3  . LEU A 1 16  ? -1.899  17.160  13.728  1.00 0.00 ? 16  LEU A HB3  2  
ATOM 2120  H HG   . LEU A 1 16  ? -3.741  18.766  14.232  1.00 0.00 ? 16  LEU A HG   2  
ATOM 2121  H HD11 . LEU A 1 16  ? -1.826  20.602  14.630  1.00 0.00 ? 16  LEU A HD11 2  
ATOM 2122  H HD12 . LEU A 1 16  ? -3.491  21.009  14.214  1.00 0.00 ? 16  LEU A HD12 2  
ATOM 2123  H HD13 . LEU A 1 16  ? -2.253  20.972  12.959  1.00 0.00 ? 16  LEU A HD13 2  
ATOM 2124  H HD21 . LEU A 1 16  ? -2.352  18.719  11.580  1.00 0.00 ? 16  LEU A HD21 2  
ATOM 2125  H HD22 . LEU A 1 16  ? -3.836  19.645  11.803  1.00 0.00 ? 16  LEU A HD22 2  
ATOM 2126  H HD23 . LEU A 1 16  ? -3.833  17.902  12.080  1.00 0.00 ? 16  LEU A HD23 2  
ATOM 2127  N N    . GLN A 1 17  ? -1.278  15.900  16.310  1.00 0.00 ? 17  GLN A N    2  
ATOM 2128  C CA   . GLN A 1 17  ? -1.794  14.696  16.953  1.00 0.00 ? 17  GLN A CA   2  
ATOM 2129  C C    . GLN A 1 17  ? -3.009  14.157  16.204  1.00 0.00 ? 17  GLN A C    2  
ATOM 2130  O O    . GLN A 1 17  ? -4.118  14.669  16.351  1.00 0.00 ? 17  GLN A O    2  
ATOM 2131  C CB   . GLN A 1 17  ? -2.166  14.990  18.408  1.00 0.00 ? 17  GLN A CB   2  
ATOM 2132  C CG   . GLN A 1 17  ? -1.049  15.647  19.202  1.00 0.00 ? 17  GLN A CG   2  
ATOM 2133  C CD   . GLN A 1 17  ? -1.558  16.718  20.146  1.00 0.00 ? 17  GLN A CD   2  
ATOM 2134  O OE1  . GLN A 1 17  ? -1.634  16.509  21.357  1.00 0.00 ? 17  GLN A OE1  2  
ATOM 2135  N NE2  . GLN A 1 17  ? -1.908  17.875  19.596  1.00 0.00 ? 17  GLN A NE2  2  
ATOM 2136  H H    . GLN A 1 17  ? -0.370  15.892  15.942  1.00 0.00 ? 17  GLN A H    2  
ATOM 2137  H HA   . GLN A 1 17  ? -1.014  13.950  16.934  1.00 0.00 ? 17  GLN A HA   2  
ATOM 2138  H HB2  . GLN A 1 17  ? -3.024  15.646  18.423  1.00 0.00 ? 17  GLN A HB2  2  
ATOM 2139  H HB3  . GLN A 1 17  ? -2.426  14.062  18.895  1.00 0.00 ? 17  GLN A HB3  2  
ATOM 2140  H HG2  . GLN A 1 17  ? -0.542  14.891  19.780  1.00 0.00 ? 17  GLN A HG2  2  
ATOM 2141  H HG3  . GLN A 1 17  ? -0.352  16.099  18.511  1.00 0.00 ? 17  GLN A HG3  2  
ATOM 2142  H HE21 . GLN A 1 17  ? -1.821  17.971  18.625  1.00 0.00 ? 17  GLN A HE21 2  
ATOM 2143  H HE22 . GLN A 1 17  ? -2.241  18.585  20.184  1.00 0.00 ? 17  GLN A HE22 2  
ATOM 2144  N N    . GLY A 1 18  ? -2.789  13.121  15.401  1.00 0.00 ? 18  GLY A N    2  
ATOM 2145  C CA   . GLY A 1 18  ? -3.875  12.529  14.641  1.00 0.00 ? 18  GLY A CA   2  
ATOM 2146  C C    . GLY A 1 18  ? -4.213  13.327  13.397  1.00 0.00 ? 18  GLY A C    2  
ATOM 2147  O O    . GLY A 1 18  ? -4.434  14.536  13.467  1.00 0.00 ? 18  GLY A O    2  
ATOM 2148  H H    . GLY A 1 18  ? -1.883  12.756  15.324  1.00 0.00 ? 18  GLY A H    2  
ATOM 2149  H HA2  . GLY A 1 18  ? -3.591  11.529  14.349  1.00 0.00 ? 18  GLY A HA2  2  
ATOM 2150  H HA3  . GLY A 1 18  ? -4.751  12.475  15.270  1.00 0.00 ? 18  GLY A HA3  2  
ATOM 2151  N N    . GLY A 1 19  ? -4.254  12.648  12.255  1.00 0.00 ? 19  GLY A N    2  
ATOM 2152  C CA   . GLY A 1 19  ? -4.568  13.317  11.005  1.00 0.00 ? 19  GLY A CA   2  
ATOM 2153  C C    . GLY A 1 19  ? -5.689  12.633  10.248  1.00 0.00 ? 19  GLY A C    2  
ATOM 2154  O O    . GLY A 1 19  ? -6.383  11.774  10.794  1.00 0.00 ? 19  GLY A O    2  
ATOM 2155  H H    . GLY A 1 19  ? -4.069  11.687  12.260  1.00 0.00 ? 19  GLY A H    2  
ATOM 2156  H HA2  . GLY A 1 19  ? -4.861  14.335  11.218  1.00 0.00 ? 19  GLY A HA2  2  
ATOM 2157  H HA3  . GLY A 1 19  ? -3.685  13.330  10.385  1.00 0.00 ? 19  GLY A HA3  2  
ATOM 2158  N N    . ASP A 1 20  ? -5.868  13.014  8.987   1.00 0.00 ? 20  ASP A N    2  
ATOM 2159  C CA   . ASP A 1 20  ? -6.913  12.432  8.154   1.00 0.00 ? 20  ASP A CA   2  
ATOM 2160  C C    . ASP A 1 20  ? -6.313  11.521  7.086   1.00 0.00 ? 20  ASP A C    2  
ATOM 2161  O O    . ASP A 1 20  ? -5.577  11.975  6.211   1.00 0.00 ? 20  ASP A O    2  
ATOM 2162  C CB   . ASP A 1 20  ? -7.740  13.536  7.491   1.00 0.00 ? 20  ASP A CB   2  
ATOM 2163  C CG   . ASP A 1 20  ? -8.285  14.531  8.496   1.00 0.00 ? 20  ASP A CG   2  
ATOM 2164  O OD1  . ASP A 1 20  ? -9.310  14.222  9.139   1.00 0.00 ? 20  ASP A OD1  2  
ATOM 2165  O OD2  . ASP A 1 20  ? -7.690  15.619  8.638   1.00 0.00 ? 20  ASP A OD2  2  
ATOM 2166  H H    . ASP A 1 20  ? -5.283  13.704  8.609   1.00 0.00 ? 20  ASP A H    2  
ATOM 2167  H HA   . ASP A 1 20  ? -7.557  11.845  8.790   1.00 0.00 ? 20  ASP A HA   2  
ATOM 2168  H HB2  . ASP A 1 20  ? -7.118  14.069  6.787   1.00 0.00 ? 20  ASP A HB2  2  
ATOM 2169  H HB3  . ASP A 1 20  ? -8.570  13.089  6.965   1.00 0.00 ? 20  ASP A HB3  2  
ATOM 2170  N N    . GLU A 1 21  ? -6.633  10.234  7.168   1.00 0.00 ? 21  GLU A N    2  
ATOM 2171  C CA   . GLU A 1 21  ? -6.126  9.258   6.210   1.00 0.00 ? 21  GLU A CA   2  
ATOM 2172  C C    . GLU A 1 21  ? -7.271  8.610   5.437   1.00 0.00 ? 21  GLU A C    2  
ATOM 2173  O O    . GLU A 1 21  ? -8.309  8.276   6.009   1.00 0.00 ? 21  GLU A O    2  
ATOM 2174  C CB   . GLU A 1 21  ? -5.309  8.184   6.928   1.00 0.00 ? 21  GLU A CB   2  
ATOM 2175  C CG   . GLU A 1 21  ? -3.971  8.684   7.448   1.00 0.00 ? 21  GLU A CG   2  
ATOM 2176  C CD   . GLU A 1 21  ? -4.030  9.094   8.907   1.00 0.00 ? 21  GLU A CD   2  
ATOM 2177  O OE1  . GLU A 1 21  ? -4.540  8.300   9.726   1.00 0.00 ? 21  GLU A OE1  2  
ATOM 2178  O OE2  . GLU A 1 21  ? -3.565  10.207  9.231   1.00 0.00 ? 21  GLU A OE2  2  
ATOM 2179  H H    . GLU A 1 21  ? -7.224  9.933   7.889   1.00 0.00 ? 21  GLU A H    2  
ATOM 2180  H HA   . GLU A 1 21  ? -5.487  9.778   5.513   1.00 0.00 ? 21  GLU A HA   2  
ATOM 2181  H HB2  . GLU A 1 21  ? -5.881  7.813   7.767   1.00 0.00 ? 21  GLU A HB2  2  
ATOM 2182  H HB3  . GLU A 1 21  ? -5.123  7.371   6.243   1.00 0.00 ? 21  GLU A HB3  2  
ATOM 2183  H HG2  . GLU A 1 21  ? -3.239  7.895   7.341   1.00 0.00 ? 21  GLU A HG2  2  
ATOM 2184  H HG3  . GLU A 1 21  ? -3.669  9.541   6.861   1.00 0.00 ? 21  GLU A HG3  2  
ATOM 2185  N N    . LYS A 1 22  ? -7.074  8.436   4.135   1.00 0.00 ? 22  LYS A N    2  
ATOM 2186  C CA   . LYS A 1 22  ? -8.090  7.828   3.282   1.00 0.00 ? 22  LYS A CA   2  
ATOM 2187  C C    . LYS A 1 22  ? -7.730  6.383   2.953   1.00 0.00 ? 22  LYS A C    2  
ATOM 2188  O O    . LYS A 1 22  ? -6.737  6.119   2.275   1.00 0.00 ? 22  LYS A O    2  
ATOM 2189  C CB   . LYS A 1 22  ? -8.249  8.632   1.991   1.00 0.00 ? 22  LYS A CB   2  
ATOM 2190  C CG   . LYS A 1 22  ? -9.430  8.192   1.142   1.00 0.00 ? 22  LYS A CG   2  
ATOM 2191  C CD   . LYS A 1 22  ? -9.708  9.178   0.018   1.00 0.00 ? 22  LYS A CD   2  
ATOM 2192  C CE   . LYS A 1 22  ? -10.089 8.465   -1.269  1.00 0.00 ? 22  LYS A CE   2  
ATOM 2193  N NZ   . LYS A 1 22  ? -11.209 7.506   -1.061  1.00 0.00 ? 22  LYS A NZ   2  
ATOM 2194  H H    . LYS A 1 22  ? -6.226  8.723   3.736   1.00 0.00 ? 22  LYS A H    2  
ATOM 2195  H HA   . LYS A 1 22  ? -9.025  7.840   3.821   1.00 0.00 ? 22  LYS A HA   2  
ATOM 2196  H HB2  . LYS A 1 22  ? -8.385  9.674   2.244   1.00 0.00 ? 22  LYS A HB2  2  
ATOM 2197  H HB3  . LYS A 1 22  ? -7.351  8.528   1.402   1.00 0.00 ? 22  LYS A HB3  2  
ATOM 2198  H HG2  . LYS A 1 22  ? -9.211  7.225   0.712   1.00 0.00 ? 22  LYS A HG2  2  
ATOM 2199  H HG3  . LYS A 1 22  ? -10.305 8.119   1.769   1.00 0.00 ? 22  LYS A HG3  2  
ATOM 2200  H HD2  . LYS A 1 22  ? -10.520 9.825   0.314   1.00 0.00 ? 22  LYS A HD2  2  
ATOM 2201  H HD3  . LYS A 1 22  ? -8.820  9.768   -0.157  1.00 0.00 ? 22  LYS A HD3  2  
ATOM 2202  H HE2  . LYS A 1 22  ? -10.390 9.202   -1.998  1.00 0.00 ? 22  LYS A HE2  2  
ATOM 2203  H HE3  . LYS A 1 22  ? -9.228  7.926   -1.636  1.00 0.00 ? 22  LYS A HE3  2  
ATOM 2204  H HZ1  . LYS A 1 22  ? -11.379 6.960   -1.930  1.00 0.00 ? 22  LYS A HZ1  2  
ATOM 2205  H HZ2  . LYS A 1 22  ? -12.079 8.020   -0.813  1.00 0.00 ? 22  LYS A HZ2  2  
ATOM 2206  H HZ3  . LYS A 1 22  ? -10.978 6.847   -0.290  1.00 0.00 ? 22  LYS A HZ3  2  
ATOM 2207  N N    . LYS A 1 23  ? -8.544  5.451   3.438   1.00 0.00 ? 23  LYS A N    2  
ATOM 2208  C CA   . LYS A 1 23  ? -8.311  4.032   3.194   1.00 0.00 ? 23  LYS A CA   2  
ATOM 2209  C C    . LYS A 1 23  ? -9.085  3.557   1.969   1.00 0.00 ? 23  LYS A C    2  
ATOM 2210  O O    . LYS A 1 23  ? -10.229 3.955   1.752   1.00 0.00 ? 23  LYS A O    2  
ATOM 2211  C CB   . LYS A 1 23  ? -8.715  3.210   4.422   1.00 0.00 ? 23  LYS A CB   2  
ATOM 2212  C CG   . LYS A 1 23  ? -7.530  2.648   5.192   1.00 0.00 ? 23  LYS A CG   2  
ATOM 2213  C CD   . LYS A 1 23  ? -7.400  3.289   6.565   1.00 0.00 ? 23  LYS A CD   2  
ATOM 2214  C CE   . LYS A 1 23  ? -5.944  3.536   6.929   1.00 0.00 ? 23  LYS A CE   2  
ATOM 2215  N NZ   . LYS A 1 23  ? -5.769  4.803   7.690   1.00 0.00 ? 23  LYS A NZ   2  
ATOM 2216  H H    . LYS A 1 23  ? -9.319  5.724   3.972   1.00 0.00 ? 23  LYS A H    2  
ATOM 2217  H HA   . LYS A 1 23  ? -7.255  3.896   3.014   1.00 0.00 ? 23  LYS A HA   2  
ATOM 2218  H HB2  . LYS A 1 23  ? -9.287  3.838   5.089   1.00 0.00 ? 23  LYS A HB2  2  
ATOM 2219  H HB3  . LYS A 1 23  ? -9.332  2.384   4.102   1.00 0.00 ? 23  LYS A HB3  2  
ATOM 2220  H HG2  . LYS A 1 23  ? -7.666  1.584   5.316   1.00 0.00 ? 23  LYS A HG2  2  
ATOM 2221  H HG3  . LYS A 1 23  ? -6.627  2.834   4.630   1.00 0.00 ? 23  LYS A HG3  2  
ATOM 2222  H HD2  . LYS A 1 23  ? -7.924  4.233   6.562   1.00 0.00 ? 23  LYS A HD2  2  
ATOM 2223  H HD3  . LYS A 1 23  ? -7.839  2.633   7.302   1.00 0.00 ? 23  LYS A HD3  2  
ATOM 2224  H HE2  . LYS A 1 23  ? -5.593  2.713   7.532   1.00 0.00 ? 23  LYS A HE2  2  
ATOM 2225  H HE3  . LYS A 1 23  ? -5.364  3.589   6.020   1.00 0.00 ? 23  LYS A HE3  2  
ATOM 2226  H HZ1  . LYS A 1 23  ? -4.774  4.919   7.968   1.00 0.00 ? 23  LYS A HZ1  2  
ATOM 2227  H HZ2  . LYS A 1 23  ? -6.357  4.789   8.548   1.00 0.00 ? 23  LYS A HZ2  2  
ATOM 2228  H HZ3  . LYS A 1 23  ? -6.051  5.615   7.104   1.00 0.00 ? 23  LYS A HZ3  2  
ATOM 2229  N N    . VAL A 1 24  ? -8.452  2.704   1.170   1.00 0.00 ? 24  VAL A N    2  
ATOM 2230  C CA   . VAL A 1 24  ? -9.080  2.174   -0.034  1.00 0.00 ? 24  VAL A CA   2  
ATOM 2231  C C    . VAL A 1 24  ? -9.182  0.653   0.024   1.00 0.00 ? 24  VAL A C    2  
ATOM 2232  O O    . VAL A 1 24  ? -8.324  -0.057  -0.498  1.00 0.00 ? 24  VAL A O    2  
ATOM 2233  C CB   . VAL A 1 24  ? -8.300  2.575   -1.299  1.00 0.00 ? 24  VAL A CB   2  
ATOM 2234  C CG1  . VAL A 1 24  ? -9.072  2.187   -2.550  1.00 0.00 ? 24  VAL A CG1  2  
ATOM 2235  C CG2  . VAL A 1 24  ? -8.001  4.067   -1.291  1.00 0.00 ? 24  VAL A CG2  2  
ATOM 2236  H H    . VAL A 1 24  ? -7.540  2.422   1.396   1.00 0.00 ? 24  VAL A H    2  
ATOM 2237  H HA   . VAL A 1 24  ? -10.075 2.590   -0.102  1.00 0.00 ? 24  VAL A HA   2  
ATOM 2238  H HB   . VAL A 1 24  ? -7.361  2.043   -1.302  1.00 0.00 ? 24  VAL A HB   2  
ATOM 2239  H HG11 . VAL A 1 24  ? -9.956  2.801   -2.633  1.00 0.00 ? 24  VAL A HG11 2  
ATOM 2240  H HG12 . VAL A 1 24  ? -9.360  1.148   -2.487  1.00 0.00 ? 24  VAL A HG12 2  
ATOM 2241  H HG13 . VAL A 1 24  ? -8.447  2.336   -3.419  1.00 0.00 ? 24  VAL A HG13 2  
ATOM 2242  H HG21 . VAL A 1 24  ? -7.679  4.365   -0.303  1.00 0.00 ? 24  VAL A HG21 2  
ATOM 2243  H HG22 . VAL A 1 24  ? -8.892  4.614   -1.558  1.00 0.00 ? 24  VAL A HG22 2  
ATOM 2244  H HG23 . VAL A 1 24  ? -7.218  4.282   -2.003  1.00 0.00 ? 24  VAL A HG23 2  
ATOM 2245  N N    . ASN A 1 25  ? -10.239 0.160   0.662   1.00 0.00 ? 25  ASN A N    2  
ATOM 2246  C CA   . ASN A 1 25  ? -10.453 -1.277  0.788   1.00 0.00 ? 25  ASN A CA   2  
ATOM 2247  C C    . ASN A 1 25  ? -10.819 -1.892  -0.559  1.00 0.00 ? 25  ASN A C    2  
ATOM 2248  O O    . ASN A 1 25  ? -11.905 -1.653  -1.088  1.00 0.00 ? 25  ASN A O    2  
ATOM 2249  C CB   . ASN A 1 25  ? -11.556 -1.561  1.809   1.00 0.00 ? 25  ASN A CB   2  
ATOM 2250  C CG   . ASN A 1 25  ? -11.275 -0.922  3.155   1.00 0.00 ? 25  ASN A CG   2  
ATOM 2251  O OD1  . ASN A 1 25  ? -10.419 -0.046  3.273   1.00 0.00 ? 25  ASN A OD1  2  
ATOM 2252  N ND2  . ASN A 1 25  ? -11.997 -1.360  4.180   1.00 0.00 ? 25  ASN A ND2  2  
ATOM 2253  H H    . ASN A 1 25  ? -10.889 0.777   1.057   1.00 0.00 ? 25  ASN A H    2  
ATOM 2254  H HA   . ASN A 1 25  ? -9.531  -1.720  1.134   1.00 0.00 ? 25  ASN A HA   2  
ATOM 2255  H HB2  . ASN A 1 25  ? -12.492 -1.174  1.436   1.00 0.00 ? 25  ASN A HB2  2  
ATOM 2256  H HB3  . ASN A 1 25  ? -11.642 -2.629  1.948   1.00 0.00 ? 25  ASN A HB3  2  
ATOM 2257  H HD21 . ASN A 1 25  ? -12.661 -2.062  4.013   1.00 0.00 ? 25  ASN A HD21 2  
ATOM 2258  H HD22 . ASN A 1 25  ? -11.836 -0.965  5.062   1.00 0.00 ? 25  ASN A HD22 2  
ATOM 2259  N N    . LEU A 1 26  ? -9.905  -2.685  -1.109  1.00 0.00 ? 26  LEU A N    2  
ATOM 2260  C CA   . LEU A 1 26  ? -10.130 -3.336  -2.393  1.00 0.00 ? 26  LEU A CA   2  
ATOM 2261  C C    . LEU A 1 26  ? -10.110 -4.854  -2.244  1.00 0.00 ? 26  LEU A C    2  
ATOM 2262  O O    . LEU A 1 26  ? -9.161  -5.423  -1.706  1.00 0.00 ? 26  LEU A O    2  
ATOM 2263  C CB   . LEU A 1 26  ? -9.067  -2.898  -3.403  1.00 0.00 ? 26  LEU A CB   2  
ATOM 2264  C CG   . LEU A 1 26  ? -9.175  -1.444  -3.868  1.00 0.00 ? 26  LEU A CG   2  
ATOM 2265  C CD1  . LEU A 1 26  ? -8.114  -1.137  -4.913  1.00 0.00 ? 26  LEU A CD1  2  
ATOM 2266  C CD2  . LEU A 1 26  ? -10.566 -1.166  -4.419  1.00 0.00 ? 26  LEU A CD2  2  
ATOM 2267  H H    . LEU A 1 26  ? -9.059  -2.836  -0.638  1.00 0.00 ? 26  LEU A H    2  
ATOM 2268  H HA   . LEU A 1 26  ? -11.102 -3.034  -2.754  1.00 0.00 ? 26  LEU A HA   2  
ATOM 2269  H HB2  . LEU A 1 26  ? -8.094  -3.038  -2.953  1.00 0.00 ? 26  LEU A HB2  2  
ATOM 2270  H HB3  . LEU A 1 26  ? -9.139  -3.536  -4.270  1.00 0.00 ? 26  LEU A HB3  2  
ATOM 2271  H HG   . LEU A 1 26  ? -9.012  -0.790  -3.025  1.00 0.00 ? 26  LEU A HG   2  
ATOM 2272  H HD11 . LEU A 1 26  ? -8.543  -1.228  -5.900  1.00 0.00 ? 26  LEU A HD11 2  
ATOM 2273  H HD12 . LEU A 1 26  ? -7.296  -1.836  -4.811  1.00 0.00 ? 26  LEU A HD12 2  
ATOM 2274  H HD13 . LEU A 1 26  ? -7.749  -0.131  -4.771  1.00 0.00 ? 26  LEU A HD13 2  
ATOM 2275  H HD21 . LEU A 1 26  ? -11.012 -2.090  -4.757  1.00 0.00 ? 26  LEU A HD21 2  
ATOM 2276  H HD22 . LEU A 1 26  ? -10.493 -0.478  -5.249  1.00 0.00 ? 26  LEU A HD22 2  
ATOM 2277  H HD23 . LEU A 1 26  ? -11.181 -0.732  -3.645  1.00 0.00 ? 26  LEU A HD23 2  
ATOM 2278  N N    . VAL A 1 27  ? -11.165 -5.504  -2.724  1.00 0.00 ? 27  VAL A N    2  
ATOM 2279  C CA   . VAL A 1 27  ? -11.269 -6.956  -2.643  1.00 0.00 ? 27  VAL A CA   2  
ATOM 2280  C C    . VAL A 1 27  ? -10.994 -7.603  -3.996  1.00 0.00 ? 27  VAL A C    2  
ATOM 2281  O O    . VAL A 1 27  ? -11.906 -7.793  -4.801  1.00 0.00 ? 27  VAL A O    2  
ATOM 2282  C CB   . VAL A 1 27  ? -12.662 -7.394  -2.149  1.00 0.00 ? 27  VAL A CB   2  
ATOM 2283  C CG1  . VAL A 1 27  ? -12.701 -8.899  -1.923  1.00 0.00 ? 27  VAL A CG1  2  
ATOM 2284  C CG2  . VAL A 1 27  ? -13.039 -6.648  -0.878  1.00 0.00 ? 27  VAL A CG2  2  
ATOM 2285  H H    . VAL A 1 27  ? -11.892 -4.996  -3.141  1.00 0.00 ? 27  VAL A H    2  
ATOM 2286  H HA   . VAL A 1 27  ? -10.533 -7.304  -1.932  1.00 0.00 ? 27  VAL A HA   2  
ATOM 2287  H HB   . VAL A 1 27  ? -13.385 -7.150  -2.912  1.00 0.00 ? 27  VAL A HB   2  
ATOM 2288  H HG11 . VAL A 1 27  ? -12.797 -9.404  -2.873  1.00 0.00 ? 27  VAL A HG11 2  
ATOM 2289  H HG12 . VAL A 1 27  ? -13.544 -9.146  -1.296  1.00 0.00 ? 27  VAL A HG12 2  
ATOM 2290  H HG13 . VAL A 1 27  ? -11.788 -9.214  -1.439  1.00 0.00 ? 27  VAL A HG13 2  
ATOM 2291  H HG21 . VAL A 1 27  ? -14.078 -6.358  -0.926  1.00 0.00 ? 27  VAL A HG21 2  
ATOM 2292  H HG22 . VAL A 1 27  ? -12.424 -5.766  -0.781  1.00 0.00 ? 27  VAL A HG22 2  
ATOM 2293  H HG23 . VAL A 1 27  ? -12.883 -7.290  -0.024  1.00 0.00 ? 27  VAL A HG23 2  
ATOM 2294  N N    . LEU A 1 28  ? -9.732  -7.936  -4.240  1.00 0.00 ? 28  LEU A N    2  
ATOM 2295  C CA   . LEU A 1 28  ? -9.335  -8.561  -5.497  1.00 0.00 ? 28  LEU A CA   2  
ATOM 2296  C C    . LEU A 1 28  ? -9.918  -9.966  -5.614  1.00 0.00 ? 28  LEU A C    2  
ATOM 2297  O O    . LEU A 1 28  ? -10.649 -10.421 -4.734  1.00 0.00 ? 28  LEU A O    2  
ATOM 2298  C CB   . LEU A 1 28  ? -7.810  -8.619  -5.604  1.00 0.00 ? 28  LEU A CB   2  
ATOM 2299  C CG   . LEU A 1 28  ? -7.111  -7.259  -5.619  1.00 0.00 ? 28  LEU A CG   2  
ATOM 2300  C CD1  . LEU A 1 28  ? -5.610  -7.428  -5.438  1.00 0.00 ? 28  LEU A CD1  2  
ATOM 2301  C CD2  . LEU A 1 28  ? -7.414  -6.519  -6.915  1.00 0.00 ? 28  LEU A CD2  2  
ATOM 2302  H H    . LEU A 1 28  ? -9.050  -7.757  -3.560  1.00 0.00 ? 28  LEU A H    2  
ATOM 2303  H HA   . LEU A 1 28  ? -9.721  -7.957  -6.304  1.00 0.00 ? 28  LEU A HA   2  
ATOM 2304  H HB2  . LEU A 1 28  ? -7.433  -9.185  -4.765  1.00 0.00 ? 28  LEU A HB2  2  
ATOM 2305  H HB3  . LEU A 1 28  ? -7.554  -9.140  -6.513  1.00 0.00 ? 28  LEU A HB3  2  
ATOM 2306  H HG   . LEU A 1 28  ? -7.481  -6.661  -4.798  1.00 0.00 ? 28  LEU A HG   2  
ATOM 2307  H HD11 . LEU A 1 28  ? -5.092  -6.662  -5.997  1.00 0.00 ? 28  LEU A HD11 2  
ATOM 2308  H HD12 . LEU A 1 28  ? -5.312  -8.401  -5.798  1.00 0.00 ? 28  LEU A HD12 2  
ATOM 2309  H HD13 . LEU A 1 28  ? -5.362  -7.340  -4.391  1.00 0.00 ? 28  LEU A HD13 2  
ATOM 2310  H HD21 . LEU A 1 28  ? -7.513  -5.464  -6.711  1.00 0.00 ? 28  LEU A HD21 2  
ATOM 2311  H HD22 . LEU A 1 28  ? -8.335  -6.893  -7.334  1.00 0.00 ? 28  LEU A HD22 2  
ATOM 2312  H HD23 . LEU A 1 28  ? -6.608  -6.677  -7.616  1.00 0.00 ? 28  LEU A HD23 2  
ATOM 2313  N N    . GLY A 1 29  ? -9.588  -10.650 -6.705  1.00 0.00 ? 29  GLY A N    2  
ATOM 2314  C CA   . GLY A 1 29  ? -10.086 -11.996 -6.917  1.00 0.00 ? 29  GLY A CA   2  
ATOM 2315  C C    . GLY A 1 29  ? -8.975  -12.986 -7.200  1.00 0.00 ? 29  GLY A C    2  
ATOM 2316  O O    . GLY A 1 29  ? -8.819  -13.450 -8.329  1.00 0.00 ? 29  GLY A O    2  
ATOM 2317  H H    . GLY A 1 29  ? -9.001  -10.235 -7.372  1.00 0.00 ? 29  GLY A H    2  
ATOM 2318  H HA2  . GLY A 1 29  ? -10.621 -12.314 -6.032  1.00 0.00 ? 29  GLY A HA2  2  
ATOM 2319  H HA3  . GLY A 1 29  ? -10.769 -11.987 -7.757  1.00 0.00 ? 29  GLY A HA3  2  
ATOM 2320  N N    . ASP A 1 30  ? -8.200  -13.313 -6.170  1.00 0.00 ? 30  ASP A N    2  
ATOM 2321  C CA   . ASP A 1 30  ? -7.096  -14.256 -6.312  1.00 0.00 ? 30  ASP A CA   2  
ATOM 2322  C C    . ASP A 1 30  ? -6.054  -13.733 -7.294  1.00 0.00 ? 30  ASP A C    2  
ATOM 2323  O O    . ASP A 1 30  ? -5.388  -14.510 -7.980  1.00 0.00 ? 30  ASP A O    2  
ATOM 2324  C CB   . ASP A 1 30  ? -7.616  -15.616 -6.778  1.00 0.00 ? 30  ASP A CB   2  
ATOM 2325  C CG   . ASP A 1 30  ? -8.021  -16.509 -5.620  1.00 0.00 ? 30  ASP A CG   2  
ATOM 2326  O OD1  . ASP A 1 30  ? -7.398  -16.401 -4.542  1.00 0.00 ? 30  ASP A OD1  2  
ATOM 2327  O OD2  . ASP A 1 30  ? -8.960  -17.315 -5.792  1.00 0.00 ? 30  ASP A OD2  2  
ATOM 2328  H H    . ASP A 1 30  ? -8.375  -12.911 -5.294  1.00 0.00 ? 30  ASP A H    2  
ATOM 2329  H HA   . ASP A 1 30  ? -6.634  -14.370 -5.343  1.00 0.00 ? 30  ASP A HA   2  
ATOM 2330  H HB2  . ASP A 1 30  ? -8.478  -15.468 -7.411  1.00 0.00 ? 30  ASP A HB2  2  
ATOM 2331  H HB3  . ASP A 1 30  ? -6.842  -16.118 -7.341  1.00 0.00 ? 30  ASP A HB3  2  
ATOM 2332  N N    . GLY A 1 31  ? -5.916  -12.412 -7.357  1.00 0.00 ? 31  GLY A N    2  
ATOM 2333  C CA   . GLY A 1 31  ? -4.951  -11.809 -8.259  1.00 0.00 ? 31  GLY A CA   2  
ATOM 2334  C C    . GLY A 1 31  ? -5.611  -11.043 -9.388  1.00 0.00 ? 31  GLY A C    2  
ATOM 2335  O O    . GLY A 1 31  ? -5.410  -11.356 -10.561 1.00 0.00 ? 31  GLY A O    2  
ATOM 2336  H H    . GLY A 1 31  ? -6.473  -11.843 -6.787  1.00 0.00 ? 31  GLY A H    2  
ATOM 2337  H HA2  . GLY A 1 31  ? -4.324  -11.130 -7.695  1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2338  H HA3  . GLY A 1 31  ? -4.333  -12.591 -8.682  1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2339  N N    . ARG A 1 32  ? -6.402  -10.035 -9.033  1.00 0.00 ? 32  ARG A N    2  
ATOM 2340  C CA   . ARG A 1 32  ? -7.094  -9.220  -10.026 1.00 0.00 ? 32  ARG A CA   2  
ATOM 2341  C C    . ARG A 1 32  ? -6.270  -7.992  -10.413 1.00 0.00 ? 32  ARG A C    2  
ATOM 2342  O O    . ARG A 1 32  ? -6.660  -7.227  -11.295 1.00 0.00 ? 32  ARG A O    2  
ATOM 2343  C CB   . ARG A 1 32  ? -8.458  -8.781  -9.493  1.00 0.00 ? 32  ARG A CB   2  
ATOM 2344  C CG   . ARG A 1 32  ? -9.575  -9.769  -9.792  1.00 0.00 ? 32  ARG A CG   2  
ATOM 2345  C CD   . ARG A 1 32  ? -10.420 -9.318  -10.971 1.00 0.00 ? 32  ARG A CD   2  
ATOM 2346  N NE   . ARG A 1 32  ? -9.711  -9.465  -12.240 1.00 0.00 ? 32  ARG A NE   2  
ATOM 2347  C CZ   . ARG A 1 32  ? -9.583  -10.620 -12.889 1.00 0.00 ? 32  ARG A CZ   2  
ATOM 2348  N NH1  . ARG A 1 32  ? -10.113 -11.730 -12.392 1.00 0.00 ? 32  ARG A NH1  2  
ATOM 2349  N NH2  . ARG A 1 32  ? -8.923  -10.664 -14.038 1.00 0.00 ? 32  ARG A NH2  2  
ATOM 2350  H H    . ARG A 1 32  ? -6.522  -9.834  -8.081  1.00 0.00 ? 32  ARG A H    2  
ATOM 2351  H HA   . ARG A 1 32  ? -7.242  -9.828  -10.906 1.00 0.00 ? 32  ARG A HA   2  
ATOM 2352  H HB2  . ARG A 1 32  ? -8.391  -8.658  -8.422  1.00 0.00 ? 32  ARG A HB2  2  
ATOM 2353  H HB3  . ARG A 1 32  ? -8.718  -7.832  -9.939  1.00 0.00 ? 32  ARG A HB3  2  
ATOM 2354  H HG2  . ARG A 1 32  ? -9.139  -10.730 -10.020 1.00 0.00 ? 32  ARG A HG2  2  
ATOM 2355  H HG3  . ARG A 1 32  ? -10.207 -9.857  -8.919  1.00 0.00 ? 32  ARG A HG3  2  
ATOM 2356  H HD2  . ARG A 1 32  ? -11.320 -9.914  -11.002 1.00 0.00 ? 32  ARG A HD2  2  
ATOM 2357  H HD3  . ARG A 1 32  ? -10.682 -8.279  -10.833 1.00 0.00 ? 32  ARG A HD3  2  
ATOM 2358  H HE   . ARG A 1 32  ? -9.310  -8.660  -12.630 1.00 0.00 ? 32  ARG A HE   2  
ATOM 2359  H HH11 . ARG A 1 32  ? -10.613 -11.704 -11.526 1.00 0.00 ? 32  ARG A HH11 2  
ATOM 2360  H HH12 . ARG A 1 32  ? -10.014 -12.595 -12.885 1.00 0.00 ? 32  ARG A HH12 2  
ATOM 2361  H HH21 . ARG A 1 32  ? -8.521  -9.831  -14.416 1.00 0.00 ? 32  ARG A HH21 2  
ATOM 2362  H HH22 . ARG A 1 32  ? -8.826  -11.532 -14.525 1.00 0.00 ? 32  ARG A HH22 2  
ATOM 2363  N N    . SER A 1 33  ? -5.129  -7.806  -9.752  1.00 0.00 ? 33  SER A N    2  
ATOM 2364  C CA   . SER A 1 33  ? -4.260  -6.670  -10.035 1.00 0.00 ? 33  SER A CA   2  
ATOM 2365  C C    . SER A 1 33  ? -4.981  -5.353  -9.769  1.00 0.00 ? 33  SER A C    2  
ATOM 2366  O O    . SER A 1 33  ? -6.210  -5.289  -9.801  1.00 0.00 ? 33  SER A O    2  
ATOM 2367  C CB   . SER A 1 33  ? -3.780  -6.717  -11.488 1.00 0.00 ? 33  SER A CB   2  
ATOM 2368  O OG   . SER A 1 33  ? -2.975  -7.859  -11.721 1.00 0.00 ? 33  SER A OG   2  
ATOM 2369  H H    . SER A 1 33  ? -4.866  -8.447  -9.060  1.00 0.00 ? 33  SER A H    2  
ATOM 2370  H HA   . SER A 1 33  ? -3.404  -6.737  -9.380  1.00 0.00 ? 33  SER A HA   2  
ATOM 2371  H HB2  . SER A 1 33  ? -4.634  -6.753  -12.146 1.00 0.00 ? 33  SER A HB2  2  
ATOM 2372  H HB3  . SER A 1 33  ? -3.198  -5.831  -11.701 1.00 0.00 ? 33  SER A HB3  2  
ATOM 2373  H HG   . SER A 1 33  ? -3.512  -8.651  -11.643 1.00 0.00 ? 33  SER A HG   2  
ATOM 2374  N N    . LEU A 1 34  ? -4.210  -4.304  -9.505  1.00 0.00 ? 34  LEU A N    2  
ATOM 2375  C CA   . LEU A 1 34  ? -4.775  -2.987  -9.233  1.00 0.00 ? 34  LEU A CA   2  
ATOM 2376  C C    . LEU A 1 34  ? -4.880  -2.164  -10.512 1.00 0.00 ? 34  LEU A C    2  
ATOM 2377  O O    . LEU A 1 34  ? -5.919  -1.569  -10.796 1.00 0.00 ? 34  LEU A O    2  
ATOM 2378  C CB   . LEU A 1 34  ? -3.921  -2.245  -8.203  1.00 0.00 ? 34  LEU A CB   2  
ATOM 2379  C CG   . LEU A 1 34  ? -3.957  -2.831  -6.790  1.00 0.00 ? 34  LEU A CG   2  
ATOM 2380  C CD1  . LEU A 1 34  ? -2.670  -2.512  -6.046  1.00 0.00 ? 34  LEU A CD1  2  
ATOM 2381  C CD2  . LEU A 1 34  ? -5.162  -2.303  -6.026  1.00 0.00 ? 34  LEU A CD2  2  
ATOM 2382  H H    . LEU A 1 34  ? -3.236  -4.417  -9.494  1.00 0.00 ? 34  LEU A H    2  
ATOM 2383  H HA   . LEU A 1 34  ? -5.767  -3.130  -8.829  1.00 0.00 ? 34  LEU A HA   2  
ATOM 2384  H HB2  . LEU A 1 34  ? -2.894  -2.251  -8.547  1.00 0.00 ? 34  LEU A HB2  2  
ATOM 2385  H HB3  . LEU A 1 34  ? -4.265  -1.220  -8.152  1.00 0.00 ? 34  LEU A HB3  2  
ATOM 2386  H HG   . LEU A 1 34  ? -4.046  -3.906  -6.856  1.00 0.00 ? 34  LEU A HG   2  
ATOM 2387  H HD11 . LEU A 1 34  ? -2.388  -3.357  -5.435  1.00 0.00 ? 34  LEU A HD11 2  
ATOM 2388  H HD12 . LEU A 1 34  ? -2.822  -1.648  -5.418  1.00 0.00 ? 34  LEU A HD12 2  
ATOM 2389  H HD13 . LEU A 1 34  ? -1.885  -2.305  -6.759  1.00 0.00 ? 34  LEU A HD13 2  
ATOM 2390  H HD21 . LEU A 1 34  ? -5.327  -1.269  -6.286  1.00 0.00 ? 34  LEU A HD21 2  
ATOM 2391  H HD22 . LEU A 1 34  ? -4.978  -2.383  -4.965  1.00 0.00 ? 34  LEU A HD22 2  
ATOM 2392  H HD23 . LEU A 1 34  ? -6.036  -2.883  -6.285  1.00 0.00 ? 34  LEU A HD23 2  
ATOM 2393  N N    . GLY A 1 35  ? -3.797  -2.137  -11.283 1.00 0.00 ? 35  GLY A N    2  
ATOM 2394  C CA   . GLY A 1 35  ? -3.788  -1.386  -12.523 1.00 0.00 ? 35  GLY A CA   2  
ATOM 2395  C C    . GLY A 1 35  ? -3.319  0.043   -12.334 1.00 0.00 ? 35  GLY A C    2  
ATOM 2396  O O    . GLY A 1 35  ? -3.745  0.945   -13.056 1.00 0.00 ? 35  GLY A O    2  
ATOM 2397  H H    . GLY A 1 35  ? -2.997  -2.632  -11.006 1.00 0.00 ? 35  GLY A H    2  
ATOM 2398  H HA2  . GLY A 1 35  ? -3.128  -1.879  -13.226 1.00 0.00 ? 35  GLY A HA2  2  
ATOM 2399  H HA3  . GLY A 1 35  ? -4.790  -1.373  -12.931 1.00 0.00 ? 35  GLY A HA3  2  
ATOM 2400  N N    . LEU A 1 36  ? -2.439  0.252   -11.360 1.00 0.00 ? 36  LEU A N    2  
ATOM 2401  C CA   . LEU A 1 36  ? -1.911  1.582   -11.078 1.00 0.00 ? 36  LEU A CA   2  
ATOM 2402  C C    . LEU A 1 36  ? -0.441  1.679   -11.471 1.00 0.00 ? 36  LEU A C    2  
ATOM 2403  O O    . LEU A 1 36  ? 0.310   0.711   -11.347 1.00 0.00 ? 36  LEU A O    2  
ATOM 2404  C CB   . LEU A 1 36  ? -2.078  1.916   -9.595  1.00 0.00 ? 36  LEU A CB   2  
ATOM 2405  C CG   . LEU A 1 36  ? -3.494  2.314   -9.175  1.00 0.00 ? 36  LEU A CG   2  
ATOM 2406  C CD1  . LEU A 1 36  ? -3.635  2.272   -7.662  1.00 0.00 ? 36  LEU A CD1  2  
ATOM 2407  C CD2  . LEU A 1 36  ? -3.837  3.698   -9.706  1.00 0.00 ? 36  LEU A CD2  2  
ATOM 2408  H H    . LEU A 1 36  ? -2.136  -0.506  -10.818 1.00 0.00 ? 36  LEU A H    2  
ATOM 2409  H HA   . LEU A 1 36  ? -2.475  2.292   -11.663 1.00 0.00 ? 36  LEU A HA   2  
ATOM 2410  H HB2  . LEU A 1 36  ? -1.783  1.051   -9.018  1.00 0.00 ? 36  LEU A HB2  2  
ATOM 2411  H HB3  . LEU A 1 36  ? -1.414  2.733   -9.354  1.00 0.00 ? 36  LEU A HB3  2  
ATOM 2412  H HG   . LEU A 1 36  ? -4.198  1.609   -9.594  1.00 0.00 ? 36  LEU A HG   2  
ATOM 2413  H HD11 . LEU A 1 36  ? -2.921  2.950   -7.216  1.00 0.00 ? 36  LEU A HD11 2  
ATOM 2414  H HD12 . LEU A 1 36  ? -3.447  1.269   -7.310  1.00 0.00 ? 36  LEU A HD12 2  
ATOM 2415  H HD13 . LEU A 1 36  ? -4.635  2.570   -7.384  1.00 0.00 ? 36  LEU A HD13 2  
ATOM 2416  H HD21 . LEU A 1 36  ? -4.483  4.204   -9.004  1.00 0.00 ? 36  LEU A HD21 2  
ATOM 2417  H HD22 . LEU A 1 36  ? -4.343  3.603   -10.656 1.00 0.00 ? 36  LEU A HD22 2  
ATOM 2418  H HD23 . LEU A 1 36  ? -2.930  4.268   -9.837  1.00 0.00 ? 36  LEU A HD23 2  
ATOM 2419  N N    . THR A 1 37  ? -0.036  2.853   -11.944 1.00 0.00 ? 37  THR A N    2  
ATOM 2420  C CA   . THR A 1 37  ? 1.345   3.077   -12.355 1.00 0.00 ? 37  THR A CA   2  
ATOM 2421  C C    . THR A 1 37  ? 2.089   3.920   -11.325 1.00 0.00 ? 37  THR A C    2  
ATOM 2422  O O    . THR A 1 37  ? 2.283   5.121   -11.513 1.00 0.00 ? 37  THR A O    2  
ATOM 2423  C CB   . THR A 1 37  ? 1.389   3.763   -13.721 1.00 0.00 ? 37  THR A CB   2  
ATOM 2424  O OG1  . THR A 1 37  ? 0.532   3.106   -14.640 1.00 0.00 ? 37  THR A OG1  2  
ATOM 2425  C CG2  . THR A 1 37  ? 2.774   3.798   -14.330 1.00 0.00 ? 37  THR A CG2  2  
ATOM 2426  H H    . THR A 1 37  ? -0.682  3.587   -12.019 1.00 0.00 ? 37  THR A H    2  
ATOM 2427  H HA   . THR A 1 37  ? 1.828   2.113   -12.431 1.00 0.00 ? 37  THR A HA   2  
ATOM 2428  H HB   . THR A 1 37  ? 1.049   4.783   -13.611 1.00 0.00 ? 37  THR A HB   2  
ATOM 2429  H HG1  . THR A 1 37  ? -0.347  3.035   -14.263 1.00 0.00 ? 37  THR A HG1  2  
ATOM 2430  H HG21 . THR A 1 37  ? 2.783   4.484   -15.163 1.00 0.00 ? 37  THR A HG21 2  
ATOM 2431  H HG22 . THR A 1 37  ? 3.041   2.810   -14.675 1.00 0.00 ? 37  THR A HG22 2  
ATOM 2432  H HG23 . THR A 1 37  ? 3.486   4.124   -13.586 1.00 0.00 ? 37  THR A HG23 2  
ATOM 2433  N N    . ILE A 1 38  ? 2.505   3.281   -10.235 1.00 0.00 ? 38  ILE A N    2  
ATOM 2434  C CA   . ILE A 1 38  ? 3.229   3.973   -9.175  1.00 0.00 ? 38  ILE A CA   2  
ATOM 2435  C C    . ILE A 1 38  ? 4.646   4.324   -9.614  1.00 0.00 ? 38  ILE A C    2  
ATOM 2436  O O    . ILE A 1 38  ? 5.136   3.821   -10.625 1.00 0.00 ? 38  ILE A O    2  
ATOM 2437  C CB   . ILE A 1 38  ? 3.297   3.120   -7.894  1.00 0.00 ? 38  ILE A CB   2  
ATOM 2438  C CG1  . ILE A 1 38  ? 3.841   1.726   -8.211  1.00 0.00 ? 38  ILE A CG1  2  
ATOM 2439  C CG2  . ILE A 1 38  ? 1.924   3.025   -7.246  1.00 0.00 ? 38  ILE A CG2  2  
ATOM 2440  C CD1  . ILE A 1 38  ? 4.508   1.054   -7.030  1.00 0.00 ? 38  ILE A CD1  2  
ATOM 2441  H H    . ILE A 1 38  ? 2.322   2.324   -10.142 1.00 0.00 ? 38  ILE A H    2  
ATOM 2442  H HA   . ILE A 1 38  ? 2.696   4.885   -8.947  1.00 0.00 ? 38  ILE A HA   2  
ATOM 2443  H HB   . ILE A 1 38  ? 3.962   3.608   -7.198  1.00 0.00 ? 38  ILE A HB   2  
ATOM 2444  H HG12 . ILE A 1 38  ? 3.027   1.094   -8.534  1.00 0.00 ? 38  ILE A HG12 2  
ATOM 2445  H HG13 . ILE A 1 38  ? 4.569   1.803   -9.005  1.00 0.00 ? 38  ILE A HG13 2  
ATOM 2446  H HG21 . ILE A 1 38  ? 1.161   3.172   -7.996  1.00 0.00 ? 38  ILE A HG21 2  
ATOM 2447  H HG22 . ILE A 1 38  ? 1.832   3.785   -6.485  1.00 0.00 ? 38  ILE A HG22 2  
ATOM 2448  H HG23 . ILE A 1 38  ? 1.804   2.050   -6.797  1.00 0.00 ? 38  ILE A HG23 2  
ATOM 2449  H HD11 . ILE A 1 38  ? 3.774   0.868   -6.260  1.00 0.00 ? 38  ILE A HD11 2  
ATOM 2450  H HD12 . ILE A 1 38  ? 5.283   1.699   -6.641  1.00 0.00 ? 38  ILE A HD12 2  
ATOM 2451  H HD13 . ILE A 1 38  ? 4.944   0.118   -7.347  1.00 0.00 ? 38  ILE A HD13 2  
ATOM 2452  N N    . ARG A 1 39  ? 5.300   5.190   -8.848  1.00 0.00 ? 39  ARG A N    2  
ATOM 2453  C CA   . ARG A 1 39  ? 6.662   5.609   -9.157  1.00 0.00 ? 39  ARG A CA   2  
ATOM 2454  C C    . ARG A 1 39  ? 7.448   5.894   -7.881  1.00 0.00 ? 39  ARG A C    2  
ATOM 2455  O O    . ARG A 1 39  ? 6.868   6.059   -6.808  1.00 0.00 ? 39  ARG A O    2  
ATOM 2456  C CB   . ARG A 1 39  ? 6.646   6.852   -10.048 1.00 0.00 ? 39  ARG A CB   2  
ATOM 2457  C CG   . ARG A 1 39  ? 5.826   7.999   -9.477  1.00 0.00 ? 39  ARG A CG   2  
ATOM 2458  C CD   . ARG A 1 39  ? 6.714   9.061   -8.849  1.00 0.00 ? 39  ARG A CD   2  
ATOM 2459  N NE   . ARG A 1 39  ? 6.224   10.412  -9.117  1.00 0.00 ? 39  ARG A NE   2  
ATOM 2460  C CZ   . ARG A 1 39  ? 6.173   10.954  -10.332 1.00 0.00 ? 39  ARG A CZ   2  
ATOM 2461  N NH1  . ARG A 1 39  ? 6.579   10.265  -11.391 1.00 0.00 ? 39  ARG A NH1  2  
ATOM 2462  N NH2  . ARG A 1 39  ? 5.713   12.188  -10.488 1.00 0.00 ? 39  ARG A NH2  2  
ATOM 2463  H H    . ARG A 1 39  ? 4.856   5.557   -8.053  1.00 0.00 ? 39  ARG A H    2  
ATOM 2464  H HA   . ARG A 1 39  ? 7.144   4.802   -9.689  1.00 0.00 ? 39  ARG A HA   2  
ATOM 2465  H HB2  . ARG A 1 39  ? 7.660   7.196   -10.186 1.00 0.00 ? 39  ARG A HB2  2  
ATOM 2466  H HB3  . ARG A 1 39  ? 6.231   6.586   -11.009 1.00 0.00 ? 39  ARG A HB3  2  
ATOM 2467  H HG2  . ARG A 1 39  ? 5.252   8.449   -10.273 1.00 0.00 ? 39  ARG A HG2  2  
ATOM 2468  H HG3  . ARG A 1 39  ? 5.157   7.609   -8.724  1.00 0.00 ? 39  ARG A HG3  2  
ATOM 2469  H HD2  . ARG A 1 39  ? 6.740   8.905   -7.781  1.00 0.00 ? 39  ARG A HD2  2  
ATOM 2470  H HD3  . ARG A 1 39  ? 7.711   8.963   -9.252  1.00 0.00 ? 39  ARG A HD3  2  
ATOM 2471  H HE   . ARG A 1 39  ? 5.918   10.943  -8.353  1.00 0.00 ? 39  ARG A HE   2  
ATOM 2472  H HH11 . ARG A 1 39  ? 6.927   9.334   -11.281 1.00 0.00 ? 39  ARG A HH11 2  
ATOM 2473  H HH12 . ARG A 1 39  ? 6.538   10.678  -12.301 1.00 0.00 ? 39  ARG A HH12 2  
ATOM 2474  H HH21 . ARG A 1 39  ? 5.406   12.711  -9.694  1.00 0.00 ? 39  ARG A HH21 2  
ATOM 2475  H HH22 . ARG A 1 39  ? 5.675   12.595  -11.401 1.00 0.00 ? 39  ARG A HH22 2  
ATOM 2476  N N    . GLY A 1 40  ? 8.770   5.951   -8.007  1.00 0.00 ? 40  GLY A N    2  
ATOM 2477  C CA   . GLY A 1 40  ? 9.613   6.217   -6.857  1.00 0.00 ? 40  GLY A CA   2  
ATOM 2478  C C    . GLY A 1 40  ? 9.908   4.967   -6.051  1.00 0.00 ? 40  GLY A C    2  
ATOM 2479  O O    . GLY A 1 40  ? 9.318   3.913   -6.291  1.00 0.00 ? 40  GLY A O    2  
ATOM 2480  H H    . GLY A 1 40  ? 9.176   5.812   -8.888  1.00 0.00 ? 40  GLY A H    2  
ATOM 2481  H HA2  . GLY A 1 40  ? 10.546  6.640   -7.198  1.00 0.00 ? 40  GLY A HA2  2  
ATOM 2482  H HA3  . GLY A 1 40  ? 9.117   6.934   -6.218  1.00 0.00 ? 40  GLY A HA3  2  
ATOM 2483  N N    . GLY A 1 41  ? 10.823  5.084   -5.095  1.00 0.00 ? 41  GLY A N    2  
ATOM 2484  C CA   . GLY A 1 41  ? 11.180  3.947   -4.266  1.00 0.00 ? 41  GLY A CA   2  
ATOM 2485  C C    . GLY A 1 41  ? 12.348  4.246   -3.347  1.00 0.00 ? 41  GLY A C    2  
ATOM 2486  O O    . GLY A 1 41  ? 13.024  5.263   -3.501  1.00 0.00 ? 41  GLY A O    2  
ATOM 2487  H H    . GLY A 1 41  ? 11.260  5.949   -4.950  1.00 0.00 ? 41  GLY A H    2  
ATOM 2488  H HA2  . GLY A 1 41  ? 10.323  3.672   -3.665  1.00 0.00 ? 41  GLY A HA2  2  
ATOM 2489  H HA3  . GLY A 1 41  ? 11.443  3.116   -4.908  1.00 0.00 ? 41  GLY A HA3  2  
ATOM 2490  N N    . ALA A 1 42  ? 12.586  3.356   -2.389  1.00 0.00 ? 42  ALA A N    2  
ATOM 2491  C CA   . ALA A 1 42  ? 13.680  3.529   -1.441  1.00 0.00 ? 42  ALA A CA   2  
ATOM 2492  C C    . ALA A 1 42  ? 15.030  3.514   -2.152  1.00 0.00 ? 42  ALA A C    2  
ATOM 2493  O O    . ALA A 1 42  ? 15.954  4.231   -1.767  1.00 0.00 ? 42  ALA A O    2  
ATOM 2494  C CB   . ALA A 1 42  ? 13.631  2.444   -0.375  1.00 0.00 ? 42  ALA A CB   2  
ATOM 2495  H H    . ALA A 1 42  ? 12.013  2.564   -2.317  1.00 0.00 ? 42  ALA A H    2  
ATOM 2496  H HA   . ALA A 1 42  ? 13.552  4.486   -0.955  1.00 0.00 ? 42  ALA A HA   2  
ATOM 2497  H HB1  . ALA A 1 42  ? 13.143  1.569   -0.775  1.00 0.00 ? 42  ALA A HB1  2  
ATOM 2498  H HB2  . ALA A 1 42  ? 13.079  2.806   0.479   1.00 0.00 ? 42  ALA A HB2  2  
ATOM 2499  H HB3  . ALA A 1 42  ? 14.636  2.190   -0.073  1.00 0.00 ? 42  ALA A HB3  2  
ATOM 2500  N N    . GLU A 1 43  ? 15.136  2.692   -3.191  1.00 0.00 ? 43  GLU A N    2  
ATOM 2501  C CA   . GLU A 1 43  ? 16.373  2.583   -3.956  1.00 0.00 ? 43  GLU A CA   2  
ATOM 2502  C C    . GLU A 1 43  ? 16.755  3.928   -4.567  1.00 0.00 ? 43  GLU A C    2  
ATOM 2503  O O    . GLU A 1 43  ? 17.807  4.485   -4.258  1.00 0.00 ? 43  GLU A O    2  
ATOM 2504  C CB   . GLU A 1 43  ? 16.225  1.532   -5.058  1.00 0.00 ? 43  GLU A CB   2  
ATOM 2505  C CG   . GLU A 1 43  ? 17.552  1.063   -5.633  1.00 0.00 ? 43  GLU A CG   2  
ATOM 2506  C CD   . GLU A 1 43  ? 17.471  0.763   -7.117  1.00 0.00 ? 43  GLU A CD   2  
ATOM 2507  O OE1  . GLU A 1 43  ? 16.440  0.212   -7.556  1.00 0.00 ? 43  GLU A OE1  2  
ATOM 2508  O OE2  . GLU A 1 43  ? 18.439  1.080   -7.840  1.00 0.00 ? 43  GLU A OE2  2  
ATOM 2509  H H    . GLU A 1 43  ? 14.366  2.145   -3.449  1.00 0.00 ? 43  GLU A H    2  
ATOM 2510  H HA   . GLU A 1 43  ? 17.155  2.274   -3.279  1.00 0.00 ? 43  GLU A HA   2  
ATOM 2511  H HB2  . GLU A 1 43  ? 15.709  0.674   -4.654  1.00 0.00 ? 43  GLU A HB2  2  
ATOM 2512  H HB3  . GLU A 1 43  ? 15.637  1.950   -5.861  1.00 0.00 ? 43  GLU A HB3  2  
ATOM 2513  H HG2  . GLU A 1 43  ? 18.290  1.835   -5.477  1.00 0.00 ? 43  GLU A HG2  2  
ATOM 2514  H HG3  . GLU A 1 43  ? 17.856  0.165   -5.114  1.00 0.00 ? 43  GLU A HG3  2  
ATOM 2515  N N    . TYR A 1 44  ? 15.890  4.444   -5.435  1.00 0.00 ? 44  TYR A N    2  
ATOM 2516  C CA   . TYR A 1 44  ? 16.135  5.724   -6.089  1.00 0.00 ? 44  TYR A CA   2  
ATOM 2517  C C    . TYR A 1 44  ? 16.215  6.852   -5.065  1.00 0.00 ? 44  TYR A C    2  
ATOM 2518  O O    . TYR A 1 44  ? 16.902  7.851   -5.280  1.00 0.00 ? 44  TYR A O    2  
ATOM 2519  C CB   . TYR A 1 44  ? 15.031  6.021   -7.106  1.00 0.00 ? 44  TYR A CB   2  
ATOM 2520  C CG   . TYR A 1 44  ? 15.119  5.181   -8.359  1.00 0.00 ? 44  TYR A CG   2  
ATOM 2521  C CD1  . TYR A 1 44  ? 16.243  5.229   -9.174  1.00 0.00 ? 44  TYR A CD1  2  
ATOM 2522  C CD2  . TYR A 1 44  ? 14.077  4.339   -8.728  1.00 0.00 ? 44  TYR A CD2  2  
ATOM 2523  C CE1  . TYR A 1 44  ? 16.326  4.463   -10.321 1.00 0.00 ? 44  TYR A CE1  2  
ATOM 2524  C CE2  . TYR A 1 44  ? 14.153  3.569   -9.873  1.00 0.00 ? 44  TYR A CE2  2  
ATOM 2525  C CZ   . TYR A 1 44  ? 15.280  3.634   -10.666 1.00 0.00 ? 44  TYR A CZ   2  
ATOM 2526  O OH   . TYR A 1 44  ? 15.359  2.869   -11.807 1.00 0.00 ? 44  TYR A OH   2  
ATOM 2527  H H    . TYR A 1 44  ? 15.068  3.952   -5.641  1.00 0.00 ? 44  TYR A H    2  
ATOM 2528  H HA   . TYR A 1 44  ? 17.081  5.656   -6.606  1.00 0.00 ? 44  TYR A HA   2  
ATOM 2529  H HB2  . TYR A 1 44  ? 14.071  5.837   -6.649  1.00 0.00 ? 44  TYR A HB2  2  
ATOM 2530  H HB3  . TYR A 1 44  ? 15.092  7.060   -7.397  1.00 0.00 ? 44  TYR A HB3  2  
ATOM 2531  H HD1  . TYR A 1 44  ? 17.062  5.879   -8.901  1.00 0.00 ? 44  TYR A HD1  2  
ATOM 2532  H HD2  . TYR A 1 44  ? 13.196  4.290   -8.106  1.00 0.00 ? 44  TYR A HD2  2  
ATOM 2533  H HE1  . TYR A 1 44  ? 17.209  4.514   -10.941 1.00 0.00 ? 44  TYR A HE1  2  
ATOM 2534  H HE2  . TYR A 1 44  ? 13.333  2.921   -10.143 1.00 0.00 ? 44  TYR A HE2  2  
ATOM 2535  H HH   . TYR A 1 44  ? 16.250  2.522   -11.899 1.00 0.00 ? 44  TYR A HH   2  
ATOM 2536  N N    . GLY A 1 45  ? 15.508  6.686   -3.952  1.00 0.00 ? 45  GLY A N    2  
ATOM 2537  C CA   . GLY A 1 45  ? 15.511  7.698   -2.913  1.00 0.00 ? 45  GLY A CA   2  
ATOM 2538  C C    . GLY A 1 45  ? 14.259  8.554   -2.936  1.00 0.00 ? 45  GLY A C    2  
ATOM 2539  O O    . GLY A 1 45  ? 14.281  9.711   -2.517  1.00 0.00 ? 45  GLY A O    2  
ATOM 2540  H H    . GLY A 1 45  ? 14.978  5.870   -3.836  1.00 0.00 ? 45  GLY A H    2  
ATOM 2541  H HA2  . GLY A 1 45  ? 15.584  7.212   -1.952  1.00 0.00 ? 45  GLY A HA2  2  
ATOM 2542  H HA3  . GLY A 1 45  ? 16.372  8.337   -3.049  1.00 0.00 ? 45  GLY A HA3  2  
ATOM 2543  N N    . LEU A 1 46  ? 13.165  7.982   -3.428  1.00 0.00 ? 46  LEU A N    2  
ATOM 2544  C CA   . LEU A 1 46  ? 11.897  8.697   -3.505  1.00 0.00 ? 46  LEU A CA   2  
ATOM 2545  C C    . LEU A 1 46  ? 10.765  7.864   -2.913  1.00 0.00 ? 46  LEU A C    2  
ATOM 2546  O O    . LEU A 1 46  ? 10.780  6.635   -2.990  1.00 0.00 ? 46  LEU A O    2  
ATOM 2547  C CB   . LEU A 1 46  ? 11.578  9.053   -4.959  1.00 0.00 ? 46  LEU A CB   2  
ATOM 2548  C CG   . LEU A 1 46  ? 10.224  9.729   -5.180  1.00 0.00 ? 46  LEU A CG   2  
ATOM 2549  C CD1  . LEU A 1 46  ? 10.212  11.116  -4.558  1.00 0.00 ? 46  LEU A CD1  2  
ATOM 2550  C CD2  . LEU A 1 46  ? 9.904   9.806   -6.665  1.00 0.00 ? 46  LEU A CD2  2  
ATOM 2551  H H    . LEU A 1 46  ? 13.211  7.056   -3.746  1.00 0.00 ? 46  LEU A H    2  
ATOM 2552  H HA   . LEU A 1 46  ? 11.994  9.609   -2.934  1.00 0.00 ? 46  LEU A HA   2  
ATOM 2553  H HB2  . LEU A 1 46  ? 12.352  9.717   -5.322  1.00 0.00 ? 46  LEU A HB2  2  
ATOM 2554  H HB3  . LEU A 1 46  ? 11.601  8.143   -5.544  1.00 0.00 ? 46  LEU A HB3  2  
ATOM 2555  H HG   . LEU A 1 46  ? 9.454   9.142   -4.701  1.00 0.00 ? 46  LEU A HG   2  
ATOM 2556  H HD11 . LEU A 1 46  ? 11.221  11.498  -4.511  1.00 0.00 ? 46  LEU A HD11 2  
ATOM 2557  H HD12 . LEU A 1 46  ? 9.801   11.061  -3.561  1.00 0.00 ? 46  LEU A HD12 2  
ATOM 2558  H HD13 . LEU A 1 46  ? 9.605   11.776  -5.161  1.00 0.00 ? 46  LEU A HD13 2  
ATOM 2559  H HD21 . LEU A 1 46  ? 10.182  10.777  -7.044  1.00 0.00 ? 46  LEU A HD21 2  
ATOM 2560  H HD22 . LEU A 1 46  ? 8.846   9.649   -6.814  1.00 0.00 ? 46  LEU A HD22 2  
ATOM 2561  H HD23 . LEU A 1 46  ? 10.458  9.043   -7.193  1.00 0.00 ? 46  LEU A HD23 2  
ATOM 2562  N N    . GLY A 1 47  ? 9.785   8.539   -2.322  1.00 0.00 ? 47  GLY A N    2  
ATOM 2563  C CA   . GLY A 1 47  ? 8.660   7.844   -1.725  1.00 0.00 ? 47  GLY A CA   2  
ATOM 2564  C C    . GLY A 1 47  ? 7.857   7.059   -2.744  1.00 0.00 ? 47  GLY A C    2  
ATOM 2565  O O    . GLY A 1 47  ? 8.404   6.570   -3.733  1.00 0.00 ? 47  GLY A O    2  
ATOM 2566  H H    . GLY A 1 47  ? 9.827   9.518   -2.291  1.00 0.00 ? 47  GLY A H    2  
ATOM 2567  H HA2  . GLY A 1 47  ? 9.029   7.163   -0.973  1.00 0.00 ? 47  GLY A HA2  2  
ATOM 2568  H HA3  . GLY A 1 47  ? 8.012   8.568   -1.253  1.00 0.00 ? 47  GLY A HA3  2  
ATOM 2569  N N    . ILE A 1 48  ? 6.555   6.940   -2.503  1.00 0.00 ? 48  ILE A N    2  
ATOM 2570  C CA   . ILE A 1 48  ? 5.675   6.210   -3.408  1.00 0.00 ? 48  ILE A CA   2  
ATOM 2571  C C    . ILE A 1 48  ? 4.506   7.080   -3.859  1.00 0.00 ? 48  ILE A C    2  
ATOM 2572  O O    . ILE A 1 48  ? 3.758   7.607   -3.037  1.00 0.00 ? 48  ILE A O    2  
ATOM 2573  C CB   . ILE A 1 48  ? 5.123   4.933   -2.746  1.00 0.00 ? 48  ILE A CB   2  
ATOM 2574  C CG1  . ILE A 1 48  ? 6.257   4.134   -2.102  1.00 0.00 ? 48  ILE A CG1  2  
ATOM 2575  C CG2  . ILE A 1 48  ? 4.383   4.084   -3.768  1.00 0.00 ? 48  ILE A CG2  2  
ATOM 2576  C CD1  . ILE A 1 48  ? 7.287   3.640   -3.095  1.00 0.00 ? 48  ILE A CD1  2  
ATOM 2577  H H    . ILE A 1 48  ? 6.178   7.353   -1.700  1.00 0.00 ? 48  ILE A H    2  
ATOM 2578  H HA   . ILE A 1 48  ? 6.251   5.921   -4.275  1.00 0.00 ? 48  ILE A HA   2  
ATOM 2579  H HB   . ILE A 1 48  ? 4.419   5.226   -1.981  1.00 0.00 ? 48  ILE A HB   2  
ATOM 2580  H HG12 . ILE A 1 48  ? 6.764   4.758   -1.382  1.00 0.00 ? 48  ILE A HG12 2  
ATOM 2581  H HG13 . ILE A 1 48  ? 5.841   3.274   -1.598  1.00 0.00 ? 48  ILE A HG13 2  
ATOM 2582  H HG21 . ILE A 1 48  ? 4.535   3.038   -3.545  1.00 0.00 ? 48  ILE A HG21 2  
ATOM 2583  H HG22 . ILE A 1 48  ? 4.759   4.301   -4.756  1.00 0.00 ? 48  ILE A HG22 2  
ATOM 2584  H HG23 . ILE A 1 48  ? 3.327   4.311   -3.728  1.00 0.00 ? 48  ILE A HG23 2  
ATOM 2585  H HD11 . ILE A 1 48  ? 8.277   3.886   -2.739  1.00 0.00 ? 48  ILE A HD11 2  
ATOM 2586  H HD12 . ILE A 1 48  ? 7.121   4.114   -4.051  1.00 0.00 ? 48  ILE A HD12 2  
ATOM 2587  H HD13 . ILE A 1 48  ? 7.199   2.570   -3.203  1.00 0.00 ? 48  ILE A HD13 2  
ATOM 2588  N N    . TYR A 1 49  ? 4.356   7.225   -5.171  1.00 0.00 ? 49  TYR A N    2  
ATOM 2589  C CA   . TYR A 1 49  ? 3.278   8.030   -5.733  1.00 0.00 ? 49  TYR A CA   2  
ATOM 2590  C C    . TYR A 1 49  ? 2.513   7.250   -6.798  1.00 0.00 ? 49  TYR A C    2  
ATOM 2591  O O    . TYR A 1 49  ? 2.801   6.081   -7.050  1.00 0.00 ? 49  TYR A O    2  
ATOM 2592  C CB   . TYR A 1 49  ? 3.837   9.321   -6.334  1.00 0.00 ? 49  TYR A CB   2  
ATOM 2593  C CG   . TYR A 1 49  ? 4.520   10.216  -5.324  1.00 0.00 ? 49  TYR A CG   2  
ATOM 2594  C CD1  . TYR A 1 49  ? 3.778   10.987  -4.438  1.00 0.00 ? 49  TYR A CD1  2  
ATOM 2595  C CD2  . TYR A 1 49  ? 5.905   10.289  -5.257  1.00 0.00 ? 49  TYR A CD2  2  
ATOM 2596  C CE1  . TYR A 1 49  ? 4.398   11.806  -3.515  1.00 0.00 ? 49  TYR A CE1  2  
ATOM 2597  C CE2  . TYR A 1 49  ? 6.532   11.106  -4.335  1.00 0.00 ? 49  TYR A CE2  2  
ATOM 2598  C CZ   . TYR A 1 49  ? 5.774   11.862  -3.467  1.00 0.00 ? 49  TYR A CZ   2  
ATOM 2599  O OH   . TYR A 1 49  ? 6.395   12.676  -2.547  1.00 0.00 ? 49  TYR A OH   2  
ATOM 2600  H H    . TYR A 1 49  ? 4.985   6.779   -5.777  1.00 0.00 ? 49  TYR A H    2  
ATOM 2601  H HA   . TYR A 1 49  ? 2.600   8.282   -4.932  1.00 0.00 ? 49  TYR A HA   2  
ATOM 2602  H HB2  . TYR A 1 49  ? 4.560   9.071   -7.097  1.00 0.00 ? 49  TYR A HB2  2  
ATOM 2603  H HB3  . TYR A 1 49  ? 3.029   9.881   -6.782  1.00 0.00 ? 49  TYR A HB3  2  
ATOM 2604  H HD1  . TYR A 1 49  ? 2.699   10.941  -4.478  1.00 0.00 ? 49  TYR A HD1  2  
ATOM 2605  H HD2  . TYR A 1 49  ? 6.496   9.694   -5.938  1.00 0.00 ? 49  TYR A HD2  2  
ATOM 2606  H HE1  . TYR A 1 49  ? 3.804   12.399  -2.834  1.00 0.00 ? 49  TYR A HE1  2  
ATOM 2607  H HE2  . TYR A 1 49  ? 7.610   11.149  -4.298  1.00 0.00 ? 49  TYR A HE2  2  
ATOM 2608  H HH   . TYR A 1 49  ? 5.938   13.519  -2.507  1.00 0.00 ? 49  TYR A HH   2  
ATOM 2609  N N    . ILE A 1 50  ? 1.538   7.906   -7.418  1.00 0.00 ? 50  ILE A N    2  
ATOM 2610  C CA   . ILE A 1 50  ? 0.732   7.274   -8.456  1.00 0.00 ? 50  ILE A CA   2  
ATOM 2611  C C    . ILE A 1 50  ? 0.615   8.172   -9.683  1.00 0.00 ? 50  ILE A C    2  
ATOM 2612  O O    . ILE A 1 50  ? 0.484   9.390   -9.563  1.00 0.00 ? 50  ILE A O    2  
ATOM 2613  C CB   . ILE A 1 50  ? -0.681  6.937   -7.945  1.00 0.00 ? 50  ILE A CB   2  
ATOM 2614  C CG1  . ILE A 1 50  ? -0.601  6.208   -6.602  1.00 0.00 ? 50  ILE A CG1  2  
ATOM 2615  C CG2  . ILE A 1 50  ? -1.428  6.096   -8.967  1.00 0.00 ? 50  ILE A CG2  2  
ATOM 2616  C CD1  . ILE A 1 50  ? -1.946  6.030   -5.931  1.00 0.00 ? 50  ILE A CD1  2  
ATOM 2617  H H    . ILE A 1 50  ? 1.357   8.837   -7.173  1.00 0.00 ? 50  ILE A H    2  
ATOM 2618  H HA   . ILE A 1 50  ? 1.220   6.353   -8.741  1.00 0.00 ? 50  ILE A HA   2  
ATOM 2619  H HB   . ILE A 1 50  ? -1.221  7.862   -7.813  1.00 0.00 ? 50  ILE A HB   2  
ATOM 2620  H HG12 . ILE A 1 50  ? -0.176  5.228   -6.756  1.00 0.00 ? 50  ILE A HG12 2  
ATOM 2621  H HG13 . ILE A 1 50  ? 0.034   6.771   -5.931  1.00 0.00 ? 50  ILE A HG13 2  
ATOM 2622  H HG21 . ILE A 1 50  ? -1.350  6.558   -9.940  1.00 0.00 ? 50  ILE A HG21 2  
ATOM 2623  H HG22 . ILE A 1 50  ? -2.468  6.024   -8.685  1.00 0.00 ? 50  ILE A HG22 2  
ATOM 2624  H HG23 . ILE A 1 50  ? -0.997  5.105   -9.003  1.00 0.00 ? 50  ILE A HG23 2  
ATOM 2625  H HD11 . ILE A 1 50  ? -2.590  5.440   -6.566  1.00 0.00 ? 50  ILE A HD11 2  
ATOM 2626  H HD12 . ILE A 1 50  ? -2.395  6.997   -5.762  1.00 0.00 ? 50  ILE A HD12 2  
ATOM 2627  H HD13 . ILE A 1 50  ? -1.812  5.524   -4.986  1.00 0.00 ? 50  ILE A HD13 2  
ATOM 2628  N N    . THR A 1 51  ? 0.664   7.563   -10.863 1.00 0.00 ? 51  THR A N    2  
ATOM 2629  C CA   . THR A 1 51  ? 0.563   8.308   -12.112 1.00 0.00 ? 51  THR A CA   2  
ATOM 2630  C C    . THR A 1 51  ? 0.007   7.427   -13.228 1.00 0.00 ? 51  THR A C    2  
ATOM 2631  O O    . THR A 1 51  ? 0.466   7.489   -14.368 1.00 0.00 ? 51  THR A O    2  
ATOM 2632  C CB   . THR A 1 51  ? 1.933   8.858   -12.513 1.00 0.00 ? 51  THR A CB   2  
ATOM 2633  O OG1  . THR A 1 51  ? 2.826   7.803   -12.820 1.00 0.00 ? 51  THR A OG1  2  
ATOM 2634  C CG2  . THR A 1 51  ? 2.576   9.705   -11.437 1.00 0.00 ? 51  THR A CG2  2  
ATOM 2635  H H    . THR A 1 51  ? 0.771   6.589   -10.894 1.00 0.00 ? 51  THR A H    2  
ATOM 2636  H HA   . THR A 1 51  ? -0.113  9.134   -11.951 1.00 0.00 ? 51  THR A HA   2  
ATOM 2637  H HB   . THR A 1 51  ? 1.819   9.473   -13.394 1.00 0.00 ? 51  THR A HB   2  
ATOM 2638  H HG1  . THR A 1 51  ? 2.978   7.272   -12.036 1.00 0.00 ? 51  THR A HG1  2  
ATOM 2639  H HG21 . THR A 1 51  ? 3.455   10.188  -11.837 1.00 0.00 ? 51  THR A HG21 2  
ATOM 2640  H HG22 . THR A 1 51  ? 2.857   9.078   -10.604 1.00 0.00 ? 51  THR A HG22 2  
ATOM 2641  H HG23 . THR A 1 51  ? 1.875   10.455  -11.102 1.00 0.00 ? 51  THR A HG23 2  
ATOM 2642  N N    . GLY A 1 52  ? -0.984  6.609   -12.889 1.00 0.00 ? 52  GLY A N    2  
ATOM 2643  C CA   . GLY A 1 52  ? -1.586  5.729   -13.874 1.00 0.00 ? 52  GLY A CA   2  
ATOM 2644  C C    . GLY A 1 52  ? -2.856  5.076   -13.367 1.00 0.00 ? 52  GLY A C    2  
ATOM 2645  O O    . GLY A 1 52  ? -2.956  4.724   -12.191 1.00 0.00 ? 52  GLY A O    2  
ATOM 2646  H H    . GLY A 1 52  ? -1.309  6.603   -11.965 1.00 0.00 ? 52  GLY A H    2  
ATOM 2647  H HA2  . GLY A 1 52  ? -1.817  6.302   -14.759 1.00 0.00 ? 52  GLY A HA2  2  
ATOM 2648  H HA3  . GLY A 1 52  ? -0.875  4.957   -14.132 1.00 0.00 ? 52  GLY A HA3  2  
ATOM 2649  N N    . VAL A 1 53  ? -3.830  4.913   -14.257 1.00 0.00 ? 53  VAL A N    2  
ATOM 2650  C CA   . VAL A 1 53  ? -5.102  4.299   -13.894 1.00 0.00 ? 53  VAL A CA   2  
ATOM 2651  C C    . VAL A 1 53  ? -5.663  3.477   -15.051 1.00 0.00 ? 53  VAL A C    2  
ATOM 2652  O O    . VAL A 1 53  ? -5.946  4.011   -16.123 1.00 0.00 ? 53  VAL A O    2  
ATOM 2653  C CB   . VAL A 1 53  ? -6.141  5.357   -13.480 1.00 0.00 ? 53  VAL A CB   2  
ATOM 2654  C CG1  . VAL A 1 53  ? -7.389  4.692   -12.919 1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2655  C CG2  . VAL A 1 53  ? -5.544  6.325   -12.470 1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2656  H H    . VAL A 1 53  ? -3.691  5.215   -15.178 1.00 0.00 ? 53  VAL A H    2  
ATOM 2657  H HA   . VAL A 1 53  ? -4.929  3.645   -13.052 1.00 0.00 ? 53  VAL A HA   2  
ATOM 2658  H HB   . VAL A 1 53  ? -6.424  5.918   -14.360 1.00 0.00 ? 53  VAL A HB   2  
ATOM 2659  H HG11 . VAL A 1 53  ? -7.225  4.436   -11.883 1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2660  H HG12 . VAL A 1 53  ? -7.602  3.796   -13.483 1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2661  H HG13 . VAL A 1 53  ? -8.224  5.372   -12.995 1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2662  H HG21 . VAL A 1 53  ? -6.255  7.109   -12.259 1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2663  H HG22 . VAL A 1 53  ? -4.641  6.757   -12.875 1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2664  H HG23 . VAL A 1 53  ? -5.312  5.794   -11.558 1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2665  N N    . ASP A 1 54  ? -5.820  2.177   -14.825 1.00 0.00 ? 54  ASP A N    2  
ATOM 2666  C CA   . ASP A 1 54  ? -6.347  1.283   -15.849 1.00 0.00 ? 54  ASP A CA   2  
ATOM 2667  C C    . ASP A 1 54  ? -7.847  1.497   -16.041 1.00 0.00 ? 54  ASP A C    2  
ATOM 2668  O O    . ASP A 1 54  ? -8.571  1.764   -15.081 1.00 0.00 ? 54  ASP A O    2  
ATOM 2669  C CB   . ASP A 1 54  ? -6.071  -0.175  -15.473 1.00 0.00 ? 54  ASP A CB   2  
ATOM 2670  C CG   . ASP A 1 54  ? -4.865  -0.741  -16.199 1.00 0.00 ? 54  ASP A CG   2  
ATOM 2671  O OD1  . ASP A 1 54  ? -5.011  -1.135  -17.375 1.00 0.00 ? 54  ASP A OD1  2  
ATOM 2672  O OD2  . ASP A 1 54  ? -3.775  -0.788  -15.590 1.00 0.00 ? 54  ASP A OD2  2  
ATOM 2673  H H    . ASP A 1 54  ? -5.577  1.811   -13.949 1.00 0.00 ? 54  ASP A H    2  
ATOM 2674  H HA   . ASP A 1 54  ? -5.841  1.508   -16.775 1.00 0.00 ? 54  ASP A HA   2  
ATOM 2675  H HB2  . ASP A 1 54  ? -5.889  -0.238  -14.410 1.00 0.00 ? 54  ASP A HB2  2  
ATOM 2676  H HB3  . ASP A 1 54  ? -6.933  -0.776  -15.723 1.00 0.00 ? 54  ASP A HB3  2  
ATOM 2677  N N    . PRO A 1 55  ? -8.336  1.383   -17.288 1.00 0.00 ? 55  PRO A N    2  
ATOM 2678  C CA   . PRO A 1 55  ? -9.757  1.566   -17.598 1.00 0.00 ? 55  PRO A CA   2  
ATOM 2679  C C    . PRO A 1 55  ? -10.606 0.381   -17.149 1.00 0.00 ? 55  PRO A C    2  
ATOM 2680  O O    . PRO A 1 55  ? -10.623 -0.664  -17.798 1.00 0.00 ? 55  PRO A O    2  
ATOM 2681  C CB   . PRO A 1 55  ? -9.770  1.686   -19.121 1.00 0.00 ? 55  PRO A CB   2  
ATOM 2682  C CG   . PRO A 1 55  ? -8.585  0.902   -19.568 1.00 0.00 ? 55  PRO A CG   2  
ATOM 2683  C CD   . PRO A 1 55  ? -7.545  1.066   -18.494 1.00 0.00 ? 55  PRO A CD   2  
ATOM 2684  H HA   . PRO A 1 55  ? -10.145 2.473   -17.158 1.00 0.00 ? 55  PRO A HA   2  
ATOM 2685  H HB2  . PRO A 1 55  ? -10.690 1.273   -19.510 1.00 0.00 ? 55  PRO A HB2  2  
ATOM 2686  H HB3  . PRO A 1 55  ? -9.685  2.724   -19.405 1.00 0.00 ? 55  PRO A HB3  2  
ATOM 2687  H HG2  . PRO A 1 55  ? -8.854  -0.139  -19.675 1.00 0.00 ? 55  PRO A HG2  2  
ATOM 2688  H HG3  . PRO A 1 55  ? -8.220  1.293   -20.507 1.00 0.00 ? 55  PRO A HG3  2  
ATOM 2689  H HD2  . PRO A 1 55  ? -6.992  0.147   -18.360 1.00 0.00 ? 55  PRO A HD2  2  
ATOM 2690  H HD3  . PRO A 1 55  ? -6.876  1.877   -18.737 1.00 0.00 ? 55  PRO A HD3  2  
ATOM 2691  N N    . GLY A 1 56  ? -11.311 0.552   -16.035 1.00 0.00 ? 56  GLY A N    2  
ATOM 2692  C CA   . GLY A 1 56  ? -12.152 -0.512  -15.520 1.00 0.00 ? 56  GLY A CA   2  
ATOM 2693  C C    . GLY A 1 56  ? -11.425 -1.399  -14.529 1.00 0.00 ? 56  GLY A C    2  
ATOM 2694  O O    . GLY A 1 56  ? -11.668 -2.606  -14.471 1.00 0.00 ? 56  GLY A O    2  
ATOM 2695  H H    . GLY A 1 56  ? -11.258 1.407   -15.559 1.00 0.00 ? 56  GLY A H    2  
ATOM 2696  H HA2  . GLY A 1 56  ? -13.009 -0.073  -15.032 1.00 0.00 ? 56  GLY A HA2  2  
ATOM 2697  H HA3  . GLY A 1 56  ? -12.493 -1.118  -16.346 1.00 0.00 ? 56  GLY A HA3  2  
ATOM 2698  N N    . SER A 1 57  ? -10.531 -0.803  -13.748 1.00 0.00 ? 57  SER A N    2  
ATOM 2699  C CA   . SER A 1 57  ? -9.767  -1.548  -12.754 1.00 0.00 ? 57  SER A CA   2  
ATOM 2700  C C    . SER A 1 57  ? -10.413 -1.438  -11.377 1.00 0.00 ? 57  SER A C    2  
ATOM 2701  O O    . SER A 1 57  ? -11.317 -0.630  -11.167 1.00 0.00 ? 57  SER A O    2  
ATOM 2702  C CB   . SER A 1 57  ? -8.327  -1.033  -12.697 1.00 0.00 ? 57  SER A CB   2  
ATOM 2703  O OG   . SER A 1 57  ? -8.259  0.216   -12.031 1.00 0.00 ? 57  SER A OG   2  
ATOM 2704  H H    . SER A 1 57  ? -10.382 0.161   -13.841 1.00 0.00 ? 57  SER A H    2  
ATOM 2705  H HA   . SER A 1 57  ? -9.757  -2.584  -13.053 1.00 0.00 ? 57  SER A HA   2  
ATOM 2706  H HB2  . SER A 1 57  ? -7.713  -1.745  -12.161 1.00 0.00 ? 57  SER A HB2  2  
ATOM 2707  H HB3  . SER A 1 57  ? -7.950  -0.912  -13.703 1.00 0.00 ? 57  SER A HB3  2  
ATOM 2708  H HG   . SER A 1 57  ? -8.757  0.871   -12.526 1.00 0.00 ? 57  SER A HG   2  
ATOM 2709  N N    . GLU A 1 58  ? -9.944  -2.257  -10.442 1.00 0.00 ? 58  GLU A N    2  
ATOM 2710  C CA   . GLU A 1 58  ? -10.477 -2.253  -9.085  1.00 0.00 ? 58  GLU A CA   2  
ATOM 2711  C C    . GLU A 1 58  ? -10.120 -0.957  -8.364  1.00 0.00 ? 58  GLU A C    2  
ATOM 2712  O O    . GLU A 1 58  ? -10.876 -0.478  -7.517  1.00 0.00 ? 58  GLU A O    2  
ATOM 2713  C CB   . GLU A 1 58  ? -9.939  -3.451  -8.299  1.00 0.00 ? 58  GLU A CB   2  
ATOM 2714  C CG   . GLU A 1 58  ? -10.495 -4.785  -8.768  1.00 0.00 ? 58  GLU A CG   2  
ATOM 2715  C CD   . GLU A 1 58  ? -11.974 -4.937  -8.473  1.00 0.00 ? 58  GLU A CD   2  
ATOM 2716  O OE1  . GLU A 1 58  ? -12.366 -4.761  -7.300  1.00 0.00 ? 58  GLU A OE1  2  
ATOM 2717  O OE2  . GLU A 1 58  ? -12.740 -5.231  -9.414  1.00 0.00 ? 58  GLU A OE2  2  
ATOM 2718  H H    . GLU A 1 58  ? -9.222  -2.880  -10.670 1.00 0.00 ? 58  GLU A H    2  
ATOM 2719  H HA   . GLU A 1 58  ? -11.552 -2.331  -9.150  1.00 0.00 ? 58  GLU A HA   2  
ATOM 2720  H HB2  . GLU A 1 58  ? -8.864  -3.478  -8.398  1.00 0.00 ? 58  GLU A HB2  2  
ATOM 2721  H HB3  . GLU A 1 58  ? -10.193 -3.326  -7.256  1.00 0.00 ? 58  GLU A HB3  2  
ATOM 2722  H HG2  . GLU A 1 58  ? -10.346 -4.867  -9.834  1.00 0.00 ? 58  GLU A HG2  2  
ATOM 2723  H HG3  . GLU A 1 58  ? -9.959  -5.579  -8.268  1.00 0.00 ? 58  GLU A HG3  2  
ATOM 2724  N N    . ALA A 1 59  ? -8.967  -0.393  -8.706  1.00 0.00 ? 59  ALA A N    2  
ATOM 2725  C CA   . ALA A 1 59  ? -8.511  0.848   -8.092  1.00 0.00 ? 59  ALA A CA   2  
ATOM 2726  C C    . ALA A 1 59  ? -9.321  2.039   -8.594  1.00 0.00 ? 59  ALA A C    2  
ATOM 2727  O O    . ALA A 1 59  ? -9.593  2.977   -7.844  1.00 0.00 ? 59  ALA A O    2  
ATOM 2728  C CB   . ALA A 1 59  ? -7.030  1.060   -8.370  1.00 0.00 ? 59  ALA A CB   2  
ATOM 2729  H H    . ALA A 1 59  ? -8.409  -0.822  -9.387  1.00 0.00 ? 59  ALA A H    2  
ATOM 2730  H HA   . ALA A 1 59  ? -8.643  0.760   -7.024  1.00 0.00 ? 59  ALA A HA   2  
ATOM 2731  H HB1  . ALA A 1 59  ? -6.630  1.773   -7.664  1.00 0.00 ? 59  ALA A HB1  2  
ATOM 2732  H HB2  . ALA A 1 59  ? -6.903  1.438   -9.373  1.00 0.00 ? 59  ALA A HB2  2  
ATOM 2733  H HB3  . ALA A 1 59  ? -6.507  0.121   -8.270  1.00 0.00 ? 59  ALA A HB3  2  
ATOM 2734  N N    . GLU A 1 60  ? -9.705  1.994   -9.865  1.00 0.00 ? 60  GLU A N    2  
ATOM 2735  C CA   . GLU A 1 60  ? -10.485 3.070   -10.465 1.00 0.00 ? 60  GLU A CA   2  
ATOM 2736  C C    . GLU A 1 60  ? -11.920 3.055   -9.949  1.00 0.00 ? 60  GLU A C    2  
ATOM 2737  O O    . GLU A 1 60  ? -12.563 4.099   -9.843  1.00 0.00 ? 60  GLU A O    2  
ATOM 2738  C CB   . GLU A 1 60  ? -10.478 2.943   -11.990 1.00 0.00 ? 60  GLU A CB   2  
ATOM 2739  C CG   . GLU A 1 60  ? -10.950 4.197   -12.707 1.00 0.00 ? 60  GLU A CG   2  
ATOM 2740  C CD   . GLU A 1 60  ? -12.435 4.170   -13.014 1.00 0.00 ? 60  GLU A CD   2  
ATOM 2741  O OE1  . GLU A 1 60  ? -12.900 3.174   -13.607 1.00 0.00 ? 60  GLU A OE1  2  
ATOM 2742  O OE2  . GLU A 1 60  ? -13.132 5.144   -12.662 1.00 0.00 ? 60  GLU A OE2  2  
ATOM 2743  H H    . GLU A 1 60  ? -9.458  1.220   -10.412 1.00 0.00 ? 60  GLU A H    2  
ATOM 2744  H HA   . GLU A 1 60  ? -10.025 4.007   -10.189 1.00 0.00 ? 60  GLU A HA   2  
ATOM 2745  H HB2  . GLU A 1 60  ? -9.473  2.724   -12.317 1.00 0.00 ? 60  GLU A HB2  2  
ATOM 2746  H HB3  . GLU A 1 60  ? -11.126 2.127   -12.275 1.00 0.00 ? 60  GLU A HB3  2  
ATOM 2747  H HG2  . GLU A 1 60  ? -10.744 5.053   -12.081 1.00 0.00 ? 60  GLU A HG2  2  
ATOM 2748  H HG3  . GLU A 1 60  ? -10.407 4.292   -13.635 1.00 0.00 ? 60  GLU A HG3  2  
ATOM 2749  N N    . GLY A 1 61  ? -12.417 1.865   -9.630  1.00 0.00 ? 61  GLY A N    2  
ATOM 2750  C CA   . GLY A 1 61  ? -13.772 1.737   -9.127  1.00 0.00 ? 61  GLY A CA   2  
ATOM 2751  C C    . GLY A 1 61  ? -13.948 2.371   -7.762  1.00 0.00 ? 61  GLY A C    2  
ATOM 2752  O O    . GLY A 1 61  ? -14.935 3.065   -7.516  1.00 0.00 ? 61  GLY A O    2  
ATOM 2753  H H    . GLY A 1 61  ? -11.858 1.066   -9.735  1.00 0.00 ? 61  GLY A H    2  
ATOM 2754  H HA2  . GLY A 1 61  ? -14.448 2.213   -9.824  1.00 0.00 ? 61  GLY A HA2  2  
ATOM 2755  H HA3  . GLY A 1 61  ? -14.022 0.688   -9.060  1.00 0.00 ? 61  GLY A HA3  2  
ATOM 2756  N N    . SER A 1 62  ? -12.990 2.133   -6.873  1.00 0.00 ? 62  SER A N    2  
ATOM 2757  C CA   . SER A 1 62  ? -13.044 2.686   -5.525  1.00 0.00 ? 62  SER A CA   2  
ATOM 2758  C C    . SER A 1 62  ? -13.070 4.211   -5.562  1.00 0.00 ? 62  SER A C    2  
ATOM 2759  O O    . SER A 1 62  ? -13.905 4.843   -4.914  1.00 0.00 ? 62  SER A O    2  
ATOM 2760  C CB   . SER A 1 62  ? -11.845 2.206   -4.706  1.00 0.00 ? 62  SER A CB   2  
ATOM 2761  O OG   . SER A 1 62  ? -12.177 2.092   -3.333  1.00 0.00 ? 62  SER A OG   2  
ATOM 2762  H H    . SER A 1 62  ? -12.229 1.572   -7.129  1.00 0.00 ? 62  SER A H    2  
ATOM 2763  H HA   . SER A 1 62  ? -13.952 2.334   -5.058  1.00 0.00 ? 62  SER A HA   2  
ATOM 2764  H HB2  . SER A 1 62  ? -11.529 1.238   -5.068  1.00 0.00 ? 62  SER A HB2  2  
ATOM 2765  H HB3  . SER A 1 62  ? -11.034 2.912   -4.811  1.00 0.00 ? 62  SER A HB3  2  
ATOM 2766  H HG   . SER A 1 62  ? -12.878 1.446   -3.225  1.00 0.00 ? 62  SER A HG   2  
ATOM 2767  N N    . GLY A 1 63  ? -12.153 4.795   -6.325  1.00 0.00 ? 63  GLY A N    2  
ATOM 2768  C CA   . GLY A 1 63  ? -12.088 6.241   -6.434  1.00 0.00 ? 63  GLY A CA   2  
ATOM 2769  C C    . GLY A 1 63  ? -10.676 6.772   -6.283  1.00 0.00 ? 63  GLY A C    2  
ATOM 2770  O O    . GLY A 1 63  ? -10.448 7.760   -5.585  1.00 0.00 ? 63  GLY A O    2  
ATOM 2771  H H    . GLY A 1 63  ? -11.514 4.240   -6.820  1.00 0.00 ? 63  GLY A H    2  
ATOM 2772  H HA2  . GLY A 1 63  ? -12.471 6.536   -7.400  1.00 0.00 ? 63  GLY A HA2  2  
ATOM 2773  H HA3  . GLY A 1 63  ? -12.709 6.677   -5.664  1.00 0.00 ? 63  GLY A HA3  2  
ATOM 2774  N N    . LEU A 1 64  ? -9.726  6.115   -6.940  1.00 0.00 ? 64  LEU A N    2  
ATOM 2775  C CA   . LEU A 1 64  ? -8.328  6.526   -6.876  1.00 0.00 ? 64  LEU A CA   2  
ATOM 2776  C C    . LEU A 1 64  ? -7.980  7.448   -8.041  1.00 0.00 ? 64  LEU A C    2  
ATOM 2777  O O    . LEU A 1 64  ? -8.544  7.330   -9.129  1.00 0.00 ? 64  LEU A O    2  
ATOM 2778  C CB   . LEU A 1 64  ? -7.413  5.299   -6.887  1.00 0.00 ? 64  LEU A CB   2  
ATOM 2779  C CG   . LEU A 1 64  ? -6.949  4.825   -5.508  1.00 0.00 ? 64  LEU A CG   2  
ATOM 2780  C CD1  . LEU A 1 64  ? -6.900  3.306   -5.452  1.00 0.00 ? 64  LEU A CD1  2  
ATOM 2781  C CD2  . LEU A 1 64  ? -5.588  5.417   -5.172  1.00 0.00 ? 64  LEU A CD2  2  
ATOM 2782  H H    . LEU A 1 64  ? -9.971  5.335   -7.480  1.00 0.00 ? 64  LEU A H    2  
ATOM 2783  H HA   . LEU A 1 64  ? -8.183  7.064   -5.952  1.00 0.00 ? 64  LEU A HA   2  
ATOM 2784  H HB2  . LEU A 1 64  ? -7.942  4.487   -7.366  1.00 0.00 ? 64  LEU A HB2  2  
ATOM 2785  H HB3  . LEU A 1 64  ? -6.538  5.531   -7.475  1.00 0.00 ? 64  LEU A HB3  2  
ATOM 2786  H HG   . LEU A 1 64  ? -7.655  5.162   -4.763  1.00 0.00 ? 64  LEU A HG   2  
ATOM 2787  H HD11 . LEU A 1 64  ? -6.813  2.986   -4.425  1.00 0.00 ? 64  LEU A HD11 2  
ATOM 2788  H HD12 . LEU A 1 64  ? -6.046  2.954   -6.012  1.00 0.00 ? 64  LEU A HD12 2  
ATOM 2789  H HD13 . LEU A 1 64  ? -7.804  2.900   -5.881  1.00 0.00 ? 64  LEU A HD13 2  
ATOM 2790  H HD21 . LEU A 1 64  ? -5.028  4.715   -4.575  1.00 0.00 ? 64  LEU A HD21 2  
ATOM 2791  H HD22 . LEU A 1 64  ? -5.722  6.335   -4.618  1.00 0.00 ? 64  LEU A HD22 2  
ATOM 2792  H HD23 . LEU A 1 64  ? -5.051  5.624   -6.085  1.00 0.00 ? 64  LEU A HD23 2  
ATOM 2793  N N    . LYS A 1 65  ? -7.047  8.365   -7.804  1.00 0.00 ? 65  LYS A N    2  
ATOM 2794  C CA   . LYS A 1 65  ? -6.624  9.307   -8.834  1.00 0.00 ? 65  LYS A CA   2  
ATOM 2795  C C    . LYS A 1 65  ? -5.103  9.332   -8.956  1.00 0.00 ? 65  LYS A C    2  
ATOM 2796  O O    . LYS A 1 65  ? -4.397  8.707   -8.165  1.00 0.00 ? 65  LYS A O    2  
ATOM 2797  C CB   . LYS A 1 65  ? -7.143  10.711  -8.517  1.00 0.00 ? 65  LYS A CB   2  
ATOM 2798  C CG   . LYS A 1 65  ? -8.644  10.764  -8.276  1.00 0.00 ? 65  LYS A CG   2  
ATOM 2799  C CD   . LYS A 1 65  ? -8.968  11.062  -6.820  1.00 0.00 ? 65  LYS A CD   2  
ATOM 2800  C CE   . LYS A 1 65  ? -10.128 12.038  -6.696  1.00 0.00 ? 65  LYS A CE   2  
ATOM 2801  N NZ   . LYS A 1 65  ? -11.445 11.346  -6.764  1.00 0.00 ? 65  LYS A NZ   2  
ATOM 2802  H H    . LYS A 1 65  ? -6.634  8.410   -6.917  1.00 0.00 ? 65  LYS A H    2  
ATOM 2803  H HA   . LYS A 1 65  ? -7.043  8.982   -9.774  1.00 0.00 ? 65  LYS A HA   2  
ATOM 2804  H HB2  . LYS A 1 65  ? -6.643  11.075  -7.631  1.00 0.00 ? 65  LYS A HB2  2  
ATOM 2805  H HB3  . LYS A 1 65  ? -6.910  11.364  -9.345  1.00 0.00 ? 65  LYS A HB3  2  
ATOM 2806  H HG2  . LYS A 1 65  ? -9.070  11.540  -8.894  1.00 0.00 ? 65  LYS A HG2  2  
ATOM 2807  H HG3  . LYS A 1 65  ? -9.075  9.810   -8.544  1.00 0.00 ? 65  LYS A HG3  2  
ATOM 2808  H HD2  . LYS A 1 65  ? -9.233  10.141  -6.324  1.00 0.00 ? 65  LYS A HD2  2  
ATOM 2809  H HD3  . LYS A 1 65  ? -8.096  11.491  -6.347  1.00 0.00 ? 65  LYS A HD3  2  
ATOM 2810  H HE2  . LYS A 1 65  ? -10.051 12.552  -5.749  1.00 0.00 ? 65  LYS A HE2  2  
ATOM 2811  H HE3  . LYS A 1 65  ? -10.065 12.756  -7.500  1.00 0.00 ? 65  LYS A HE3  2  
ATOM 2812  H HZ1  . LYS A 1 65  ? -11.346 10.357  -6.463  1.00 0.00 ? 65  LYS A HZ1  2  
ATOM 2813  H HZ2  . LYS A 1 65  ? -11.809 11.366  -7.738  1.00 0.00 ? 65  LYS A HZ2  2  
ATOM 2814  H HZ3  . LYS A 1 65  ? -12.130 11.820  -6.141  1.00 0.00 ? 65  LYS A HZ3  2  
ATOM 2815  N N    . VAL A 1 66  ? -4.607  10.059  -9.952  1.00 0.00 ? 66  VAL A N    2  
ATOM 2816  C CA   . VAL A 1 66  ? -3.171  10.166  -10.178 1.00 0.00 ? 66  VAL A CA   2  
ATOM 2817  C C    . VAL A 1 66  ? -2.569  11.297  -9.350  1.00 0.00 ? 66  VAL A C    2  
ATOM 2818  O O    . VAL A 1 66  ? -3.101  12.406  -9.318  1.00 0.00 ? 66  VAL A O    2  
ATOM 2819  C CB   . VAL A 1 66  ? -2.852  10.407  -11.665 1.00 0.00 ? 66  VAL A CB   2  
ATOM 2820  C CG1  . VAL A 1 66  ? -3.121  9.152   -12.480 1.00 0.00 ? 66  VAL A CG1  2  
ATOM 2821  C CG2  . VAL A 1 66  ? -3.657  11.583  -12.200 1.00 0.00 ? 66  VAL A CG2  2  
ATOM 2822  H H    . VAL A 1 66  ? -5.221  10.535  -10.548 1.00 0.00 ? 66  VAL A H    2  
ATOM 2823  H HA   . VAL A 1 66  ? -2.715  9.233   -9.880  1.00 0.00 ? 66  VAL A HA   2  
ATOM 2824  H HB   . VAL A 1 66  ? -1.803  10.648  -11.753 1.00 0.00 ? 66  VAL A HB   2  
ATOM 2825  H HG11 . VAL A 1 66  ? -3.493  9.430   -13.456 1.00 0.00 ? 66  VAL A HG11 2  
ATOM 2826  H HG12 . VAL A 1 66  ? -3.856  8.544   -11.974 1.00 0.00 ? 66  VAL A HG12 2  
ATOM 2827  H HG13 . VAL A 1 66  ? -2.204  8.592   -12.590 1.00 0.00 ? 66  VAL A HG13 2  
ATOM 2828  H HG21 . VAL A 1 66  ? -4.527  11.215  -12.724 1.00 0.00 ? 66  VAL A HG21 2  
ATOM 2829  H HG22 . VAL A 1 66  ? -3.045  12.160  -12.876 1.00 0.00 ? 66  VAL A HG22 2  
ATOM 2830  H HG23 . VAL A 1 66  ? -3.972  12.207  -11.377 1.00 0.00 ? 66  VAL A HG23 2  
ATOM 2831  N N    . GLY A 1 67  ? -1.456  11.008  -8.683  1.00 0.00 ? 67  GLY A N    2  
ATOM 2832  C CA   . GLY A 1 67  ? -0.800  12.012  -7.866  1.00 0.00 ? 67  GLY A CA   2  
ATOM 2833  C C    . GLY A 1 67  ? -0.880  11.699  -6.383  1.00 0.00 ? 67  GLY A C    2  
ATOM 2834  O O    . GLY A 1 67  ? -0.097  12.223  -5.590  1.00 0.00 ? 67  GLY A O    2  
ATOM 2835  H H    . GLY A 1 67  ? -1.076  10.107  -8.747  1.00 0.00 ? 67  GLY A H    2  
ATOM 2836  H HA2  . GLY A 1 67  ? 0.241   12.070  -8.154  1.00 0.00 ? 67  GLY A HA2  2  
ATOM 2837  H HA3  . GLY A 1 67  ? -1.270  12.970  -8.045  1.00 0.00 ? 67  GLY A HA3  2  
ATOM 2838  N N    . ASP A 1 68  ? -1.828  10.845  -6.006  1.00 0.00 ? 68  ASP A N    2  
ATOM 2839  C CA   . ASP A 1 68  ? -2.006  10.467  -4.607  1.00 0.00 ? 68  ASP A CA   2  
ATOM 2840  C C    . ASP A 1 68  ? -0.710  9.913   -4.021  1.00 0.00 ? 68  ASP A C    2  
ATOM 2841  O O    . ASP A 1 68  ? 0.100   9.317   -4.731  1.00 0.00 ? 68  ASP A O    2  
ATOM 2842  C CB   . ASP A 1 68  ? -3.122  9.429   -4.477  1.00 0.00 ? 68  ASP A CB   2  
ATOM 2843  C CG   . ASP A 1 68  ? -4.478  10.066  -4.243  1.00 0.00 ? 68  ASP A CG   2  
ATOM 2844  O OD1  . ASP A 1 68  ? -4.714  11.171  -4.775  1.00 0.00 ? 68  ASP A OD1  2  
ATOM 2845  O OD2  . ASP A 1 68  ? -5.304  9.459   -3.530  1.00 0.00 ? 68  ASP A OD2  2  
ATOM 2846  H H    . ASP A 1 68  ? -2.423  10.462  -6.683  1.00 0.00 ? 68  ASP A H    2  
ATOM 2847  H HA   . ASP A 1 68  ? -2.285  11.353  -4.057  1.00 0.00 ? 68  ASP A HA   2  
ATOM 2848  H HB2  . ASP A 1 68  ? -3.172  8.846   -5.386  1.00 0.00 ? 68  ASP A HB2  2  
ATOM 2849  H HB3  . ASP A 1 68  ? -2.902  8.776   -3.643  1.00 0.00 ? 68  ASP A HB3  2  
ATOM 2850  N N    . GLN A 1 69  ? -0.521  10.116  -2.721  1.00 0.00 ? 69  GLN A N    2  
ATOM 2851  C CA   . GLN A 1 69  ? 0.674   9.638   -2.038  1.00 0.00 ? 69  GLN A CA   2  
ATOM 2852  C C    . GLN A 1 69  ? 0.349   8.456   -1.132  1.00 0.00 ? 69  GLN A C    2  
ATOM 2853  O O    . GLN A 1 69  ? -0.320  8.609   -0.111  1.00 0.00 ? 69  GLN A O    2  
ATOM 2854  C CB   . GLN A 1 69  ? 1.303   10.766  -1.218  1.00 0.00 ? 69  GLN A CB   2  
ATOM 2855  C CG   . GLN A 1 69  ? 2.790   10.578  -0.963  1.00 0.00 ? 69  GLN A CG   2  
ATOM 2856  C CD   . GLN A 1 69  ? 3.068   9.716   0.252   1.00 0.00 ? 69  GLN A CD   2  
ATOM 2857  O OE1  . GLN A 1 69  ? 2.817   10.122  1.388   1.00 0.00 ? 69  GLN A OE1  2  
ATOM 2858  N NE2  . GLN A 1 69  ? 3.591   8.517   0.021   1.00 0.00 ? 69  GLN A NE2  2  
ATOM 2859  H H    . GLN A 1 69  ? -1.204  10.598  -2.209  1.00 0.00 ? 69  GLN A H    2  
ATOM 2860  H HA   . GLN A 1 69  ? 1.379   9.317   -2.790  1.00 0.00 ? 69  GLN A HA   2  
ATOM 2861  H HB2  . GLN A 1 69  ? 1.165   11.699  -1.744  1.00 0.00 ? 69  GLN A HB2  2  
ATOM 2862  H HB3  . GLN A 1 69  ? 0.801   10.824  -0.263  1.00 0.00 ? 69  GLN A HB3  2  
ATOM 2863  H HG2  . GLN A 1 69  ? 3.233   10.108  -1.828  1.00 0.00 ? 69  GLN A HG2  2  
ATOM 2864  H HG3  . GLN A 1 69  ? 3.241   11.547  -0.810  1.00 0.00 ? 69  GLN A HG3  2  
ATOM 2865  H HE21 . GLN A 1 69  ? 3.765   8.260   -0.909  1.00 0.00 ? 69  GLN A HE21 2  
ATOM 2866  H HE22 . GLN A 1 69  ? 3.780   7.938   0.788   1.00 0.00 ? 69  GLN A HE22 2  
ATOM 2867  N N    . ILE A 1 70  ? 0.829   7.276   -1.512  1.00 0.00 ? 70  ILE A N    2  
ATOM 2868  C CA   . ILE A 1 70  ? 0.590   6.066   -0.734  1.00 0.00 ? 70  ILE A CA   2  
ATOM 2869  C C    . ILE A 1 70  ? 1.432   6.056   0.537   1.00 0.00 ? 70  ILE A C    2  
ATOM 2870  O O    . ILE A 1 70  ? 2.659   5.962   0.480   1.00 0.00 ? 70  ILE A O    2  
ATOM 2871  C CB   . ILE A 1 70  ? 0.901   4.799   -1.552  1.00 0.00 ? 70  ILE A CB   2  
ATOM 2872  C CG1  . ILE A 1 70  ? 0.226   4.871   -2.923  1.00 0.00 ? 70  ILE A CG1  2  
ATOM 2873  C CG2  . ILE A 1 70  ? 0.452   3.556   -0.798  1.00 0.00 ? 70  ILE A CG2  2  
ATOM 2874  C CD1  . ILE A 1 70  ? 0.498   3.664   -3.794  1.00 0.00 ? 70  ILE A CD1  2  
ATOM 2875  H H    . ILE A 1 70  ? 1.357   7.217   -2.336  1.00 0.00 ? 70  ILE A H    2  
ATOM 2876  H HA   . ILE A 1 70  ? -0.456  6.047   -0.461  1.00 0.00 ? 70  ILE A HA   2  
ATOM 2877  H HB   . ILE A 1 70  ? 1.971   4.740   -1.688  1.00 0.00 ? 70  ILE A HB   2  
ATOM 2878  H HG12 . ILE A 1 70  ? -0.843  4.947   -2.787  1.00 0.00 ? 70  ILE A HG12 2  
ATOM 2879  H HG13 . ILE A 1 70  ? 0.581   5.746   -3.446  1.00 0.00 ? 70  ILE A HG13 2  
ATOM 2880  H HG21 . ILE A 1 70  ? 0.339   3.792   0.250   1.00 0.00 ? 70  ILE A HG21 2  
ATOM 2881  H HG22 . ILE A 1 70  ? 1.191   2.778   -0.915  1.00 0.00 ? 70  ILE A HG22 2  
ATOM 2882  H HG23 . ILE A 1 70  ? -0.494  3.217   -1.194  1.00 0.00 ? 70  ILE A HG23 2  
ATOM 2883  H HD11 . ILE A 1 70  ? -0.096  2.830   -3.449  1.00 0.00 ? 70  ILE A HD11 2  
ATOM 2884  H HD12 . ILE A 1 70  ? 1.546   3.408   -3.738  1.00 0.00 ? 70  ILE A HD12 2  
ATOM 2885  H HD13 . ILE A 1 70  ? 0.238   3.893   -4.818  1.00 0.00 ? 70  ILE A HD13 2  
ATOM 2886  N N    . LEU A 1 71  ? 0.768   6.154   1.683   1.00 0.00 ? 71  LEU A N    2  
ATOM 2887  C CA   . LEU A 1 71  ? 1.457   6.156   2.969   1.00 0.00 ? 71  LEU A CA   2  
ATOM 2888  C C    . LEU A 1 71  ? 1.767   4.734   3.422   1.00 0.00 ? 71  LEU A C    2  
ATOM 2889  O O    . LEU A 1 71  ? 2.929   4.366   3.599   1.00 0.00 ? 71  LEU A O    2  
ATOM 2890  C CB   . LEU A 1 71  ? 0.609   6.867   4.024   1.00 0.00 ? 71  LEU A CB   2  
ATOM 2891  C CG   . LEU A 1 71  ? 0.185   8.291   3.662   1.00 0.00 ? 71  LEU A CG   2  
ATOM 2892  C CD1  . LEU A 1 71  ? -1.136  8.642   4.330   1.00 0.00 ? 71  LEU A CD1  2  
ATOM 2893  C CD2  . LEU A 1 71  ? 1.265   9.286   4.058   1.00 0.00 ? 71  LEU A CD2  2  
ATOM 2894  H H    . LEU A 1 71  ? -0.210  6.227   1.665   1.00 0.00 ? 71  LEU A H    2  
ATOM 2895  H HA   . LEU A 1 71  ? 2.386   6.692   2.845   1.00 0.00 ? 71  LEU A HA   2  
ATOM 2896  H HB2  . LEU A 1 71  ? -0.282  6.281   4.196   1.00 0.00 ? 71  LEU A HB2  2  
ATOM 2897  H HB3  . LEU A 1 71  ? 1.176   6.908   4.943   1.00 0.00 ? 71  LEU A HB3  2  
ATOM 2898  H HG   . LEU A 1 71  ? 0.044   8.356   2.593   1.00 0.00 ? 71  LEU A HG   2  
ATOM 2899  H HD11 . LEU A 1 71  ? -1.145  9.693   4.580   1.00 0.00 ? 71  LEU A HD11 2  
ATOM 2900  H HD12 . LEU A 1 71  ? -1.248  8.058   5.232   1.00 0.00 ? 71  LEU A HD12 2  
ATOM 2901  H HD13 . LEU A 1 71  ? -1.950  8.423   3.657   1.00 0.00 ? 71  LEU A HD13 2  
ATOM 2902  H HD21 . LEU A 1 71  ? 2.218   8.780   4.112   1.00 0.00 ? 71  LEU A HD21 2  
ATOM 2903  H HD22 . LEU A 1 71  ? 1.029   9.710   5.022   1.00 0.00 ? 71  LEU A HD22 2  
ATOM 2904  H HD23 . LEU A 1 71  ? 1.318   10.073  3.321   1.00 0.00 ? 71  LEU A HD23 2  
ATOM 2905  N N    . GLU A 1 72  ? 0.720   3.936   3.609   1.00 0.00 ? 72  GLU A N    2  
ATOM 2906  C CA   . GLU A 1 72  ? 0.879   2.553   4.042   1.00 0.00 ? 72  GLU A CA   2  
ATOM 2907  C C    . GLU A 1 72  ? -0.154  1.651   3.375   1.00 0.00 ? 72  GLU A C    2  
ATOM 2908  O O    . GLU A 1 72  ? -1.177  2.123   2.879   1.00 0.00 ? 72  GLU A O    2  
ATOM 2909  C CB   . GLU A 1 72  ? 0.752   2.455   5.564   1.00 0.00 ? 72  GLU A CB   2  
ATOM 2910  C CG   . GLU A 1 72  ? -0.615  2.863   6.087   1.00 0.00 ? 72  GLU A CG   2  
ATOM 2911  C CD   . GLU A 1 72  ? -0.543  4.010   7.077   1.00 0.00 ? 72  GLU A CD   2  
ATOM 2912  O OE1  . GLU A 1 72  ? 0.319   4.895   6.900   1.00 0.00 ? 72  GLU A OE1  2  
ATOM 2913  O OE2  . GLU A 1 72  ? -1.351  4.022   8.030   1.00 0.00 ? 72  GLU A OE2  2  
ATOM 2914  H H    . GLU A 1 72  ? -0.183  4.287   3.452   1.00 0.00 ? 72  GLU A H    2  
ATOM 2915  H HA   . GLU A 1 72  ? 1.866   2.226   3.751   1.00 0.00 ? 72  GLU A HA   2  
ATOM 2916  H HB2  . GLU A 1 72  ? 0.938   1.433   5.864   1.00 0.00 ? 72  GLU A HB2  2  
ATOM 2917  H HB3  . GLU A 1 72  ? 1.495   3.094   6.017   1.00 0.00 ? 72  GLU A HB3  2  
ATOM 2918  H HG2  . GLU A 1 72  ? -1.229  3.168   5.252   1.00 0.00 ? 72  GLU A HG2  2  
ATOM 2919  H HG3  . GLU A 1 72  ? -1.069  2.013   6.574   1.00 0.00 ? 72  GLU A HG3  2  
ATOM 2920  N N    . VAL A 1 73  ? 0.120   0.350   3.368   1.00 0.00 ? 73  VAL A N    2  
ATOM 2921  C CA   . VAL A 1 73  ? -0.787  -0.617  2.762   1.00 0.00 ? 73  VAL A CA   2  
ATOM 2922  C C    . VAL A 1 73  ? -0.851  -1.901  3.584   1.00 0.00 ? 73  VAL A C    2  
ATOM 2923  O O    . VAL A 1 73  ? 0.176   -2.507  3.888   1.00 0.00 ? 73  VAL A O    2  
ATOM 2924  C CB   . VAL A 1 73  ? -0.361  -0.964  1.324   1.00 0.00 ? 73  VAL A CB   2  
ATOM 2925  C CG1  . VAL A 1 73  ? -1.420  -1.814  0.641   1.00 0.00 ? 73  VAL A CG1  2  
ATOM 2926  C CG2  . VAL A 1 73  ? -0.088  0.303   0.528   1.00 0.00 ? 73  VAL A CG2  2  
ATOM 2927  H H    . VAL A 1 73  ? 0.950   0.034   3.780   1.00 0.00 ? 73  VAL A H    2  
ATOM 2928  H HA   . VAL A 1 73  ? -1.772  -0.175  2.727   1.00 0.00 ? 73  VAL A HA   2  
ATOM 2929  H HB   . VAL A 1 73  ? 0.554   -1.537  1.370   1.00 0.00 ? 73  VAL A HB   2  
ATOM 2930  H HG11 . VAL A 1 73  ? -2.319  -1.232  0.510   1.00 0.00 ? 73  VAL A HG11 2  
ATOM 2931  H HG12 . VAL A 1 73  ? -1.636  -2.679  1.252   1.00 0.00 ? 73  VAL A HG12 2  
ATOM 2932  H HG13 . VAL A 1 73  ? -1.057  -2.138  -0.323  1.00 0.00 ? 73  VAL A HG13 2  
ATOM 2933  H HG21 . VAL A 1 73  ? -0.362  0.146   -0.505  1.00 0.00 ? 73  VAL A HG21 2  
ATOM 2934  H HG22 . VAL A 1 73  ? 0.962   0.550   0.589   1.00 0.00 ? 73  VAL A HG22 2  
ATOM 2935  H HG23 . VAL A 1 73  ? -0.672  1.116   0.935   1.00 0.00 ? 73  VAL A HG23 2  
ATOM 2936  N N    . ASN A 1 74  ? -2.065  -2.309  3.940   1.00 0.00 ? 74  ASN A N    2  
ATOM 2937  C CA   . ASN A 1 74  ? -2.263  -3.521  4.726   1.00 0.00 ? 74  ASN A CA   2  
ATOM 2938  C C    . ASN A 1 74  ? -1.559  -3.417  6.074   1.00 0.00 ? 74  ASN A C    2  
ATOM 2939  O O    . ASN A 1 74  ? -1.030  -4.403  6.587   1.00 0.00 ? 74  ASN A O    2  
ATOM 2940  C CB   . ASN A 1 74  ? -1.748  -4.741  3.961   1.00 0.00 ? 74  ASN A CB   2  
ATOM 2941  C CG   . ASN A 1 74  ? -2.665  -5.137  2.820   1.00 0.00 ? 74  ASN A CG   2  
ATOM 2942  O OD1  . ASN A 1 74  ? -3.840  -5.435  3.027   1.00 0.00 ? 74  ASN A OD1  2  
ATOM 2943  N ND2  . ASN A 1 74  ? -2.128  -5.142  1.604   1.00 0.00 ? 74  ASN A ND2  2  
ATOM 2944  H H    . ASN A 1 74  ? -2.846  -1.783  3.667   1.00 0.00 ? 74  ASN A H    2  
ATOM 2945  H HA   . ASN A 1 74  ? -3.324  -3.636  4.895   1.00 0.00 ? 74  ASN A HA   2  
ATOM 2946  H HB2  . ASN A 1 74  ? -0.771  -4.516  3.552   1.00 0.00 ? 74  ASN A HB2  2  
ATOM 2947  H HB3  . ASN A 1 74  ? -1.667  -5.579  4.642   1.00 0.00 ? 74  ASN A HB3  2  
ATOM 2948  H HD21 . ASN A 1 74  ? -1.184  -4.893  1.514   1.00 0.00 ? 74  ASN A HD21 2  
ATOM 2949  H HD22 . ASN A 1 74  ? -2.698  -5.394  0.848   1.00 0.00 ? 74  ASN A HD22 2  
ATOM 2950  N N    . GLY A 1 75  ? -1.554  -2.216  6.643   1.00 0.00 ? 75  GLY A N    2  
ATOM 2951  C CA   . GLY A 1 75  ? -0.911  -2.005  7.927   1.00 0.00 ? 75  GLY A CA   2  
ATOM 2952  C C    . GLY A 1 75  ? 0.602   -2.026  7.827   1.00 0.00 ? 75  GLY A C    2  
ATOM 2953  O O    . GLY A 1 75  ? 1.288   -2.374  8.788   1.00 0.00 ? 75  GLY A O    2  
ATOM 2954  H H    . GLY A 1 75  ? -1.992  -1.466  6.187   1.00 0.00 ? 75  GLY A H    2  
ATOM 2955  H HA2  . GLY A 1 75  ? -1.222  -1.050  8.320   1.00 0.00 ? 75  GLY A HA2  2  
ATOM 2956  H HA3  . GLY A 1 75  ? -1.227  -2.783  8.607   1.00 0.00 ? 75  GLY A HA3  2  
ATOM 2957  N N    . ARG A 1 76  ? 1.122   -1.651  6.664   1.00 0.00 ? 76  ARG A N    2  
ATOM 2958  C CA   . ARG A 1 76  ? 2.563   -1.627  6.442   1.00 0.00 ? 76  ARG A CA   2  
ATOM 2959  C C    . ARG A 1 76  ? 2.991   -0.316  5.792   1.00 0.00 ? 76  ARG A C    2  
ATOM 2960  O O    . ARG A 1 76  ? 2.407   0.116   4.799   1.00 0.00 ? 76  ARG A O    2  
ATOM 2961  C CB   . ARG A 1 76  ? 2.985   -2.807  5.564   1.00 0.00 ? 76  ARG A CB   2  
ATOM 2962  C CG   . ARG A 1 76  ? 4.486   -2.884  5.331   1.00 0.00 ? 76  ARG A CG   2  
ATOM 2963  C CD   . ARG A 1 76  ? 4.986   -4.318  5.383   1.00 0.00 ? 76  ARG A CD   2  
ATOM 2964  N NE   . ARG A 1 76  ? 6.417   -4.389  5.671   1.00 0.00 ? 76  ARG A NE   2  
ATOM 2965  C CZ   . ARG A 1 76  ? 6.947   -4.121  6.862   1.00 0.00 ? 76  ARG A CZ   2  
ATOM 2966  N NH1  . ARG A 1 76  ? 6.170   -3.766  7.878   1.00 0.00 ? 76  ARG A NH1  2  
ATOM 2967  N NH2  . ARG A 1 76  ? 8.258   -4.210  7.039   1.00 0.00 ? 76  ARG A NH2  2  
ATOM 2968  H H    . ARG A 1 76  ? 0.522   -1.384  5.936   1.00 0.00 ? 76  ARG A H    2  
ATOM 2969  H HA   . ARG A 1 76  ? 3.047   -1.714  7.404   1.00 0.00 ? 76  ARG A HA   2  
ATOM 2970  H HB2  . ARG A 1 76  ? 2.668   -3.725  6.039   1.00 0.00 ? 76  ARG A HB2  2  
ATOM 2971  H HB3  . ARG A 1 76  ? 2.497   -2.720  4.605   1.00 0.00 ? 76  ARG A HB3  2  
ATOM 2972  H HG2  . ARG A 1 76  ? 4.711   -2.471  4.359   1.00 0.00 ? 76  ARG A HG2  2  
ATOM 2973  H HG3  . ARG A 1 76  ? 4.989   -2.308  6.094   1.00 0.00 ? 76  ARG A HG3  2  
ATOM 2974  H HD2  . ARG A 1 76  ? 4.447   -4.846  6.156   1.00 0.00 ? 76  ARG A HD2  2  
ATOM 2975  H HD3  . ARG A 1 76  ? 4.797   -4.788  4.429   1.00 0.00 ? 76  ARG A HD3  2  
ATOM 2976  H HE   . ARG A 1 76  ? 7.014   -4.650  4.939   1.00 0.00 ? 76  ARG A HE   2  
ATOM 2977  H HH11 . ARG A 1 76  ? 5.180   -3.697  7.751   1.00 0.00 ? 76  ARG A HH11 2  
ATOM 2978  H HH12 . ARG A 1 76  ? 6.574   -3.564  8.770   1.00 0.00 ? 76  ARG A HH12 2  
ATOM 2979  H HH21 . ARG A 1 76  ? 8.848   -4.478  6.278   1.00 0.00 ? 76  ARG A HH21 2  
ATOM 2980  H HH22 . ARG A 1 76  ? 8.656   -4.008  7.935   1.00 0.00 ? 76  ARG A HH22 2  
ATOM 2981  N N    . SER A 1 77  ? 4.015   0.313   6.360   1.00 0.00 ? 77  SER A N    2  
ATOM 2982  C CA   . SER A 1 77  ? 4.522   1.576   5.836   1.00 0.00 ? 77  SER A CA   2  
ATOM 2983  C C    . SER A 1 77  ? 5.076   1.398   4.426   1.00 0.00 ? 77  SER A C    2  
ATOM 2984  O O    . SER A 1 77  ? 5.766   0.419   4.139   1.00 0.00 ? 77  SER A O    2  
ATOM 2985  C CB   . SER A 1 77  ? 5.608   2.136   6.757   1.00 0.00 ? 77  SER A CB   2  
ATOM 2986  O OG   . SER A 1 77  ? 5.520   3.548   6.851   1.00 0.00 ? 77  SER A OG   2  
ATOM 2987  H H    . SER A 1 77  ? 4.440   -0.081  7.151   1.00 0.00 ? 77  SER A H    2  
ATOM 2988  H HA   . SER A 1 77  ? 3.698   2.274   5.800   1.00 0.00 ? 77  SER A HA   2  
ATOM 2989  H HB2  . SER A 1 77  ? 5.491   1.715   7.744   1.00 0.00 ? 77  SER A HB2  2  
ATOM 2990  H HB3  . SER A 1 77  ? 6.579   1.873   6.365   1.00 0.00 ? 77  SER A HB3  2  
ATOM 2991  H HG   . SER A 1 77  ? 4.640   3.795   7.144   1.00 0.00 ? 77  SER A HG   2  
ATOM 2992  N N    . PHE A 1 78  ? 4.770   2.350   3.551   1.00 0.00 ? 78  PHE A N    2  
ATOM 2993  C CA   . PHE A 1 78  ? 5.237   2.299   2.171   1.00 0.00 ? 78  PHE A CA   2  
ATOM 2994  C C    . PHE A 1 78  ? 6.083   3.525   1.838   1.00 0.00 ? 78  PHE A C    2  
ATOM 2995  O O    . PHE A 1 78  ? 6.099   3.990   0.699   1.00 0.00 ? 78  PHE A O    2  
ATOM 2996  C CB   . PHE A 1 78  ? 4.049   2.208   1.211   1.00 0.00 ? 78  PHE A CB   2  
ATOM 2997  C CG   . PHE A 1 78  ? 3.674   0.798   0.854   1.00 0.00 ? 78  PHE A CG   2  
ATOM 2998  C CD1  . PHE A 1 78  ? 3.459   -0.148  1.844   1.00 0.00 ? 78  PHE A CD1  2  
ATOM 2999  C CD2  . PHE A 1 78  ? 3.534   0.419   -0.472  1.00 0.00 ? 78  PHE A CD2  2  
ATOM 3000  C CE1  . PHE A 1 78  ? 3.113   -1.446  1.518   1.00 0.00 ? 78  PHE A CE1  2  
ATOM 3001  C CE2  . PHE A 1 78  ? 3.188   -0.878  -0.804  1.00 0.00 ? 78  PHE A CE2  2  
ATOM 3002  C CZ   . PHE A 1 78  ? 2.978   -1.812  0.193   1.00 0.00 ? 78  PHE A CZ   2  
ATOM 3003  H H    . PHE A 1 78  ? 4.216   3.105   3.840   1.00 0.00 ? 78  PHE A H    2  
ATOM 3004  H HA   . PHE A 1 78  ? 5.848   1.416   2.059   1.00 0.00 ? 78  PHE A HA   2  
ATOM 3005  H HB2  . PHE A 1 78  ? 3.190   2.674   1.668   1.00 0.00 ? 78  PHE A HB2  2  
ATOM 3006  H HB3  . PHE A 1 78  ? 4.292   2.729   0.296   1.00 0.00 ? 78  PHE A HB3  2  
ATOM 3007  H HD1  . PHE A 1 78  ? 3.565   0.137   2.879   1.00 0.00 ? 78  PHE A HD1  2  
ATOM 3008  H HD2  . PHE A 1 78  ? 3.700   1.148   -1.251  1.00 0.00 ? 78  PHE A HD2  2  
ATOM 3009  H HE1  . PHE A 1 78  ? 2.949   -2.174  2.299   1.00 0.00 ? 78  PHE A HE1  2  
ATOM 3010  H HE2  . PHE A 1 78  ? 3.082   -1.161  -1.840  1.00 0.00 ? 78  PHE A HE2  2  
ATOM 3011  H HZ   . PHE A 1 78  ? 2.708   -2.824  -0.064  1.00 0.00 ? 78  PHE A HZ   2  
ATOM 3012  N N    . LEU A 1 79  ? 6.782   4.044   2.841   1.00 0.00 ? 79  LEU A N    2  
ATOM 3013  C CA   . LEU A 1 79  ? 7.630   5.217   2.656   1.00 0.00 ? 79  LEU A CA   2  
ATOM 3014  C C    . LEU A 1 79  ? 8.994   4.819   2.102   1.00 0.00 ? 79  LEU A C    2  
ATOM 3015  O O    . LEU A 1 79  ? 9.409   5.296   1.045   1.00 0.00 ? 79  LEU A O    2  
ATOM 3016  C CB   . LEU A 1 79  ? 7.802   5.962   3.981   1.00 0.00 ? 79  LEU A CB   2  
ATOM 3017  C CG   . LEU A 1 79  ? 6.505   6.476   4.608   1.00 0.00 ? 79  LEU A CG   2  
ATOM 3018  C CD1  . LEU A 1 79  ? 6.770   7.036   5.997   1.00 0.00 ? 79  LEU A CD1  2  
ATOM 3019  C CD2  . LEU A 1 79  ? 5.865   7.532   3.719   1.00 0.00 ? 79  LEU A CD2  2  
ATOM 3020  H H    . LEU A 1 79  ? 6.727   3.630   3.727   1.00 0.00 ? 79  LEU A H    2  
ATOM 3021  H HA   . LEU A 1 79  ? 7.142   5.870   1.947   1.00 0.00 ? 79  LEU A HA   2  
ATOM 3022  H HB2  . LEU A 1 79  ? 8.280   5.296   4.685   1.00 0.00 ? 79  LEU A HB2  2  
ATOM 3023  H HB3  . LEU A 1 79  ? 8.453   6.807   3.812   1.00 0.00 ? 79  LEU A HB3  2  
ATOM 3024  H HG   . LEU A 1 79  ? 5.810   5.655   4.706   1.00 0.00 ? 79  LEU A HG   2  
ATOM 3025  H HD11 . LEU A 1 79  ? 7.793   7.377   6.059   1.00 0.00 ? 79  LEU A HD11 2  
ATOM 3026  H HD12 . LEU A 1 79  ? 6.603   6.264   6.734   1.00 0.00 ? 79  LEU A HD12 2  
ATOM 3027  H HD13 . LEU A 1 79  ? 6.102   7.864   6.185   1.00 0.00 ? 79  LEU A HD13 2  
ATOM 3028  H HD21 . LEU A 1 79  ? 6.506   8.401   3.675   1.00 0.00 ? 79  LEU A HD21 2  
ATOM 3029  H HD22 . LEU A 1 79  ? 4.906   7.812   4.127   1.00 0.00 ? 79  LEU A HD22 2  
ATOM 3030  H HD23 . LEU A 1 79  ? 5.732   7.132   2.724   1.00 0.00 ? 79  LEU A HD23 2  
ATOM 3031  N N    . ASN A 1 80  ? 9.688   3.946   2.823   1.00 0.00 ? 80  ASN A N    2  
ATOM 3032  C CA   . ASN A 1 80  ? 11.006  3.484   2.404   1.00 0.00 ? 80  ASN A CA   2  
ATOM 3033  C C    . ASN A 1 80  ? 10.912  2.132   1.704   1.00 0.00 ? 80  ASN A C    2  
ATOM 3034  O O    . ASN A 1 80  ? 11.796  1.286   1.846   1.00 0.00 ? 80  ASN A O    2  
ATOM 3035  C CB   . ASN A 1 80  ? 11.942  3.384   3.609   1.00 0.00 ? 80  ASN A CB   2  
ATOM 3036  C CG   . ASN A 1 80  ? 11.440  2.403   4.651   1.00 0.00 ? 80  ASN A CG   2  
ATOM 3037  O OD1  . ASN A 1 80  ? 10.992  1.304   4.321   1.00 0.00 ? 80  ASN A OD1  2  
ATOM 3038  N ND2  . ASN A 1 80  ? 11.512  2.795   5.917   1.00 0.00 ? 80  ASN A ND2  2  
ATOM 3039  H H    . ASN A 1 80  ? 9.304   3.603   3.657   1.00 0.00 ? 80  ASN A H    2  
ATOM 3040  H HA   . ASN A 1 80  ? 11.405  4.208   1.709   1.00 0.00 ? 80  ASN A HA   2  
ATOM 3041  H HB2  . ASN A 1 80  ? 12.916  3.059   3.277   1.00 0.00 ? 80  ASN A HB2  2  
ATOM 3042  H HB3  . ASN A 1 80  ? 12.030  4.357   4.071   1.00 0.00 ? 80  ASN A HB3  2  
ATOM 3043  H HD21 . ASN A 1 80  ? 11.880  3.684   6.106   1.00 0.00 ? 80  ASN A HD21 2  
ATOM 3044  H HD22 . ASN A 1 80  ? 11.195  2.181   6.612   1.00 0.00 ? 80  ASN A HD22 2  
ATOM 3045  N N    . ILE A 1 81  ? 9.836   1.935   0.951   1.00 0.00 ? 81  ILE A N    2  
ATOM 3046  C CA   . ILE A 1 81  ? 9.626   0.685   0.230   1.00 0.00 ? 81  ILE A CA   2  
ATOM 3047  C C    . ILE A 1 81  ? 10.177  0.772   -1.190  1.00 0.00 ? 81  ILE A C    2  
ATOM 3048  O O    . ILE A 1 81  ? 10.008  1.783   -1.872  1.00 0.00 ? 81  ILE A O    2  
ATOM 3049  C CB   . ILE A 1 81  ? 8.130   0.314   0.173   1.00 0.00 ? 81  ILE A CB   2  
ATOM 3050  C CG1  . ILE A 1 81  ? 7.943   -1.051  -0.495  1.00 0.00 ? 81  ILE A CG1  2  
ATOM 3051  C CG2  . ILE A 1 81  ? 7.343   1.386   -0.567  1.00 0.00 ? 81  ILE A CG2  2  
ATOM 3052  C CD1  . ILE A 1 81  ? 6.810   -1.862  0.096   1.00 0.00 ? 81  ILE A CD1  2  
ATOM 3053  H H    . ILE A 1 81  ? 9.166   2.647   0.878   1.00 0.00 ? 81  ILE A H    2  
ATOM 3054  H HA   . ILE A 1 81  ? 10.150  -0.096  0.761   1.00 0.00 ? 81  ILE A HA   2  
ATOM 3055  H HB   . ILE A 1 81  ? 7.757   0.264   1.185   1.00 0.00 ? 81  ILE A HB   2  
ATOM 3056  H HG12 . ILE A 1 81  ? 7.733   -0.905  -1.544  1.00 0.00 ? 81  ILE A HG12 2  
ATOM 3057  H HG13 . ILE A 1 81  ? 8.852   -1.623  -0.390  1.00 0.00 ? 81  ILE A HG13 2  
ATOM 3058  H HG21 . ILE A 1 81  ? 7.751   1.512   -1.559  1.00 0.00 ? 81  ILE A HG21 2  
ATOM 3059  H HG22 . ILE A 1 81  ? 7.410   2.318   -0.027  1.00 0.00 ? 81  ILE A HG22 2  
ATOM 3060  H HG23 . ILE A 1 81  ? 6.308   1.086   -0.640  1.00 0.00 ? 81  ILE A HG23 2  
ATOM 3061  H HD11 . ILE A 1 81  ? 7.017   -2.065  1.136   1.00 0.00 ? 81  ILE A HD11 2  
ATOM 3062  H HD12 . ILE A 1 81  ? 6.717   -2.794  -0.441  1.00 0.00 ? 81  ILE A HD12 2  
ATOM 3063  H HD13 . ILE A 1 81  ? 5.888   -1.305  0.014   1.00 0.00 ? 81  ILE A HD13 2  
ATOM 3064  N N    . LEU A 1 82  ? 10.837  -0.295  -1.629  1.00 0.00 ? 82  LEU A N    2  
ATOM 3065  C CA   . LEU A 1 82  ? 11.413  -0.341  -2.968  1.00 0.00 ? 82  LEU A CA   2  
ATOM 3066  C C    . LEU A 1 82  ? 10.329  -0.189  -4.030  1.00 0.00 ? 82  LEU A C    2  
ATOM 3067  O O    . LEU A 1 82  ? 9.141   -0.337  -3.746  1.00 0.00 ? 82  LEU A O    2  
ATOM 3068  C CB   . LEU A 1 82  ? 12.166  -1.656  -3.176  1.00 0.00 ? 82  LEU A CB   2  
ATOM 3069  C CG   . LEU A 1 82  ? 13.328  -1.897  -2.207  1.00 0.00 ? 82  LEU A CG   2  
ATOM 3070  C CD1  . LEU A 1 82  ? 13.243  -3.290  -1.603  1.00 0.00 ? 82  LEU A CD1  2  
ATOM 3071  C CD2  . LEU A 1 82  ? 14.662  -1.700  -2.913  1.00 0.00 ? 82  LEU A CD2  2  
ATOM 3072  H H    . LEU A 1 82  ? 10.939  -1.071  -1.038  1.00 0.00 ? 82  LEU A H    2  
ATOM 3073  H HA   . LEU A 1 82  ? 12.107  0.481   -3.059  1.00 0.00 ? 82  LEU A HA   2  
ATOM 3074  H HB2  . LEU A 1 82  ? 11.462  -2.470  -3.073  1.00 0.00 ? 82  LEU A HB2  2  
ATOM 3075  H HB3  . LEU A 1 82  ? 12.557  -1.667  -4.182  1.00 0.00 ? 82  LEU A HB3  2  
ATOM 3076  H HG   . LEU A 1 82  ? 13.267  -1.181  -1.400  1.00 0.00 ? 82  LEU A HG   2  
ATOM 3077  H HD11 . LEU A 1 82  ? 12.700  -3.248  -0.671  1.00 0.00 ? 82  LEU A HD11 2  
ATOM 3078  H HD12 . LEU A 1 82  ? 14.240  -3.665  -1.423  1.00 0.00 ? 82  LEU A HD12 2  
ATOM 3079  H HD13 . LEU A 1 82  ? 12.731  -3.949  -2.289  1.00 0.00 ? 82  LEU A HD13 2  
ATOM 3080  H HD21 . LEU A 1 82  ? 15.405  -1.384  -2.195  1.00 0.00 ? 82  LEU A HD21 2  
ATOM 3081  H HD22 . LEU A 1 82  ? 14.556  -0.945  -3.677  1.00 0.00 ? 82  LEU A HD22 2  
ATOM 3082  H HD23 . LEU A 1 82  ? 14.971  -2.630  -3.364  1.00 0.00 ? 82  LEU A HD23 2  
ATOM 3083  N N    . HIS A 1 83  ? 10.748  0.107   -5.257  1.00 0.00 ? 83  HIS A N    2  
ATOM 3084  C CA   . HIS A 1 83  ? 9.813   0.278   -6.363  1.00 0.00 ? 83  HIS A CA   2  
ATOM 3085  C C    . HIS A 1 83  ? 9.252   -1.066  -6.814  1.00 0.00 ? 83  HIS A C    2  
ATOM 3086  O O    . HIS A 1 83  ? 8.111   -1.153  -7.268  1.00 0.00 ? 83  HIS A O    2  
ATOM 3087  C CB   . HIS A 1 83  ? 10.502  0.976   -7.537  1.00 0.00 ? 83  HIS A CB   2  
ATOM 3088  C CG   . HIS A 1 83  ? 9.562   1.367   -8.635  1.00 0.00 ? 83  HIS A CG   2  
ATOM 3089  N ND1  . HIS A 1 83  ? 8.305   1.883   -8.401  1.00 0.00 ? 83  HIS A ND1  2  
ATOM 3090  C CD2  . HIS A 1 83  ? 9.701   1.317   -9.981  1.00 0.00 ? 83  HIS A CD2  2  
ATOM 3091  C CE1  . HIS A 1 83  ? 7.712   2.132   -9.555  1.00 0.00 ? 83  HIS A CE1  2  
ATOM 3092  N NE2  . HIS A 1 83  ? 8.538   1.798   -10.529 1.00 0.00 ? 83  HIS A NE2  2  
ATOM 3093  H H    . HIS A 1 83  ? 11.708  0.211   -5.422  1.00 0.00 ? 83  HIS A H    2  
ATOM 3094  H HA   . HIS A 1 83  ? 9.000   0.897   -6.015  1.00 0.00 ? 83  HIS A HA   2  
ATOM 3095  H HB2  . HIS A 1 83  ? 10.987  1.874   -7.179  1.00 0.00 ? 83  HIS A HB2  2  
ATOM 3096  H HB3  . HIS A 1 83  ? 11.245  0.310   -7.956  1.00 0.00 ? 83  HIS A HB3  2  
ATOM 3097  H HD1  . HIS A 1 83  ? 7.906   2.043   -7.520  1.00 0.00 ? 83  HIS A HD1  2  
ATOM 3098  H HD2  . HIS A 1 83  ? 10.568  0.963   -10.523 1.00 0.00 ? 83  HIS A HD2  2  
ATOM 3099  H HE1  . HIS A 1 83  ? 6.720   2.541   -9.680  1.00 0.00 ? 83  HIS A HE1  2  
ATOM 3100  H HE2  . HIS A 1 83  ? 8.315   1.798   -11.483 1.00 0.00 ? 83  HIS A HE2  2  
ATOM 3101  N N    . ASP A 1 84  ? 10.060  -2.113  -6.684  1.00 0.00 ? 84  ASP A N    2  
ATOM 3102  C CA   . ASP A 1 84  ? 9.644   -3.454  -7.077  1.00 0.00 ? 84  ASP A CA   2  
ATOM 3103  C C    . ASP A 1 84  ? 8.773   -4.091  -6.000  1.00 0.00 ? 84  ASP A C    2  
ATOM 3104  O O    . ASP A 1 84  ? 7.792   -4.771  -6.303  1.00 0.00 ? 84  ASP A O    2  
ATOM 3105  C CB   . ASP A 1 84  ? 10.867  -4.332  -7.346  1.00 0.00 ? 84  ASP A CB   2  
ATOM 3106  C CG   . ASP A 1 84  ? 11.631  -3.897  -8.581  1.00 0.00 ? 84  ASP A CG   2  
ATOM 3107  O OD1  . ASP A 1 84  ? 11.534  -2.708  -8.951  1.00 0.00 ? 84  ASP A OD1  2  
ATOM 3108  O OD2  . ASP A 1 84  ? 12.327  -4.746  -9.178  1.00 0.00 ? 84  ASP A OD2  2  
ATOM 3109  H H    . ASP A 1 84  ? 10.958  -1.980  -6.314  1.00 0.00 ? 84  ASP A H    2  
ATOM 3110  H HA   . ASP A 1 84  ? 9.067   -3.368  -7.986  1.00 0.00 ? 84  ASP A HA   2  
ATOM 3111  H HB2  . ASP A 1 84  ? 11.533  -4.280  -6.497  1.00 0.00 ? 84  ASP A HB2  2  
ATOM 3112  H HB3  . ASP A 1 84  ? 10.546  -5.354  -7.484  1.00 0.00 ? 84  ASP A HB3  2  
ATOM 3113  N N    . GLU A 1 85  ? 9.138   -3.868  -4.742  1.00 0.00 ? 85  GLU A N    2  
ATOM 3114  C CA   . GLU A 1 85  ? 8.389   -4.420  -3.619  1.00 0.00 ? 85  GLU A CA   2  
ATOM 3115  C C    . GLU A 1 85  ? 6.963   -3.879  -3.596  1.00 0.00 ? 85  GLU A C    2  
ATOM 3116  O O    . GLU A 1 85  ? 6.027   -4.583  -3.219  1.00 0.00 ? 85  GLU A O    2  
ATOM 3117  C CB   . GLU A 1 85  ? 9.092   -4.094  -2.301  1.00 0.00 ? 85  GLU A CB   2  
ATOM 3118  C CG   . GLU A 1 85  ? 8.659   -4.981  -1.144  1.00 0.00 ? 85  GLU A CG   2  
ATOM 3119  C CD   . GLU A 1 85  ? 9.568   -4.852  0.061   1.00 0.00 ? 85  GLU A CD   2  
ATOM 3120  O OE1  . GLU A 1 85  ? 9.714   -3.725  0.578   1.00 0.00 ? 85  GLU A OE1  2  
ATOM 3121  O OE2  . GLU A 1 85  ? 10.136  -5.880  0.488   1.00 0.00 ? 85  GLU A OE2  2  
ATOM 3122  H H    . GLU A 1 85  ? 9.930   -3.318  -4.564  1.00 0.00 ? 85  GLU A H    2  
ATOM 3123  H HA   . GLU A 1 85  ? 8.352   -5.493  -3.742  1.00 0.00 ? 85  GLU A HA   2  
ATOM 3124  H HB2  . GLU A 1 85  ? 10.157  -4.209  -2.435  1.00 0.00 ? 85  GLU A HB2  2  
ATOM 3125  H HB3  . GLU A 1 85  ? 8.880   -3.068  -2.037  1.00 0.00 ? 85  GLU A HB3  2  
ATOM 3126  H HG2  . GLU A 1 85  ? 7.657   -4.705  -0.851  1.00 0.00 ? 85  GLU A HG2  2  
ATOM 3127  H HG3  . GLU A 1 85  ? 8.666   -6.009  -1.475  1.00 0.00 ? 85  GLU A HG3  2  
ATOM 3128  N N    . ALA A 1 86  ? 6.806   -2.624  -4.004  1.00 0.00 ? 86  ALA A N    2  
ATOM 3129  C CA   . ALA A 1 86  ? 5.495   -1.988  -4.031  1.00 0.00 ? 86  ALA A CA   2  
ATOM 3130  C C    . ALA A 1 86  ? 4.580   -2.660  -5.049  1.00 0.00 ? 86  ALA A C    2  
ATOM 3131  O O    . ALA A 1 86  ? 3.363   -2.707  -4.870  1.00 0.00 ? 86  ALA A O    2  
ATOM 3132  C CB   . ALA A 1 86  ? 5.633   -0.505  -4.342  1.00 0.00 ? 86  ALA A CB   2  
ATOM 3133  H H    . ALA A 1 86  ? 7.590   -2.113  -4.294  1.00 0.00 ? 86  ALA A H    2  
ATOM 3134  H HA   . ALA A 1 86  ? 5.056   -2.087  -3.048  1.00 0.00 ? 86  ALA A HA   2  
ATOM 3135  H HB1  . ALA A 1 86  ? 5.903   -0.379  -5.379  1.00 0.00 ? 86  ALA A HB1  2  
ATOM 3136  H HB2  . ALA A 1 86  ? 6.402   -0.077  -3.715  1.00 0.00 ? 86  ALA A HB2  2  
ATOM 3137  H HB3  . ALA A 1 86  ? 4.695   -0.007  -4.149  1.00 0.00 ? 86  ALA A HB3  2  
ATOM 3138  N N    . VAL A 1 87  ? 5.173   -3.180  -6.118  1.00 0.00 ? 87  VAL A N    2  
ATOM 3139  C CA   . VAL A 1 87  ? 4.412   -3.850  -7.166  1.00 0.00 ? 87  VAL A CA   2  
ATOM 3140  C C    . VAL A 1 87  ? 4.119   -5.299  -6.791  1.00 0.00 ? 87  VAL A C    2  
ATOM 3141  O O    . VAL A 1 87  ? 2.974   -5.746  -6.848  1.00 0.00 ? 87  VAL A O    2  
ATOM 3142  C CB   . VAL A 1 87  ? 5.160   -3.821  -8.511  1.00 0.00 ? 87  VAL A CB   2  
ATOM 3143  C CG1  . VAL A 1 87  ? 4.272   -4.343  -9.629  1.00 0.00 ? 87  VAL A CG1  2  
ATOM 3144  C CG2  . VAL A 1 87  ? 5.649   -2.414  -8.820  1.00 0.00 ? 87  VAL A CG2  2  
ATOM 3145  H H    . VAL A 1 87  ? 6.147   -3.112  -6.205  1.00 0.00 ? 87  VAL A H    2  
ATOM 3146  H HA   . VAL A 1 87  ? 3.476   -3.323  -7.287  1.00 0.00 ? 87  VAL A HA   2  
ATOM 3147  H HB   . VAL A 1 87  ? 6.022   -4.469  -8.434  1.00 0.00 ? 87  VAL A HB   2  
ATOM 3148  H HG11 . VAL A 1 87  ? 4.489   -3.807  -10.541 1.00 0.00 ? 87  VAL A HG11 2  
ATOM 3149  H HG12 . VAL A 1 87  ? 3.236   -4.196  -9.363  1.00 0.00 ? 87  VAL A HG12 2  
ATOM 3150  H HG13 . VAL A 1 87  ? 4.460   -5.396  -9.777  1.00 0.00 ? 87  VAL A HG13 2  
ATOM 3151  H HG21 . VAL A 1 87  ? 6.335   -2.445  -9.654  1.00 0.00 ? 87  VAL A HG21 2  
ATOM 3152  H HG22 . VAL A 1 87  ? 6.154   -2.009  -7.955  1.00 0.00 ? 87  VAL A HG22 2  
ATOM 3153  H HG23 . VAL A 1 87  ? 4.806   -1.787  -9.071  1.00 0.00 ? 87  VAL A HG23 2  
ATOM 3154  N N    . ARG A 1 88  ? 5.162   -6.028  -6.407  1.00 0.00 ? 88  ARG A N    2  
ATOM 3155  C CA   . ARG A 1 88  ? 5.016   -7.427  -6.024  1.00 0.00 ? 88  ARG A CA   2  
ATOM 3156  C C    . ARG A 1 88  ? 4.077   -7.569  -4.829  1.00 0.00 ? 88  ARG A C    2  
ATOM 3157  O O    . ARG A 1 88  ? 3.336   -8.545  -4.722  1.00 0.00 ? 88  ARG A O    2  
ATOM 3158  C CB   . ARG A 1 88  ? 6.383   -8.031  -5.691  1.00 0.00 ? 88  ARG A CB   2  
ATOM 3159  C CG   . ARG A 1 88  ? 6.993   -8.819  -6.838  1.00 0.00 ? 88  ARG A CG   2  
ATOM 3160  C CD   . ARG A 1 88  ? 8.488   -8.566  -6.957  1.00 0.00 ? 88  ARG A CD   2  
ATOM 3161  N NE   . ARG A 1 88  ? 8.999   -8.917  -8.279  1.00 0.00 ? 88  ARG A NE   2  
ATOM 3162  C CZ   . ARG A 1 88  ? 9.261   -10.165 -8.666  1.00 0.00 ? 88  ARG A CZ   2  
ATOM 3163  N NH1  . ARG A 1 88  ? 9.062   -11.180 -7.834  1.00 0.00 ? 88  ARG A NH1  2  
ATOM 3164  N NH2  . ARG A 1 88  ? 9.723   -10.397 -9.887  1.00 0.00 ? 88  ARG A NH2  2  
ATOM 3165  H H    . ARG A 1 88  ? 6.051   -5.615  -6.381  1.00 0.00 ? 88  ARG A H    2  
ATOM 3166  H HA   . ARG A 1 88  ? 4.593   -7.958  -6.863  1.00 0.00 ? 88  ARG A HA   2  
ATOM 3167  H HB2  . ARG A 1 88  ? 7.061   -7.233  -5.429  1.00 0.00 ? 88  ARG A HB2  2  
ATOM 3168  H HB3  . ARG A 1 88  ? 6.276   -8.694  -4.845  1.00 0.00 ? 88  ARG A HB3  2  
ATOM 3169  H HG2  . ARG A 1 88  ? 6.831   -9.875  -6.665  1.00 0.00 ? 88  ARG A HG2  2  
ATOM 3170  H HG3  . ARG A 1 88  ? 6.512   -8.524  -7.762  1.00 0.00 ? 88  ARG A HG3  2  
ATOM 3171  H HD2  . ARG A 1 88  ? 8.678   -7.519  -6.775  1.00 0.00 ? 88  ARG A HD2  2  
ATOM 3172  H HD3  . ARG A 1 88  ? 9.001   -9.158  -6.213  1.00 0.00 ? 88  ARG A HD3  2  
ATOM 3173  H HE   . ARG A 1 88  ? 9.155   -8.187  -8.914  1.00 0.00 ? 88  ARG A HE   2  
ATOM 3174  H HH11 . ARG A 1 88  ? 8.714   -11.012 -6.913  1.00 0.00 ? 88  ARG A HH11 2  
ATOM 3175  H HH12 . ARG A 1 88  ? 9.260   -12.114 -8.131  1.00 0.00 ? 88  ARG A HH12 2  
ATOM 3176  H HH21 . ARG A 1 88  ? 9.875   -9.636  -10.518 1.00 0.00 ? 88  ARG A HH21 2  
ATOM 3177  H HH22 . ARG A 1 88  ? 9.920   -11.333 -10.178 1.00 0.00 ? 88  ARG A HH22 2  
ATOM 3178  N N    . LEU A 1 89  ? 4.115   -6.587  -3.934  1.00 0.00 ? 89  LEU A N    2  
ATOM 3179  C CA   . LEU A 1 89  ? 3.267   -6.603  -2.747  1.00 0.00 ? 89  LEU A CA   2  
ATOM 3180  C C    . LEU A 1 89  ? 1.842   -6.178  -3.090  1.00 0.00 ? 89  LEU A C    2  
ATOM 3181  O O    . LEU A 1 89  ? 0.882   -6.633  -2.468  1.00 0.00 ? 89  LEU A O    2  
ATOM 3182  C CB   . LEU A 1 89  ? 3.841   -5.679  -1.671  1.00 0.00 ? 89  LEU A CB   2  
ATOM 3183  C CG   . LEU A 1 89  ? 3.246   -5.866  -0.274  1.00 0.00 ? 89  LEU A CG   2  
ATOM 3184  C CD1  . LEU A 1 89  ? 3.359   -7.319  0.163   1.00 0.00 ? 89  LEU A CD1  2  
ATOM 3185  C CD2  . LEU A 1 89  ? 3.938   -4.952  0.725   1.00 0.00 ? 89  LEU A CD2  2  
ATOM 3186  H H    . LEU A 1 89  ? 4.726   -5.835  -4.074  1.00 0.00 ? 89  LEU A H    2  
ATOM 3187  H HA   . LEU A 1 89  ? 3.247   -7.614  -2.368  1.00 0.00 ? 89  LEU A HA   2  
ATOM 3188  H HB2  . LEU A 1 89  ? 4.906   -5.849  -1.613  1.00 0.00 ? 89  LEU A HB2  2  
ATOM 3189  H HB3  . LEU A 1 89  ? 3.672   -4.657  -1.976  1.00 0.00 ? 89  LEU A HB3  2  
ATOM 3190  H HG   . LEU A 1 89  ? 2.198   -5.604  -0.298  1.00 0.00 ? 89  LEU A HG   2  
ATOM 3191  H HD11 . LEU A 1 89  ? 2.450   -7.842  -0.092  1.00 0.00 ? 89  LEU A HD11 2  
ATOM 3192  H HD12 . LEU A 1 89  ? 3.511   -7.362  1.232   1.00 0.00 ? 89  LEU A HD12 2  
ATOM 3193  H HD13 . LEU A 1 89  ? 4.194   -7.782  -0.339  1.00 0.00 ? 89  LEU A HD13 2  
ATOM 3194  H HD21 . LEU A 1 89  ? 3.247   -4.691  1.514   1.00 0.00 ? 89  LEU A HD21 2  
ATOM 3195  H HD22 . LEU A 1 89  ? 4.267   -4.053  0.224   1.00 0.00 ? 89  LEU A HD22 2  
ATOM 3196  H HD23 . LEU A 1 89  ? 4.792   -5.460  1.148   1.00 0.00 ? 89  LEU A HD23 2  
ATOM 3197  N N    . LEU A 1 90  ? 1.714   -5.306  -4.084  1.00 0.00 ? 90  LEU A N    2  
ATOM 3198  C CA   . LEU A 1 90  ? 0.406   -4.821  -4.510  1.00 0.00 ? 90  LEU A CA   2  
ATOM 3199  C C    . LEU A 1 90  ? -0.258  -5.810  -5.461  1.00 0.00 ? 90  LEU A C    2  
ATOM 3200  O O    . LEU A 1 90  ? -1.481  -5.953  -5.471  1.00 0.00 ? 90  LEU A O    2  
ATOM 3201  C CB   . LEU A 1 90  ? 0.542   -3.456  -5.188  1.00 0.00 ? 90  LEU A CB   2  
ATOM 3202  C CG   . LEU A 1 90  ? 0.605   -2.261  -4.234  1.00 0.00 ? 90  LEU A CG   2  
ATOM 3203  C CD1  . LEU A 1 90  ? 0.998   -1.000  -4.985  1.00 0.00 ? 90  LEU A CD1  2  
ATOM 3204  C CD2  . LEU A 1 90  ? -0.730  -2.072  -3.530  1.00 0.00 ? 90  LEU A CD2  2  
ATOM 3205  H H    . LEU A 1 90  ? 2.517   -4.980  -4.542  1.00 0.00 ? 90  LEU A H    2  
ATOM 3206  H HA   . LEU A 1 90  ? -0.211  -4.715  -3.630  1.00 0.00 ? 90  LEU A HA   2  
ATOM 3207  H HB2  . LEU A 1 90  ? 1.442   -3.462  -5.785  1.00 0.00 ? 90  LEU A HB2  2  
ATOM 3208  H HB3  . LEU A 1 90  ? -0.304  -3.318  -5.845  1.00 0.00 ? 90  LEU A HB3  2  
ATOM 3209  H HG   . LEU A 1 90  ? 1.358   -2.450  -3.482  1.00 0.00 ? 90  LEU A HG   2  
ATOM 3210  H HD11 . LEU A 1 90  ? 0.503   -0.148  -4.542  1.00 0.00 ? 90  LEU A HD11 2  
ATOM 3211  H HD12 . LEU A 1 90  ? 0.702   -1.089  -6.020  1.00 0.00 ? 90  LEU A HD12 2  
ATOM 3212  H HD13 . LEU A 1 90  ? 2.068   -0.864  -4.928  1.00 0.00 ? 90  LEU A HD13 2  
ATOM 3213  H HD21 . LEU A 1 90  ? -1.307  -1.322  -4.049  1.00 0.00 ? 90  LEU A HD21 2  
ATOM 3214  H HD22 . LEU A 1 90  ? -0.558  -1.754  -2.512  1.00 0.00 ? 90  LEU A HD22 2  
ATOM 3215  H HD23 . LEU A 1 90  ? -1.272  -3.006  -3.529  1.00 0.00 ? 90  LEU A HD23 2  
ATOM 3216  N N    . LYS A 1 91  ? 0.557   -6.493  -6.259  1.00 0.00 ? 91  LYS A N    2  
ATOM 3217  C CA   . LYS A 1 91  ? 0.048   -7.471  -7.215  1.00 0.00 ? 91  LYS A CA   2  
ATOM 3218  C C    . LYS A 1 91  ? 0.355   -8.893  -6.753  1.00 0.00 ? 91  LYS A C    2  
ATOM 3219  O O    . LYS A 1 91  ? 1.252   -9.549  -7.282  1.00 0.00 ? 91  LYS A O    2  
ATOM 3220  C CB   . LYS A 1 91  ? 0.654   -7.226  -8.598  1.00 0.00 ? 91  LYS A CB   2  
ATOM 3221  C CG   . LYS A 1 91  ? -0.245  -6.424  -9.524  1.00 0.00 ? 91  LYS A CG   2  
ATOM 3222  C CD   . LYS A 1 91  ? -0.471  -5.016  -8.998  1.00 0.00 ? 91  LYS A CD   2  
ATOM 3223  C CE   . LYS A 1 91  ? -0.530  -4.002  -10.130 1.00 0.00 ? 91  LYS A CE   2  
ATOM 3224  N NZ   . LYS A 1 91  ? -0.081  -2.652  -9.690  1.00 0.00 ? 91  LYS A NZ   2  
ATOM 3225  H H    . LYS A 1 91  ? 1.523   -6.336  -6.205  1.00 0.00 ? 91  LYS A H    2  
ATOM 3226  H HA   . LYS A 1 91  ? -1.023  -7.350  -7.275  1.00 0.00 ? 91  LYS A HA   2  
ATOM 3227  H HB2  . LYS A 1 91  ? 1.585   -6.689  -8.481  1.00 0.00 ? 91  LYS A HB2  2  
ATOM 3228  H HB3  . LYS A 1 91  ? 0.856   -8.180  -9.065  1.00 0.00 ? 91  LYS A HB3  2  
ATOM 3229  H HG2  . LYS A 1 91  ? 0.218   -6.364  -10.497 1.00 0.00 ? 91  LYS A HG2  2  
ATOM 3230  H HG3  . LYS A 1 91  ? -1.199  -6.925  -9.606  1.00 0.00 ? 91  LYS A HG3  2  
ATOM 3231  H HD2  . LYS A 1 91  ? -1.404  -4.989  -8.455  1.00 0.00 ? 91  LYS A HD2  2  
ATOM 3232  H HD3  . LYS A 1 91  ? 0.342   -4.754  -8.335  1.00 0.00 ? 91  LYS A HD3  2  
ATOM 3233  H HE2  . LYS A 1 91  ? 0.108   -4.340  -10.933 1.00 0.00 ? 91  LYS A HE2  2  
ATOM 3234  H HE3  . LYS A 1 91  ? -1.549  -3.937  -10.484 1.00 0.00 ? 91  LYS A HE3  2  
ATOM 3235  H HZ1  . LYS A 1 91  ? -0.643  -2.337  -8.874  1.00 0.00 ? 91  LYS A HZ1  2  
ATOM 3236  H HZ2  . LYS A 1 91  ? -0.201  -1.967  -10.463 1.00 0.00 ? 91  LYS A HZ2  2  
ATOM 3237  H HZ3  . LYS A 1 91  ? 0.922   -2.680  -9.419  1.00 0.00 ? 91  LYS A HZ3  2  
ATOM 3238  N N    . SER A 1 92  ? -0.396  -9.361  -5.761  1.00 0.00 ? 92  SER A N    2  
ATOM 3239  C CA   . SER A 1 92  ? -0.205  -10.704 -5.227  1.00 0.00 ? 92  SER A CA   2  
ATOM 3240  C C    . SER A 1 92  ? -1.243  -11.013 -4.153  1.00 0.00 ? 92  SER A C    2  
ATOM 3241  O O    . SER A 1 92  ? -1.819  -12.100 -4.126  1.00 0.00 ? 92  SER A O    2  
ATOM 3242  C CB   . SER A 1 92  ? 1.203   -10.852 -4.649  1.00 0.00 ? 92  SER A CB   2  
ATOM 3243  O OG   . SER A 1 92  ? 1.649   -12.195 -4.725  1.00 0.00 ? 92  SER A OG   2  
ATOM 3244  H H    . SER A 1 92  ? -1.094  -8.790  -5.380  1.00 0.00 ? 92  SER A H    2  
ATOM 3245  H HA   . SER A 1 92  ? -0.326  -11.404 -6.039  1.00 0.00 ? 92  SER A HA   2  
ATOM 3246  H HB2  . SER A 1 92  ? 1.886   -10.227 -5.206  1.00 0.00 ? 92  SER A HB2  2  
ATOM 3247  H HB3  . SER A 1 92  ? 1.199   -10.545 -3.613  1.00 0.00 ? 92  SER A HB3  2  
ATOM 3248  H HG   . SER A 1 92  ? 1.034   -12.763 -4.256  1.00 0.00 ? 92  SER A HG   2  
ATOM 3249  N N    . SER A 1 93  ? -1.476  -10.049 -3.268  1.00 0.00 ? 93  SER A N    2  
ATOM 3250  C CA   . SER A 1 93  ? -2.445  -10.217 -2.191  1.00 0.00 ? 93  SER A CA   2  
ATOM 3251  C C    . SER A 1 93  ? -3.862  -9.950  -2.688  1.00 0.00 ? 93  SER A C    2  
ATOM 3252  O O    . SER A 1 93  ? -4.063  -9.216  -3.657  1.00 0.00 ? 93  SER A O    2  
ATOM 3253  C CB   . SER A 1 93  ? -2.113  -9.281  -1.028  1.00 0.00 ? 93  SER A CB   2  
ATOM 3254  O OG   . SER A 1 93  ? -1.418  -9.968  -0.003  1.00 0.00 ? 93  SER A OG   2  
ATOM 3255  H H    . SER A 1 93  ? -0.985  -9.204  -3.342  1.00 0.00 ? 93  SER A H    2  
ATOM 3256  H HA   . SER A 1 93  ? -2.384  -11.239 -1.848  1.00 0.00 ? 93  SER A HA   2  
ATOM 3257  H HB2  . SER A 1 93  ? -1.490  -8.471  -1.386  1.00 0.00 ? 93  SER A HB2  2  
ATOM 3258  H HB3  . SER A 1 93  ? -3.031  -8.878  -0.618  1.00 0.00 ? 93  SER A HB3  2  
ATOM 3259  H HG   . SER A 1 93  ? -1.868  -9.834  0.835   1.00 0.00 ? 93  SER A HG   2  
ATOM 3260  N N    . ARG A 1 94  ? -4.842  -10.548 -2.019  1.00 0.00 ? 94  ARG A N    2  
ATOM 3261  C CA   . ARG A 1 94  ? -6.240  -10.373 -2.392  1.00 0.00 ? 94  ARG A CA   2  
ATOM 3262  C C    . ARG A 1 94  ? -6.761  -9.017  -1.930  1.00 0.00 ? 94  ARG A C    2  
ATOM 3263  O O    . ARG A 1 94  ? -7.165  -8.186  -2.742  1.00 0.00 ? 94  ARG A O    2  
ATOM 3264  C CB   . ARG A 1 94  ? -7.093  -11.492 -1.792  1.00 0.00 ? 94  ARG A CB   2  
ATOM 3265  C CG   . ARG A 1 94  ? -7.061  -12.781 -2.599  1.00 0.00 ? 94  ARG A CG   2  
ATOM 3266  C CD   . ARG A 1 94  ? -5.875  -13.650 -2.213  1.00 0.00 ? 94  ARG A CD   2  
ATOM 3267  N NE   . ARG A 1 94  ? -6.179  -15.074 -2.332  1.00 0.00 ? 94  ARG A NE   2  
ATOM 3268  C CZ   . ARG A 1 94  ? -5.463  -16.036 -1.753  1.00 0.00 ? 94  ARG A CZ   2  
ATOM 3269  N NH1  . ARG A 1 94  ? -4.403  -15.731 -1.015  1.00 0.00 ? 94  ARG A NH1  2  
ATOM 3270  N NH2  . ARG A 1 94  ? -5.809  -17.306 -1.913  1.00 0.00 ? 94  ARG A NH2  2  
ATOM 3271  H H    . ARG A 1 94  ? -4.618  -11.120 -1.256  1.00 0.00 ? 94  ARG A H    2  
ATOM 3272  H HA   . ARG A 1 94  ? -6.304  -10.423 -3.469  1.00 0.00 ? 94  ARG A HA   2  
ATOM 3273  H HB2  . ARG A 1 94  ? -6.733  -11.708 -0.795  1.00 0.00 ? 94  ARG A HB2  2  
ATOM 3274  H HB3  . ARG A 1 94  ? -8.120  -11.155 -1.733  1.00 0.00 ? 94  ARG A HB3  2  
ATOM 3275  H HG2  . ARG A 1 94  ? -7.972  -13.331 -2.417  1.00 0.00 ? 94  ARG A HG2  2  
ATOM 3276  H HG3  . ARG A 1 94  ? -6.990  -12.535 -3.648  1.00 0.00 ? 94  ARG A HG3  2  
ATOM 3277  H HD2  . ARG A 1 94  ? -5.046  -13.413 -2.863  1.00 0.00 ? 94  ARG A HD2  2  
ATOM 3278  H HD3  . ARG A 1 94  ? -5.604  -13.433 -1.191  1.00 0.00 ? 94  ARG A HD3  2  
ATOM 3279  H HE   . ARG A 1 94  ? -6.956  -15.328 -2.872  1.00 0.00 ? 94  ARG A HE   2  
ATOM 3280  H HH11 . ARG A 1 94  ? -4.137  -14.775 -0.890  1.00 0.00 ? 94  ARG A HH11 2  
ATOM 3281  H HH12 . ARG A 1 94  ? -3.870  -16.457 -0.582  1.00 0.00 ? 94  ARG A HH12 2  
ATOM 3282  H HH21 . ARG A 1 94  ? -6.606  -17.541 -2.467  1.00 0.00 ? 94  ARG A HH21 2  
ATOM 3283  H HH22 . ARG A 1 94  ? -5.271  -18.029 -1.477  1.00 0.00 ? 94  ARG A HH22 2  
ATOM 3284  N N    . HIS A 1 95  ? -6.748  -8.800  -0.618  1.00 0.00 ? 95  HIS A N    2  
ATOM 3285  C CA   . HIS A 1 95  ? -7.220  -7.544  -0.047  1.00 0.00 ? 95  HIS A CA   2  
ATOM 3286  C C    . HIS A 1 95  ? -6.078  -6.539  0.073   1.00 0.00 ? 95  HIS A C    2  
ATOM 3287  O O    . HIS A 1 95  ? -5.061  -6.812  0.709   1.00 0.00 ? 95  HIS A O    2  
ATOM 3288  C CB   . HIS A 1 95  ? -7.845  -7.788  1.328   1.00 0.00 ? 95  HIS A CB   2  
ATOM 3289  C CG   . HIS A 1 95  ? -8.738  -6.676  1.785   1.00 0.00 ? 95  HIS A CG   2  
ATOM 3290  N ND1  . HIS A 1 95  ? -9.645  -6.815  2.814   1.00 0.00 ? 95  HIS A ND1  2  
ATOM 3291  C CD2  . HIS A 1 95  ? -8.859  -5.401  1.348   1.00 0.00 ? 95  HIS A CD2  2  
ATOM 3292  C CE1  . HIS A 1 95  ? -10.286 -5.672  2.990   1.00 0.00 ? 95  HIS A CE1  2  
ATOM 3293  N NE2  . HIS A 1 95  ? -9.828  -4.799  2.114   1.00 0.00 ? 95  HIS A NE2  2  
ATOM 3294  H H    . HIS A 1 95  ? -6.414  -9.502  -0.021  1.00 0.00 ? 95  HIS A H    2  
ATOM 3295  H HA   . HIS A 1 95  ? -7.971  -7.140  -0.708  1.00 0.00 ? 95  HIS A HA   2  
ATOM 3296  H HB2  . HIS A 1 95  ? -8.434  -8.692  1.291   1.00 0.00 ? 95  HIS A HB2  2  
ATOM 3297  H HB3  . HIS A 1 95  ? -7.058  -7.906  2.058   1.00 0.00 ? 95  HIS A HB3  2  
ATOM 3298  H HD1  . HIS A 1 95  ? -9.797  -7.629  3.338   1.00 0.00 ? 95  HIS A HD1  2  
ATOM 3299  H HD2  . HIS A 1 95  ? -8.298  -4.941  0.546   1.00 0.00 ? 95  HIS A HD2  2  
ATOM 3300  H HE1  . HIS A 1 95  ? -11.054 -5.485  3.726   1.00 0.00 ? 95  HIS A HE1  2  
ATOM 3301  H HE2  . HIS A 1 95  ? -10.066 -3.849  2.086   1.00 0.00 ? 95  HIS A HE2  2  
ATOM 3302  N N    . LEU A 1 96  ? -6.256  -5.373  -0.542  1.00 0.00 ? 96  LEU A N    2  
ATOM 3303  C CA   . LEU A 1 96  ? -5.241  -4.327  -0.504  1.00 0.00 ? 96  LEU A CA   2  
ATOM 3304  C C    . LEU A 1 96  ? -5.811  -3.037  0.077   1.00 0.00 ? 96  LEU A C    2  
ATOM 3305  O O    . LEU A 1 96  ? -6.547  -2.313  -0.595  1.00 0.00 ? 96  LEU A O    2  
ATOM 3306  C CB   . LEU A 1 96  ? -4.692  -4.069  -1.908  1.00 0.00 ? 96  LEU A CB   2  
ATOM 3307  C CG   . LEU A 1 96  ? -4.331  -5.325  -2.703  1.00 0.00 ? 96  LEU A CG   2  
ATOM 3308  C CD1  . LEU A 1 96  ? -4.305  -5.026  -4.193  1.00 0.00 ? 96  LEU A CD1  2  
ATOM 3309  C CD2  . LEU A 1 96  ? -2.988  -5.876  -2.243  1.00 0.00 ? 96  LEU A CD2  2  
ATOM 3310  H H    . LEU A 1 96  ? -7.089  -5.215  -1.032  1.00 0.00 ? 96  LEU A H    2  
ATOM 3311  H HA   . LEU A 1 96  ? -4.436  -4.668  0.130   1.00 0.00 ? 96  LEU A HA   2  
ATOM 3312  H HB2  . LEU A 1 96  ? -5.437  -3.517  -2.468  1.00 0.00 ? 96  LEU A HB2  2  
ATOM 3313  H HB3  . LEU A 1 96  ? -3.803  -3.458  -1.818  1.00 0.00 ? 96  LEU A HB3  2  
ATOM 3314  H HG   . LEU A 1 96  ? -5.081  -6.083  -2.526  1.00 0.00 ? 96  LEU A HG   2  
ATOM 3315  H HD11 . LEU A 1 96  ? -5.305  -5.099  -4.592  1.00 0.00 ? 96  LEU A HD11 2  
ATOM 3316  H HD12 . LEU A 1 96  ? -3.665  -5.740  -4.692  1.00 0.00 ? 96  LEU A HD12 2  
ATOM 3317  H HD13 . LEU A 1 96  ? -3.924  -4.029  -4.353  1.00 0.00 ? 96  LEU A HD13 2  
ATOM 3318  H HD21 . LEU A 1 96  ? -3.017  -6.956  -2.262  1.00 0.00 ? 96  LEU A HD21 2  
ATOM 3319  H HD22 . LEU A 1 96  ? -2.786  -5.539  -1.237  1.00 0.00 ? 96  LEU A HD22 2  
ATOM 3320  H HD23 . LEU A 1 96  ? -2.210  -5.524  -2.903  1.00 0.00 ? 96  LEU A HD23 2  
ATOM 3321  N N    . ILE A 1 97  ? -5.466  -2.756  1.329   1.00 0.00 ? 97  ILE A N    2  
ATOM 3322  C CA   . ILE A 1 97  ? -5.944  -1.553  2.001   1.00 0.00 ? 97  ILE A CA   2  
ATOM 3323  C C    . ILE A 1 97  ? -4.884  -0.456  1.982   1.00 0.00 ? 97  ILE A C    2  
ATOM 3324  O O    . ILE A 1 97  ? -4.064  -0.356  2.895   1.00 0.00 ? 97  ILE A O    2  
ATOM 3325  C CB   . ILE A 1 97  ? -6.339  -1.844  3.462   1.00 0.00 ? 97  ILE A CB   2  
ATOM 3326  C CG1  . ILE A 1 97  ? -7.260  -3.065  3.535   1.00 0.00 ? 97  ILE A CG1  2  
ATOM 3327  C CG2  . ILE A 1 97  ? -7.012  -0.627  4.080   1.00 0.00 ? 97  ILE A CG2  2  
ATOM 3328  C CD1  . ILE A 1 97  ? -6.827  -4.087  4.563   1.00 0.00 ? 97  ILE A CD1  2  
ATOM 3329  H H    . ILE A 1 97  ? -4.877  -3.371  1.813   1.00 0.00 ? 97  ILE A H    2  
ATOM 3330  H HA   . ILE A 1 97  ? -6.820  -1.202  1.476   1.00 0.00 ? 97  ILE A HA   2  
ATOM 3331  H HB   . ILE A 1 97  ? -5.438  -2.047  4.021   1.00 0.00 ? 97  ILE A HB   2  
ATOM 3332  H HG12 . ILE A 1 97  ? -8.258  -2.743  3.790   1.00 0.00 ? 97  ILE A HG12 2  
ATOM 3333  H HG13 . ILE A 1 97  ? -7.280  -3.552  2.571   1.00 0.00 ? 97  ILE A HG13 2  
ATOM 3334  H HG21 . ILE A 1 97  ? -7.999  -0.509  3.659   1.00 0.00 ? 97  ILE A HG21 2  
ATOM 3335  H HG22 . ILE A 1 97  ? -6.425  0.255   3.872   1.00 0.00 ? 97  ILE A HG22 2  
ATOM 3336  H HG23 . ILE A 1 97  ? -7.091  -0.763  5.149   1.00 0.00 ? 97  ILE A HG23 2  
ATOM 3337  H HD11 . ILE A 1 97  ? -6.390  -3.581  5.412   1.00 0.00 ? 97  ILE A HD11 2  
ATOM 3338  H HD12 . ILE A 1 97  ? -6.095  -4.750  4.125   1.00 0.00 ? 97  ILE A HD12 2  
ATOM 3339  H HD13 . ILE A 1 97  ? -7.683  -4.659  4.886   1.00 0.00 ? 97  ILE A HD13 2  
ATOM 3340  N N    . LEU A 1 98  ? -4.906  0.364   0.937   1.00 0.00 ? 98  LEU A N    2  
ATOM 3341  C CA   . LEU A 1 98  ? -3.946  1.453   0.800   1.00 0.00 ? 98  LEU A CA   2  
ATOM 3342  C C    . LEU A 1 98  ? -4.377  2.663   1.624   1.00 0.00 ? 98  LEU A C    2  
ATOM 3343  O O    . LEU A 1 98  ? -5.552  2.814   1.957   1.00 0.00 ? 98  LEU A O    2  
ATOM 3344  C CB   . LEU A 1 98  ? -3.799  1.850   -0.670  1.00 0.00 ? 98  LEU A CB   2  
ATOM 3345  C CG   . LEU A 1 98  ? -3.326  0.729   -1.599  1.00 0.00 ? 98  LEU A CG   2  
ATOM 3346  C CD1  . LEU A 1 98  ? -4.516  -0.009  -2.191  1.00 0.00 ? 98  LEU A CD1  2  
ATOM 3347  C CD2  . LEU A 1 98  ? -2.440  1.290   -2.701  1.00 0.00 ? 98  LEU A CD2  2  
ATOM 3348  H H    . LEU A 1 98  ? -5.584  0.233   0.241   1.00 0.00 ? 98  LEU A H    2  
ATOM 3349  H HA   . LEU A 1 98  ? -2.994  1.103   1.168   1.00 0.00 ? 98  LEU A HA   2  
ATOM 3350  H HB2  . LEU A 1 98  ? -4.756  2.203   -1.023  1.00 0.00 ? 98  LEU A HB2  2  
ATOM 3351  H HB3  . LEU A 1 98  ? -3.089  2.661   -0.732  1.00 0.00 ? 98  LEU A HB3  2  
ATOM 3352  H HG   . LEU A 1 98  ? -2.743  0.020   -1.028  1.00 0.00 ? 98  LEU A HG   2  
ATOM 3353  H HD11 . LEU A 1 98  ? -5.356  0.664   -2.266  1.00 0.00 ? 98  LEU A HD11 2  
ATOM 3354  H HD12 . LEU A 1 98  ? -4.776  -0.842  -1.554  1.00 0.00 ? 98  LEU A HD12 2  
ATOM 3355  H HD13 . LEU A 1 98  ? -4.258  -0.375  -3.175  1.00 0.00 ? 98  LEU A HD13 2  
ATOM 3356  H HD21 . LEU A 1 98  ? -2.391  0.583   -3.517  1.00 0.00 ? 98  LEU A HD21 2  
ATOM 3357  H HD22 . LEU A 1 98  ? -1.447  1.461   -2.313  1.00 0.00 ? 98  LEU A HD22 2  
ATOM 3358  H HD23 . LEU A 1 98  ? -2.854  2.221   -3.056  1.00 0.00 ? 98  LEU A HD23 2  
ATOM 3359  N N    . THR A 1 99  ? -3.416  3.521   1.951   1.00 0.00 ? 99  THR A N    2  
ATOM 3360  C CA   . THR A 1 99  ? -3.696  4.719   2.736   1.00 0.00 ? 99  THR A CA   2  
ATOM 3361  C C    . THR A 1 99  ? -3.097  5.955   2.074   1.00 0.00 ? 99  THR A C    2  
ATOM 3362  O O    . THR A 1 99  ? -1.988  6.373   2.406   1.00 0.00 ? 99  THR A O    2  
ATOM 3363  C CB   . THR A 1 99  ? -3.142  4.565   4.153   1.00 0.00 ? 99  THR A CB   2  
ATOM 3364  O OG1  . THR A 1 99  ? -3.546  3.331   4.718   1.00 0.00 ? 99  THR A OG1  2  
ATOM 3365  C CG2  . THR A 1 99  ? -3.583  5.668   5.091   1.00 0.00 ? 99  THR A CG2  2  
ATOM 3366  H H    . THR A 1 99  ? -2.498  3.346   1.657   1.00 0.00 ? 99  THR A H    2  
ATOM 3367  H HA   . THR A 1 99  ? -4.768  4.837   2.789   1.00 0.00 ? 99  THR A HA   2  
ATOM 3368  H HB   . THR A 1 99  ? -2.062  4.580   4.110   1.00 0.00 ? 99  THR A HB   2  
ATOM 3369  H HG1  . THR A 1 99  ? -3.191  3.254   5.607   1.00 0.00 ? 99  THR A HG1  2  
ATOM 3370  H HG21 . THR A 1 99  ? -2.738  6.010   5.667   1.00 0.00 ? 99  THR A HG21 2  
ATOM 3371  H HG22 . THR A 1 99  ? -4.345  5.289   5.757   1.00 0.00 ? 99  THR A HG22 2  
ATOM 3372  H HG23 . THR A 1 99  ? -3.985  6.490   4.516   1.00 0.00 ? 99  THR A HG23 2  
ATOM 3373  N N    . VAL A 1 100 ? -3.839  6.535   1.136   1.00 0.00 ? 100 VAL A N    2  
ATOM 3374  C CA   . VAL A 1 100 ? -3.381  7.724   0.427   1.00 0.00 ? 100 VAL A CA   2  
ATOM 3375  C C    . VAL A 1 100 ? -4.017  8.985   1.001   1.00 0.00 ? 100 VAL A C    2  
ATOM 3376  O O    . VAL A 1 100 ? -5.148  8.956   1.488   1.00 0.00 ? 100 VAL A O    2  
ATOM 3377  C CB   . VAL A 1 100 ? -3.702  7.640   -1.077  1.00 0.00 ? 100 VAL A CB   2  
ATOM 3378  C CG1  . VAL A 1 100 ? -2.840  6.584   -1.751  1.00 0.00 ? 100 VAL A CG1  2  
ATOM 3379  C CG2  . VAL A 1 100 ? -5.180  7.348   -1.291  1.00 0.00 ? 100 VAL A CG2  2  
ATOM 3380  H H    . VAL A 1 100 ? -4.714  6.155   0.915   1.00 0.00 ? 100 VAL A H    2  
ATOM 3381  H HA   . VAL A 1 100 ? -2.308  7.789   0.541   1.00 0.00 ? 100 VAL A HA   2  
ATOM 3382  H HB   . VAL A 1 100 ? -3.478  8.596   -1.526  1.00 0.00 ? 100 VAL A HB   2  
ATOM 3383  H HG11 . VAL A 1 100 ? -2.541  5.845   -1.022  1.00 0.00 ? 100 VAL A HG11 2  
ATOM 3384  H HG12 . VAL A 1 100 ? -1.961  7.052   -2.169  1.00 0.00 ? 100 VAL A HG12 2  
ATOM 3385  H HG13 . VAL A 1 100 ? -3.404  6.107   -2.537  1.00 0.00 ? 100 VAL A HG13 2  
ATOM 3386  H HG21 . VAL A 1 100 ? -5.416  7.435   -2.341  1.00 0.00 ? 100 VAL A HG21 2  
ATOM 3387  H HG22 . VAL A 1 100 ? -5.772  8.055   -0.729  1.00 0.00 ? 100 VAL A HG22 2  
ATOM 3388  H HG23 . VAL A 1 100 ? -5.402  6.346   -0.953  1.00 0.00 ? 100 VAL A HG23 2  
ATOM 3389  N N    . LYS A 1 101 ? -3.284  10.091  0.941   1.00 0.00 ? 101 LYS A N    2  
ATOM 3390  C CA   . LYS A 1 101 ? -3.776  11.365  1.455   1.00 0.00 ? 101 LYS A CA   2  
ATOM 3391  C C    . LYS A 1 101 ? -4.041  12.345  0.318   1.00 0.00 ? 101 LYS A C    2  
ATOM 3392  O O    . LYS A 1 101 ? -3.759  12.053  -0.845  1.00 0.00 ? 101 LYS A O    2  
ATOM 3393  C CB   . LYS A 1 101 ? -2.770  11.966  2.437   1.00 0.00 ? 101 LYS A CB   2  
ATOM 3394  C CG   . LYS A 1 101 ? -1.335  11.931  1.936   1.00 0.00 ? 101 LYS A CG   2  
ATOM 3395  C CD   . LYS A 1 101 ? -0.384  12.590  2.923   1.00 0.00 ? 101 LYS A CD   2  
ATOM 3396  C CE   . LYS A 1 101 ? -0.605  14.093  2.993   1.00 0.00 ? 101 LYS A CE   2  
ATOM 3397  N NZ   . LYS A 1 101 ? -1.275  14.498  4.261   1.00 0.00 ? 101 LYS A NZ   2  
ATOM 3398  H H    . LYS A 1 101 ? -2.389  10.052  0.542   1.00 0.00 ? 101 LYS A H    2  
ATOM 3399  H HA   . LYS A 1 101 ? -4.704  11.175  1.975   1.00 0.00 ? 101 LYS A HA   2  
ATOM 3400  H HB2  . LYS A 1 101 ? -3.038  12.995  2.625   1.00 0.00 ? 101 LYS A HB2  2  
ATOM 3401  H HB3  . LYS A 1 101 ? -2.817  11.417  3.367   1.00 0.00 ? 101 LYS A HB3  2  
ATOM 3402  H HG2  . LYS A 1 101 ? -1.037  10.903  1.797   1.00 0.00 ? 101 LYS A HG2  2  
ATOM 3403  H HG3  . LYS A 1 101 ? -1.281  12.454  0.993   1.00 0.00 ? 101 LYS A HG3  2  
ATOM 3404  H HD2  . LYS A 1 101 ? -0.546  12.167  3.902   1.00 0.00 ? 101 LYS A HD2  2  
ATOM 3405  H HD3  . LYS A 1 101 ? 0.633   12.400  2.610   1.00 0.00 ? 101 LYS A HD3  2  
ATOM 3406  H HE2  . LYS A 1 101 ? 0.352   14.588  2.929   1.00 0.00 ? 101 LYS A HE2  2  
ATOM 3407  H HE3  . LYS A 1 101 ? -1.222  14.394  2.159   1.00 0.00 ? 101 LYS A HE3  2  
ATOM 3408  H HZ1  . LYS A 1 101 ? -2.298  14.326  4.195   1.00 0.00 ? 101 LYS A HZ1  2  
ATOM 3409  H HZ2  . LYS A 1 101 ? -1.115  15.508  4.443   1.00 0.00 ? 101 LYS A HZ2  2  
ATOM 3410  H HZ3  . LYS A 1 101 ? -0.892  13.948  5.057   1.00 0.00 ? 101 LYS A HZ3  2  
ATOM 3411  N N    . ASP A 1 102 ? -4.585  13.508  0.659   1.00 0.00 ? 102 ASP A N    2  
ATOM 3412  C CA   . ASP A 1 102 ? -4.888  14.531  -0.334  1.00 0.00 ? 102 ASP A CA   2  
ATOM 3413  C C    . ASP A 1 102 ? -3.610  15.186  -0.848  1.00 0.00 ? 102 ASP A C    2  
ATOM 3414  O O    . ASP A 1 102 ? -2.798  15.681  -0.066  1.00 0.00 ? 102 ASP A O    2  
ATOM 3415  C CB   . ASP A 1 102 ? -5.814  15.593  0.263   1.00 0.00 ? 102 ASP A CB   2  
ATOM 3416  C CG   . ASP A 1 102 ? -7.274  15.188  0.197   1.00 0.00 ? 102 ASP A CG   2  
ATOM 3417  O OD1  . ASP A 1 102 ? -7.610  14.308  -0.623  1.00 0.00 ? 102 ASP A OD1  2  
ATOM 3418  O OD2  . ASP A 1 102 ? -8.082  15.752  0.964   1.00 0.00 ? 102 ASP A OD2  2  
ATOM 3419  H H    . ASP A 1 102 ? -4.788  13.682  1.602   1.00 0.00 ? 102 ASP A H    2  
ATOM 3420  H HA   . ASP A 1 102 ? -5.391  14.052  -1.160  1.00 0.00 ? 102 ASP A HA   2  
ATOM 3421  H HB2  . ASP A 1 102 ? -5.552  15.750  1.300   1.00 0.00 ? 102 ASP A HB2  2  
ATOM 3422  H HB3  . ASP A 1 102 ? -5.691  16.518  -0.283  1.00 0.00 ? 102 ASP A HB3  2  
ATOM 3423  N N    . VAL A 1 103 ? -3.438  15.184  -2.166  1.00 0.00 ? 103 VAL A N    2  
ATOM 3424  C CA   . VAL A 1 103 ? -2.259  15.778  -2.783  1.00 0.00 ? 103 VAL A CA   2  
ATOM 3425  C C    . VAL A 1 103 ? -2.636  16.977  -3.646  1.00 0.00 ? 103 VAL A C    2  
ATOM 3426  O O    . VAL A 1 103 ? -2.838  16.848  -4.854  1.00 0.00 ? 103 VAL A O    2  
ATOM 3427  C CB   . VAL A 1 103 ? -1.504  14.754  -3.652  1.00 0.00 ? 103 VAL A CB   2  
ATOM 3428  C CG1  . VAL A 1 103 ? -0.181  15.330  -4.128  1.00 0.00 ? 103 VAL A CG1  2  
ATOM 3429  C CG2  . VAL A 1 103 ? -1.285  13.460  -2.881  1.00 0.00 ? 103 VAL A CG2  2  
ATOM 3430  H H    . VAL A 1 103 ? -4.122  14.773  -2.735  1.00 0.00 ? 103 VAL A H    2  
ATOM 3431  H HA   . VAL A 1 103 ? -1.599  16.107  -1.994  1.00 0.00 ? 103 VAL A HA   2  
ATOM 3432  H HB   . VAL A 1 103 ? -2.108  14.532  -4.519  1.00 0.00 ? 103 VAL A HB   2  
ATOM 3433  H HG11 . VAL A 1 103 ? 0.439   14.535  -4.517  1.00 0.00 ? 103 VAL A HG11 2  
ATOM 3434  H HG12 . VAL A 1 103 ? 0.323   15.808  -3.301  1.00 0.00 ? 103 VAL A HG12 2  
ATOM 3435  H HG13 . VAL A 1 103 ? -0.363  16.056  -4.906  1.00 0.00 ? 103 VAL A HG13 2  
ATOM 3436  H HG21 . VAL A 1 103 ? -0.902  12.704  -3.550  1.00 0.00 ? 103 VAL A HG21 2  
ATOM 3437  H HG22 . VAL A 1 103 ? -2.222  13.128  -2.460  1.00 0.00 ? 103 VAL A HG22 2  
ATOM 3438  H HG23 . VAL A 1 103 ? -0.574  13.631  -2.086  1.00 0.00 ? 103 VAL A HG23 2  
ATOM 3439  N N    . GLY A 1 104 ? -2.730  18.144  -3.018  1.00 0.00 ? 104 GLY A N    2  
ATOM 3440  C CA   . GLY A 1 104 ? -3.082  19.351  -3.743  1.00 0.00 ? 104 GLY A CA   2  
ATOM 3441  C C    . GLY A 1 104 ? -4.576  19.612  -3.744  1.00 0.00 ? 104 GLY A C    2  
ATOM 3442  O O    . GLY A 1 104 ? -5.099  20.259  -4.651  1.00 0.00 ? 104 GLY A O    2  
ATOM 3443  H H    . GLY A 1 104 ? -2.559  18.186  -2.053  1.00 0.00 ? 104 GLY A H    2  
ATOM 3444  H HA2  . GLY A 1 104 ? -2.581  20.191  -3.285  1.00 0.00 ? 104 GLY A HA2  2  
ATOM 3445  H HA3  . GLY A 1 104 ? -2.744  19.255  -4.764  1.00 0.00 ? 104 GLY A HA3  2  
ATOM 3446  N N    . ARG A 1 105 ? -5.264  19.109  -2.724  1.00 0.00 ? 105 ARG A N    2  
ATOM 3447  C CA   . ARG A 1 105 ? -6.707  19.294  -2.611  1.00 0.00 ? 105 ARG A CA   2  
ATOM 3448  C C    . ARG A 1 105 ? -7.034  20.495  -1.730  1.00 0.00 ? 105 ARG A C    2  
ATOM 3449  O O    . ARG A 1 105 ? -6.138  21.145  -1.192  1.00 0.00 ? 105 ARG A O    2  
ATOM 3450  C CB   . ARG A 1 105 ? -7.360  18.034  -2.039  1.00 0.00 ? 105 ARG A CB   2  
ATOM 3451  C CG   . ARG A 1 105 ? -7.115  16.788  -2.875  1.00 0.00 ? 105 ARG A CG   2  
ATOM 3452  C CD   . ARG A 1 105 ? -8.251  16.544  -3.856  1.00 0.00 ? 105 ARG A CD   2  
ATOM 3453  N NE   . ARG A 1 105 ? -9.312  15.728  -3.273  1.00 0.00 ? 105 ARG A NE   2  
ATOM 3454  C CZ   . ARG A 1 105 ? -10.227 15.078  -3.989  1.00 0.00 ? 105 ARG A CZ   2  
ATOM 3455  N NH1  . ARG A 1 105 ? -10.213 15.146  -5.315  1.00 0.00 ? 105 ARG A NH1  2  
ATOM 3456  N NH2  . ARG A 1 105 ? -11.158 14.357  -3.379  1.00 0.00 ? 105 ARG A NH2  2  
ATOM 3457  H H    . ARG A 1 105 ? -4.792  18.603  -2.030  1.00 0.00 ? 105 ARG A H    2  
ATOM 3458  H HA   . ARG A 1 105 ? -7.097  19.472  -3.602  1.00 0.00 ? 105 ARG A HA   2  
ATOM 3459  H HB2  . ARG A 1 105 ? -6.970  17.858  -1.047  1.00 0.00 ? 105 ARG A HB2  2  
ATOM 3460  H HB3  . ARG A 1 105 ? -8.426  18.194  -1.974  1.00 0.00 ? 105 ARG A HB3  2  
ATOM 3461  H HG2  . ARG A 1 105 ? -6.196  16.912  -3.428  1.00 0.00 ? 105 ARG A HG2  2  
ATOM 3462  H HG3  . ARG A 1 105 ? -7.031  15.936  -2.217  1.00 0.00 ? 105 ARG A HG3  2  
ATOM 3463  H HD2  . ARG A 1 105 ? -8.664  17.496  -4.153  1.00 0.00 ? 105 ARG A HD2  2  
ATOM 3464  H HD3  . ARG A 1 105 ? -7.855  16.037  -4.724  1.00 0.00 ? 105 ARG A HD3  2  
ATOM 3465  H HE   . ARG A 1 105 ? -9.346  15.660  -2.296  1.00 0.00 ? 105 ARG A HE   2  
ATOM 3466  H HH11 . ARG A 1 105 ? -9.513  15.687  -5.782  1.00 0.00 ? 105 ARG A HH11 2  
ATOM 3467  H HH12 . ARG A 1 105 ? -10.902 14.654  -5.847  1.00 0.00 ? 105 ARG A HH12 2  
ATOM 3468  H HH21 . ARG A 1 105 ? -11.173 14.302  -2.381  1.00 0.00 ? 105 ARG A HH21 2  
ATOM 3469  H HH22 . ARG A 1 105 ? -11.846 13.869  -3.918  1.00 0.00 ? 105 ARG A HH22 2  
ATOM 3470  N N    . LEU A 1 106 ? -8.323  20.785  -1.589  1.00 0.00 ? 106 LEU A N    2  
ATOM 3471  C CA   . LEU A 1 106 ? -8.768  21.909  -0.773  1.00 0.00 ? 106 LEU A CA   2  
ATOM 3472  C C    . LEU A 1 106 ? -10.041 21.555  -0.006  1.00 0.00 ? 106 LEU A C    2  
ATOM 3473  O O    . LEU A 1 106 ? -11.134 21.558  -0.571  1.00 0.00 ? 106 LEU A O    2  
ATOM 3474  C CB   . LEU A 1 106 ? -9.015  23.136  -1.654  1.00 0.00 ? 106 LEU A CB   2  
ATOM 3475  C CG   . LEU A 1 106 ? -9.090  24.468  -0.902  1.00 0.00 ? 106 LEU A CG   2  
ATOM 3476  C CD1  . LEU A 1 106 ? -8.264  25.531  -1.609  1.00 0.00 ? 106 LEU A CD1  2  
ATOM 3477  C CD2  . LEU A 1 106 ? -10.537 24.920  -0.763  1.00 0.00 ? 106 LEU A CD2  2  
ATOM 3478  H H    . LEU A 1 106 ? -8.991  20.230  -2.043  1.00 0.00 ? 106 LEU A H    2  
ATOM 3479  H HA   . LEU A 1 106 ? -7.984  22.138  -0.068  1.00 0.00 ? 106 LEU A HA   2  
ATOM 3480  H HB2  . LEU A 1 106 ? -8.216  23.198  -2.378  1.00 0.00 ? 106 LEU A HB2  2  
ATOM 3481  H HB3  . LEU A 1 106 ? -9.946  22.993  -2.182  1.00 0.00 ? 106 LEU A HB3  2  
ATOM 3482  H HG   . LEU A 1 106 ? -8.684  24.336  0.091   1.00 0.00 ? 106 LEU A HG   2  
ATOM 3483  H HD11 . LEU A 1 106 ? -7.899  26.244  -0.885  1.00 0.00 ? 106 LEU A HD11 2  
ATOM 3484  H HD12 . LEU A 1 106 ? -8.878  26.040  -2.337  1.00 0.00 ? 106 LEU A HD12 2  
ATOM 3485  H HD13 . LEU A 1 106 ? -7.427  25.064  -2.107  1.00 0.00 ? 106 LEU A HD13 2  
ATOM 3486  H HD21 . LEU A 1 106 ? -10.574 25.837  -0.193  1.00 0.00 ? 106 LEU A HD21 2  
ATOM 3487  H HD22 . LEU A 1 106 ? -11.106 24.157  -0.255  1.00 0.00 ? 106 LEU A HD22 2  
ATOM 3488  H HD23 . LEU A 1 106 ? -10.957 25.090  -1.744  1.00 0.00 ? 106 LEU A HD23 2  
ATOM 3489  N N    . PRO A 1 107 ? -9.919  21.243  1.298   1.00 0.00 ? 107 PRO A N    2  
ATOM 3490  C CA   . PRO A 1 107 ? -11.072 20.887  2.132   1.00 0.00 ? 107 PRO A CA   2  
ATOM 3491  C C    . PRO A 1 107 ? -12.006 22.069  2.362   1.00 0.00 ? 107 PRO A C    2  
ATOM 3492  O O    . PRO A 1 107 ? -11.763 23.171  1.870   1.00 0.00 ? 107 PRO A O    2  
ATOM 3493  C CB   . PRO A 1 107 ? -10.437 20.441  3.452   1.00 0.00 ? 107 PRO A CB   2  
ATOM 3494  C CG   . PRO A 1 107 ? -9.115  21.124  3.488   1.00 0.00 ? 107 PRO A CG   2  
ATOM 3495  C CD   . PRO A 1 107 ? -8.656  21.212  2.059   1.00 0.00 ? 107 PRO A CD   2  
ATOM 3496  H HA   . PRO A 1 107 ? -11.631 20.068  1.704   1.00 0.00 ? 107 PRO A HA   2  
ATOM 3497  H HB2  . PRO A 1 107 ? -11.065 20.749  4.279   1.00 0.00 ? 107 PRO A HB2  2  
ATOM 3498  H HB3  . PRO A 1 107 ? -10.325 19.365  3.456   1.00 0.00 ? 107 PRO A HB3  2  
ATOM 3499  H HG2  . PRO A 1 107 ? -9.224  22.113  3.909   1.00 0.00 ? 107 PRO A HG2  2  
ATOM 3500  H HG3  . PRO A 1 107 ? -8.417  20.543  4.071   1.00 0.00 ? 107 PRO A HG3  2  
ATOM 3501  H HD2  . PRO A 1 107 ? -8.087  22.119  1.901   1.00 0.00 ? 107 PRO A HD2  2  
ATOM 3502  H HD3  . PRO A 1 107 ? -8.069  20.343  1.797   1.00 0.00 ? 107 PRO A HD3  2  
ATOM 3503  N N    . HIS A 1 108 ? -13.077 21.833  3.114   1.00 0.00 ? 108 HIS A N    2  
ATOM 3504  C CA   . HIS A 1 108 ? -14.050 22.880  3.409   1.00 0.00 ? 108 HIS A CA   2  
ATOM 3505  C C    . HIS A 1 108 ? -14.073 23.199  4.900   1.00 0.00 ? 108 HIS A C    2  
ATOM 3506  O O    . HIS A 1 108 ? -13.907 24.349  5.302   1.00 0.00 ? 108 HIS A O    2  
ATOM 3507  C CB   . HIS A 1 108 ? -15.443 22.454  2.944   1.00 0.00 ? 108 HIS A CB   2  
ATOM 3508  C CG   . HIS A 1 108 ? -16.262 23.582  2.397   1.00 0.00 ? 108 HIS A CG   2  
ATOM 3509  N ND1  . HIS A 1 108 ? -17.001 23.482  1.237   1.00 0.00 ? 108 HIS A ND1  2  
ATOM 3510  C CD2  . HIS A 1 108 ? -16.457 24.841  2.857   1.00 0.00 ? 108 HIS A CD2  2  
ATOM 3511  C CE1  . HIS A 1 108 ? -17.614 24.629  1.007   1.00 0.00 ? 108 HIS A CE1  2  
ATOM 3512  N NE2  . HIS A 1 108 ? -17.301 25.470  1.976   1.00 0.00 ? 108 HIS A NE2  2  
ATOM 3513  H H    . HIS A 1 108 ? -13.217 20.935  3.478   1.00 0.00 ? 108 HIS A H    2  
ATOM 3514  H HA   . HIS A 1 108 ? -13.756 23.767  2.869   1.00 0.00 ? 108 HIS A HA   2  
ATOM 3515  H HB2  . HIS A 1 108 ? -15.345 21.709  2.170   1.00 0.00 ? 108 HIS A HB2  2  
ATOM 3516  H HB3  . HIS A 1 108 ? -15.979 22.029  3.781   1.00 0.00 ? 108 HIS A HB3  2  
ATOM 3517  H HD1  . HIS A 1 108 ? -17.066 22.688  0.666   1.00 0.00 ? 108 HIS A HD1  2  
ATOM 3518  H HD2  . HIS A 1 108 ? -16.028 25.269  3.752   1.00 0.00 ? 108 HIS A HD2  2  
ATOM 3519  H HE1  . HIS A 1 108 ? -18.262 24.842  0.170   1.00 0.00 ? 108 HIS A HE1  2  
ATOM 3520  H HE2  . HIS A 1 108 ? -17.550 26.418  2.003   1.00 0.00 ? 108 HIS A HE2  2  
ATOM 3521  N N    . ALA A 1 109 ? -14.283 22.170  5.717   1.00 0.00 ? 109 ALA A N    2  
ATOM 3522  C CA   . ALA A 1 109 ? -14.330 22.342  7.164   1.00 0.00 ? 109 ALA A CA   2  
ATOM 3523  C C    . ALA A 1 109 ? -15.461 23.282  7.567   1.00 0.00 ? 109 ALA A C    2  
ATOM 3524  O O    . ALA A 1 109 ? -16.030 23.981  6.727   1.00 0.00 ? 109 ALA A O    2  
ATOM 3525  C CB   . ALA A 1 109 ? -12.997 22.866  7.677   1.00 0.00 ? 109 ALA A CB   2  
ATOM 3526  H H    . ALA A 1 109 ? -14.411 21.276  5.337   1.00 0.00 ? 109 ALA A H    2  
ATOM 3527  H HA   . ALA A 1 109 ? -14.506 21.373  7.609   1.00 0.00 ? 109 ALA A HA   2  
ATOM 3528  H HB1  . ALA A 1 109 ? -12.371 22.035  7.965   1.00 0.00 ? 109 ALA A HB1  2  
ATOM 3529  H HB2  . ALA A 1 109 ? -13.166 23.503  8.533   1.00 0.00 ? 109 ALA A HB2  2  
ATOM 3530  H HB3  . ALA A 1 109 ? -12.508 23.432  6.898   1.00 0.00 ? 109 ALA A HB3  2  
ATOM 3531  N N    . ARG A 1 110 ? -15.782 23.296  8.857   1.00 0.00 ? 110 ARG A N    2  
ATOM 3532  C CA   . ARG A 1 110 ? -16.846 24.151  9.370   1.00 0.00 ? 110 ARG A CA   2  
ATOM 3533  C C    . ARG A 1 110 ? -16.582 24.536  10.821  1.00 0.00 ? 110 ARG A C    2  
ATOM 3534  O O    . ARG A 1 110 ? -17.082 23.893  11.745  1.00 0.00 ? 110 ARG A O    2  
ATOM 3535  C CB   . ARG A 1 110 ? -18.197 23.444  9.255   1.00 0.00 ? 110 ARG A CB   2  
ATOM 3536  C CG   . ARG A 1 110 ? -19.385 24.391  9.305   1.00 0.00 ? 110 ARG A CG   2  
ATOM 3537  C CD   . ARG A 1 110 ? -19.488 25.225  8.039   1.00 0.00 ? 110 ARG A CD   2  
ATOM 3538  N NE   . ARG A 1 110 ? -20.145 26.507  8.280   1.00 0.00 ? 110 ARG A NE   2  
ATOM 3539  C CZ   . ARG A 1 110 ? -20.059 27.550  7.456   1.00 0.00 ? 110 ARG A CZ   2  
ATOM 3540  N NH1  . ARG A 1 110 ? -19.347 27.467  6.339   1.00 0.00 ? 110 ARG A NH1  2  
ATOM 3541  N NH2  . ARG A 1 110 ? -20.689 28.680  7.750   1.00 0.00 ? 110 ARG A NH2  2  
ATOM 3542  H H    . ARG A 1 110 ? -15.292 22.717  9.478   1.00 0.00 ? 110 ARG A H    2  
ATOM 3543  H HA   . ARG A 1 110 ? -16.867 25.049  8.770   1.00 0.00 ? 110 ARG A HA   2  
ATOM 3544  H HB2  . ARG A 1 110 ? -18.232 22.909  8.317   1.00 0.00 ? 110 ARG A HB2  2  
ATOM 3545  H HB3  . ARG A 1 110 ? -18.292 22.739  10.066  1.00 0.00 ? 110 ARG A HB3  2  
ATOM 3546  H HG2  . ARG A 1 110 ? -20.290 23.812  9.418   1.00 0.00 ? 110 ARG A HG2  2  
ATOM 3547  H HG3  . ARG A 1 110 ? -19.271 25.052  10.153  1.00 0.00 ? 110 ARG A HG3  2  
ATOM 3548  H HD2  . ARG A 1 110 ? -18.493 25.407  7.661   1.00 0.00 ? 110 ARG A HD2  2  
ATOM 3549  H HD3  . ARG A 1 110 ? -20.056 24.672  7.304   1.00 0.00 ? 110 ARG A HD3  2  
ATOM 3550  H HE   . ARG A 1 110 ? -20.678 26.597  9.097   1.00 0.00 ? 110 ARG A HE   2  
ATOM 3551  H HH11 . ARG A 1 110 ? -18.870 26.618  6.112   1.00 0.00 ? 110 ARG A HH11 2  
ATOM 3552  H HH12 . ARG A 1 110 ? -19.287 28.253  5.726   1.00 0.00 ? 110 ARG A HH12 2  
ATOM 3553  H HH21 . ARG A 1 110 ? -21.228 28.748  8.590   1.00 0.00 ? 110 ARG A HH21 2  
ATOM 3554  H HH22 . ARG A 1 110 ? -20.625 29.464  7.133   1.00 0.00 ? 110 ARG A HH22 2  
ATOM 3555  N N    . THR A 1 111 ? -15.795 25.588  11.016  1.00 0.00 ? 111 THR A N    2  
ATOM 3556  C CA   . THR A 1 111 ? -15.466 26.059  12.358  1.00 0.00 ? 111 THR A CA   2  
ATOM 3557  C C    . THR A 1 111 ? -16.391 27.195  12.778  1.00 0.00 ? 111 THR A C    2  
ATOM 3558  O O    . THR A 1 111 ? -16.032 28.369  12.687  1.00 0.00 ? 111 THR A O    2  
ATOM 3559  C CB   . THR A 1 111 ? -14.010 26.524  12.415  1.00 0.00 ? 111 THR A CB   2  
ATOM 3560  O OG1  . THR A 1 111 ? -13.210 25.780  11.512  1.00 0.00 ? 111 THR A OG1  2  
ATOM 3561  C CG2  . THR A 1 111 ? -13.393 26.394  13.790  1.00 0.00 ? 111 THR A CG2  2  
ATOM 3562  H H    . THR A 1 111 ? -15.426 26.060  10.241  1.00 0.00 ? 111 THR A H    2  
ATOM 3563  H HA   . THR A 1 111 ? -15.596 25.233  13.040  1.00 0.00 ? 111 THR A HA   2  
ATOM 3564  H HB   . THR A 1 111 ? -13.964 27.565  12.129  1.00 0.00 ? 111 THR A HB   2  
ATOM 3565  H HG1  . THR A 1 111 ? -13.177 24.863  11.794  1.00 0.00 ? 111 THR A HG1  2  
ATOM 3566  H HG21 . THR A 1 111 ? -12.359 26.098  13.695  1.00 0.00 ? 111 THR A HG21 2  
ATOM 3567  H HG22 . THR A 1 111 ? -13.931 25.647  14.356  1.00 0.00 ? 111 THR A HG22 2  
ATOM 3568  H HG23 . THR A 1 111 ? -13.449 27.343  14.302  1.00 0.00 ? 111 THR A HG23 2  
ATOM 3569  N N    . THR A 1 112 ? -17.587 26.839  13.237  1.00 0.00 ? 112 THR A N    2  
ATOM 3570  C CA   . THR A 1 112 ? -18.566 27.828  13.671  1.00 0.00 ? 112 THR A CA   2  
ATOM 3571  C C    . THR A 1 112 ? -19.212 27.413  14.989  1.00 0.00 ? 112 THR A C    2  
ATOM 3572  O O    . THR A 1 112 ? -20.432 27.278  15.081  1.00 0.00 ? 112 THR A O    2  
ATOM 3573  C CB   . THR A 1 112 ? -19.640 28.018  12.597  1.00 0.00 ? 112 THR A CB   2  
ATOM 3574  O OG1  . THR A 1 112 ? -19.976 26.779  12.000  1.00 0.00 ? 112 THR A OG1  2  
ATOM 3575  C CG2  . THR A 1 112 ? -19.221 28.963  11.492  1.00 0.00 ? 112 THR A CG2  2  
ATOM 3576  H H    . THR A 1 112 ? -17.816 25.887  13.285  1.00 0.00 ? 112 THR A H    2  
ATOM 3577  H HA   . THR A 1 112 ? -18.047 28.764  13.816  1.00 0.00 ? 112 THR A HA   2  
ATOM 3578  H HB   . THR A 1 112 ? -20.528 28.424  13.060  1.00 0.00 ? 112 THR A HB   2  
ATOM 3579  H HG1  . THR A 1 112 ? -20.675 26.913  11.355  1.00 0.00 ? 112 THR A HG1  2  
ATOM 3580  H HG21 . THR A 1 112 ? -19.389 29.983  11.807  1.00 0.00 ? 112 THR A HG21 2  
ATOM 3581  H HG22 . THR A 1 112 ? -19.802 28.759  10.605  1.00 0.00 ? 112 THR A HG22 2  
ATOM 3582  H HG23 . THR A 1 112 ? -18.173 28.822  11.276  1.00 0.00 ? 112 THR A HG23 2  
ATOM 3583  N N    . VAL A 1 113 ? -18.382 27.211  16.008  1.00 0.00 ? 113 VAL A N    2  
ATOM 3584  C CA   . VAL A 1 113 ? -18.871 26.811  17.323  1.00 0.00 ? 113 VAL A CA   2  
ATOM 3585  C C    . VAL A 1 113 ? -19.551 25.448  17.265  1.00 0.00 ? 113 VAL A C    2  
ATOM 3586  O O    . VAL A 1 113 ? -20.148 25.084  16.253  1.00 0.00 ? 113 VAL A O    2  
ATOM 3587  C CB   . VAL A 1 113 ? -19.864 27.843  17.892  1.00 0.00 ? 113 VAL A CB   2  
ATOM 3588  C CG1  . VAL A 1 113 ? -20.209 27.513  19.336  1.00 0.00 ? 113 VAL A CG1  2  
ATOM 3589  C CG2  . VAL A 1 113 ? -19.297 29.249  17.778  1.00 0.00 ? 113 VAL A CG2  2  
ATOM 3590  H H    . VAL A 1 113 ? -17.419 27.335  15.874  1.00 0.00 ? 113 VAL A H    2  
ATOM 3591  H HA   . VAL A 1 113 ? -18.024 26.753  17.990  1.00 0.00 ? 113 VAL A HA   2  
ATOM 3592  H HB   . VAL A 1 113 ? -20.773 27.796  17.309  1.00 0.00 ? 113 VAL A HB   2  
ATOM 3593  H HG11 . VAL A 1 113 ? -21.112 26.923  19.366  1.00 0.00 ? 113 VAL A HG11 2  
ATOM 3594  H HG12 . VAL A 1 113 ? -20.358 28.429  19.889  1.00 0.00 ? 113 VAL A HG12 2  
ATOM 3595  H HG13 . VAL A 1 113 ? -19.399 26.954  19.780  1.00 0.00 ? 113 VAL A HG13 2  
ATOM 3596  H HG21 . VAL A 1 113 ? -19.042 29.453  16.749  1.00 0.00 ? 113 VAL A HG21 2  
ATOM 3597  H HG22 . VAL A 1 113 ? -18.412 29.331  18.391  1.00 0.00 ? 113 VAL A HG22 2  
ATOM 3598  H HG23 . VAL A 1 113 ? -20.035 29.963  18.114  1.00 0.00 ? 113 VAL A HG23 2  
ATOM 3599  N N    . ASP A 1 114 ? -19.454 24.697  18.358  1.00 0.00 ? 114 ASP A N    2  
ATOM 3600  C CA   . ASP A 1 114 ? -20.060 23.373  18.432  1.00 0.00 ? 114 ASP A CA   2  
ATOM 3601  C C    . ASP A 1 114 ? -19.491 22.453  17.356  1.00 0.00 ? 114 ASP A C    2  
ATOM 3602  O O    . ASP A 1 114 ? -19.899 22.510  16.196  1.00 0.00 ? 114 ASP A O    2  
ATOM 3603  C CB   . ASP A 1 114 ? -21.579 23.475  18.281  1.00 0.00 ? 114 ASP A CB   2  
ATOM 3604  C CG   . ASP A 1 114 ? -22.318 22.540  19.218  1.00 0.00 ? 114 ASP A CG   2  
ATOM 3605  O OD1  . ASP A 1 114 ? -21.948 22.480  20.410  1.00 0.00 ? 114 ASP A OD1  2  
ATOM 3606  O OD2  . ASP A 1 114 ? -23.267 21.869  18.761  1.00 0.00 ? 114 ASP A OD2  2  
ATOM 3607  H H    . ASP A 1 114 ? -18.964 25.043  19.133  1.00 0.00 ? 114 ASP A H    2  
ATOM 3608  H HA   . ASP A 1 114 ? -19.831 22.958  19.402  1.00 0.00 ? 114 ASP A HA   2  
ATOM 3609  H HB2  . ASP A 1 114 ? -21.889 24.487  18.495  1.00 0.00 ? 114 ASP A HB2  2  
ATOM 3610  H HB3  . ASP A 1 114 ? -21.852 23.227  17.265  1.00 0.00 ? 114 ASP A HB3  2  
ATOM 3611  N N    . GLU A 1 115 ? -18.547 21.604  17.750  1.00 0.00 ? 115 GLU A N    2  
ATOM 3612  C CA   . GLU A 1 115 ? -17.922 20.671  16.820  1.00 0.00 ? 115 GLU A CA   2  
ATOM 3613  C C    . GLU A 1 115 ? -18.638 19.324  16.839  1.00 0.00 ? 115 GLU A C    2  
ATOM 3614  O O    . GLU A 1 115 ? -18.089 18.322  17.300  1.00 0.00 ? 115 GLU A O    2  
ATOM 3615  C CB   . GLU A 1 115 ? -16.444 20.483  17.169  1.00 0.00 ? 115 GLU A CB   2  
ATOM 3616  C CG   . GLU A 1 115 ? -15.570 20.171  15.964  1.00 0.00 ? 115 GLU A CG   2  
ATOM 3617  C CD   . GLU A 1 115 ? -14.164 19.762  16.356  1.00 0.00 ? 115 GLU A CD   2  
ATOM 3618  O OE1  . GLU A 1 115 ? -13.484 20.554  17.041  1.00 0.00 ? 115 GLU A OE1  2  
ATOM 3619  O OE2  . GLU A 1 115 ? -13.743 18.647  15.979  1.00 0.00 ? 115 GLU A OE2  2  
ATOM 3620  H H    . GLU A 1 115 ? -18.264 21.605  18.689  1.00 0.00 ? 115 GLU A H    2  
ATOM 3621  H HA   . GLU A 1 115 ? -17.999 21.091  15.828  1.00 0.00 ? 115 GLU A HA   2  
ATOM 3622  H HB2  . GLU A 1 115 ? -16.077 21.389  17.627  1.00 0.00 ? 115 GLU A HB2  2  
ATOM 3623  H HB3  . GLU A 1 115 ? -16.352 19.671  17.873  1.00 0.00 ? 115 GLU A HB3  2  
ATOM 3624  H HG2  . GLU A 1 115 ? -16.021 19.363  15.408  1.00 0.00 ? 115 GLU A HG2  2  
ATOM 3625  H HG3  . GLU A 1 115 ? -15.513 21.050  15.340  1.00 0.00 ? 115 GLU A HG3  2  
ATOM 3626  N N    . THR A 1 116 ? -19.868 19.306  16.336  1.00 0.00 ? 116 THR A N    2  
ATOM 3627  C CA   . THR A 1 116 ? -20.661 18.084  16.295  1.00 0.00 ? 116 THR A CA   2  
ATOM 3628  C C    . THR A 1 116 ? -20.988 17.695  14.857  1.00 0.00 ? 116 THR A C    2  
ATOM 3629  O O    . THR A 1 116 ? -20.918 16.521  14.489  1.00 0.00 ? 116 THR A O    2  
ATOM 3630  C CB   . THR A 1 116 ? -21.954 18.263  17.093  1.00 0.00 ? 116 THR A CB   2  
ATOM 3631  O OG1  . THR A 1 116 ? -21.724 19.043  18.253  1.00 0.00 ? 116 THR A OG1  2  
ATOM 3632  C CG2  . THR A 1 116 ? -22.571 16.953  17.535  1.00 0.00 ? 116 THR A CG2  2  
ATOM 3633  H H    . THR A 1 116 ? -20.252 20.137  15.984  1.00 0.00 ? 116 THR A H    2  
ATOM 3634  H HA   . THR A 1 116 ? -20.078 17.294  16.745  1.00 0.00 ? 116 THR A HA   2  
ATOM 3635  H HB   . THR A 1 116 ? -22.677 18.777  16.476  1.00 0.00 ? 116 THR A HB   2  
ATOM 3636  H HG1  . THR A 1 116 ? -21.067 18.611  18.804  1.00 0.00 ? 116 THR A HG1  2  
ATOM 3637  H HG21 . THR A 1 116 ? -21.816 16.340  18.004  1.00 0.00 ? 116 THR A HG21 2  
ATOM 3638  H HG22 . THR A 1 116 ? -22.972 16.436  16.676  1.00 0.00 ? 116 THR A HG22 2  
ATOM 3639  H HG23 . THR A 1 116 ? -23.364 17.149  18.241  1.00 0.00 ? 116 THR A HG23 2  
ATOM 3640  N N    . LYS A 1 117 ? -21.345 18.686  14.048  1.00 0.00 ? 117 LYS A N    2  
ATOM 3641  C CA   . LYS A 1 117 ? -21.683 18.448  12.649  1.00 0.00 ? 117 LYS A CA   2  
ATOM 3642  C C    . LYS A 1 117 ? -22.870 17.495  12.532  1.00 0.00 ? 117 LYS A C    2  
ATOM 3643  O O    . LYS A 1 117 ? -22.695 16.291  12.345  1.00 0.00 ? 117 LYS A O    2  
ATOM 3644  C CB   . LYS A 1 117 ? -20.476 17.877  11.902  1.00 0.00 ? 117 LYS A CB   2  
ATOM 3645  C CG   . LYS A 1 117 ? -19.727 18.913  11.079  1.00 0.00 ? 117 LYS A CG   2  
ATOM 3646  C CD   . LYS A 1 117 ? -18.823 19.770  11.951  1.00 0.00 ? 117 LYS A CD   2  
ATOM 3647  C CE   . LYS A 1 117 ? -17.480 19.100  12.190  1.00 0.00 ? 117 LYS A CE   2  
ATOM 3648  N NZ   . LYS A 1 117 ? -17.540 18.116  13.306  1.00 0.00 ? 117 LYS A NZ   2  
ATOM 3649  H H    . LYS A 1 117 ? -21.383 19.600  14.400  1.00 0.00 ? 117 LYS A H    2  
ATOM 3650  H HA   . LYS A 1 117 ? -21.954 19.396  12.208  1.00 0.00 ? 117 LYS A HA   2  
ATOM 3651  H HB2  . LYS A 1 117 ? -19.790 17.454  12.619  1.00 0.00 ? 117 LYS A HB2  2  
ATOM 3652  H HB3  . LYS A 1 117 ? -20.814 17.097  11.236  1.00 0.00 ? 117 LYS A HB3  2  
ATOM 3653  H HG2  . LYS A 1 117 ? -19.121 18.405  10.343  1.00 0.00 ? 117 LYS A HG2  2  
ATOM 3654  H HG3  . LYS A 1 117 ? -20.443 19.550  10.581  1.00 0.00 ? 117 LYS A HG3  2  
ATOM 3655  H HD2  . LYS A 1 117 ? -18.659 20.717  11.460  1.00 0.00 ? 117 LYS A HD2  2  
ATOM 3656  H HD3  . LYS A 1 117 ? -19.308 19.934  12.902  1.00 0.00 ? 117 LYS A HD3  2  
ATOM 3657  H HE2  . LYS A 1 117 ? -17.183 18.587  11.287  1.00 0.00 ? 117 LYS A HE2  2  
ATOM 3658  H HE3  . LYS A 1 117 ? -16.751 19.860  12.429  1.00 0.00 ? 117 LYS A HE3  2  
ATOM 3659  H HZ1  . LYS A 1 117 ? -16.650 18.130  13.843  1.00 0.00 ? 117 LYS A HZ1  2  
ATOM 3660  H HZ2  . LYS A 1 117 ? -17.691 17.158  12.932  1.00 0.00 ? 117 LYS A HZ2  2  
ATOM 3661  H HZ3  . LYS A 1 117 ? -18.323 18.353  13.949  1.00 0.00 ? 117 LYS A HZ3  2  
ATOM 3662  N N    . TRP A 1 118 ? -24.075 18.044  12.641  1.00 0.00 ? 118 TRP A N    2  
ATOM 3663  C CA   . TRP A 1 118 ? -25.290 17.244  12.547  1.00 0.00 ? 118 TRP A CA   2  
ATOM 3664  C C    . TRP A 1 118 ? -25.983 17.464  11.206  1.00 0.00 ? 118 TRP A C    2  
ATOM 3665  O O    . TRP A 1 118 ? -26.522 16.530  10.613  1.00 0.00 ? 118 TRP A O    2  
ATOM 3666  C CB   . TRP A 1 118 ? -26.244 17.592  13.691  1.00 0.00 ? 118 TRP A CB   2  
ATOM 3667  C CG   . TRP A 1 118 ? -26.938 16.398  14.271  1.00 0.00 ? 118 TRP A CG   2  
ATOM 3668  C CD1  . TRP A 1 118 ? -27.944 15.675  13.697  1.00 0.00 ? 118 TRP A CD1  2  
ATOM 3669  C CD2  . TRP A 1 118 ? -26.678 15.787  15.541  1.00 0.00 ? 118 TRP A CD2  2  
ATOM 3670  N NE1  . TRP A 1 118 ? -28.324 14.652  14.531  1.00 0.00 ? 118 TRP A NE1  2  
ATOM 3671  C CE2  . TRP A 1 118 ? -27.562 14.699  15.669  1.00 0.00 ? 118 TRP A CE2  2  
ATOM 3672  C CE3  . TRP A 1 118 ? -25.782 16.054  16.580  1.00 0.00 ? 118 TRP A CE3  2  
ATOM 3673  C CZ2  . TRP A 1 118 ? -27.577 13.880  16.796  1.00 0.00 ? 118 TRP A CZ2  2  
ATOM 3674  C CZ3  . TRP A 1 118 ? -25.798 15.240  17.698  1.00 0.00 ? 118 TRP A CZ3  2  
ATOM 3675  C CH2  . TRP A 1 118 ? -26.689 14.165  17.797  1.00 0.00 ? 118 TRP A CH2  2  
ATOM 3676  H H    . TRP A 1 118 ? -24.149 19.010  12.789  1.00 0.00 ? 118 TRP A H    2  
ATOM 3677  H HA   . TRP A 1 118 ? -25.010 16.204  12.627  1.00 0.00 ? 118 TRP A HA   2  
ATOM 3678  H HB2  . TRP A 1 118 ? -25.687 18.070  14.483  1.00 0.00 ? 118 TRP A HB2  2  
ATOM 3679  H HB3  . TRP A 1 118 ? -27.000 18.273  13.328  1.00 0.00 ? 118 TRP A HB3  2  
ATOM 3680  H HD1  . TRP A 1 118 ? -28.369 15.887  12.727  1.00 0.00 ? 118 TRP A HD1  2  
ATOM 3681  H HE1  . TRP A 1 118 ? -29.026 13.994  14.342  1.00 0.00 ? 118 TRP A HE1  2  
ATOM 3682  H HE3  . TRP A 1 118 ? -25.087 16.879  16.521  1.00 0.00 ? 118 TRP A HE3  2  
ATOM 3683  H HZ2  . TRP A 1 118 ? -28.258 13.047  16.888  1.00 0.00 ? 118 TRP A HZ2  2  
ATOM 3684  H HZ3  . TRP A 1 118 ? -25.114 15.432  18.512  1.00 0.00 ? 118 TRP A HZ3  2  
ATOM 3685  H HH2  . TRP A 1 118 ? -26.667 13.557  18.689  1.00 0.00 ? 118 TRP A HH2  2  
ATOM 3686  N N    . ILE A 1 119 ? -25.964 18.706  10.734  1.00 0.00 ? 119 ILE A N    2  
ATOM 3687  C CA   . ILE A 1 119 ? -26.589 19.051  9.463   1.00 0.00 ? 119 ILE A CA   2  
ATOM 3688  C C    . ILE A 1 119 ? -25.541 19.404  8.413   1.00 0.00 ? 119 ILE A C    2  
ATOM 3689  O O    . ILE A 1 119 ? -24.724 20.302  8.615   1.00 0.00 ? 119 ILE A O    2  
ATOM 3690  C CB   . ILE A 1 119 ? -27.563 20.235  9.618   1.00 0.00 ? 119 ILE A CB   2  
ATOM 3691  C CG1  . ILE A 1 119 ? -26.896 21.374  10.393  1.00 0.00 ? 119 ILE A CG1  2  
ATOM 3692  C CG2  . ILE A 1 119 ? -28.837 19.785  10.317  1.00 0.00 ? 119 ILE A CG2  2  
ATOM 3693  C CD1  . ILE A 1 119 ? -27.756 22.615  10.500  1.00 0.00 ? 119 ILE A CD1  2  
ATOM 3694  H H    . ILE A 1 119 ? -25.518 19.409  11.253  1.00 0.00 ? 119 ILE A H    2  
ATOM 3695  H HA   . ILE A 1 119 ? -27.150 18.193  9.123   1.00 0.00 ? 119 ILE A HA   2  
ATOM 3696  H HB   . ILE A 1 119 ? -27.827 20.587  8.632   1.00 0.00 ? 119 ILE A HB   2  
ATOM 3697  H HG12 . ILE A 1 119 ? -26.675 21.038  11.394  1.00 0.00 ? 119 ILE A HG12 2  
ATOM 3698  H HG13 . ILE A 1 119 ? -25.977 21.648  9.897   1.00 0.00 ? 119 ILE A HG13 2  
ATOM 3699  H HG21 . ILE A 1 119 ? -28.627 18.916  10.924  1.00 0.00 ? 119 ILE A HG21 2  
ATOM 3700  H HG22 . ILE A 1 119 ? -29.585 19.537  9.578   1.00 0.00 ? 119 ILE A HG22 2  
ATOM 3701  H HG23 . ILE A 1 119 ? -29.203 20.582  10.947  1.00 0.00 ? 119 ILE A HG23 2  
ATOM 3702  H HD11 . ILE A 1 119 ? -27.782 22.947  11.527  1.00 0.00 ? 119 ILE A HD11 2  
ATOM 3703  H HD12 . ILE A 1 119 ? -28.759 22.388  10.169  1.00 0.00 ? 119 ILE A HD12 2  
ATOM 3704  H HD13 . ILE A 1 119 ? -27.340 23.396  9.880   1.00 0.00 ? 119 ILE A HD13 2  
ATOM 3705  N N    . ALA A 1 120 ? -25.571 18.691  7.292   1.00 0.00 ? 120 ALA A N    2  
ATOM 3706  C CA   . ALA A 1 120 ? -24.623 18.930  6.210   1.00 0.00 ? 120 ALA A CA   2  
ATOM 3707  C C    . ALA A 1 120 ? -25.163 19.960  5.224   1.00 0.00 ? 120 ALA A C    2  
ATOM 3708  O O    . ALA A 1 120 ? -26.140 19.706  4.518   1.00 0.00 ? 120 ALA A O    2  
ATOM 3709  C CB   . ALA A 1 120 ? -24.304 17.626  5.493   1.00 0.00 ? 120 ALA A CB   2  
ATOM 3710  H H    . ALA A 1 120 ? -26.246 17.988  7.190   1.00 0.00 ? 120 ALA A H    2  
ATOM 3711  H HA   . ALA A 1 120 ? -23.709 19.307  6.646   1.00 0.00 ? 120 ALA A HA   2  
ATOM 3712  H HB1  . ALA A 1 120 ? -25.136 16.945  5.596   1.00 0.00 ? 120 ALA A HB1  2  
ATOM 3713  H HB2  . ALA A 1 120 ? -23.420 17.183  5.929   1.00 0.00 ? 120 ALA A HB2  2  
ATOM 3714  H HB3  . ALA A 1 120 ? -24.129 17.825  4.446   1.00 0.00 ? 120 ALA A HB3  2  
ATOM 3715  N N    . SER A 1 121 ? -24.520 21.123  5.180   1.00 0.00 ? 121 SER A N    2  
ATOM 3716  C CA   . SER A 1 121 ? -24.936 22.192  4.280   1.00 0.00 ? 121 SER A CA   2  
ATOM 3717  C C    . SER A 1 121 ? -26.359 22.643  4.591   1.00 0.00 ? 121 SER A C    2  
ATOM 3718  O O    . SER A 1 121 ? -27.315 21.895  4.391   1.00 0.00 ? 121 SER A O    2  
ATOM 3719  C CB   . SER A 1 121 ? -24.841 21.728  2.825   1.00 0.00 ? 121 SER A CB   2  
ATOM 3720  O OG   . SER A 1 121 ? -23.603 22.107  2.249   1.00 0.00 ? 121 SER A OG   2  
ATOM 3721  H H    . SER A 1 121 ? -23.749 21.264  5.767   1.00 0.00 ? 121 SER A H    2  
ATOM 3722  H HA   . SER A 1 121 ? -24.266 23.026  4.426   1.00 0.00 ? 121 SER A HA   2  
ATOM 3723  H HB2  . SER A 1 121 ? -24.927 20.652  2.786   1.00 0.00 ? 121 SER A HB2  2  
ATOM 3724  H HB3  . SER A 1 121 ? -25.642 22.173  2.254   1.00 0.00 ? 121 SER A HB3  2  
ATOM 3725  H HG   . SER A 1 121 ? -22.961 21.405  2.376   1.00 0.00 ? 121 SER A HG   2  
ATOM 3726  N N    . SER A 1 122 ? -26.491 23.872  5.081   1.00 0.00 ? 122 SER A N    2  
ATOM 3727  C CA   . SER A 1 122 ? -27.798 24.423  5.420   1.00 0.00 ? 122 SER A CA   2  
ATOM 3728  C C    . SER A 1 122 ? -28.324 25.306  4.293   1.00 0.00 ? 122 SER A C    2  
ATOM 3729  O O    . SER A 1 122 ? -27.800 26.392  4.045   1.00 0.00 ? 122 SER A O    2  
ATOM 3730  C CB   . SER A 1 122 ? -27.714 25.228  6.717   1.00 0.00 ? 122 SER A CB   2  
ATOM 3731  O OG   . SER A 1 122 ? -27.828 24.384  7.850   1.00 0.00 ? 122 SER A OG   2  
ATOM 3732  H H    . SER A 1 122 ? -25.691 24.420  5.219   1.00 0.00 ? 122 SER A H    2  
ATOM 3733  H HA   . SER A 1 122 ? -28.479 23.597  5.562   1.00 0.00 ? 122 SER A HA   2  
ATOM 3734  H HB2  . SER A 1 122 ? -26.765 25.740  6.761   1.00 0.00 ? 122 SER A HB2  2  
ATOM 3735  H HB3  . SER A 1 122 ? -28.515 25.952  6.741   1.00 0.00 ? 122 SER A HB3  2  
ATOM 3736  H HG   . SER A 1 122 ? -27.844 24.918  8.648   1.00 0.00 ? 122 SER A HG   2  
ATOM 3737  N N    . SER A 1 123 ? -29.364 24.833  3.613   1.00 0.00 ? 123 SER A N    2  
ATOM 3738  C CA   . SER A 1 123 ? -29.961 25.580  2.512   1.00 0.00 ? 123 SER A CA   2  
ATOM 3739  C C    . SER A 1 123 ? -31.482 25.480  2.550   1.00 0.00 ? 123 SER A C    2  
ATOM 3740  O O    . SER A 1 123 ? -32.048 24.783  3.391   1.00 0.00 ? 123 SER A O    2  
ATOM 3741  C CB   . SER A 1 123 ? -29.437 25.059  1.173   1.00 0.00 ? 123 SER A CB   2  
ATOM 3742  O OG   . SER A 1 123 ? -30.037 23.820  0.837   1.00 0.00 ? 123 SER A OG   2  
ATOM 3743  H H    . SER A 1 123 ? -29.737 23.961  3.858   1.00 0.00 ? 123 SER A H    2  
ATOM 3744  H HA   . SER A 1 123 ? -29.677 26.616  2.622   1.00 0.00 ? 123 SER A HA   2  
ATOM 3745  H HB2  . SER A 1 123 ? -29.665 25.776  0.397   1.00 0.00 ? 123 SER A HB2  2  
ATOM 3746  H HB3  . SER A 1 123 ? -28.367 24.923  1.235   1.00 0.00 ? 123 SER A HB3  2  
ATOM 3747  H HG   . SER A 1 123 ? -29.398 23.113  0.951   1.00 0.00 ? 123 SER A HG   2  
ATOM 3748  N N    . GLY A 1 124 ? -32.139 26.183  1.633   1.00 0.00 ? 124 GLY A N    2  
ATOM 3749  C CA   . GLY A 1 124 ? -33.588 26.161  1.578   1.00 0.00 ? 124 GLY A CA   2  
ATOM 3750  C C    . GLY A 1 124 ? -34.131 26.745  0.288   1.00 0.00 ? 124 GLY A C    2  
ATOM 3751  O O    . GLY A 1 124 ? -34.973 27.642  0.316   1.00 0.00 ? 124 GLY A O    2  
ATOM 3752  H H    . GLY A 1 124 ? -31.634 26.721  0.987   1.00 0.00 ? 124 GLY A H    2  
ATOM 3753  H HA2  . GLY A 1 124 ? -33.925 25.139  1.668   1.00 0.00 ? 124 GLY A HA2  2  
ATOM 3754  H HA3  . GLY A 1 124 ? -33.978 26.730  2.410   1.00 0.00 ? 124 GLY A HA3  2  
ATOM 3755  N N    . PRO A 1 125 ? -33.663 26.251  -0.872  1.00 0.00 ? 125 PRO A N    2  
ATOM 3756  C CA   . PRO A 1 125 ? -34.117 26.741  -2.178  1.00 0.00 ? 125 PRO A CA   2  
ATOM 3757  C C    . PRO A 1 125 ? -35.558 26.341  -2.478  1.00 0.00 ? 125 PRO A C    2  
ATOM 3758  O O    . PRO A 1 125 ? -36.191 25.629  -1.697  1.00 0.00 ? 125 PRO A O    2  
ATOM 3759  C CB   . PRO A 1 125 ? -33.160 26.066  -3.163  1.00 0.00 ? 125 PRO A CB   2  
ATOM 3760  C CG   . PRO A 1 125 ? -32.703 24.833  -2.464  1.00 0.00 ? 125 PRO A CG   2  
ATOM 3761  C CD   . PRO A 1 125 ? -32.658 25.180  -1.001  1.00 0.00 ? 125 PRO A CD   2  
ATOM 3762  H HA   . PRO A 1 125 ? -34.020 27.813  -2.254  1.00 0.00 ? 125 PRO A HA   2  
ATOM 3763  H HB2  . PRO A 1 125 ? -33.686 25.831  -4.077  1.00 0.00 ? 125 PRO A HB2  2  
ATOM 3764  H HB3  . PRO A 1 125 ? -32.333 26.727  -3.377  1.00 0.00 ? 125 PRO A HB3  2  
ATOM 3765  H HG2  . PRO A 1 125 ? -33.405 24.031  -2.638  1.00 0.00 ? 125 PRO A HG2  2  
ATOM 3766  H HG3  . PRO A 1 125 ? -31.720 24.555  -2.813  1.00 0.00 ? 125 PRO A HG3  2  
ATOM 3767  H HD2  . PRO A 1 125 ? -32.930 24.323  -0.401  1.00 0.00 ? 125 PRO A HD2  2  
ATOM 3768  H HD3  . PRO A 1 125 ? -31.677 25.539  -0.728  1.00 0.00 ? 125 PRO A HD3  2  
ATOM 3769  N N    . SER A 1 126 ? -36.071 26.803  -3.613  1.00 0.00 ? 126 SER A N    2  
ATOM 3770  C CA   . SER A 1 126 ? -37.438 26.494  -4.016  1.00 0.00 ? 126 SER A CA   2  
ATOM 3771  C C    . SER A 1 126 ? -38.439 27.007  -2.984  1.00 0.00 ? 126 SER A C    2  
ATOM 3772  O O    . SER A 1 126 ? -39.217 26.238  -2.420  1.00 0.00 ? 126 SER A O    2  
ATOM 3773  C CB   . SER A 1 126 ? -37.607 24.985  -4.204  1.00 0.00 ? 126 SER A CB   2  
ATOM 3774  O OG   . SER A 1 126 ? -37.352 24.606  -5.545  1.00 0.00 ? 126 SER A OG   2  
ATOM 3775  H H    . SER A 1 126 ? -35.518 27.366  -4.194  1.00 0.00 ? 126 SER A H    2  
ATOM 3776  H HA   . SER A 1 126 ? -37.625 26.988  -4.957  1.00 0.00 ? 126 SER A HA   2  
ATOM 3777  H HB2  . SER A 1 126 ? -36.915 24.464  -3.559  1.00 0.00 ? 126 SER A HB2  2  
ATOM 3778  H HB3  . SER A 1 126 ? -38.618 24.703  -3.949  1.00 0.00 ? 126 SER A HB3  2  
ATOM 3779  H HG   . SER A 1 126 ? -37.917 25.112  -6.134  1.00 0.00 ? 126 SER A HG   2  
ATOM 3780  N N    . SER A 1 127 ? -38.413 28.314  -2.742  1.00 0.00 ? 127 SER A N    2  
ATOM 3781  C CA   . SER A 1 127 ? -39.317 28.932  -1.780  1.00 0.00 ? 127 SER A CA   2  
ATOM 3782  C C    . SER A 1 127 ? -40.739 28.986  -2.326  1.00 0.00 ? 127 SER A C    2  
ATOM 3783  O O    . SER A 1 127 ? -41.708 28.912  -1.571  1.00 0.00 ? 127 SER A O    2  
ATOM 3784  C CB   . SER A 1 127 ? -38.837 30.342  -1.431  1.00 0.00 ? 127 SER A CB   2  
ATOM 3785  O OG   . SER A 1 127 ? -39.560 30.869  -0.332  1.00 0.00 ? 127 SER A OG   2  
ATOM 3786  H H    . SER A 1 127 ? -37.770 28.876  -3.224  1.00 0.00 ? 127 SER A H    2  
ATOM 3787  H HA   . SER A 1 127 ? -39.310 28.328  -0.884  1.00 0.00 ? 127 SER A HA   2  
ATOM 3788  H HB2  . SER A 1 127 ? -37.789 30.312  -1.175  1.00 0.00 ? 127 SER A HB2  2  
ATOM 3789  H HB3  . SER A 1 127 ? -38.981 30.990  -2.283  1.00 0.00 ? 127 SER A HB3  2  
ATOM 3790  H HG   . SER A 1 127 ? -40.386 31.247  -0.642  1.00 0.00 ? 127 SER A HG   2  
ATOM 3791  N N    . GLY A 1 128 ? -40.858 29.115  -3.644  1.00 0.00 ? 128 GLY A N    2  
ATOM 3792  C CA   . GLY A 1 128 ? -42.165 29.177  -4.269  1.00 0.00 ? 128 GLY A CA   2  
ATOM 3793  C C    . GLY A 1 128 ? -42.105 29.700  -5.690  1.00 0.00 ? 128 GLY A C    2  
ATOM 3794  O O    . GLY A 1 128 ? -42.965 29.304  -6.505  1.00 0.00 ? 128 GLY A O    2  
ATOM 3795  O OXT  . GLY A 1 128 ? -41.199 30.507  -5.988  1.00 0.00 ? 128 GLY A OXT  2  
ATOM 3796  H H    . GLY A 1 128 ? -40.050 29.169  -4.195  1.00 0.00 ? 128 GLY A H    2  
ATOM 3797  H HA2  . GLY A 1 128 ? -42.594 28.185  -4.279  1.00 0.00 ? 128 GLY A HA2  2  
ATOM 3798  H HA3  . GLY A 1 128 ? -42.801 29.826  -3.684  1.00 0.00 ? 128 GLY A HA3  2  
ATOM 3799  N N    . GLY A 1 1   ? -20.301 14.226  22.884  1.00 0.00 ? 1   GLY A N    3  
ATOM 3800  C CA   . GLY A 1 1   ? -20.379 13.515  24.189  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3801  C C    . GLY A 1 1   ? -20.971 14.378  25.286  1.00 0.00 ? 1   GLY A C    3  
ATOM 3802  O O    . GLY A 1 1   ? -21.710 13.888  26.139  1.00 0.00 ? 1   GLY A O    3  
ATOM 3803  H H1   . GLY A 1 1   ? -19.337 14.589  22.732  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3804  H H2   . GLY A 1 1   ? -20.965 15.025  22.871  1.00 0.00 ? 1   GLY A H2   3  
ATOM 3805  H H3   . GLY A 1 1   ? -20.542 13.576  22.107  1.00 0.00 ? 1   GLY A H3   3  
ATOM 3806  H HA2  . GLY A 1 1   ? -20.991 12.632  24.070  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3807  H HA3  . GLY A 1 1   ? -19.384 13.213  24.483  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3808  N N    . SER A 1 2   ? -20.647 15.666  25.261  1.00 0.00 ? 2   SER A N    3  
ATOM 3809  C CA   . SER A 1 2   ? -21.152 16.600  26.261  1.00 0.00 ? 2   SER A CA   3  
ATOM 3810  C C    . SER A 1 2   ? -22.378 17.343  25.739  1.00 0.00 ? 2   SER A C    3  
ATOM 3811  O O    . SER A 1 2   ? -22.603 17.420  24.532  1.00 0.00 ? 2   SER A O    3  
ATOM 3812  C CB   . SER A 1 2   ? -20.061 17.598  26.654  1.00 0.00 ? 2   SER A CB   3  
ATOM 3813  O OG   . SER A 1 2   ? -19.470 17.246  27.893  1.00 0.00 ? 2   SER A OG   3  
ATOM 3814  H H    . SER A 1 2   ? -20.054 15.997  24.556  1.00 0.00 ? 2   SER A H    3  
ATOM 3815  H HA   . SER A 1 2   ? -21.437 16.030  27.132  1.00 0.00 ? 2   SER A HA   3  
ATOM 3816  H HB2  . SER A 1 2   ? -19.295 17.608  25.894  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3817  H HB3  . SER A 1 2   ? -20.492 18.585  26.743  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3818  H HG   . SER A 1 2   ? -20.079 17.448  28.607  1.00 0.00 ? 2   SER A HG   3  
ATOM 3819  N N    . SER A 1 3   ? -23.167 17.891  26.658  1.00 0.00 ? 3   SER A N    3  
ATOM 3820  C CA   . SER A 1 3   ? -24.370 18.629  26.291  1.00 0.00 ? 3   SER A CA   3  
ATOM 3821  C C    . SER A 1 3   ? -25.011 19.270  27.517  1.00 0.00 ? 3   SER A C    3  
ATOM 3822  O O    . SER A 1 3   ? -25.248 18.604  28.526  1.00 0.00 ? 3   SER A O    3  
ATOM 3823  C CB   . SER A 1 3   ? -25.373 17.700  25.603  1.00 0.00 ? 3   SER A CB   3  
ATOM 3824  O OG   . SER A 1 3   ? -26.051 18.369  24.555  1.00 0.00 ? 3   SER A OG   3  
ATOM 3825  H H    . SER A 1 3   ? -22.935 17.796  27.605  1.00 0.00 ? 3   SER A H    3  
ATOM 3826  H HA   . SER A 1 3   ? -24.082 19.407  25.601  1.00 0.00 ? 3   SER A HA   3  
ATOM 3827  H HB2  . SER A 1 3   ? -24.850 16.850  25.191  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3828  H HB3  . SER A 1 3   ? -26.100 17.360  26.327  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3829  H HG   . SER A 1 3   ? -25.411 18.734  23.940  1.00 0.00 ? 3   SER A HG   3  
ATOM 3830  N N    . GLY A 1 4   ? -25.288 20.566  27.424  1.00 0.00 ? 4   GLY A N    3  
ATOM 3831  C CA   . GLY A 1 4   ? -25.899 21.275  28.534  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3832  C C    . GLY A 1 4   ? -26.167 22.732  28.213  1.00 0.00 ? 4   GLY A C    3  
ATOM 3833  O O    . GLY A 1 4   ? -26.690 23.054  27.145  1.00 0.00 ? 4   GLY A O    3  
ATOM 3834  H H    . GLY A 1 4   ? -25.077 21.045  26.596  1.00 0.00 ? 4   GLY A H    3  
ATOM 3835  H HA2  . GLY A 1 4   ? -26.833 20.795  28.783  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3836  H HA3  . GLY A 1 4   ? -25.239 21.221  29.387  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3837  N N    . SER A 1 5   ? -25.808 23.616  29.138  1.00 0.00 ? 5   SER A N    3  
ATOM 3838  C CA   . SER A 1 5   ? -26.014 25.047  28.948  1.00 0.00 ? 5   SER A CA   3  
ATOM 3839  C C    . SER A 1 5   ? -25.023 25.609  27.934  1.00 0.00 ? 5   SER A C    3  
ATOM 3840  O O    . SER A 1 5   ? -23.843 25.259  27.944  1.00 0.00 ? 5   SER A O    3  
ATOM 3841  C CB   . SER A 1 5   ? -25.871 25.786  30.281  1.00 0.00 ? 5   SER A CB   3  
ATOM 3842  O OG   . SER A 1 5   ? -27.009 25.582  31.100  1.00 0.00 ? 5   SER A OG   3  
ATOM 3843  H H    . SER A 1 5   ? -25.396 23.298  29.968  1.00 0.00 ? 5   SER A H    3  
ATOM 3844  H HA   . SER A 1 5   ? -27.015 25.191  28.572  1.00 0.00 ? 5   SER A HA   3  
ATOM 3845  H HB2  . SER A 1 5   ? -24.999 25.420  30.801  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3846  H HB3  . SER A 1 5   ? -25.762 26.844  30.093  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3847  H HG   . SER A 1 5   ? -27.805 25.758  30.593  1.00 0.00 ? 5   SER A HG   3  
ATOM 3848  N N    . SER A 1 6   ? -25.510 26.483  27.059  1.00 0.00 ? 6   SER A N    3  
ATOM 3849  C CA   . SER A 1 6   ? -24.667 27.093  26.037  1.00 0.00 ? 6   SER A CA   3  
ATOM 3850  C C    . SER A 1 6   ? -23.696 28.091  26.659  1.00 0.00 ? 6   SER A C    3  
ATOM 3851  O O    . SER A 1 6   ? -24.008 28.734  27.662  1.00 0.00 ? 6   SER A O    3  
ATOM 3852  C CB   . SER A 1 6   ? -25.530 27.790  24.984  1.00 0.00 ? 6   SER A CB   3  
ATOM 3853  O OG   . SER A 1 6   ? -24.731 28.534  24.081  1.00 0.00 ? 6   SER A OG   3  
ATOM 3854  H H    . SER A 1 6   ? -26.460 26.722  27.100  1.00 0.00 ? 6   SER A H    3  
ATOM 3855  H HA   . SER A 1 6   ? -24.100 26.306  25.562  1.00 0.00 ? 6   SER A HA   3  
ATOM 3856  H HB2  . SER A 1 6   ? -26.085 27.050  24.428  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3857  H HB3  . SER A 1 6   ? -26.219 28.462  25.474  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3858  H HG   . SER A 1 6   ? -25.181 28.602  23.236  1.00 0.00 ? 6   SER A HG   3  
ATOM 3859  N N    . GLY A 1 7   ? -22.519 28.217  26.056  1.00 0.00 ? 7   GLY A N    3  
ATOM 3860  C CA   . GLY A 1 7   ? -21.521 29.140  26.565  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3861  C C    . GLY A 1 7   ? -20.282 29.194  25.692  1.00 0.00 ? 7   GLY A C    3  
ATOM 3862  O O    . GLY A 1 7   ? -20.280 29.840  24.645  1.00 0.00 ? 7   GLY A O    3  
ATOM 3863  H H    . GLY A 1 7   ? -22.325 27.679  25.261  1.00 0.00 ? 7   GLY A H    3  
ATOM 3864  H HA2  . GLY A 1 7   ? -21.953 30.128  26.618  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3865  H HA3  . GLY A 1 7   ? -21.233 28.831  27.559  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3866  N N    . ASP A 1 8   ? -19.226 28.513  26.124  1.00 0.00 ? 8   ASP A N    3  
ATOM 3867  C CA   . ASP A 1 8   ? -17.975 28.486  25.376  1.00 0.00 ? 8   ASP A CA   3  
ATOM 3868  C C    . ASP A 1 8   ? -17.781 27.137  24.689  1.00 0.00 ? 8   ASP A C    3  
ATOM 3869  O O    . ASP A 1 8   ? -17.680 26.103  25.349  1.00 0.00 ? 8   ASP A O    3  
ATOM 3870  C CB   . ASP A 1 8   ? -16.794 28.773  26.304  1.00 0.00 ? 8   ASP A CB   3  
ATOM 3871  C CG   . ASP A 1 8   ? -15.550 29.192  25.545  1.00 0.00 ? 8   ASP A CG   3  
ATOM 3872  O OD1  . ASP A 1 8   ? -15.421 30.394  25.234  1.00 0.00 ? 8   ASP A OD1  3  
ATOM 3873  O OD2  . ASP A 1 8   ? -14.705 28.317  25.261  1.00 0.00 ? 8   ASP A OD2  3  
ATOM 3874  H H    . ASP A 1 8   ? -19.289 28.017  26.967  1.00 0.00 ? 8   ASP A H    3  
ATOM 3875  H HA   . ASP A 1 8   ? -18.024 29.256  24.621  1.00 0.00 ? 8   ASP A HA   3  
ATOM 3876  H HB2  . ASP A 1 8   ? -17.062 29.569  26.983  1.00 0.00 ? 8   ASP A HB2  3  
ATOM 3877  H HB3  . ASP A 1 8   ? -16.565 27.884  26.872  1.00 0.00 ? 8   ASP A HB3  3  
ATOM 3878  N N    . ARG A 1 9   ? -17.729 27.157  23.361  1.00 0.00 ? 9   ARG A N    3  
ATOM 3879  C CA   . ARG A 1 9   ? -17.547 25.936  22.585  1.00 0.00 ? 9   ARG A CA   3  
ATOM 3880  C C    . ARG A 1 9   ? -16.087 25.494  22.601  1.00 0.00 ? 9   ARG A C    3  
ATOM 3881  O O    . ARG A 1 9   ? -15.217 26.213  23.092  1.00 0.00 ? 9   ARG A O    3  
ATOM 3882  C CB   . ARG A 1 9   ? -18.013 26.149  21.144  1.00 0.00 ? 9   ARG A CB   3  
ATOM 3883  C CG   . ARG A 1 9   ? -19.521 26.274  21.004  1.00 0.00 ? 9   ARG A CG   3  
ATOM 3884  C CD   . ARG A 1 9   ? -19.901 27.098  19.784  1.00 0.00 ? 9   ARG A CD   3  
ATOM 3885  N NE   . ARG A 1 9   ? -19.468 28.488  19.907  1.00 0.00 ? 9   ARG A NE   3  
ATOM 3886  C CZ   . ARG A 1 9   ? -20.109 29.402  20.632  1.00 0.00 ? 9   ARG A CZ   3  
ATOM 3887  N NH1  . ARG A 1 9   ? -21.208 29.077  21.301  1.00 0.00 ? 9   ARG A NH1  3  
ATOM 3888  N NH2  . ARG A 1 9   ? -19.647 30.643  20.689  1.00 0.00 ? 9   ARG A NH2  3  
ATOM 3889  H H    . ARG A 1 9   ? -17.817 28.013  22.893  1.00 0.00 ? 9   ARG A H    3  
ATOM 3890  H HA   . ARG A 1 9   ? -18.149 25.163  23.038  1.00 0.00 ? 9   ARG A HA   3  
ATOM 3891  H HB2  . ARG A 1 9   ? -17.562 27.052  20.762  1.00 0.00 ? 9   ARG A HB2  3  
ATOM 3892  H HB3  . ARG A 1 9   ? -17.686 25.313  20.545  1.00 0.00 ? 9   ARG A HB3  3  
ATOM 3893  H HG2  . ARG A 1 9   ? -19.948 25.287  20.906  1.00 0.00 ? 9   ARG A HG2  3  
ATOM 3894  H HG3  . ARG A 1 9   ? -19.917 26.753  21.889  1.00 0.00 ? 9   ARG A HG3  3  
ATOM 3895  H HD2  . ARG A 1 9   ? -19.436 26.661  18.912  1.00 0.00 ? 9   ARG A HD2  3  
ATOM 3896  H HD3  . ARG A 1 9   ? -20.975 27.073  19.669  1.00 0.00 ? 9   ARG A HD3  3  
ATOM 3897  H HE   . ARG A 1 9   ? -18.660 28.754  19.422  1.00 0.00 ? 9   ARG A HE   3  
ATOM 3898  H HH11 . ARG A 1 9   ? -21.561 28.144  21.263  1.00 0.00 ? 9   ARG A HH11 3  
ATOM 3899  H HH12 . ARG A 1 9   ? -21.684 29.770  21.844  1.00 0.00 ? 9   ARG A HH12 3  
ATOM 3900  H HH21 . ARG A 1 9   ? -18.819 30.893  20.188  1.00 0.00 ? 9   ARG A HH21 3  
ATOM 3901  H HH22 . ARG A 1 9   ? -20.128 31.331  21.234  1.00 0.00 ? 9   ARG A HH22 3  
ATOM 3902  N N    . ARG A 1 10  ? -15.828 24.310  22.058  1.00 0.00 ? 10  ARG A N    3  
ATOM 3903  C CA   . ARG A 1 10  ? -14.473 23.772  22.007  1.00 0.00 ? 10  ARG A CA   3  
ATOM 3904  C C    . ARG A 1 10  ? -13.958 23.732  20.573  1.00 0.00 ? 10  ARG A C    3  
ATOM 3905  O O    . ARG A 1 10  ? -14.221 22.782  19.835  1.00 0.00 ? 10  ARG A O    3  
ATOM 3906  C CB   . ARG A 1 10  ? -14.435 22.368  22.615  1.00 0.00 ? 10  ARG A CB   3  
ATOM 3907  C CG   . ARG A 1 10  ? -15.226 22.242  23.909  1.00 0.00 ? 10  ARG A CG   3  
ATOM 3908  C CD   . ARG A 1 10  ? -14.679 21.130  24.790  1.00 0.00 ? 10  ARG A CD   3  
ATOM 3909  N NE   . ARG A 1 10  ? -13.590 21.595  25.645  1.00 0.00 ? 10  ARG A NE   3  
ATOM 3910  C CZ   . ARG A 1 10  ? -13.187 20.960  26.743  1.00 0.00 ? 10  ARG A CZ   3  
ATOM 3911  N NH1  . ARG A 1 10  ? -13.779 19.833  27.122  1.00 0.00 ? 10  ARG A NH1  3  
ATOM 3912  N NH2  . ARG A 1 10  ? -12.189 21.451  27.464  1.00 0.00 ? 10  ARG A NH2  3  
ATOM 3913  H H    . ARG A 1 10  ? -16.564 23.784  21.682  1.00 0.00 ? 10  ARG A H    3  
ATOM 3914  H HA   . ARG A 1 10  ? -13.836 24.423  22.588  1.00 0.00 ? 10  ARG A HA   3  
ATOM 3915  H HB2  . ARG A 1 10  ? -14.843 21.668  21.901  1.00 0.00 ? 10  ARG A HB2  3  
ATOM 3916  H HB3  . ARG A 1 10  ? -13.408 22.104  22.819  1.00 0.00 ? 10  ARG A HB3  3  
ATOM 3917  H HG2  . ARG A 1 10  ? -15.166 23.177  24.447  1.00 0.00 ? 10  ARG A HG2  3  
ATOM 3918  H HG3  . ARG A 1 10  ? -16.257 22.027  23.669  1.00 0.00 ? 10  ARG A HG3  3  
ATOM 3919  H HD2  . ARG A 1 10  ? -15.479 20.758  25.412  1.00 0.00 ? 10  ARG A HD2  3  
ATOM 3920  H HD3  . ARG A 1 10  ? -14.314 20.335  24.157  1.00 0.00 ? 10  ARG A HD3  3  
ATOM 3921  H HE   . ARG A 1 10  ? -13.135 22.423  25.388  1.00 0.00 ? 10  ARG A HE   3  
ATOM 3922  H HH11 . ARG A 1 10  ? -14.533 19.457  26.583  1.00 0.00 ? 10  ARG A HH11 3  
ATOM 3923  H HH12 . ARG A 1 10  ? -13.472 19.361  27.949  1.00 0.00 ? 10  ARG A HH12 3  
ATOM 3924  H HH21 . ARG A 1 10  ? -11.739 22.299  27.183  1.00 0.00 ? 10  ARG A HH21 3  
ATOM 3925  H HH22 . ARG A 1 10  ? -11.886 20.974  28.290  1.00 0.00 ? 10  ARG A HH22 3  
ATOM 3926  N N    . SER A 1 11  ? -13.223 24.768  20.184  1.00 0.00 ? 11  SER A N    3  
ATOM 3927  C CA   . SER A 1 11  ? -12.672 24.852  18.837  1.00 0.00 ? 11  SER A CA   3  
ATOM 3928  C C    . SER A 1 11  ? -13.785 24.874  17.794  1.00 0.00 ? 11  SER A C    3  
ATOM 3929  O O    . SER A 1 11  ? -14.284 23.828  17.382  1.00 0.00 ? 11  SER A O    3  
ATOM 3930  C CB   . SER A 1 11  ? -11.730 23.674  18.574  1.00 0.00 ? 11  SER A CB   3  
ATOM 3931  O OG   . SER A 1 11  ? -10.374 24.080  18.641  1.00 0.00 ? 11  SER A OG   3  
ATOM 3932  H H    . SER A 1 11  ? -13.048 25.495  20.818  1.00 0.00 ? 11  SER A H    3  
ATOM 3933  H HA   . SER A 1 11  ? -12.110 25.772  18.766  1.00 0.00 ? 11  SER A HA   3  
ATOM 3934  H HB2  . SER A 1 11  ? -11.899 22.909  19.316  1.00 0.00 ? 11  SER A HB2  3  
ATOM 3935  H HB3  . SER A 1 11  ? -11.924 23.271  17.591  1.00 0.00 ? 11  SER A HB3  3  
ATOM 3936  H HG   . SER A 1 11  ? -10.125 24.504  17.816  1.00 0.00 ? 11  SER A HG   3  
ATOM 3937  N N    . THR A 1 12  ? -14.169 26.075  17.372  1.00 0.00 ? 12  THR A N    3  
ATOM 3938  C CA   . THR A 1 12  ? -15.223 26.234  16.377  1.00 0.00 ? 12  THR A CA   3  
ATOM 3939  C C    . THR A 1 12  ? -14.632 26.419  14.983  1.00 0.00 ? 12  THR A C    3  
ATOM 3940  O O    . THR A 1 12  ? -14.527 27.540  14.486  1.00 0.00 ? 12  THR A O    3  
ATOM 3941  C CB   . THR A 1 12  ? -16.109 27.430  16.730  1.00 0.00 ? 12  THR A CB   3  
ATOM 3942  O OG1  . THR A 1 12  ? -16.624 27.302  18.044  1.00 0.00 ? 12  THR A OG1  3  
ATOM 3943  C CG2  . THR A 1 12  ? -17.284 27.602  15.792  1.00 0.00 ? 12  THR A CG2  3  
ATOM 3944  H H    . THR A 1 12  ? -13.733 26.872  17.738  1.00 0.00 ? 12  THR A H    3  
ATOM 3945  H HA   . THR A 1 12  ? -15.825 25.337  16.384  1.00 0.00 ? 12  THR A HA   3  
ATOM 3946  H HB   . THR A 1 12  ? -15.515 28.331  16.685  1.00 0.00 ? 12  THR A HB   3  
ATOM 3947  H HG1  . THR A 1 12  ? -15.925 27.471  18.680  1.00 0.00 ? 12  THR A HG1  3  
ATOM 3948  H HG21 . THR A 1 12  ? -17.966 28.333  16.199  1.00 0.00 ? 12  THR A HG21 3  
ATOM 3949  H HG22 . THR A 1 12  ? -17.795 26.657  15.677  1.00 0.00 ? 12  THR A HG22 3  
ATOM 3950  H HG23 . THR A 1 12  ? -16.930 27.937  14.829  1.00 0.00 ? 12  THR A HG23 3  
ATOM 3951  N N    . LEU A 1 13  ? -14.249 25.311  14.357  1.00 0.00 ? 13  LEU A N    3  
ATOM 3952  C CA   . LEU A 1 13  ? -13.669 25.351  13.020  1.00 0.00 ? 13  LEU A CA   3  
ATOM 3953  C C    . LEU A 1 13  ? -14.238 24.238  12.146  1.00 0.00 ? 13  LEU A C    3  
ATOM 3954  O O    . LEU A 1 13  ? -14.745 24.491  11.053  1.00 0.00 ? 13  LEU A O    3  
ATOM 3955  C CB   . LEU A 1 13  ? -12.146 25.227  13.097  1.00 0.00 ? 13  LEU A CB   3  
ATOM 3956  C CG   . LEU A 1 13  ? -11.467 26.188  14.074  1.00 0.00 ? 13  LEU A CG   3  
ATOM 3957  C CD1  . LEU A 1 13  ? -10.169 25.590  14.596  1.00 0.00 ? 13  LEU A CD1  3  
ATOM 3958  C CD2  . LEU A 1 13  ? -11.207 27.530  13.407  1.00 0.00 ? 13  LEU A CD2  3  
ATOM 3959  H H    . LEU A 1 13  ? -14.359 24.446  14.804  1.00 0.00 ? 13  LEU A H    3  
ATOM 3960  H HA   . LEU A 1 13  ? -13.922 26.304  12.578  1.00 0.00 ? 13  LEU A HA   3  
ATOM 3961  H HB2  . LEU A 1 13  ? -11.903 24.215  13.391  1.00 0.00 ? 13  LEU A HB2  3  
ATOM 3962  H HB3  . LEU A 1 13  ? -11.740 25.405  12.113  1.00 0.00 ? 13  LEU A HB3  3  
ATOM 3963  H HG   . LEU A 1 13  ? -12.121 26.354  14.919  1.00 0.00 ? 13  LEU A HG   3  
ATOM 3964  H HD11 . LEU A 1 13  ? -10.214 24.514  14.522  1.00 0.00 ? 13  LEU A HD11 3  
ATOM 3965  H HD12 . LEU A 1 13  ? -10.031 25.874  15.628  1.00 0.00 ? 13  LEU A HD12 3  
ATOM 3966  H HD13 . LEU A 1 13  ? -9.342  25.957  14.007  1.00 0.00 ? 13  LEU A HD13 3  
ATOM 3967  H HD21 . LEU A 1 13  ? -10.390 27.433  12.709  1.00 0.00 ? 13  LEU A HD21 3  
ATOM 3968  H HD22 . LEU A 1 13  ? -10.954 28.263  14.159  1.00 0.00 ? 13  LEU A HD22 3  
ATOM 3969  H HD23 . LEU A 1 13  ? -12.095 27.848  12.880  1.00 0.00 ? 13  LEU A HD23 3  
ATOM 3970  N N    . HIS A 1 14  ? -14.149 23.005  12.634  1.00 0.00 ? 14  HIS A N    3  
ATOM 3971  C CA   . HIS A 1 14  ? -14.654 21.853  11.897  1.00 0.00 ? 14  HIS A CA   3  
ATOM 3972  C C    . HIS A 1 14  ? -15.096 20.747  12.851  1.00 0.00 ? 14  HIS A C    3  
ATOM 3973  O O    . HIS A 1 14  ? -14.746 20.756  14.032  1.00 0.00 ? 14  HIS A O    3  
ATOM 3974  C CB   . HIS A 1 14  ? -13.584 21.321  10.942  1.00 0.00 ? 14  HIS A CB   3  
ATOM 3975  C CG   . HIS A 1 14  ? -13.103 22.340  9.956   1.00 0.00 ? 14  HIS A CG   3  
ATOM 3976  N ND1  . HIS A 1 14  ? -12.207 23.337  10.279  1.00 0.00 ? 14  HIS A ND1  3  
ATOM 3977  C CD2  . HIS A 1 14  ? -13.398 22.512  8.645   1.00 0.00 ? 14  HIS A CD2  3  
ATOM 3978  C CE1  . HIS A 1 14  ? -11.972 24.078  9.210   1.00 0.00 ? 14  HIS A CE1  3  
ATOM 3979  N NE2  . HIS A 1 14  ? -12.682 23.599  8.206   1.00 0.00 ? 14  HIS A NE2  3  
ATOM 3980  H H    . HIS A 1 14  ? -13.733 22.867  13.511  1.00 0.00 ? 14  HIS A H    3  
ATOM 3981  H HA   . HIS A 1 14  ? -15.509 22.177  11.322  1.00 0.00 ? 14  HIS A HA   3  
ATOM 3982  H HB2  . HIS A 1 14  ? -12.733 20.989  11.517  1.00 0.00 ? 14  HIS A HB2  3  
ATOM 3983  H HB3  . HIS A 1 14  ? -13.988 20.486  10.389  1.00 0.00 ? 14  HIS A HB3  3  
ATOM 3984  H HD1  . HIS A 1 14  ? -11.803 23.481  11.160  1.00 0.00 ? 14  HIS A HD1  3  
ATOM 3985  H HD2  . HIS A 1 14  ? -14.072 21.907  8.054   1.00 0.00 ? 14  HIS A HD2  3  
ATOM 3986  H HE1  . HIS A 1 14  ? -11.311 24.931  9.166   1.00 0.00 ? 14  HIS A HE1  3  
ATOM 3987  H HE2  . HIS A 1 14  ? -12.760 24.012  7.321   1.00 0.00 ? 14  HIS A HE2  3  
ATOM 3988  N N    . LEU A 1 15  ? -15.863 19.795  12.331  1.00 0.00 ? 15  LEU A N    3  
ATOM 3989  C CA   . LEU A 1 15  ? -16.352 18.681  13.136  1.00 0.00 ? 15  LEU A CA   3  
ATOM 3990  C C    . LEU A 1 15  ? -15.973 17.347  12.501  1.00 0.00 ? 15  LEU A C    3  
ATOM 3991  O O    . LEU A 1 15  ? -16.766 16.744  11.777  1.00 0.00 ? 15  LEU A O    3  
ATOM 3992  C CB   . LEU A 1 15  ? -17.871 18.772  13.302  1.00 0.00 ? 15  LEU A CB   3  
ATOM 3993  C CG   . LEU A 1 15  ? -18.347 19.121  14.715  1.00 0.00 ? 15  LEU A CG   3  
ATOM 3994  C CD1  . LEU A 1 15  ? -18.902 20.537  14.761  1.00 0.00 ? 15  LEU A CD1  3  
ATOM 3995  C CD2  . LEU A 1 15  ? -19.392 18.122  15.190  1.00 0.00 ? 15  LEU A CD2  3  
ATOM 3996  H H    . LEU A 1 15  ? -16.108 19.843  11.383  1.00 0.00 ? 15  LEU A H    3  
ATOM 3997  H HA   . LEU A 1 15  ? -15.887 18.747  14.108  1.00 0.00 ? 15  LEU A HA   3  
ATOM 3998  H HB2  . LEU A 1 15  ? -18.240 19.527  12.622  1.00 0.00 ? 15  LEU A HB2  3  
ATOM 3999  H HB3  . LEU A 1 15  ? -18.302 17.821  13.025  1.00 0.00 ? 15  LEU A HB3  3  
ATOM 4000  H HG   . LEU A 1 15  ? -17.506 19.072  15.393  1.00 0.00 ? 15  LEU A HG   3  
ATOM 4001  H HD11 . LEU A 1 15  ? -18.706 20.969  15.731  1.00 0.00 ? 15  LEU A HD11 3  
ATOM 4002  H HD12 . LEU A 1 15  ? -19.967 20.511  14.587  1.00 0.00 ? 15  LEU A HD12 3  
ATOM 4003  H HD13 . LEU A 1 15  ? -18.427 21.134  13.998  1.00 0.00 ? 15  LEU A HD13 3  
ATOM 4004  H HD21 . LEU A 1 15  ? -18.956 17.135  15.233  1.00 0.00 ? 15  LEU A HD21 3  
ATOM 4005  H HD22 . LEU A 1 15  ? -20.225 18.118  14.501  1.00 0.00 ? 15  LEU A HD22 3  
ATOM 4006  H HD23 . LEU A 1 15  ? -19.741 18.404  16.173  1.00 0.00 ? 15  LEU A HD23 3  
ATOM 4007  N N    . LEU A 1 16  ? -14.756 16.890  12.777  1.00 0.00 ? 16  LEU A N    3  
ATOM 4008  C CA   . LEU A 1 16  ? -14.271 15.627  12.233  1.00 0.00 ? 16  LEU A CA   3  
ATOM 4009  C C    . LEU A 1 16  ? -12.922 15.255  12.840  1.00 0.00 ? 16  LEU A C    3  
ATOM 4010  O O    . LEU A 1 16  ? -11.872 15.531  12.260  1.00 0.00 ? 16  LEU A O    3  
ATOM 4011  C CB   . LEU A 1 16  ? -14.151 15.716  10.710  1.00 0.00 ? 16  LEU A CB   3  
ATOM 4012  C CG   . LEU A 1 16  ? -14.444 14.413  9.960   1.00 0.00 ? 16  LEU A CG   3  
ATOM 4013  C CD1  . LEU A 1 16  ? -15.308 14.680  8.737   1.00 0.00 ? 16  LEU A CD1  3  
ATOM 4014  C CD2  . LEU A 1 16  ? -13.146 13.727  9.558   1.00 0.00 ? 16  LEU A CD2  3  
ATOM 4015  H H    . LEU A 1 16  ? -14.168 17.416  13.360  1.00 0.00 ? 16  LEU A H    3  
ATOM 4016  H HA   . LEU A 1 16  ? -14.989 14.861  12.484  1.00 0.00 ? 16  LEU A HA   3  
ATOM 4017  H HB2  . LEU A 1 16  ? -14.840 16.472  10.360  1.00 0.00 ? 16  LEU A HB2  3  
ATOM 4018  H HB3  . LEU A 1 16  ? -13.147 16.028  10.466  1.00 0.00 ? 16  LEU A HB3  3  
ATOM 4019  H HG   . LEU A 1 16  ? -14.987 13.745  10.613  1.00 0.00 ? 16  LEU A HG   3  
ATOM 4020  H HD11 . LEU A 1 16  ? -16.348 14.543  8.994   1.00 0.00 ? 16  LEU A HD11 3  
ATOM 4021  H HD12 . LEU A 1 16  ? -15.039 13.992  7.949   1.00 0.00 ? 16  LEU A HD12 3  
ATOM 4022  H HD13 . LEU A 1 16  ? -15.150 15.694  8.400   1.00 0.00 ? 16  LEU A HD13 3  
ATOM 4023  H HD21 . LEU A 1 16  ? -13.294 13.190  8.633   1.00 0.00 ? 16  LEU A HD21 3  
ATOM 4024  H HD22 . LEU A 1 16  ? -12.850 13.035  10.333  1.00 0.00 ? 16  LEU A HD22 3  
ATOM 4025  H HD23 . LEU A 1 16  ? -12.373 14.469  9.423   1.00 0.00 ? 16  LEU A HD23 3  
ATOM 4026  N N    . GLN A 1 17  ? -12.960 14.627  14.010  1.00 0.00 ? 17  GLN A N    3  
ATOM 4027  C CA   . GLN A 1 17  ? -11.740 14.217  14.697  1.00 0.00 ? 17  GLN A CA   3  
ATOM 4028  C C    . GLN A 1 17  ? -11.444 12.742  14.446  1.00 0.00 ? 17  GLN A C    3  
ATOM 4029  O O    . GLN A 1 17  ? -12.344 11.902  14.488  1.00 0.00 ? 17  GLN A O    3  
ATOM 4030  C CB   . GLN A 1 17  ? -11.864 14.476  16.199  1.00 0.00 ? 17  GLN A CB   3  
ATOM 4031  C CG   . GLN A 1 17  ? -12.077 15.940  16.548  1.00 0.00 ? 17  GLN A CG   3  
ATOM 4032  C CD   . GLN A 1 17  ? -13.457 16.211  17.117  1.00 0.00 ? 17  GLN A CD   3  
ATOM 4033  O OE1  . GLN A 1 17  ? -13.831 15.664  18.155  1.00 0.00 ? 17  GLN A OE1  3  
ATOM 4034  N NE2  . GLN A 1 17  ? -14.220 17.059  16.438  1.00 0.00 ? 17  GLN A NE2  3  
ATOM 4035  H H    . GLN A 1 17  ? -13.828 14.435  14.422  1.00 0.00 ? 17  GLN A H    3  
ATOM 4036  H HA   . GLN A 1 17  ? -10.925 14.807  14.305  1.00 0.00 ? 17  GLN A HA   3  
ATOM 4037  H HB2  . GLN A 1 17  ? -12.702 13.911  16.583  1.00 0.00 ? 17  GLN A HB2  3  
ATOM 4038  H HB3  . GLN A 1 17  ? -10.962 14.140  16.687  1.00 0.00 ? 17  GLN A HB3  3  
ATOM 4039  H HG2  . GLN A 1 17  ? -11.339 16.233  17.281  1.00 0.00 ? 17  GLN A HG2  3  
ATOM 4040  H HG3  . GLN A 1 17  ? -11.951 16.532  15.654  1.00 0.00 ? 17  GLN A HG3  3  
ATOM 4041  H HE21 . GLN A 1 17  ? -13.856 17.457  15.620  1.00 0.00 ? 17  GLN A HE21 3  
ATOM 4042  H HE22 . GLN A 1 17  ? -15.117 17.253  16.784  1.00 0.00 ? 17  GLN A HE22 3  
ATOM 4043  N N    . GLY A 1 18  ? -10.178 12.433  14.186  1.00 0.00 ? 18  GLY A N    3  
ATOM 4044  C CA   . GLY A 1 18  ? -9.786  11.060  13.932  1.00 0.00 ? 18  GLY A CA   3  
ATOM 4045  C C    . GLY A 1 18  ? -8.949  10.918  12.676  1.00 0.00 ? 18  GLY A C    3  
ATOM 4046  O O    . GLY A 1 18  ? -9.148  9.992   11.889  1.00 0.00 ? 18  GLY A O    3  
ATOM 4047  H H    . GLY A 1 18  ? -9.505  13.145  14.167  1.00 0.00 ? 18  GLY A H    3  
ATOM 4048  H HA2  . GLY A 1 18  ? -9.215  10.698  14.775  1.00 0.00 ? 18  GLY A HA2  3  
ATOM 4049  H HA3  . GLY A 1 18  ? -10.675 10.456  13.828  1.00 0.00 ? 18  GLY A HA3  3  
ATOM 4050  N N    . GLY A 1 19  ? -8.010  11.840  12.486  1.00 0.00 ? 19  GLY A N    3  
ATOM 4051  C CA   . GLY A 1 19  ? -7.154  11.796  11.316  1.00 0.00 ? 19  GLY A CA   3  
ATOM 4052  C C    . GLY A 1 19  ? -7.925  11.984  10.025  1.00 0.00 ? 19  GLY A C    3  
ATOM 4053  O O    . GLY A 1 19  ? -9.029  11.462  9.871   1.00 0.00 ? 19  GLY A O    3  
ATOM 4054  H H    . GLY A 1 19  ? -7.896  12.554  13.148  1.00 0.00 ? 19  GLY A H    3  
ATOM 4055  H HA2  . GLY A 1 19  ? -6.412  12.577  11.397  1.00 0.00 ? 19  GLY A HA2  3  
ATOM 4056  H HA3  . GLY A 1 19  ? -6.651  10.840  11.286  1.00 0.00 ? 19  GLY A HA3  3  
ATOM 4057  N N    . ASP A 1 20  ? -7.342  12.732  9.094   1.00 0.00 ? 20  ASP A N    3  
ATOM 4058  C CA   . ASP A 1 20  ? -7.981  12.989  7.808   1.00 0.00 ? 20  ASP A CA   3  
ATOM 4059  C C    . ASP A 1 20  ? -7.369  12.118  6.714   1.00 0.00 ? 20  ASP A C    3  
ATOM 4060  O O    . ASP A 1 20  ? -7.324  12.508  5.548   1.00 0.00 ? 20  ASP A O    3  
ATOM 4061  C CB   . ASP A 1 20  ? -7.850  14.469  7.437   1.00 0.00 ? 20  ASP A CB   3  
ATOM 4062  C CG   . ASP A 1 20  ? -9.171  15.207  7.529   1.00 0.00 ? 20  ASP A CG   3  
ATOM 4063  O OD1  . ASP A 1 20  ? -9.932  14.946  8.485   1.00 0.00 ? 20  ASP A OD1  3  
ATOM 4064  O OD2  . ASP A 1 20  ? -9.446  16.044  6.644   1.00 0.00 ? 20  ASP A OD2  3  
ATOM 4065  H H    . ASP A 1 20  ? -6.461  13.121  9.276   1.00 0.00 ? 20  ASP A H    3  
ATOM 4066  H HA   . ASP A 1 20  ? -9.027  12.742  7.904   1.00 0.00 ? 20  ASP A HA   3  
ATOM 4067  H HB2  . ASP A 1 20  ? -7.149  14.941  8.110   1.00 0.00 ? 20  ASP A HB2  3  
ATOM 4068  H HB3  . ASP A 1 20  ? -7.482  14.551  6.425   1.00 0.00 ? 20  ASP A HB3  3  
ATOM 4069  N N    . GLU A 1 21  ? -6.901  10.935  7.100   1.00 0.00 ? 21  GLU A N    3  
ATOM 4070  C CA   . GLU A 1 21  ? -6.292  10.009  6.153   1.00 0.00 ? 21  GLU A CA   3  
ATOM 4071  C C    . GLU A 1 21  ? -7.358  9.248   5.373   1.00 0.00 ? 21  GLU A C    3  
ATOM 4072  O O    . GLU A 1 21  ? -8.392  8.869   5.923   1.00 0.00 ? 21  GLU A O    3  
ATOM 4073  C CB   . GLU A 1 21  ? -5.379  9.024   6.884   1.00 0.00 ? 21  GLU A CB   3  
ATOM 4074  C CG   . GLU A 1 21  ? -3.988  9.572   7.162   1.00 0.00 ? 21  GLU A CG   3  
ATOM 4075  C CD   . GLU A 1 21  ? -3.712  9.744   8.643   1.00 0.00 ? 21  GLU A CD   3  
ATOM 4076  O OE1  . GLU A 1 21  ? -3.852  8.753   9.391   1.00 0.00 ? 21  GLU A OE1  3  
ATOM 4077  O OE2  . GLU A 1 21  ? -3.358  10.868  9.054   1.00 0.00 ? 21  GLU A OE2  3  
ATOM 4078  H H    . GLU A 1 21  ? -6.965  10.680  8.044   1.00 0.00 ? 21  GLU A H    3  
ATOM 4079  H HA   . GLU A 1 21  ? -5.699  10.586  5.458   1.00 0.00 ? 21  GLU A HA   3  
ATOM 4080  H HB2  . GLU A 1 21  ? -5.835  8.762   7.828   1.00 0.00 ? 21  GLU A HB2  3  
ATOM 4081  H HB3  . GLU A 1 21  ? -5.277  8.131   6.285   1.00 0.00 ? 21  GLU A HB3  3  
ATOM 4082  H HG2  . GLU A 1 21  ? -3.257  8.888   6.753   1.00 0.00 ? 21  GLU A HG2  3  
ATOM 4083  H HG3  . GLU A 1 21  ? -3.893  10.535  6.678   1.00 0.00 ? 21  GLU A HG3  3  
ATOM 4084  N N    . LYS A 1 22  ? -7.101  9.029   4.088   1.00 0.00 ? 22  LYS A N    3  
ATOM 4085  C CA   . LYS A 1 22  ? -8.039  8.314   3.231   1.00 0.00 ? 22  LYS A CA   3  
ATOM 4086  C C    . LYS A 1 22  ? -7.757  6.815   3.248   1.00 0.00 ? 22  LYS A C    3  
ATOM 4087  O O    . LYS A 1 22  ? -6.610  6.390   3.376   1.00 0.00 ? 22  LYS A O    3  
ATOM 4088  C CB   . LYS A 1 22  ? -7.958  8.844   1.798   1.00 0.00 ? 22  LYS A CB   3  
ATOM 4089  C CG   . LYS A 1 22  ? -9.207  8.569   0.976   1.00 0.00 ? 22  LYS A CG   3  
ATOM 4090  C CD   . LYS A 1 22  ? -9.398  9.613   -0.112  1.00 0.00 ? 22  LYS A CD   3  
ATOM 4091  C CE   . LYS A 1 22  ? -8.692  9.216   -1.399  1.00 0.00 ? 22  LYS A CE   3  
ATOM 4092  N NZ   . LYS A 1 22  ? -9.658  8.862   -2.475  1.00 0.00 ? 22  LYS A NZ   3  
ATOM 4093  H H    . LYS A 1 22  ? -6.259  9.357   3.706   1.00 0.00 ? 22  LYS A H    3  
ATOM 4094  H HA   . LYS A 1 22  ? -9.034  8.486   3.614   1.00 0.00 ? 22  LYS A HA   3  
ATOM 4095  H HB2  . LYS A 1 22  ? -7.801  9.911   1.830   1.00 0.00 ? 22  LYS A HB2  3  
ATOM 4096  H HB3  . LYS A 1 22  ? -7.118  8.380   1.303   1.00 0.00 ? 22  LYS A HB3  3  
ATOM 4097  H HG2  . LYS A 1 22  ? -9.118  7.597   0.516   1.00 0.00 ? 22  LYS A HG2  3  
ATOM 4098  H HG3  . LYS A 1 22  ? -10.066 8.582   1.631   1.00 0.00 ? 22  LYS A HG3  3  
ATOM 4099  H HD2  . LYS A 1 22  ? -10.454 9.722   -0.311  1.00 0.00 ? 22  LYS A HD2  3  
ATOM 4100  H HD3  . LYS A 1 22  ? -8.997  10.555  0.233   1.00 0.00 ? 22  LYS A HD3  3  
ATOM 4101  H HE2  . LYS A 1 22  ? -8.085  10.045  -1.731  1.00 0.00 ? 22  LYS A HE2  3  
ATOM 4102  H HE3  . LYS A 1 22  ? -8.059  8.364   -1.200  1.00 0.00 ? 22  LYS A HE3  3  
ATOM 4103  H HZ1  . LYS A 1 22  ? -10.117 9.721   -2.840  1.00 0.00 ? 22  LYS A HZ1  3  
ATOM 4104  H HZ2  . LYS A 1 22  ? -10.389 8.222   -2.104  1.00 0.00 ? 22  LYS A HZ2  3  
ATOM 4105  H HZ3  . LYS A 1 22  ? -9.163  8.387   -3.257  1.00 0.00 ? 22  LYS A HZ3  3  
ATOM 4106  N N    . LYS A 1 23  ? -8.813  6.019   3.118   1.00 0.00 ? 23  LYS A N    3  
ATOM 4107  C CA   . LYS A 1 23  ? -8.680  4.566   3.118   1.00 0.00 ? 23  LYS A CA   3  
ATOM 4108  C C    . LYS A 1 23  ? -9.389  3.955   1.914   1.00 0.00 ? 23  LYS A C    3  
ATOM 4109  O O    . LYS A 1 23  ? -10.587 4.155   1.719   1.00 0.00 ? 23  LYS A O    3  
ATOM 4110  C CB   . LYS A 1 23  ? -9.249  3.981   4.411   1.00 0.00 ? 23  LYS A CB   3  
ATOM 4111  C CG   . LYS A 1 23  ? -8.473  2.781   4.930   1.00 0.00 ? 23  LYS A CG   3  
ATOM 4112  C CD   . LYS A 1 23  ? -8.712  2.563   6.416   1.00 0.00 ? 23  LYS A CD   3  
ATOM 4113  C CE   . LYS A 1 23  ? -7.442  2.121   7.124   1.00 0.00 ? 23  LYS A CE   3  
ATOM 4114  N NZ   . LYS A 1 23  ? -6.694  3.274   7.697   1.00 0.00 ? 23  LYS A NZ   3  
ATOM 4115  H H    . LYS A 1 23  ? -9.703  6.417   3.019   1.00 0.00 ? 23  LYS A H    3  
ATOM 4116  H HA   . LYS A 1 23  ? -7.629  4.330   3.060   1.00 0.00 ? 23  LYS A HA   3  
ATOM 4117  H HB2  . LYS A 1 23  ? -9.240  4.745   5.174   1.00 0.00 ? 23  LYS A HB2  3  
ATOM 4118  H HB3  . LYS A 1 23  ? -10.270 3.673   4.235   1.00 0.00 ? 23  LYS A HB3  3  
ATOM 4119  H HG2  . LYS A 1 23  ? -8.789  1.900   4.392   1.00 0.00 ? 23  LYS A HG2  3  
ATOM 4120  H HG3  . LYS A 1 23  ? -7.419  2.948   4.764   1.00 0.00 ? 23  LYS A HG3  3  
ATOM 4121  H HD2  . LYS A 1 23  ? -9.054  3.488   6.855   1.00 0.00 ? 23  LYS A HD2  3  
ATOM 4122  H HD3  . LYS A 1 23  ? -9.468  1.802   6.540   1.00 0.00 ? 23  LYS A HD3  3  
ATOM 4123  H HE2  . LYS A 1 23  ? -7.708  1.443   7.923   1.00 0.00 ? 23  LYS A HE2  3  
ATOM 4124  H HE3  . LYS A 1 23  ? -6.809  1.608   6.415   1.00 0.00 ? 23  LYS A HE3  3  
ATOM 4125  H HZ1  . LYS A 1 23  ? -6.167  2.973   8.542   1.00 0.00 ? 23  LYS A HZ1  3  
ATOM 4126  H HZ2  . LYS A 1 23  ? -7.355  4.030   7.966   1.00 0.00 ? 23  LYS A HZ2  3  
ATOM 4127  H HZ3  . LYS A 1 23  ? -6.023  3.647   6.996   1.00 0.00 ? 23  LYS A HZ3  3  
ATOM 4128  N N    . VAL A 1 24  ? -8.639  3.208   1.110   1.00 0.00 ? 24  VAL A N    3  
ATOM 4129  C CA   . VAL A 1 24  ? -9.194  2.566   -0.076  1.00 0.00 ? 24  VAL A CA   3  
ATOM 4130  C C    . VAL A 1 24  ? -9.050  1.050   0.003   1.00 0.00 ? 24  VAL A C    3  
ATOM 4131  O O    . VAL A 1 24  ? -8.042  0.489   -0.429  1.00 0.00 ? 24  VAL A O    3  
ATOM 4132  C CB   . VAL A 1 24  ? -8.509  3.070   -1.360  1.00 0.00 ? 24  VAL A CB   3  
ATOM 4133  C CG1  . VAL A 1 24  ? -9.231  2.544   -2.592  1.00 0.00 ? 24  VAL A CG1  3  
ATOM 4134  C CG2  . VAL A 1 24  ? -8.450  4.589   -1.373  1.00 0.00 ? 24  VAL A CG2  3  
ATOM 4135  H H    . VAL A 1 24  ? -7.689  3.086   1.319   1.00 0.00 ? 24  VAL A H    3  
ATOM 4136  H HA   . VAL A 1 24  ? -10.244 2.816   -0.130  1.00 0.00 ? 24  VAL A HA   3  
ATOM 4137  H HB   . VAL A 1 24  ? -7.497  2.692   -1.375  1.00 0.00 ? 24  VAL A HB   3  
ATOM 4138  H HG11 . VAL A 1 24  ? -9.225  3.302   -3.363  1.00 0.00 ? 24  VAL A HG11 3  
ATOM 4139  H HG12 . VAL A 1 24  ? -10.250 2.300   -2.335  1.00 0.00 ? 24  VAL A HG12 3  
ATOM 4140  H HG13 . VAL A 1 24  ? -8.728  1.659   -2.953  1.00 0.00 ? 24  VAL A HG13 3  
ATOM 4141  H HG21 . VAL A 1 24  ? -9.310  4.988   -0.853  1.00 0.00 ? 24  VAL A HG21 3  
ATOM 4142  H HG22 . VAL A 1 24  ? -8.453  4.941   -2.395  1.00 0.00 ? 24  VAL A HG22 3  
ATOM 4143  H HG23 . VAL A 1 24  ? -7.548  4.920   -0.881  1.00 0.00 ? 24  VAL A HG23 3  
ATOM 4144  N N    . ASN A 1 25  ? -10.064 0.393   0.556   1.00 0.00 ? 25  ASN A N    3  
ATOM 4145  C CA   . ASN A 1 25  ? -10.050 -1.060  0.691   1.00 0.00 ? 25  ASN A CA   3  
ATOM 4146  C C    . ASN A 1 25  ? -10.468 -1.732  -0.613  1.00 0.00 ? 25  ASN A C    3  
ATOM 4147  O O    . ASN A 1 25  ? -11.511 -1.410  -1.182  1.00 0.00 ? 25  ASN A O    3  
ATOM 4148  C CB   . ASN A 1 25  ? -10.979 -1.496  1.824   1.00 0.00 ? 25  ASN A CB   3  
ATOM 4149  C CG   . ASN A 1 25  ? -12.380 -0.935  1.672   1.00 0.00 ? 25  ASN A CG   3  
ATOM 4150  O OD1  . ASN A 1 25  ? -12.627 0.234   1.967   1.00 0.00 ? 25  ASN A OD1  3  
ATOM 4151  N ND2  . ASN A 1 25  ? -13.305 -1.768  1.210   1.00 0.00 ? 25  ASN A ND2  3  
ATOM 4152  H H    . ASN A 1 25  ? -10.839 0.895   0.881   1.00 0.00 ? 25  ASN A H    3  
ATOM 4153  H HA   . ASN A 1 25  ? -9.040  -1.361  0.929   1.00 0.00 ? 25  ASN A HA   3  
ATOM 4154  H HB2  . ASN A 1 25  ? -11.043 -2.574  1.834   1.00 0.00 ? 25  ASN A HB2  3  
ATOM 4155  H HB3  . ASN A 1 25  ? -10.574 -1.154  2.766   1.00 0.00 ? 25  ASN A HB3  3  
ATOM 4156  H HD21 . ASN A 1 25  ? -13.035 -2.686  0.996   1.00 0.00 ? 25  ASN A HD21 3  
ATOM 4157  H HD22 . ASN A 1 25  ? -14.219 -1.432  1.101   1.00 0.00 ? 25  ASN A HD22 3  
ATOM 4158  N N    . LEU A 1 26  ? -9.648  -2.667  -1.080  1.00 0.00 ? 26  LEU A N    3  
ATOM 4159  C CA   . LEU A 1 26  ? -9.933  -3.385  -2.317  1.00 0.00 ? 26  LEU A CA   3  
ATOM 4160  C C    . LEU A 1 26  ? -9.621  -4.871  -2.167  1.00 0.00 ? 26  LEU A C    3  
ATOM 4161  O O    . LEU A 1 26  ? -8.529  -5.247  -1.742  1.00 0.00 ? 26  LEU A O    3  
ATOM 4162  C CB   . LEU A 1 26  ? -9.120  -2.797  -3.472  1.00 0.00 ? 26  LEU A CB   3  
ATOM 4163  C CG   . LEU A 1 26  ? -9.581  -1.420  -3.954  1.00 0.00 ? 26  LEU A CG   3  
ATOM 4164  C CD1  . LEU A 1 26  ? -8.722  -0.947  -5.116  1.00 0.00 ? 26  LEU A CD1  3  
ATOM 4165  C CD2  . LEU A 1 26  ? -11.048 -1.461  -4.353  1.00 0.00 ? 26  LEU A CD2  3  
ATOM 4166  H H    . LEU A 1 26  ? -8.832  -2.879  -0.581  1.00 0.00 ? 26  LEU A H    3  
ATOM 4167  H HA   . LEU A 1 26  ? -10.985 -3.270  -2.533  1.00 0.00 ? 26  LEU A HA   3  
ATOM 4168  H HB2  . LEU A 1 26  ? -8.090  -2.719  -3.156  1.00 0.00 ? 26  LEU A HB2  3  
ATOM 4169  H HB3  . LEU A 1 26  ? -9.172  -3.480  -4.306  1.00 0.00 ? 26  LEU A HB3  3  
ATOM 4170  H HG   . LEU A 1 26  ? -9.472  -0.710  -3.148  1.00 0.00 ? 26  LEU A HG   3  
ATOM 4171  H HD11 . LEU A 1 26  ? -8.327  -1.803  -5.643  1.00 0.00 ? 26  LEU A HD11 3  
ATOM 4172  H HD12 . LEU A 1 26  ? -7.907  -0.348  -4.740  1.00 0.00 ? 26  LEU A HD12 3  
ATOM 4173  H HD13 . LEU A 1 26  ? -9.323  -0.355  -5.790  1.00 0.00 ? 26  LEU A HD13 3  
ATOM 4174  H HD21 . LEU A 1 26  ? -11.212 -0.800  -5.192  1.00 0.00 ? 26  LEU A HD21 3  
ATOM 4175  H HD22 . LEU A 1 26  ? -11.658 -1.142  -3.520  1.00 0.00 ? 26  LEU A HD22 3  
ATOM 4176  H HD23 . LEU A 1 26  ? -11.318 -2.469  -4.631  1.00 0.00 ? 26  LEU A HD23 3  
ATOM 4177  N N    . VAL A 1 27  ? -10.588 -5.712  -2.521  1.00 0.00 ? 27  VAL A N    3  
ATOM 4178  C CA   . VAL A 1 27  ? -10.417 -7.156  -2.428  1.00 0.00 ? 27  VAL A CA   3  
ATOM 4179  C C    . VAL A 1 27  ? -10.213 -7.774  -3.807  1.00 0.00 ? 27  VAL A C    3  
ATOM 4180  O O    . VAL A 1 27  ? -11.031 -7.587  -4.707  1.00 0.00 ? 27  VAL A O    3  
ATOM 4181  C CB   . VAL A 1 27  ? -11.628 -7.825  -1.751  1.00 0.00 ? 27  VAL A CB   3  
ATOM 4182  C CG1  . VAL A 1 27  ? -11.364 -9.306  -1.522  1.00 0.00 ? 27  VAL A CG1  3  
ATOM 4183  C CG2  . VAL A 1 27  ? -11.961 -7.128  -0.439  1.00 0.00 ? 27  VAL A CG2  3  
ATOM 4184  H H    . VAL A 1 27  ? -11.436 -5.352  -2.855  1.00 0.00 ? 27  VAL A H    3  
ATOM 4185  H HA   . VAL A 1 27  ? -9.540  -7.349  -1.825  1.00 0.00 ? 27  VAL A HA   3  
ATOM 4186  H HB   . VAL A 1 27  ? -12.479 -7.733  -2.409  1.00 0.00 ? 27  VAL A HB   3  
ATOM 4187  H HG11 . VAL A 1 27  ? -11.983 -9.661  -0.712  1.00 0.00 ? 27  VAL A HG11 3  
ATOM 4188  H HG12 . VAL A 1 27  ? -10.324 -9.451  -1.270  1.00 0.00 ? 27  VAL A HG12 3  
ATOM 4189  H HG13 . VAL A 1 27  ? -11.597 -9.857  -2.421  1.00 0.00 ? 27  VAL A HG13 3  
ATOM 4190  H HG21 . VAL A 1 27  ? -11.581 -7.713  0.386   1.00 0.00 ? 27  VAL A HG21 3  
ATOM 4191  H HG22 . VAL A 1 27  ? -13.032 -7.029  -0.347  1.00 0.00 ? 27  VAL A HG22 3  
ATOM 4192  H HG23 . VAL A 1 27  ? -11.507 -6.149  -0.425  1.00 0.00 ? 27  VAL A HG23 3  
ATOM 4193  N N    . LEU A 1 28  ? -9.119  -8.509  -3.966  1.00 0.00 ? 28  LEU A N    3  
ATOM 4194  C CA   . LEU A 1 28  ? -8.808  -9.153  -5.237  1.00 0.00 ? 28  LEU A CA   3  
ATOM 4195  C C    . LEU A 1 28  ? -9.188  -10.630 -5.207  1.00 0.00 ? 28  LEU A C    3  
ATOM 4196  O O    . LEU A 1 28  ? -9.150  -11.270 -4.156  1.00 0.00 ? 28  LEU A O    3  
ATOM 4197  C CB   . LEU A 1 28  ? -7.319  -9.004  -5.557  1.00 0.00 ? 28  LEU A CB   3  
ATOM 4198  C CG   . LEU A 1 28  ? -6.816  -7.561  -5.637  1.00 0.00 ? 28  LEU A CG   3  
ATOM 4199  C CD1  . LEU A 1 28  ? -5.298  -7.529  -5.718  1.00 0.00 ? 28  LEU A CD1  3  
ATOM 4200  C CD2  . LEU A 1 28  ? -7.432  -6.848  -6.832  1.00 0.00 ? 28  LEU A CD2  3  
ATOM 4201  H H    . LEU A 1 28  ? -8.504  -8.621  -3.211  1.00 0.00 ? 28  LEU A H    3  
ATOM 4202  H HA   . LEU A 1 28  ? -9.383  -8.661  -6.007  1.00 0.00 ? 28  LEU A HA   3  
ATOM 4203  H HB2  . LEU A 1 28  ? -6.755  -9.519  -4.794  1.00 0.00 ? 28  LEU A HB2  3  
ATOM 4204  H HB3  . LEU A 1 28  ? -7.127  -9.480  -6.507  1.00 0.00 ? 28  LEU A HB3  3  
ATOM 4205  H HG   . LEU A 1 28  ? -7.114  -7.033  -4.742  1.00 0.00 ? 28  LEU A HG   3  
ATOM 4206  H HD11 . LEU A 1 28  ? -4.887  -7.408  -4.727  1.00 0.00 ? 28  LEU A HD11 3  
ATOM 4207  H HD12 . LEU A 1 28  ? -4.989  -6.701  -6.340  1.00 0.00 ? 28  LEU A HD12 3  
ATOM 4208  H HD13 . LEU A 1 28  ? -4.941  -8.453  -6.147  1.00 0.00 ? 28  LEU A HD13 3  
ATOM 4209  H HD21 . LEU A 1 28  ? -8.313  -6.310  -6.515  1.00 0.00 ? 28  LEU A HD21 3  
ATOM 4210  H HD22 . LEU A 1 28  ? -7.706  -7.575  -7.583  1.00 0.00 ? 28  LEU A HD22 3  
ATOM 4211  H HD23 . LEU A 1 28  ? -6.716  -6.155  -7.246  1.00 0.00 ? 28  LEU A HD23 3  
ATOM 4212  N N    . GLY A 1 29  ? -9.555  -11.165 -6.367  1.00 0.00 ? 29  GLY A N    3  
ATOM 4213  C CA   . GLY A 1 29  ? -9.937  -12.562 -6.452  1.00 0.00 ? 29  GLY A CA   3  
ATOM 4214  C C    . GLY A 1 29  ? -8.744  -13.495 -6.382  1.00 0.00 ? 29  GLY A C    3  
ATOM 4215  O O    . GLY A 1 29  ? -8.318  -13.886 -5.295  1.00 0.00 ? 29  GLY A O    3  
ATOM 4216  H H    . GLY A 1 29  ? -9.566  -10.606 -7.172  1.00 0.00 ? 29  GLY A H    3  
ATOM 4217  H HA2  . GLY A 1 29  ? -10.608 -12.791 -5.635  1.00 0.00 ? 29  GLY A HA2  3  
ATOM 4218  H HA3  . GLY A 1 29  ? -10.454 -12.726 -7.389  1.00 0.00 ? 29  GLY A HA3  3  
ATOM 4219  N N    . ASP A 1 30  ? -8.205  -13.853 -7.543  1.00 0.00 ? 30  ASP A N    3  
ATOM 4220  C CA   . ASP A 1 30  ? -7.055  -14.747 -7.608  1.00 0.00 ? 30  ASP A CA   3  
ATOM 4221  C C    . ASP A 1 30  ? -5.968  -14.171 -8.509  1.00 0.00 ? 30  ASP A C    3  
ATOM 4222  O O    . ASP A 1 30  ? -4.798  -14.116 -8.130  1.00 0.00 ? 30  ASP A O    3  
ATOM 4223  C CB   . ASP A 1 30  ? -7.481  -16.124 -8.119  1.00 0.00 ? 30  ASP A CB   3  
ATOM 4224  C CG   . ASP A 1 30  ? -7.848  -17.071 -6.993  1.00 0.00 ? 30  ASP A CG   3  
ATOM 4225  O OD1  . ASP A 1 30  ? -6.926  -17.626 -6.361  1.00 0.00 ? 30  ASP A OD1  3  
ATOM 4226  O OD2  . ASP A 1 30  ? -9.059  -17.257 -6.744  1.00 0.00 ? 30  ASP A OD2  3  
ATOM 4227  H H    . ASP A 1 30  ? -8.591  -13.508 -8.375  1.00 0.00 ? 30  ASP A H    3  
ATOM 4228  H HA   . ASP A 1 30  ? -6.659  -14.851 -6.608  1.00 0.00 ? 30  ASP A HA   3  
ATOM 4229  H HB2  . ASP A 1 30  ? -8.341  -16.012 -8.763  1.00 0.00 ? 30  ASP A HB2  3  
ATOM 4230  H HB3  . ASP A 1 30  ? -6.668  -16.560 -8.682  1.00 0.00 ? 30  ASP A HB3  3  
ATOM 4231  N N    . GLY A 1 31  ? -6.361  -13.744 -9.704  1.00 0.00 ? 31  GLY A N    3  
ATOM 4232  C CA   . GLY A 1 31  ? -5.409  -13.178 -10.641 1.00 0.00 ? 31  GLY A CA   3  
ATOM 4233  C C    . GLY A 1 31  ? -5.774  -11.766 -11.056 1.00 0.00 ? 31  GLY A C    3  
ATOM 4234  O O    . GLY A 1 31  ? -5.693  -11.417 -12.233 1.00 0.00 ? 31  GLY A O    3  
ATOM 4235  H H    . GLY A 1 31  ? -7.308  -13.813 -9.952  1.00 0.00 ? 31  GLY A H    3  
ATOM 4236  H HA2  . GLY A 1 31  ? -4.430  -13.163 -10.180 1.00 0.00 ? 31  GLY A HA2  3  
ATOM 4237  H HA3  . GLY A 1 31  ? -5.374  -13.803 -11.524 1.00 0.00 ? 31  GLY A HA3  3  
ATOM 4238  N N    . ARG A 1 32  ? -6.178  -10.953 -10.086 1.00 0.00 ? 32  ARG A N    3  
ATOM 4239  C CA   . ARG A 1 32  ? -6.557  -9.570  -10.356 1.00 0.00 ? 32  ARG A CA   3  
ATOM 4240  C C    . ARG A 1 32  ? -5.406  -8.619  -10.050 1.00 0.00 ? 32  ARG A C    3  
ATOM 4241  O O    . ARG A 1 32  ? -4.315  -9.049  -9.673  1.00 0.00 ? 32  ARG A O    3  
ATOM 4242  C CB   . ARG A 1 32  ? -7.785  -9.185  -9.529  1.00 0.00 ? 32  ARG A CB   3  
ATOM 4243  C CG   . ARG A 1 32  ? -9.033  -9.977  -9.889  1.00 0.00 ? 32  ARG A CG   3  
ATOM 4244  C CD   . ARG A 1 32  ? -10.266 -9.086  -9.945  1.00 0.00 ? 32  ARG A CD   3  
ATOM 4245  N NE   . ARG A 1 32  ? -10.763 -8.925  -11.308 1.00 0.00 ? 32  ARG A NE   3  
ATOM 4246  C CZ   . ARG A 1 32  ? -11.584 -7.948  -11.687 1.00 0.00 ? 32  ARG A CZ   3  
ATOM 4247  N NH1  . ARG A 1 32  ? -12.002 -7.044  -10.809 1.00 0.00 ? 32  ARG A NH1  3  
ATOM 4248  N NH2  . ARG A 1 32  ? -11.989 -7.875  -12.948 1.00 0.00 ? 32  ARG A NH2  3  
ATOM 4249  H H    . ARG A 1 32  ? -6.221  -11.289 -9.167  1.00 0.00 ? 32  ARG A H    3  
ATOM 4250  H HA   . ARG A 1 32  ? -6.803  -9.493  -11.405 1.00 0.00 ? 32  ARG A HA   3  
ATOM 4251  H HB2  . ARG A 1 32  ? -7.568  -9.353  -8.484  1.00 0.00 ? 32  ARG A HB2  3  
ATOM 4252  H HB3  . ARG A 1 32  ? -7.993  -8.137  -9.681  1.00 0.00 ? 32  ARG A HB3  3  
ATOM 4253  H HG2  . ARG A 1 32  ? -8.891  -10.435 -10.856 1.00 0.00 ? 32  ARG A HG2  3  
ATOM 4254  H HG3  . ARG A 1 32  ? -9.187  -10.744 -9.144  1.00 0.00 ? 32  ARG A HG3  3  
ATOM 4255  H HD2  . ARG A 1 32  ? -11.042 -9.530  -9.339  1.00 0.00 ? 32  ARG A HD2  3  
ATOM 4256  H HD3  . ARG A 1 32  ? -10.011 -8.115  -9.546  1.00 0.00 ? 32  ARG A HD3  3  
ATOM 4257  H HE   . ARG A 1 32  ? -10.470 -9.579  -11.976 1.00 0.00 ? 32  ARG A HE   3  
ATOM 4258  H HH11 . ARG A 1 32  ? -11.700 -7.094  -9.857  1.00 0.00 ? 32  ARG A HH11 3  
ATOM 4259  H HH12 . ARG A 1 32  ? -12.618 -6.313  -11.101 1.00 0.00 ? 32  ARG A HH12 3  
ATOM 4260  H HH21 . ARG A 1 32  ? -11.677 -8.553  -13.613 1.00 0.00 ? 32  ARG A HH21 3  
ATOM 4261  H HH22 . ARG A 1 32  ? -12.606 -7.141  -13.233 1.00 0.00 ? 32  ARG A HH22 3  
ATOM 4262  N N    . SER A 1 33  ? -5.655  -7.324  -10.215 1.00 0.00 ? 33  SER A N    3  
ATOM 4263  C CA   . SER A 1 33  ? -4.639  -6.311  -9.956  1.00 0.00 ? 33  SER A CA   3  
ATOM 4264  C C    . SER A 1 33  ? -5.267  -4.926  -9.847  1.00 0.00 ? 33  SER A C    3  
ATOM 4265  O O    . SER A 1 33  ? -6.307  -4.656  -10.449 1.00 0.00 ? 33  SER A O    3  
ATOM 4266  C CB   . SER A 1 33  ? -3.585  -6.320  -11.066 1.00 0.00 ? 33  SER A CB   3  
ATOM 4267  O OG   . SER A 1 33  ? -2.607  -7.318  -10.833 1.00 0.00 ? 33  SER A OG   3  
ATOM 4268  H H    . SER A 1 33  ? -6.543  -7.043  -10.518 1.00 0.00 ? 33  SER A H    3  
ATOM 4269  H HA   . SER A 1 33  ? -4.162  -6.551  -9.018  1.00 0.00 ? 33  SER A HA   3  
ATOM 4270  H HB2  . SER A 1 33  ? -4.065  -6.519  -12.013 1.00 0.00 ? 33  SER A HB2  3  
ATOM 4271  H HB3  . SER A 1 33  ? -3.099  -5.356  -11.105 1.00 0.00 ? 33  SER A HB3  3  
ATOM 4272  H HG   . SER A 1 33  ? -1.876  -7.197  -11.442 1.00 0.00 ? 33  SER A HG   3  
ATOM 4273  N N    . LEU A 1 34  ? -4.630  -4.051  -9.076  1.00 0.00 ? 34  LEU A N    3  
ATOM 4274  C CA   . LEU A 1 34  ? -5.128  -2.692  -8.889  1.00 0.00 ? 34  LEU A CA   3  
ATOM 4275  C C    . LEU A 1 34  ? -5.074  -1.908  -10.197 1.00 0.00 ? 34  LEU A C    3  
ATOM 4276  O O    . LEU A 1 34  ? -6.052  -1.272  -10.590 1.00 0.00 ? 34  LEU A O    3  
ATOM 4277  C CB   . LEU A 1 34  ? -4.311  -1.971  -7.816  1.00 0.00 ? 34  LEU A CB   3  
ATOM 4278  C CG   . LEU A 1 34  ? -4.445  -2.545  -6.405  1.00 0.00 ? 34  LEU A CG   3  
ATOM 4279  C CD1  . LEU A 1 34  ? -3.196  -2.253  -5.588  1.00 0.00 ? 34  LEU A CD1  3  
ATOM 4280  C CD2  . LEU A 1 34  ? -5.679  -1.982  -5.716  1.00 0.00 ? 34  LEU A CD2  3  
ATOM 4281  H H    . LEU A 1 34  ? -3.805  -4.324  -8.623  1.00 0.00 ? 34  LEU A H    3  
ATOM 4282  H HA   . LEU A 1 34  ? -6.155  -2.757  -8.564  1.00 0.00 ? 34  LEU A HA   3  
ATOM 4283  H HB2  . LEU A 1 34  ? -3.267  -2.010  -8.100  1.00 0.00 ? 34  LEU A HB2  3  
ATOM 4284  H HB3  . LEU A 1 34  ? -4.624  -0.935  -7.789  1.00 0.00 ? 34  LEU A HB3  3  
ATOM 4285  H HG   . LEU A 1 34  ? -4.557  -3.619  -6.470  1.00 0.00 ? 34  LEU A HG   3  
ATOM 4286  H HD11 . LEU A 1 34  ? -3.126  -1.190  -5.406  1.00 0.00 ? 34  LEU A HD11 3  
ATOM 4287  H HD12 . LEU A 1 34  ? -2.324  -2.582  -6.133  1.00 0.00 ? 34  LEU A HD12 3  
ATOM 4288  H HD13 . LEU A 1 34  ? -3.250  -2.776  -4.645  1.00 0.00 ? 34  LEU A HD13 3  
ATOM 4289  H HD21 . LEU A 1 34  ? -6.381  -1.638  -6.460  1.00 0.00 ? 34  LEU A HD21 3  
ATOM 4290  H HD22 . LEU A 1 34  ? -5.392  -1.157  -5.082  1.00 0.00 ? 34  LEU A HD22 3  
ATOM 4291  H HD23 . LEU A 1 34  ? -6.140  -2.754  -5.116  1.00 0.00 ? 34  LEU A HD23 3  
ATOM 4292  N N    . GLY A 1 35  ? -3.926  -1.959  -10.864 1.00 0.00 ? 35  GLY A N    3  
ATOM 4293  C CA   . GLY A 1 35  ? -3.767  -1.250  -12.119 1.00 0.00 ? 35  GLY A CA   3  
ATOM 4294  C C    . GLY A 1 35  ? -3.283  0.174   -11.923 1.00 0.00 ? 35  GLY A C    3  
ATOM 4295  O O    . GLY A 1 35  ? -3.675  1.077   -12.659 1.00 0.00 ? 35  GLY A O    3  
ATOM 4296  H H    . GLY A 1 35  ? -3.182  -2.483  -10.501 1.00 0.00 ? 35  GLY A H    3  
ATOM 4297  H HA2  . GLY A 1 35  ? -3.050  -1.780  -12.732 1.00 0.00 ? 35  GLY A HA2  3  
ATOM 4298  H HA3  . GLY A 1 35  ? -4.720  -1.227  -12.632 1.00 0.00 ? 35  GLY A HA3  3  
ATOM 4299  N N    . LEU A 1 36  ? -2.428  0.372   -10.924 1.00 0.00 ? 36  LEU A N    3  
ATOM 4300  C CA   . LEU A 1 36  ? -1.890  1.695   -10.631 1.00 0.00 ? 36  LEU A CA   3  
ATOM 4301  C C    . LEU A 1 36  ? -0.396  1.755   -10.938 1.00 0.00 ? 36  LEU A C    3  
ATOM 4302  O O    . LEU A 1 36  ? 0.371   0.894   -10.507 1.00 0.00 ? 36  LEU A O    3  
ATOM 4303  C CB   . LEU A 1 36  ? -2.136  2.055   -9.165  1.00 0.00 ? 36  LEU A CB   3  
ATOM 4304  C CG   . LEU A 1 36  ? -3.607  2.203   -8.773  1.00 0.00 ? 36  LEU A CG   3  
ATOM 4305  C CD1  . LEU A 1 36  ? -3.734  2.525   -7.292  1.00 0.00 ? 36  LEU A CD1  3  
ATOM 4306  C CD2  . LEU A 1 36  ? -4.275  3.280   -9.615  1.00 0.00 ? 36  LEU A CD2  3  
ATOM 4307  H H    . LEU A 1 36  ? -2.153  -0.389  -10.373 1.00 0.00 ? 36  LEU A H    3  
ATOM 4308  H HA   . LEU A 1 36  ? -2.402  2.409   -11.259 1.00 0.00 ? 36  LEU A HA   3  
ATOM 4309  H HB2  . LEU A 1 36  ? -1.696  1.284   -8.548  1.00 0.00 ? 36  LEU A HB2  3  
ATOM 4310  H HB3  . LEU A 1 36  ? -1.635  2.988   -8.955  1.00 0.00 ? 36  LEU A HB3  3  
ATOM 4311  H HG   . LEU A 1 36  ? -4.117  1.269   -8.956  1.00 0.00 ? 36  LEU A HG   3  
ATOM 4312  H HD11 . LEU A 1 36  ? -3.774  1.606   -6.726  1.00 0.00 ? 36  LEU A HD11 3  
ATOM 4313  H HD12 . LEU A 1 36  ? -4.639  3.091   -7.124  1.00 0.00 ? 36  LEU A HD12 3  
ATOM 4314  H HD13 . LEU A 1 36  ? -2.882  3.108   -6.975  1.00 0.00 ? 36  LEU A HD13 3  
ATOM 4315  H HD21 . LEU A 1 36  ? -5.298  3.407   -9.291  1.00 0.00 ? 36  LEU A HD21 3  
ATOM 4316  H HD22 . LEU A 1 36  ? -4.260  2.985   -10.654 1.00 0.00 ? 36  LEU A HD22 3  
ATOM 4317  H HD23 . LEU A 1 36  ? -3.741  4.211   -9.497  1.00 0.00 ? 36  LEU A HD23 3  
ATOM 4318  N N    . THR A 1 37  ? 0.008   2.778   -11.684 1.00 0.00 ? 37  THR A N    3  
ATOM 4319  C CA   . THR A 1 37  ? 1.409   2.950   -12.048 1.00 0.00 ? 37  THR A CA   3  
ATOM 4320  C C    . THR A 1 37  ? 2.131   3.827   -11.030 1.00 0.00 ? 37  THR A C    3  
ATOM 4321  O O    . THR A 1 37  ? 2.264   5.036   -11.220 1.00 0.00 ? 37  THR A O    3  
ATOM 4322  C CB   . THR A 1 37  ? 1.522   3.569   -13.443 1.00 0.00 ? 37  THR A CB   3  
ATOM 4323  O OG1  . THR A 1 37  ? 0.630   2.939   -14.344 1.00 0.00 ? 37  THR A OG1  3  
ATOM 4324  C CG2  . THR A 1 37  ? 2.913   3.471   -14.030 1.00 0.00 ? 37  THR A CG2  3  
ATOM 4325  H H    . THR A 1 37  ? -0.651  3.431   -11.997 1.00 0.00 ? 37  THR A H    3  
ATOM 4326  H HA   . THR A 1 37  ? 1.872   1.975   -12.058 1.00 0.00 ? 37  THR A HA   3  
ATOM 4327  H HB   . THR A 1 37  ? 1.261   4.616   -13.383 1.00 0.00 ? 37  THR A HB   3  
ATOM 4328  H HG1  . THR A 1 37  ? 0.897   2.027   -14.474 1.00 0.00 ? 37  THR A HG1  3  
ATOM 4329  H HG21 . THR A 1 37  ? 3.042   4.236   -14.781 1.00 0.00 ? 37  THR A HG21 3  
ATOM 4330  H HG22 . THR A 1 37  ? 3.046   2.499   -14.481 1.00 0.00 ? 37  THR A HG22 3  
ATOM 4331  H HG23 . THR A 1 37  ? 3.645   3.609   -13.248 1.00 0.00 ? 37  THR A HG23 3  
ATOM 4332  N N    . ILE A 1 38  ? 2.598   3.210   -9.950  1.00 0.00 ? 38  ILE A N    3  
ATOM 4333  C CA   . ILE A 1 38  ? 3.306   3.933   -8.901  1.00 0.00 ? 38  ILE A CA   3  
ATOM 4334  C C    . ILE A 1 38  ? 4.677   4.395   -9.382  1.00 0.00 ? 38  ILE A C    3  
ATOM 4335  O O    . ILE A 1 38  ? 5.139   3.994   -10.450 1.00 0.00 ? 38  ILE A O    3  
ATOM 4336  C CB   . ILE A 1 38  ? 3.483   3.067   -7.641  1.00 0.00 ? 38  ILE A CB   3  
ATOM 4337  C CG1  . ILE A 1 38  ? 4.112   1.721   -8.003  1.00 0.00 ? 38  ILE A CG1  3  
ATOM 4338  C CG2  . ILE A 1 38  ? 2.143   2.861   -6.947  1.00 0.00 ? 38  ILE A CG2  3  
ATOM 4339  C CD1  . ILE A 1 38  ? 4.661   0.968   -6.811  1.00 0.00 ? 38  ILE A CD1  3  
ATOM 4340  H H    . ILE A 1 38  ? 2.461   2.244   -9.855  1.00 0.00 ? 38  ILE A H    3  
ATOM 4341  H HA   . ILE A 1 38  ? 2.717   4.800   -8.638  1.00 0.00 ? 38  ILE A HA   3  
ATOM 4342  H HB   . ILE A 1 38  ? 4.136   3.590   -6.959  1.00 0.00 ? 38  ILE A HB   3  
ATOM 4343  H HG12 . ILE A 1 38  ? 3.367   1.097   -8.474  1.00 0.00 ? 38  ILE A HG12 3  
ATOM 4344  H HG13 . ILE A 1 38  ? 4.926   1.886   -8.695  1.00 0.00 ? 38  ILE A HG13 3  
ATOM 4345  H HG21 . ILE A 1 38  ? 1.464   3.649   -7.236  1.00 0.00 ? 38  ILE A HG21 3  
ATOM 4346  H HG22 . ILE A 1 38  ? 2.285   2.883   -5.877  1.00 0.00 ? 38  ILE A HG22 3  
ATOM 4347  H HG23 . ILE A 1 38  ? 1.732   1.906   -7.236  1.00 0.00 ? 38  ILE A HG23 3  
ATOM 4348  H HD11 . ILE A 1 38  ? 4.710   1.631   -5.959  1.00 0.00 ? 38  ILE A HD11 3  
ATOM 4349  H HD12 . ILE A 1 38  ? 5.649   0.602   -7.040  1.00 0.00 ? 38  ILE A HD12 3  
ATOM 4350  H HD13 . ILE A 1 38  ? 4.012   0.136   -6.581  1.00 0.00 ? 38  ILE A HD13 3  
ATOM 4351  N N    . ARG A 1 39  ? 5.323   5.241   -8.587  1.00 0.00 ? 39  ARG A N    3  
ATOM 4352  C CA   . ARG A 1 39  ? 6.641   5.758   -8.930  1.00 0.00 ? 39  ARG A CA   3  
ATOM 4353  C C    . ARG A 1 39  ? 7.532   5.843   -7.695  1.00 0.00 ? 39  ARG A C    3  
ATOM 4354  O O    . ARG A 1 39  ? 7.094   5.552   -6.581  1.00 0.00 ? 39  ARG A O    3  
ATOM 4355  C CB   . ARG A 1 39  ? 6.518   7.138   -9.580  1.00 0.00 ? 39  ARG A CB   3  
ATOM 4356  C CG   . ARG A 1 39  ? 6.412   7.089   -11.096 1.00 0.00 ? 39  ARG A CG   3  
ATOM 4357  C CD   . ARG A 1 39  ? 7.636   7.696   -11.764 1.00 0.00 ? 39  ARG A CD   3  
ATOM 4358  N NE   . ARG A 1 39  ? 7.841   9.088   -11.370 1.00 0.00 ? 39  ARG A NE   3  
ATOM 4359  C CZ   . ARG A 1 39  ? 8.610   9.943   -12.039 1.00 0.00 ? 39  ARG A CZ   3  
ATOM 4360  N NH1  . ARG A 1 39  ? 9.249   9.553   -13.135 1.00 0.00 ? 39  ARG A NH1  3  
ATOM 4361  N NH2  . ARG A 1 39  ? 8.741   11.191  -11.612 1.00 0.00 ? 39  ARG A NH2  3  
ATOM 4362  H H    . ARG A 1 39  ? 4.902   5.525   -7.748  1.00 0.00 ? 39  ARG A H    3  
ATOM 4363  H HA   . ARG A 1 39  ? 7.091   5.076   -9.637  1.00 0.00 ? 39  ARG A HA   3  
ATOM 4364  H HB2  . ARG A 1 39  ? 5.635   7.626   -9.195  1.00 0.00 ? 39  ARG A HB2  3  
ATOM 4365  H HB3  . ARG A 1 39  ? 7.386   7.725   -9.320  1.00 0.00 ? 39  ARG A HB3  3  
ATOM 4366  H HG2  . ARG A 1 39  ? 6.319   6.059   -11.408 1.00 0.00 ? 39  ARG A HG2  3  
ATOM 4367  H HG3  . ARG A 1 39  ? 5.534   7.639   -11.404 1.00 0.00 ? 39  ARG A HG3  3  
ATOM 4368  H HD2  . ARG A 1 39  ? 8.506   7.121   -11.483 1.00 0.00 ? 39  ARG A HD2  3  
ATOM 4369  H HD3  . ARG A 1 39  ? 7.506   7.650   -12.835 1.00 0.00 ? 39  ARG A HD3  3  
ATOM 4370  H HE   . ARG A 1 39  ? 7.380   9.402   -10.563 1.00 0.00 ? 39  ARG A HE   3  
ATOM 4371  H HH11 . ARG A 1 39  ? 9.155   8.613   -13.463 1.00 0.00 ? 39  ARG A HH11 3  
ATOM 4372  H HH12 . ARG A 1 39  ? 9.826   10.200  -13.634 1.00 0.00 ? 39  ARG A HH12 3  
ATOM 4373  H HH21 . ARG A 1 39  ? 8.261   11.490  -10.787 1.00 0.00 ? 39  ARG A HH21 3  
ATOM 4374  H HH22 . ARG A 1 39  ? 9.319   11.834  -12.115 1.00 0.00 ? 39  ARG A HH22 3  
ATOM 4375  N N    . GLY A 1 40  ? 8.783   6.243   -7.899  1.00 0.00 ? 40  GLY A N    3  
ATOM 4376  C CA   . GLY A 1 40  ? 9.714   6.358   -6.792  1.00 0.00 ? 40  GLY A CA   3  
ATOM 4377  C C    . GLY A 1 40  ? 9.974   5.029   -6.111  1.00 0.00 ? 40  GLY A C    3  
ATOM 4378  O O    . GLY A 1 40  ? 9.495   3.988   -6.563  1.00 0.00 ? 40  GLY A O    3  
ATOM 4379  H H    . GLY A 1 40  ? 9.076   6.461   -8.809  1.00 0.00 ? 40  GLY A H    3  
ATOM 4380  H HA2  . GLY A 1 40  ? 10.651  6.748   -7.164  1.00 0.00 ? 40  GLY A HA2  3  
ATOM 4381  H HA3  . GLY A 1 40  ? 9.311   7.050   -6.067  1.00 0.00 ? 40  GLY A HA3  3  
ATOM 4382  N N    . GLY A 1 41  ? 10.732  5.063   -5.019  1.00 0.00 ? 41  GLY A N    3  
ATOM 4383  C CA   . GLY A 1 41  ? 11.040  3.847   -4.293  1.00 0.00 ? 41  GLY A CA   3  
ATOM 4384  C C    . GLY A 1 41  ? 12.200  4.022   -3.334  1.00 0.00 ? 41  GLY A C    3  
ATOM 4385  O O    . GLY A 1 41  ? 12.775  5.107   -3.236  1.00 0.00 ? 41  GLY A O    3  
ATOM 4386  H H    . GLY A 1 41  ? 11.085  5.923   -4.706  1.00 0.00 ? 41  GLY A H    3  
ATOM 4387  H HA2  . GLY A 1 41  ? 10.165  3.545   -3.731  1.00 0.00 ? 41  GLY A HA2  3  
ATOM 4388  H HA3  . GLY A 1 41  ? 11.288  3.069   -5.003  1.00 0.00 ? 41  GLY A HA3  3  
ATOM 4389  N N    . ALA A 1 42  ? 12.547  2.953   -2.624  1.00 0.00 ? 42  ALA A N    3  
ATOM 4390  C CA   . ALA A 1 42  ? 13.646  2.995   -1.667  1.00 0.00 ? 42  ALA A CA   3  
ATOM 4391  C C    . ALA A 1 42  ? 14.988  3.122   -2.379  1.00 0.00 ? 42  ALA A C    3  
ATOM 4392  O O    . ALA A 1 42  ? 15.870  3.858   -1.937  1.00 0.00 ? 42  ALA A O    3  
ATOM 4393  C CB   . ALA A 1 42  ? 13.628  1.753   -0.789  1.00 0.00 ? 42  ALA A CB   3  
ATOM 4394  H H    . ALA A 1 42  ? 12.051  2.118   -2.746  1.00 0.00 ? 42  ALA A H    3  
ATOM 4395  H HA   . ALA A 1 42  ? 13.504  3.858   -1.033  1.00 0.00 ? 42  ALA A HA   3  
ATOM 4396  H HB1  . ALA A 1 42  ? 14.591  1.633   -0.315  1.00 0.00 ? 42  ALA A HB1  3  
ATOM 4397  H HB2  . ALA A 1 42  ? 13.415  0.886   -1.396  1.00 0.00 ? 42  ALA A HB2  3  
ATOM 4398  H HB3  . ALA A 1 42  ? 12.864  1.858   -0.032  1.00 0.00 ? 42  ALA A HB3  3  
ATOM 4399  N N    . GLU A 1 43  ? 15.137  2.399   -3.484  1.00 0.00 ? 43  GLU A N    3  
ATOM 4400  C CA   . GLU A 1 43  ? 16.372  2.430   -4.258  1.00 0.00 ? 43  GLU A CA   3  
ATOM 4401  C C    . GLU A 1 43  ? 16.571  3.795   -4.910  1.00 0.00 ? 43  GLU A C    3  
ATOM 4402  O O    . GLU A 1 43  ? 17.656  4.372   -4.844  1.00 0.00 ? 43  GLU A O    3  
ATOM 4403  C CB   . GLU A 1 43  ? 16.355  1.338   -5.330  1.00 0.00 ? 43  GLU A CB   3  
ATOM 4404  C CG   . GLU A 1 43  ? 17.632  1.275   -6.154  1.00 0.00 ? 43  GLU A CG   3  
ATOM 4405  C CD   . GLU A 1 43  ? 17.452  1.835   -7.551  1.00 0.00 ? 43  GLU A CD   3  
ATOM 4406  O OE1  . GLU A 1 43  ? 17.364  3.073   -7.688  1.00 0.00 ? 43  GLU A OE1  3  
ATOM 4407  O OE2  . GLU A 1 43  ? 17.401  1.035   -8.509  1.00 0.00 ? 43  GLU A OE2  3  
ATOM 4408  H H    . GLU A 1 43  ? 14.398  1.830   -3.787  1.00 0.00 ? 43  GLU A H    3  
ATOM 4409  H HA   . GLU A 1 43  ? 17.193  2.245   -3.581  1.00 0.00 ? 43  GLU A HA   3  
ATOM 4410  H HB2  . GLU A 1 43  ? 16.215  0.381   -4.849  1.00 0.00 ? 43  GLU A HB2  3  
ATOM 4411  H HB3  . GLU A 1 43  ? 15.529  1.520   -6.000  1.00 0.00 ? 43  GLU A HB3  3  
ATOM 4412  H HG2  . GLU A 1 43  ? 18.399  1.845   -5.651  1.00 0.00 ? 43  GLU A HG2  3  
ATOM 4413  H HG3  . GLU A 1 43  ? 17.943  0.243   -6.233  1.00 0.00 ? 43  GLU A HG3  3  
ATOM 4414  N N    . TYR A 1 44  ? 15.517  4.304   -5.538  1.00 0.00 ? 44  TYR A N    3  
ATOM 4415  C CA   . TYR A 1 44  ? 15.576  5.602   -6.200  1.00 0.00 ? 44  TYR A CA   3  
ATOM 4416  C C    . TYR A 1 44  ? 15.651  6.732   -5.179  1.00 0.00 ? 44  TYR A C    3  
ATOM 4417  O O    . TYR A 1 44  ? 16.233  7.784   -5.445  1.00 0.00 ? 44  TYR A O    3  
ATOM 4418  C CB   . TYR A 1 44  ? 14.354  5.794   -7.101  1.00 0.00 ? 44  TYR A CB   3  
ATOM 4419  C CG   . TYR A 1 44  ? 14.288  4.813   -8.249  1.00 0.00 ? 44  TYR A CG   3  
ATOM 4420  C CD1  . TYR A 1 44  ? 15.397  4.578   -9.053  1.00 0.00 ? 44  TYR A CD1  3  
ATOM 4421  C CD2  . TYR A 1 44  ? 13.117  4.120   -8.530  1.00 0.00 ? 44  TYR A CD2  3  
ATOM 4422  C CE1  . TYR A 1 44  ? 15.340  3.682   -10.103 1.00 0.00 ? 44  TYR A CE1  3  
ATOM 4423  C CE2  . TYR A 1 44  ? 13.052  3.223   -9.579  1.00 0.00 ? 44  TYR A CE2  3  
ATOM 4424  C CZ   . TYR A 1 44  ? 14.166  3.007   -10.362 1.00 0.00 ? 44  TYR A CZ   3  
ATOM 4425  O OH   . TYR A 1 44  ? 14.106  2.115   -11.408 1.00 0.00 ? 44  TYR A OH   3  
ATOM 4426  H H    . TYR A 1 44  ? 14.679  3.796   -5.555  1.00 0.00 ? 44  TYR A H    3  
ATOM 4427  H HA   . TYR A 1 44  ? 16.467  5.622   -6.809  1.00 0.00 ? 44  TYR A HA   3  
ATOM 4428  H HB2  . TYR A 1 44  ? 13.458  5.674   -6.511  1.00 0.00 ? 44  TYR A HB2  3  
ATOM 4429  H HB3  . TYR A 1 44  ? 14.375  6.791   -7.516  1.00 0.00 ? 44  TYR A HB3  3  
ATOM 4430  H HD1  . TYR A 1 44  ? 16.315  5.107   -8.847  1.00 0.00 ? 44  TYR A HD1  3  
ATOM 4431  H HD2  . TYR A 1 44  ? 12.245  4.291   -7.916  1.00 0.00 ? 44  TYR A HD2  3  
ATOM 4432  H HE1  . TYR A 1 44  ? 16.213  3.514   -10.716 1.00 0.00 ? 44  TYR A HE1  3  
ATOM 4433  H HE2  . TYR A 1 44  ? 12.132  2.694   -9.782  1.00 0.00 ? 44  TYR A HE2  3  
ATOM 4434  H HH   . TYR A 1 44  ? 13.670  1.311   -11.117 1.00 0.00 ? 44  TYR A HH   3  
ATOM 4435  N N    . GLY A 1 45  ? 15.058  6.509   -4.011  1.00 0.00 ? 45  GLY A N    3  
ATOM 4436  C CA   . GLY A 1 45  ? 15.068  7.517   -2.968  1.00 0.00 ? 45  GLY A CA   3  
ATOM 4437  C C    . GLY A 1 45  ? 13.847  8.413   -3.018  1.00 0.00 ? 45  GLY A C    3  
ATOM 4438  O O    . GLY A 1 45  ? 13.923  9.597   -2.689  1.00 0.00 ? 45  GLY A O    3  
ATOM 4439  H H    . GLY A 1 45  ? 14.608  5.652   -3.856  1.00 0.00 ? 45  GLY A H    3  
ATOM 4440  H HA2  . GLY A 1 45  ? 15.103  7.027   -2.007  1.00 0.00 ? 45  GLY A HA2  3  
ATOM 4441  H HA3  . GLY A 1 45  ? 15.953  8.127   -3.082  1.00 0.00 ? 45  GLY A HA3  3  
ATOM 4442  N N    . LEU A 1 46  ? 12.717  7.847   -3.430  1.00 0.00 ? 46  LEU A N    3  
ATOM 4443  C CA   . LEU A 1 46  ? 11.473  8.601   -3.523  1.00 0.00 ? 46  LEU A CA   3  
ATOM 4444  C C    . LEU A 1 46  ? 10.308  7.801   -2.950  1.00 0.00 ? 46  LEU A C    3  
ATOM 4445  O O    . LEU A 1 46  ? 10.347  6.571   -2.910  1.00 0.00 ? 46  LEU A O    3  
ATOM 4446  C CB   . LEU A 1 46  ? 11.186  8.972   -4.979  1.00 0.00 ? 46  LEU A CB   3  
ATOM 4447  C CG   . LEU A 1 46  ? 9.929   9.817   -5.196  1.00 0.00 ? 46  LEU A CG   3  
ATOM 4448  C CD1  . LEU A 1 46  ? 10.109  11.203  -4.596  1.00 0.00 ? 46  LEU A CD1  3  
ATOM 4449  C CD2  . LEU A 1 46  ? 9.601   9.913   -6.678  1.00 0.00 ? 46  LEU A CD2  3  
ATOM 4450  H H    . LEU A 1 46  ? 12.721  6.899   -3.679  1.00 0.00 ? 46  LEU A H    3  
ATOM 4451  H HA   . LEU A 1 46  ? 11.590  9.506   -2.947  1.00 0.00 ? 46  LEU A HA   3  
ATOM 4452  H HB2  . LEU A 1 46  ? 12.035  9.522   -5.364  1.00 0.00 ? 46  LEU A HB2  3  
ATOM 4453  H HB3  . LEU A 1 46  ? 11.079  8.057   -5.547  1.00 0.00 ? 46  LEU A HB3  3  
ATOM 4454  H HG   . LEU A 1 46  ? 9.095   9.344   -4.697  1.00 0.00 ? 46  LEU A HG   3  
ATOM 4455  H HD11 . LEU A 1 46  ? 9.853   11.179  -3.547  1.00 0.00 ? 46  LEU A HD11 3  
ATOM 4456  H HD12 . LEU A 1 46  ? 9.465   11.903  -5.108  1.00 0.00 ? 46  LEU A HD12 3  
ATOM 4457  H HD13 . LEU A 1 46  ? 11.138  11.514  -4.709  1.00 0.00 ? 46  LEU A HD13 3  
ATOM 4458  H HD21 . LEU A 1 46  ? 9.995   10.837  -7.075  1.00 0.00 ? 46  LEU A HD21 3  
ATOM 4459  H HD22 . LEU A 1 46  ? 8.530   9.892   -6.812  1.00 0.00 ? 46  LEU A HD22 3  
ATOM 4460  H HD23 . LEU A 1 46  ? 10.045  9.078   -7.199  1.00 0.00 ? 46  LEU A HD23 3  
ATOM 4461  N N    . GLY A 1 47  ? 9.272   8.507   -2.509  1.00 0.00 ? 47  GLY A N    3  
ATOM 4462  C CA   . GLY A 1 47  ? 8.111   7.846   -1.944  1.00 0.00 ? 47  GLY A CA   3  
ATOM 4463  C C    . GLY A 1 47  ? 7.381   6.988   -2.959  1.00 0.00 ? 47  GLY A C    3  
ATOM 4464  O O    . GLY A 1 47  ? 7.909   6.700   -4.033  1.00 0.00 ? 47  GLY A O    3  
ATOM 4465  H H    . GLY A 1 47  ? 9.297   9.485   -2.567  1.00 0.00 ? 47  GLY A H    3  
ATOM 4466  H HA2  . GLY A 1 47  ? 8.430   7.220   -1.123  1.00 0.00 ? 47  GLY A HA2  3  
ATOM 4467  H HA3  . GLY A 1 47  ? 7.431   8.596   -1.568  1.00 0.00 ? 47  GLY A HA3  3  
ATOM 4468  N N    . ILE A 1 48  ? 6.163   6.579   -2.619  1.00 0.00 ? 48  ILE A N    3  
ATOM 4469  C CA   . ILE A 1 48  ? 5.358   5.750   -3.507  1.00 0.00 ? 48  ILE A CA   3  
ATOM 4470  C C    . ILE A 1 48  ? 4.081   6.470   -3.925  1.00 0.00 ? 48  ILE A C    3  
ATOM 4471  O O    . ILE A 1 48  ? 3.046   6.351   -3.269  1.00 0.00 ? 48  ILE A O    3  
ATOM 4472  C CB   . ILE A 1 48  ? 4.984   4.411   -2.842  1.00 0.00 ? 48  ILE A CB   3  
ATOM 4473  C CG1  . ILE A 1 48  ? 6.224   3.756   -2.230  1.00 0.00 ? 48  ILE A CG1  3  
ATOM 4474  C CG2  . ILE A 1 48  ? 4.330   3.481   -3.851  1.00 0.00 ? 48  ILE A CG2  3  
ATOM 4475  C CD1  . ILE A 1 48  ? 7.267   3.364   -3.254  1.00 0.00 ? 48  ILE A CD1  3  
ATOM 4476  H H    . ILE A 1 48  ? 5.797   6.841   -1.748  1.00 0.00 ? 48  ILE A H    3  
ATOM 4477  H HA   . ILE A 1 48  ? 5.946   5.537   -4.389  1.00 0.00 ? 48  ILE A HA   3  
ATOM 4478  H HB   . ILE A 1 48  ? 4.269   4.613   -2.058  1.00 0.00 ? 48  ILE A HB   3  
ATOM 4479  H HG12 . ILE A 1 48  ? 6.683   4.445   -1.537  1.00 0.00 ? 48  ILE A HG12 3  
ATOM 4480  H HG13 . ILE A 1 48  ? 5.927   2.863   -1.700  1.00 0.00 ? 48  ILE A HG13 3  
ATOM 4481  H HG21 . ILE A 1 48  ? 4.192   2.506   -3.407  1.00 0.00 ? 48  ILE A HG21 3  
ATOM 4482  H HG22 . ILE A 1 48  ? 4.962   3.394   -4.722  1.00 0.00 ? 48  ILE A HG22 3  
ATOM 4483  H HG23 . ILE A 1 48  ? 3.370   3.883   -4.142  1.00 0.00 ? 48  ILE A HG23 3  
ATOM 4484  H HD11 . ILE A 1 48  ? 7.459   4.199   -3.911  1.00 0.00 ? 48  ILE A HD11 3  
ATOM 4485  H HD12 . ILE A 1 48  ? 6.907   2.526   -3.832  1.00 0.00 ? 48  ILE A HD12 3  
ATOM 4486  H HD13 . ILE A 1 48  ? 8.180   3.086   -2.749  1.00 0.00 ? 48  ILE A HD13 3  
ATOM 4487  N N    . TYR A 1 49  ? 4.162   7.220   -5.019  1.00 0.00 ? 49  TYR A N    3  
ATOM 4488  C CA   . TYR A 1 49  ? 3.012   7.962   -5.525  1.00 0.00 ? 49  TYR A CA   3  
ATOM 4489  C C    . TYR A 1 49  ? 2.212   7.119   -6.513  1.00 0.00 ? 49  TYR A C    3  
ATOM 4490  O O    . TYR A 1 49  ? 2.505   5.942   -6.720  1.00 0.00 ? 49  TYR A O    3  
ATOM 4491  C CB   . TYR A 1 49  ? 3.472   9.257   -6.197  1.00 0.00 ? 49  TYR A CB   3  
ATOM 4492  C CG   . TYR A 1 49  ? 4.434   10.067  -5.358  1.00 0.00 ? 49  TYR A CG   3  
ATOM 4493  C CD1  . TYR A 1 49  ? 3.997   10.745  -4.227  1.00 0.00 ? 49  TYR A CD1  3  
ATOM 4494  C CD2  . TYR A 1 49  ? 5.779   10.153  -5.698  1.00 0.00 ? 49  TYR A CD2  3  
ATOM 4495  C CE1  . TYR A 1 49  ? 4.874   11.487  -3.458  1.00 0.00 ? 49  TYR A CE1  3  
ATOM 4496  C CE2  . TYR A 1 49  ? 6.661   10.893  -4.933  1.00 0.00 ? 49  TYR A CE2  3  
ATOM 4497  C CZ   . TYR A 1 49  ? 6.203   11.557  -3.815  1.00 0.00 ? 49  TYR A CZ   3  
ATOM 4498  O OH   . TYR A 1 49  ? 7.079   12.295  -3.051  1.00 0.00 ? 49  TYR A OH   3  
ATOM 4499  H H    . TYR A 1 49  ? 5.015   7.275   -5.499  1.00 0.00 ? 49  TYR A H    3  
ATOM 4500  H HA   . TYR A 1 49  ? 2.381   8.208   -4.684  1.00 0.00 ? 49  TYR A HA   3  
ATOM 4501  H HB2  . TYR A 1 49  ? 3.965   9.017   -7.128  1.00 0.00 ? 49  TYR A HB2  3  
ATOM 4502  H HB3  . TYR A 1 49  ? 2.608   9.873   -6.403  1.00 0.00 ? 49  TYR A HB3  3  
ATOM 4503  H HD1  . TYR A 1 49  ? 2.955   10.687  -3.950  1.00 0.00 ? 49  TYR A HD1  3  
ATOM 4504  H HD2  . TYR A 1 49  ? 6.132   9.632   -6.574  1.00 0.00 ? 49  TYR A HD2  3  
ATOM 4505  H HE1  . TYR A 1 49  ? 4.515   12.008  -2.582  1.00 0.00 ? 49  TYR A HE1  3  
ATOM 4506  H HE2  . TYR A 1 49  ? 7.702   10.948  -5.213  1.00 0.00 ? 49  TYR A HE2  3  
ATOM 4507  H HH   . TYR A 1 49  ? 6.919   12.119  -2.121  1.00 0.00 ? 49  TYR A HH   3  
ATOM 4508  N N    . ILE A 1 50  ? 1.198   7.730   -7.118  1.00 0.00 ? 50  ILE A N    3  
ATOM 4509  C CA   . ILE A 1 50  ? 0.354   7.037   -8.083  1.00 0.00 ? 50  ILE A CA   3  
ATOM 4510  C C    . ILE A 1 50  ? 0.170   7.869   -9.348  1.00 0.00 ? 50  ILE A C    3  
ATOM 4511  O O    . ILE A 1 50  ? -0.429  8.944   -9.315  1.00 0.00 ? 50  ILE A O    3  
ATOM 4512  C CB   . ILE A 1 50  ? -1.031  6.713   -7.490  1.00 0.00 ? 50  ILE A CB   3  
ATOM 4513  C CG1  . ILE A 1 50  ? -0.880  6.036   -6.127  1.00 0.00 ? 50  ILE A CG1  3  
ATOM 4514  C CG2  . ILE A 1 50  ? -1.822  5.829   -8.442  1.00 0.00 ? 50  ILE A CG2  3  
ATOM 4515  C CD1  . ILE A 1 50  ? -2.197  5.808   -5.416  1.00 0.00 ? 50  ILE A CD1  3  
ATOM 4516  H H    . ILE A 1 50  ? 1.014   8.670   -6.910  1.00 0.00 ? 50  ILE A H    3  
ATOM 4517  H HA   . ILE A 1 50  ? 0.839   6.107   -8.343  1.00 0.00 ? 50  ILE A HA   3  
ATOM 4518  H HB   . ILE A 1 50  ? -1.570  7.639   -7.365  1.00 0.00 ? 50  ILE A HB   3  
ATOM 4519  H HG12 . ILE A 1 50  ? -0.406  5.075   -6.259  1.00 0.00 ? 50  ILE A HG12 3  
ATOM 4520  H HG13 . ILE A 1 50  ? -0.262  6.653   -5.491  1.00 0.00 ? 50  ILE A HG13 3  
ATOM 4521  H HG21 . ILE A 1 50  ? -2.855  6.144   -8.452  1.00 0.00 ? 50  ILE A HG21 3  
ATOM 4522  H HG22 . ILE A 1 50  ? -1.763  4.802   -8.113  1.00 0.00 ? 50  ILE A HG22 3  
ATOM 4523  H HG23 . ILE A 1 50  ? -1.411  5.912   -9.437  1.00 0.00 ? 50  ILE A HG23 3  
ATOM 4524  H HD11 . ILE A 1 50  ? -2.173  6.291   -4.451  1.00 0.00 ? 50  ILE A HD11 3  
ATOM 4525  H HD12 . ILE A 1 50  ? -2.357  4.749   -5.286  1.00 0.00 ? 50  ILE A HD12 3  
ATOM 4526  H HD13 . ILE A 1 50  ? -3.001  6.223   -6.007  1.00 0.00 ? 50  ILE A HD13 3  
ATOM 4527  N N    . THR A 1 51  ? 0.687   7.363   -10.463 1.00 0.00 ? 51  THR A N    3  
ATOM 4528  C CA   . THR A 1 51  ? 0.578   8.060   -11.739 1.00 0.00 ? 51  THR A CA   3  
ATOM 4529  C C    . THR A 1 51  ? 0.117   7.107   -12.839 1.00 0.00 ? 51  THR A C    3  
ATOM 4530  O O    . THR A 1 51  ? 0.696   7.068   -13.925 1.00 0.00 ? 51  THR A O    3  
ATOM 4531  C CB   . THR A 1 51  ? 1.920   8.688   -12.117 1.00 0.00 ? 51  THR A CB   3  
ATOM 4532  O OG1  . THR A 1 51  ? 1.859   9.258   -13.413 1.00 0.00 ? 51  THR A OG1  3  
ATOM 4533  C CG2  . THR A 1 51  ? 3.069   7.703   -12.102 1.00 0.00 ? 51  THR A CG2  3  
ATOM 4534  H H    . THR A 1 51  ? 1.152   6.501   -10.427 1.00 0.00 ? 51  THR A H    3  
ATOM 4535  H HA   . THR A 1 51  ? -0.157  8.842   -11.627 1.00 0.00 ? 51  THR A HA   3  
ATOM 4536  H HB   . THR A 1 51  ? 2.149   9.474   -11.412 1.00 0.00 ? 51  THR A HB   3  
ATOM 4537  H HG1  . THR A 1 51  ? 1.306   10.041  -13.393 1.00 0.00 ? 51  THR A HG1  3  
ATOM 4538  H HG21 . THR A 1 51  ? 2.761   6.783   -12.576 1.00 0.00 ? 51  THR A HG21 3  
ATOM 4539  H HG22 . THR A 1 51  ? 3.357   7.504   -11.080 1.00 0.00 ? 51  THR A HG22 3  
ATOM 4540  H HG23 . THR A 1 51  ? 3.908   8.121   -12.637 1.00 0.00 ? 51  THR A HG23 3  
ATOM 4541  N N    . GLY A 1 52  ? -0.929  6.341   -12.549 1.00 0.00 ? 52  GLY A N    3  
ATOM 4542  C CA   . GLY A 1 52  ? -1.452  5.399   -13.521 1.00 0.00 ? 52  GLY A CA   3  
ATOM 4543  C C    . GLY A 1 52  ? -2.808  4.850   -13.125 1.00 0.00 ? 52  GLY A C    3  
ATOM 4544  O O    . GLY A 1 52  ? -3.018  4.467   -11.973 1.00 0.00 ? 52  GLY A O    3  
ATOM 4545  H H    . GLY A 1 52  ? -1.350  6.415   -11.668 1.00 0.00 ? 52  GLY A H    3  
ATOM 4546  H HA2  . GLY A 1 52  ? -1.542  5.896   -14.476 1.00 0.00 ? 52  GLY A HA2  3  
ATOM 4547  H HA3  . GLY A 1 52  ? -0.758  4.577   -13.619 1.00 0.00 ? 52  GLY A HA3  3  
ATOM 4548  N N    . VAL A 1 53  ? -3.732  4.813   -14.079 1.00 0.00 ? 53  VAL A N    3  
ATOM 4549  C CA   . VAL A 1 53  ? -5.076  4.309   -13.824 1.00 0.00 ? 53  VAL A CA   3  
ATOM 4550  C C    . VAL A 1 53  ? -5.613  3.545   -15.029 1.00 0.00 ? 53  VAL A C    3  
ATOM 4551  O O    . VAL A 1 53  ? -6.145  4.140   -15.967 1.00 0.00 ? 53  VAL A O    3  
ATOM 4552  C CB   . VAL A 1 53  ? -6.048  5.452   -13.478 1.00 0.00 ? 53  VAL A CB   3  
ATOM 4553  C CG1  . VAL A 1 53  ? -7.388  4.895   -13.024 1.00 0.00 ? 53  VAL A CG1  3  
ATOM 4554  C CG2  . VAL A 1 53  ? -5.448  6.357   -12.414 1.00 0.00 ? 53  VAL A CG2  3  
ATOM 4555  H H    . VAL A 1 53  ? -3.504  5.133   -14.977 1.00 0.00 ? 53  VAL A H    3  
ATOM 4556  H HA   . VAL A 1 53  ? -5.025  3.638   -12.978 1.00 0.00 ? 53  VAL A HA   3  
ATOM 4557  H HB   . VAL A 1 53  ? -6.212  6.039   -14.370 1.00 0.00 ? 53  VAL A HB   3  
ATOM 4558  H HG11 . VAL A 1 53  ? -7.227  4.003   -12.437 1.00 0.00 ? 53  VAL A HG11 3  
ATOM 4559  H HG12 . VAL A 1 53  ? -7.990  4.655   -13.887 1.00 0.00 ? 53  VAL A HG12 3  
ATOM 4560  H HG13 . VAL A 1 53  ? -7.898  5.634   -12.423 1.00 0.00 ? 53  VAL A HG13 3  
ATOM 4561  H HG21 . VAL A 1 53  ? -4.464  6.676   -12.724 1.00 0.00 ? 53  VAL A HG21 3  
ATOM 4562  H HG22 . VAL A 1 53  ? -5.375  5.818   -11.481 1.00 0.00 ? 53  VAL A HG22 3  
ATOM 4563  H HG23 . VAL A 1 53  ? -6.081  7.223   -12.279 1.00 0.00 ? 53  VAL A HG23 3  
ATOM 4564  N N    . ASP A 1 54  ? -5.470  2.224   -15.000 1.00 0.00 ? 54  ASP A N    3  
ATOM 4565  C CA   . ASP A 1 54  ? -5.940  1.378   -16.090 1.00 0.00 ? 54  ASP A CA   3  
ATOM 4566  C C    . ASP A 1 54  ? -7.456  1.479   -16.245 1.00 0.00 ? 54  ASP A C    3  
ATOM 4567  O O    . ASP A 1 54  ? -8.176  1.677   -15.268 1.00 0.00 ? 54  ASP A O    3  
ATOM 4568  C CB   . ASP A 1 54  ? -5.536  -0.077  -15.844 1.00 0.00 ? 54  ASP A CB   3  
ATOM 4569  C CG   . ASP A 1 54  ? -4.218  -0.432  -16.504 1.00 0.00 ? 54  ASP A CG   3  
ATOM 4570  O OD1  . ASP A 1 54  ? -4.225  -0.742  -17.714 1.00 0.00 ? 54  ASP A OD1  3  
ATOM 4571  O OD2  . ASP A 1 54  ? -3.180  -0.399  -15.811 1.00 0.00 ? 54  ASP A OD2  3  
ATOM 4572  H H    . ASP A 1 54  ? -5.037  1.808   -14.225 1.00 0.00 ? 54  ASP A H    3  
ATOM 4573  H HA   . ASP A 1 54  ? -5.473  1.722   -17.001 1.00 0.00 ? 54  ASP A HA   3  
ATOM 4574  H HB2  . ASP A 1 54  ? -5.441  -0.243  -14.781 1.00 0.00 ? 54  ASP A HB2  3  
ATOM 4575  H HB3  . ASP A 1 54  ? -6.302  -0.729  -16.238 1.00 0.00 ? 54  ASP A HB3  3  
ATOM 4576  N N    . PRO A 1 55  ? -7.960  1.341   -17.485 1.00 0.00 ? 55  PRO A N    3  
ATOM 4577  C CA   . PRO A 1 55  ? -9.398  1.416   -17.764 1.00 0.00 ? 55  PRO A CA   3  
ATOM 4578  C C    . PRO A 1 55  ? -10.152 0.196   -17.246 1.00 0.00 ? 55  PRO A C    3  
ATOM 4579  O O    . PRO A 1 55  ? -9.852  -0.937  -17.622 1.00 0.00 ? 55  PRO A O    3  
ATOM 4580  C CB   . PRO A 1 55  ? -9.459  1.474   -19.291 1.00 0.00 ? 55  PRO A CB   3  
ATOM 4581  C CG   . PRO A 1 55  ? -8.216  0.791   -19.745 1.00 0.00 ? 55  PRO A CG   3  
ATOM 4582  C CD   . PRO A 1 55  ? -7.171  1.099   -18.708 1.00 0.00 ? 55  PRO A CD   3  
ATOM 4583  H HA   . PRO A 1 55  ? -9.835  2.312   -17.347 1.00 0.00 ? 55  PRO A HA   3  
ATOM 4584  H HB2  . PRO A 1 55  ? -10.344 0.960   -19.639 1.00 0.00 ? 55  PRO A HB2  3  
ATOM 4585  H HB3  . PRO A 1 55  ? -9.482  2.504   -19.615 1.00 0.00 ? 55  PRO A HB3  3  
ATOM 4586  H HG2  . PRO A 1 55  ? -8.384  -0.275  -19.802 1.00 0.00 ? 55  PRO A HG2  3  
ATOM 4587  H HG3  . PRO A 1 55  ? -7.915  1.177   -20.707 1.00 0.00 ? 55  PRO A HG3  3  
ATOM 4588  H HD2  . PRO A 1 55  ? -6.508  0.258   -18.578 1.00 0.00 ? 55  PRO A HD2  3  
ATOM 4589  H HD3  . PRO A 1 55  ? -6.613  1.982   -18.985 1.00 0.00 ? 55  PRO A HD3  3  
ATOM 4590  N N    . GLY A 1 56  ? -11.132 0.436   -16.382 1.00 0.00 ? 56  GLY A N    3  
ATOM 4591  C CA   . GLY A 1 56  ? -11.914 -0.654  -15.827 1.00 0.00 ? 56  GLY A CA   3  
ATOM 4592  C C    . GLY A 1 56  ? -11.171 -1.406  -14.741 1.00 0.00 ? 56  GLY A C    3  
ATOM 4593  O O    . GLY A 1 56  ? -11.329 -2.618  -14.597 1.00 0.00 ? 56  GLY A O    3  
ATOM 4594  H H    . GLY A 1 56  ? -11.326 1.359   -16.118 1.00 0.00 ? 56  GLY A H    3  
ATOM 4595  H HA2  . GLY A 1 56  ? -12.827 -0.253  -15.412 1.00 0.00 ? 56  GLY A HA2  3  
ATOM 4596  H HA3  . GLY A 1 56  ? -12.164 -1.343  -16.620 1.00 0.00 ? 56  GLY A HA3  3  
ATOM 4597  N N    . SER A 1 57  ? -10.360 -0.685  -13.974 1.00 0.00 ? 57  SER A N    3  
ATOM 4598  C CA   . SER A 1 57  ? -9.589  -1.292  -12.895 1.00 0.00 ? 57  SER A CA   3  
ATOM 4599  C C    . SER A 1 57  ? -10.316 -1.152  -11.562 1.00 0.00 ? 57  SER A C    3  
ATOM 4600  O O    . SER A 1 57  ? -11.215 -0.324  -11.418 1.00 0.00 ? 57  SER A O    3  
ATOM 4601  C CB   . SER A 1 57  ? -8.204  -0.648  -12.804 1.00 0.00 ? 57  SER A CB   3  
ATOM 4602  O OG   . SER A 1 57  ? -8.260  0.582   -12.102 1.00 0.00 ? 57  SER A OG   3  
ATOM 4603  H H    . SER A 1 57  ? -10.277 0.277   -14.138 1.00 0.00 ? 57  SER A H    3  
ATOM 4604  H HA   . SER A 1 57  ? -9.473  -2.342  -13.120 1.00 0.00 ? 57  SER A HA   3  
ATOM 4605  H HB2  . SER A 1 57  ? -7.532  -1.316  -12.282 1.00 0.00 ? 57  SER A HB2  3  
ATOM 4606  H HB3  . SER A 1 57  ? -7.830  -0.463  -13.802 1.00 0.00 ? 57  SER A HB3  3  
ATOM 4607  H HG   . SER A 1 57  ? -8.415  1.298   -12.722 1.00 0.00 ? 57  SER A HG   3  
ATOM 4608  N N    . GLU A 1 58  ? -9.922  -1.968  -10.590 1.00 0.00 ? 58  GLU A N    3  
ATOM 4609  C CA   . GLU A 1 58  ? -10.536 -1.934  -9.268  1.00 0.00 ? 58  GLU A CA   3  
ATOM 4610  C C    . GLU A 1 58  ? -10.188 -0.640  -8.539  1.00 0.00 ? 58  GLU A C    3  
ATOM 4611  O O    . GLU A 1 58  ? -10.981 -0.130  -7.748  1.00 0.00 ? 58  GLU A O    3  
ATOM 4612  C CB   . GLU A 1 58  ? -10.081 -3.138  -8.440  1.00 0.00 ? 58  GLU A CB   3  
ATOM 4613  C CG   . GLU A 1 58  ? -10.890 -4.397  -8.702  1.00 0.00 ? 58  GLU A CG   3  
ATOM 4614  C CD   . GLU A 1 58  ? -12.267 -4.347  -8.071  1.00 0.00 ? 58  GLU A CD   3  
ATOM 4615  O OE1  . GLU A 1 58  ? -12.864 -3.250  -8.036  1.00 0.00 ? 58  GLU A OE1  3  
ATOM 4616  O OE2  . GLU A 1 58  ? -12.750 -5.404  -7.613  1.00 0.00 ? 58  GLU A OE2  3  
ATOM 4617  H H    . GLU A 1 58  ? -9.200  -2.608  -10.765 1.00 0.00 ? 58  GLU A H    3  
ATOM 4618  H HA   . GLU A 1 58  ? -11.607 -1.984  -9.398  1.00 0.00 ? 58  GLU A HA   3  
ATOM 4619  H HB2  . GLU A 1 58  ? -9.046  -3.347  -8.668  1.00 0.00 ? 58  GLU A HB2  3  
ATOM 4620  H HB3  . GLU A 1 58  ? -10.167 -2.893  -7.391  1.00 0.00 ? 58  GLU A HB3  3  
ATOM 4621  H HG2  . GLU A 1 58  ? -11.004 -4.521  -9.769  1.00 0.00 ? 58  GLU A HG2  3  
ATOM 4622  H HG3  . GLU A 1 58  ? -10.355 -5.244  -8.296  1.00 0.00 ? 58  GLU A HG3  3  
ATOM 4623  N N    . ALA A 1 59  ? -8.999  -0.114  -8.812  1.00 0.00 ? 59  ALA A N    3  
ATOM 4624  C CA   . ALA A 1 59  ? -8.546  1.120   -8.184  1.00 0.00 ? 59  ALA A CA   3  
ATOM 4625  C C    . ALA A 1 59  ? -9.334  2.320   -8.701  1.00 0.00 ? 59  ALA A C    3  
ATOM 4626  O O    . ALA A 1 59  ? -9.659  3.234   -7.944  1.00 0.00 ? 59  ALA A O    3  
ATOM 4627  C CB   . ALA A 1 59  ? -7.058  1.321   -8.425  1.00 0.00 ? 59  ALA A CB   3  
ATOM 4628  H H    . ALA A 1 59  ? -8.412  -0.568  -9.453  1.00 0.00 ? 59  ALA A H    3  
ATOM 4629  H HA   . ALA A 1 59  ? -8.705  1.030   -7.119  1.00 0.00 ? 59  ALA A HA   3  
ATOM 4630  H HB1  . ALA A 1 59  ? -6.841  1.181   -9.474  1.00 0.00 ? 59  ALA A HB1  3  
ATOM 4631  H HB2  . ALA A 1 59  ? -6.499  0.602   -7.844  1.00 0.00 ? 59  ALA A HB2  3  
ATOM 4632  H HB3  . ALA A 1 59  ? -6.776  2.320   -8.129  1.00 0.00 ? 59  ALA A HB3  3  
ATOM 4633  N N    . GLU A 1 60  ? -9.636  2.309   -9.995  1.00 0.00 ? 60  GLU A N    3  
ATOM 4634  C CA   . GLU A 1 60  ? -10.385 3.396   -10.615 1.00 0.00 ? 60  GLU A CA   3  
ATOM 4635  C C    . GLU A 1 60  ? -11.832 3.403   -10.133 1.00 0.00 ? 60  GLU A C    3  
ATOM 4636  O O    . GLU A 1 60  ? -12.459 4.458   -10.035 1.00 0.00 ? 60  GLU A O    3  
ATOM 4637  C CB   . GLU A 1 60  ? -10.344 3.267   -12.137 1.00 0.00 ? 60  GLU A CB   3  
ATOM 4638  C CG   . GLU A 1 60  ? -10.824 4.511   -12.867 1.00 0.00 ? 60  GLU A CG   3  
ATOM 4639  C CD   . GLU A 1 60  ? -11.034 4.274   -14.350 1.00 0.00 ? 60  GLU A CD   3  
ATOM 4640  O OE1  . GLU A 1 60  ? -10.198 3.577   -14.962 1.00 0.00 ? 60  GLU A OE1  3  
ATOM 4641  O OE2  . GLU A 1 60  ? -12.033 4.785   -14.897 1.00 0.00 ? 60  GLU A OE2  3  
ATOM 4642  H H    . GLU A 1 60  ? -9.348  1.552   -10.547 1.00 0.00 ? 60  GLU A H    3  
ATOM 4643  H HA   . GLU A 1 60  ? -9.918  4.325   -10.328 1.00 0.00 ? 60  GLU A HA   3  
ATOM 4644  H HB2  . GLU A 1 60  ? -9.329  3.066   -12.444 1.00 0.00 ? 60  GLU A HB2  3  
ATOM 4645  H HB3  . GLU A 1 60  ? -10.971 2.438   -12.435 1.00 0.00 ? 60  GLU A HB3  3  
ATOM 4646  H HG2  . GLU A 1 60  ? -11.760 4.828   -12.433 1.00 0.00 ? 60  GLU A HG2  3  
ATOM 4647  H HG3  . GLU A 1 60  ? -10.087 5.292   -12.743 1.00 0.00 ? 60  GLU A HG3  3  
ATOM 4648  N N    . GLY A 1 61  ? -12.357 2.220   -9.832  1.00 0.00 ? 61  GLY A N    3  
ATOM 4649  C CA   . GLY A 1 61  ? -13.727 2.113   -9.364  1.00 0.00 ? 61  GLY A CA   3  
ATOM 4650  C C    . GLY A 1 61  ? -13.893 2.600   -7.937  1.00 0.00 ? 61  GLY A C    3  
ATOM 4651  O O    . GLY A 1 61  ? -14.907 3.209   -7.597  1.00 0.00 ? 61  GLY A O    3  
ATOM 4652  H H    . GLY A 1 61  ? -11.810 1.412   -9.929  1.00 0.00 ? 61  GLY A H    3  
ATOM 4653  H HA2  . GLY A 1 61  ? -14.362 2.700   -10.009 1.00 0.00 ? 61  GLY A HA2  3  
ATOM 4654  H HA3  . GLY A 1 61  ? -14.034 1.079   -9.417  1.00 0.00 ? 61  GLY A HA3  3  
ATOM 4655  N N    . SER A 1 62  ? -12.895 2.329   -7.102  1.00 0.00 ? 62  SER A N    3  
ATOM 4656  C CA   . SER A 1 62  ? -12.937 2.744   -5.704  1.00 0.00 ? 62  SER A CA   3  
ATOM 4657  C C    . SER A 1 62  ? -12.800 4.258   -5.581  1.00 0.00 ? 62  SER A C    3  
ATOM 4658  O O    . SER A 1 62  ? -13.748 4.950   -5.208  1.00 0.00 ? 62  SER A O    3  
ATOM 4659  C CB   . SER A 1 62  ? -11.825 2.053   -4.912  1.00 0.00 ? 62  SER A CB   3  
ATOM 4660  O OG   . SER A 1 62  ? -12.276 1.671   -3.624  1.00 0.00 ? 62  SER A OG   3  
ATOM 4661  H H    . SER A 1 62  ? -12.114 1.840   -7.432  1.00 0.00 ? 62  SER A H    3  
ATOM 4662  H HA   . SER A 1 62  ? -13.893 2.447   -5.298  1.00 0.00 ? 62  SER A HA   3  
ATOM 4663  H HB2  . SER A 1 62  ? -11.503 1.171   -5.443  1.00 0.00 ? 62  SER A HB2  3  
ATOM 4664  H HB3  . SER A 1 62  ? -10.990 2.730   -4.802  1.00 0.00 ? 62  SER A HB3  3  
ATOM 4665  H HG   . SER A 1 62  ? -11.663 1.038   -3.245  1.00 0.00 ? 62  SER A HG   3  
ATOM 4666  N N    . GLY A 1 63  ? -11.613 4.767   -5.896  1.00 0.00 ? 63  GLY A N    3  
ATOM 4667  C CA   . GLY A 1 63  ? -11.374 6.196   -5.815  1.00 0.00 ? 63  GLY A CA   3  
ATOM 4668  C C    . GLY A 1 63  ? -9.899  6.533   -5.716  1.00 0.00 ? 63  GLY A C    3  
ATOM 4669  O O    . GLY A 1 63  ? -9.500  7.374   -4.911  1.00 0.00 ? 63  GLY A O    3  
ATOM 4670  H H    . GLY A 1 63  ? -10.894 4.168   -6.187  1.00 0.00 ? 63  GLY A H    3  
ATOM 4671  H HA2  . GLY A 1 63  ? -11.782 6.670   -6.696  1.00 0.00 ? 63  GLY A HA2  3  
ATOM 4672  H HA3  . GLY A 1 63  ? -11.880 6.586   -4.943  1.00 0.00 ? 63  GLY A HA3  3  
ATOM 4673  N N    . LEU A 1 64  ? -9.088  5.873   -6.536  1.00 0.00 ? 64  LEU A N    3  
ATOM 4674  C CA   . LEU A 1 64  ? -7.647  6.105   -6.538  1.00 0.00 ? 64  LEU A CA   3  
ATOM 4675  C C    . LEU A 1 64  ? -7.214  6.828   -7.809  1.00 0.00 ? 64  LEU A C    3  
ATOM 4676  O O    . LEU A 1 64  ? -7.089  6.217   -8.870  1.00 0.00 ? 64  LEU A O    3  
ATOM 4677  C CB   . LEU A 1 64  ? -6.898  4.778   -6.412  1.00 0.00 ? 64  LEU A CB   3  
ATOM 4678  C CG   . LEU A 1 64  ? -6.955  4.130   -5.027  1.00 0.00 ? 64  LEU A CG   3  
ATOM 4679  C CD1  . LEU A 1 64  ? -6.539  2.670   -5.105  1.00 0.00 ? 64  LEU A CD1  3  
ATOM 4680  C CD2  . LEU A 1 64  ? -6.072  4.887   -4.048  1.00 0.00 ? 64  LEU A CD2  3  
ATOM 4681  H H    . LEU A 1 64  ? -9.466  5.214   -7.155  1.00 0.00 ? 64  LEU A H    3  
ATOM 4682  H HA   . LEU A 1 64  ? -7.411  6.725   -5.686  1.00 0.00 ? 64  LEU A HA   3  
ATOM 4683  H HB2  . LEU A 1 64  ? -7.312  4.085   -7.129  1.00 0.00 ? 64  LEU A HB2  3  
ATOM 4684  H HB3  . LEU A 1 64  ? -5.860  4.950   -6.660  1.00 0.00 ? 64  LEU A HB3  3  
ATOM 4685  H HG   . LEU A 1 64  ? -7.972  4.168   -4.662  1.00 0.00 ? 64  LEU A HG   3  
ATOM 4686  H HD11 . LEU A 1 64  ? -5.496  2.578   -4.841  1.00 0.00 ? 64  LEU A HD11 3  
ATOM 4687  H HD12 . LEU A 1 64  ? -6.689  2.305   -6.110  1.00 0.00 ? 64  LEU A HD12 3  
ATOM 4688  H HD13 . LEU A 1 64  ? -7.137  2.088   -4.418  1.00 0.00 ? 64  LEU A HD13 3  
ATOM 4689  H HD21 . LEU A 1 64  ? -6.242  4.516   -3.048  1.00 0.00 ? 64  LEU A HD21 3  
ATOM 4690  H HD22 . LEU A 1 64  ? -6.312  5.940   -4.087  1.00 0.00 ? 64  LEU A HD22 3  
ATOM 4691  H HD23 . LEU A 1 64  ? -5.035  4.745   -4.314  1.00 0.00 ? 64  LEU A HD23 3  
ATOM 4692  N N    . LYS A 1 65  ? -6.988  8.133   -7.693  1.00 0.00 ? 65  LYS A N    3  
ATOM 4693  C CA   . LYS A 1 65  ? -6.569  8.940   -8.834  1.00 0.00 ? 65  LYS A CA   3  
ATOM 4694  C C    . LYS A 1 65  ? -5.055  9.123   -8.844  1.00 0.00 ? 65  LYS A C    3  
ATOM 4695  O O    . LYS A 1 65  ? -4.342  8.513   -8.047  1.00 0.00 ? 65  LYS A O    3  
ATOM 4696  C CB   . LYS A 1 65  ? -7.259  10.305  -8.802  1.00 0.00 ? 65  LYS A CB   3  
ATOM 4697  C CG   . LYS A 1 65  ? -8.768  10.218  -8.642  1.00 0.00 ? 65  LYS A CG   3  
ATOM 4698  C CD   . LYS A 1 65  ? -9.454  9.953   -9.972  1.00 0.00 ? 65  LYS A CD   3  
ATOM 4699  C CE   . LYS A 1 65  ? -10.751 10.737  -10.097 1.00 0.00 ? 65  LYS A CE   3  
ATOM 4700  N NZ   . LYS A 1 65  ? -11.946 9.870   -9.900  1.00 0.00 ? 65  LYS A NZ   3  
ATOM 4701  H H    . LYS A 1 65  ? -7.106  8.564   -6.821  1.00 0.00 ? 65  LYS A H    3  
ATOM 4702  H HA   . LYS A 1 65  ? -6.862  8.419   -9.734  1.00 0.00 ? 65  LYS A HA   3  
ATOM 4703  H HB2  . LYS A 1 65  ? -6.862  10.875  -7.975  1.00 0.00 ? 65  LYS A HB2  3  
ATOM 4704  H HB3  . LYS A 1 65  ? -7.045  10.825  -9.723  1.00 0.00 ? 65  LYS A HB3  3  
ATOM 4705  H HG2  . LYS A 1 65  ? -9.003  9.415   -7.960  1.00 0.00 ? 65  LYS A HG2  3  
ATOM 4706  H HG3  . LYS A 1 65  ? -9.131  11.154  -8.239  1.00 0.00 ? 65  LYS A HG3  3  
ATOM 4707  H HD2  . LYS A 1 65  ? -8.792  10.244  -10.773 1.00 0.00 ? 65  LYS A HD2  3  
ATOM 4708  H HD3  . LYS A 1 65  ? -9.673  8.897   -10.048 1.00 0.00 ? 65  LYS A HD3  3  
ATOM 4709  H HE2  . LYS A 1 65  ? -10.759 11.519  -9.352  1.00 0.00 ? 65  LYS A HE2  3  
ATOM 4710  H HE3  . LYS A 1 65  ? -10.796 11.179  -11.082 1.00 0.00 ? 65  LYS A HE3  3  
ATOM 4711  H HZ1  . LYS A 1 65  ? -12.320 9.561   -10.821 1.00 0.00 ? 65  LYS A HZ1  3  
ATOM 4712  H HZ2  . LYS A 1 65  ? -12.689 10.394  -9.395  1.00 0.00 ? 65  LYS A HZ2  3  
ATOM 4713  H HZ3  . LYS A 1 65  ? -11.690 9.030   -9.342  1.00 0.00 ? 65  LYS A HZ3  3  
ATOM 4714  N N    . VAL A 1 66  ? -4.571  9.965   -9.750  1.00 0.00 ? 66  VAL A N    3  
ATOM 4715  C CA   . VAL A 1 66  ? -3.141  10.227  -9.863  1.00 0.00 ? 66  VAL A CA   3  
ATOM 4716  C C    . VAL A 1 66  ? -2.701  11.307  -8.880  1.00 0.00 ? 66  VAL A C    3  
ATOM 4717  O O    . VAL A 1 66  ? -3.459  12.227  -8.573  1.00 0.00 ? 66  VAL A O    3  
ATOM 4718  C CB   . VAL A 1 66  ? -2.761  10.665  -11.289 1.00 0.00 ? 66  VAL A CB   3  
ATOM 4719  C CG1  . VAL A 1 66  ? -2.851  9.490   -12.251 1.00 0.00 ? 66  VAL A CG1  3  
ATOM 4720  C CG2  . VAL A 1 66  ? -3.649  11.810  -11.752 1.00 0.00 ? 66  VAL A CG2  3  
ATOM 4721  H H    . VAL A 1 66  ? -5.190  10.420  -10.358 1.00 0.00 ? 66  VAL A H    3  
ATOM 4722  H HA   . VAL A 1 66  ? -2.616  9.311   -9.637  1.00 0.00 ? 66  VAL A HA   3  
ATOM 4723  H HB   . VAL A 1 66  ? -1.738  11.013  -11.277 1.00 0.00 ? 66  VAL A HB   3  
ATOM 4724  H HG11 . VAL A 1 66  ? -2.605  9.822   -13.249 1.00 0.00 ? 66  VAL A HG11 3  
ATOM 4725  H HG12 . VAL A 1 66  ? -3.854  9.092   -12.241 1.00 0.00 ? 66  VAL A HG12 3  
ATOM 4726  H HG13 . VAL A 1 66  ? -2.155  8.722   -11.946 1.00 0.00 ? 66  VAL A HG13 3  
ATOM 4727  H HG21 . VAL A 1 66  ? -3.061  12.513  -12.324 1.00 0.00 ? 66  VAL A HG21 3  
ATOM 4728  H HG22 . VAL A 1 66  ? -4.069  12.309  -10.892 1.00 0.00 ? 66  VAL A HG22 3  
ATOM 4729  H HG23 . VAL A 1 66  ? -4.446  11.422  -12.369 1.00 0.00 ? 66  VAL A HG23 3  
ATOM 4730  N N    . GLY A 1 67  ? -1.472  11.187  -8.388  1.00 0.00 ? 67  GLY A N    3  
ATOM 4731  C CA   . GLY A 1 67  ? -0.953  12.159  -7.444  1.00 0.00 ? 67  GLY A CA   3  
ATOM 4732  C C    . GLY A 1 67  ? -1.045  11.679  -6.008  1.00 0.00 ? 67  GLY A C    3  
ATOM 4733  O O    . GLY A 1 67  ? -0.234  12.063  -5.166  1.00 0.00 ? 67  GLY A O    3  
ATOM 4734  H H    . GLY A 1 67  ? -0.914  10.432  -8.670  1.00 0.00 ? 67  GLY A H    3  
ATOM 4735  H HA2  . GLY A 1 67  ? 0.086   12.353  -7.681  1.00 0.00 ? 67  GLY A HA2  3  
ATOM 4736  H HA3  . GLY A 1 67  ? -1.516  13.077  -7.543  1.00 0.00 ? 67  GLY A HA3  3  
ATOM 4737  N N    . ASP A 1 68  ? -2.037  10.838  -5.731  1.00 0.00 ? 68  ASP A N    3  
ATOM 4738  C CA   . ASP A 1 68  ? -2.236  10.304  -4.387  1.00 0.00 ? 68  ASP A CA   3  
ATOM 4739  C C    . ASP A 1 68  ? -0.974  9.611   -3.880  1.00 0.00 ? 68  ASP A C    3  
ATOM 4740  O O    . ASP A 1 68  ? -0.504  8.641   -4.476  1.00 0.00 ? 68  ASP A O    3  
ATOM 4741  C CB   . ASP A 1 68  ? -3.410  9.324   -4.374  1.00 0.00 ? 68  ASP A CB   3  
ATOM 4742  C CG   . ASP A 1 68  ? -4.726  10.004  -4.052  1.00 0.00 ? 68  ASP A CG   3  
ATOM 4743  O OD1  . ASP A 1 68  ? -4.854  10.554  -2.939  1.00 0.00 ? 68  ASP A OD1  3  
ATOM 4744  O OD2  . ASP A 1 68  ? -5.630  9.987   -4.915  1.00 0.00 ? 68  ASP A OD2  3  
ATOM 4745  H H    . ASP A 1 68  ? -2.650  10.570  -6.447  1.00 0.00 ? 68  ASP A H    3  
ATOM 4746  H HA   . ASP A 1 68  ? -2.464  11.132  -3.733  1.00 0.00 ? 68  ASP A HA   3  
ATOM 4747  H HB2  . ASP A 1 68  ? -3.495  8.861   -5.348  1.00 0.00 ? 68  ASP A HB2  3  
ATOM 4748  H HB3  . ASP A 1 68  ? -3.227  8.562   -3.628  1.00 0.00 ? 68  ASP A HB3  3  
ATOM 4749  N N    . GLN A 1 69  ? -0.432  10.116  -2.777  1.00 0.00 ? 69  GLN A N    3  
ATOM 4750  C CA   . GLN A 1 69  ? 0.775   9.547   -2.189  1.00 0.00 ? 69  GLN A CA   3  
ATOM 4751  C C    . GLN A 1 69  ? 0.428   8.449   -1.190  1.00 0.00 ? 69  GLN A C    3  
ATOM 4752  O O    . GLN A 1 69  ? -0.165  8.712   -0.144  1.00 0.00 ? 69  GLN A O    3  
ATOM 4753  C CB   . GLN A 1 69  ? 1.593   10.641  -1.498  1.00 0.00 ? 69  GLN A CB   3  
ATOM 4754  C CG   . GLN A 1 69  ? 2.891   10.137  -0.888  1.00 0.00 ? 69  GLN A CG   3  
ATOM 4755  C CD   . GLN A 1 69  ? 3.744   11.256  -0.327  1.00 0.00 ? 69  GLN A CD   3  
ATOM 4756  O OE1  . GLN A 1 69  ? 3.234   12.309  0.058   1.00 0.00 ? 69  GLN A OE1  3  
ATOM 4757  N NE2  . GLN A 1 69  ? 5.053   11.036  -0.277  1.00 0.00 ? 69  GLN A NE2  3  
ATOM 4758  H H    . GLN A 1 69  ? -0.853  10.890  -2.348  1.00 0.00 ? 69  GLN A H    3  
ATOM 4759  H HA   . GLN A 1 69  ? 1.363   9.119   -2.987  1.00 0.00 ? 69  GLN A HA   3  
ATOM 4760  H HB2  . GLN A 1 69  ? 1.835   11.404  -2.222  1.00 0.00 ? 69  GLN A HB2  3  
ATOM 4761  H HB3  . GLN A 1 69  ? 0.996   11.078  -0.712  1.00 0.00 ? 69  GLN A HB3  3  
ATOM 4762  H HG2  . GLN A 1 69  ? 2.655   9.450   -0.089  1.00 0.00 ? 69  GLN A HG2  3  
ATOM 4763  H HG3  . GLN A 1 69  ? 3.456   9.620   -1.651  1.00 0.00 ? 69  GLN A HG3  3  
ATOM 4764  H HE21 . GLN A 1 69  ? 5.389   10.174  -0.600  1.00 0.00 ? 69  GLN A HE21 3  
ATOM 4765  H HE22 . GLN A 1 69  ? 5.628   11.743  0.083   1.00 0.00 ? 69  GLN A HE22 3  
ATOM 4766  N N    . ILE A 1 70  ? 0.802   7.216   -1.518  1.00 0.00 ? 70  ILE A N    3  
ATOM 4767  C CA   . ILE A 1 70  ? 0.531   6.078   -0.649  1.00 0.00 ? 70  ILE A CA   3  
ATOM 4768  C C    . ILE A 1 70  ? 1.441   6.093   0.574   1.00 0.00 ? 70  ILE A C    3  
ATOM 4769  O O    . ILE A 1 70  ? 2.656   5.932   0.458   1.00 0.00 ? 70  ILE A O    3  
ATOM 4770  C CB   . ILE A 1 70  ? 0.715   4.743   -1.395  1.00 0.00 ? 70  ILE A CB   3  
ATOM 4771  C CG1  . ILE A 1 70  ? -0.055  4.760   -2.717  1.00 0.00 ? 70  ILE A CG1  3  
ATOM 4772  C CG2  . ILE A 1 70  ? 0.256   3.581   -0.526  1.00 0.00 ? 70  ILE A CG2  3  
ATOM 4773  C CD1  . ILE A 1 70  ? 0.242   3.570   -3.605  1.00 0.00 ? 70  ILE A CD1  3  
ATOM 4774  H H    . ILE A 1 70  ? 1.272   7.070   -2.365  1.00 0.00 ? 70  ILE A H    3  
ATOM 4775  H HA   . ILE A 1 70  ? -0.497  6.146   -0.321  1.00 0.00 ? 70  ILE A HA   3  
ATOM 4776  H HB   . ILE A 1 70  ? 1.767   4.612   -1.601  1.00 0.00 ? 70  ILE A HB   3  
ATOM 4777  H HG12 . ILE A 1 70  ? -1.114  4.762   -2.510  1.00 0.00 ? 70  ILE A HG12 3  
ATOM 4778  H HG13 . ILE A 1 70  ? 0.203   5.655   -3.264  1.00 0.00 ? 70  ILE A HG13 3  
ATOM 4779  H HG21 . ILE A 1 70  ? -0.781  3.719   -0.257  1.00 0.00 ? 70  ILE A HG21 3  
ATOM 4780  H HG22 . ILE A 1 70  ? 0.858   3.543   0.370   1.00 0.00 ? 70  ILE A HG22 3  
ATOM 4781  H HG23 . ILE A 1 70  ? 0.366   2.656   -1.073  1.00 0.00 ? 70  ILE A HG23 3  
ATOM 4782  H HD11 . ILE A 1 70  ? 0.787   2.828   -3.041  1.00 0.00 ? 70  ILE A HD11 3  
ATOM 4783  H HD12 . ILE A 1 70  ? 0.836   3.890   -4.448  1.00 0.00 ? 70  ILE A HD12 3  
ATOM 4784  H HD13 . ILE A 1 70  ? -0.686  3.146   -3.958  1.00 0.00 ? 70  ILE A HD13 3  
ATOM 4785  N N    . LEU A 1 71  ? 0.845   6.285   1.747   1.00 0.00 ? 71  LEU A N    3  
ATOM 4786  C CA   . LEU A 1 71  ? 1.604   6.321   2.992   1.00 0.00 ? 71  LEU A CA   3  
ATOM 4787  C C    . LEU A 1 71  ? 1.848   4.911   3.519   1.00 0.00 ? 71  LEU A C    3  
ATOM 4788  O O    . LEU A 1 71  ? 2.933   4.601   4.014   1.00 0.00 ? 71  LEU A O    3  
ATOM 4789  C CB   . LEU A 1 71  ? 0.861   7.149   4.042   1.00 0.00 ? 71  LEU A CB   3  
ATOM 4790  C CG   . LEU A 1 71  ? 0.540   8.585   3.626   1.00 0.00 ? 71  LEU A CG   3  
ATOM 4791  C CD1  . LEU A 1 71  ? -0.564  9.160   4.500   1.00 0.00 ? 71  LEU A CD1  3  
ATOM 4792  C CD2  . LEU A 1 71  ? 1.788   9.453   3.701   1.00 0.00 ? 71  LEU A CD2  3  
ATOM 4793  H H    . LEU A 1 71  ? -0.126  6.408   1.775   1.00 0.00 ? 71  LEU A H    3  
ATOM 4794  H HA   . LEU A 1 71  ? 2.556   6.786   2.787   1.00 0.00 ? 71  LEU A HA   3  
ATOM 4795  H HB2  . LEU A 1 71  ? -0.067  6.647   4.275   1.00 0.00 ? 71  LEU A HB2  3  
ATOM 4796  H HB3  . LEU A 1 71  ? 1.466   7.184   4.935   1.00 0.00 ? 71  LEU A HB3  3  
ATOM 4797  H HG   . LEU A 1 71  ? 0.190   8.587   2.604   1.00 0.00 ? 71  LEU A HG   3  
ATOM 4798  H HD11 . LEU A 1 71  ? -0.358  8.933   5.536   1.00 0.00 ? 71  LEU A HD11 3  
ATOM 4799  H HD12 . LEU A 1 71  ? -1.511  8.723   4.218   1.00 0.00 ? 71  LEU A HD12 3  
ATOM 4800  H HD13 . LEU A 1 71  ? -0.608  10.231  4.368   1.00 0.00 ? 71  LEU A HD13 3  
ATOM 4801  H HD21 . LEU A 1 71  ? 2.150   9.474   4.718   1.00 0.00 ? 71  LEU A HD21 3  
ATOM 4802  H HD22 . LEU A 1 71  ? 1.548   10.457  3.382   1.00 0.00 ? 71  LEU A HD22 3  
ATOM 4803  H HD23 . LEU A 1 71  ? 2.550   9.042   3.055   1.00 0.00 ? 71  LEU A HD23 3  
ATOM 4804  N N    . GLU A 1 72  ? 0.834   4.059   3.410   1.00 0.00 ? 72  GLU A N    3  
ATOM 4805  C CA   . GLU A 1 72  ? 0.939   2.682   3.876   1.00 0.00 ? 72  GLU A CA   3  
ATOM 4806  C C    . GLU A 1 72  ? -0.136  1.807   3.239   1.00 0.00 ? 72  GLU A C    3  
ATOM 4807  O O    . GLU A 1 72  ? -1.157  2.307   2.765   1.00 0.00 ? 72  GLU A O    3  
ATOM 4808  C CB   . GLU A 1 72  ? 0.820   2.627   5.400   1.00 0.00 ? 72  GLU A CB   3  
ATOM 4809  C CG   . GLU A 1 72  ? -0.495  3.175   5.928   1.00 0.00 ? 72  GLU A CG   3  
ATOM 4810  C CD   . GLU A 1 72  ? -0.367  4.593   6.451   1.00 0.00 ? 72  GLU A CD   3  
ATOM 4811  O OE1  . GLU A 1 72  ? 0.586   5.290   6.048   1.00 0.00 ? 72  GLU A OE1  3  
ATOM 4812  O OE2  . GLU A 1 72  ? -1.221  5.004   7.265   1.00 0.00 ? 72  GLU A OE2  3  
ATOM 4813  H H    . GLU A 1 72  ? -0.006  4.365   3.007   1.00 0.00 ? 72  GLU A H    3  
ATOM 4814  H HA   . GLU A 1 72  ? 1.909   2.308   3.586   1.00 0.00 ? 72  GLU A HA   3  
ATOM 4815  H HB2  . GLU A 1 72  ? 0.911   1.599   5.720   1.00 0.00 ? 72  GLU A HB2  3  
ATOM 4816  H HB3  . GLU A 1 72  ? 1.625   3.201   5.834   1.00 0.00 ? 72  GLU A HB3  3  
ATOM 4817  H HG2  . GLU A 1 72  ? -1.220  3.168   5.129   1.00 0.00 ? 72  GLU A HG2  3  
ATOM 4818  H HG3  . GLU A 1 72  ? -0.839  2.539   6.732   1.00 0.00 ? 72  GLU A HG3  3  
ATOM 4819  N N    . VAL A 1 73  ? 0.100   0.500   3.231   1.00 0.00 ? 73  VAL A N    3  
ATOM 4820  C CA   . VAL A 1 73  ? -0.848  -0.445  2.653   1.00 0.00 ? 73  VAL A CA   3  
ATOM 4821  C C    . VAL A 1 73  ? -0.842  -1.765  3.415   1.00 0.00 ? 73  VAL A C    3  
ATOM 4822  O O    . VAL A 1 73  ? 0.211   -2.365  3.630   1.00 0.00 ? 73  VAL A O    3  
ATOM 4823  C CB   . VAL A 1 73  ? -0.533  -0.721  1.171   1.00 0.00 ? 73  VAL A CB   3  
ATOM 4824  C CG1  . VAL A 1 73  ? -1.647  -1.535  0.530   1.00 0.00 ? 73  VAL A CG1  3  
ATOM 4825  C CG2  . VAL A 1 73  ? -0.316  0.583   0.418   1.00 0.00 ? 73  VAL A CG2  3  
ATOM 4826  H H    . VAL A 1 73  ? 0.931   0.161   3.625   1.00 0.00 ? 73  VAL A H    3  
ATOM 4827  H HA   . VAL A 1 73  ? -1.835  -0.009  2.715   1.00 0.00 ? 73  VAL A HA   3  
ATOM 4828  H HB   . VAL A 1 73  ? 0.378   -1.298  1.119   1.00 0.00 ? 73  VAL A HB   3  
ATOM 4829  H HG11 . VAL A 1 73  ? -1.707  -1.300  -0.521  1.00 0.00 ? 73  VAL A HG11 3  
ATOM 4830  H HG12 . VAL A 1 73  ? -2.586  -1.298  1.007   1.00 0.00 ? 73  VAL A HG12 3  
ATOM 4831  H HG13 . VAL A 1 73  ? -1.438  -2.588  0.652   1.00 0.00 ? 73  VAL A HG13 3  
ATOM 4832  H HG21 . VAL A 1 73  ? 0.642   1.000   0.690   1.00 0.00 ? 73  VAL A HG21 3  
ATOM 4833  H HG22 . VAL A 1 73  ? -1.099  1.282   0.676   1.00 0.00 ? 73  VAL A HG22 3  
ATOM 4834  H HG23 . VAL A 1 73  ? -0.339  0.394   -0.645  1.00 0.00 ? 73  VAL A HG23 3  
ATOM 4835  N N    . ASN A 1 74  ? -2.025  -2.214  3.822   1.00 0.00 ? 74  ASN A N    3  
ATOM 4836  C CA   . ASN A 1 74  ? -2.157  -3.463  4.561   1.00 0.00 ? 74  ASN A CA   3  
ATOM 4837  C C    . ASN A 1 74  ? -1.376  -3.407  5.871   1.00 0.00 ? 74  ASN A C    3  
ATOM 4838  O O    . ASN A 1 74  ? -0.879  -4.425  6.353   1.00 0.00 ? 74  ASN A O    3  
ATOM 4839  C CB   . ASN A 1 74  ? -1.667  -4.637  3.712   1.00 0.00 ? 74  ASN A CB   3  
ATOM 4840  C CG   . ASN A 1 74  ? -2.758  -5.199  2.820   1.00 0.00 ? 74  ASN A CG   3  
ATOM 4841  O OD1  . ASN A 1 74  ? -3.845  -5.535  3.289   1.00 0.00 ? 74  ASN A OD1  3  
ATOM 4842  N ND2  . ASN A 1 74  ? -2.473  -5.303  1.528   1.00 0.00 ? 74  ASN A ND2  3  
ATOM 4843  H H    . ASN A 1 74  ? -2.829  -1.690  3.621   1.00 0.00 ? 74  ASN A H    3  
ATOM 4844  H HA   . ASN A 1 74  ? -3.203  -3.606  4.787   1.00 0.00 ? 74  ASN A HA   3  
ATOM 4845  H HB2  . ASN A 1 74  ? -0.852  -4.304  3.083   1.00 0.00 ? 74  ASN A HB2  3  
ATOM 4846  H HB3  . ASN A 1 74  ? -1.318  -5.426  4.364   1.00 0.00 ? 74  ASN A HB3  3  
ATOM 4847  H HD21 . ASN A 1 74  ? -1.586  -5.015  1.225   1.00 0.00 ? 74  ASN A HD21 3  
ATOM 4848  H HD22 . ASN A 1 74  ? -3.160  -5.662  0.929   1.00 0.00 ? 74  ASN A HD22 3  
ATOM 4849  N N    . GLY A 1 75  ? -1.271  -2.211  6.441   1.00 0.00 ? 75  GLY A N    3  
ATOM 4850  C CA   . GLY A 1 75  ? -0.551  -2.045  7.689   1.00 0.00 ? 75  GLY A CA   3  
ATOM 4851  C C    . GLY A 1 75  ? 0.952   -2.025  7.496   1.00 0.00 ? 75  GLY A C    3  
ATOM 4852  O O    . GLY A 1 75  ? 1.706   -2.397  8.396   1.00 0.00 ? 75  GLY A O    3  
ATOM 4853  H H    . GLY A 1 75  ? -1.688  -1.435  6.011   1.00 0.00 ? 75  GLY A H    3  
ATOM 4854  H HA2  . GLY A 1 75  ? -0.856  -1.115  8.147   1.00 0.00 ? 75  GLY A HA2  3  
ATOM 4855  H HA3  . GLY A 1 75  ? -0.808  -2.859  8.351   1.00 0.00 ? 75  GLY A HA3  3  
ATOM 4856  N N    . ARG A 1 76  ? 1.390   -1.593  6.319   1.00 0.00 ? 76  ARG A N    3  
ATOM 4857  C CA   . ARG A 1 76  ? 2.815   -1.527  6.010   1.00 0.00 ? 76  ARG A CA   3  
ATOM 4858  C C    . ARG A 1 76  ? 3.191   -0.152  5.471   1.00 0.00 ? 76  ARG A C    3  
ATOM 4859  O O    . ARG A 1 76  ? 2.482   0.417   4.640   1.00 0.00 ? 76  ARG A O    3  
ATOM 4860  C CB   . ARG A 1 76  ? 3.189   -2.607  4.993   1.00 0.00 ? 76  ARG A CB   3  
ATOM 4861  C CG   . ARG A 1 76  ? 4.664   -2.614  4.629   1.00 0.00 ? 76  ARG A CG   3  
ATOM 4862  C CD   . ARG A 1 76  ? 5.075   -3.934  3.995   1.00 0.00 ? 76  ARG A CD   3  
ATOM 4863  N NE   . ARG A 1 76  ? 5.338   -4.964  4.997   1.00 0.00 ? 76  ARG A NE   3  
ATOM 4864  C CZ   . ARG A 1 76  ? 6.052   -6.063  4.763   1.00 0.00 ? 76  ARG A CZ   3  
ATOM 4865  N NH1  . ARG A 1 76  ? 6.575   -6.279  3.562   1.00 0.00 ? 76  ARG A NH1  3  
ATOM 4866  N NH2  . ARG A 1 76  ? 6.243   -6.948  5.731   1.00 0.00 ? 76  ARG A NH2  3  
ATOM 4867  H H    . ARG A 1 76  ? 0.741   -1.309  5.641   1.00 0.00 ? 76  ARG A H    3  
ATOM 4868  H HA   . ARG A 1 76  ? 3.360   -1.703  6.926   1.00 0.00 ? 76  ARG A HA   3  
ATOM 4869  H HB2  . ARG A 1 76  ? 2.936   -3.574  5.403   1.00 0.00 ? 76  ARG A HB2  3  
ATOM 4870  H HB3  . ARG A 1 76  ? 2.618   -2.448  4.090   1.00 0.00 ? 76  ARG A HB3  3  
ATOM 4871  H HG2  . ARG A 1 76  ? 4.857   -1.816  3.929   1.00 0.00 ? 76  ARG A HG2  3  
ATOM 4872  H HG3  . ARG A 1 76  ? 5.247   -2.458  5.525   1.00 0.00 ? 76  ARG A HG3  3  
ATOM 4873  H HD2  . ARG A 1 76  ? 4.281   -4.270  3.347   1.00 0.00 ? 76  ARG A HD2  3  
ATOM 4874  H HD3  . ARG A 1 76  ? 5.971   -3.774  3.413   1.00 0.00 ? 76  ARG A HD3  3  
ATOM 4875  H HE   . ARG A 1 76  ? 4.962   -4.831  5.892   1.00 0.00 ? 76  ARG A HE   3  
ATOM 4876  H HH11 . ARG A 1 76  ? 6.434   -5.616  2.827   1.00 0.00 ? 76  ARG A HH11 3  
ATOM 4877  H HH12 . ARG A 1 76  ? 7.110   -7.107  3.392   1.00 0.00 ? 76  ARG A HH12 3  
ATOM 4878  H HH21 . ARG A 1 76  ? 5.851   -6.790  6.637   1.00 0.00 ? 76  ARG A HH21 3  
ATOM 4879  H HH22 . ARG A 1 76  ? 6.780   -7.773  5.555   1.00 0.00 ? 76  ARG A HH22 3  
ATOM 4880  N N    . SER A 1 77  ? 4.314   0.379   5.947   1.00 0.00 ? 77  SER A N    3  
ATOM 4881  C CA   . SER A 1 77  ? 4.785   1.688   5.511   1.00 0.00 ? 77  SER A CA   3  
ATOM 4882  C C    . SER A 1 77  ? 5.202   1.655   4.045   1.00 0.00 ? 77  SER A C    3  
ATOM 4883  O O    . SER A 1 77  ? 6.128   0.936   3.667   1.00 0.00 ? 77  SER A O    3  
ATOM 4884  C CB   . SER A 1 77  ? 5.960   2.144   6.377   1.00 0.00 ? 77  SER A CB   3  
ATOM 4885  O OG   . SER A 1 77  ? 5.703   1.911   7.751   1.00 0.00 ? 77  SER A OG   3  
ATOM 4886  H H    . SER A 1 77  ? 4.836   -0.122  6.606   1.00 0.00 ? 77  SER A H    3  
ATOM 4887  H HA   . SER A 1 77  ? 3.971   2.389   5.627   1.00 0.00 ? 77  SER A HA   3  
ATOM 4888  H HB2  . SER A 1 77  ? 6.848   1.598   6.094   1.00 0.00 ? 77  SER A HB2  3  
ATOM 4889  H HB3  . SER A 1 77  ? 6.126   3.201   6.228   1.00 0.00 ? 77  SER A HB3  3  
ATOM 4890  H HG   . SER A 1 77  ? 5.029   2.521   8.059   1.00 0.00 ? 77  SER A HG   3  
ATOM 4891  N N    . PHE A 1 78  ? 4.512   2.437   3.220   1.00 0.00 ? 78  PHE A N    3  
ATOM 4892  C CA   . PHE A 1 78  ? 4.809   2.498   1.794   1.00 0.00 ? 78  PHE A CA   3  
ATOM 4893  C C    . PHE A 1 78  ? 5.565   3.777   1.449   1.00 0.00 ? 78  PHE A C    3  
ATOM 4894  O O    . PHE A 1 78  ? 5.441   4.304   0.343   1.00 0.00 ? 78  PHE A O    3  
ATOM 4895  C CB   . PHE A 1 78  ? 3.516   2.414   0.979   1.00 0.00 ? 78  PHE A CB   3  
ATOM 4896  C CG   . PHE A 1 78  ? 3.278   1.062   0.368   1.00 0.00 ? 78  PHE A CG   3  
ATOM 4897  C CD1  . PHE A 1 78  ? 3.043   -0.043  1.168   1.00 0.00 ? 78  PHE A CD1  3  
ATOM 4898  C CD2  . PHE A 1 78  ? 3.288   0.899   -1.008  1.00 0.00 ? 78  PHE A CD2  3  
ATOM 4899  C CE1  . PHE A 1 78  ? 2.824   -1.288  0.608   1.00 0.00 ? 78  PHE A CE1  3  
ATOM 4900  C CE2  . PHE A 1 78  ? 3.070   -0.342  -1.574  1.00 0.00 ? 78  PHE A CE2  3  
ATOM 4901  C CZ   . PHE A 1 78  ? 2.837   -1.437  -0.766  1.00 0.00 ? 78  PHE A CZ   3  
ATOM 4902  H H    . PHE A 1 78  ? 3.785   2.987   3.580   1.00 0.00 ? 78  PHE A H    3  
ATOM 4903  H HA   . PHE A 1 78  ? 5.432   1.649   1.551   1.00 0.00 ? 78  PHE A HA   3  
ATOM 4904  H HB2  . PHE A 1 78  ? 2.679   2.638   1.623   1.00 0.00 ? 78  PHE A HB2  3  
ATOM 4905  H HB3  . PHE A 1 78  ? 3.552   3.140   0.180   1.00 0.00 ? 78  PHE A HB3  3  
ATOM 4906  H HD1  . PHE A 1 78  ? 3.033   0.072   2.242   1.00 0.00 ? 78  PHE A HD1  3  
ATOM 4907  H HD2  . PHE A 1 78  ? 3.471   1.755   -1.642  1.00 0.00 ? 78  PHE A HD2  3  
ATOM 4908  H HE1  . PHE A 1 78  ? 2.642   -2.143  1.243   1.00 0.00 ? 78  PHE A HE1  3  
ATOM 4909  H HE2  . PHE A 1 78  ? 3.080   -0.456  -2.648  1.00 0.00 ? 78  PHE A HE2  3  
ATOM 4910  H HZ   . PHE A 1 78  ? 2.666   -2.408  -1.206  1.00 0.00 ? 78  PHE A HZ   3  
ATOM 4911  N N    . LEU A 1 79  ? 6.346   4.275   2.402   1.00 0.00 ? 79  LEU A N    3  
ATOM 4912  C CA   . LEU A 1 79  ? 7.120   5.494   2.196   1.00 0.00 ? 79  LEU A CA   3  
ATOM 4913  C C    . LEU A 1 79  ? 8.586   5.169   1.925   1.00 0.00 ? 79  LEU A C    3  
ATOM 4914  O O    . LEU A 1 79  ? 9.269   5.895   1.202   1.00 0.00 ? 79  LEU A O    3  
ATOM 4915  C CB   . LEU A 1 79  ? 7.004   6.408   3.416   1.00 0.00 ? 79  LEU A CB   3  
ATOM 4916  C CG   . LEU A 1 79  ? 5.669   7.140   3.552   1.00 0.00 ? 79  LEU A CG   3  
ATOM 4917  C CD1  . LEU A 1 79  ? 5.636   7.961   4.833   1.00 0.00 ? 79  LEU A CD1  3  
ATOM 4918  C CD2  . LEU A 1 79  ? 5.424   8.028   2.341   1.00 0.00 ? 79  LEU A CD2  3  
ATOM 4919  H H    . LEU A 1 79  ? 6.403   3.812   3.264   1.00 0.00 ? 79  LEU A H    3  
ATOM 4920  H HA   . LEU A 1 79  ? 6.712   6.003   1.336   1.00 0.00 ? 79  LEU A HA   3  
ATOM 4921  H HB2  . LEU A 1 79  ? 7.156   5.810   4.303   1.00 0.00 ? 79  LEU A HB2  3  
ATOM 4922  H HB3  . LEU A 1 79  ? 7.790   7.147   3.363   1.00 0.00 ? 79  LEU A HB3  3  
ATOM 4923  H HG   . LEU A 1 79  ? 4.871   6.413   3.602   1.00 0.00 ? 79  LEU A HG   3  
ATOM 4924  H HD11 . LEU A 1 79  ? 6.592   8.444   4.974   1.00 0.00 ? 79  LEU A HD11 3  
ATOM 4925  H HD12 . LEU A 1 79  ? 5.434   7.311   5.671   1.00 0.00 ? 79  LEU A HD12 3  
ATOM 4926  H HD13 . LEU A 1 79  ? 4.862   8.709   4.761   1.00 0.00 ? 79  LEU A HD13 3  
ATOM 4927  H HD21 . LEU A 1 79  ? 6.370   8.314   1.907   1.00 0.00 ? 79  LEU A HD21 3  
ATOM 4928  H HD22 . LEU A 1 79  ? 4.886   8.914   2.647   1.00 0.00 ? 79  LEU A HD22 3  
ATOM 4929  H HD23 . LEU A 1 79  ? 4.841   7.488   1.610   1.00 0.00 ? 79  LEU A HD23 3  
ATOM 4930  N N    . ASN A 1 80  ? 9.062   4.074   2.509   1.00 0.00 ? 80  ASN A N    3  
ATOM 4931  C CA   . ASN A 1 80  ? 10.447  3.653   2.330   1.00 0.00 ? 80  ASN A CA   3  
ATOM 4932  C C    . ASN A 1 80  ? 10.516  2.237   1.765   1.00 0.00 ? 80  ASN A C    3  
ATOM 4933  O O    . ASN A 1 80  ? 11.428  1.475   2.083   1.00 0.00 ? 80  ASN A O    3  
ATOM 4934  C CB   . ASN A 1 80  ? 11.199  3.721   3.660   1.00 0.00 ? 80  ASN A CB   3  
ATOM 4935  C CG   . ASN A 1 80  ? 10.511  2.928   4.754   1.00 0.00 ? 80  ASN A CG   3  
ATOM 4936  O OD1  . ASN A 1 80  ? 9.648   3.446   5.462   1.00 0.00 ? 80  ASN A OD1  3  
ATOM 4937  N ND2  . ASN A 1 80  ? 10.892  1.664   4.898   1.00 0.00 ? 80  ASN A ND2  3  
ATOM 4938  H H    . ASN A 1 80  ? 8.468   3.536   3.073   1.00 0.00 ? 80  ASN A H    3  
ATOM 4939  H HA   . ASN A 1 80  ? 10.911  4.330   1.629   1.00 0.00 ? 80  ASN A HA   3  
ATOM 4940  H HB2  . ASN A 1 80  ? 12.194  3.322   3.525   1.00 0.00 ? 80  ASN A HB2  3  
ATOM 4941  H HB3  . ASN A 1 80  ? 11.268  4.751   3.975   1.00 0.00 ? 80  ASN A HB3  3  
ATOM 4942  H HD21 . ASN A 1 80  ? 11.586  1.319   4.298   1.00 0.00 ? 80  ASN A HD21 3  
ATOM 4943  H HD22 . ASN A 1 80  ? 10.464  1.128   5.598   1.00 0.00 ? 80  ASN A HD22 3  
ATOM 4944  N N    . ILE A 1 81  ? 9.546   1.894   0.924   1.00 0.00 ? 81  ILE A N    3  
ATOM 4945  C CA   . ILE A 1 81  ? 9.495   0.571   0.315   1.00 0.00 ? 81  ILE A CA   3  
ATOM 4946  C C    . ILE A 1 81  ? 10.089  0.593   -1.091  1.00 0.00 ? 81  ILE A C    3  
ATOM 4947  O O    . ILE A 1 81  ? 10.095  1.627   -1.758  1.00 0.00 ? 81  ILE A O    3  
ATOM 4948  C CB   . ILE A 1 81  ? 8.049   0.039   0.248   1.00 0.00 ? 81  ILE A CB   3  
ATOM 4949  C CG1  . ILE A 1 81  ? 8.030   -1.391  -0.298  1.00 0.00 ? 81  ILE A CG1  3  
ATOM 4950  C CG2  . ILE A 1 81  ? 7.184   0.951   -0.610  1.00 0.00 ? 81  ILE A CG2  3  
ATOM 4951  C CD1  . ILE A 1 81  ? 6.781   -2.162  0.071   1.00 0.00 ? 81  ILE A CD1  3  
ATOM 4952  H H    . ILE A 1 81  ? 8.846   2.546   0.709   1.00 0.00 ? 81  ILE A H    3  
ATOM 4953  H HA   . ILE A 1 81  ? 10.076  -0.101  0.930   1.00 0.00 ? 81  ILE A HA   3  
ATOM 4954  H HB   . ILE A 1 81  ? 7.644   0.039   1.249   1.00 0.00 ? 81  ILE A HB   3  
ATOM 4955  H HG12 . ILE A 1 81  ? 8.093   -1.360  -1.374  1.00 0.00 ? 81  ILE A HG12 3  
ATOM 4956  H HG13 . ILE A 1 81  ? 8.880   -1.930  0.093   1.00 0.00 ? 81  ILE A HG13 3  
ATOM 4957  H HG21 . ILE A 1 81  ? 7.672   1.125   -1.557  1.00 0.00 ? 81  ILE A HG21 3  
ATOM 4958  H HG22 . ILE A 1 81  ? 7.039   1.893   -0.100  1.00 0.00 ? 81  ILE A HG22 3  
ATOM 4959  H HG23 . ILE A 1 81  ? 6.225   0.483   -0.780  1.00 0.00 ? 81  ILE A HG23 3  
ATOM 4960  H HD11 . ILE A 1 81  ? 6.418   -2.694  -0.796  1.00 0.00 ? 81  ILE A HD11 3  
ATOM 4961  H HD12 . ILE A 1 81  ? 6.022   -1.474  0.414   1.00 0.00 ? 81  ILE A HD12 3  
ATOM 4962  H HD13 . ILE A 1 81  ? 7.010   -2.866  0.856   1.00 0.00 ? 81  ILE A HD13 3  
ATOM 4963  N N    . LEU A 1 82  ? 10.588  -0.557  -1.534  1.00 0.00 ? 82  LEU A N    3  
ATOM 4964  C CA   . LEU A 1 82  ? 11.184  -0.671  -2.859  1.00 0.00 ? 82  LEU A CA   3  
ATOM 4965  C C    . LEU A 1 82  ? 10.120  -0.556  -3.946  1.00 0.00 ? 82  LEU A C    3  
ATOM 4966  O O    . LEU A 1 82  ? 8.944   -0.831  -3.709  1.00 0.00 ? 82  LEU A O    3  
ATOM 4967  C CB   . LEU A 1 82  ? 11.930  -2.002  -2.994  1.00 0.00 ? 82  LEU A CB   3  
ATOM 4968  C CG   . LEU A 1 82  ? 13.441  -1.921  -2.781  1.00 0.00 ? 82  LEU A CG   3  
ATOM 4969  C CD1  . LEU A 1 82  ? 14.030  -3.312  -2.601  1.00 0.00 ? 82  LEU A CD1  3  
ATOM 4970  C CD2  . LEU A 1 82  ? 14.107  -1.206  -3.948  1.00 0.00 ? 82  LEU A CD2  3  
ATOM 4971  H H    . LEU A 1 82  ? 10.554  -1.347  -0.955  1.00 0.00 ? 82  LEU A H    3  
ATOM 4972  H HA   . LEU A 1 82  ? 11.890  0.139   -2.975  1.00 0.00 ? 82  LEU A HA   3  
ATOM 4973  H HB2  . LEU A 1 82  ? 11.521  -2.692  -2.271  1.00 0.00 ? 82  LEU A HB2  3  
ATOM 4974  H HB3  . LEU A 1 82  ? 11.749  -2.394  -3.984  1.00 0.00 ? 82  LEU A HB3  3  
ATOM 4975  H HG   . LEU A 1 82  ? 13.643  -1.356  -1.882  1.00 0.00 ? 82  LEU A HG   3  
ATOM 4976  H HD11 . LEU A 1 82  ? 13.781  -3.685  -1.619  1.00 0.00 ? 82  LEU A HD11 3  
ATOM 4977  H HD12 . LEU A 1 82  ? 15.104  -3.265  -2.708  1.00 0.00 ? 82  LEU A HD12 3  
ATOM 4978  H HD13 . LEU A 1 82  ? 13.622  -3.974  -3.352  1.00 0.00 ? 82  LEU A HD13 3  
ATOM 4979  H HD21 . LEU A 1 82  ? 13.500  -1.322  -4.834  1.00 0.00 ? 82  LEU A HD21 3  
ATOM 4980  H HD22 . LEU A 1 82  ? 15.083  -1.631  -4.122  1.00 0.00 ? 82  LEU A HD22 3  
ATOM 4981  H HD23 . LEU A 1 82  ? 14.207  -0.156  -3.716  1.00 0.00 ? 82  LEU A HD23 3  
ATOM 4982  N N    . HIS A 1 83  ? 10.541  -0.147  -5.139  1.00 0.00 ? 83  HIS A N    3  
ATOM 4983  C CA   . HIS A 1 83  ? 9.625   0.003   -6.262  1.00 0.00 ? 83  HIS A CA   3  
ATOM 4984  C C    . HIS A 1 83  ? 9.016   -1.341  -6.651  1.00 0.00 ? 83  HIS A C    3  
ATOM 4985  O O    . HIS A 1 83  ? 7.795   -1.490  -6.697  1.00 0.00 ? 83  HIS A O    3  
ATOM 4986  C CB   . HIS A 1 83  ? 10.352  0.613   -7.463  1.00 0.00 ? 83  HIS A CB   3  
ATOM 4987  C CG   . HIS A 1 83  ? 9.453   0.896   -8.626  1.00 0.00 ? 83  HIS A CG   3  
ATOM 4988  N ND1  . HIS A 1 83  ? 8.094   1.093   -8.498  1.00 0.00 ? 83  HIS A ND1  3  
ATOM 4989  C CD2  . HIS A 1 83  ? 9.726   1.017   -9.947  1.00 0.00 ? 83  HIS A CD2  3  
ATOM 4990  C CE1  . HIS A 1 83  ? 7.569   1.322   -9.688  1.00 0.00 ? 83  HIS A CE1  3  
ATOM 4991  N NE2  . HIS A 1 83  ? 8.539   1.281   -10.584 1.00 0.00 ? 83  HIS A NE2  3  
ATOM 4992  H H    . HIS A 1 83  ? 11.491  0.056   -5.266  1.00 0.00 ? 83  HIS A H    3  
ATOM 4993  H HA   . HIS A 1 83  ? 8.832   0.669   -5.956  1.00 0.00 ? 83  HIS A HA   3  
ATOM 4994  H HB2  . HIS A 1 83  ? 10.808  1.547   -7.161  1.00 0.00 ? 83  HIS A HB2  3  
ATOM 4995  H HB3  . HIS A 1 83  ? 11.121  -0.072  -7.794  1.00 0.00 ? 83  HIS A HB3  3  
ATOM 4996  H HD1  . HIS A 1 83  ? 7.589   1.069   -7.658  1.00 0.00 ? 83  HIS A HD1  3  
ATOM 4997  H HD2  . HIS A 1 83  ? 10.696  0.923   -10.412 1.00 0.00 ? 83  HIS A HD2  3  
ATOM 4998  H HE1  . HIS A 1 83  ? 6.527   1.510   -9.894  1.00 0.00 ? 83  HIS A HE1  3  
ATOM 4999  H HE2  . HIS A 1 83  ? 8.413   1.335   -11.555 1.00 0.00 ? 83  HIS A HE2  3  
ATOM 5000  N N    . ASP A 1 84  ? 9.875   -2.315  -6.931  1.00 0.00 ? 84  ASP A N    3  
ATOM 5001  C CA   . ASP A 1 84  ? 9.423   -3.647  -7.315  1.00 0.00 ? 84  ASP A CA   3  
ATOM 5002  C C    . ASP A 1 84  ? 8.611   -4.291  -6.195  1.00 0.00 ? 84  ASP A C    3  
ATOM 5003  O O    . ASP A 1 84  ? 7.592   -4.935  -6.445  1.00 0.00 ? 84  ASP A O    3  
ATOM 5004  C CB   . ASP A 1 84  ? 10.619  -4.533  -7.668  1.00 0.00 ? 84  ASP A CB   3  
ATOM 5005  C CG   . ASP A 1 84  ? 10.933  -4.516  -9.152  1.00 0.00 ? 84  ASP A CG   3  
ATOM 5006  O OD1  . ASP A 1 84  ? 11.729  -3.653  -9.579  1.00 0.00 ? 84  ASP A OD1  3  
ATOM 5007  O OD2  . ASP A 1 84  ? 10.384  -5.364  -9.884  1.00 0.00 ? 84  ASP A OD2  3  
ATOM 5008  H H    . ASP A 1 84  ? 10.837  -2.135  -6.876  1.00 0.00 ? 84  ASP A H    3  
ATOM 5009  H HA   . ASP A 1 84  ? 8.793   -3.544  -8.186  1.00 0.00 ? 84  ASP A HA   3  
ATOM 5010  H HB2  . ASP A 1 84  ? 11.488  -4.183  -7.131  1.00 0.00 ? 84  ASP A HB2  3  
ATOM 5011  H HB3  . ASP A 1 84  ? 10.405  -5.550  -7.376  1.00 0.00 ? 84  ASP A HB3  3  
ATOM 5012  N N    . GLU A 1 85  ? 9.071   -4.114  -4.961  1.00 0.00 ? 85  GLU A N    3  
ATOM 5013  C CA   . GLU A 1 85  ? 8.387   -4.679  -3.803  1.00 0.00 ? 85  GLU A CA   3  
ATOM 5014  C C    . GLU A 1 85  ? 6.963   -4.145  -3.696  1.00 0.00 ? 85  GLU A C    3  
ATOM 5015  O O    . GLU A 1 85  ? 6.058   -4.850  -3.249  1.00 0.00 ? 85  GLU A O    3  
ATOM 5016  C CB   . GLU A 1 85  ? 9.161   -4.359  -2.522  1.00 0.00 ? 85  GLU A CB   3  
ATOM 5017  C CG   . GLU A 1 85  ? 8.860   -5.311  -1.376  1.00 0.00 ? 85  GLU A CG   3  
ATOM 5018  C CD   . GLU A 1 85  ? 9.405   -4.817  -0.050  1.00 0.00 ? 85  GLU A CD   3  
ATOM 5019  O OE1  . GLU A 1 85  ? 10.621  -4.539  0.026   1.00 0.00 ? 85  GLU A OE1  3  
ATOM 5020  O OE2  . GLU A 1 85  ? 8.617   -4.708  0.913   1.00 0.00 ? 85  GLU A OE2  3  
ATOM 5021  H H    . GLU A 1 85  ? 9.888   -3.592  -4.825  1.00 0.00 ? 85  GLU A H    3  
ATOM 5022  H HA   . GLU A 1 85  ? 8.349   -5.751  -3.930  1.00 0.00 ? 85  GLU A HA   3  
ATOM 5023  H HB2  . GLU A 1 85  ? 10.220  -4.408  -2.733  1.00 0.00 ? 85  GLU A HB2  3  
ATOM 5024  H HB3  . GLU A 1 85  ? 8.911   -3.358  -2.205  1.00 0.00 ? 85  GLU A HB3  3  
ATOM 5025  H HG2  . GLU A 1 85  ? 7.790   -5.422  -1.288  1.00 0.00 ? 85  GLU A HG2  3  
ATOM 5026  H HG3  . GLU A 1 85  ? 9.303   -6.271  -1.596  1.00 0.00 ? 85  GLU A HG3  3  
ATOM 5027  N N    . ALA A 1 86  ? 6.772   -2.897  -4.110  1.00 0.00 ? 86  ALA A N    3  
ATOM 5028  C CA   . ALA A 1 86  ? 5.458   -2.269  -4.062  1.00 0.00 ? 86  ALA A CA   3  
ATOM 5029  C C    . ALA A 1 86  ? 4.553   -2.803  -5.166  1.00 0.00 ? 86  ALA A C    3  
ATOM 5030  O O    . ALA A 1 86  ? 3.341   -2.925  -4.986  1.00 0.00 ? 86  ALA A O    3  
ATOM 5031  C CB   . ALA A 1 86  ? 5.591   -0.757  -4.170  1.00 0.00 ? 86  ALA A CB   3  
ATOM 5032  H H    . ALA A 1 86  ? 7.533   -2.387  -4.457  1.00 0.00 ? 86  ALA A H    3  
ATOM 5033  H HA   . ALA A 1 86  ? 5.013   -2.499  -3.104  1.00 0.00 ? 86  ALA A HA   3  
ATOM 5034  H HB1  . ALA A 1 86  ? 5.800   -0.344  -3.195  1.00 0.00 ? 86  ALA A HB1  3  
ATOM 5035  H HB2  . ALA A 1 86  ? 4.669   -0.342  -4.547  1.00 0.00 ? 86  ALA A HB2  3  
ATOM 5036  H HB3  . ALA A 1 86  ? 6.398   -0.515  -4.845  1.00 0.00 ? 86  ALA A HB3  3  
ATOM 5037  N N    . VAL A 1 87  ? 5.150   -3.121  -6.311  1.00 0.00 ? 87  VAL A N    3  
ATOM 5038  C CA   . VAL A 1 87  ? 4.397   -3.642  -7.445  1.00 0.00 ? 87  VAL A CA   3  
ATOM 5039  C C    . VAL A 1 87  ? 4.103   -5.129  -7.273  1.00 0.00 ? 87  VAL A C    3  
ATOM 5040  O O    . VAL A 1 87  ? 3.095   -5.634  -7.767  1.00 0.00 ? 87  VAL A O    3  
ATOM 5041  C CB   . VAL A 1 87  ? 5.157   -3.432  -8.769  1.00 0.00 ? 87  VAL A CB   3  
ATOM 5042  C CG1  . VAL A 1 87  ? 4.271   -3.780  -9.956  1.00 0.00 ? 87  VAL A CG1  3  
ATOM 5043  C CG2  . VAL A 1 87  ? 5.662   -1.999  -8.873  1.00 0.00 ? 87  VAL A CG2  3  
ATOM 5044  H H    . VAL A 1 87  ? 6.119   -3.002  -6.394  1.00 0.00 ? 87  VAL A H    3  
ATOM 5045  H HA   . VAL A 1 87  ? 3.462   -3.104  -7.501  1.00 0.00 ? 87  VAL A HA   3  
ATOM 5046  H HB   . VAL A 1 87  ? 6.011   -4.093  -8.779  1.00 0.00 ? 87  VAL A HB   3  
ATOM 5047  H HG11 . VAL A 1 87  ? 3.538   -4.514  -9.654  1.00 0.00 ? 87  VAL A HG11 3  
ATOM 5048  H HG12 . VAL A 1 87  ? 4.879   -4.186  -10.751 1.00 0.00 ? 87  VAL A HG12 3  
ATOM 5049  H HG13 . VAL A 1 87  ? 3.768   -2.890  -10.304 1.00 0.00 ? 87  VAL A HG13 3  
ATOM 5050  H HG21 . VAL A 1 87  ? 5.544   -1.649  -9.887  1.00 0.00 ? 87  VAL A HG21 3  
ATOM 5051  H HG22 . VAL A 1 87  ? 6.706   -1.965  -8.599  1.00 0.00 ? 87  VAL A HG22 3  
ATOM 5052  H HG23 . VAL A 1 87  ? 5.093   -1.368  -8.206  1.00 0.00 ? 87  VAL A HG23 3  
ATOM 5053  N N    . ARG A 1 88  ? 4.990   -5.826  -6.570  1.00 0.00 ? 88  ARG A N    3  
ATOM 5054  C CA   . ARG A 1 88  ? 4.824   -7.256  -6.333  1.00 0.00 ? 88  ARG A CA   3  
ATOM 5055  C C    . ARG A 1 88  ? 3.968   -7.506  -5.095  1.00 0.00 ? 88  ARG A C    3  
ATOM 5056  O O    . ARG A 1 88  ? 3.241   -8.497  -5.021  1.00 0.00 ? 88  ARG A O    3  
ATOM 5057  C CB   . ARG A 1 88  ? 6.190   -7.929  -6.174  1.00 0.00 ? 88  ARG A CB   3  
ATOM 5058  C CG   . ARG A 1 88  ? 6.451   -9.022  -7.198  1.00 0.00 ? 88  ARG A CG   3  
ATOM 5059  C CD   . ARG A 1 88  ? 7.793   -8.835  -7.886  1.00 0.00 ? 88  ARG A CD   3  
ATOM 5060  N NE   . ARG A 1 88  ? 8.426   -10.112 -8.209  1.00 0.00 ? 88  ARG A NE   3  
ATOM 5061  C CZ   . ARG A 1 88  ? 9.062   -10.870 -7.320  1.00 0.00 ? 88  ARG A CZ   3  
ATOM 5062  N NH1  . ARG A 1 88  ? 9.155   -10.484 -6.054  1.00 0.00 ? 88  ARG A NH1  3  
ATOM 5063  N NH2  . ARG A 1 88  ? 9.610   -12.018 -7.697  1.00 0.00 ? 88  ARG A NH2  3  
ATOM 5064  H H    . ARG A 1 88  ? 5.775   -5.369  -6.202  1.00 0.00 ? 88  ARG A H    3  
ATOM 5065  H HA   . ARG A 1 88  ? 4.323   -7.677  -7.192  1.00 0.00 ? 88  ARG A HA   3  
ATOM 5066  H HB2  . ARG A 1 88  ? 6.960   -7.180  -6.273  1.00 0.00 ? 88  ARG A HB2  3  
ATOM 5067  H HB3  . ARG A 1 88  ? 6.251   -8.367  -5.188  1.00 0.00 ? 88  ARG A HB3  3  
ATOM 5068  H HG2  . ARG A 1 88  ? 6.445   -9.981  -6.696  1.00 0.00 ? 88  ARG A HG2  3  
ATOM 5069  H HG3  . ARG A 1 88  ? 5.667   -8.997  -7.944  1.00 0.00 ? 88  ARG A HG3  3  
ATOM 5070  H HD2  . ARG A 1 88  ? 7.641   -8.279  -8.799  1.00 0.00 ? 88  ARG A HD2  3  
ATOM 5071  H HD3  . ARG A 1 88  ? 8.445   -8.277  -7.230  1.00 0.00 ? 88  ARG A HD3  3  
ATOM 5072  H HE   . ARG A 1 88  ? 8.374   -10.421 -9.138  1.00 0.00 ? 88  ARG A HE   3  
ATOM 5073  H HH11 . ARG A 1 88  ? 8.745   -9.620  -5.762  1.00 0.00 ? 88  ARG A HH11 3  
ATOM 5074  H HH12 . ARG A 1 88  ? 9.635   -11.058 -5.389  1.00 0.00 ? 88  ARG A HH12 3  
ATOM 5075  H HH21 . ARG A 1 88  ? 9.543   -12.313 -8.650  1.00 0.00 ? 88  ARG A HH21 3  
ATOM 5076  H HH22 . ARG A 1 88  ? 10.088  -12.587 -7.029  1.00 0.00 ? 88  ARG A HH22 3  
ATOM 5077  N N    . LEU A 1 89  ? 4.060   -6.603  -4.125  1.00 0.00 ? 89  LEU A N    3  
ATOM 5078  C CA   . LEU A 1 89  ? 3.294   -6.726  -2.890  1.00 0.00 ? 89  LEU A CA   3  
ATOM 5079  C C    . LEU A 1 89  ? 1.839   -6.328  -3.109  1.00 0.00 ? 89  LEU A C    3  
ATOM 5080  O O    . LEU A 1 89  ? 0.931   -6.895  -2.500  1.00 0.00 ? 89  LEU A O    3  
ATOM 5081  C CB   . LEU A 1 89  ? 3.913   -5.858  -1.793  1.00 0.00 ? 89  LEU A CB   3  
ATOM 5082  C CG   . LEU A 1 89  ? 3.188   -5.902  -0.446  1.00 0.00 ? 89  LEU A CG   3  
ATOM 5083  C CD1  . LEU A 1 89  ? 3.328   -7.276  0.191   1.00 0.00 ? 89  LEU A CD1  3  
ATOM 5084  C CD2  . LEU A 1 89  ? 3.726   -4.824  0.483   1.00 0.00 ? 89  LEU A CD2  3  
ATOM 5085  H H    . LEU A 1 89  ? 4.657   -5.834  -4.243  1.00 0.00 ? 89  LEU A H    3  
ATOM 5086  H HA   . LEU A 1 89  ? 3.329   -7.760  -2.581  1.00 0.00 ? 89  LEU A HA   3  
ATOM 5087  H HB2  . LEU A 1 89  ? 4.933   -6.181  -1.639  1.00 0.00 ? 89  LEU A HB2  3  
ATOM 5088  H HB3  . LEU A 1 89  ? 3.925   -4.834  -2.135  1.00 0.00 ? 89  LEU A HB3  3  
ATOM 5089  H HG   . LEU A 1 89  ? 2.136   -5.714  -0.605  1.00 0.00 ? 89  LEU A HG   3  
ATOM 5090  H HD11 . LEU A 1 89  ? 3.369   -7.172  1.265   1.00 0.00 ? 89  LEU A HD11 3  
ATOM 5091  H HD12 . LEU A 1 89  ? 4.234   -7.745  -0.161  1.00 0.00 ? 89  LEU A HD12 3  
ATOM 5092  H HD13 . LEU A 1 89  ? 2.478   -7.885  -0.079  1.00 0.00 ? 89  LEU A HD13 3  
ATOM 5093  H HD21 . LEU A 1 89  ? 4.746   -4.592  0.213   1.00 0.00 ? 89  LEU A HD21 3  
ATOM 5094  H HD22 . LEU A 1 89  ? 3.695   -5.179  1.502   1.00 0.00 ? 89  LEU A HD22 3  
ATOM 5095  H HD23 . LEU A 1 89  ? 3.118   -3.936  0.394   1.00 0.00 ? 89  LEU A HD23 3  
ATOM 5096  N N    . LEU A 1 90  ? 1.623   -5.348  -3.982  1.00 0.00 ? 90  LEU A N    3  
ATOM 5097  C CA   . LEU A 1 90  ? 0.277   -4.873  -4.281  1.00 0.00 ? 90  LEU A CA   3  
ATOM 5098  C C    . LEU A 1 90  ? -0.449  -5.841  -5.210  1.00 0.00 ? 90  LEU A C    3  
ATOM 5099  O O    . LEU A 1 90  ? -1.670  -5.978  -5.149  1.00 0.00 ? 90  LEU A O    3  
ATOM 5100  C CB   . LEU A 1 90  ? 0.334   -3.484  -4.917  1.00 0.00 ? 90  LEU A CB   3  
ATOM 5101  C CG   . LEU A 1 90  ? 0.404   -2.320  -3.927  1.00 0.00 ? 90  LEU A CG   3  
ATOM 5102  C CD1  . LEU A 1 90  ? 0.723   -1.021  -4.652  1.00 0.00 ? 90  LEU A CD1  3  
ATOM 5103  C CD2  . LEU A 1 90  ? -0.903  -2.197  -3.158  1.00 0.00 ? 90  LEU A CD2  3  
ATOM 5104  H H    . LEU A 1 90  ? 2.387   -4.935  -4.435  1.00 0.00 ? 90  LEU A H    3  
ATOM 5105  H HA   . LEU A 1 90  ? -0.267  -4.811  -3.350  1.00 0.00 ? 90  LEU A HA   3  
ATOM 5106  H HB2  . LEU A 1 90  ? 1.204   -3.439  -5.556  1.00 0.00 ? 90  LEU A HB2  3  
ATOM 5107  H HB3  . LEU A 1 90  ? -0.547  -3.355  -5.528  1.00 0.00 ? 90  LEU A HB3  3  
ATOM 5108  H HG   . LEU A 1 90  ? 1.194   -2.508  -3.216  1.00 0.00 ? 90  LEU A HG   3  
ATOM 5109  H HD11 . LEU A 1 90  ? 0.982   -0.260  -3.931  1.00 0.00 ? 90  LEU A HD11 3  
ATOM 5110  H HD12 . LEU A 1 90  ? -0.141  -0.702  -5.216  1.00 0.00 ? 90  LEU A HD12 3  
ATOM 5111  H HD13 . LEU A 1 90  ? 1.553   -1.178  -5.324  1.00 0.00 ? 90  LEU A HD13 3  
ATOM 5112  H HD21 . LEU A 1 90  ? -0.695  -1.903  -2.140  1.00 0.00 ? 90  LEU A HD21 3  
ATOM 5113  H HD22 . LEU A 1 90  ? -1.414  -3.147  -3.162  1.00 0.00 ? 90  LEU A HD22 3  
ATOM 5114  H HD23 . LEU A 1 90  ? -1.527  -1.449  -3.627  1.00 0.00 ? 90  LEU A HD23 3  
ATOM 5115  N N    . LYS A 1 91  ? 0.313   -6.509  -6.071  1.00 0.00 ? 91  LYS A N    3  
ATOM 5116  C CA   . LYS A 1 91  ? -0.259  -7.463  -7.015  1.00 0.00 ? 91  LYS A CA   3  
ATOM 5117  C C    . LYS A 1 91  ? -0.015  -8.897  -6.555  1.00 0.00 ? 91  LYS A C    3  
ATOM 5118  O O    . LYS A 1 91  ? 0.333   -9.766  -7.354  1.00 0.00 ? 91  LYS A O    3  
ATOM 5119  C CB   . LYS A 1 91  ? 0.338   -7.254  -8.409  1.00 0.00 ? 91  LYS A CB   3  
ATOM 5120  C CG   . LYS A 1 91  ? 0.462   -5.791  -8.805  1.00 0.00 ? 91  LYS A CG   3  
ATOM 5121  C CD   . LYS A 1 91  ? -0.894  -5.185  -9.132  1.00 0.00 ? 91  LYS A CD   3  
ATOM 5122  C CE   . LYS A 1 91  ? -0.816  -4.262  -10.337 1.00 0.00 ? 91  LYS A CE   3  
ATOM 5123  N NZ   . LYS A 1 91  ? 0.042   -3.075  -10.073 1.00 0.00 ? 91  LYS A NZ   3  
ATOM 5124  H H    . LYS A 1 91  ? 1.280   -6.357  -6.072  1.00 0.00 ? 91  LYS A H    3  
ATOM 5125  H HA   . LYS A 1 91  ? -1.323  -7.288  -7.058  1.00 0.00 ? 91  LYS A HA   3  
ATOM 5126  H HB2  . LYS A 1 91  ? 1.323   -7.696  -8.436  1.00 0.00 ? 91  LYS A HB2  3  
ATOM 5127  H HB3  . LYS A 1 91  ? -0.290  -7.749  -9.134  1.00 0.00 ? 91  LYS A HB3  3  
ATOM 5128  H HG2  . LYS A 1 91  ? 0.902   -5.241  -7.987  1.00 0.00 ? 91  LYS A HG2  3  
ATOM 5129  H HG3  . LYS A 1 91  ? 1.099   -5.717  -9.675  1.00 0.00 ? 91  LYS A HG3  3  
ATOM 5130  H HD2  . LYS A 1 91  ? -1.592  -5.981  -9.345  1.00 0.00 ? 91  LYS A HD2  3  
ATOM 5131  H HD3  . LYS A 1 91  ? -1.240  -4.620  -8.278  1.00 0.00 ? 91  LYS A HD3  3  
ATOM 5132  H HE2  . LYS A 1 91  ? -0.405  -4.813  -11.170 1.00 0.00 ? 91  LYS A HE2  3  
ATOM 5133  H HE3  . LYS A 1 91  ? -1.813  -3.928  -10.584 1.00 0.00 ? 91  LYS A HE3  3  
ATOM 5134  H HZ1  . LYS A 1 91  ? 0.900   -3.360  -9.559  1.00 0.00 ? 91  LYS A HZ1  3  
ATOM 5135  H HZ2  . LYS A 1 91  ? -0.477  -2.379  -9.499  1.00 0.00 ? 91  LYS A HZ2  3  
ATOM 5136  H HZ3  . LYS A 1 91  ? 0.320   -2.627  -10.970 1.00 0.00 ? 91  LYS A HZ3  3  
ATOM 5137  N N    . SER A 1 92  ? -0.200  -9.137  -5.260  1.00 0.00 ? 92  SER A N    3  
ATOM 5138  C CA   . SER A 1 92  ? -0.003  -10.466 -4.694  1.00 0.00 ? 92  SER A CA   3  
ATOM 5139  C C    . SER A 1 92  ? -1.053  -10.767 -3.629  1.00 0.00 ? 92  SER A C    3  
ATOM 5140  O O    . SER A 1 92  ? -1.703  -11.811 -3.662  1.00 0.00 ? 92  SER A O    3  
ATOM 5141  C CB   . SER A 1 92  ? 1.399   -10.581 -4.090  1.00 0.00 ? 92  SER A CB   3  
ATOM 5142  O OG   . SER A 1 92  ? 1.591   -11.848 -3.486  1.00 0.00 ? 92  SER A OG   3  
ATOM 5143  H H    . SER A 1 92  ? -0.478  -8.403  -4.673  1.00 0.00 ? 92  SER A H    3  
ATOM 5144  H HA   . SER A 1 92  ? -0.101  -11.185 -5.492  1.00 0.00 ? 92  SER A HA   3  
ATOM 5145  H HB2  . SER A 1 92  ? 2.136   -10.454 -4.870  1.00 0.00 ? 92  SER A HB2  3  
ATOM 5146  H HB3  . SER A 1 92  ? 1.531   -9.815  -3.342  1.00 0.00 ? 92  SER A HB3  3  
ATOM 5147  H HG   . SER A 1 92  ? 2.460   -12.186 -3.716  1.00 0.00 ? 92  SER A HG   3  
ATOM 5148  N N    . SER A 1 93  ? -1.212  -9.843  -2.686  1.00 0.00 ? 93  SER A N    3  
ATOM 5149  C CA   . SER A 1 93  ? -2.183  -10.010 -1.610  1.00 0.00 ? 93  SER A CA   3  
ATOM 5150  C C    . SER A 1 93  ? -3.600  -9.741  -2.109  1.00 0.00 ? 93  SER A C    3  
ATOM 5151  O O    . SER A 1 93  ? -3.827  -8.825  -2.899  1.00 0.00 ? 93  SER A O    3  
ATOM 5152  C CB   . SER A 1 93  ? -1.854  -9.071  -0.448  1.00 0.00 ? 93  SER A CB   3  
ATOM 5153  O OG   . SER A 1 93  ? -2.854  -9.130  0.554   1.00 0.00 ? 93  SER A OG   3  
ATOM 5154  H H    . SER A 1 93  ? -0.663  -9.032  -2.714  1.00 0.00 ? 93  SER A H    3  
ATOM 5155  H HA   . SER A 1 93  ? -2.124  -11.030 -1.265  1.00 0.00 ? 93  SER A HA   3  
ATOM 5156  H HB2  . SER A 1 93  ? -0.907  -9.362  -0.011  1.00 0.00 ? 93  SER A HB2  3  
ATOM 5157  H HB3  . SER A 1 93  ? -1.787  -8.056  -0.816  1.00 0.00 ? 93  SER A HB3  3  
ATOM 5158  H HG   . SER A 1 93  ? -2.864  -8.305  1.045   1.00 0.00 ? 93  SER A HG   3  
ATOM 5159  N N    . ARG A 1 94  ? -4.548  -10.546 -1.641  1.00 0.00 ? 94  ARG A N    3  
ATOM 5160  C CA   . ARG A 1 94  ? -5.943  -10.394 -2.039  1.00 0.00 ? 94  ARG A CA   3  
ATOM 5161  C C    . ARG A 1 94  ? -6.522  -9.086  -1.507  1.00 0.00 ? 94  ARG A C    3  
ATOM 5162  O O    . ARG A 1 94  ? -7.052  -8.276  -2.266  1.00 0.00 ? 94  ARG A O    3  
ATOM 5163  C CB   . ARG A 1 94  ? -6.771  -11.575 -1.531  1.00 0.00 ? 94  ARG A CB   3  
ATOM 5164  C CG   . ARG A 1 94  ? -6.460  -12.884 -2.240  1.00 0.00 ? 94  ARG A CG   3  
ATOM 5165  C CD   . ARG A 1 94  ? -5.160  -13.491 -1.741  1.00 0.00 ? 94  ARG A CD   3  
ATOM 5166  N NE   . ARG A 1 94  ? -5.123  -14.940 -1.933  1.00 0.00 ? 94  ARG A NE   3  
ATOM 5167  C CZ   . ARG A 1 94  ? -4.856  -15.527 -3.097  1.00 0.00 ? 94  ARG A CZ   3  
ATOM 5168  N NH1  . ARG A 1 94  ? -4.600  -14.795 -4.174  1.00 0.00 ? 94  ARG A NH1  3  
ATOM 5169  N NH2  . ARG A 1 94  ? -4.843  -16.850 -3.184  1.00 0.00 ? 94  ARG A NH2  3  
ATOM 5170  H H    . ARG A 1 94  ? -4.305  -11.257 -1.013  1.00 0.00 ? 94  ARG A H    3  
ATOM 5171  H HA   . ARG A 1 94  ? -5.980  -10.377 -3.118  1.00 0.00 ? 94  ARG A HA   3  
ATOM 5172  H HB2  . ARG A 1 94  ? -6.579  -11.708 -0.475  1.00 0.00 ? 94  ARG A HB2  3  
ATOM 5173  H HB3  . ARG A 1 94  ? -7.821  -11.353 -1.676  1.00 0.00 ? 94  ARG A HB3  3  
ATOM 5174  H HG2  . ARG A 1 94  ? -7.264  -13.581 -2.057  1.00 0.00 ? 94  ARG A HG2  3  
ATOM 5175  H HG3  . ARG A 1 94  ? -6.377  -12.697 -3.300  1.00 0.00 ? 94  ARG A HG3  3  
ATOM 5176  H HD2  . ARG A 1 94  ? -4.338  -13.046 -2.282  1.00 0.00 ? 94  ARG A HD2  3  
ATOM 5177  H HD3  . ARG A 1 94  ? -5.057  -13.274 -0.689  1.00 0.00 ? 94  ARG A HD3  3  
ATOM 5178  H HE   . ARG A 1 94  ? -5.308  -15.504 -1.153  1.00 0.00 ? 94  ARG A HE   3  
ATOM 5179  H HH11 . ARG A 1 94  ? -4.609  -13.797 -4.115  1.00 0.00 ? 94  ARG A HH11 3  
ATOM 5180  H HH12 . ARG A 1 94  ? -4.400  -15.243 -5.046  1.00 0.00 ? 94  ARG A HH12 3  
ATOM 5181  H HH21 . ARG A 1 94  ? -5.034  -17.407 -2.375  1.00 0.00 ? 94  ARG A HH21 3  
ATOM 5182  H HH22 . ARG A 1 94  ? -4.642  -17.291 -4.059  1.00 0.00 ? 94  ARG A HH22 3  
ATOM 5183  N N    . HIS A 1 95  ? -6.413  -8.888  -0.197  1.00 0.00 ? 95  HIS A N    3  
ATOM 5184  C CA   . HIS A 1 95  ? -6.925  -7.678  0.436   1.00 0.00 ? 95  HIS A CA   3  
ATOM 5185  C C    . HIS A 1 95  ? -5.916  -6.540  0.327   1.00 0.00 ? 95  HIS A C    3  
ATOM 5186  O O    . HIS A 1 95  ? -4.721  -6.732  0.556   1.00 0.00 ? 95  HIS A O    3  
ATOM 5187  C CB   . HIS A 1 95  ? -7.251  -7.946  1.907   1.00 0.00 ? 95  HIS A CB   3  
ATOM 5188  C CG   . HIS A 1 95  ? -8.477  -7.233  2.388   1.00 0.00 ? 95  HIS A CG   3  
ATOM 5189  N ND1  . HIS A 1 95  ? -9.387  -7.799  3.256   1.00 0.00 ? 95  HIS A ND1  3  
ATOM 5190  C CD2  . HIS A 1 95  ? -8.941  -5.989  2.119   1.00 0.00 ? 95  HIS A CD2  3  
ATOM 5191  C CE1  . HIS A 1 95  ? -10.357 -6.936  3.499   1.00 0.00 ? 95  HIS A CE1  3  
ATOM 5192  N NE2  . HIS A 1 95  ? -10.110 -5.830  2.821   1.00 0.00 ? 95  HIS A NE2  3  
ATOM 5193  H H    . HIS A 1 95  ? -5.980  -9.570  0.356   1.00 0.00 ? 95  HIS A H    3  
ATOM 5194  H HA   . HIS A 1 95  ? -7.830  -7.392  -0.078  1.00 0.00 ? 95  HIS A HA   3  
ATOM 5195  H HB2  . HIS A 1 95  ? -7.409  -9.005  2.046   1.00 0.00 ? 95  HIS A HB2  3  
ATOM 5196  H HB3  . HIS A 1 95  ? -6.419  -7.629  2.518   1.00 0.00 ? 95  HIS A HB3  3  
ATOM 5197  H HD1  . HIS A 1 95  ? -9.329  -8.701  3.636   1.00 0.00 ? 95  HIS A HD1  3  
ATOM 5198  H HD2  . HIS A 1 95  ? -8.477  -5.258  1.471   1.00 0.00 ? 95  HIS A HD2  3  
ATOM 5199  H HE1  . HIS A 1 95  ? -11.207 -7.106  4.143   1.00 0.00 ? 95  HIS A HE1  3  
ATOM 5200  H HE2  . HIS A 1 95  ? -10.715 -5.063  2.753   1.00 0.00 ? 95  HIS A HE2  3  
ATOM 5201  N N    . LEU A 1 96  ? -6.403  -5.354  -0.024  1.00 0.00 ? 96  LEU A N    3  
ATOM 5202  C CA   . LEU A 1 96  ? -5.543  -4.186  -0.163  1.00 0.00 ? 96  LEU A CA   3  
ATOM 5203  C C    . LEU A 1 96  ? -6.197  -2.953  0.451   1.00 0.00 ? 96  LEU A C    3  
ATOM 5204  O O    . LEU A 1 96  ? -7.299  -2.563  0.062   1.00 0.00 ? 96  LEU A O    3  
ATOM 5205  C CB   . LEU A 1 96  ? -5.231  -3.932  -1.639  1.00 0.00 ? 96  LEU A CB   3  
ATOM 5206  C CG   . LEU A 1 96  ? -4.637  -5.126  -2.389  1.00 0.00 ? 96  LEU A CG   3  
ATOM 5207  C CD1  . LEU A 1 96  ? -4.769  -4.932  -3.891  1.00 0.00 ? 96  LEU A CD1  3  
ATOM 5208  C CD2  . LEU A 1 96  ? -3.179  -5.326  -2.000  1.00 0.00 ? 96  LEU A CD2  3  
ATOM 5209  H H    . LEU A 1 96  ? -7.364  -5.265  -0.194  1.00 0.00 ? 96  LEU A H    3  
ATOM 5210  H HA   . LEU A 1 96  ? -4.621  -4.388  0.361   1.00 0.00 ? 96  LEU A HA   3  
ATOM 5211  H HB2  . LEU A 1 96  ? -6.148  -3.641  -2.135  1.00 0.00 ? 96  LEU A HB2  3  
ATOM 5212  H HB3  . LEU A 1 96  ? -4.528  -3.111  -1.700  1.00 0.00 ? 96  LEU A HB3  3  
ATOM 5213  H HG   . LEU A 1 96  ? -5.182  -6.018  -2.119  1.00 0.00 ? 96  LEU A HG   3  
ATOM 5214  H HD11 . LEU A 1 96  ? -4.827  -3.876  -4.114  1.00 0.00 ? 96  LEU A HD11 3  
ATOM 5215  H HD12 . LEU A 1 96  ? -5.664  -5.425  -4.240  1.00 0.00 ? 96  LEU A HD12 3  
ATOM 5216  H HD13 . LEU A 1 96  ? -3.907  -5.356  -4.386  1.00 0.00 ? 96  LEU A HD13 3  
ATOM 5217  H HD21 . LEU A 1 96  ? -2.543  -4.852  -2.733  1.00 0.00 ? 96  LEU A HD21 3  
ATOM 5218  H HD22 . LEU A 1 96  ? -2.959  -6.383  -1.962  1.00 0.00 ? 96  LEU A HD22 3  
ATOM 5219  H HD23 . LEU A 1 96  ? -3.002  -4.886  -1.030  1.00 0.00 ? 96  LEU A HD23 3  
ATOM 5220  N N    . ILE A 1 97  ? -5.511  -2.341  1.410   1.00 0.00 ? 97  ILE A N    3  
ATOM 5221  C CA   . ILE A 1 97  ? -6.023  -1.151  2.077   1.00 0.00 ? 97  ILE A CA   3  
ATOM 5222  C C    . ILE A 1 97  ? -4.979  -0.040  2.097   1.00 0.00 ? 97  ILE A C    3  
ATOM 5223  O O    . ILE A 1 97  ? -4.264  0.138   3.084   1.00 0.00 ? 97  ILE A O    3  
ATOM 5224  C CB   . ILE A 1 97  ? -6.456  -1.459  3.524   1.00 0.00 ? 97  ILE A CB   3  
ATOM 5225  C CG1  . ILE A 1 97  ? -7.348  -2.702  3.560   1.00 0.00 ? 97  ILE A CG1  3  
ATOM 5226  C CG2  . ILE A 1 97  ? -7.179  -0.264  4.126   1.00 0.00 ? 97  ILE A CG2  3  
ATOM 5227  C CD1  . ILE A 1 97  ? -6.573  -4.002  3.534   1.00 0.00 ? 97  ILE A CD1  3  
ATOM 5228  H H    . ILE A 1 97  ? -4.638  -2.699  1.676   1.00 0.00 ? 97  ILE A H    3  
ATOM 5229  H HA   . ILE A 1 97  ? -6.889  -0.807  1.530   1.00 0.00 ? 97  ILE A HA   3  
ATOM 5230  H HB   . ILE A 1 97  ? -5.568  -1.643  4.110   1.00 0.00 ? 97  ILE A HB   3  
ATOM 5231  H HG12 . ILE A 1 97  ? -7.937  -2.687  4.465   1.00 0.00 ? 97  ILE A HG12 3  
ATOM 5232  H HG13 . ILE A 1 97  ? -8.006  -2.690  2.704   1.00 0.00 ? 97  ILE A HG13 3  
ATOM 5233  H HG21 . ILE A 1 97  ? -7.657  -0.559  5.049   1.00 0.00 ? 97  ILE A HG21 3  
ATOM 5234  H HG22 . ILE A 1 97  ? -7.927  0.092   3.431   1.00 0.00 ? 97  ILE A HG22 3  
ATOM 5235  H HG23 . ILE A 1 97  ? -6.469  0.524   4.325   1.00 0.00 ? 97  ILE A HG23 3  
ATOM 5236  H HD11 . ILE A 1 97  ? -6.941  -4.623  2.731   1.00 0.00 ? 97  ILE A HD11 3  
ATOM 5237  H HD12 . ILE A 1 97  ? -6.701  -4.516  4.475   1.00 0.00 ? 97  ILE A HD12 3  
ATOM 5238  H HD13 . ILE A 1 97  ? -5.525  -3.794  3.377   1.00 0.00 ? 97  ILE A HD13 3  
ATOM 5239  N N    . LEU A 1 98  ? -4.893  0.705   1.000   1.00 0.00 ? 98  LEU A N    3  
ATOM 5240  C CA   . LEU A 1 98  ? -3.934  1.799   0.890   1.00 0.00 ? 98  LEU A CA   3  
ATOM 5241  C C    . LEU A 1 98  ? -4.392  3.009   1.697   1.00 0.00 ? 98  LEU A C    3  
ATOM 5242  O O    . LEU A 1 98  ? -5.588  3.220   1.897   1.00 0.00 ? 98  LEU A O    3  
ATOM 5243  C CB   . LEU A 1 98  ? -3.743  2.192   -0.576  1.00 0.00 ? 98  LEU A CB   3  
ATOM 5244  C CG   . LEU A 1 98  ? -3.187  1.088   -1.476  1.00 0.00 ? 98  LEU A CG   3  
ATOM 5245  C CD1  . LEU A 1 98  ? -4.299  0.152   -1.922  1.00 0.00 ? 98  LEU A CD1  3  
ATOM 5246  C CD2  . LEU A 1 98  ? -2.478  1.688   -2.681  1.00 0.00 ? 98  LEU A CD2  3  
ATOM 5247  H H    . LEU A 1 98  ? -5.490  0.515   0.245   1.00 0.00 ? 98  LEU A H    3  
ATOM 5248  H HA   . LEU A 1 98  ? -2.992  1.453   1.287   1.00 0.00 ? 98  LEU A HA   3  
ATOM 5249  H HB2  . LEU A 1 98  ? -4.699  2.503   -0.971  1.00 0.00 ? 98  LEU A HB2  3  
ATOM 5250  H HB3  . LEU A 1 98  ? -3.066  3.032   -0.616  1.00 0.00 ? 98  LEU A HB3  3  
ATOM 5251  H HG   . LEU A 1 98  ? -2.466  0.506   -0.918  1.00 0.00 ? 98  LEU A HG   3  
ATOM 5252  H HD11 . LEU A 1 98  ? -3.995  -0.366  -2.820  1.00 0.00 ? 98  LEU A HD11 3  
ATOM 5253  H HD12 . LEU A 1 98  ? -5.192  0.724   -2.122  1.00 0.00 ? 98  LEU A HD12 3  
ATOM 5254  H HD13 . LEU A 1 98  ? -4.500  -0.568  -1.142  1.00 0.00 ? 98  LEU A HD13 3  
ATOM 5255  H HD21 . LEU A 1 98  ? -2.597  1.035   -3.532  1.00 0.00 ? 98  LEU A HD21 3  
ATOM 5256  H HD22 . LEU A 1 98  ? -1.427  1.804   -2.460  1.00 0.00 ? 98  LEU A HD22 3  
ATOM 5257  H HD23 . LEU A 1 98  ? -2.906  2.654   -2.905  1.00 0.00 ? 98  LEU A HD23 3  
ATOM 5258  N N    . THR A 1 99  ? -3.430  3.804   2.157   1.00 0.00 ? 99  THR A N    3  
ATOM 5259  C CA   . THR A 1 99  ? -3.732  4.995   2.941   1.00 0.00 ? 99  THR A CA   3  
ATOM 5260  C C    . THR A 1 99  ? -3.056  6.224   2.343   1.00 0.00 ? 99  THR A C    3  
ATOM 5261  O O    . THR A 1 99  ? -1.937  6.575   2.720   1.00 0.00 ? 99  THR A O    3  
ATOM 5262  C CB   . THR A 1 99  ? -3.281  4.805   4.390   1.00 0.00 ? 99  THR A CB   3  
ATOM 5263  O OG1  . THR A 1 99  ? -3.792  3.595   4.920   1.00 0.00 ? 99  THR A OG1  3  
ATOM 5264  C CG2  . THR A 1 99  ? -3.719  5.928   5.306   1.00 0.00 ? 99  THR A CG2  3  
ATOM 5265  H H    . THR A 1 99  ? -2.496  3.583   1.963   1.00 0.00 ? 99  THR A H    3  
ATOM 5266  H HA   . THR A 1 99  ? -4.802  5.143   2.923   1.00 0.00 ? 99  THR A HA   3  
ATOM 5267  H HB   . THR A 1 99  ? -2.201  4.759   4.417   1.00 0.00 ? 99  THR A HB   3  
ATOM 5268  H HG1  . THR A 1 99  ? -3.540  2.864   4.350   1.00 0.00 ? 99  THR A HG1  3  
ATOM 5269  H HG21 . THR A 1 99  ? -3.781  6.848   4.743   1.00 0.00 ? 99  THR A HG21 3  
ATOM 5270  H HG22 . THR A 1 99  ? -3.001  6.042   6.105   1.00 0.00 ? 99  THR A HG22 3  
ATOM 5271  H HG23 . THR A 1 99  ? -4.687  5.695   5.723   1.00 0.00 ? 99  THR A HG23 3  
ATOM 5272  N N    . VAL A 1 100 ? -3.740  6.876   1.408   1.00 0.00 ? 100 VAL A N    3  
ATOM 5273  C CA   . VAL A 1 100 ? -3.205  8.064   0.758   1.00 0.00 ? 100 VAL A CA   3  
ATOM 5274  C C    . VAL A 1 100 ? -3.798  9.334   1.358   1.00 0.00 ? 100 VAL A C    3  
ATOM 5275  O O    . VAL A 1 100 ? -4.863  9.303   1.976   1.00 0.00 ? 100 VAL A O    3  
ATOM 5276  C CB   . VAL A 1 100 ? -3.481  8.049   -0.757  1.00 0.00 ? 100 VAL A CB   3  
ATOM 5277  C CG1  . VAL A 1 100 ? -2.722  6.917   -1.428  1.00 0.00 ? 100 VAL A CG1  3  
ATOM 5278  C CG2  . VAL A 1 100 ? -4.975  7.932   -1.026  1.00 0.00 ? 100 VAL A CG2  3  
ATOM 5279  H H    . VAL A 1 100 ? -4.627  6.547   1.150   1.00 0.00 ? 100 VAL A H    3  
ATOM 5280  H HA   . VAL A 1 100 ? -2.135  8.074   0.907   1.00 0.00 ? 100 VAL A HA   3  
ATOM 5281  H HB   . VAL A 1 100 ? -3.136  8.983   -1.175  1.00 0.00 ? 100 VAL A HB   3  
ATOM 5282  H HG11 . VAL A 1 100 ? -3.206  6.658   -2.358  1.00 0.00 ? 100 VAL A HG11 3  
ATOM 5283  H HG12 . VAL A 1 100 ? -2.711  6.054   -0.777  1.00 0.00 ? 100 VAL A HG12 3  
ATOM 5284  H HG13 . VAL A 1 100 ? -1.707  7.231   -1.625  1.00 0.00 ? 100 VAL A HG13 3  
ATOM 5285  H HG21 . VAL A 1 100 ? -5.524  8.265   -0.157  1.00 0.00 ? 100 VAL A HG21 3  
ATOM 5286  H HG22 . VAL A 1 100 ? -5.222  6.902   -1.236  1.00 0.00 ? 100 VAL A HG22 3  
ATOM 5287  H HG23 . VAL A 1 100 ? -5.237  8.546   -1.875  1.00 0.00 ? 100 VAL A HG23 3  
ATOM 5288  N N    . LYS A 1 101 ? -3.102  10.451  1.174   1.00 0.00 ? 101 LYS A N    3  
ATOM 5289  C CA   . LYS A 1 101 ? -3.559  11.733  1.697   1.00 0.00 ? 101 LYS A CA   3  
ATOM 5290  C C    . LYS A 1 101 ? -3.992  12.660  0.566   1.00 0.00 ? 101 LYS A C    3  
ATOM 5291  O O    . LYS A 1 101 ? -3.649  12.439  -0.597  1.00 0.00 ? 101 LYS A O    3  
ATOM 5292  C CB   . LYS A 1 101 ? -2.452  12.396  2.519   1.00 0.00 ? 101 LYS A CB   3  
ATOM 5293  C CG   . LYS A 1 101 ? -1.143  12.552  1.761   1.00 0.00 ? 101 LYS A CG   3  
ATOM 5294  C CD   . LYS A 1 101 ? -0.553  13.941  1.942   1.00 0.00 ? 101 LYS A CD   3  
ATOM 5295  C CE   . LYS A 1 101 ? 0.200   14.393  0.701   1.00 0.00 ? 101 LYS A CE   3  
ATOM 5296  N NZ   . LYS A 1 101 ? 1.368   15.251  1.042   1.00 0.00 ? 101 LYS A NZ   3  
ATOM 5297  H H    . LYS A 1 101 ? -2.259  10.413  0.673   1.00 0.00 ? 101 LYS A H    3  
ATOM 5298  H HA   . LYS A 1 101 ? -4.408  11.546  2.337   1.00 0.00 ? 101 LYS A HA   3  
ATOM 5299  H HB2  . LYS A 1 101 ? -2.786  13.377  2.826   1.00 0.00 ? 101 LYS A HB2  3  
ATOM 5300  H HB3  . LYS A 1 101 ? -2.265  11.797  3.398   1.00 0.00 ? 101 LYS A HB3  3  
ATOM 5301  H HG2  . LYS A 1 101 ? -0.437  11.822  2.129   1.00 0.00 ? 101 LYS A HG2  3  
ATOM 5302  H HG3  . LYS A 1 101 ? -1.325  12.382  0.709   1.00 0.00 ? 101 LYS A HG3  3  
ATOM 5303  H HD2  . LYS A 1 101 ? -1.354  14.639  2.139   1.00 0.00 ? 101 LYS A HD2  3  
ATOM 5304  H HD3  . LYS A 1 101 ? 0.127   13.927  2.781   1.00 0.00 ? 101 LYS A HD3  3  
ATOM 5305  H HE2  . LYS A 1 101 ? 0.549   13.520  0.171   1.00 0.00 ? 101 LYS A HE2  3  
ATOM 5306  H HE3  . LYS A 1 101 ? -0.475  14.953  0.070   1.00 0.00 ? 101 LYS A HE3  3  
ATOM 5307  H HZ1  . LYS A 1 101 ? 1.506   15.975  0.309   1.00 0.00 ? 101 LYS A HZ1  3  
ATOM 5308  H HZ2  . LYS A 1 101 ? 2.230   14.673  1.107   1.00 0.00 ? 101 LYS A HZ2  3  
ATOM 5309  H HZ3  . LYS A 1 101 ? 1.212   15.722  1.956   1.00 0.00 ? 101 LYS A HZ3  3  
ATOM 5310  N N    . ASP A 1 102 ? -4.746  13.697  0.913   1.00 0.00 ? 102 ASP A N    3  
ATOM 5311  C CA   . ASP A 1 102 ? -5.226  14.658  -0.074  1.00 0.00 ? 102 ASP A CA   3  
ATOM 5312  C C    . ASP A 1 102 ? -4.078  15.509  -0.608  1.00 0.00 ? 102 ASP A C    3  
ATOM 5313  O O    . ASP A 1 102 ? -3.706  16.515  -0.004  1.00 0.00 ? 102 ASP A O    3  
ATOM 5314  C CB   . ASP A 1 102 ? -6.301  15.558  0.540   1.00 0.00 ? 102 ASP A CB   3  
ATOM 5315  C CG   . ASP A 1 102 ? -7.424  14.763  1.177   1.00 0.00 ? 102 ASP A CG   3  
ATOM 5316  O OD1  . ASP A 1 102 ? -7.838  13.742  0.588   1.00 0.00 ? 102 ASP A OD1  3  
ATOM 5317  O OD2  . ASP A 1 102 ? -7.888  15.161  2.267   1.00 0.00 ? 102 ASP A OD2  3  
ATOM 5318  H H    . ASP A 1 102 ? -4.987  13.819  1.855   1.00 0.00 ? 102 ASP A H    3  
ATOM 5319  H HA   . ASP A 1 102 ? -5.659  14.103  -0.892  1.00 0.00 ? 102 ASP A HA   3  
ATOM 5320  H HB2  . ASP A 1 102 ? -5.849  16.181  1.301   1.00 0.00 ? 102 ASP A HB2  3  
ATOM 5321  H HB3  . ASP A 1 102 ? -6.721  16.185  -0.235  1.00 0.00 ? 102 ASP A HB3  3  
ATOM 5322  N N    . VAL A 1 103 ? -3.523  15.098  -1.744  1.00 0.00 ? 103 VAL A N    3  
ATOM 5323  C CA   . VAL A 1 103 ? -2.419  15.824  -2.359  1.00 0.00 ? 103 VAL A CA   3  
ATOM 5324  C C    . VAL A 1 103 ? -2.843  17.234  -2.755  1.00 0.00 ? 103 VAL A C    3  
ATOM 5325  O O    . VAL A 1 103 ? -2.038  18.166  -2.729  1.00 0.00 ? 103 VAL A O    3  
ATOM 5326  C CB   . VAL A 1 103 ? -1.888  15.089  -3.605  1.00 0.00 ? 103 VAL A CB   3  
ATOM 5327  C CG1  . VAL A 1 103 ? -0.642  15.777  -4.143  1.00 0.00 ? 103 VAL A CG1  3  
ATOM 5328  C CG2  . VAL A 1 103 ? -1.602  13.629  -3.286  1.00 0.00 ? 103 VAL A CG2  3  
ATOM 5329  H H    . VAL A 1 103 ? -3.865  14.289  -2.177  1.00 0.00 ? 103 VAL A H    3  
ATOM 5330  H HA   . VAL A 1 103 ? -1.618  15.889  -1.637  1.00 0.00 ? 103 VAL A HA   3  
ATOM 5331  H HB   . VAL A 1 103 ? -2.650  15.125  -4.371  1.00 0.00 ? 103 VAL A HB   3  
ATOM 5332  H HG11 . VAL A 1 103 ? -0.605  16.792  -3.776  1.00 0.00 ? 103 VAL A HG11 3  
ATOM 5333  H HG12 . VAL A 1 103 ? -0.673  15.785  -5.223  1.00 0.00 ? 103 VAL A HG12 3  
ATOM 5334  H HG13 . VAL A 1 103 ? 0.235   15.241  -3.813  1.00 0.00 ? 103 VAL A HG13 3  
ATOM 5335  H HG21 . VAL A 1 103 ? -2.111  13.352  -2.375  1.00 0.00 ? 103 VAL A HG21 3  
ATOM 5336  H HG22 . VAL A 1 103 ? -0.539  13.489  -3.160  1.00 0.00 ? 103 VAL A HG22 3  
ATOM 5337  H HG23 . VAL A 1 103 ? -1.954  13.008  -4.097  1.00 0.00 ? 103 VAL A HG23 3  
ATOM 5338  N N    . GLY A 1 104 ? -4.111  17.384  -3.124  1.00 0.00 ? 104 GLY A N    3  
ATOM 5339  C CA   . GLY A 1 104 ? -4.619  18.683  -3.521  1.00 0.00 ? 104 GLY A CA   3  
ATOM 5340  C C    . GLY A 1 104 ? -6.123  18.791  -3.359  1.00 0.00 ? 104 GLY A C    3  
ATOM 5341  O O    . GLY A 1 104 ? -6.615  19.627  -2.602  1.00 0.00 ? 104 GLY A O    3  
ATOM 5342  H H    . GLY A 1 104 ? -4.706  16.605  -3.126  1.00 0.00 ? 104 GLY A H    3  
ATOM 5343  H HA2  . GLY A 1 104 ? -4.148  19.443  -2.913  1.00 0.00 ? 104 GLY A HA2  3  
ATOM 5344  H HA3  . GLY A 1 104 ? -4.366  18.856  -4.556  1.00 0.00 ? 104 GLY A HA3  3  
ATOM 5345  N N    . ARG A 1 105 ? -6.854  17.943  -4.075  1.00 0.00 ? 105 ARG A N    3  
ATOM 5346  C CA   . ARG A 1 105 ? -8.311  17.944  -4.009  1.00 0.00 ? 105 ARG A CA   3  
ATOM 5347  C C    . ARG A 1 105 ? -8.875  19.300  -4.426  1.00 0.00 ? 105 ARG A C    3  
ATOM 5348  O O    . ARG A 1 105 ? -8.957  20.224  -3.616  1.00 0.00 ? 105 ARG A O    3  
ATOM 5349  C CB   . ARG A 1 105 ? -8.778  17.593  -2.594  1.00 0.00 ? 105 ARG A CB   3  
ATOM 5350  C CG   . ARG A 1 105 ? -9.639  16.342  -2.534  1.00 0.00 ? 105 ARG A CG   3  
ATOM 5351  C CD   . ARG A 1 105 ? -8.793  15.090  -2.374  1.00 0.00 ? 105 ARG A CD   3  
ATOM 5352  N NE   . ARG A 1 105 ? -9.370  13.946  -3.075  1.00 0.00 ? 105 ARG A NE   3  
ATOM 5353  C CZ   . ARG A 1 105 ? -10.380 13.218  -2.602  1.00 0.00 ? 105 ARG A CZ   3  
ATOM 5354  N NH1  . ARG A 1 105 ? -10.925 13.511  -1.428  1.00 0.00 ? 105 ARG A NH1  3  
ATOM 5355  N NH2  . ARG A 1 105 ? -10.846 12.195  -3.305  1.00 0.00 ? 105 ARG A NH2  3  
ATOM 5356  H H    . ARG A 1 105 ? -6.403  17.299  -4.662  1.00 0.00 ? 105 ARG A H    3  
ATOM 5357  H HA   . ARG A 1 105 ? -8.674  17.193  -4.694  1.00 0.00 ? 105 ARG A HA   3  
ATOM 5358  H HB2  . ARG A 1 105 ? -7.910  17.436  -1.970  1.00 0.00 ? 105 ARG A HB2  3  
ATOM 5359  H HB3  . ARG A 1 105 ? -9.351  18.418  -2.199  1.00 0.00 ? 105 ARG A HB3  3  
ATOM 5360  H HG2  . ARG A 1 105 ? -10.311 16.421  -1.693  1.00 0.00 ? 105 ARG A HG2  3  
ATOM 5361  H HG3  . ARG A 1 105 ? -10.211 16.266  -3.447  1.00 0.00 ? 105 ARG A HG3  3  
ATOM 5362  H HD2  . ARG A 1 105 ? -7.808  15.283  -2.772  1.00 0.00 ? 105 ARG A HD2  3  
ATOM 5363  H HD3  . ARG A 1 105 ? -8.716  14.854  -1.323  1.00 0.00 ? 105 ARG A HD3  3  
ATOM 5364  H HE   . ARG A 1 105 ? -8.987  13.707  -3.945  1.00 0.00 ? 105 ARG A HE   3  
ATOM 5365  H HH11 . ARG A 1 105 ? -10.578 14.281  -0.892  1.00 0.00 ? 105 ARG A HH11 3  
ATOM 5366  H HH12 . ARG A 1 105 ? -11.684 12.961  -1.078  1.00 0.00 ? 105 ARG A HH12 3  
ATOM 5367  H HH21 . ARG A 1 105 ? -10.439 11.970  -4.191  1.00 0.00 ? 105 ARG A HH21 3  
ATOM 5368  H HH22 . ARG A 1 105 ? -11.604 11.648  -2.950  1.00 0.00 ? 105 ARG A HH22 3  
ATOM 5369  N N    . LEU A 1 106 ? -9.260  19.411  -5.693  1.00 0.00 ? 106 LEU A N    3  
ATOM 5370  C CA   . LEU A 1 106 ? -9.816  20.653  -6.218  1.00 0.00 ? 106 LEU A CA   3  
ATOM 5371  C C    . LEU A 1 106 ? -11.267 20.456  -6.654  1.00 0.00 ? 106 LEU A C    3  
ATOM 5372  O O    . LEU A 1 106 ? -11.550 19.651  -7.542  1.00 0.00 ? 106 LEU A O    3  
ATOM 5373  C CB   . LEU A 1 106 ? -8.979  21.149  -7.398  1.00 0.00 ? 106 LEU A CB   3  
ATOM 5374  C CG   . LEU A 1 106 ? -7.802  22.052  -7.025  1.00 0.00 ? 106 LEU A CG   3  
ATOM 5375  C CD1  . LEU A 1 106 ? -6.762  22.059  -8.133  1.00 0.00 ? 106 LEU A CD1  3  
ATOM 5376  C CD2  . LEU A 1 106 ? -8.286  23.466  -6.736  1.00 0.00 ? 106 LEU A CD2  3  
ATOM 5377  H H    . LEU A 1 106 ? -9.169  18.638  -6.289  1.00 0.00 ? 106 LEU A H    3  
ATOM 5378  H HA   . LEU A 1 106 ? -9.781  21.388  -5.429  1.00 0.00 ? 106 LEU A HA   3  
ATOM 5379  H HB2  . LEU A 1 106 ? -8.594  20.290  -7.926  1.00 0.00 ? 106 LEU A HB2  3  
ATOM 5380  H HB3  . LEU A 1 106 ? -9.627  21.699  -8.065  1.00 0.00 ? 106 LEU A HB3  3  
ATOM 5381  H HG   . LEU A 1 106 ? -7.334  21.669  -6.130  1.00 0.00 ? 106 LEU A HG   3  
ATOM 5382  H HD11 . LEU A 1 106 ? -5.874  22.570  -7.790  1.00 0.00 ? 106 LEU A HD11 3  
ATOM 5383  H HD12 . LEU A 1 106 ? -7.160  22.570  -8.997  1.00 0.00 ? 106 LEU A HD12 3  
ATOM 5384  H HD13 . LEU A 1 106 ? -6.512  21.043  -8.399  1.00 0.00 ? 106 LEU A HD13 3  
ATOM 5385  H HD21 . LEU A 1 106 ? -8.209  24.062  -7.633  1.00 0.00 ? 106 LEU A HD21 3  
ATOM 5386  H HD22 . LEU A 1 106 ? -7.676  23.903  -5.959  1.00 0.00 ? 106 LEU A HD22 3  
ATOM 5387  H HD23 . LEU A 1 106 ? -9.315  23.434  -6.412  1.00 0.00 ? 106 LEU A HD23 3  
ATOM 5388  N N    . PRO A 1 107 ? -12.213 21.189  -6.036  1.00 0.00 ? 107 PRO A N    3  
ATOM 5389  C CA   . PRO A 1 107 ? -13.637 21.081  -6.375  1.00 0.00 ? 107 PRO A CA   3  
ATOM 5390  C C    . PRO A 1 107 ? -13.890 21.239  -7.870  1.00 0.00 ? 107 PRO A C    3  
ATOM 5391  O O    . PRO A 1 107 ? -14.461 20.356  -8.509  1.00 0.00 ? 107 PRO A O    3  
ATOM 5392  C CB   . PRO A 1 107 ? -14.276 22.235  -5.599  1.00 0.00 ? 107 PRO A CB   3  
ATOM 5393  C CG   . PRO A 1 107 ? -13.355 22.477  -4.455  1.00 0.00 ? 107 PRO A CG   3  
ATOM 5394  C CD   . PRO A 1 107 ? -11.974 22.175  -4.966  1.00 0.00 ? 107 PRO A CD   3  
ATOM 5395  H HA   . PRO A 1 107 ? -14.052 20.143  -6.038  1.00 0.00 ? 107 PRO A HA   3  
ATOM 5396  H HB2  . PRO A 1 107 ? -14.351 23.104  -6.239  1.00 0.00 ? 107 PRO A HB2  3  
ATOM 5397  H HB3  . PRO A 1 107 ? -15.260 21.942  -5.259  1.00 0.00 ? 107 PRO A HB3  3  
ATOM 5398  H HG2  . PRO A 1 107 ? -13.423 23.508  -4.142  1.00 0.00 ? 107 PRO A HG2  3  
ATOM 5399  H HG3  . PRO A 1 107 ? -13.605 21.818  -3.637  1.00 0.00 ? 107 PRO A HG3  3  
ATOM 5400  H HD2  . PRO A 1 107 ? -11.514 23.070  -5.362  1.00 0.00 ? 107 PRO A HD2  3  
ATOM 5401  H HD3  . PRO A 1 107 ? -11.365 21.750  -4.180  1.00 0.00 ? 107 PRO A HD3  3  
ATOM 5402  N N    . HIS A 1 108 ? -13.460 22.369  -8.422  1.00 0.00 ? 108 HIS A N    3  
ATOM 5403  C CA   . HIS A 1 108 ? -13.641 22.643  -9.843  1.00 0.00 ? 108 HIS A CA   3  
ATOM 5404  C C    . HIS A 1 108 ? -12.520 22.013  -10.664 1.00 0.00 ? 108 HIS A C    3  
ATOM 5405  O O    . HIS A 1 108 ? -11.461 21.676  -10.132 1.00 0.00 ? 108 HIS A O    3  
ATOM 5406  C CB   . HIS A 1 108 ? -13.691 24.152  -10.091 1.00 0.00 ? 108 HIS A CB   3  
ATOM 5407  C CG   . HIS A 1 108 ? -14.931 24.600  -10.800 1.00 0.00 ? 108 HIS A CG   3  
ATOM 5408  N ND1  . HIS A 1 108 ? -16.141 24.772  -10.162 1.00 0.00 ? 108 HIS A ND1  3  
ATOM 5409  C CD2  . HIS A 1 108 ? -15.145 24.914  -12.099 1.00 0.00 ? 108 HIS A CD2  3  
ATOM 5410  C CE1  . HIS A 1 108 ? -17.046 25.171  -11.039 1.00 0.00 ? 108 HIS A CE1  3  
ATOM 5411  N NE2  . HIS A 1 108 ? -16.467 25.265  -12.221 1.00 0.00 ? 108 HIS A NE2  3  
ATOM 5412  H H    . HIS A 1 108 ? -13.011 23.035  -7.860  1.00 0.00 ? 108 HIS A H    3  
ATOM 5413  H HA   . HIS A 1 108 ? -14.580 22.206  -10.147 1.00 0.00 ? 108 HIS A HA   3  
ATOM 5414  H HB2  . HIS A 1 108 ? -13.646 24.667  -9.143  1.00 0.00 ? 108 HIS A HB2  3  
ATOM 5415  H HB3  . HIS A 1 108 ? -12.841 24.441  -10.692 1.00 0.00 ? 108 HIS A HB3  3  
ATOM 5416  H HD1  . HIS A 1 108 ? -16.313 24.624  -9.208  1.00 0.00 ? 108 HIS A HD1  3  
ATOM 5417  H HD2  . HIS A 1 108 ? -14.412 24.892  -12.893 1.00 0.00 ? 108 HIS A HD2  3  
ATOM 5418  H HE1  . HIS A 1 108 ? -18.083 25.385  -10.824 1.00 0.00 ? 108 HIS A HE1  3  
ATOM 5419  H HE2  . HIS A 1 108 ? -16.932 25.450  -13.064 1.00 0.00 ? 108 HIS A HE2  3  
ATOM 5420  N N    . ALA A 1 109 ? -12.759 21.856  -11.962 1.00 0.00 ? 109 ALA A N    3  
ATOM 5421  C CA   . ALA A 1 109 ? -11.770 21.267  -12.855 1.00 0.00 ? 109 ALA A CA   3  
ATOM 5422  C C    . ALA A 1 109 ? -10.727 22.295  -13.278 1.00 0.00 ? 109 ALA A C    3  
ATOM 5423  O O    . ALA A 1 109 ? -10.948 23.072  -14.207 1.00 0.00 ? 109 ALA A O    3  
ATOM 5424  C CB   . ALA A 1 109 ? -12.453 20.671  -14.077 1.00 0.00 ? 109 ALA A CB   3  
ATOM 5425  H H    . ALA A 1 109 ? -13.622 22.144  -12.327 1.00 0.00 ? 109 ALA A H    3  
ATOM 5426  H HA   . ALA A 1 109 ? -11.276 20.466  -12.324 1.00 0.00 ? 109 ALA A HA   3  
ATOM 5427  H HB1  . ALA A 1 109 ? -11.964 19.746  -14.348 1.00 0.00 ? 109 ALA A HB1  3  
ATOM 5428  H HB2  . ALA A 1 109 ? -12.386 21.367  -14.901 1.00 0.00 ? 109 ALA A HB2  3  
ATOM 5429  H HB3  . ALA A 1 109 ? -13.491 20.478  -13.852 1.00 0.00 ? 109 ALA A HB3  3  
ATOM 5430  N N    . ARG A 1 110 ? -9.591  22.296  -12.588 1.00 0.00 ? 110 ARG A N    3  
ATOM 5431  C CA   . ARG A 1 110 ? -8.513  23.230  -12.893 1.00 0.00 ? 110 ARG A CA   3  
ATOM 5432  C C    . ARG A 1 110 ? -7.187  22.495  -13.058 1.00 0.00 ? 110 ARG A C    3  
ATOM 5433  O O    . ARG A 1 110 ? -6.555  22.105  -12.075 1.00 0.00 ? 110 ARG A O    3  
ATOM 5434  C CB   . ARG A 1 110 ? -8.392  24.281  -11.788 1.00 0.00 ? 110 ARG A CB   3  
ATOM 5435  C CG   . ARG A 1 110 ? -7.605  25.512  -12.203 1.00 0.00 ? 110 ARG A CG   3  
ATOM 5436  C CD   . ARG A 1 110 ? -8.521  26.630  -12.670 1.00 0.00 ? 110 ARG A CD   3  
ATOM 5437  N NE   . ARG A 1 110 ? -9.421  27.080  -11.611 1.00 0.00 ? 110 ARG A NE   3  
ATOM 5438  C CZ   . ARG A 1 110 ? -10.082 28.235  -11.639 1.00 0.00 ? 110 ARG A CZ   3  
ATOM 5439  N NH1  . ARG A 1 110 ? -9.947  29.059  -12.672 1.00 0.00 ? 110 ARG A NH1  3  
ATOM 5440  N NH2  . ARG A 1 110 ? -10.879 28.567  -10.634 1.00 0.00 ? 110 ARG A NH2  3  
ATOM 5441  H H    . ARG A 1 110 ? -9.473  21.652  -11.859 1.00 0.00 ? 110 ARG A H    3  
ATOM 5442  H HA   . ARG A 1 110 ? -8.754  23.723  -13.822 1.00 0.00 ? 110 ARG A HA   3  
ATOM 5443  H HB2  . ARG A 1 110 ? -9.384  24.595  -11.497 1.00 0.00 ? 110 ARG A HB2  3  
ATOM 5444  H HB3  . ARG A 1 110 ? -7.902  23.836  -10.935 1.00 0.00 ? 110 ARG A HB3  3  
ATOM 5445  H HG2  . ARG A 1 110 ? -7.030  25.862  -11.359 1.00 0.00 ? 110 ARG A HG2  3  
ATOM 5446  H HG3  . ARG A 1 110 ? -6.937  25.245  -13.009 1.00 0.00 ? 110 ARG A HG3  3  
ATOM 5447  H HD2  . ARG A 1 110 ? -7.916  27.464  -12.994 1.00 0.00 ? 110 ARG A HD2  3  
ATOM 5448  H HD3  . ARG A 1 110 ? -9.111  26.270  -13.502 1.00 0.00 ? 110 ARG A HD3  3  
ATOM 5449  H HE   . ARG A 1 110 ? -9.538  26.491  -10.837 1.00 0.00 ? 110 ARG A HE   3  
ATOM 5450  H HH11 . ARG A 1 110 ? -9.347  28.814  -13.434 1.00 0.00 ? 110 ARG A HH11 3  
ATOM 5451  H HH12 . ARG A 1 110 ? -10.447 29.925  -12.687 1.00 0.00 ? 110 ARG A HH12 3  
ATOM 5452  H HH21 . ARG A 1 110 ? -10.984 27.951  -9.854  1.00 0.00 ? 110 ARG A HH21 3  
ATOM 5453  H HH22 . ARG A 1 110 ? -11.375 29.436  -10.655 1.00 0.00 ? 110 ARG A HH22 3  
ATOM 5454  N N    . THR A 1 111 ? -6.770  22.308  -14.305 1.00 0.00 ? 111 THR A N    3  
ATOM 5455  C CA   . THR A 1 111 ? -5.519  21.619  -14.599 1.00 0.00 ? 111 THR A CA   3  
ATOM 5456  C C    . THR A 1 111 ? -4.773  22.308  -15.737 1.00 0.00 ? 111 THR A C    3  
ATOM 5457  O O    . THR A 1 111 ? -5.336  23.141  -16.447 1.00 0.00 ? 111 THR A O    3  
ATOM 5458  C CB   . THR A 1 111 ? -5.790  20.158  -14.961 1.00 0.00 ? 111 THR A CB   3  
ATOM 5459  O OG1  . THR A 1 111 ? -6.951  19.685  -14.300 1.00 0.00 ? 111 THR A OG1  3  
ATOM 5460  C CG2  . THR A 1 111 ? -4.649  19.231  -14.603 1.00 0.00 ? 111 THR A CG2  3  
ATOM 5461  H H    . THR A 1 111 ? -7.318  22.641  -15.047 1.00 0.00 ? 111 THR A H    3  
ATOM 5462  H HA   . THR A 1 111 ? -4.906  21.652  -13.710 1.00 0.00 ? 111 THR A HA   3  
ATOM 5463  H HB   . THR A 1 111 ? -5.954  20.086  -16.027 1.00 0.00 ? 111 THR A HB   3  
ATOM 5464  H HG1  . THR A 1 111 ? -6.792  19.657  -13.353 1.00 0.00 ? 111 THR A HG1  3  
ATOM 5465  H HG21 . THR A 1 111 ? -4.150  18.909  -15.506 1.00 0.00 ? 111 THR A HG21 3  
ATOM 5466  H HG22 . THR A 1 111 ? -5.035  18.370  -14.079 1.00 0.00 ? 111 THR A HG22 3  
ATOM 5467  H HG23 . THR A 1 111 ? -3.946  19.752  -13.970 1.00 0.00 ? 111 THR A HG23 3  
ATOM 5468  N N    . THR A 1 112 ? -3.503  21.953  -15.905 1.00 0.00 ? 112 THR A N    3  
ATOM 5469  C CA   . THR A 1 112 ? -2.680  22.538  -16.957 1.00 0.00 ? 112 THR A CA   3  
ATOM 5470  C C    . THR A 1 112 ? -2.437  21.534  -18.080 1.00 0.00 ? 112 THR A C    3  
ATOM 5471  O O    . THR A 1 112 ? -2.302  21.910  -19.245 1.00 0.00 ? 112 THR A O    3  
ATOM 5472  C CB   . THR A 1 112 ? -1.344  23.013  -16.383 1.00 0.00 ? 112 THR A CB   3  
ATOM 5473  O OG1  . THR A 1 112 ? -1.545  23.750  -15.192 1.00 0.00 ? 112 THR A OG1  3  
ATOM 5474  C CG2  . THR A 1 112 ? -0.560  23.887  -17.338 1.00 0.00 ? 112 THR A CG2  3  
ATOM 5475  H H    . THR A 1 112 ? -3.110  21.284  -15.308 1.00 0.00 ? 112 THR A H    3  
ATOM 5476  H HA   . THR A 1 112 ? -3.211  23.388  -17.360 1.00 0.00 ? 112 THR A HA   3  
ATOM 5477  H HB   . THR A 1 112 ? -0.737  22.150  -16.151 1.00 0.00 ? 112 THR A HB   3  
ATOM 5478  H HG1  . THR A 1 112 ? -2.229  24.410  -15.334 1.00 0.00 ? 112 THR A HG1  3  
ATOM 5479  H HG21 . THR A 1 112 ? 0.026   23.265  -17.998 1.00 0.00 ? 112 THR A HG21 3  
ATOM 5480  H HG22 . THR A 1 112 ? 0.097   24.535  -16.776 1.00 0.00 ? 112 THR A HG22 3  
ATOM 5481  H HG23 . THR A 1 112 ? -1.243  24.486  -17.921 1.00 0.00 ? 112 THR A HG23 3  
ATOM 5482  N N    . VAL A 1 113 ? -2.379  20.256  -17.722 1.00 0.00 ? 113 VAL A N    3  
ATOM 5483  C CA   . VAL A 1 113 ? -2.152  19.197  -18.699 1.00 0.00 ? 113 VAL A CA   3  
ATOM 5484  C C    . VAL A 1 113 ? -3.314  19.096  -19.679 1.00 0.00 ? 113 VAL A C    3  
ATOM 5485  O O    . VAL A 1 113 ? -4.436  18.764  -19.295 1.00 0.00 ? 113 VAL A O    3  
ATOM 5486  C CB   . VAL A 1 113 ? -1.953  17.832  -18.014 1.00 0.00 ? 113 VAL A CB   3  
ATOM 5487  C CG1  . VAL A 1 113 ? -1.519  16.785  -19.027 1.00 0.00 ? 113 VAL A CG1  3  
ATOM 5488  C CG2  . VAL A 1 113 ? -0.940  17.945  -16.885 1.00 0.00 ? 113 VAL A CG2  3  
ATOM 5489  H H    . VAL A 1 113 ? -2.494  20.018  -16.778 1.00 0.00 ? 113 VAL A H    3  
ATOM 5490  H HA   . VAL A 1 113 ? -1.251  19.437  -19.246 1.00 0.00 ? 113 VAL A HA   3  
ATOM 5491  H HB   . VAL A 1 113 ? -2.897  17.524  -17.592 1.00 0.00 ? 113 VAL A HB   3  
ATOM 5492  H HG11 . VAL A 1 113 ? -2.377  16.458  -19.597 1.00 0.00 ? 113 VAL A HG11 3  
ATOM 5493  H HG12 . VAL A 1 113 ? -1.088  15.940  -18.510 1.00 0.00 ? 113 VAL A HG12 3  
ATOM 5494  H HG13 . VAL A 1 113 ? -0.785  17.211  -19.694 1.00 0.00 ? 113 VAL A HG13 3  
ATOM 5495  H HG21 . VAL A 1 113 ? -0.272  18.772  -17.080 1.00 0.00 ? 113 VAL A HG21 3  
ATOM 5496  H HG22 . VAL A 1 113 ? -0.370  17.029  -16.820 1.00 0.00 ? 113 VAL A HG22 3  
ATOM 5497  H HG23 . VAL A 1 113 ? -1.457  18.113  -15.951 1.00 0.00 ? 113 VAL A HG23 3  
ATOM 5498  N N    . ASP A 1 114 ? -3.039  19.384  -20.947 1.00 0.00 ? 114 ASP A N    3  
ATOM 5499  C CA   . ASP A 1 114 ? -4.064  19.325  -21.984 1.00 0.00 ? 114 ASP A CA   3  
ATOM 5500  C C    . ASP A 1 114 ? -3.928  18.051  -22.810 1.00 0.00 ? 114 ASP A C    3  
ATOM 5501  O O    . ASP A 1 114 ? -4.911  17.356  -23.065 1.00 0.00 ? 114 ASP A O    3  
ATOM 5502  C CB   . ASP A 1 114 ? -3.968  20.551  -22.895 1.00 0.00 ? 114 ASP A CB   3  
ATOM 5503  C CG   . ASP A 1 114 ? -4.869  21.682  -22.438 1.00 0.00 ? 114 ASP A CG   3  
ATOM 5504  O OD1  . ASP A 1 114 ? -4.878  21.981  -21.227 1.00 0.00 ? 114 ASP A OD1  3  
ATOM 5505  O OD2  . ASP A 1 114 ? -5.565  22.268  -23.294 1.00 0.00 ? 114 ASP A OD2  3  
ATOM 5506  H H    . ASP A 1 114 ? -2.126  19.643  -21.192 1.00 0.00 ? 114 ASP A H    3  
ATOM 5507  H HA   . ASP A 1 114 ? -5.027  19.323  -21.498 1.00 0.00 ? 114 ASP A HA   3  
ATOM 5508  H HB2  . ASP A 1 114 ? -2.949  20.907  -22.902 1.00 0.00 ? 114 ASP A HB2  3  
ATOM 5509  H HB3  . ASP A 1 114 ? -4.253  20.269  -23.898 1.00 0.00 ? 114 ASP A HB3  3  
ATOM 5510  N N    . GLU A 1 115 ? -2.702  17.749  -23.226 1.00 0.00 ? 115 GLU A N    3  
ATOM 5511  C CA   . GLU A 1 115 ? -2.437  16.557  -24.024 1.00 0.00 ? 115 GLU A CA   3  
ATOM 5512  C C    . GLU A 1 115 ? -2.303  15.325  -23.135 1.00 0.00 ? 115 GLU A C    3  
ATOM 5513  O O    . GLU A 1 115 ? -1.551  15.329  -22.161 1.00 0.00 ? 115 GLU A O    3  
ATOM 5514  C CB   . GLU A 1 115 ? -1.164  16.747  -24.854 1.00 0.00 ? 115 GLU A CB   3  
ATOM 5515  C CG   . GLU A 1 115 ? -1.337  16.384  -26.321 1.00 0.00 ? 115 GLU A CG   3  
ATOM 5516  C CD   . GLU A 1 115 ? -0.391  15.285  -26.766 1.00 0.00 ? 115 GLU A CD   3  
ATOM 5517  O OE1  . GLU A 1 115 ? 0.800   15.341  -26.396 1.00 0.00 ? 115 GLU A OE1  3  
ATOM 5518  O OE2  . GLU A 1 115 ? -0.843  14.366  -27.482 1.00 0.00 ? 115 GLU A OE2  3  
ATOM 5519  H H    . GLU A 1 115 ? -1.958  18.341  -22.991 1.00 0.00 ? 115 GLU A H    3  
ATOM 5520  H HA   . GLU A 1 115 ? -3.274  16.415  -24.692 1.00 0.00 ? 115 GLU A HA   3  
ATOM 5521  H HB2  . GLU A 1 115 ? -0.862  17.782  -24.795 1.00 0.00 ? 115 GLU A HB2  3  
ATOM 5522  H HB3  . GLU A 1 115 ? -0.382  16.128  -24.440 1.00 0.00 ? 115 GLU A HB3  3  
ATOM 5523  H HG2  . GLU A 1 115 ? -2.351  16.050  -26.480 1.00 0.00 ? 115 GLU A HG2  3  
ATOM 5524  H HG3  . GLU A 1 115 ? -1.151  17.263  -26.920 1.00 0.00 ? 115 GLU A HG3  3  
ATOM 5525  N N    . THR A 1 116 ? -3.039  14.272  -23.477 1.00 0.00 ? 116 THR A N    3  
ATOM 5526  C CA   . THR A 1 116 ? -3.001  13.032  -22.711 1.00 0.00 ? 116 THR A CA   3  
ATOM 5527  C C    . THR A 1 116 ? -3.338  11.836  -23.596 1.00 0.00 ? 116 THR A C    3  
ATOM 5528  O O    . THR A 1 116 ? -2.647  10.818  -23.570 1.00 0.00 ? 116 THR A O    3  
ATOM 5529  C CB   . THR A 1 116 ? -3.979  13.105  -21.537 1.00 0.00 ? 116 THR A CB   3  
ATOM 5530  O OG1  . THR A 1 116 ? -4.236  14.451  -21.182 1.00 0.00 ? 116 THR A OG1  3  
ATOM 5531  C CG2  . THR A 1 116 ? -3.481  12.389  -20.299 1.00 0.00 ? 116 THR A CG2  3  
ATOM 5532  H H    . THR A 1 116 ? -3.619  14.330  -24.264 1.00 0.00 ? 116 THR A H    3  
ATOM 5533  H HA   . THR A 1 116 ? -2.000  12.910  -22.327 1.00 0.00 ? 116 THR A HA   3  
ATOM 5534  H HB   . THR A 1 116 ? -4.913  12.646  -21.831 1.00 0.00 ? 116 THR A HB   3  
ATOM 5535  H HG1  . THR A 1 116 ? -5.154  14.542  -20.914 1.00 0.00 ? 116 THR A HG1  3  
ATOM 5536  H HG21 . THR A 1 116 ? -3.926  12.836  -19.423 1.00 0.00 ? 116 THR A HG21 3  
ATOM 5537  H HG22 . THR A 1 116 ? -2.406  12.476  -20.242 1.00 0.00 ? 116 THR A HG22 3  
ATOM 5538  H HG23 . THR A 1 116 ? -3.757  11.346  -20.351 1.00 0.00 ? 116 THR A HG23 3  
ATOM 5539  N N    . LYS A 1 117 ? -4.405  11.967  -24.378 1.00 0.00 ? 117 LYS A N    3  
ATOM 5540  C CA   . LYS A 1 117 ? -4.835  10.898  -25.272 1.00 0.00 ? 117 LYS A CA   3  
ATOM 5541  C C    . LYS A 1 117 ? -4.960  11.407  -26.705 1.00 0.00 ? 117 LYS A C    3  
ATOM 5542  O O    . LYS A 1 117 ? -5.811  10.947  -27.467 1.00 0.00 ? 117 LYS A O    3  
ATOM 5543  C CB   . LYS A 1 117 ? -6.171  10.317  -24.799 1.00 0.00 ? 117 LYS A CB   3  
ATOM 5544  C CG   . LYS A 1 117 ? -6.032  8.983   -24.083 1.00 0.00 ? 117 LYS A CG   3  
ATOM 5545  C CD   . LYS A 1 117 ? -6.805  8.966   -22.774 1.00 0.00 ? 117 LYS A CD   3  
ATOM 5546  C CE   . LYS A 1 117 ? -6.041  9.671   -21.666 1.00 0.00 ? 117 LYS A CE   3  
ATOM 5547  N NZ   . LYS A 1 117 ? -6.935  10.096  -20.555 1.00 0.00 ? 117 LYS A NZ   3  
ATOM 5548  H H    . LYS A 1 117 ? -4.916  12.803  -24.353 1.00 0.00 ? 117 LYS A H    3  
ATOM 5549  H HA   . LYS A 1 117 ? -4.085  10.121  -25.243 1.00 0.00 ? 117 LYS A HA   3  
ATOM 5550  H HB2  . LYS A 1 117 ? -6.635  11.019  -24.121 1.00 0.00 ? 117 LYS A HB2  3  
ATOM 5551  H HB3  . LYS A 1 117 ? -6.815  10.176  -25.653 1.00 0.00 ? 117 LYS A HB3  3  
ATOM 5552  H HG2  . LYS A 1 117 ? -6.413  8.201   -24.722 1.00 0.00 ? 117 LYS A HG2  3  
ATOM 5553  H HG3  . LYS A 1 117 ? -4.987  8.803   -23.876 1.00 0.00 ? 117 LYS A HG3  3  
ATOM 5554  H HD2  . LYS A 1 117 ? -7.751  9.466   -22.919 1.00 0.00 ? 117 LYS A HD2  3  
ATOM 5555  H HD3  . LYS A 1 117 ? -6.979  7.940   -22.482 1.00 0.00 ? 117 LYS A HD3  3  
ATOM 5556  H HE2  . LYS A 1 117 ? -5.293  8.997   -21.275 1.00 0.00 ? 117 LYS A HE2  3  
ATOM 5557  H HE3  . LYS A 1 117 ? -5.555  10.544  -22.080 1.00 0.00 ? 117 LYS A HE3  3  
ATOM 5558  H HZ1  . LYS A 1 117 ? -7.613  9.338   -20.333 1.00 0.00 ? 117 LYS A HZ1  3  
ATOM 5559  H HZ2  . LYS A 1 117 ? -7.464  10.950  -20.827 1.00 0.00 ? 117 LYS A HZ2  3  
ATOM 5560  H HZ3  . LYS A 1 117 ? -6.375  10.305  -19.703 1.00 0.00 ? 117 LYS A HZ3  3  
ATOM 5561  N N    . TRP A 1 118 ? -4.106  12.360  -27.064 1.00 0.00 ? 118 TRP A N    3  
ATOM 5562  C CA   . TRP A 1 118 ? -4.118  12.932  -28.406 1.00 0.00 ? 118 TRP A CA   3  
ATOM 5563  C C    . TRP A 1 118 ? -5.450  13.619  -28.693 1.00 0.00 ? 118 TRP A C    3  
ATOM 5564  O O    . TRP A 1 118 ? -6.381  13.547  -27.891 1.00 0.00 ? 118 TRP A O    3  
ATOM 5565  C CB   . TRP A 1 118 ? -3.857  11.845  -29.451 1.00 0.00 ? 118 TRP A CB   3  
ATOM 5566  C CG   . TRP A 1 118 ? -2.622  11.042  -29.176 1.00 0.00 ? 118 TRP A CG   3  
ATOM 5567  C CD1  . TRP A 1 118 ? -1.328  11.460  -29.298 1.00 0.00 ? 118 TRP A CD1  3  
ATOM 5568  C CD2  . TRP A 1 118 ? -2.565  9.681   -28.734 1.00 0.00 ? 118 TRP A CD2  3  
ATOM 5569  N NE1  . TRP A 1 118 ? -0.470  10.443  -28.958 1.00 0.00 ? 118 TRP A NE1  3  
ATOM 5570  C CE2  . TRP A 1 118 ? -1.205  9.340   -28.608 1.00 0.00 ? 118 TRP A CE2  3  
ATOM 5571  C CE3  . TRP A 1 118 ? -3.531  8.717   -28.431 1.00 0.00 ? 118 TRP A CE3  3  
ATOM 5572  C CZ2  . TRP A 1 118 ? -0.789  8.077   -28.194 1.00 0.00 ? 118 TRP A CZ2  3  
ATOM 5573  C CZ3  . TRP A 1 118 ? -3.117  7.464   -28.020 1.00 0.00 ? 118 TRP A CZ3  3  
ATOM 5574  C CH2  . TRP A 1 118 ? -1.756  7.154   -27.903 1.00 0.00 ? 118 TRP A CH2  3  
ATOM 5575  H H    . TRP A 1 118 ? -3.451  12.685  -26.412 1.00 0.00 ? 118 TRP A H    3  
ATOM 5576  H HA   . TRP A 1 118 ? -3.329  13.667  -28.459 1.00 0.00 ? 118 TRP A HA   3  
ATOM 5577  H HB2  . TRP A 1 118 ? -4.697  11.167  -29.474 1.00 0.00 ? 118 TRP A HB2  3  
ATOM 5578  H HB3  . TRP A 1 118 ? -3.746  12.307  -30.421 1.00 0.00 ? 118 TRP A HB3  3  
ATOM 5579  H HD1  . TRP A 1 118 ? -1.037  12.450  -29.616 1.00 0.00 ? 118 TRP A HD1  3  
ATOM 5580  H HE1  . TRP A 1 118 ? 0.508   10.497  -28.964 1.00 0.00 ? 118 TRP A HE1  3  
ATOM 5581  H HE3  . TRP A 1 118 ? -4.585  8.938   -28.515 1.00 0.00 ? 118 TRP A HE3  3  
ATOM 5582  H HZ2  . TRP A 1 118 ? 0.256   7.822   -28.098 1.00 0.00 ? 118 TRP A HZ2  3  
ATOM 5583  H HZ3  . TRP A 1 118 ? -3.850  6.708   -27.782 1.00 0.00 ? 118 TRP A HZ3  3  
ATOM 5584  H HH2  . TRP A 1 118 ? -1.478  6.162   -27.579 1.00 0.00 ? 118 TRP A HH2  3  
ATOM 5585  N N    . ILE A 1 119 ? -5.531  14.284  -29.840 1.00 0.00 ? 119 ILE A N    3  
ATOM 5586  C CA   . ILE A 1 119 ? -6.748  14.983  -30.233 1.00 0.00 ? 119 ILE A CA   3  
ATOM 5587  C C    . ILE A 1 119 ? -7.929  14.021  -30.326 1.00 0.00 ? 119 ILE A C    3  
ATOM 5588  O O    . ILE A 1 119 ? -7.954  13.132  -31.176 1.00 0.00 ? 119 ILE A O    3  
ATOM 5589  C CB   . ILE A 1 119 ? -6.569  15.704  -31.585 1.00 0.00 ? 119 ILE A CB   3  
ATOM 5590  C CG1  . ILE A 1 119 ? -7.807  16.542  -31.915 1.00 0.00 ? 119 ILE A CG1  3  
ATOM 5591  C CG2  . ILE A 1 119 ? -6.293  14.698  -32.694 1.00 0.00 ? 119 ILE A CG2  3  
ATOM 5592  C CD1  . ILE A 1 119 ? -7.678  17.995  -31.510 1.00 0.00 ? 119 ILE A CD1  3  
ATOM 5593  H H    . ILE A 1 119 ? -4.754  14.304  -30.438 1.00 0.00 ? 119 ILE A H    3  
ATOM 5594  H HA   . ILE A 1 119 ? -6.962  15.728  -29.479 1.00 0.00 ? 119 ILE A HA   3  
ATOM 5595  H HB   . ILE A 1 119 ? -5.714  16.357  -31.507 1.00 0.00 ? 119 ILE A HB   3  
ATOM 5596  H HG12 . ILE A 1 119 ? -7.984  16.510  -32.979 1.00 0.00 ? 119 ILE A HG12 3  
ATOM 5597  H HG13 . ILE A 1 119 ? -8.662  16.129  -31.400 1.00 0.00 ? 119 ILE A HG13 3  
ATOM 5598  H HG21 . ILE A 1 119 ? -7.225  14.277  -33.039 1.00 0.00 ? 119 ILE A HG21 3  
ATOM 5599  H HG22 . ILE A 1 119 ? -5.661  13.908  -32.314 1.00 0.00 ? 119 ILE A HG22 3  
ATOM 5600  H HG23 . ILE A 1 119 ? -5.795  15.194  -33.514 1.00 0.00 ? 119 ILE A HG23 3  
ATOM 5601  H HD11 . ILE A 1 119 ? -7.097  18.524  -32.252 1.00 0.00 ? 119 ILE A HD11 3  
ATOM 5602  H HD12 . ILE A 1 119 ? -7.181  18.059  -30.553 1.00 0.00 ? 119 ILE A HD12 3  
ATOM 5603  H HD13 . ILE A 1 119 ? -8.659  18.438  -31.438 1.00 0.00 ? 119 ILE A HD13 3  
ATOM 5604  N N    . ALA A 1 120 ? -8.906  14.207  -29.444 1.00 0.00 ? 120 ALA A N    3  
ATOM 5605  C CA   . ALA A 1 120 ? -10.090 13.356  -29.425 1.00 0.00 ? 120 ALA A CA   3  
ATOM 5606  C C    . ALA A 1 120 ? -10.964 13.606  -30.649 1.00 0.00 ? 120 ALA A C    3  
ATOM 5607  O O    . ALA A 1 120 ? -11.463 14.714  -30.852 1.00 0.00 ? 120 ALA A O    3  
ATOM 5608  C CB   . ALA A 1 120 ? -10.886 13.587  -28.150 1.00 0.00 ? 120 ALA A CB   3  
ATOM 5609  H H    . ALA A 1 120 ? -8.829  14.932  -28.790 1.00 0.00 ? 120 ALA A H    3  
ATOM 5610  H HA   . ALA A 1 120 ? -9.761  12.327  -29.435 1.00 0.00 ? 120 ALA A HA   3  
ATOM 5611  H HB1  . ALA A 1 120 ? -10.475 12.983  -27.355 1.00 0.00 ? 120 ALA A HB1  3  
ATOM 5612  H HB2  . ALA A 1 120 ? -11.918 13.313  -28.314 1.00 0.00 ? 120 ALA A HB2  3  
ATOM 5613  H HB3  . ALA A 1 120 ? -10.830 14.630  -27.874 1.00 0.00 ? 120 ALA A HB3  3  
ATOM 5614  N N    . SER A 1 121 ? -11.147 12.571  -31.462 1.00 0.00 ? 121 SER A N    3  
ATOM 5615  C CA   . SER A 1 121 ? -11.962 12.678  -32.666 1.00 0.00 ? 121 SER A CA   3  
ATOM 5616  C C    . SER A 1 121 ? -13.447 12.671  -32.321 1.00 0.00 ? 121 SER A C    3  
ATOM 5617  O O    . SER A 1 121 ? -14.026 11.619  -32.047 1.00 0.00 ? 121 SER A O    3  
ATOM 5618  C CB   . SER A 1 121 ? -11.643 11.531  -33.627 1.00 0.00 ? 121 SER A CB   3  
ATOM 5619  O OG   . SER A 1 121 ? -11.677 11.968  -34.974 1.00 0.00 ? 121 SER A OG   3  
ATOM 5620  H H    . SER A 1 121 ? -10.724 11.714  -31.246 1.00 0.00 ? 121 SER A H    3  
ATOM 5621  H HA   . SER A 1 121 ? -11.721 13.615  -33.147 1.00 0.00 ? 121 SER A HA   3  
ATOM 5622  H HB2  . SER A 1 121 ? -10.657 11.147  -33.411 1.00 0.00 ? 121 SER A HB2  3  
ATOM 5623  H HB3  . SER A 1 121 ? -12.372 10.744  -33.497 1.00 0.00 ? 121 SER A HB3  3  
ATOM 5624  H HG   . SER A 1 121 ? -11.216 12.807  -35.050 1.00 0.00 ? 121 SER A HG   3  
ATOM 5625  N N    . SER A 1 122 ? -14.059 13.851  -32.336 1.00 0.00 ? 122 SER A N    3  
ATOM 5626  C CA   . SER A 1 122 ? -15.477 13.981  -32.026 1.00 0.00 ? 122 SER A CA   3  
ATOM 5627  C C    . SER A 1 122 ? -16.304 14.117  -33.300 1.00 0.00 ? 122 SER A C    3  
ATOM 5628  O O    . SER A 1 122 ? -16.646 15.224  -33.714 1.00 0.00 ? 122 SER A O    3  
ATOM 5629  C CB   . SER A 1 122 ? -15.714 15.190  -31.119 1.00 0.00 ? 122 SER A CB   3  
ATOM 5630  O OG   . SER A 1 122 ? -16.967 15.099  -30.464 1.00 0.00 ? 122 SER A OG   3  
ATOM 5631  H H    . SER A 1 122 ? -13.544 14.653  -32.564 1.00 0.00 ? 122 SER A H    3  
ATOM 5632  H HA   . SER A 1 122 ? -15.786 13.086  -31.505 1.00 0.00 ? 122 SER A HA   3  
ATOM 5633  H HB2  . SER A 1 122 ? -14.935 15.235  -30.372 1.00 0.00 ? 122 SER A HB2  3  
ATOM 5634  H HB3  . SER A 1 122 ? -15.695 16.091  -31.714 1.00 0.00 ? 122 SER A HB3  3  
ATOM 5635  H HG   . SER A 1 122 ? -17.584 15.715  -30.866 1.00 0.00 ? 122 SER A HG   3  
ATOM 5636  N N    . SER A 1 123 ? -16.619 12.984  -33.919 1.00 0.00 ? 123 SER A N    3  
ATOM 5637  C CA   . SER A 1 123 ? -17.405 12.977  -35.148 1.00 0.00 ? 123 SER A CA   3  
ATOM 5638  C C    . SER A 1 123 ? -18.309 11.750  -35.210 1.00 0.00 ? 123 SER A C    3  
ATOM 5639  O O    . SER A 1 123 ? -18.345 10.945  -34.279 1.00 0.00 ? 123 SER A O    3  
ATOM 5640  C CB   . SER A 1 123 ? -16.482 13.007  -36.368 1.00 0.00 ? 123 SER A CB   3  
ATOM 5641  O OG   . SER A 1 123 ? -16.095 14.333  -36.683 1.00 0.00 ? 123 SER A OG   3  
ATOM 5642  H H    . SER A 1 123 ? -16.317 12.132  -33.541 1.00 0.00 ? 123 SER A H    3  
ATOM 5643  H HA   . SER A 1 123 ? -18.020 13.864  -35.152 1.00 0.00 ? 123 SER A HA   3  
ATOM 5644  H HB2  . SER A 1 123 ? -15.596 12.426  -36.160 1.00 0.00 ? 123 SER A HB2  3  
ATOM 5645  H HB3  . SER A 1 123 ? -16.999 12.583  -37.217 1.00 0.00 ? 123 SER A HB3  3  
ATOM 5646  H HG   . SER A 1 123 ? -15.237 14.516  -36.294 1.00 0.00 ? 123 SER A HG   3  
ATOM 5647  N N    . GLY A 1 124 ? -19.039 11.615  -36.312 1.00 0.00 ? 124 GLY A N    3  
ATOM 5648  C CA   . GLY A 1 124 ? -19.932 10.483  -36.475 1.00 0.00 ? 124 GLY A CA   3  
ATOM 5649  C C    . GLY A 1 124 ? -21.020 10.444  -35.418 1.00 0.00 ? 124 GLY A C    3  
ATOM 5650  O O    . GLY A 1 124 ? -21.103 9.487   -34.647 1.00 0.00 ? 124 GLY A O    3  
ATOM 5651  H H    . GLY A 1 124 ? -18.968 12.288  -37.021 1.00 0.00 ? 124 GLY A H    3  
ATOM 5652  H HA2  . GLY A 1 124 ? -20.396 10.543  -37.450 1.00 0.00 ? 124 GLY A HA2  3  
ATOM 5653  H HA3  . GLY A 1 124 ? -19.357 9.572   -36.418 1.00 0.00 ? 124 GLY A HA3  3  
ATOM 5654  N N    . PRO A 1 125 ? -21.877 11.478  -35.355 1.00 0.00 ? 125 PRO A N    3  
ATOM 5655  C CA   . PRO A 1 125 ? -22.965 11.543  -34.374 1.00 0.00 ? 125 PRO A CA   3  
ATOM 5656  C C    . PRO A 1 125 ? -23.836 10.292  -34.393 1.00 0.00 ? 125 PRO A C    3  
ATOM 5657  O O    . PRO A 1 125 ? -24.089 9.716   -35.451 1.00 0.00 ? 125 PRO A O    3  
ATOM 5658  C CB   . PRO A 1 125 ? -23.774 12.764  -34.817 1.00 0.00 ? 125 PRO A CB   3  
ATOM 5659  C CG   . PRO A 1 125 ? -22.803 13.613  -35.562 1.00 0.00 ? 125 PRO A CG   3  
ATOM 5660  C CD   . PRO A 1 125 ? -21.853 12.661  -36.235 1.00 0.00 ? 125 PRO A CD   3  
ATOM 5661  H HA   . PRO A 1 125 ? -22.586 11.701  -33.374 1.00 0.00 ? 125 PRO A HA   3  
ATOM 5662  H HB2  . PRO A 1 125 ? -24.590 12.448  -35.449 1.00 0.00 ? 125 PRO A HB2  3  
ATOM 5663  H HB3  . PRO A 1 125 ? -24.160 13.278  -33.949 1.00 0.00 ? 125 PRO A HB3  3  
ATOM 5664  H HG2  . PRO A 1 125 ? -23.323 14.207  -36.299 1.00 0.00 ? 125 PRO A HG2  3  
ATOM 5665  H HG3  . PRO A 1 125 ? -22.269 14.251  -34.874 1.00 0.00 ? 125 PRO A HG3  3  
ATOM 5666  H HD2  . PRO A 1 125 ? -22.205 12.413  -37.225 1.00 0.00 ? 125 PRO A HD2  3  
ATOM 5667  H HD3  . PRO A 1 125 ? -20.861 13.087  -36.280 1.00 0.00 ? 125 PRO A HD3  3  
ATOM 5668  N N    . SER A 1 126 ? -24.294 9.878   -33.216 1.00 0.00 ? 126 SER A N    3  
ATOM 5669  C CA   . SER A 1 126 ? -25.137 8.694   -33.099 1.00 0.00 ? 126 SER A CA   3  
ATOM 5670  C C    . SER A 1 126 ? -26.106 8.831   -31.927 1.00 0.00 ? 126 SER A C    3  
ATOM 5671  O O    . SER A 1 126 ? -27.314 8.648   -32.083 1.00 0.00 ? 126 SER A O    3  
ATOM 5672  C CB   . SER A 1 126 ? -24.274 7.442   -32.922 1.00 0.00 ? 126 SER A CB   3  
ATOM 5673  O OG   . SER A 1 126 ? -24.677 6.415   -33.809 1.00 0.00 ? 126 SER A OG   3  
ATOM 5674  H H    . SER A 1 126 ? -24.058 10.378  -32.407 1.00 0.00 ? 126 SER A H    3  
ATOM 5675  H HA   . SER A 1 126 ? -25.706 8.601   -34.012 1.00 0.00 ? 126 SER A HA   3  
ATOM 5676  H HB2  . SER A 1 126 ? -23.242 7.689   -33.121 1.00 0.00 ? 126 SER A HB2  3  
ATOM 5677  H HB3  . SER A 1 126 ? -24.368 7.083   -31.907 1.00 0.00 ? 126 SER A HB3  3  
ATOM 5678  H HG   . SER A 1 126 ? -25.635 6.354   -33.816 1.00 0.00 ? 126 SER A HG   3  
ATOM 5679  N N    . SER A 1 127 ? -25.568 9.154   -30.756 1.00 0.00 ? 127 SER A N    3  
ATOM 5680  C CA   . SER A 1 127 ? -26.385 9.316   -29.559 1.00 0.00 ? 127 SER A CA   3  
ATOM 5681  C C    . SER A 1 127 ? -26.146 10.679  -28.918 1.00 0.00 ? 127 SER A C    3  
ATOM 5682  O O    . SER A 1 127 ? -26.231 10.827  -27.698 1.00 0.00 ? 127 SER A O    3  
ATOM 5683  C CB   . SER A 1 127 ? -26.077 8.205   -28.552 1.00 0.00 ? 127 SER A CB   3  
ATOM 5684  O OG   . SER A 1 127 ? -27.255 7.776   -27.891 1.00 0.00 ? 127 SER A OG   3  
ATOM 5685  H H    . SER A 1 127 ? -24.599 9.287   -30.695 1.00 0.00 ? 127 SER A H    3  
ATOM 5686  H HA   . SER A 1 127 ? -27.422 9.246   -29.852 1.00 0.00 ? 127 SER A HA   3  
ATOM 5687  H HB2  . SER A 1 127 ? -25.643 7.363   -29.070 1.00 0.00 ? 127 SER A HB2  3  
ATOM 5688  H HB3  . SER A 1 127 ? -25.380 8.575   -27.815 1.00 0.00 ? 127 SER A HB3  3  
ATOM 5689  H HG   . SER A 1 127 ? -27.628 8.507   -27.394 1.00 0.00 ? 127 SER A HG   3  
ATOM 5690  N N    . GLY A 1 128 ? -25.847 11.673  -29.747 1.00 0.00 ? 128 GLY A N    3  
ATOM 5691  C CA   . GLY A 1 128 ? -25.601 13.011  -29.244 1.00 0.00 ? 128 GLY A CA   3  
ATOM 5692  C C    . GLY A 1 128 ? -24.139 13.249  -28.920 1.00 0.00 ? 128 GLY A C    3  
ATOM 5693  O O    . GLY A 1 128 ? -23.370 13.572  -29.850 1.00 0.00 ? 128 GLY A O    3  
ATOM 5694  O OXT  . GLY A 1 128 ? -23.764 13.113  -27.737 1.00 0.00 ? 128 GLY A OXT  3  
ATOM 5695  H H    . GLY A 1 128 ? -25.794 11.497  -30.710 1.00 0.00 ? 128 GLY A H    3  
ATOM 5696  H HA2  . GLY A 1 128 ? -25.914 13.728  -29.989 1.00 0.00 ? 128 GLY A HA2  3  
ATOM 5697  H HA3  . GLY A 1 128 ? -26.185 13.160  -28.349 1.00 0.00 ? 128 GLY A HA3  3  
ATOM 5698  N N    . GLY A 1 1   ? 6.595   35.359  33.365  1.00 0.00 ? 1   GLY A N    4  
ATOM 5699  C CA   . GLY A 1 1   ? 7.210   35.157  34.705  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5700  C C    . GLY A 1 1   ? 8.404   34.225  34.661  1.00 0.00 ? 1   GLY A C    4  
ATOM 5701  O O    . GLY A 1 1   ? 8.677   33.509  35.625  1.00 0.00 ? 1   GLY A O    4  
ATOM 5702  H H1   . GLY A 1 1   ? 7.001   36.201  32.907  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5703  H H2   . GLY A 1 1   ? 5.568   35.492  33.458  1.00 0.00 ? 1   GLY A H2   4  
ATOM 5704  H H3   . GLY A 1 1   ? 6.772   34.530  32.761  1.00 0.00 ? 1   GLY A H3   4  
ATOM 5705  H HA2  . GLY A 1 1   ? 7.529   36.115  35.090  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5706  H HA3  . GLY A 1 1   ? 6.467   34.743  35.372  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5707  N N    . SER A 1 2   ? 9.117   34.232  33.540  1.00 0.00 ? 2   SER A N    4  
ATOM 5708  C CA   . SER A 1 2   ? 10.288  33.379  33.374  1.00 0.00 ? 2   SER A CA   4  
ATOM 5709  C C    . SER A 1 2   ? 11.005  33.689  32.063  1.00 0.00 ? 2   SER A C    4  
ATOM 5710  O O    . SER A 1 2   ? 10.672  33.133  31.016  1.00 0.00 ? 2   SER A O    4  
ATOM 5711  C CB   . SER A 1 2   ? 9.882   31.905  33.411  1.00 0.00 ? 2   SER A CB   4  
ATOM 5712  O OG   . SER A 1 2   ? 10.918  31.077  32.911  1.00 0.00 ? 2   SER A OG   4  
ATOM 5713  H H    . SER A 1 2   ? 8.849   34.824  32.807  1.00 0.00 ? 2   SER A H    4  
ATOM 5714  H HA   . SER A 1 2   ? 10.962  33.578  34.194  1.00 0.00 ? 2   SER A HA   4  
ATOM 5715  H HB2  . SER A 1 2   ? 9.669   31.618  34.429  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5716  H HB3  . SER A 1 2   ? 9.000   31.762  32.803  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5717  H HG   . SER A 1 2   ? 11.753  31.332  33.312  1.00 0.00 ? 2   SER A HG   4  
ATOM 5718  N N    . SER A 1 3   ? 11.989  34.579  32.129  1.00 0.00 ? 3   SER A N    4  
ATOM 5719  C CA   . SER A 1 3   ? 12.753  34.962  30.947  1.00 0.00 ? 3   SER A CA   4  
ATOM 5720  C C    . SER A 1 3   ? 14.169  34.399  31.009  1.00 0.00 ? 3   SER A C    4  
ATOM 5721  O O    . SER A 1 3   ? 14.663  34.047  32.080  1.00 0.00 ? 3   SER A O    4  
ATOM 5722  C CB   . SER A 1 3   ? 12.803  36.487  30.819  1.00 0.00 ? 3   SER A CB   4  
ATOM 5723  O OG   . SER A 1 3   ? 11.605  37.077  31.291  1.00 0.00 ? 3   SER A OG   4  
ATOM 5724  H H    . SER A 1 3   ? 12.208  34.988  32.992  1.00 0.00 ? 3   SER A H    4  
ATOM 5725  H HA   . SER A 1 3   ? 12.254  34.554  30.082  1.00 0.00 ? 3   SER A HA   4  
ATOM 5726  H HB2  . SER A 1 3   ? 13.630  36.868  31.399  1.00 0.00 ? 3   SER A HB2  4  
ATOM 5727  H HB3  . SER A 1 3   ? 12.938  36.753  29.781  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5728  H HG   . SER A 1 3   ? 11.710  37.321  32.214  1.00 0.00 ? 3   SER A HG   4  
ATOM 5729  N N    . GLY A 1 4   ? 14.819  34.318  29.852  1.00 0.00 ? 4   GLY A N    4  
ATOM 5730  C CA   . GLY A 1 4   ? 16.172  33.797  29.796  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5731  C C    . GLY A 1 4   ? 16.877  34.148  28.501  1.00 0.00 ? 4   GLY A C    4  
ATOM 5732  O O    . GLY A 1 4   ? 18.034  34.566  28.510  1.00 0.00 ? 4   GLY A O    4  
ATOM 5733  H H    . GLY A 1 4   ? 14.376  34.614  29.030  1.00 0.00 ? 4   GLY A H    4  
ATOM 5734  H HA2  . GLY A 1 4   ? 16.737  34.204  30.622  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5735  H HA3  . GLY A 1 4   ? 16.136  32.722  29.894  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5736  N N    . SER A 1 5   ? 16.177  33.978  27.383  1.00 0.00 ? 5   SER A N    4  
ATOM 5737  C CA   . SER A 1 5   ? 16.742  34.279  26.073  1.00 0.00 ? 5   SER A CA   4  
ATOM 5738  C C    . SER A 1 5   ? 15.797  35.159  25.263  1.00 0.00 ? 5   SER A C    4  
ATOM 5739  O O    . SER A 1 5   ? 14.749  35.579  25.753  1.00 0.00 ? 5   SER A O    4  
ATOM 5740  C CB   . SER A 1 5   ? 17.033  32.986  25.310  1.00 0.00 ? 5   SER A CB   4  
ATOM 5741  O OG   . SER A 1 5   ? 18.362  32.548  25.534  1.00 0.00 ? 5   SER A OG   4  
ATOM 5742  H H    . SER A 1 5   ? 15.259  33.641  27.441  1.00 0.00 ? 5   SER A H    4  
ATOM 5743  H HA   . SER A 1 5   ? 17.668  34.812  26.227  1.00 0.00 ? 5   SER A HA   4  
ATOM 5744  H HB2  . SER A 1 5   ? 16.354  32.214  25.642  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5745  H HB3  . SER A 1 5   ? 16.895  33.155  24.253  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5746  H HG   . SER A 1 5   ? 18.976  33.221  25.229  1.00 0.00 ? 5   SER A HG   4  
ATOM 5747  N N    . SER A 1 6   ? 16.176  35.437  24.019  1.00 0.00 ? 6   SER A N    4  
ATOM 5748  C CA   . SER A 1 6   ? 15.362  36.268  23.140  1.00 0.00 ? 6   SER A CA   4  
ATOM 5749  C C    . SER A 1 6   ? 14.501  35.408  22.219  1.00 0.00 ? 6   SER A C    4  
ATOM 5750  O O    . SER A 1 6   ? 14.864  34.277  21.892  1.00 0.00 ? 6   SER A O    4  
ATOM 5751  C CB   . SER A 1 6   ? 16.253  37.191  22.308  1.00 0.00 ? 6   SER A CB   4  
ATOM 5752  O OG   . SER A 1 6   ? 16.389  38.461  22.924  1.00 0.00 ? 6   SER A OG   4  
ATOM 5753  H H    . SER A 1 6   ? 17.022  35.073  23.684  1.00 0.00 ? 6   SER A H    4  
ATOM 5754  H HA   . SER A 1 6   ? 14.714  36.870  23.760  1.00 0.00 ? 6   SER A HA   4  
ATOM 5755  H HB2  . SER A 1 6   ? 17.233  36.749  22.207  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5756  H HB3  . SER A 1 6   ? 15.817  37.325  21.329  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5757  H HG   . SER A 1 6   ? 16.010  39.135  22.356  1.00 0.00 ? 6   SER A HG   4  
ATOM 5758  N N    . GLY A 1 7   ? 13.362  35.950  21.805  1.00 0.00 ? 7   GLY A N    4  
ATOM 5759  C CA   . GLY A 1 7   ? 12.468  35.218  20.927  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5760  C C    . GLY A 1 7   ? 13.095  34.923  19.578  1.00 0.00 ? 7   GLY A C    4  
ATOM 5761  O O    . GLY A 1 7   ? 13.767  35.777  18.998  1.00 0.00 ? 7   GLY A O    4  
ATOM 5762  H H    . GLY A 1 7   ? 13.125  36.854  22.098  1.00 0.00 ? 7   GLY A H    4  
ATOM 5763  H HA2  . GLY A 1 7   ? 12.202  34.284  21.399  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5764  H HA3  . GLY A 1 7   ? 11.572  35.802  20.775  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5765  N N    . ASP A 1 8   ? 12.874  33.712  19.077  1.00 0.00 ? 8   ASP A N    4  
ATOM 5766  C CA   . ASP A 1 8   ? 13.422  33.307  17.788  1.00 0.00 ? 8   ASP A CA   4  
ATOM 5767  C C    . ASP A 1 8   ? 12.753  34.069  16.649  1.00 0.00 ? 8   ASP A C    4  
ATOM 5768  O O    . ASP A 1 8   ? 11.588  34.455  16.746  1.00 0.00 ? 8   ASP A O    4  
ATOM 5769  C CB   . ASP A 1 8   ? 13.246  31.799  17.587  1.00 0.00 ? 8   ASP A CB   4  
ATOM 5770  C CG   . ASP A 1 8   ? 14.551  31.104  17.249  1.00 0.00 ? 8   ASP A CG   4  
ATOM 5771  O OD1  . ASP A 1 8   ? 15.477  31.786  16.760  1.00 0.00 ? 8   ASP A OD1  4  
ATOM 5772  O OD2  . ASP A 1 8   ? 14.647  29.880  17.473  1.00 0.00 ? 8   ASP A OD2  4  
ATOM 5773  H H    . ASP A 1 8   ? 12.330  33.076  19.587  1.00 0.00 ? 8   ASP A H    4  
ATOM 5774  H HA   . ASP A 1 8   ? 14.476  33.539  17.789  1.00 0.00 ? 8   ASP A HA   4  
ATOM 5775  H HB2  . ASP A 1 8   ? 12.855  31.365  18.495  1.00 0.00 ? 8   ASP A HB2  4  
ATOM 5776  H HB3  . ASP A 1 8   ? 12.547  31.627  16.781  1.00 0.00 ? 8   ASP A HB3  4  
ATOM 5777  N N    . ARG A 1 9   ? 13.498  34.284  15.569  1.00 0.00 ? 9   ARG A N    4  
ATOM 5778  C CA   . ARG A 1 9   ? 12.977  35.000  14.410  1.00 0.00 ? 9   ARG A CA   4  
ATOM 5779  C C    . ARG A 1 9   ? 12.987  34.112  13.170  1.00 0.00 ? 9   ARG A C    4  
ATOM 5780  O O    . ARG A 1 9   ? 11.942  33.845  12.578  1.00 0.00 ? 9   ARG A O    4  
ATOM 5781  C CB   . ARG A 1 9   ? 13.801  36.263  14.153  1.00 0.00 ? 9   ARG A CB   4  
ATOM 5782  C CG   . ARG A 1 9   ? 13.020  37.371  13.465  1.00 0.00 ? 9   ARG A CG   4  
ATOM 5783  C CD   . ARG A 1 9   ? 13.901  38.573  13.171  1.00 0.00 ? 9   ARG A CD   4  
ATOM 5784  N NE   . ARG A 1 9   ? 13.249  39.525  12.275  1.00 0.00 ? 9   ARG A NE   4  
ATOM 5785  C CZ   . ARG A 1 9   ? 13.738  40.730  11.989  1.00 0.00 ? 9   ARG A CZ   4  
ATOM 5786  N NH1  . ARG A 1 9   ? 14.883  41.133  12.525  1.00 0.00 ? 9   ARG A NH1  4  
ATOM 5787  N NH2  . ARG A 1 9   ? 13.080  41.533  11.164  1.00 0.00 ? 9   ARG A NH2  4  
ATOM 5788  H H    . ARG A 1 9   ? 14.420  33.952  15.551  1.00 0.00 ? 9   ARG A H    4  
ATOM 5789  H HA   . ARG A 1 9   ? 11.957  35.284  14.627  1.00 0.00 ? 9   ARG A HA   4  
ATOM 5790  H HB2  . ARG A 1 9   ? 14.164  36.641  15.098  1.00 0.00 ? 9   ARG A HB2  4  
ATOM 5791  H HB3  . ARG A 1 9   ? 14.646  36.006  13.530  1.00 0.00 ? 9   ARG A HB3  4  
ATOM 5792  H HG2  . ARG A 1 9   ? 12.622  36.993  12.535  1.00 0.00 ? 9   ARG A HG2  4  
ATOM 5793  H HG3  . ARG A 1 9   ? 12.209  37.678  14.108  1.00 0.00 ? 9   ARG A HG3  4  
ATOM 5794  H HD2  . ARG A 1 9   ? 14.134  39.070  14.101  1.00 0.00 ? 9   ARG A HD2  4  
ATOM 5795  H HD3  . ARG A 1 9   ? 14.817  38.229  12.710  1.00 0.00 ? 9   ARG A HD3  4  
ATOM 5796  H HE   . ARG A 1 9   ? 12.401  39.253  11.866  1.00 0.00 ? 9   ARG A HE   4  
ATOM 5797  H HH11 . ARG A 1 9   ? 15.384  40.532  13.147  1.00 0.00 ? 9   ARG A HH11 4  
ATOM 5798  H HH12 . ARG A 1 9   ? 15.245  42.039  12.306  1.00 0.00 ? 9   ARG A HH12 4  
ATOM 5799  H HH21 . ARG A 1 9   ? 12.217  41.234  10.758  1.00 0.00 ? 9   ARG A HH21 4  
ATOM 5800  H HH22 . ARG A 1 9   ? 13.446  42.439  10.950  1.00 0.00 ? 9   ARG A HH22 4  
ATOM 5801  N N    . ARG A 1 10  ? 14.174  33.656  12.786  1.00 0.00 ? 10  ARG A N    4  
ATOM 5802  C CA   . ARG A 1 10  ? 14.320  32.796  11.617  1.00 0.00 ? 10  ARG A CA   4  
ATOM 5803  C C    . ARG A 1 10  ? 13.520  31.508  11.785  1.00 0.00 ? 10  ARG A C    4  
ATOM 5804  O O    . ARG A 1 10  ? 13.291  31.048  12.904  1.00 0.00 ? 10  ARG A O    4  
ATOM 5805  C CB   . ARG A 1 10  ? 15.796  32.468  11.381  1.00 0.00 ? 10  ARG A CB   4  
ATOM 5806  C CG   . ARG A 1 10  ? 16.455  33.350  10.332  1.00 0.00 ? 10  ARG A CG   4  
ATOM 5807  C CD   . ARG A 1 10  ? 17.306  34.436  10.970  1.00 0.00 ? 10  ARG A CD   4  
ATOM 5808  N NE   . ARG A 1 10  ? 17.959  35.278  9.970   1.00 0.00 ? 10  ARG A NE   4  
ATOM 5809  C CZ   . ARG A 1 10  ? 19.012  36.051  10.226  1.00 0.00 ? 10  ARG A CZ   4  
ATOM 5810  N NH1  . ARG A 1 10  ? 19.534  36.093  11.446  1.00 0.00 ? 10  ARG A NH1  4  
ATOM 5811  N NH2  . ARG A 1 10  ? 19.547  36.784  9.258   1.00 0.00 ? 10  ARG A NH2  4  
ATOM 5812  H H    . ARG A 1 10  ? 14.971  33.903  13.300  1.00 0.00 ? 10  ARG A H    4  
ATOM 5813  H HA   . ARG A 1 10  ? 13.939  33.332  10.761  1.00 0.00 ? 10  ARG A HA   4  
ATOM 5814  H HB2  . ARG A 1 10  ? 16.333  32.587  12.310  1.00 0.00 ? 10  ARG A HB2  4  
ATOM 5815  H HB3  . ARG A 1 10  ? 15.880  31.440  11.058  1.00 0.00 ? 10  ARG A HB3  4  
ATOM 5816  H HG2  . ARG A 1 10  ? 17.084  32.738  9.703   1.00 0.00 ? 10  ARG A HG2  4  
ATOM 5817  H HG3  . ARG A 1 10  ? 15.686  33.814  9.731   1.00 0.00 ? 10  ARG A HG3  4  
ATOM 5818  H HD2  . ARG A 1 10  ? 16.673  35.056  11.588  1.00 0.00 ? 10  ARG A HD2  4  
ATOM 5819  H HD3  . ARG A 1 10  ? 18.061  33.969  11.584  1.00 0.00 ? 10  ARG A HD3  4  
ATOM 5820  H HE   . ARG A 1 10  ? 17.594  35.266  9.061   1.00 0.00 ? 10  ARG A HE   4  
ATOM 5821  H HH11 . ARG A 1 10  ? 19.136  35.544  12.180  1.00 0.00 ? 10  ARG A HH11 4  
ATOM 5822  H HH12 . ARG A 1 10  ? 20.325  36.676  11.631  1.00 0.00 ? 10  ARG A HH12 4  
ATOM 5823  H HH21 . ARG A 1 10  ? 19.159  36.755  8.337   1.00 0.00 ? 10  ARG A HH21 4  
ATOM 5824  H HH22 . ARG A 1 10  ? 20.338  37.365  9.449   1.00 0.00 ? 10  ARG A HH22 4  
ATOM 5825  N N    . SER A 1 11  ? 13.096  30.929  10.665  1.00 0.00 ? 11  SER A N    4  
ATOM 5826  C CA   . SER A 1 11  ? 12.321  29.694  10.688  1.00 0.00 ? 11  SER A CA   4  
ATOM 5827  C C    . SER A 1 11  ? 12.865  28.692  9.676   1.00 0.00 ? 11  SER A C    4  
ATOM 5828  O O    . SER A 1 11  ? 13.209  27.564  10.029  1.00 0.00 ? 11  SER A O    4  
ATOM 5829  C CB   . SER A 1 11  ? 10.849  29.987  10.392  1.00 0.00 ? 11  SER A CB   4  
ATOM 5830  O OG   . SER A 1 11  ? 10.005  29.024  10.999  1.00 0.00 ? 11  SER A OG   4  
ATOM 5831  H H    . SER A 1 11  ? 13.311  31.344  9.803   1.00 0.00 ? 11  SER A H    4  
ATOM 5832  H HA   . SER A 1 11  ? 12.403  29.271  11.677  1.00 0.00 ? 11  SER A HA   4  
ATOM 5833  H HB2  . SER A 1 11  ? 10.594  30.963  10.777  1.00 0.00 ? 11  SER A HB2  4  
ATOM 5834  H HB3  . SER A 1 11  ? 10.687  29.968  9.324   1.00 0.00 ? 11  SER A HB3  4  
ATOM 5835  H HG   . SER A 1 11  ? 10.324  28.143  10.791  1.00 0.00 ? 11  SER A HG   4  
ATOM 5836  N N    . THR A 1 12  ? 12.941  29.111  8.416   1.00 0.00 ? 12  THR A N    4  
ATOM 5837  C CA   . THR A 1 12  ? 13.443  28.250  7.350   1.00 0.00 ? 12  THR A CA   4  
ATOM 5838  C C    . THR A 1 12  ? 12.647  26.952  7.273   1.00 0.00 ? 12  THR A C    4  
ATOM 5839  O O    . THR A 1 12  ? 13.185  25.900  6.932   1.00 0.00 ? 12  THR A O    4  
ATOM 5840  C CB   . THR A 1 12  ? 14.927  27.939  7.567   1.00 0.00 ? 12  THR A CB   4  
ATOM 5841  O OG1  . THR A 1 12  ? 15.089  26.917  8.536   1.00 0.00 ? 12  THR A OG1  4  
ATOM 5842  C CG2  . THR A 1 12  ? 15.734  29.137  8.021   1.00 0.00 ? 12  THR A CG2  4  
ATOM 5843  H H    . THR A 1 12  ? 12.651  30.021  8.199   1.00 0.00 ? 12  THR A H    4  
ATOM 5844  H HA   . THR A 1 12  ? 13.331  28.783  6.416   1.00 0.00 ? 12  THR A HA   4  
ATOM 5845  H HB   . THR A 1 12  ? 15.349  27.590  6.635   1.00 0.00 ? 12  THR A HB   4  
ATOM 5846  H HG1  . THR A 1 12  ? 14.883  27.265  9.407   1.00 0.00 ? 12  THR A HG1  4  
ATOM 5847  H HG21 . THR A 1 12  ? 16.787  28.918  7.927   1.00 0.00 ? 12  THR A HG21 4  
ATOM 5848  H HG22 . THR A 1 12  ? 15.501  29.358  9.052   1.00 0.00 ? 12  THR A HG22 4  
ATOM 5849  H HG23 . THR A 1 12  ? 15.487  29.990  7.405   1.00 0.00 ? 12  THR A HG23 4  
ATOM 5850  N N    . LEU A 1 13  ? 11.359  27.035  7.595   1.00 0.00 ? 13  LEU A N    4  
ATOM 5851  C CA   . LEU A 1 13  ? 10.486  25.867  7.564   1.00 0.00 ? 13  LEU A CA   4  
ATOM 5852  C C    . LEU A 1 13  ? 10.939  24.821  8.577   1.00 0.00 ? 13  LEU A C    4  
ATOM 5853  O O    . LEU A 1 13  ? 12.136  24.619  8.781   1.00 0.00 ? 13  LEU A O    4  
ATOM 5854  C CB   . LEU A 1 13  ? 10.459  25.257  6.160   1.00 0.00 ? 13  LEU A CB   4  
ATOM 5855  C CG   . LEU A 1 13  ? 9.184   24.481  5.816   1.00 0.00 ? 13  LEU A CG   4  
ATOM 5856  C CD1  . LEU A 1 13  ? 8.316   25.276  4.854   1.00 0.00 ? 13  LEU A CD1  4  
ATOM 5857  C CD2  . LEU A 1 13  ? 9.530   23.121  5.224   1.00 0.00 ? 13  LEU A CD2  4  
ATOM 5858  H H    . LEU A 1 13  ? 10.987  27.902  7.860   1.00 0.00 ? 13  LEU A H    4  
ATOM 5859  H HA   . LEU A 1 13  ? 9.489   26.193  7.824   1.00 0.00 ? 13  LEU A HA   4  
ATOM 5860  H HB2  . LEU A 1 13  ? 10.577  26.056  5.443   1.00 0.00 ? 13  LEU A HB2  4  
ATOM 5861  H HB3  . LEU A 1 13  ? 11.300  24.587  6.068   1.00 0.00 ? 13  LEU A HB3  4  
ATOM 5862  H HG   . LEU A 1 13  ? 8.616   24.317  6.720   1.00 0.00 ? 13  LEU A HG   4  
ATOM 5863  H HD11 . LEU A 1 13  ? 8.481   24.927  3.846   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 5864  H HD12 . LEU A 1 13  ? 8.573   26.323  4.918   1.00 0.00 ? 13  LEU A HD12 4  
ATOM 5865  H HD13 . LEU A 1 13  ? 7.276   25.144  5.115   1.00 0.00 ? 13  LEU A HD13 4  
ATOM 5866  H HD21 . LEU A 1 13  ? 10.500  23.171  4.752   1.00 0.00 ? 13  LEU A HD21 4  
ATOM 5867  H HD22 . LEU A 1 13  ? 8.786   22.850  4.490   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 5868  H HD23 . LEU A 1 13  ? 9.548   22.381  6.010   1.00 0.00 ? 13  LEU A HD23 4  
ATOM 5869  N N    . HIS A 1 14  ? 9.976   24.160  9.209   1.00 0.00 ? 14  HIS A N    4  
ATOM 5870  C CA   . HIS A 1 14  ? 10.277  23.135  10.201  1.00 0.00 ? 14  HIS A CA   4  
ATOM 5871  C C    . HIS A 1 14  ? 9.184   22.071  10.234  1.00 0.00 ? 14  HIS A C    4  
ATOM 5872  O O    . HIS A 1 14  ? 9.469   20.874  10.234  1.00 0.00 ? 14  HIS A O    4  
ATOM 5873  C CB   . HIS A 1 14  ? 10.433  23.766  11.586  1.00 0.00 ? 14  HIS A CB   4  
ATOM 5874  C CG   . HIS A 1 14  ? 9.227   24.532  12.034  1.00 0.00 ? 14  HIS A CG   4  
ATOM 5875  N ND1  . HIS A 1 14  ? 8.342   24.057  12.980  1.00 0.00 ? 14  HIS A ND1  4  
ATOM 5876  C CD2  . HIS A 1 14  ? 8.760   25.747  11.660  1.00 0.00 ? 14  HIS A CD2  4  
ATOM 5877  C CE1  . HIS A 1 14  ? 7.383   24.947  13.168  1.00 0.00 ? 14  HIS A CE1  4  
ATOM 5878  N NE2  . HIS A 1 14  ? 7.614   25.981  12.380  1.00 0.00 ? 14  HIS A NE2  4  
ATOM 5879  H H    . HIS A 1 14  ? 9.039   24.365  9.004   1.00 0.00 ? 14  HIS A H    4  
ATOM 5880  H HA   . HIS A 1 14  ? 11.209  22.666  9.922   1.00 0.00 ? 14  HIS A HA   4  
ATOM 5881  H HB2  . HIS A 1 14  ? 10.619  22.986  12.310  1.00 0.00 ? 14  HIS A HB2  4  
ATOM 5882  H HB3  . HIS A 1 14  ? 11.273  24.445  11.571  1.00 0.00 ? 14  HIS A HB3  4  
ATOM 5883  H HD1  . HIS A 1 14  ? 8.406   23.196  13.443  1.00 0.00 ? 14  HIS A HD1  4  
ATOM 5884  H HD2  . HIS A 1 14  ? 9.206   26.409  10.932  1.00 0.00 ? 14  HIS A HD2  4  
ATOM 5885  H HE1  . HIS A 1 14  ? 6.553   24.846  13.851  1.00 0.00 ? 14  HIS A HE1  4  
ATOM 5886  H HE2  . HIS A 1 14  ? 7.106   26.819  12.386  1.00 0.00 ? 14  HIS A HE2  4  
ATOM 5887  N N    . LEU A 1 15  ? 7.932   22.517  10.264  1.00 0.00 ? 15  LEU A N    4  
ATOM 5888  C CA   . LEU A 1 15  ? 6.796   21.603  10.296  1.00 0.00 ? 15  LEU A CA   4  
ATOM 5889  C C    . LEU A 1 15  ? 5.492   22.347  10.029  1.00 0.00 ? 15  LEU A C    4  
ATOM 5890  O O    . LEU A 1 15  ? 5.260   23.428  10.571  1.00 0.00 ? 15  LEU A O    4  
ATOM 5891  C CB   . LEU A 1 15  ? 6.725   20.893  11.650  1.00 0.00 ? 15  LEU A CB   4  
ATOM 5892  C CG   . LEU A 1 15  ? 6.141   19.480  11.611  1.00 0.00 ? 15  LEU A CG   4  
ATOM 5893  C CD1  . LEU A 1 15  ? 7.085   18.533  10.888  1.00 0.00 ? 15  LEU A CD1  4  
ATOM 5894  C CD2  . LEU A 1 15  ? 5.860   18.983  13.021  1.00 0.00 ? 15  LEU A CD2  4  
ATOM 5895  H H    . LEU A 1 15  ? 7.768   23.482  10.263  1.00 0.00 ? 15  LEU A H    4  
ATOM 5896  H HA   . LEU A 1 15  ? 6.941   20.866  9.521   1.00 0.00 ? 15  LEU A HA   4  
ATOM 5897  H HB2  . LEU A 1 15  ? 7.724   20.838  12.056  1.00 0.00 ? 15  LEU A HB2  4  
ATOM 5898  H HB3  . LEU A 1 15  ? 6.118   21.491  12.314  1.00 0.00 ? 15  LEU A HB3  4  
ATOM 5899  H HG   . LEU A 1 15  ? 5.206   19.499  11.070  1.00 0.00 ? 15  LEU A HG   4  
ATOM 5900  H HD11 . LEU A 1 15  ? 7.728   19.098  10.230  1.00 0.00 ? 15  LEU A HD11 4  
ATOM 5901  H HD12 . LEU A 1 15  ? 6.510   17.825  10.308  1.00 0.00 ? 15  LEU A HD12 4  
ATOM 5902  H HD13 . LEU A 1 15  ? 7.687   18.003  11.611  1.00 0.00 ? 15  LEU A HD13 4  
ATOM 5903  H HD21 . LEU A 1 15  ? 6.793   18.757  13.516  1.00 0.00 ? 15  LEU A HD21 4  
ATOM 5904  H HD22 . LEU A 1 15  ? 5.252   18.091  12.974  1.00 0.00 ? 15  LEU A HD22 4  
ATOM 5905  H HD23 . LEU A 1 15  ? 5.335   19.748  13.575  1.00 0.00 ? 15  LEU A HD23 4  
ATOM 5906  N N    . LEU A 1 16  ? 4.643   21.762  9.191   1.00 0.00 ? 16  LEU A N    4  
ATOM 5907  C CA   . LEU A 1 16  ? 3.362   22.370  8.852   1.00 0.00 ? 16  LEU A CA   4  
ATOM 5908  C C    . LEU A 1 16  ? 2.221   21.690  9.602   1.00 0.00 ? 16  LEU A C    4  
ATOM 5909  O O    . LEU A 1 16  ? 2.426   20.689  10.290  1.00 0.00 ? 16  LEU A O    4  
ATOM 5910  C CB   . LEU A 1 16  ? 3.120   22.290  7.342   1.00 0.00 ? 16  LEU A CB   4  
ATOM 5911  C CG   . LEU A 1 16  ? 3.022   23.641  6.631   1.00 0.00 ? 16  LEU A CG   4  
ATOM 5912  C CD1  . LEU A 1 16  ? 3.557   23.538  5.212   1.00 0.00 ? 16  LEU A CD1  4  
ATOM 5913  C CD2  . LEU A 1 16  ? 1.583   24.136  6.626   1.00 0.00 ? 16  LEU A CD2  4  
ATOM 5914  H H    . LEU A 1 16  ? 4.884   20.901  8.790   1.00 0.00 ? 16  LEU A H    4  
ATOM 5915  H HA   . LEU A 1 16  ? 3.400   23.408  9.146   1.00 0.00 ? 16  LEU A HA   4  
ATOM 5916  H HB2  . LEU A 1 16  ? 3.932   21.732  6.899   1.00 0.00 ? 16  LEU A HB2  4  
ATOM 5917  H HB3  . LEU A 1 16  ? 2.201   21.752  7.170   1.00 0.00 ? 16  LEU A HB3  4  
ATOM 5918  H HG   . LEU A 1 16  ? 3.623   24.365  7.163   1.00 0.00 ? 16  LEU A HG   4  
ATOM 5919  H HD11 . LEU A 1 16  ? 4.238   22.703  5.144   1.00 0.00 ? 16  LEU A HD11 4  
ATOM 5920  H HD12 . LEU A 1 16  ? 4.079   24.449  4.957   1.00 0.00 ? 16  LEU A HD12 4  
ATOM 5921  H HD13 . LEU A 1 16  ? 2.735   23.390  4.527   1.00 0.00 ? 16  LEU A HD13 4  
ATOM 5922  H HD21 . LEU A 1 16  ? 1.361   24.609  7.572   1.00 0.00 ? 16  LEU A HD21 4  
ATOM 5923  H HD22 . LEU A 1 16  ? 0.916   23.299  6.478   1.00 0.00 ? 16  LEU A HD22 4  
ATOM 5924  H HD23 . LEU A 1 16  ? 1.450   24.848  5.826   1.00 0.00 ? 16  LEU A HD23 4  
ATOM 5925  N N    . GLN A 1 17  ? 1.018   22.238  9.465   1.00 0.00 ? 17  GLN A N    4  
ATOM 5926  C CA   . GLN A 1 17  ? -0.156  21.684  10.129  1.00 0.00 ? 17  GLN A CA   4  
ATOM 5927  C C    . GLN A 1 17  ? -0.980  20.839  9.163   1.00 0.00 ? 17  GLN A C    4  
ATOM 5928  O O    . GLN A 1 17  ? -0.919  21.029  7.949   1.00 0.00 ? 17  GLN A O    4  
ATOM 5929  C CB   . GLN A 1 17  ? -1.019  22.808  10.706  1.00 0.00 ? 17  GLN A CB   4  
ATOM 5930  C CG   . GLN A 1 17  ? -0.412  23.474  11.931  1.00 0.00 ? 17  GLN A CG   4  
ATOM 5931  C CD   . GLN A 1 17  ? 0.946   24.086  11.647  1.00 0.00 ? 17  GLN A CD   4  
ATOM 5932  O OE1  . GLN A 1 17  ? 1.952   23.695  12.239  1.00 0.00 ? 17  GLN A OE1  4  
ATOM 5933  N NE2  . GLN A 1 17  ? 0.981   25.053  10.738  1.00 0.00 ? 17  GLN A NE2  4  
ATOM 5934  H H    . GLN A 1 17  ? 0.918   23.035  8.903   1.00 0.00 ? 17  GLN A H    4  
ATOM 5935  H HA   . GLN A 1 17  ? 0.187   21.055  10.937  1.00 0.00 ? 17  GLN A HA   4  
ATOM 5936  H HB2  . GLN A 1 17  ? -1.163  23.562  9.946   1.00 0.00 ? 17  GLN A HB2  4  
ATOM 5937  H HB3  . GLN A 1 17  ? -1.980  22.401  10.984  1.00 0.00 ? 17  GLN A HB3  4  
ATOM 5938  H HG2  . GLN A 1 17  ? -1.077  24.255  12.267  1.00 0.00 ? 17  GLN A HG2  4  
ATOM 5939  H HG3  . GLN A 1 17  ? -0.302  22.734  12.709  1.00 0.00 ? 17  GLN A HG3  4  
ATOM 5940  H HE21 . GLN A 1 17  ? 0.142   25.314  10.306  1.00 0.00 ? 17  GLN A HE21 4  
ATOM 5941  H HE22 . GLN A 1 17  ? 1.847   25.467  10.536  1.00 0.00 ? 17  GLN A HE22 4  
ATOM 5942  N N    . GLY A 1 18  ? -1.750  19.905  9.712   1.00 0.00 ? 18  GLY A N    4  
ATOM 5943  C CA   . GLY A 1 18  ? -2.576  19.044  8.885   1.00 0.00 ? 18  GLY A CA   4  
ATOM 5944  C C    . GLY A 1 18  ? -2.068  17.616  8.846   1.00 0.00 ? 18  GLY A C    4  
ATOM 5945  O O    . GLY A 1 18  ? -0.868  17.381  8.703   1.00 0.00 ? 18  GLY A O    4  
ATOM 5946  H H    . GLY A 1 18  ? -1.758  19.800  10.687  1.00 0.00 ? 18  GLY A H    4  
ATOM 5947  H HA2  . GLY A 1 18  ? -3.582  19.046  9.277   1.00 0.00 ? 18  GLY A HA2  4  
ATOM 5948  H HA3  . GLY A 1 18  ? -2.591  19.436  7.880   1.00 0.00 ? 18  GLY A HA3  4  
ATOM 5949  N N    . GLY A 1 19  ? -2.983  16.660  8.975   1.00 0.00 ? 19  GLY A N    4  
ATOM 5950  C CA   . GLY A 1 19  ? -2.602  15.261  8.952   1.00 0.00 ? 19  GLY A CA   4  
ATOM 5951  C C    . GLY A 1 19  ? -3.779  14.342  8.693   1.00 0.00 ? 19  GLY A C    4  
ATOM 5952  O O    . GLY A 1 19  ? -4.140  13.531  9.545   1.00 0.00 ? 19  GLY A O    4  
ATOM 5953  H H    . GLY A 1 19  ? -3.924  16.908  9.087   1.00 0.00 ? 19  GLY A H    4  
ATOM 5954  H HA2  . GLY A 1 19  ? -1.865  15.113  8.175   1.00 0.00 ? 19  GLY A HA2  4  
ATOM 5955  H HA3  . GLY A 1 19  ? -2.160  15.003  9.904   1.00 0.00 ? 19  GLY A HA3  4  
ATOM 5956  N N    . ASP A 1 20  ? -4.379  14.470  7.515   1.00 0.00 ? 20  ASP A N    4  
ATOM 5957  C CA   . ASP A 1 20  ? -5.523  13.645  7.146   1.00 0.00 ? 20  ASP A CA   4  
ATOM 5958  C C    . ASP A 1 20  ? -5.106  12.530  6.192   1.00 0.00 ? 20  ASP A C    4  
ATOM 5959  O O    . ASP A 1 20  ? -4.376  12.765  5.229   1.00 0.00 ? 20  ASP A O    4  
ATOM 5960  C CB   . ASP A 1 20  ? -6.612  14.504  6.500   1.00 0.00 ? 20  ASP A CB   4  
ATOM 5961  C CG   . ASP A 1 20  ? -7.032  15.663  7.382   1.00 0.00 ? 20  ASP A CG   4  
ATOM 5962  O OD1  . ASP A 1 20  ? -6.382  16.727  7.315   1.00 0.00 ? 20  ASP A OD1  4  
ATOM 5963  O OD2  . ASP A 1 20  ? -8.012  15.507  8.140   1.00 0.00 ? 20  ASP A OD2  4  
ATOM 5964  H H    . ASP A 1 20  ? -4.045  15.135  6.877   1.00 0.00 ? 20  ASP A H    4  
ATOM 5965  H HA   . ASP A 1 20  ? -5.916  13.201  8.049   1.00 0.00 ? 20  ASP A HA   4  
ATOM 5966  H HB2  . ASP A 1 20  ? -6.242  14.902  5.568   1.00 0.00 ? 20  ASP A HB2  4  
ATOM 5967  H HB3  . ASP A 1 20  ? -7.480  13.890  6.306   1.00 0.00 ? 20  ASP A HB3  4  
ATOM 5968  N N    . GLU A 1 21  ? -5.575  11.317  6.466   1.00 0.00 ? 21  GLU A N    4  
ATOM 5969  C CA   . GLU A 1 21  ? -5.251  10.165  5.631   1.00 0.00 ? 21  GLU A CA   4  
ATOM 5970  C C    . GLU A 1 21  ? -6.518  9.505   5.098   1.00 0.00 ? 21  GLU A C    4  
ATOM 5971  O O    . GLU A 1 21  ? -7.608  9.711   5.632   1.00 0.00 ? 21  GLU A O    4  
ATOM 5972  C CB   . GLU A 1 21  ? -4.429  9.149   6.426   1.00 0.00 ? 21  GLU A CB   4  
ATOM 5973  C CG   . GLU A 1 21  ? -3.059  9.664   6.840   1.00 0.00 ? 21  GLU A CG   4  
ATOM 5974  C CD   . GLU A 1 21  ? -2.915  9.796   8.343   1.00 0.00 ? 21  GLU A CD   4  
ATOM 5975  O OE1  . GLU A 1 21  ? -2.881  8.754   9.030   1.00 0.00 ? 21  GLU A OE1  4  
ATOM 5976  O OE2  . GLU A 1 21  ? -2.837  10.942  8.834   1.00 0.00 ? 21  GLU A OE2  4  
ATOM 5977  H H    . GLU A 1 21  ? -6.153  11.193  7.247   1.00 0.00 ? 21  GLU A H    4  
ATOM 5978  H HA   . GLU A 1 21  ? -4.663  10.515  4.796   1.00 0.00 ? 21  GLU A HA   4  
ATOM 5979  H HB2  . GLU A 1 21  ? -4.975  8.880   7.319   1.00 0.00 ? 21  GLU A HB2  4  
ATOM 5980  H HB3  . GLU A 1 21  ? -4.289  8.265   5.822   1.00 0.00 ? 21  GLU A HB3  4  
ATOM 5981  H HG2  . GLU A 1 21  ? -2.306  8.975   6.481   1.00 0.00 ? 21  GLU A HG2  4  
ATOM 5982  H HG3  . GLU A 1 21  ? -2.904  10.636  6.390   1.00 0.00 ? 21  GLU A HG3  4  
ATOM 5983  N N    . LYS A 1 22  ? -6.368  8.713   4.042   1.00 0.00 ? 22  LYS A N    4  
ATOM 5984  C CA   . LYS A 1 22  ? -7.502  8.023   3.436   1.00 0.00 ? 22  LYS A CA   4  
ATOM 5985  C C    . LYS A 1 22  ? -7.231  6.526   3.324   1.00 0.00 ? 22  LYS A C    4  
ATOM 5986  O O    . LYS A 1 22  ? -6.085  6.084   3.406   1.00 0.00 ? 22  LYS A O    4  
ATOM 5987  C CB   . LYS A 1 22  ? -7.799  8.605   2.054   1.00 0.00 ? 22  LYS A CB   4  
ATOM 5988  C CG   . LYS A 1 22  ? -9.241  8.412   1.610   1.00 0.00 ? 22  LYS A CG   4  
ATOM 5989  C CD   . LYS A 1 22  ? -9.572  9.275   0.403   1.00 0.00 ? 22  LYS A CD   4  
ATOM 5990  C CE   . LYS A 1 22  ? -9.547  8.467   -0.885  1.00 0.00 ? 22  LYS A CE   4  
ATOM 5991  N NZ   . LYS A 1 22  ? -9.829  9.312   -2.078  1.00 0.00 ? 22  LYS A NZ   4  
ATOM 5992  H H    . LYS A 1 22  ? -5.474  8.588   3.661   1.00 0.00 ? 22  LYS A H    4  
ATOM 5993  H HA   . LYS A 1 22  ? -8.361  8.174   4.073   1.00 0.00 ? 22  LYS A HA   4  
ATOM 5994  H HB2  . LYS A 1 22  ? -7.589  9.664   2.069   1.00 0.00 ? 22  LYS A HB2  4  
ATOM 5995  H HB3  . LYS A 1 22  ? -7.155  8.129   1.328   1.00 0.00 ? 22  LYS A HB3  4  
ATOM 5996  H HG2  . LYS A 1 22  ? -9.391  7.375   1.349   1.00 0.00 ? 22  LYS A HG2  4  
ATOM 5997  H HG3  . LYS A 1 22  ? -9.896  8.680   2.424   1.00 0.00 ? 22  LYS A HG3  4  
ATOM 5998  H HD2  . LYS A 1 22  ? -10.558 9.694   0.532   1.00 0.00 ? 22  LYS A HD2  4  
ATOM 5999  H HD3  . LYS A 1 22  ? -8.847  10.073  0.332   1.00 0.00 ? 22  LYS A HD3  4  
ATOM 6000  H HE2  . LYS A 1 22  ? -8.570  8.021   -0.995  1.00 0.00 ? 22  LYS A HE2  4  
ATOM 6001  H HE3  . LYS A 1 22  ? -10.293 7.688   -0.821  1.00 0.00 ? 22  LYS A HE3  4  
ATOM 6002  H HZ1  . LYS A 1 22  ? -10.432 8.794   -2.749  1.00 0.00 ? 22  LYS A HZ1  4  
ATOM 6003  H HZ2  . LYS A 1 22  ? -8.941  9.567   -2.554  1.00 0.00 ? 22  LYS A HZ2  4  
ATOM 6004  H HZ3  . LYS A 1 22  ? -10.318 10.185  -1.791  1.00 0.00 ? 22  LYS A HZ3  4  
ATOM 6005  N N    . LYS A 1 23  ? -8.294  5.751   3.133   1.00 0.00 ? 23  LYS A N    4  
ATOM 6006  C CA   . LYS A 1 23  ? -8.170  4.303   3.008   1.00 0.00 ? 23  LYS A CA   4  
ATOM 6007  C C    . LYS A 1 23  ? -9.004  3.784   1.839   1.00 0.00 ? 23  LYS A C    4  
ATOM 6008  O O    . LYS A 1 23  ? -10.156 4.181   1.662   1.00 0.00 ? 23  LYS A O    4  
ATOM 6009  C CB   . LYS A 1 23  ? -8.606  3.619   4.307   1.00 0.00 ? 23  LYS A CB   4  
ATOM 6010  C CG   . LYS A 1 23  ? -7.582  2.632   4.847   1.00 0.00 ? 23  LYS A CG   4  
ATOM 6011  C CD   . LYS A 1 23  ? -6.943  3.135   6.133   1.00 0.00 ? 23  LYS A CD   4  
ATOM 6012  C CE   . LYS A 1 23  ? -5.469  2.777   6.200   1.00 0.00 ? 23  LYS A CE   4  
ATOM 6013  N NZ   . LYS A 1 23  ? -5.030  2.484   7.592   1.00 0.00 ? 23  LYS A NZ   4  
ATOM 6014  H H    . LYS A 1 23  ? -9.181  6.161   3.076   1.00 0.00 ? 23  LYS A H    4  
ATOM 6015  H HA   . LYS A 1 23  ? -7.132  4.073   2.822   1.00 0.00 ? 23  LYS A HA   4  
ATOM 6016  H HB2  . LYS A 1 23  ? -8.777  4.376   5.058   1.00 0.00 ? 23  LYS A HB2  4  
ATOM 6017  H HB3  . LYS A 1 23  ? -9.528  3.085   4.130   1.00 0.00 ? 23  LYS A HB3  4  
ATOM 6018  H HG2  . LYS A 1 23  ? -8.073  1.691   5.046   1.00 0.00 ? 23  LYS A HG2  4  
ATOM 6019  H HG3  . LYS A 1 23  ? -6.810  2.488   4.106   1.00 0.00 ? 23  LYS A HG3  4  
ATOM 6020  H HD2  . LYS A 1 23  ? -7.045  4.209   6.177   1.00 0.00 ? 23  LYS A HD2  4  
ATOM 6021  H HD3  . LYS A 1 23  ? -7.453  2.688   6.974   1.00 0.00 ? 23  LYS A HD3  4  
ATOM 6022  H HE2  . LYS A 1 23  ? -5.294  1.905   5.587   1.00 0.00 ? 23  LYS A HE2  4  
ATOM 6023  H HE3  . LYS A 1 23  ? -4.892  3.606   5.817   1.00 0.00 ? 23  LYS A HE3  4  
ATOM 6024  H HZ1  . LYS A 1 23  ? -5.405  1.563   7.898   1.00 0.00 ? 23  LYS A HZ1  4  
ATOM 6025  H HZ2  . LYS A 1 23  ? -5.379  3.219   8.240   1.00 0.00 ? 23  LYS A HZ2  4  
ATOM 6026  H HZ3  . LYS A 1 23  ? -3.992  2.457   7.643   1.00 0.00 ? 23  LYS A HZ3  4  
ATOM 6027  N N    . VAL A 1 24  ? -8.414  2.898   1.045   1.00 0.00 ? 24  VAL A N    4  
ATOM 6028  C CA   . VAL A 1 24  ? -9.102  2.326   -0.106  1.00 0.00 ? 24  VAL A CA   4  
ATOM 6029  C C    . VAL A 1 24  ? -9.138  0.805   -0.026  1.00 0.00 ? 24  VAL A C    4  
ATOM 6030  O O    . VAL A 1 24  ? -8.231  0.126   -0.508  1.00 0.00 ? 24  VAL A O    4  
ATOM 6031  C CB   . VAL A 1 24  ? -8.429  2.743   -1.428  1.00 0.00 ? 24  VAL A CB   4  
ATOM 6032  C CG1  . VAL A 1 24  ? -9.271  2.309   -2.618  1.00 0.00 ? 24  VAL A CG1  4  
ATOM 6033  C CG2  . VAL A 1 24  ? -8.187  4.245   -1.454  1.00 0.00 ? 24  VAL A CG2  4  
ATOM 6034  H H    . VAL A 1 24  ? -7.494  2.621   1.238   1.00 0.00 ? 24  VAL A H    4  
ATOM 6035  H HA   . VAL A 1 24  ? -10.115 2.701   -0.110  1.00 0.00 ? 24  VAL A HA   4  
ATOM 6036  H HB   . VAL A 1 24  ? -7.472  2.245   -1.492  1.00 0.00 ? 24  VAL A HB   4  
ATOM 6037  H HG11 . VAL A 1 24  ? -9.801  3.162   -3.015  1.00 0.00 ? 24  VAL A HG11 4  
ATOM 6038  H HG12 . VAL A 1 24  ? -9.979  1.557   -2.303  1.00 0.00 ? 24  VAL A HG12 4  
ATOM 6039  H HG13 . VAL A 1 24  ? -8.627  1.898   -3.383  1.00 0.00 ? 24  VAL A HG13 4  
ATOM 6040  H HG21 . VAL A 1 24  ? -8.312  4.612   -2.462  1.00 0.00 ? 24  VAL A HG21 4  
ATOM 6041  H HG22 . VAL A 1 24  ? -7.183  4.455   -1.117  1.00 0.00 ? 24  VAL A HG22 4  
ATOM 6042  H HG23 . VAL A 1 24  ? -8.896  4.734   -0.802  1.00 0.00 ? 24  VAL A HG23 4  
ATOM 6043  N N    . ASN A 1 25  ? -10.191 0.273   0.586   1.00 0.00 ? 25  ASN A N    4  
ATOM 6044  C CA   . ASN A 1 25  ? -10.345 -1.170  0.730   1.00 0.00 ? 25  ASN A CA   4  
ATOM 6045  C C    . ASN A 1 25  ? -10.795 -1.802  -0.582  1.00 0.00 ? 25  ASN A C    4  
ATOM 6046  O O    . ASN A 1 25  ? -11.863 -1.482  -1.103  1.00 0.00 ? 25  ASN A O    4  
ATOM 6047  C CB   . ASN A 1 25  ? -11.354 -1.488  1.836   1.00 0.00 ? 25  ASN A CB   4  
ATOM 6048  C CG   . ASN A 1 25  ? -12.660 -0.740  1.659   1.00 0.00 ? 25  ASN A CG   4  
ATOM 6049  O OD1  . ASN A 1 25  ? -12.673 0.478   1.480   1.00 0.00 ? 25  ASN A OD1  4  
ATOM 6050  N ND2  . ASN A 1 25  ? -13.770 -1.467  1.709   1.00 0.00 ? 25  ASN A ND2  4  
ATOM 6051  H H    . ASN A 1 25  ? -10.881 0.867   0.950   1.00 0.00 ? 25  ASN A H    4  
ATOM 6052  H HA   . ASN A 1 25  ? -9.384  -1.579  1.003   1.00 0.00 ? 25  ASN A HA   4  
ATOM 6053  H HB2  . ASN A 1 25  ? -11.563 -2.547  1.828   1.00 0.00 ? 25  ASN A HB2  4  
ATOM 6054  H HB3  . ASN A 1 25  ? -10.929 -1.216  2.791   1.00 0.00 ? 25  ASN A HB3  4  
ATOM 6055  H HD21 . ASN A 1 25  ? -13.684 -2.433  1.855   1.00 0.00 ? 25  ASN A HD21 4  
ATOM 6056  H HD22 . ASN A 1 25  ? -14.629 -1.009  1.599   1.00 0.00 ? 25  ASN A HD22 4  
ATOM 6057  N N    . LEU A 1 26  ? -9.974  -2.704  -1.112  1.00 0.00 ? 26  LEU A N    4  
ATOM 6058  C CA   . LEU A 1 26  ? -10.288 -3.383  -2.364  1.00 0.00 ? 26  LEU A CA   4  
ATOM 6059  C C    . LEU A 1 26  ? -10.296 -4.896  -2.174  1.00 0.00 ? 26  LEU A C    4  
ATOM 6060  O O    . LEU A 1 26  ? -9.420  -5.453  -1.513  1.00 0.00 ? 26  LEU A O    4  
ATOM 6061  C CB   . LEU A 1 26  ? -9.277  -2.998  -3.446  1.00 0.00 ? 26  LEU A CB   4  
ATOM 6062  C CG   . LEU A 1 26  ? -9.153  -1.497  -3.711  1.00 0.00 ? 26  LEU A CG   4  
ATOM 6063  C CD1  . LEU A 1 26  ? -8.050  -1.223  -4.721  1.00 0.00 ? 26  LEU A CD1  4  
ATOM 6064  C CD2  . LEU A 1 26  ? -10.478 -0.931  -4.199  1.00 0.00 ? 26  LEU A CD2  4  
ATOM 6065  H H    . LEU A 1 26  ? -9.136  -2.917  -0.649  1.00 0.00 ? 26  LEU A H    4  
ATOM 6066  H HA   . LEU A 1 26  ? -11.272 -3.066  -2.675  1.00 0.00 ? 26  LEU A HA   4  
ATOM 6067  H HB2  . LEU A 1 26  ? -8.307  -3.373  -3.151  1.00 0.00 ? 26  LEU A HB2  4  
ATOM 6068  H HB3  . LEU A 1 26  ? -9.566  -3.480  -4.367  1.00 0.00 ? 26  LEU A HB3  4  
ATOM 6069  H HG   . LEU A 1 26  ? -8.892  -0.995  -2.790  1.00 0.00 ? 26  LEU A HG   4  
ATOM 6070  H HD11 . LEU A 1 26  ? -7.095  -1.203  -4.216  1.00 0.00 ? 26  LEU A HD11 4  
ATOM 6071  H HD12 . LEU A 1 26  ? -8.225  -0.270  -5.196  1.00 0.00 ? 26  LEU A HD12 4  
ATOM 6072  H HD13 . LEU A 1 26  ? -8.045  -2.002  -5.468  1.00 0.00 ? 26  LEU A HD13 4  
ATOM 6073  H HD21 . LEU A 1 26  ? -11.129 -0.760  -3.355  1.00 0.00 ? 26  LEU A HD21 4  
ATOM 6074  H HD22 . LEU A 1 26  ? -10.942 -1.634  -4.875  1.00 0.00 ? 26  LEU A HD22 4  
ATOM 6075  H HD23 . LEU A 1 26  ? -10.303 0.002   -4.714  1.00 0.00 ? 26  LEU A HD23 4  
ATOM 6076  N N    . VAL A 1 27  ? -11.290 -5.555  -2.761  1.00 0.00 ? 27  VAL A N    4  
ATOM 6077  C CA   . VAL A 1 27  ? -11.412 -7.004  -2.658  1.00 0.00 ? 27  VAL A CA   4  
ATOM 6078  C C    . VAL A 1 27  ? -11.243 -7.668  -4.020  1.00 0.00 ? 27  VAL A C    4  
ATOM 6079  O O    . VAL A 1 27  ? -12.112 -7.562  -4.885  1.00 0.00 ? 27  VAL A O    4  
ATOM 6080  C CB   . VAL A 1 27  ? -12.774 -7.413  -2.066  1.00 0.00 ? 27  VAL A CB   4  
ATOM 6081  C CG1  . VAL A 1 27  ? -12.807 -8.906  -1.781  1.00 0.00 ? 27  VAL A CG1  4  
ATOM 6082  C CG2  . VAL A 1 27  ? -13.069 -6.615  -0.806  1.00 0.00 ? 27  VAL A CG2  4  
ATOM 6083  H H    . VAL A 1 27  ? -11.957 -5.055  -3.275  1.00 0.00 ? 27  VAL A H    4  
ATOM 6084  H HA   . VAL A 1 27  ? -10.634 -7.359  -1.996  1.00 0.00 ? 27  VAL A HA   4  
ATOM 6085  H HB   . VAL A 1 27  ? -13.541 -7.192  -2.794  1.00 0.00 ? 27  VAL A HB   4  
ATOM 6086  H HG11 . VAL A 1 27  ? -13.067 -9.440  -2.683  1.00 0.00 ? 27  VAL A HG11 4  
ATOM 6087  H HG12 . VAL A 1 27  ? -13.542 -9.111  -1.017  1.00 0.00 ? 27  VAL A HG12 4  
ATOM 6088  H HG13 . VAL A 1 27  ? -11.834 -9.229  -1.440  1.00 0.00 ? 27  VAL A HG13 4  
ATOM 6089  H HG21 . VAL A 1 27  ? -14.050 -6.876  -0.435  1.00 0.00 ? 27  VAL A HG21 4  
ATOM 6090  H HG22 . VAL A 1 27  ? -13.041 -5.559  -1.033  1.00 0.00 ? 27  VAL A HG22 4  
ATOM 6091  H HG23 . VAL A 1 27  ? -12.329 -6.842  -0.054  1.00 0.00 ? 27  VAL A HG23 4  
ATOM 6092  N N    . LEU A 1 28  ? -10.118 -8.352  -4.203  1.00 0.00 ? 28  LEU A N    4  
ATOM 6093  C CA   . LEU A 1 28  ? -9.835  -9.034  -5.462  1.00 0.00 ? 28  LEU A CA   4  
ATOM 6094  C C    . LEU A 1 28  ? -10.238 -10.503 -5.387  1.00 0.00 ? 28  LEU A C    4  
ATOM 6095  O O    . LEU A 1 28  ? -10.449 -11.046 -4.302  1.00 0.00 ? 28  LEU A O    4  
ATOM 6096  C CB   . LEU A 1 28  ? -8.349  -8.919  -5.805  1.00 0.00 ? 28  LEU A CB   4  
ATOM 6097  C CG   . LEU A 1 28  ? -7.748  -7.523  -5.621  1.00 0.00 ? 28  LEU A CG   4  
ATOM 6098  C CD1  . LEU A 1 28  ? -6.271  -7.620  -5.274  1.00 0.00 ? 28  LEU A CD1  4  
ATOM 6099  C CD2  . LEU A 1 28  ? -7.949  -6.690  -6.878  1.00 0.00 ? 28  LEU A CD2  4  
ATOM 6100  H H    . LEU A 1 28  ? -9.463  -8.400  -3.476  1.00 0.00 ? 28  LEU A H    4  
ATOM 6101  H HA   . LEU A 1 28  ? -10.414 -8.553  -6.236  1.00 0.00 ? 28  LEU A HA   4  
ATOM 6102  H HB2  . LEU A 1 28  ? -7.802  -9.609  -5.179  1.00 0.00 ? 28  LEU A HB2  4  
ATOM 6103  H HB3  . LEU A 1 28  ? -8.216  -9.209  -6.835  1.00 0.00 ? 28  LEU A HB3  4  
ATOM 6104  H HG   . LEU A 1 28  ? -8.251  -7.026  -4.804  1.00 0.00 ? 28  LEU A HG   4  
ATOM 6105  H HD11 . LEU A 1 28  ? -5.762  -6.731  -5.613  1.00 0.00 ? 28  LEU A HD11 4  
ATOM 6106  H HD12 . LEU A 1 28  ? -5.843  -8.487  -5.757  1.00 0.00 ? 28  LEU A HD12 4  
ATOM 6107  H HD13 . LEU A 1 28  ? -6.158  -7.713  -4.204  1.00 0.00 ? 28  LEU A HD13 4  
ATOM 6108  H HD21 . LEU A 1 28  ? -8.952  -6.836  -7.251  1.00 0.00 ? 28  LEU A HD21 4  
ATOM 6109  H HD22 . LEU A 1 28  ? -7.236  -6.995  -7.630  1.00 0.00 ? 28  LEU A HD22 4  
ATOM 6110  H HD23 . LEU A 1 28  ? -7.800  -5.645  -6.644  1.00 0.00 ? 28  LEU A HD23 4  
ATOM 6111  N N    . GLY A 1 29  ? -10.342 -11.141 -6.548  1.00 0.00 ? 29  GLY A N    4  
ATOM 6112  C CA   . GLY A 1 29  ? -10.717 -12.543 -6.593  1.00 0.00 ? 29  GLY A CA   4  
ATOM 6113  C C    . GLY A 1 29  ? -9.535  -13.448 -6.874  1.00 0.00 ? 29  GLY A C    4  
ATOM 6114  O O    . GLY A 1 29  ? -9.631  -14.375 -7.677  1.00 0.00 ? 29  GLY A O    4  
ATOM 6115  H H    . GLY A 1 29  ? -10.161 -10.657 -7.381  1.00 0.00 ? 29  GLY A H    4  
ATOM 6116  H HA2  . GLY A 1 29  ? -11.151 -12.819 -5.641  1.00 0.00 ? 29  GLY A HA2  4  
ATOM 6117  H HA3  . GLY A 1 29  ? -11.456 -12.682 -7.372  1.00 0.00 ? 29  GLY A HA3  4  
ATOM 6118  N N    . ASP A 1 30  ? -8.416  -13.179 -6.209  1.00 0.00 ? 30  ASP A N    4  
ATOM 6119  C CA   . ASP A 1 30  ? -7.208  -13.976 -6.391  1.00 0.00 ? 30  ASP A CA   4  
ATOM 6120  C C    . ASP A 1 30  ? -6.742  -13.934 -7.842  1.00 0.00 ? 30  ASP A C    4  
ATOM 6121  O O    . ASP A 1 30  ? -6.293  -14.940 -8.392  1.00 0.00 ? 30  ASP A O    4  
ATOM 6122  C CB   . ASP A 1 30  ? -7.458  -15.424 -5.964  1.00 0.00 ? 30  ASP A CB   4  
ATOM 6123  C CG   . ASP A 1 30  ? -8.144  -15.521 -4.615  1.00 0.00 ? 30  ASP A CG   4  
ATOM 6124  O OD1  . ASP A 1 30  ? -7.437  -15.493 -3.586  1.00 0.00 ? 30  ASP A OD1  4  
ATOM 6125  O OD2  . ASP A 1 30  ? -9.388  -15.623 -4.588  1.00 0.00 ? 30  ASP A OD2  4  
ATOM 6126  H H    . ASP A 1 30  ? -8.401  -12.426 -5.582  1.00 0.00 ? 30  ASP A H    4  
ATOM 6127  H HA   . ASP A 1 30  ? -6.436  -13.554 -5.765  1.00 0.00 ? 30  ASP A HA   4  
ATOM 6128  H HB2  . ASP A 1 30  ? -8.084  -15.906 -6.700  1.00 0.00 ? 30  ASP A HB2  4  
ATOM 6129  H HB3  . ASP A 1 30  ? -6.513  -15.944 -5.905  1.00 0.00 ? 30  ASP A HB3  4  
ATOM 6130  N N    . GLY A 1 31  ? -6.852  -12.761 -8.460  1.00 0.00 ? 31  GLY A N    4  
ATOM 6131  C CA   . GLY A 1 31  ? -6.438  -12.609 -9.841  1.00 0.00 ? 31  GLY A CA   4  
ATOM 6132  C C    . GLY A 1 31  ? -6.451  -11.163 -10.296 1.00 0.00 ? 31  GLY A C    4  
ATOM 6133  O O    . GLY A 1 31  ? -5.558  -10.726 -11.022 1.00 0.00 ? 31  GLY A O    4  
ATOM 6134  H H    . GLY A 1 31  ? -7.217  -11.992 -7.972  1.00 0.00 ? 31  GLY A H    4  
ATOM 6135  H HA2  . GLY A 1 31  ? -5.434  -12.999 -9.950  1.00 0.00 ? 31  GLY A HA2  4  
ATOM 6136  H HA3  . GLY A 1 31  ? -7.108  -13.179 -10.471 1.00 0.00 ? 31  GLY A HA3  4  
ATOM 6137  N N    . ARG A 1 32  ? -7.466  -10.418 -9.870  1.00 0.00 ? 32  ARG A N    4  
ATOM 6138  C CA   . ARG A 1 32  ? -7.591  -9.012  -10.240 1.00 0.00 ? 32  ARG A CA   4  
ATOM 6139  C C    . ARG A 1 32  ? -6.375  -8.218  -9.774  1.00 0.00 ? 32  ARG A C    4  
ATOM 6140  O O    . ARG A 1 32  ? -5.492  -8.751  -9.103  1.00 0.00 ? 32  ARG A O    4  
ATOM 6141  C CB   . ARG A 1 32  ? -8.865  -8.415  -9.639  1.00 0.00 ? 32  ARG A CB   4  
ATOM 6142  C CG   . ARG A 1 32  ? -10.114 -9.234  -9.923  1.00 0.00 ? 32  ARG A CG   4  
ATOM 6143  C CD   . ARG A 1 32  ? -10.975 -8.586  -10.997 1.00 0.00 ? 32  ARG A CD   4  
ATOM 6144  N NE   . ARG A 1 32  ? -10.469 -8.853  -12.340 1.00 0.00 ? 32  ARG A NE   4  
ATOM 6145  C CZ   . ARG A 1 32  ? -11.195 -8.712  -13.447 1.00 0.00 ? 32  ARG A CZ   4  
ATOM 6146  N NH1  . ARG A 1 32  ? -12.458 -8.308  -13.375 1.00 0.00 ? 32  ARG A NH1  4  
ATOM 6147  N NH2  . ARG A 1 32  ? -10.657 -8.976  -14.630 1.00 0.00 ? 32  ARG A NH2  4  
ATOM 6148  H H    . ARG A 1 32  ? -8.148  -10.823 -9.293  1.00 0.00 ? 32  ARG A H    4  
ATOM 6149  H HA   . ARG A 1 32  ? -7.651  -8.957  -11.316 1.00 0.00 ? 32  ARG A HA   4  
ATOM 6150  H HB2  . ARG A 1 32  ? -8.744  -8.344  -8.568  1.00 0.00 ? 32  ARG A HB2  4  
ATOM 6151  H HB3  . ARG A 1 32  ? -9.009  -7.424  -10.042 1.00 0.00 ? 32  ARG A HB3  4  
ATOM 6152  H HG2  . ARG A 1 32  ? -9.820  -10.218 -10.258 1.00 0.00 ? 32  ARG A HG2  4  
ATOM 6153  H HG3  . ARG A 1 32  ? -10.691 -9.320  -9.014  1.00 0.00 ? 32  ARG A HG3  4  
ATOM 6154  H HD2  . ARG A 1 32  ? -11.979 -8.974  -10.917 1.00 0.00 ? 32  ARG A HD2  4  
ATOM 6155  H HD3  . ARG A 1 32  ? -10.990 -7.518  -10.832 1.00 0.00 ? 32  ARG A HD3  4  
ATOM 6156  H HE   . ARG A 1 32  ? -9.539  -9.152  -12.423 1.00 0.00 ? 32  ARG A HE   4  
ATOM 6157  H HH11 . ARG A 1 32  ? -12.869 -8.107  -12.487 1.00 0.00 ? 32  ARG A HH11 4  
ATOM 6158  H HH12 . ARG A 1 32  ? -12.997 -8.205  -14.211 1.00 0.00 ? 32  ARG A HH12 4  
ATOM 6159  H HH21 . ARG A 1 32  ? -9.706  -9.280  -14.690 1.00 0.00 ? 32  ARG A HH21 4  
ATOM 6160  H HH22 . ARG A 1 32  ? -11.202 -8.871  -15.462 1.00 0.00 ? 32  ARG A HH22 4  
ATOM 6161  N N    . SER A 1 33  ? -6.335  -6.939  -10.135 1.00 0.00 ? 33  SER A N    4  
ATOM 6162  C CA   . SER A 1 33  ? -5.227  -6.071  -9.754  1.00 0.00 ? 33  SER A CA   4  
ATOM 6163  C C    . SER A 1 33  ? -5.698  -4.631  -9.585  1.00 0.00 ? 33  SER A C    4  
ATOM 6164  O O    . SER A 1 33  ? -6.836  -4.296  -9.913  1.00 0.00 ? 33  SER A O    4  
ATOM 6165  C CB   . SER A 1 33  ? -4.117  -6.137  -10.804 1.00 0.00 ? 33  SER A CB   4  
ATOM 6166  O OG   . SER A 1 33  ? -4.629  -5.898  -12.104 1.00 0.00 ? 33  SER A OG   4  
ATOM 6167  H H    . SER A 1 33  ? -7.069  -6.571  -10.670 1.00 0.00 ? 33  SER A H    4  
ATOM 6168  H HA   . SER A 1 33  ? -4.839  -6.424  -8.811  1.00 0.00 ? 33  SER A HA   4  
ATOM 6169  H HB2  . SER A 1 33  ? -3.371  -5.389  -10.584 1.00 0.00 ? 33  SER A HB2  4  
ATOM 6170  H HB3  . SER A 1 33  ? -3.662  -7.116  -10.784 1.00 0.00 ? 33  SER A HB3  4  
ATOM 6171  H HG   . SER A 1 33  ? -4.338  -6.597  -12.697 1.00 0.00 ? 33  SER A HG   4  
ATOM 6172  N N    . LEU A 1 34  ? -4.814  -3.781  -9.070  1.00 0.00 ? 34  LEU A N    4  
ATOM 6173  C CA   . LEU A 1 34  ? -5.139  -2.376  -8.858  1.00 0.00 ? 34  LEU A CA   4  
ATOM 6174  C C    . LEU A 1 34  ? -5.037  -1.591  -10.162 1.00 0.00 ? 34  LEU A C    4  
ATOM 6175  O O    . LEU A 1 34  ? -5.818  -0.673  -10.408 1.00 0.00 ? 34  LEU A O    4  
ATOM 6176  C CB   . LEU A 1 34  ? -4.206  -1.769  -7.807  1.00 0.00 ? 34  LEU A CB   4  
ATOM 6177  C CG   . LEU A 1 34  ? -4.075  -2.576  -6.516  1.00 0.00 ? 34  LEU A CG   4  
ATOM 6178  C CD1  . LEU A 1 34  ? -2.764  -2.257  -5.816  1.00 0.00 ? 34  LEU A CD1  4  
ATOM 6179  C CD2  . LEU A 1 34  ? -5.255  -2.300  -5.594  1.00 0.00 ? 34  LEU A CD2  4  
ATOM 6180  H H    . LEU A 1 34  ? -3.923  -4.108  -8.829  1.00 0.00 ? 34  LEU A H    4  
ATOM 6181  H HA   . LEU A 1 34  ? -6.156  -2.322  -8.498  1.00 0.00 ? 34  LEU A HA   4  
ATOM 6182  H HB2  . LEU A 1 34  ? -3.222  -1.667  -8.247  1.00 0.00 ? 34  LEU A HB2  4  
ATOM 6183  H HB3  . LEU A 1 34  ? -4.577  -0.784  -7.554  1.00 0.00 ? 34  LEU A HB3  4  
ATOM 6184  H HG   . LEU A 1 34  ? -4.078  -3.630  -6.755  1.00 0.00 ? 34  LEU A HG   4  
ATOM 6185  H HD11 . LEU A 1 34  ? -2.353  -3.161  -5.391  1.00 0.00 ? 34  LEU A HD11 4  
ATOM 6186  H HD12 . LEU A 1 34  ? -2.940  -1.537  -5.030  1.00 0.00 ? 34  LEU A HD12 4  
ATOM 6187  H HD13 . LEU A 1 34  ? -2.065  -1.846  -6.530  1.00 0.00 ? 34  LEU A HD13 4  
ATOM 6188  H HD21 . LEU A 1 34  ? -5.102  -2.807  -4.653  1.00 0.00 ? 34  LEU A HD21 4  
ATOM 6189  H HD22 . LEU A 1 34  ? -6.163  -2.660  -6.055  1.00 0.00 ? 34  LEU A HD22 4  
ATOM 6190  H HD23 . LEU A 1 34  ? -5.335  -1.238  -5.422  1.00 0.00 ? 34  LEU A HD23 4  
ATOM 6191  N N    . GLY A 1 35  ? -4.068  -1.961  -10.994 1.00 0.00 ? 35  GLY A N    4  
ATOM 6192  C CA   . GLY A 1 35  ? -3.881  -1.281  -12.263 1.00 0.00 ? 35  GLY A CA   4  
ATOM 6193  C C    . GLY A 1 35  ? -3.427  0.155   -12.091 1.00 0.00 ? 35  GLY A C    4  
ATOM 6194  O O    . GLY A 1 35  ? -3.886  1.048   -12.804 1.00 0.00 ? 35  GLY A O    4  
ATOM 6195  H H    . GLY A 1 35  ? -3.476  -2.700  -10.744 1.00 0.00 ? 35  GLY A H    4  
ATOM 6196  H HA2  . GLY A 1 35  ? -3.138  -1.816  -12.839 1.00 0.00 ? 35  GLY A HA2  4  
ATOM 6197  H HA3  . GLY A 1 35  ? -4.819  -1.289  -12.803 1.00 0.00 ? 35  GLY A HA3  4  
ATOM 6198  N N    . LEU A 1 36  ? -2.522  0.378   -11.144 1.00 0.00 ? 36  LEU A N    4  
ATOM 6199  C CA   . LEU A 1 36  ? -2.004  1.716   -10.882 1.00 0.00 ? 36  LEU A CA   4  
ATOM 6200  C C    . LEU A 1 36  ? -0.508  1.787   -11.172 1.00 0.00 ? 36  LEU A C    4  
ATOM 6201  O O    . LEU A 1 36  ? 0.246   0.883   -10.816 1.00 0.00 ? 36  LEU A O    4  
ATOM 6202  C CB   . LEU A 1 36  ? -2.273  2.114   -9.428  1.00 0.00 ? 36  LEU A CB   4  
ATOM 6203  C CG   . LEU A 1 36  ? -3.750  2.259   -9.059  1.00 0.00 ? 36  LEU A CG   4  
ATOM 6204  C CD1  . LEU A 1 36  ? -3.944  2.093   -7.560  1.00 0.00 ? 36  LEU A CD1  4  
ATOM 6205  C CD2  . LEU A 1 36  ? -4.283  3.606   -9.522  1.00 0.00 ? 36  LEU A CD2  4  
ATOM 6206  H H    . LEU A 1 36  ? -2.194  -0.374  -10.609 1.00 0.00 ? 36  LEU A H    4  
ATOM 6207  H HA   . LEU A 1 36  ? -2.519  2.405   -11.534 1.00 0.00 ? 36  LEU A HA   4  
ATOM 6208  H HB2  . LEU A 1 36  ? -1.833  1.365   -8.785  1.00 0.00 ? 36  LEU A HB2  4  
ATOM 6209  H HB3  . LEU A 1 36  ? -1.784  3.058   -9.240  1.00 0.00 ? 36  LEU A HB3  4  
ATOM 6210  H HG   . LEU A 1 36  ? -4.316  1.485   -9.556  1.00 0.00 ? 36  LEU A HG   4  
ATOM 6211  H HD11 . LEU A 1 36  ? -3.211  2.687   -7.034  1.00 0.00 ? 36  LEU A HD11 4  
ATOM 6212  H HD12 . LEU A 1 36  ? -3.823  1.053   -7.295  1.00 0.00 ? 36  LEU A HD12 4  
ATOM 6213  H HD13 . LEU A 1 36  ? -4.936  2.420   -7.287  1.00 0.00 ? 36  LEU A HD13 4  
ATOM 6214  H HD21 . LEU A 1 36  ? -4.280  3.644   -10.601 1.00 0.00 ? 36  LEU A HD21 4  
ATOM 6215  H HD22 . LEU A 1 36  ? -3.657  4.394   -9.131  1.00 0.00 ? 36  LEU A HD22 4  
ATOM 6216  H HD23 . LEU A 1 36  ? -5.292  3.737   -9.161  1.00 0.00 ? 36  LEU A HD23 4  
ATOM 6217  N N    . THR A 1 37  ? -0.089  2.869   -11.819 1.00 0.00 ? 37  THR A N    4  
ATOM 6218  C CA   . THR A 1 37  ? 1.317   3.060   -12.157 1.00 0.00 ? 37  THR A CA   4  
ATOM 6219  C C    . THR A 1 37  ? 2.024   3.895   -11.094 1.00 0.00 ? 37  THR A C    4  
ATOM 6220  O O    . THR A 1 37  ? 2.134   5.114   -11.220 1.00 0.00 ? 37  THR A O    4  
ATOM 6221  C CB   . THR A 1 37  ? 1.448   3.735   -13.522 1.00 0.00 ? 37  THR A CB   4  
ATOM 6222  O OG1  . THR A 1 37  ? 0.568   3.145   -14.461 1.00 0.00 ? 37  THR A OG1  4  
ATOM 6223  C CG2  . THR A 1 37  ? 2.848   3.660   -14.095 1.00 0.00 ? 37  THR A CG2  4  
ATOM 6224  H H    . THR A 1 37  ? -0.739  3.556   -12.076 1.00 0.00 ? 37  THR A H    4  
ATOM 6225  H HA   . THR A 1 37  ? 1.783   2.086   -12.201 1.00 0.00 ? 37  THR A HA   4  
ATOM 6226  H HB   . THR A 1 37  ? 1.188   4.779   -13.422 1.00 0.00 ? 37  THR A HB   4  
ATOM 6227  H HG1  . THR A 1 37  ? 0.849   2.244   -14.641 1.00 0.00 ? 37  THR A HG1  4  
ATOM 6228  H HG21 . THR A 1 37  ? 3.515   4.261   -13.496 1.00 0.00 ? 37  THR A HG21 4  
ATOM 6229  H HG22 . THR A 1 37  ? 2.842   4.032   -15.109 1.00 0.00 ? 37  THR A HG22 4  
ATOM 6230  H HG23 . THR A 1 37  ? 3.184   2.634   -14.089 1.00 0.00 ? 37  THR A HG23 4  
ATOM 6231  N N    . ILE A 1 38  ? 2.501   3.229   -10.047 1.00 0.00 ? 38  ILE A N    4  
ATOM 6232  C CA   . ILE A 1 38  ? 3.197   3.910   -8.963  1.00 0.00 ? 38  ILE A CA   4  
ATOM 6233  C C    . ILE A 1 38  ? 4.580   4.377   -9.404  1.00 0.00 ? 38  ILE A C    4  
ATOM 6234  O O    . ILE A 1 38  ? 5.196   3.779   -10.286 1.00 0.00 ? 38  ILE A O    4  
ATOM 6235  C CB   . ILE A 1 38  ? 3.345   2.998   -7.730  1.00 0.00 ? 38  ILE A CB   4  
ATOM 6236  C CG1  . ILE A 1 38  ? 4.033   1.687   -8.118  1.00 0.00 ? 38  ILE A CG1  4  
ATOM 6237  C CG2  . ILE A 1 38  ? 1.985   2.725   -7.105  1.00 0.00 ? 38  ILE A CG2  4  
ATOM 6238  C CD1  . ILE A 1 38  ? 4.607   0.935   -6.937  1.00 0.00 ? 38  ILE A CD1  4  
ATOM 6239  H H    . ILE A 1 38  ? 2.383   2.258   -10.004 1.00 0.00 ? 38  ILE A H    4  
ATOM 6240  H HA   . ILE A 1 38  ? 2.610   4.771   -8.679  1.00 0.00 ? 38  ILE A HA   4  
ATOM 6241  H HB   . ILE A 1 38  ? 3.952   3.512   -7.000  1.00 0.00 ? 38  ILE A HB   4  
ATOM 6242  H HG12 . ILE A 1 38  ? 3.317   1.043   -8.604  1.00 0.00 ? 38  ILE A HG12 4  
ATOM 6243  H HG13 . ILE A 1 38  ? 4.842   1.901   -8.801  1.00 0.00 ? 38  ILE A HG13 4  
ATOM 6244  H HG21 . ILE A 1 38  ? 1.328   2.297   -7.848  1.00 0.00 ? 38  ILE A HG21 4  
ATOM 6245  H HG22 . ILE A 1 38  ? 1.564   3.651   -6.742  1.00 0.00 ? 38  ILE A HG22 4  
ATOM 6246  H HG23 . ILE A 1 38  ? 2.099   2.034   -6.284  1.00 0.00 ? 38  ILE A HG23 4  
ATOM 6247  H HD11 . ILE A 1 38  ? 5.643   0.696   -7.131  1.00 0.00 ? 38  ILE A HD11 4  
ATOM 6248  H HD12 . ILE A 1 38  ? 4.049   0.023   -6.786  1.00 0.00 ? 38  ILE A HD12 4  
ATOM 6249  H HD13 . ILE A 1 38  ? 4.541   1.549   -6.051  1.00 0.00 ? 38  ILE A HD13 4  
ATOM 6250  N N    . ARG A 1 39  ? 5.061   5.451   -8.785  1.00 0.00 ? 39  ARG A N    4  
ATOM 6251  C CA   . ARG A 1 39  ? 6.371   5.999   -9.114  1.00 0.00 ? 39  ARG A CA   4  
ATOM 6252  C C    . ARG A 1 39  ? 7.167   6.303   -7.848  1.00 0.00 ? 39  ARG A C    4  
ATOM 6253  O O    . ARG A 1 39  ? 6.594   6.506   -6.778  1.00 0.00 ? 39  ARG A O    4  
ATOM 6254  C CB   . ARG A 1 39  ? 6.221   7.270   -9.951  1.00 0.00 ? 39  ARG A CB   4  
ATOM 6255  C CG   . ARG A 1 39  ? 5.397   8.351   -9.271  1.00 0.00 ? 39  ARG A CG   4  
ATOM 6256  C CD   . ARG A 1 39  ? 5.908   9.741   -9.619  1.00 0.00 ? 39  ARG A CD   4  
ATOM 6257  N NE   . ARG A 1 39  ? 5.419   10.753  -8.686  1.00 0.00 ? 39  ARG A NE   4  
ATOM 6258  C CZ   . ARG A 1 39  ? 5.517   12.063  -8.895  1.00 0.00 ? 39  ARG A CZ   4  
ATOM 6259  N NH1  . ARG A 1 39  ? 6.084   12.525  -10.002 1.00 0.00 ? 39  ARG A NH1  4  
ATOM 6260  N NH2  . ARG A 1 39  ? 5.045   12.916  -7.994  1.00 0.00 ? 39  ARG A NH2  4  
ATOM 6261  H H    . ARG A 1 39  ? 4.522   5.884   -8.091  1.00 0.00 ? 39  ARG A H    4  
ATOM 6262  H HA   . ARG A 1 39  ? 6.905   5.259   -9.691  1.00 0.00 ? 39  ARG A HA   4  
ATOM 6263  H HB2  . ARG A 1 39  ? 7.201   7.670   -10.157 1.00 0.00 ? 39  ARG A HB2  4  
ATOM 6264  H HB3  . ARG A 1 39  ? 5.740   7.016   -10.885 1.00 0.00 ? 39  ARG A HB3  4  
ATOM 6265  H HG2  . ARG A 1 39  ? 4.371   8.266   -9.593  1.00 0.00 ? 39  ARG A HG2  4  
ATOM 6266  H HG3  . ARG A 1 39  ? 5.455   8.214   -8.202  1.00 0.00 ? 39  ARG A HG3  4  
ATOM 6267  H HD2  . ARG A 1 39  ? 6.987   9.732   -9.591  1.00 0.00 ? 39  ARG A HD2  4  
ATOM 6268  H HD3  . ARG A 1 39  ? 5.576   9.993   -10.615 1.00 0.00 ? 39  ARG A HD3  4  
ATOM 6269  H HE   . ARG A 1 39  ? 4.995   10.439  -7.859  1.00 0.00 ? 39  ARG A HE   4  
ATOM 6270  H HH11 . ARG A 1 39  ? 6.442   11.889  -10.686 1.00 0.00 ? 39  ARG A HH11 4  
ATOM 6271  H HH12 . ARG A 1 39  ? 6.154   13.511  -10.154 1.00 0.00 ? 39  ARG A HH12 4  
ATOM 6272  H HH21 . ARG A 1 39  ? 4.617   12.573  -7.158  1.00 0.00 ? 39  ARG A HH21 4  
ATOM 6273  H HH22 . ARG A 1 39  ? 5.119   13.900  -8.151  1.00 0.00 ? 39  ARG A HH22 4  
ATOM 6274  N N    . GLY A 1 40  ? 8.489   6.331   -7.979  1.00 0.00 ? 40  GLY A N    4  
ATOM 6275  C CA   . GLY A 1 40  ? 9.340   6.611   -6.838  1.00 0.00 ? 40  GLY A CA   4  
ATOM 6276  C C    . GLY A 1 40  ? 9.537   5.398   -5.949  1.00 0.00 ? 40  GLY A C    4  
ATOM 6277  O O    . GLY A 1 40  ? 8.666   4.532   -5.868  1.00 0.00 ? 40  GLY A O    4  
ATOM 6278  H H    . GLY A 1 40  ? 8.889   6.161   -8.857  1.00 0.00 ? 40  GLY A H    4  
ATOM 6279  H HA2  . GLY A 1 40  ? 10.305  6.941   -7.196  1.00 0.00 ? 40  GLY A HA2  4  
ATOM 6280  H HA3  . GLY A 1 40  ? 8.895   7.402   -6.255  1.00 0.00 ? 40  GLY A HA3  4  
ATOM 6281  N N    . GLY A 1 41  ? 10.684  5.337   -5.281  1.00 0.00 ? 41  GLY A N    4  
ATOM 6282  C CA   . GLY A 1 41  ? 10.972  4.219   -4.402  1.00 0.00 ? 41  GLY A CA   4  
ATOM 6283  C C    . GLY A 1 41  ? 12.038  4.548   -3.376  1.00 0.00 ? 41  GLY A C    4  
ATOM 6284  O O    . GLY A 1 41  ? 12.670  5.603   -3.445  1.00 0.00 ? 41  GLY A O    4  
ATOM 6285  H H    . GLY A 1 41  ? 11.340  6.058   -5.385  1.00 0.00 ? 41  GLY A H    4  
ATOM 6286  H HA2  . GLY A 1 41  ? 10.063  3.940   -3.884  1.00 0.00 ? 41  GLY A HA2  4  
ATOM 6287  H HA3  . GLY A 1 41  ? 11.308  3.383   -5.001  1.00 0.00 ? 41  GLY A HA3  4  
ATOM 6288  N N    . ALA A 1 42  ? 12.240  3.644   -2.423  1.00 0.00 ? 42  ALA A N    4  
ATOM 6289  C CA   . ALA A 1 42  ? 13.237  3.844   -1.379  1.00 0.00 ? 42  ALA A CA   4  
ATOM 6290  C C    . ALA A 1 42  ? 14.636  3.973   -1.974  1.00 0.00 ? 42  ALA A C    4  
ATOM 6291  O O    . ALA A 1 42  ? 15.496  4.658   -1.419  1.00 0.00 ? 42  ALA A O    4  
ATOM 6292  C CB   . ALA A 1 42  ? 13.191  2.699   -0.380  1.00 0.00 ? 42  ALA A CB   4  
ATOM 6293  H H    . ALA A 1 42  ? 11.705  2.823   -2.422  1.00 0.00 ? 42  ALA A H    4  
ATOM 6294  H HA   . ALA A 1 42  ? 12.994  4.758   -0.857  1.00 0.00 ? 42  ALA A HA   4  
ATOM 6295  H HB1  . ALA A 1 42  ? 13.788  1.877   -0.745  1.00 0.00 ? 42  ALA A HB1  4  
ATOM 6296  H HB2  . ALA A 1 42  ? 12.169  2.373   -0.254  1.00 0.00 ? 42  ALA A HB2  4  
ATOM 6297  H HB3  . ALA A 1 42  ? 13.582  3.034   0.570   1.00 0.00 ? 42  ALA A HB3  4  
ATOM 6298  N N    . GLU A 1 43  ? 14.857  3.311   -3.105  1.00 0.00 ? 43  GLU A N    4  
ATOM 6299  C CA   . GLU A 1 43  ? 16.152  3.351   -3.774  1.00 0.00 ? 43  GLU A CA   4  
ATOM 6300  C C    . GLU A 1 43  ? 16.380  4.702   -4.442  1.00 0.00 ? 43  GLU A C    4  
ATOM 6301  O O    . GLU A 1 43  ? 17.514  5.165   -4.560  1.00 0.00 ? 43  GLU A O    4  
ATOM 6302  C CB   . GLU A 1 43  ? 16.247  2.233   -4.814  1.00 0.00 ? 43  GLU A CB   4  
ATOM 6303  C CG   . GLU A 1 43  ? 17.646  2.041   -5.374  1.00 0.00 ? 43  GLU A CG   4  
ATOM 6304  C CD   . GLU A 1 43  ? 17.971  0.585   -5.648  1.00 0.00 ? 43  GLU A CD   4  
ATOM 6305  O OE1  . GLU A 1 43  ? 17.477  -0.283  -4.900  1.00 0.00 ? 43  GLU A OE1  4  
ATOM 6306  O OE2  . GLU A 1 43  ? 18.718  0.315   -6.612  1.00 0.00 ? 43  GLU A OE2  4  
ATOM 6307  H H    . GLU A 1 43  ? 14.132  2.782   -3.499  1.00 0.00 ? 43  GLU A H    4  
ATOM 6308  H HA   . GLU A 1 43  ? 16.915  3.199   -3.026  1.00 0.00 ? 43  GLU A HA   4  
ATOM 6309  H HB2  . GLU A 1 43  ? 15.935  1.305   -4.357  1.00 0.00 ? 43  GLU A HB2  4  
ATOM 6310  H HB3  . GLU A 1 43  ? 15.582  2.462   -5.634  1.00 0.00 ? 43  GLU A HB3  4  
ATOM 6311  H HG2  . GLU A 1 43  ? 17.728  2.592   -6.299  1.00 0.00 ? 43  GLU A HG2  4  
ATOM 6312  H HG3  . GLU A 1 43  ? 18.362  2.426   -4.662  1.00 0.00 ? 43  GLU A HG3  4  
ATOM 6313  N N    . TYR A 1 44  ? 15.294  5.333   -4.879  1.00 0.00 ? 44  TYR A N    4  
ATOM 6314  C CA   . TYR A 1 44  ? 15.378  6.632   -5.536  1.00 0.00 ? 44  TYR A CA   4  
ATOM 6315  C C    . TYR A 1 44  ? 15.149  7.770   -4.544  1.00 0.00 ? 44  TYR A C    4  
ATOM 6316  O O    . TYR A 1 44  ? 14.840  8.895   -4.938  1.00 0.00 ? 44  TYR A O    4  
ATOM 6317  C CB   . TYR A 1 44  ? 14.356  6.719   -6.672  1.00 0.00 ? 44  TYR A CB   4  
ATOM 6318  C CG   . TYR A 1 44  ? 14.709  5.869   -7.871  1.00 0.00 ? 44  TYR A CG   4  
ATOM 6319  C CD1  . TYR A 1 44  ? 15.657  6.293   -8.793  1.00 0.00 ? 44  TYR A CD1  4  
ATOM 6320  C CD2  . TYR A 1 44  ? 14.093  4.641   -8.081  1.00 0.00 ? 44  TYR A CD2  4  
ATOM 6321  C CE1  . TYR A 1 44  ? 15.982  5.518   -9.891  1.00 0.00 ? 44  TYR A CE1  4  
ATOM 6322  C CE2  . TYR A 1 44  ? 14.413  3.860   -9.176  1.00 0.00 ? 44  TYR A CE2  4  
ATOM 6323  C CZ   . TYR A 1 44  ? 15.357  4.303   -10.077 1.00 0.00 ? 44  TYR A CZ   4  
ATOM 6324  O OH   . TYR A 1 44  ? 15.678  3.529   -11.169 1.00 0.00 ? 44  TYR A OH   4  
ATOM 6325  H H    . TYR A 1 44  ? 14.416  4.915   -4.758  1.00 0.00 ? 44  TYR A H    4  
ATOM 6326  H HA   . TYR A 1 44  ? 16.370  6.729   -5.952  1.00 0.00 ? 44  TYR A HA   4  
ATOM 6327  H HB2  . TYR A 1 44  ? 13.394  6.393   -6.305  1.00 0.00 ? 44  TYR A HB2  4  
ATOM 6328  H HB3  . TYR A 1 44  ? 14.281  7.745   -7.002  1.00 0.00 ? 44  TYR A HB3  4  
ATOM 6329  H HD1  . TYR A 1 44  ? 16.144  7.245   -8.645  1.00 0.00 ? 44  TYR A HD1  4  
ATOM 6330  H HD2  . TYR A 1 44  ? 13.354  4.296   -7.373  1.00 0.00 ? 44  TYR A HD2  4  
ATOM 6331  H HE1  . TYR A 1 44  ? 16.721  5.866   -10.597 1.00 0.00 ? 44  TYR A HE1  4  
ATOM 6332  H HE2  . TYR A 1 44  ? 13.923  2.908   -9.321  1.00 0.00 ? 44  TYR A HE2  4  
ATOM 6333  H HH   . TYR A 1 44  ? 16.623  3.580   -11.331 1.00 0.00 ? 44  TYR A HH   4  
ATOM 6334  N N    . GLY A 1 45  ? 15.302  7.474   -3.255  1.00 0.00 ? 45  GLY A N    4  
ATOM 6335  C CA   . GLY A 1 45  ? 15.107  8.486   -2.232  1.00 0.00 ? 45  GLY A CA   4  
ATOM 6336  C C    . GLY A 1 45  ? 13.777  9.204   -2.362  1.00 0.00 ? 45  GLY A C    4  
ATOM 6337  O O    . GLY A 1 45  ? 13.638  10.348  -1.932  1.00 0.00 ? 45  GLY A O    4  
ATOM 6338  H H    . GLY A 1 45  ? 15.549  6.562   -2.997  1.00 0.00 ? 45  GLY A H    4  
ATOM 6339  H HA2  . GLY A 1 45  ? 15.154  8.013   -1.262  1.00 0.00 ? 45  GLY A HA2  4  
ATOM 6340  H HA3  . GLY A 1 45  ? 15.904  9.212   -2.304  1.00 0.00 ? 45  GLY A HA3  4  
ATOM 6341  N N    . LEU A 1 46  ? 12.798  8.530   -2.958  1.00 0.00 ? 46  LEU A N    4  
ATOM 6342  C CA   . LEU A 1 46  ? 11.474  9.113   -3.143  1.00 0.00 ? 46  LEU A CA   4  
ATOM 6343  C C    . LEU A 1 46  ? 10.386  8.160   -2.659  1.00 0.00 ? 46  LEU A C    4  
ATOM 6344  O O    . LEU A 1 46  ? 10.458  6.952   -2.886  1.00 0.00 ? 46  LEU A O    4  
ATOM 6345  C CB   . LEU A 1 46  ? 11.246  9.455   -4.617  1.00 0.00 ? 46  LEU A CB   4  
ATOM 6346  C CG   . LEU A 1 46  ? 9.924   10.160  -4.920  1.00 0.00 ? 46  LEU A CG   4  
ATOM 6347  C CD1  . LEU A 1 46  ? 9.927   11.569  -4.350  1.00 0.00 ? 46  LEU A CD1  4  
ATOM 6348  C CD2  . LEU A 1 46  ? 9.669   10.191  -6.420  1.00 0.00 ? 46  LEU A CD2  4  
ATOM 6349  H H    . LEU A 1 46  ? 12.970  7.621   -3.280  1.00 0.00 ? 46  LEU A H    4  
ATOM 6350  H HA   . LEU A 1 46  ? 11.426  10.020  -2.561  1.00 0.00 ? 46  LEU A HA   4  
ATOM 6351  H HB2  . LEU A 1 46  ? 12.056  10.096  -4.945  1.00 0.00 ? 46  LEU A HB2  4  
ATOM 6352  H HB3  . LEU A 1 46  ? 11.278  8.536   -5.188  1.00 0.00 ? 46  LEU A HB3  4  
ATOM 6353  H HG   . LEU A 1 46  ? 9.117   9.613   -4.454  1.00 0.00 ? 46  LEU A HG   4  
ATOM 6354  H HD11 . LEU A 1 46  ? 10.270  12.263  -5.104  1.00 0.00 ? 46  LEU A HD11 4  
ATOM 6355  H HD12 . LEU A 1 46  ? 10.587  11.611  -3.496  1.00 0.00 ? 46  LEU A HD12 4  
ATOM 6356  H HD13 . LEU A 1 46  ? 8.926   11.837  -4.044  1.00 0.00 ? 46  LEU A HD13 4  
ATOM 6357  H HD21 . LEU A 1 46  ? 9.064   9.342   -6.700  1.00 0.00 ? 46  LEU A HD21 4  
ATOM 6358  H HD22 . LEU A 1 46  ? 10.612  10.150  -6.946  1.00 0.00 ? 46  LEU A HD22 4  
ATOM 6359  H HD23 . LEU A 1 46  ? 9.152   11.103  -6.679  1.00 0.00 ? 46  LEU A HD23 4  
ATOM 6360  N N    . GLY A 1 47  ? 9.379   8.711   -1.989  1.00 0.00 ? 47  GLY A N    4  
ATOM 6361  C CA   . GLY A 1 47  ? 8.291   7.896   -1.484  1.00 0.00 ? 47  GLY A CA   4  
ATOM 6362  C C    . GLY A 1 47  ? 7.522   7.202   -2.592  1.00 0.00 ? 47  GLY A C    4  
ATOM 6363  O O    . GLY A 1 47  ? 7.886   7.301   -3.764  1.00 0.00 ? 47  GLY A O    4  
ATOM 6364  H H    . GLY A 1 47  ? 9.374   9.679   -1.839  1.00 0.00 ? 47  GLY A H    4  
ATOM 6365  H HA2  . GLY A 1 47  ? 8.695   7.147   -0.818  1.00 0.00 ? 47  GLY A HA2  4  
ATOM 6366  H HA3  . GLY A 1 47  ? 7.611   8.526   -0.930  1.00 0.00 ? 47  GLY A HA3  4  
ATOM 6367  N N    . ILE A 1 48  ? 6.457   6.499   -2.221  1.00 0.00 ? 48  ILE A N    4  
ATOM 6368  C CA   . ILE A 1 48  ? 5.637   5.786   -3.192  1.00 0.00 ? 48  ILE A CA   4  
ATOM 6369  C C    . ILE A 1 48  ? 4.396   6.592   -3.561  1.00 0.00 ? 48  ILE A C    4  
ATOM 6370  O O    . ILE A 1 48  ? 3.532   6.840   -2.720  1.00 0.00 ? 48  ILE A O    4  
ATOM 6371  C CB   . ILE A 1 48  ? 5.199   4.409   -2.656  1.00 0.00 ? 48  ILE A CB   4  
ATOM 6372  C CG1  . ILE A 1 48  ? 6.401   3.653   -2.089  1.00 0.00 ? 48  ILE A CG1  4  
ATOM 6373  C CG2  . ILE A 1 48  ? 4.527   3.602   -3.756  1.00 0.00 ? 48  ILE A CG2  4  
ATOM 6374  C CD1  . ILE A 1 48  ? 7.515   3.450   -3.093  1.00 0.00 ? 48  ILE A CD1  4  
ATOM 6375  H H    . ILE A 1 48  ? 6.218   6.458   -1.271  1.00 0.00 ? 48  ILE A H    4  
ATOM 6376  H HA   . ILE A 1 48  ? 6.231   5.631   -4.081  1.00 0.00 ? 48  ILE A HA   4  
ATOM 6377  H HB   . ILE A 1 48  ? 4.478   4.568   -1.868  1.00 0.00 ? 48  ILE A HB   4  
ATOM 6378  H HG12 . ILE A 1 48  ? 6.805   4.204   -1.254  1.00 0.00 ? 48  ILE A HG12 4  
ATOM 6379  H HG13 . ILE A 1 48  ? 6.078   2.680   -1.750  1.00 0.00 ? 48  ILE A HG13 4  
ATOM 6380  H HG21 . ILE A 1 48  ? 3.473   3.838   -3.783  1.00 0.00 ? 48  ILE A HG21 4  
ATOM 6381  H HG22 . ILE A 1 48  ? 4.655   2.548   -3.559  1.00 0.00 ? 48  ILE A HG22 4  
ATOM 6382  H HG23 . ILE A 1 48  ? 4.975   3.848   -4.708  1.00 0.00 ? 48  ILE A HG23 4  
ATOM 6383  H HD11 . ILE A 1 48  ? 7.839   2.420   -3.070  1.00 0.00 ? 48  ILE A HD11 4  
ATOM 6384  H HD12 . ILE A 1 48  ? 8.346   4.094   -2.844  1.00 0.00 ? 48  ILE A HD12 4  
ATOM 6385  H HD13 . ILE A 1 48  ? 7.157   3.692   -4.083  1.00 0.00 ? 48  ILE A HD13 4  
ATOM 6386  N N    . TYR A 1 49  ? 4.316   7.001   -4.824  1.00 0.00 ? 49  TYR A N    4  
ATOM 6387  C CA   . TYR A 1 49  ? 3.181   7.780   -5.305  1.00 0.00 ? 49  TYR A CA   4  
ATOM 6388  C C    . TYR A 1 49  ? 2.451   7.043   -6.424  1.00 0.00 ? 49  TYR A C    4  
ATOM 6389  O O    . TYR A 1 49  ? 2.789   5.907   -6.756  1.00 0.00 ? 49  TYR A O    4  
ATOM 6390  C CB   . TYR A 1 49  ? 3.649   9.148   -5.801  1.00 0.00 ? 49  TYR A CB   4  
ATOM 6391  C CG   . TYR A 1 49  ? 4.360   9.966   -4.746  1.00 0.00 ? 49  TYR A CG   4  
ATOM 6392  C CD1  . TYR A 1 49  ? 5.649   9.644   -4.342  1.00 0.00 ? 49  TYR A CD1  4  
ATOM 6393  C CD2  . TYR A 1 49  ? 3.741   11.060  -4.154  1.00 0.00 ? 49  TYR A CD2  4  
ATOM 6394  C CE1  . TYR A 1 49  ? 6.301   10.388  -3.378  1.00 0.00 ? 49  TYR A CE1  4  
ATOM 6395  C CE2  . TYR A 1 49  ? 4.387   11.810  -3.190  1.00 0.00 ? 49  TYR A CE2  4  
ATOM 6396  C CZ   . TYR A 1 49  ? 5.666   11.469  -2.805  1.00 0.00 ? 49  TYR A CZ   4  
ATOM 6397  O OH   . TYR A 1 49  ? 6.313   12.213  -1.845  1.00 0.00 ? 49  TYR A OH   4  
ATOM 6398  H H    . TYR A 1 49  ? 5.037   6.772   -5.447  1.00 0.00 ? 49  TYR A H    4  
ATOM 6399  H HA   . TYR A 1 49  ? 2.500   7.920   -4.479  1.00 0.00 ? 49  TYR A HA   4  
ATOM 6400  H HB2  . TYR A 1 49  ? 4.330   9.010   -6.627  1.00 0.00 ? 49  TYR A HB2  4  
ATOM 6401  H HB3  . TYR A 1 49  ? 2.792   9.714   -6.139  1.00 0.00 ? 49  TYR A HB3  4  
ATOM 6402  H HD1  . TYR A 1 49  ? 6.143   8.796   -4.792  1.00 0.00 ? 49  TYR A HD1  4  
ATOM 6403  H HD2  . TYR A 1 49  ? 2.738   11.324  -4.457  1.00 0.00 ? 49  TYR A HD2  4  
ATOM 6404  H HE1  . TYR A 1 49  ? 7.304   10.121  -3.077  1.00 0.00 ? 49  TYR A HE1  4  
ATOM 6405  H HE2  . TYR A 1 49  ? 3.890   12.657  -2.741  1.00 0.00 ? 49  TYR A HE2  4  
ATOM 6406  H HH   . TYR A 1 49  ? 6.594   13.049  -2.222  1.00 0.00 ? 49  TYR A HH   4  
ATOM 6407  N N    . ILE A 1 50  ? 1.449   7.698   -7.002  1.00 0.00 ? 50  ILE A N    4  
ATOM 6408  C CA   . ILE A 1 50  ? 0.672   7.105   -8.084  1.00 0.00 ? 50  ILE A CA   4  
ATOM 6409  C C    . ILE A 1 50  ? 0.624   8.029   -9.296  1.00 0.00 ? 50  ILE A C    4  
ATOM 6410  O O    . ILE A 1 50  ? 0.556   9.250   -9.156  1.00 0.00 ? 50  ILE A O    4  
ATOM 6411  C CB   . ILE A 1 50  ? -0.768  6.792   -7.636  1.00 0.00 ? 50  ILE A CB   4  
ATOM 6412  C CG1  . ILE A 1 50  ? -0.760  6.038   -6.305  1.00 0.00 ? 50  ILE A CG1  4  
ATOM 6413  C CG2  . ILE A 1 50  ? -1.492  5.985   -8.703  1.00 0.00 ? 50  ILE A CG2  4  
ATOM 6414  C CD1  . ILE A 1 50  ? -2.138  5.837   -5.715  1.00 0.00 ? 50  ILE A CD1  4  
ATOM 6415  H H    . ILE A 1 50  ? 1.227   8.601   -6.693  1.00 0.00 ? 50  ILE A H    4  
ATOM 6416  H HA   . ILE A 1 50  ? 1.149   6.177   -8.368  1.00 0.00 ? 50  ILE A HA   4  
ATOM 6417  H HB   . ILE A 1 50  ? -1.294  7.726   -7.509  1.00 0.00 ? 50  ILE A HB   4  
ATOM 6418  H HG12 . ILE A 1 50  ? -0.317  5.064   -6.453  1.00 0.00 ? 50  ILE A HG12 4  
ATOM 6419  H HG13 . ILE A 1 50  ? -0.169  6.592   -5.589  1.00 0.00 ? 50  ILE A HG13 4  
ATOM 6420  H HG21 . ILE A 1 50  ? -1.285  6.405   -9.675  1.00 0.00 ? 50  ILE A HG21 4  
ATOM 6421  H HG22 . ILE A 1 50  ? -2.556  6.013   -8.517  1.00 0.00 ? 50  ILE A HG22 4  
ATOM 6422  H HG23 . ILE A 1 50  ? -1.149  4.961   -8.675  1.00 0.00 ? 50  ILE A HG23 4  
ATOM 6423  H HD11 . ILE A 1 50  ? -2.424  6.717   -5.160  1.00 0.00 ? 50  ILE A HD11 4  
ATOM 6424  H HD12 . ILE A 1 50  ? -2.127  4.982   -5.055  1.00 0.00 ? 50  ILE A HD12 4  
ATOM 6425  H HD13 . ILE A 1 50  ? -2.849  5.667   -6.510  1.00 0.00 ? 50  ILE A HD13 4  
ATOM 6426  N N    . THR A 1 51  ? 0.663   7.438   -10.486 1.00 0.00 ? 51  THR A N    4  
ATOM 6427  C CA   . THR A 1 51  ? 0.625   8.209   -11.723 1.00 0.00 ? 51  THR A CA   4  
ATOM 6428  C C    . THR A 1 51  ? 0.125   7.352   -12.882 1.00 0.00 ? 51  THR A C    4  
ATOM 6429  O O    . THR A 1 51  ? 0.669   7.402   -13.986 1.00 0.00 ? 51  THR A O    4  
ATOM 6430  C CB   . THR A 1 51  ? 2.014   8.765   -12.044 1.00 0.00 ? 51  THR A CB   4  
ATOM 6431  O OG1  . THR A 1 51  ? 2.012   9.422   -13.299 1.00 0.00 ? 51  THR A OG1  4  
ATOM 6432  C CG2  . THR A 1 51  ? 3.089   7.701   -12.084 1.00 0.00 ? 51  THR A CG2  4  
ATOM 6433  H H    . THR A 1 51  ? 0.718   6.461   -10.533 1.00 0.00 ? 51  THR A H    4  
ATOM 6434  H HA   . THR A 1 51  ? -0.058  9.033   -11.580 1.00 0.00 ? 51  THR A HA   4  
ATOM 6435  H HB   . THR A 1 51  ? 2.286   9.484   -11.286 1.00 0.00 ? 51  THR A HB   4  
ATOM 6436  H HG1  . THR A 1 51  ? 1.867   8.779   -13.997 1.00 0.00 ? 51  THR A HG1  4  
ATOM 6437  H HG21 . THR A 1 51  ? 2.895   7.023   -12.902 1.00 0.00 ? 51  THR A HG21 4  
ATOM 6438  H HG22 . THR A 1 51  ? 3.088   7.154   -11.153 1.00 0.00 ? 51  THR A HG22 4  
ATOM 6439  H HG23 . THR A 1 51  ? 4.052   8.170   -12.225 1.00 0.00 ? 51  THR A HG23 4  
ATOM 6440  N N    . GLY A 1 52  ? -0.915  6.566   -12.623 1.00 0.00 ? 52  GLY A N    4  
ATOM 6441  C CA   . GLY A 1 52  ? -1.471  5.710   -13.655 1.00 0.00 ? 52  GLY A CA   4  
ATOM 6442  C C    . GLY A 1 52  ? -2.741  5.011   -13.208 1.00 0.00 ? 52  GLY A C    4  
ATOM 6443  O O    . GLY A 1 52  ? -2.842  4.562   -12.066 1.00 0.00 ? 52  GLY A O    4  
ATOM 6444  H H    . GLY A 1 52  ? -1.308  6.566   -11.726 1.00 0.00 ? 52  GLY A H    4  
ATOM 6445  H HA2  . GLY A 1 52  ? -1.690  6.309   -14.526 1.00 0.00 ? 52  GLY A HA2  4  
ATOM 6446  H HA3  . GLY A 1 52  ? -0.737  4.962   -13.921 1.00 0.00 ? 52  GLY A HA3  4  
ATOM 6447  N N    . VAL A 1 53  ? -3.713  4.921   -14.110 1.00 0.00 ? 53  VAL A N    4  
ATOM 6448  C CA   . VAL A 1 53  ? -4.983  4.274   -13.804 1.00 0.00 ? 53  VAL A CA   4  
ATOM 6449  C C    . VAL A 1 53  ? -5.477  3.448   -14.987 1.00 0.00 ? 53  VAL A C    4  
ATOM 6450  O O    . VAL A 1 53  ? -5.880  3.996   -16.013 1.00 0.00 ? 53  VAL A O    4  
ATOM 6451  C CB   . VAL A 1 53  ? -6.064  5.305   -13.426 1.00 0.00 ? 53  VAL A CB   4  
ATOM 6452  C CG1  . VAL A 1 53  ? -7.315  4.605   -12.918 1.00 0.00 ? 53  VAL A CG1  4  
ATOM 6453  C CG2  . VAL A 1 53  ? -5.529  6.281   -12.387 1.00 0.00 ? 53  VAL A CG2  4  
ATOM 6454  H H    . VAL A 1 53  ? -3.573  5.299   -15.003 1.00 0.00 ? 53  VAL A H    4  
ATOM 6455  H HA   . VAL A 1 53  ? -4.828  3.618   -12.958 1.00 0.00 ? 53  VAL A HA   4  
ATOM 6456  H HB   . VAL A 1 53  ? -6.325  5.863   -14.312 1.00 0.00 ? 53  VAL A HB   4  
ATOM 6457  H HG11 . VAL A 1 53  ? -8.026  5.343   -12.579 1.00 0.00 ? 53  VAL A HG11 4  
ATOM 6458  H HG12 . VAL A 1 53  ? -7.055  3.953   -12.098 1.00 0.00 ? 53  VAL A HG12 4  
ATOM 6459  H HG13 . VAL A 1 53  ? -7.751  4.025   -13.716 1.00 0.00 ? 53  VAL A HG13 4  
ATOM 6460  H HG21 . VAL A 1 53  ? -5.434  5.778   -11.437 1.00 0.00 ? 53  VAL A HG21 4  
ATOM 6461  H HG22 . VAL A 1 53  ? -6.213  7.110   -12.289 1.00 0.00 ? 53  VAL A HG22 4  
ATOM 6462  H HG23 . VAL A 1 53  ? -4.563  6.646   -12.700 1.00 0.00 ? 53  VAL A HG23 4  
ATOM 6463  N N    . ASP A 1 54  ? -5.442  2.128   -14.836 1.00 0.00 ? 54  ASP A N    4  
ATOM 6464  C CA   . ASP A 1 54  ? -5.886  1.228   -15.894 1.00 0.00 ? 54  ASP A CA   4  
ATOM 6465  C C    . ASP A 1 54  ? -7.406  1.075   -15.875 1.00 0.00 ? 54  ASP A C    4  
ATOM 6466  O O    . ASP A 1 54  ? -8.026  1.088   -14.812 1.00 0.00 ? 54  ASP A O    4  
ATOM 6467  C CB   . ASP A 1 54  ? -5.222  -0.142  -15.737 1.00 0.00 ? 54  ASP A CB   4  
ATOM 6468  C CG   . ASP A 1 54  ? -3.940  -0.257  -16.539 1.00 0.00 ? 54  ASP A CG   4  
ATOM 6469  O OD1  . ASP A 1 54  ? -3.950  0.117   -17.730 1.00 0.00 ? 54  ASP A OD1  4  
ATOM 6470  O OD2  . ASP A 1 54  ? -2.928  -0.723  -15.975 1.00 0.00 ? 54  ASP A OD2  4  
ATOM 6471  H H    . ASP A 1 54  ? -5.110  1.752   -13.995 1.00 0.00 ? 54  ASP A H    4  
ATOM 6472  H HA   . ASP A 1 54  ? -5.590  1.656   -16.839 1.00 0.00 ? 54  ASP A HA   4  
ATOM 6473  H HB2  . ASP A 1 54  ? -4.989  -0.305  -14.695 1.00 0.00 ? 54  ASP A HB2  4  
ATOM 6474  H HB3  . ASP A 1 54  ? -5.906  -0.908  -16.072 1.00 0.00 ? 54  ASP A HB3  4  
ATOM 6475  N N    . PRO A 1 55  ? -8.029  0.927   -17.058 1.00 0.00 ? 55  PRO A N    4  
ATOM 6476  C CA   . PRO A 1 55  ? -9.481  0.771   -17.169 1.00 0.00 ? 55  PRO A CA   4  
ATOM 6477  C C    . PRO A 1 55  ? -9.952  -0.609  -16.724 1.00 0.00 ? 55  PRO A C    4  
ATOM 6478  O O    . PRO A 1 55  ? -9.349  -1.624  -17.072 1.00 0.00 ? 55  PRO A O    4  
ATOM 6479  C CB   . PRO A 1 55  ? -9.741  0.968   -18.663 1.00 0.00 ? 55  PRO A CB   4  
ATOM 6480  C CG   . PRO A 1 55  ? -8.479  0.537   -19.324 1.00 0.00 ? 55  PRO A CG   4  
ATOM 6481  C CD   . PRO A 1 55  ? -7.366  0.900   -18.377 1.00 0.00 ? 55  PRO A CD   4  
ATOM 6482  H HA   . PRO A 1 55  ? -10.005 1.529   -16.606 1.00 0.00 ? 55  PRO A HA   4  
ATOM 6483  H HB2  . PRO A 1 55  ? -10.579 0.359   -18.969 1.00 0.00 ? 55  PRO A HB2  4  
ATOM 6484  H HB3  . PRO A 1 55  ? -9.954  2.009   -18.860 1.00 0.00 ? 55  PRO A HB3  4  
ATOM 6485  H HG2  . PRO A 1 55  ? -8.497  -0.531  -19.488 1.00 0.00 ? 55  PRO A HG2  4  
ATOM 6486  H HG3  . PRO A 1 55  ? -8.358  1.059   -20.261 1.00 0.00 ? 55  PRO A HG3  4  
ATOM 6487  H HD2  . PRO A 1 55  ? -6.590  0.150   -18.402 1.00 0.00 ? 55  PRO A HD2  4  
ATOM 6488  H HD3  . PRO A 1 55  ? -6.963  1.871   -18.624 1.00 0.00 ? 55  PRO A HD3  4  
ATOM 6489  N N    . GLY A 1 56  ? -11.034 -0.640  -15.953 1.00 0.00 ? 56  GLY A N    4  
ATOM 6490  C CA   . GLY A 1 56  ? -11.568 -1.901  -15.473 1.00 0.00 ? 56  GLY A CA   4  
ATOM 6491  C C    . GLY A 1 56  ? -10.772 -2.464  -14.312 1.00 0.00 ? 56  GLY A C    4  
ATOM 6492  O O    . GLY A 1 56  ? -10.680 -3.680  -14.146 1.00 0.00 ? 56  GLY A O    4  
ATOM 6493  H H    . GLY A 1 56  ? -11.474 0.201   -15.707 1.00 0.00 ? 56  GLY A H    4  
ATOM 6494  H HA2  . GLY A 1 56  ? -12.589 -1.749  -15.155 1.00 0.00 ? 56  GLY A HA2  4  
ATOM 6495  H HA3  . GLY A 1 56  ? -11.556 -2.615  -16.283 1.00 0.00 ? 56  GLY A HA3  4  
ATOM 6496  N N    . SER A 1 57  ? -10.195 -1.577  -13.507 1.00 0.00 ? 57  SER A N    4  
ATOM 6497  C CA   . SER A 1 57  ? -9.403  -1.993  -12.355 1.00 0.00 ? 57  SER A CA   4  
ATOM 6498  C C    . SER A 1 57  ? -10.148 -1.720  -11.053 1.00 0.00 ? 57  SER A C    4  
ATOM 6499  O O    . SER A 1 57  ? -10.950 -0.789  -10.970 1.00 0.00 ? 57  SER A O    4  
ATOM 6500  C CB   . SER A 1 57  ? -8.056  -1.268  -12.347 1.00 0.00 ? 57  SER A CB   4  
ATOM 6501  O OG   . SER A 1 57  ? -8.205  0.077   -11.923 1.00 0.00 ? 57  SER A OG   4  
ATOM 6502  H H    . SER A 1 57  ? -10.304 -0.621  -13.691 1.00 0.00 ? 57  SER A H    4  
ATOM 6503  H HA   . SER A 1 57  ? -9.228  -3.056  -12.439 1.00 0.00 ? 57  SER A HA   4  
ATOM 6504  H HB2  . SER A 1 57  ? -7.381  -1.773  -11.669 1.00 0.00 ? 57  SER A HB2  4  
ATOM 6505  H HB3  . SER A 1 57  ? -7.640  -1.274  -13.345 1.00 0.00 ? 57  SER A HB3  4  
ATOM 6506  H HG   . SER A 1 57  ? -7.645  0.645   -12.457 1.00 0.00 ? 57  SER A HG   4  
ATOM 6507  N N    . GLU A 1 58  ? -9.880  -2.537  -10.040 1.00 0.00 ? 58  GLU A N    4  
ATOM 6508  C CA   . GLU A 1 58  ? -10.525 -2.382  -8.742  1.00 0.00 ? 58  GLU A CA   4  
ATOM 6509  C C    . GLU A 1 58  ? -10.182 -1.030  -8.123  1.00 0.00 ? 58  GLU A C    4  
ATOM 6510  O O    . GLU A 1 58  ? -10.989 -0.443  -7.401  1.00 0.00 ? 58  GLU A O    4  
ATOM 6511  C CB   . GLU A 1 58  ? -10.103 -3.513  -7.801  1.00 0.00 ? 58  GLU A CB   4  
ATOM 6512  C CG   . GLU A 1 58  ? -11.262 -4.373  -7.324  1.00 0.00 ? 58  GLU A CG   4  
ATOM 6513  C CD   . GLU A 1 58  ? -11.167 -4.714  -5.851  1.00 0.00 ? 58  GLU A CD   4  
ATOM 6514  O OE1  . GLU A 1 58  ? -10.285 -5.519  -5.483  1.00 0.00 ? 58  GLU A OE1  4  
ATOM 6515  O OE2  . GLU A 1 58  ? -11.975 -4.178  -5.063  1.00 0.00 ? 58  GLU A OE2  4  
ATOM 6516  H H    . GLU A 1 58  ? -9.230  -3.260  -10.168 1.00 0.00 ? 58  GLU A H    4  
ATOM 6517  H HA   . GLU A 1 58  ? -11.593 -2.433  -8.895  1.00 0.00 ? 58  GLU A HA   4  
ATOM 6518  H HB2  . GLU A 1 58  ? -9.399  -4.151  -8.317  1.00 0.00 ? 58  GLU A HB2  4  
ATOM 6519  H HB3  . GLU A 1 58  ? -9.618  -3.087  -6.935  1.00 0.00 ? 58  GLU A HB3  4  
ATOM 6520  H HG2  . GLU A 1 58  ? -12.185 -3.837  -7.495  1.00 0.00 ? 58  GLU A HG2  4  
ATOM 6521  H HG3  . GLU A 1 58  ? -11.270 -5.291  -7.892  1.00 0.00 ? 58  GLU A HG3  4  
ATOM 6522  N N    . ALA A 1 59  ? -8.980  -0.542  -8.411  1.00 0.00 ? 59  ALA A N    4  
ATOM 6523  C CA   . ALA A 1 59  ? -8.529  0.739   -7.883  1.00 0.00 ? 59  ALA A CA   4  
ATOM 6524  C C    . ALA A 1 59  ? -9.249  1.898   -8.566  1.00 0.00 ? 59  ALA A C    4  
ATOM 6525  O O    . ALA A 1 59  ? -9.477  2.944   -7.959  1.00 0.00 ? 59  ALA A O    4  
ATOM 6526  C CB   . ALA A 1 59  ? -7.023  0.878   -8.054  1.00 0.00 ? 59  ALA A CB   4  
ATOM 6527  H H    . ALA A 1 59  ? -8.382  -1.057  -8.992  1.00 0.00 ? 59  ALA A H    4  
ATOM 6528  H HA   . ALA A 1 59  ? -8.752  0.762   -6.827  1.00 0.00 ? 59  ALA A HA   4  
ATOM 6529  H HB1  . ALA A 1 59  ? -6.588  -0.097  -8.215  1.00 0.00 ? 59  ALA A HB1  4  
ATOM 6530  H HB2  . ALA A 1 59  ? -6.599  1.319   -7.163  1.00 0.00 ? 59  ALA A HB2  4  
ATOM 6531  H HB3  . ALA A 1 59  ? -6.813  1.512   -8.903  1.00 0.00 ? 59  ALA A HB3  4  
ATOM 6532  N N    . GLU A 1 60  ? -9.607  1.702   -9.831  1.00 0.00 ? 60  GLU A N    4  
ATOM 6533  C CA   . GLU A 1 60  ? -10.302 2.730   -10.596 1.00 0.00 ? 60  GLU A CA   4  
ATOM 6534  C C    . GLU A 1 60  ? -11.744 2.882   -10.122 1.00 0.00 ? 60  GLU A C    4  
ATOM 6535  O O    . GLU A 1 60  ? -12.315 3.970   -10.180 1.00 0.00 ? 60  GLU A O    4  
ATOM 6536  C CB   . GLU A 1 60  ? -10.276 2.389   -12.088 1.00 0.00 ? 60  GLU A CB   4  
ATOM 6537  C CG   . GLU A 1 60  ? -10.661 3.555   -12.985 1.00 0.00 ? 60  GLU A CG   4  
ATOM 6538  C CD   . GLU A 1 60  ? -11.927 3.291   -13.776 1.00 0.00 ? 60  GLU A CD   4  
ATOM 6539  O OE1  . GLU A 1 60  ? -11.930 2.348   -14.594 1.00 0.00 ? 60  GLU A OE1  4  
ATOM 6540  O OE2  . GLU A 1 60  ? -12.915 4.027   -13.577 1.00 0.00 ? 60  GLU A OE2  4  
ATOM 6541  H H    . GLU A 1 60  ? -9.397  0.847   -10.260 1.00 0.00 ? 60  GLU A H    4  
ATOM 6542  H HA   . GLU A 1 60  ? -9.785  3.665   -10.441 1.00 0.00 ? 60  GLU A HA   4  
ATOM 6543  H HB2  . GLU A 1 60  ? -9.280  2.071   -12.355 1.00 0.00 ? 60  GLU A HB2  4  
ATOM 6544  H HB3  . GLU A 1 60  ? -10.965 1.579   -12.272 1.00 0.00 ? 60  GLU A HB3  4  
ATOM 6545  H HG2  . GLU A 1 60  ? -10.814 4.430   -12.371 1.00 0.00 ? 60  GLU A HG2  4  
ATOM 6546  H HG3  . GLU A 1 60  ? -9.852  3.740   -13.678 1.00 0.00 ? 60  GLU A HG3  4  
ATOM 6547  N N    . GLY A 1 61  ? -12.326 1.782   -9.654  1.00 0.00 ? 61  GLY A N    4  
ATOM 6548  C CA   . GLY A 1 61  ? -13.696 1.814   -9.178  1.00 0.00 ? 61  GLY A CA   4  
ATOM 6549  C C    . GLY A 1 61  ? -13.836 2.554   -7.862  1.00 0.00 ? 61  GLY A C    4  
ATOM 6550  O O    . GLY A 1 61  ? -14.853 3.201   -7.612  1.00 0.00 ? 61  GLY A O    4  
ATOM 6551  H H    . GLY A 1 61  ? -11.821 0.943   -9.633  1.00 0.00 ? 61  GLY A H    4  
ATOM 6552  H HA2  . GLY A 1 61  ? -14.312 2.300   -9.920  1.00 0.00 ? 61  GLY A HA2  4  
ATOM 6553  H HA3  . GLY A 1 61  ? -14.043 0.800   -9.047  1.00 0.00 ? 61  GLY A HA3  4  
ATOM 6554  N N    . SER A 1 62  ? -12.813 2.459   -7.020  1.00 0.00 ? 62  SER A N    4  
ATOM 6555  C CA   . SER A 1 62  ? -12.827 3.125   -5.723  1.00 0.00 ? 62  SER A CA   4  
ATOM 6556  C C    . SER A 1 62  ? -12.688 4.635   -5.883  1.00 0.00 ? 62  SER A C    4  
ATOM 6557  O O    . SER A 1 62  ? -13.323 5.407   -5.165  1.00 0.00 ? 62  SER A O    4  
ATOM 6558  C CB   . SER A 1 62  ? -11.699 2.589   -4.839  1.00 0.00 ? 62  SER A CB   4  
ATOM 6559  O OG   . SER A 1 62  ? -12.032 2.693   -3.466  1.00 0.00 ? 62  SER A OG   4  
ATOM 6560  H H    . SER A 1 62  ? -12.029 1.928   -7.277  1.00 0.00 ? 62  SER A H    4  
ATOM 6561  H HA   . SER A 1 62  ? -13.774 2.910   -5.251  1.00 0.00 ? 62  SER A HA   4  
ATOM 6562  H HB2  . SER A 1 62  ? -11.522 1.550   -5.075  1.00 0.00 ? 62  SER A HB2  4  
ATOM 6563  H HB3  . SER A 1 62  ? -10.799 3.158   -5.023  1.00 0.00 ? 62  SER A HB3  4  
ATOM 6564  H HG   . SER A 1 62  ? -12.274 1.828   -3.129  1.00 0.00 ? 62  SER A HG   4  
ATOM 6565  N N    . GLY A 1 63  ? -11.854 5.050   -6.831  1.00 0.00 ? 63  GLY A N    4  
ATOM 6566  C CA   . GLY A 1 63  ? -11.647 6.467   -7.070  1.00 0.00 ? 63  GLY A CA   4  
ATOM 6567  C C    . GLY A 1 63  ? -10.199 6.879   -6.893  1.00 0.00 ? 63  GLY A C    4  
ATOM 6568  O O    . GLY A 1 63  ? -9.911  7.943   -6.346  1.00 0.00 ? 63  GLY A O    4  
ATOM 6569  H H    . GLY A 1 63  ? -11.375 4.389   -7.373  1.00 0.00 ? 63  GLY A H    4  
ATOM 6570  H HA2  . GLY A 1 63  ? -11.955 6.700   -8.078  1.00 0.00 ? 63  GLY A HA2  4  
ATOM 6571  H HA3  . GLY A 1 63  ? -12.257 7.030   -6.379  1.00 0.00 ? 63  GLY A HA3  4  
ATOM 6572  N N    . LEU A 1 64  ? -9.284  6.032   -7.355  1.00 0.00 ? 64  LEU A N    4  
ATOM 6573  C CA   . LEU A 1 64  ? -7.858  6.312   -7.246  1.00 0.00 ? 64  LEU A CA   4  
ATOM 6574  C C    . LEU A 1 64  ? -7.363  7.097   -8.457  1.00 0.00 ? 64  LEU A C    4  
ATOM 6575  O O    . LEU A 1 64  ? -7.464  6.634   -9.592  1.00 0.00 ? 64  LEU A O    4  
ATOM 6576  C CB   . LEU A 1 64  ? -7.071  5.007   -7.109  1.00 0.00 ? 64  LEU A CB   4  
ATOM 6577  C CG   . LEU A 1 64  ? -6.740  4.598   -5.671  1.00 0.00 ? 64  LEU A CG   4  
ATOM 6578  C CD1  . LEU A 1 64  ? -6.979  3.110   -5.467  1.00 0.00 ? 64  LEU A CD1  4  
ATOM 6579  C CD2  . LEU A 1 64  ? -5.301  4.960   -5.331  1.00 0.00 ? 64  LEU A CD2  4  
ATOM 6580  H H    . LEU A 1 64  ? -9.577  5.198   -7.781  1.00 0.00 ? 64  LEU A H    4  
ATOM 6581  H HA   . LEU A 1 64  ? -7.705  6.908   -6.358  1.00 0.00 ? 64  LEU A HA   4  
ATOM 6582  H HB2  . LEU A 1 64  ? -7.648  4.214   -7.564  1.00 0.00 ? 64  LEU A HB2  4  
ATOM 6583  H HB3  . LEU A 1 64  ? -6.143  5.109   -7.653  1.00 0.00 ? 64  LEU A HB3  4  
ATOM 6584  H HG   . LEU A 1 64  ? -7.389  5.135   -4.994  1.00 0.00 ? 64  LEU A HG   4  
ATOM 6585  H HD11 . LEU A 1 64  ? -7.294  2.932   -4.450  1.00 0.00 ? 64  LEU A HD11 4  
ATOM 6586  H HD12 . LEU A 1 64  ? -6.064  2.568   -5.660  1.00 0.00 ? 64  LEU A HD12 4  
ATOM 6587  H HD13 . LEU A 1 64  ? -7.747  2.772   -6.147  1.00 0.00 ? 64  LEU A HD13 4  
ATOM 6588  H HD21 . LEU A 1 64  ? -4.673  4.090   -5.452  1.00 0.00 ? 64  LEU A HD21 4  
ATOM 6589  H HD22 . LEU A 1 64  ? -5.249  5.303   -4.308  1.00 0.00 ? 64  LEU A HD22 4  
ATOM 6590  H HD23 . LEU A 1 64  ? -4.962  5.744   -5.991  1.00 0.00 ? 64  LEU A HD23 4  
ATOM 6591  N N    . LYS A 1 65  ? -6.828  8.287   -8.205  1.00 0.00 ? 65  LYS A N    4  
ATOM 6592  C CA   . LYS A 1 65  ? -6.316  9.138   -9.273  1.00 0.00 ? 65  LYS A CA   4  
ATOM 6593  C C    . LYS A 1 65  ? -4.798  9.261   -9.191  1.00 0.00 ? 65  LYS A C    4  
ATOM 6594  O O    . LYS A 1 65  ? -4.168  8.705   -8.293  1.00 0.00 ? 65  LYS A O    4  
ATOM 6595  C CB   . LYS A 1 65  ? -6.958  10.525  -9.202  1.00 0.00 ? 65  LYS A CB   4  
ATOM 6596  C CG   . LYS A 1 65  ? -8.270  10.628  -9.961  1.00 0.00 ? 65  LYS A CG   4  
ATOM 6597  C CD   . LYS A 1 65  ? -9.460  10.335  -9.061  1.00 0.00 ? 65  LYS A CD   4  
ATOM 6598  C CE   . LYS A 1 65  ? -10.051 11.614  -8.487  1.00 0.00 ? 65  LYS A CE   4  
ATOM 6599  N NZ   . LYS A 1 65  ? -9.423  11.983  -7.188  1.00 0.00 ? 65  LYS A NZ   4  
ATOM 6600  H H    . LYS A 1 65  ? -6.775  8.602   -7.278  1.00 0.00 ? 65  LYS A H    4  
ATOM 6601  H HA   . LYS A 1 65  ? -6.577  8.678   -10.216 1.00 0.00 ? 65  LYS A HA   4  
ATOM 6602  H HB2  . LYS A 1 65  ? -7.145  10.768  -8.166  1.00 0.00 ? 65  LYS A HB2  4  
ATOM 6603  H HB3  . LYS A 1 65  ? -6.270  11.248  -9.613  1.00 0.00 ? 65  LYS A HB3  4  
ATOM 6604  H HG2  . LYS A 1 65  ? -8.368  11.628  -10.356 1.00 0.00 ? 65  LYS A HG2  4  
ATOM 6605  H HG3  . LYS A 1 65  ? -8.262  9.917   -10.774 1.00 0.00 ? 65  LYS A HG3  4  
ATOM 6606  H HD2  . LYS A 1 65  ? -10.218 9.827   -9.636  1.00 0.00 ? 65  LYS A HD2  4  
ATOM 6607  H HD3  . LYS A 1 65  ? -9.135  9.703   -8.247  1.00 0.00 ? 65  LYS A HD3  4  
ATOM 6608  H HE2  . LYS A 1 65  ? -9.895  12.415  -9.193  1.00 0.00 ? 65  LYS A HE2  4  
ATOM 6609  H HE3  . LYS A 1 65  ? -11.111 11.469  -8.338  1.00 0.00 ? 65  LYS A HE3  4  
ATOM 6610  H HZ1  . LYS A 1 65  ? -8.986  11.146  -6.751  1.00 0.00 ? 65  LYS A HZ1  4  
ATOM 6611  H HZ2  . LYS A 1 65  ? -10.141 12.363  -6.539  1.00 0.00 ? 65  LYS A HZ2  4  
ATOM 6612  H HZ3  . LYS A 1 65  ? -8.691  12.705  -7.338  1.00 0.00 ? 65  LYS A HZ3  4  
ATOM 6613  N N    . VAL A 1 66  ? -4.218  9.997   -10.134 1.00 0.00 ? 66  VAL A N    4  
ATOM 6614  C CA   . VAL A 1 66  ? -2.774  10.194  -10.167 1.00 0.00 ? 66  VAL A CA   4  
ATOM 6615  C C    . VAL A 1 66  ? -2.355  11.346  -9.259  1.00 0.00 ? 66  VAL A C    4  
ATOM 6616  O O    . VAL A 1 66  ? -3.111  12.296  -9.058  1.00 0.00 ? 66  VAL A O    4  
ATOM 6617  C CB   . VAL A 1 66  ? -2.279  10.480  -11.598 1.00 0.00 ? 66  VAL A CB   4  
ATOM 6618  C CG1  . VAL A 1 66  ? -2.388  9.232   -12.461 1.00 0.00 ? 66  VAL A CG1  4  
ATOM 6619  C CG2  . VAL A 1 66  ? -3.058  11.632  -12.212 1.00 0.00 ? 66  VAL A CG2  4  
ATOM 6620  H H    . VAL A 1 66  ? -4.774  10.416  -10.823 1.00 0.00 ? 66  VAL A H    4  
ATOM 6621  H HA   . VAL A 1 66  ? -2.304  9.286   -9.820  1.00 0.00 ? 66  VAL A HA   4  
ATOM 6622  H HB   . VAL A 1 66  ? -1.237  10.764  -11.546 1.00 0.00 ? 66  VAL A HB   4  
ATOM 6623  H HG11 . VAL A 1 66  ? -2.292  8.354   -11.838 1.00 0.00 ? 66  VAL A HG11 4  
ATOM 6624  H HG12 . VAL A 1 66  ? -1.601  9.235   -13.200 1.00 0.00 ? 66  VAL A HG12 4  
ATOM 6625  H HG13 . VAL A 1 66  ? -3.348  9.220   -12.956 1.00 0.00 ? 66  VAL A HG13 4  
ATOM 6626  H HG21 . VAL A 1 66  ? -3.838  11.241  -12.849 1.00 0.00 ? 66  VAL A HG21 4  
ATOM 6627  H HG22 . VAL A 1 66  ? -2.390  12.247  -12.798 1.00 0.00 ? 66  VAL A HG22 4  
ATOM 6628  H HG23 . VAL A 1 66  ? -3.499  12.228  -11.427 1.00 0.00 ? 66  VAL A HG23 4  
ATOM 6629  N N    . GLY A 1 67  ? -1.148  11.253  -8.712  1.00 0.00 ? 67  GLY A N    4  
ATOM 6630  C CA   . GLY A 1 67  ? -0.651  12.293  -7.832  1.00 0.00 ? 67  GLY A CA   4  
ATOM 6631  C C    . GLY A 1 67  ? -0.698  11.889  -6.370  1.00 0.00 ? 67  GLY A C    4  
ATOM 6632  O O    . GLY A 1 67  ? 0.081   12.386  -5.558  1.00 0.00 ? 67  GLY A O    4  
ATOM 6633  H H    . GLY A 1 67  ? -0.590  10.471  -8.908  1.00 0.00 ? 67  GLY A H    4  
ATOM 6634  H HA2  . GLY A 1 67  ? 0.373   12.517  -8.099  1.00 0.00 ? 67  GLY A HA2  4  
ATOM 6635  H HA3  . GLY A 1 67  ? -1.254  13.182  -7.967  1.00 0.00 ? 67  GLY A HA3  4  
ATOM 6636  N N    . ASP A 1 68  ? -1.614  10.985  -6.037  1.00 0.00 ? 68  ASP A N    4  
ATOM 6637  C CA   . ASP A 1 68  ? -1.759  10.515  -4.663  1.00 0.00 ? 68  ASP A CA   4  
ATOM 6638  C C    . ASP A 1 68  ? -0.462  9.888   -4.162  1.00 0.00 ? 68  ASP A C    4  
ATOM 6639  O O    . ASP A 1 68  ? 0.326   9.359   -4.945  1.00 0.00 ? 68  ASP A O    4  
ATOM 6640  C CB   . ASP A 1 68  ? -2.901  9.502   -4.567  1.00 0.00 ? 68  ASP A CB   4  
ATOM 6641  C CG   . ASP A 1 68  ? -4.257  10.169  -4.454  1.00 0.00 ? 68  ASP A CG   4  
ATOM 6642  O OD1  . ASP A 1 68  ? -4.427  11.269  -5.020  1.00 0.00 ? 68  ASP A OD1  4  
ATOM 6643  O OD2  . ASP A 1 68  ? -5.151  9.591   -3.799  1.00 0.00 ? 68  ASP A OD2  4  
ATOM 6644  H H    . ASP A 1 68  ? -2.206  10.626  -6.729  1.00 0.00 ? 68  ASP A H    4  
ATOM 6645  H HA   . ASP A 1 68  ? -1.995  11.369  -4.045  1.00 0.00 ? 68  ASP A HA   4  
ATOM 6646  H HB2  . ASP A 1 68  ? -2.898  8.881   -5.452  1.00 0.00 ? 68  ASP A HB2  4  
ATOM 6647  H HB3  . ASP A 1 68  ? -2.750  8.882   -3.692  1.00 0.00 ? 68  ASP A HB3  4  
ATOM 6648  N N    . GLN A 1 69  ? -0.249  9.951   -2.851  1.00 0.00 ? 69  GLN A N    4  
ATOM 6649  C CA   . GLN A 1 69  ? 0.952   9.389   -2.244  1.00 0.00 ? 69  GLN A CA   4  
ATOM 6650  C C    . GLN A 1 69  ? 0.595   8.285   -1.255  1.00 0.00 ? 69  GLN A C    4  
ATOM 6651  O O    . GLN A 1 69  ? -0.069  8.530   -0.248  1.00 0.00 ? 69  GLN A O    4  
ATOM 6652  C CB   . GLN A 1 69  ? 1.750   10.485  -1.537  1.00 0.00 ? 69  GLN A CB   4  
ATOM 6653  C CG   . GLN A 1 69  ? 3.091   10.011  -0.999  1.00 0.00 ? 69  GLN A CG   4  
ATOM 6654  C CD   . GLN A 1 69  ? 3.787   11.064  -0.158  1.00 0.00 ? 69  GLN A CD   4  
ATOM 6655  O OE1  . GLN A 1 69  ? 3.620   12.262  -0.381  1.00 0.00 ? 69  GLN A OE1  4  
ATOM 6656  N NE2  . GLN A 1 69  ? 4.574   10.619  0.814   1.00 0.00 ? 69  GLN A NE2  4  
ATOM 6657  H H    . GLN A 1 69  ? -0.915  10.387  -2.279  1.00 0.00 ? 69  GLN A H    4  
ATOM 6658  H HA   . GLN A 1 69  ? 1.557   8.968   -3.033  1.00 0.00 ? 69  GLN A HA   4  
ATOM 6659  H HB2  . GLN A 1 69  ? 1.930   11.290  -2.234  1.00 0.00 ? 69  GLN A HB2  4  
ATOM 6660  H HB3  . GLN A 1 69  ? 1.168   10.861  -0.709  1.00 0.00 ? 69  GLN A HB3  4  
ATOM 6661  H HG2  . GLN A 1 69  ? 2.931   9.134   -0.391  1.00 0.00 ? 69  GLN A HG2  4  
ATOM 6662  H HG3  . GLN A 1 69  ? 3.729   9.758   -1.834  1.00 0.00 ? 69  GLN A HG3  4  
ATOM 6663  H HE21 . GLN A 1 69  ? 4.660   9.650   0.933   1.00 0.00 ? 69  GLN A HE21 4  
ATOM 6664  H HE22 . GLN A 1 69  ? 5.036   11.277  1.374   1.00 0.00 ? 69  GLN A HE22 4  
ATOM 6665  N N    . ILE A 1 70  ? 1.041   7.068   -1.548  1.00 0.00 ? 70  ILE A N    4  
ATOM 6666  C CA   . ILE A 1 70  ? 0.768   5.926   -0.683  1.00 0.00 ? 70  ILE A CA   4  
ATOM 6667  C C    . ILE A 1 70  ? 1.596   5.995   0.595   1.00 0.00 ? 70  ILE A C    4  
ATOM 6668  O O    . ILE A 1 70  ? 2.797   6.266   0.554   1.00 0.00 ? 70  ILE A O    4  
ATOM 6669  C CB   . ILE A 1 70  ? 1.061   4.593   -1.400  1.00 0.00 ? 70  ILE A CB   4  
ATOM 6670  C CG1  . ILE A 1 70  ? 0.370   4.557   -2.764  1.00 0.00 ? 70  ILE A CG1  4  
ATOM 6671  C CG2  . ILE A 1 70  ? 0.611   3.419   -0.543  1.00 0.00 ? 70  ILE A CG2  4  
ATOM 6672  C CD1  . ILE A 1 70  ? 0.886   3.465   -3.675  1.00 0.00 ? 70  ILE A CD1  4  
ATOM 6673  H H    . ILE A 1 70  ? 1.565   6.934   -2.364  1.00 0.00 ? 70  ILE A H    4  
ATOM 6674  H HA   . ILE A 1 70  ? -0.280  5.947   -0.423  1.00 0.00 ? 70  ILE A HA   4  
ATOM 6675  H HB   . ILE A 1 70  ? 2.128   4.514   -1.543  1.00 0.00 ? 70  ILE A HB   4  
ATOM 6676  H HG12 . ILE A 1 70  ? -0.688  4.396   -2.620  1.00 0.00 ? 70  ILE A HG12 4  
ATOM 6677  H HG13 . ILE A 1 70  ? 0.520   5.505   -3.262  1.00 0.00 ? 70  ILE A HG13 4  
ATOM 6678  H HG21 . ILE A 1 70  ? 1.448   3.052   0.033   1.00 0.00 ? 70  ILE A HG21 4  
ATOM 6679  H HG22 . ILE A 1 70  ? 0.239   2.630   -1.179  1.00 0.00 ? 70  ILE A HG22 4  
ATOM 6680  H HG23 . ILE A 1 70  ? -0.172  3.741   0.127   1.00 0.00 ? 70  ILE A HG23 4  
ATOM 6681  H HD11 . ILE A 1 70  ? 1.530   3.898   -4.426  1.00 0.00 ? 70  ILE A HD11 4  
ATOM 6682  H HD12 . ILE A 1 70  ? 0.053   2.973   -4.155  1.00 0.00 ? 70  ILE A HD12 4  
ATOM 6683  H HD13 . ILE A 1 70  ? 1.443   2.746   -3.095  1.00 0.00 ? 70  ILE A HD13 4  
ATOM 6684  N N    . LEU A 1 71  ? 0.949   5.751   1.728   1.00 0.00 ? 71  LEU A N    4  
ATOM 6685  C CA   . LEU A 1 71  ? 1.626   5.786   3.019   1.00 0.00 ? 71  LEU A CA   4  
ATOM 6686  C C    . LEU A 1 71  ? 1.880   4.376   3.539   1.00 0.00 ? 71  LEU A C    4  
ATOM 6687  O O    . LEU A 1 71  ? 2.993   4.045   3.947   1.00 0.00 ? 71  LEU A O    4  
ATOM 6688  C CB   . LEU A 1 71  ? 0.793   6.574   4.034   1.00 0.00 ? 71  LEU A CB   4  
ATOM 6689  C CG   . LEU A 1 71  ? 0.490   8.020   3.639   1.00 0.00 ? 71  LEU A CG   4  
ATOM 6690  C CD1  . LEU A 1 71  ? -0.721  8.538   4.399   1.00 0.00 ? 71  LEU A CD1  4  
ATOM 6691  C CD2  . LEU A 1 71  ? 1.700   8.906   3.893   1.00 0.00 ? 71  LEU A CD2  4  
ATOM 6692  H H    . LEU A 1 71  ? -0.009  5.542   1.696   1.00 0.00 ? 71  LEU A H    4  
ATOM 6693  H HA   . LEU A 1 71  ? 2.574   6.283   2.883   1.00 0.00 ? 71  LEU A HA   4  
ATOM 6694  H HB2  . LEU A 1 71  ? -0.144  6.057   4.177   1.00 0.00 ? 71  LEU A HB2  4  
ATOM 6695  H HB3  . LEU A 1 71  ? 1.326   6.586   4.973   1.00 0.00 ? 71  LEU A HB3  4  
ATOM 6696  H HG   . LEU A 1 71  ? 0.262   8.058   2.583   1.00 0.00 ? 71  LEU A HG   4  
ATOM 6697  H HD11 . LEU A 1 71  ? -1.557  7.873   4.240   1.00 0.00 ? 71  LEU A HD11 4  
ATOM 6698  H HD12 . LEU A 1 71  ? -0.974  9.525   4.043   1.00 0.00 ? 71  LEU A HD12 4  
ATOM 6699  H HD13 . LEU A 1 71  ? -0.493  8.583   5.454   1.00 0.00 ? 71  LEU A HD13 4  
ATOM 6700  H HD21 . LEU A 1 71  ? 1.369   9.892   4.185   1.00 0.00 ? 71  LEU A HD21 4  
ATOM 6701  H HD22 . LEU A 1 71  ? 2.290   8.977   2.990   1.00 0.00 ? 71  LEU A HD22 4  
ATOM 6702  H HD23 . LEU A 1 71  ? 2.299   8.479   4.682   1.00 0.00 ? 71  LEU A HD23 4  
ATOM 6703  N N    . GLU A 1 72  ? 0.841   3.548   3.522   1.00 0.00 ? 72  GLU A N    4  
ATOM 6704  C CA   . GLU A 1 72  ? 0.952   2.172   3.991   1.00 0.00 ? 72  GLU A CA   4  
ATOM 6705  C C    . GLU A 1 72  ? -0.129  1.294   3.367   1.00 0.00 ? 72  GLU A C    4  
ATOM 6706  O O    . GLU A 1 72  ? -1.201  1.776   3.002   1.00 0.00 ? 72  GLU A O    4  
ATOM 6707  C CB   . GLU A 1 72  ? 0.846   2.121   5.517   1.00 0.00 ? 72  GLU A CB   4  
ATOM 6708  C CG   . GLU A 1 72  ? -0.473  2.652   6.053   1.00 0.00 ? 72  GLU A CG   4  
ATOM 6709  C CD   . GLU A 1 72  ? -0.349  4.050   6.626   1.00 0.00 ? 72  GLU A CD   4  
ATOM 6710  O OE1  . GLU A 1 72  ? 0.623   4.751   6.276   1.00 0.00 ? 72  GLU A OE1  4  
ATOM 6711  O OE2  . GLU A 1 72  ? -1.225  4.444   7.424   1.00 0.00 ? 72  GLU A OE2  4  
ATOM 6712  H H    . GLU A 1 72  ? -0.022  3.869   3.185   1.00 0.00 ? 72  GLU A H    4  
ATOM 6713  H HA   . GLU A 1 72  ? 1.920   1.798   3.693   1.00 0.00 ? 72  GLU A HA   4  
ATOM 6714  H HB2  . GLU A 1 72  ? 0.955   1.097   5.840   1.00 0.00 ? 72  GLU A HB2  4  
ATOM 6715  H HB3  . GLU A 1 72  ? 1.646   2.711   5.940   1.00 0.00 ? 72  GLU A HB3  4  
ATOM 6716  H HG2  . GLU A 1 72  ? -1.192  2.672   5.248   1.00 0.00 ? 72  GLU A HG2  4  
ATOM 6717  H HG3  . GLU A 1 72  ? -0.823  1.990   6.831   1.00 0.00 ? 72  GLU A HG3  4  
ATOM 6718  N N    . VAL A 1 73  ? 0.162   0.003   3.245   1.00 0.00 ? 73  VAL A N    4  
ATOM 6719  C CA   . VAL A 1 73  ? -0.783  -0.942  2.664   1.00 0.00 ? 73  VAL A CA   4  
ATOM 6720  C C    . VAL A 1 73  ? -0.777  -2.263  3.426   1.00 0.00 ? 73  VAL A C    4  
ATOM 6721  O O    . VAL A 1 73  ? 0.277   -2.862  3.643   1.00 0.00 ? 73  VAL A O    4  
ATOM 6722  C CB   . VAL A 1 73  ? -0.465  -1.217  1.183   1.00 0.00 ? 73  VAL A CB   4  
ATOM 6723  C CG1  . VAL A 1 73  ? -1.571  -2.041  0.542   1.00 0.00 ? 73  VAL A CG1  4  
ATOM 6724  C CG2  . VAL A 1 73  ? -0.260  0.089   0.431   1.00 0.00 ? 73  VAL A CG2  4  
ATOM 6725  H H    . VAL A 1 73  ? 1.034   -0.321  3.553   1.00 0.00 ? 73  VAL A H    4  
ATOM 6726  H HA   . VAL A 1 73  ? -1.770  -0.507  2.726   1.00 0.00 ? 73  VAL A HA   4  
ATOM 6727  H HB   . VAL A 1 73  ? 0.452   -1.785  1.131   1.00 0.00 ? 73  VAL A HB   4  
ATOM 6728  H HG11 . VAL A 1 73  ? -2.125  -2.559  1.312   1.00 0.00 ? 73  VAL A HG11 4  
ATOM 6729  H HG12 . VAL A 1 73  ? -1.138  -2.762  -0.134  1.00 0.00 ? 73  VAL A HG12 4  
ATOM 6730  H HG13 . VAL A 1 73  ? -2.237  -1.390  -0.004  1.00 0.00 ? 73  VAL A HG13 4  
ATOM 6731  H HG21 . VAL A 1 73  ? -0.878  0.859   0.870   1.00 0.00 ? 73  VAL A HG21 4  
ATOM 6732  H HG22 . VAL A 1 73  ? -0.536  -0.045  -0.605  1.00 0.00 ? 73  VAL A HG22 4  
ATOM 6733  H HG23 . VAL A 1 73  ? 0.778   0.381   0.492   1.00 0.00 ? 73  VAL A HG23 4  
ATOM 6734  N N    . ASN A 1 74  ? -1.960  -2.712  3.832   1.00 0.00 ? 74  ASN A N    4  
ATOM 6735  C CA   . ASN A 1 74  ? -2.090  -3.963  4.571   1.00 0.00 ? 74  ASN A CA   4  
ATOM 6736  C C    . ASN A 1 74  ? -1.311  -3.904  5.880   1.00 0.00 ? 74  ASN A C    4  
ATOM 6737  O O    . ASN A 1 74  ? -0.806  -4.920  6.360   1.00 0.00 ? 74  ASN A O    4  
ATOM 6738  C CB   . ASN A 1 74  ? -1.595  -5.135  3.722   1.00 0.00 ? 74  ASN A CB   4  
ATOM 6739  C CG   . ASN A 1 74  ? -2.660  -5.652  2.774   1.00 0.00 ? 74  ASN A CG   4  
ATOM 6740  O OD1  . ASN A 1 74  ? -3.666  -6.219  3.201   1.00 0.00 ? 74  ASN A OD1  4  
ATOM 6741  N ND2  . ASN A 1 74  ? -2.444  -5.457  1.478   1.00 0.00 ? 74  ASN A ND2  4  
ATOM 6742  H H    . ASN A 1 74  ? -2.765  -2.190  3.630   1.00 0.00 ? 74  ASN A H    4  
ATOM 6743  H HA   . ASN A 1 74  ? -3.136  -4.109  4.795   1.00 0.00 ? 74  ASN A HA   4  
ATOM 6744  H HB2  . ASN A 1 74  ? -0.745  -4.814  3.137   1.00 0.00 ? 74  ASN A HB2  4  
ATOM 6745  H HB3  . ASN A 1 74  ? -1.297  -5.944  4.375   1.00 0.00 ? 74  ASN A HB3  4  
ATOM 6746  H HD21 . ASN A 1 74  ? -1.621  -4.997  1.211   1.00 0.00 ? 74  ASN A HD21 4  
ATOM 6747  H HD22 . ASN A 1 74  ? -3.116  -5.781  0.843   1.00 0.00 ? 74  ASN A HD22 4  
ATOM 6748  N N    . GLY A 1 75  ? -1.215  -2.709  6.453   1.00 0.00 ? 75  GLY A N    4  
ATOM 6749  C CA   . GLY A 1 75  ? -0.494  -2.541  7.702   1.00 0.00 ? 75  GLY A CA   4  
ATOM 6750  C C    . GLY A 1 75  ? 1.009   -2.546  7.508   1.00 0.00 ? 75  GLY A C    4  
ATOM 6751  O O    . GLY A 1 75  ? 1.757   -2.921  8.412   1.00 0.00 ? 75  GLY A O    4  
ATOM 6752  H H    . GLY A 1 75  ? -1.637  -1.935  6.025   1.00 0.00 ? 75  GLY A H    4  
ATOM 6753  H HA2  . GLY A 1 75  ? -0.786  -1.602  8.149   1.00 0.00 ? 75  GLY A HA2  4  
ATOM 6754  H HA3  . GLY A 1 75  ? -0.763  -3.344  8.371   1.00 0.00 ? 75  GLY A HA3  4  
ATOM 6755  N N    . ARG A 1 76  ? 1.453   -2.128  6.326   1.00 0.00 ? 76  ARG A N    4  
ATOM 6756  C CA   . ARG A 1 76  ? 2.878   -2.086  6.016   1.00 0.00 ? 76  ARG A CA   4  
ATOM 6757  C C    . ARG A 1 76  ? 3.307   -0.677  5.621   1.00 0.00 ? 76  ARG A C    4  
ATOM 6758  O O    . ARG A 1 76  ? 2.634   -0.009  4.837   1.00 0.00 ? 76  ARG A O    4  
ATOM 6759  C CB   . ARG A 1 76  ? 3.203   -3.067  4.888   1.00 0.00 ? 76  ARG A CB   4  
ATOM 6760  C CG   . ARG A 1 76  ? 4.665   -3.485  4.849   1.00 0.00 ? 76  ARG A CG   4  
ATOM 6761  C CD   . ARG A 1 76  ? 4.821   -4.991  4.988   1.00 0.00 ? 76  ARG A CD   4  
ATOM 6762  N NE   . ARG A 1 76  ? 5.978   -5.350  5.805   1.00 0.00 ? 76  ARG A NE   4  
ATOM 6763  C CZ   . ARG A 1 76  ? 6.146   -6.543  6.369   1.00 0.00 ? 76  ARG A CZ   4  
ATOM 6764  N NH1  . ARG A 1 76  ? 5.235   -7.496  6.208   1.00 0.00 ? 76  ARG A NH1  4  
ATOM 6765  N NH2  . ARG A 1 76  ? 7.227   -6.786  7.097   1.00 0.00 ? 76  ARG A NH2  4  
ATOM 6766  H H    . ARG A 1 76  ? 0.808   -1.842  5.647   1.00 0.00 ? 76  ARG A H    4  
ATOM 6767  H HA   . ARG A 1 76  ? 3.420   -2.379  6.903   1.00 0.00 ? 76  ARG A HA   4  
ATOM 6768  H HB2  . ARG A 1 76  ? 2.599   -3.953  5.010   1.00 0.00 ? 76  ARG A HB2  4  
ATOM 6769  H HB3  . ARG A 1 76  ? 2.960   -2.603  3.943   1.00 0.00 ? 76  ARG A HB3  4  
ATOM 6770  H HG2  . ARG A 1 76  ? 5.094   -3.175  3.908   1.00 0.00 ? 76  ARG A HG2  4  
ATOM 6771  H HG3  . ARG A 1 76  ? 5.189   -3.002  5.661   1.00 0.00 ? 76  ARG A HG3  4  
ATOM 6772  H HD2  . ARG A 1 76  ? 3.930   -5.392  5.448   1.00 0.00 ? 76  ARG A HD2  4  
ATOM 6773  H HD3  . ARG A 1 76  ? 4.941   -5.420  4.004   1.00 0.00 ? 76  ARG A HD3  4  
ATOM 6774  H HE   . ARG A 1 76  ? 6.665   -4.665  5.941   1.00 0.00 ? 76  ARG A HE   4  
ATOM 6775  H HH11 . ARG A 1 76  ? 4.417   -7.319  5.660   1.00 0.00 ? 76  ARG A HH11 4  
ATOM 6776  H HH12 . ARG A 1 76  ? 5.368   -8.391  6.634   1.00 0.00 ? 76  ARG A HH12 4  
ATOM 6777  H HH21 . ARG A 1 76  ? 7.916   -6.073  7.223   1.00 0.00 ? 76  ARG A HH21 4  
ATOM 6778  H HH22 . ARG A 1 76  ? 7.353   -7.683  7.522   1.00 0.00 ? 76  ARG A HH22 4  
ATOM 6779  N N    . SER A 1 77  ? 4.433   -0.231  6.169   1.00 0.00 ? 77  SER A N    4  
ATOM 6780  C CA   . SER A 1 77  ? 4.952   1.099   5.873   1.00 0.00 ? 77  SER A CA   4  
ATOM 6781  C C    . SER A 1 77  ? 5.394   1.198   4.416   1.00 0.00 ? 77  SER A C    4  
ATOM 6782  O O    . SER A 1 77  ? 6.390   0.595   4.017   1.00 0.00 ? 77  SER A O    4  
ATOM 6783  C CB   . SER A 1 77  ? 6.125   1.428   6.797   1.00 0.00 ? 77  SER A CB   4  
ATOM 6784  O OG   . SER A 1 77  ? 6.200   2.821   7.051   1.00 0.00 ? 77  SER A OG   4  
ATOM 6785  H H    . SER A 1 77  ? 4.926   -0.811  6.786   1.00 0.00 ? 77  SER A H    4  
ATOM 6786  H HA   . SER A 1 77  ? 4.158   1.810   6.045   1.00 0.00 ? 77  SER A HA   4  
ATOM 6787  H HB2  . SER A 1 77  ? 5.997   0.912   7.736   1.00 0.00 ? 77  SER A HB2  4  
ATOM 6788  H HB3  . SER A 1 77  ? 7.047   1.109   6.333   1.00 0.00 ? 77  SER A HB3  4  
ATOM 6789  H HG   . SER A 1 77  ? 5.332   3.149   7.295   1.00 0.00 ? 77  SER A HG   4  
ATOM 6790  N N    . PHE A 1 78  ? 4.645   1.961   3.627   1.00 0.00 ? 78  PHE A N    4  
ATOM 6791  C CA   . PHE A 1 78  ? 4.959   2.139   2.214   1.00 0.00 ? 78  PHE A CA   4  
ATOM 6792  C C    . PHE A 1 78  ? 5.645   3.481   1.972   1.00 0.00 ? 78  PHE A C    4  
ATOM 6793  O O    . PHE A 1 78  ? 5.508   4.075   0.903   1.00 0.00 ? 78  PHE A O    4  
ATOM 6794  C CB   . PHE A 1 78  ? 3.685   2.043   1.372   1.00 0.00 ? 78  PHE A CB   4  
ATOM 6795  C CG   . PHE A 1 78  ? 3.447   0.677   0.794   1.00 0.00 ? 78  PHE A CG   4  
ATOM 6796  C CD1  . PHE A 1 78  ? 3.239   -0.414  1.624   1.00 0.00 ? 78  PHE A CD1  4  
ATOM 6797  C CD2  . PHE A 1 78  ? 3.433   0.483   -0.577  1.00 0.00 ? 78  PHE A CD2  4  
ATOM 6798  C CE1  . PHE A 1 78  ? 3.021   -1.671  1.097   1.00 0.00 ? 78  PHE A CE1  4  
ATOM 6799  C CE2  . PHE A 1 78  ? 3.215   -0.772  -1.111  1.00 0.00 ? 78  PHE A CE2  4  
ATOM 6800  C CZ   . PHE A 1 78  ? 3.009   -1.851  -0.274  1.00 0.00 ? 78  PHE A CZ   4  
ATOM 6801  H H    . PHE A 1 78  ? 3.863   2.416   4.003   1.00 0.00 ? 78  PHE A H    4  
ATOM 6802  H HA   . PHE A 1 78  ? 5.632   1.347   1.923   1.00 0.00 ? 78  PHE A HA   4  
ATOM 6803  H HB2  . PHE A 1 78  ? 2.835   2.295   1.989   1.00 0.00 ? 78  PHE A HB2  4  
ATOM 6804  H HB3  . PHE A 1 78  ? 3.749   2.744   0.552   1.00 0.00 ? 78  PHE A HB3  4  
ATOM 6805  H HD1  . PHE A 1 78  ? 3.248   -0.274  2.695   1.00 0.00 ? 78  PHE A HD1  4  
ATOM 6806  H HD2  . PHE A 1 78  ? 3.595   1.326   -1.233  1.00 0.00 ? 78  PHE A HD2  4  
ATOM 6807  H HE1  . PHE A 1 78  ? 2.859   -2.513  1.753   1.00 0.00 ? 78  PHE A HE1  4  
ATOM 6808  H HE2  . PHE A 1 78  ? 3.205   -0.910  -2.183  1.00 0.00 ? 78  PHE A HE2  4  
ATOM 6809  H HZ   . PHE A 1 78  ? 2.838   -2.833  -0.689  1.00 0.00 ? 78  PHE A HZ   4  
ATOM 6810  N N    . LEU A 1 79  ? 6.384   3.951   2.972   1.00 0.00 ? 79  LEU A N    4  
ATOM 6811  C CA   . LEU A 1 79  ? 7.092   5.222   2.866   1.00 0.00 ? 79  LEU A CA   4  
ATOM 6812  C C    . LEU A 1 79  ? 8.487   5.021   2.283   1.00 0.00 ? 79  LEU A C    4  
ATOM 6813  O O    . LEU A 1 79  ? 9.012   5.893   1.591   1.00 0.00 ? 79  LEU A O    4  
ATOM 6814  C CB   . LEU A 1 79  ? 7.191   5.890   4.238   1.00 0.00 ? 79  LEU A CB   4  
ATOM 6815  C CG   . LEU A 1 79  ? 5.858   6.345   4.835   1.00 0.00 ? 79  LEU A CG   4  
ATOM 6816  C CD1  . LEU A 1 79  ? 6.075   6.994   6.194   1.00 0.00 ? 79  LEU A CD1  4  
ATOM 6817  C CD2  . LEU A 1 79  ? 5.153   7.307   3.890   1.00 0.00 ? 79  LEU A CD2  4  
ATOM 6818  H H    . LEU A 1 79  ? 6.457   3.432   3.800   1.00 0.00 ? 79  LEU A H    4  
ATOM 6819  H HA   . LEU A 1 79  ? 6.526   5.861   2.204   1.00 0.00 ? 79  LEU A HA   4  
ATOM 6820  H HB2  . LEU A 1 79  ? 7.649   5.192   4.923   1.00 0.00 ? 79  LEU A HB2  4  
ATOM 6821  H HB3  . LEU A 1 79  ? 7.833   6.754   4.149   1.00 0.00 ? 79  LEU A HB3  4  
ATOM 6822  H HG   . LEU A 1 79  ? 5.221   5.484   4.974   1.00 0.00 ? 79  LEU A HG   4  
ATOM 6823  H HD11 . LEU A 1 79  ? 5.315   7.742   6.361   1.00 0.00 ? 79  LEU A HD11 4  
ATOM 6824  H HD12 . LEU A 1 79  ? 7.050   7.459   6.218   1.00 0.00 ? 79  LEU A HD12 4  
ATOM 6825  H HD13 . LEU A 1 79  ? 6.016   6.240   6.965   1.00 0.00 ? 79  LEU A HD13 4  
ATOM 6826  H HD21 . LEU A 1 79  ? 4.507   6.750   3.226   1.00 0.00 ? 79  LEU A HD21 4  
ATOM 6827  H HD22 . LEU A 1 79  ? 5.888   7.845   3.309   1.00 0.00 ? 79  LEU A HD22 4  
ATOM 6828  H HD23 . LEU A 1 79  ? 4.563   8.008   4.462   1.00 0.00 ? 79  LEU A HD23 4  
ATOM 6829  N N    . ASN A 1 80  ? 9.080   3.867   2.566   1.00 0.00 ? 80  ASN A N    4  
ATOM 6830  C CA   . ASN A 1 80  ? 10.414  3.552   2.069   1.00 0.00 ? 80  ASN A CA   4  
ATOM 6831  C C    . ASN A 1 80  ? 10.484  2.111   1.572   1.00 0.00 ? 80  ASN A C    4  
ATOM 6832  O O    . ASN A 1 80  ? 11.058  1.243   2.229   1.00 0.00 ? 80  ASN A O    4  
ATOM 6833  C CB   . ASN A 1 80  ? 11.457  3.778   3.165   1.00 0.00 ? 80  ASN A CB   4  
ATOM 6834  C CG   . ASN A 1 80  ? 11.125  3.029   4.441   1.00 0.00 ? 80  ASN A CG   4  
ATOM 6835  O OD1  . ASN A 1 80  ? 10.188  3.382   5.156   1.00 0.00 ? 80  ASN A OD1  4  
ATOM 6836  N ND2  . ASN A 1 80  ? 11.897  1.988   4.734   1.00 0.00 ? 80  ASN A ND2  4  
ATOM 6837  H H    . ASN A 1 80  ? 8.610   3.211   3.121   1.00 0.00 ? 80  ASN A H    4  
ATOM 6838  H HA   . ASN A 1 80  ? 10.625  4.215   1.243   1.00 0.00 ? 80  ASN A HA   4  
ATOM 6839  H HB2  . ASN A 1 80  ? 12.420  3.440   2.813   1.00 0.00 ? 80  ASN A HB2  4  
ATOM 6840  H HB3  . ASN A 1 80  ? 11.510  4.832   3.391   1.00 0.00 ? 80  ASN A HB3  4  
ATOM 6841  H HD21 . ASN A 1 80  ? 12.626  1.765   4.119   1.00 0.00 ? 80  ASN A HD21 4  
ATOM 6842  H HD22 . ASN A 1 80  ? 11.705  1.486   5.554   1.00 0.00 ? 80  ASN A HD22 4  
ATOM 6843  N N    . ILE A 1 81  ? 9.894   1.864   0.406   1.00 0.00 ? 81  ILE A N    4  
ATOM 6844  C CA   . ILE A 1 81  ? 9.888   0.529   -0.180  1.00 0.00 ? 81  ILE A CA   4  
ATOM 6845  C C    . ILE A 1 81  ? 10.410  0.557   -1.613  1.00 0.00 ? 81  ILE A C    4  
ATOM 6846  O O    . ILE A 1 81  ? 10.262  1.554   -2.318  1.00 0.00 ? 81  ILE A O    4  
ATOM 6847  C CB   . ILE A 1 81  ? 8.473   -0.085  -0.165  1.00 0.00 ? 81  ILE A CB   4  
ATOM 6848  C CG1  . ILE A 1 81  ? 8.508   -1.524  -0.686  1.00 0.00 ? 81  ILE A CG1  4  
ATOM 6849  C CG2  . ILE A 1 81  ? 7.516   0.762   -0.993  1.00 0.00 ? 81  ILE A CG2  4  
ATOM 6850  C CD1  . ILE A 1 81  ? 7.453   -2.416  -0.069  1.00 0.00 ? 81  ILE A CD1  4  
ATOM 6851  H H    . ILE A 1 81  ? 9.452   2.597   -0.071  1.00 0.00 ? 81  ILE A H    4  
ATOM 6852  H HA   . ILE A 1 81  ? 10.536  -0.100  0.415   1.00 0.00 ? 81  ILE A HA   4  
ATOM 6853  H HB   . ILE A 1 81  ? 8.118   -0.088  0.854   1.00 0.00 ? 81  ILE A HB   4  
ATOM 6854  H HG12 . ILE A 1 81  ? 8.351   -1.517  -1.754  1.00 0.00 ? 81  ILE A HG12 4  
ATOM 6855  H HG13 . ILE A 1 81  ? 9.475   -1.954  -0.470  1.00 0.00 ? 81  ILE A HG13 4  
ATOM 6856  H HG21 . ILE A 1 81  ? 7.563   1.787   -0.660  1.00 0.00 ? 81  ILE A HG21 4  
ATOM 6857  H HG22 . ILE A 1 81  ? 6.510   0.389   -0.872  1.00 0.00 ? 81  ILE A HG22 4  
ATOM 6858  H HG23 . ILE A 1 81  ? 7.797   0.708   -2.034  1.00 0.00 ? 81  ILE A HG23 4  
ATOM 6859  H HD11 . ILE A 1 81  ? 6.937   -1.876  0.712   1.00 0.00 ? 81  ILE A HD11 4  
ATOM 6860  H HD12 . ILE A 1 81  ? 7.923   -3.292  0.350   1.00 0.00 ? 81  ILE A HD12 4  
ATOM 6861  H HD13 . ILE A 1 81  ? 6.745   -2.715  -0.828  1.00 0.00 ? 81  ILE A HD13 4  
ATOM 6862  N N    . LEU A 1 82  ? 11.018  -0.546  -2.038  1.00 0.00 ? 82  LEU A N    4  
ATOM 6863  C CA   . LEU A 1 82  ? 11.560  -0.647  -3.388  1.00 0.00 ? 82  LEU A CA   4  
ATOM 6864  C C    . LEU A 1 82  ? 10.460  -0.474  -4.430  1.00 0.00 ? 82  LEU A C    4  
ATOM 6865  O O    . LEU A 1 82  ? 9.283   -0.700  -4.148  1.00 0.00 ? 82  LEU A O    4  
ATOM 6866  C CB   . LEU A 1 82  ? 12.254  -1.997  -3.582  1.00 0.00 ? 82  LEU A CB   4  
ATOM 6867  C CG   . LEU A 1 82  ? 13.519  -2.201  -2.747  1.00 0.00 ? 82  LEU A CG   4  
ATOM 6868  C CD1  . LEU A 1 82  ? 13.878  -3.677  -2.672  1.00 0.00 ? 82  LEU A CD1  4  
ATOM 6869  C CD2  . LEU A 1 82  ? 14.675  -1.398  -3.326  1.00 0.00 ? 82  LEU A CD2  4  
ATOM 6870  H H    . LEU A 1 82  ? 11.104  -1.310  -1.429  1.00 0.00 ? 82  LEU A H    4  
ATOM 6871  H HA   . LEU A 1 82  ? 12.286  0.142   -3.514  1.00 0.00 ? 82  LEU A HA   4  
ATOM 6872  H HB2  . LEU A 1 82  ? 11.551  -2.779  -3.330  1.00 0.00 ? 82  LEU A HB2  4  
ATOM 6873  H HB3  . LEU A 1 82  ? 12.518  -2.096  -4.623  1.00 0.00 ? 82  LEU A HB3  4  
ATOM 6874  H HG   . LEU A 1 82  ? 13.339  -1.851  -1.740  1.00 0.00 ? 82  LEU A HG   4  
ATOM 6875  H HD11 . LEU A 1 82  ? 12.981  -4.258  -2.515  1.00 0.00 ? 82  LEU A HD11 4  
ATOM 6876  H HD12 . LEU A 1 82  ? 14.562  -3.841  -1.853  1.00 0.00 ? 82  LEU A HD12 4  
ATOM 6877  H HD13 . LEU A 1 82  ? 14.346  -3.980  -3.597  1.00 0.00 ? 82  LEU A HD13 4  
ATOM 6878  H HD21 . LEU A 1 82  ? 15.274  -2.036  -3.960  1.00 0.00 ? 82  LEU A HD21 4  
ATOM 6879  H HD22 . LEU A 1 82  ? 15.284  -1.013  -2.523  1.00 0.00 ? 82  LEU A HD22 4  
ATOM 6880  H HD23 . LEU A 1 82  ? 14.284  -0.576  -3.909  1.00 0.00 ? 82  LEU A HD23 4  
ATOM 6881  N N    . HIS A 1 83  ? 10.851  -0.074  -5.636  1.00 0.00 ? 83  HIS A N    4  
ATOM 6882  C CA   . HIS A 1 83  ? 9.898   0.129   -6.720  1.00 0.00 ? 83  HIS A CA   4  
ATOM 6883  C C    . HIS A 1 83  ? 9.266   -1.192  -7.145  1.00 0.00 ? 83  HIS A C    4  
ATOM 6884  O O    . HIS A 1 83  ? 8.114   -1.230  -7.577  1.00 0.00 ? 83  HIS A O    4  
ATOM 6885  C CB   . HIS A 1 83  ? 10.587  0.787   -7.917  1.00 0.00 ? 83  HIS A CB   4  
ATOM 6886  C CG   . HIS A 1 83  ? 9.656   1.097   -9.048  1.00 0.00 ? 83  HIS A CG   4  
ATOM 6887  N ND1  . HIS A 1 83  ? 8.712   2.100   -8.992  1.00 0.00 ? 83  HIS A ND1  4  
ATOM 6888  C CD2  . HIS A 1 83  ? 9.527   0.529   -10.271 1.00 0.00 ? 83  HIS A CD2  4  
ATOM 6889  C CE1  . HIS A 1 83  ? 8.042   2.136   -10.131 1.00 0.00 ? 83  HIS A CE1  4  
ATOM 6890  N NE2  . HIS A 1 83  ? 8.518   1.193   -10.923 1.00 0.00 ? 83  HIS A NE2  4  
ATOM 6891  H H    . HIS A 1 83  ? 11.803  0.090   -5.800  1.00 0.00 ? 83  HIS A H    4  
ATOM 6892  H HA   . HIS A 1 83  ? 9.121   0.787   -6.359  1.00 0.00 ? 83  HIS A HA   4  
ATOM 6893  H HB2  . HIS A 1 83  ? 11.041  1.715   -7.597  1.00 0.00 ? 83  HIS A HB2  4  
ATOM 6894  H HB3  . HIS A 1 83  ? 11.356  0.122   -8.290  1.00 0.00 ? 83  HIS A HB3  4  
ATOM 6895  H HD1  . HIS A 1 83  ? 8.555   2.697   -8.230  1.00 0.00 ? 83  HIS A HD1  4  
ATOM 6896  H HD2  . HIS A 1 83  ? 10.110  -0.294  -10.660 1.00 0.00 ? 83  HIS A HD2  4  
ATOM 6897  H HE1  . HIS A 1 83  ? 7.242   2.820   -10.373 1.00 0.00 ? 83  HIS A HE1  4  
ATOM 6898  H HE2  . HIS A 1 83  ? 8.149   0.951   -11.797 1.00 0.00 ? 83  HIS A HE2  4  
ATOM 6899  N N    . ASP A 1 84  ? 10.028  -2.274  -7.020  1.00 0.00 ? 84  ASP A N    4  
ATOM 6900  C CA   . ASP A 1 84  ? 9.543   -3.598  -7.392  1.00 0.00 ? 84  ASP A CA   4  
ATOM 6901  C C    . ASP A 1 84  ? 8.742   -4.224  -6.255  1.00 0.00 ? 84  ASP A C    4  
ATOM 6902  O O    . ASP A 1 84  ? 7.693   -4.827  -6.480  1.00 0.00 ? 84  ASP A O    4  
ATOM 6903  C CB   . ASP A 1 84  ? 10.714  -4.507  -7.767  1.00 0.00 ? 84  ASP A CB   4  
ATOM 6904  C CG   . ASP A 1 84  ? 11.404  -4.064  -9.042  1.00 0.00 ? 84  ASP A CG   4  
ATOM 6905  O OD1  . ASP A 1 84  ? 12.346  -3.248  -8.955  1.00 0.00 ? 84  ASP A OD1  4  
ATOM 6906  O OD2  . ASP A 1 84  ? 11.004  -4.532  -10.128 1.00 0.00 ? 84  ASP A OD2  4  
ATOM 6907  H H    . ASP A 1 84  ? 10.939  -2.180  -6.669  1.00 0.00 ? 84  ASP A H    4  
ATOM 6908  H HA   . ASP A 1 84  ? 8.898   -3.485  -8.250  1.00 0.00 ? 84  ASP A HA   4  
ATOM 6909  H HB2  . ASP A 1 84  ? 11.439  -4.499  -6.967  1.00 0.00 ? 84  ASP A HB2  4  
ATOM 6910  H HB3  . ASP A 1 84  ? 10.350  -5.514  -7.907  1.00 0.00 ? 84  ASP A HB3  4  
ATOM 6911  N N    . GLU A 1 85  ? 9.244   -4.077  -5.034  1.00 0.00 ? 85  GLU A N    4  
ATOM 6912  C CA   . GLU A 1 85  ? 8.576   -4.629  -3.861  1.00 0.00 ? 85  GLU A CA   4  
ATOM 6913  C C    . GLU A 1 85  ? 7.178   -4.038  -3.702  1.00 0.00 ? 85  GLU A C    4  
ATOM 6914  O O    . GLU A 1 85  ? 6.243   -4.728  -3.297  1.00 0.00 ? 85  GLU A O    4  
ATOM 6915  C CB   . GLU A 1 85  ? 9.402   -4.359  -2.602  1.00 0.00 ? 85  GLU A CB   4  
ATOM 6916  C CG   . GLU A 1 85  ? 9.113   -5.328  -1.466  1.00 0.00 ? 85  GLU A CG   4  
ATOM 6917  C CD   . GLU A 1 85  ? 10.198  -5.324  -0.407  1.00 0.00 ? 85  GLU A CD   4  
ATOM 6918  O OE1  . GLU A 1 85  ? 10.843  -4.271  -0.221  1.00 0.00 ? 85  GLU A OE1  4  
ATOM 6919  O OE2  . GLU A 1 85  ? 10.403  -6.374  0.236   1.00 0.00 ? 85  GLU A OE2  4  
ATOM 6920  H H    . GLU A 1 85  ? 10.084  -3.586  -4.917  1.00 0.00 ? 85  GLU A H    4  
ATOM 6921  H HA   . GLU A 1 85  ? 8.487   -5.696  -4.001  1.00 0.00 ? 85  GLU A HA   4  
ATOM 6922  H HB2  . GLU A 1 85  ? 10.451  -4.434  -2.851  1.00 0.00 ? 85  GLU A HB2  4  
ATOM 6923  H HB3  . GLU A 1 85  ? 9.192   -3.359  -2.255  1.00 0.00 ? 85  GLU A HB3  4  
ATOM 6924  H HG2  . GLU A 1 85  ? 8.178   -5.049  -1.002  1.00 0.00 ? 85  GLU A HG2  4  
ATOM 6925  H HG3  . GLU A 1 85  ? 9.030   -6.324  -1.872  1.00 0.00 ? 85  GLU A HG3  4  
ATOM 6926  N N    . ALA A 1 86  ? 7.044   -2.755  -4.023  1.00 0.00 ? 86  ALA A N    4  
ATOM 6927  C CA   . ALA A 1 86  ? 5.762   -2.071  -3.916  1.00 0.00 ? 86  ALA A CA   4  
ATOM 6928  C C    . ALA A 1 86  ? 4.766   -2.608  -4.937  1.00 0.00 ? 86  ALA A C    4  
ATOM 6929  O O    . ALA A 1 86  ? 3.584   -2.779  -4.638  1.00 0.00 ? 86  ALA A O    4  
ATOM 6930  C CB   . ALA A 1 86  ? 5.948   -0.572  -4.095  1.00 0.00 ? 86  ALA A CB   4  
ATOM 6931  H H    . ALA A 1 86  ? 7.827   -2.257  -4.340  1.00 0.00 ? 86  ALA A H    4  
ATOM 6932  H HA   . ALA A 1 86  ? 5.373   -2.245  -2.924  1.00 0.00 ? 86  ALA A HA   4  
ATOM 6933  H HB1  . ALA A 1 86  ? 6.090   -0.109  -3.130  1.00 0.00 ? 86  ALA A HB1  4  
ATOM 6934  H HB2  . ALA A 1 86  ? 5.071   -0.154  -4.568  1.00 0.00 ? 86  ALA A HB2  4  
ATOM 6935  H HB3  . ALA A 1 86  ? 6.813   -0.388  -4.714  1.00 0.00 ? 86  ALA A HB3  4  
ATOM 6936  N N    . VAL A 1 87  ? 5.252   -2.874  -6.146  1.00 0.00 ? 87  VAL A N    4  
ATOM 6937  C CA   . VAL A 1 87  ? 4.404   -3.392  -7.213  1.00 0.00 ? 87  VAL A CA   4  
ATOM 6938  C C    . VAL A 1 87  ? 3.995   -4.835  -6.936  1.00 0.00 ? 87  VAL A C    4  
ATOM 6939  O O    . VAL A 1 87  ? 2.809   -5.167  -6.949  1.00 0.00 ? 87  VAL A O    4  
ATOM 6940  C CB   . VAL A 1 87  ? 5.115   -3.325  -8.579  1.00 0.00 ? 87  VAL A CB   4  
ATOM 6941  C CG1  . VAL A 1 87  ? 4.163   -3.721  -9.698  1.00 0.00 ? 87  VAL A CG1  4  
ATOM 6942  C CG2  . VAL A 1 87  ? 5.682   -1.934  -8.821  1.00 0.00 ? 87  VAL A CG2  4  
ATOM 6943  H H    . VAL A 1 87  ? 6.203   -2.717  -6.324  1.00 0.00 ? 87  VAL A H    4  
ATOM 6944  H HA   . VAL A 1 87  ? 3.516   -2.779  -7.262  1.00 0.00 ? 87  VAL A HA   4  
ATOM 6945  H HB   . VAL A 1 87  ? 5.935   -4.028  -8.570  1.00 0.00 ? 87  VAL A HB   4  
ATOM 6946  H HG11 . VAL A 1 87  ? 3.776   -2.832  -10.172 1.00 0.00 ? 87  VAL A HG11 4  
ATOM 6947  H HG12 . VAL A 1 87  ? 3.346   -4.297  -9.289  1.00 0.00 ? 87  VAL A HG12 4  
ATOM 6948  H HG13 . VAL A 1 87  ? 4.693   -4.316  -10.427 1.00 0.00 ? 87  VAL A HG13 4  
ATOM 6949  H HG21 . VAL A 1 87  ? 6.664   -2.018  -9.262  1.00 0.00 ? 87  VAL A HG21 4  
ATOM 6950  H HG22 . VAL A 1 87  ? 5.754   -1.405  -7.882  1.00 0.00 ? 87  VAL A HG22 4  
ATOM 6951  H HG23 . VAL A 1 87  ? 5.032   -1.391  -9.490  1.00 0.00 ? 87  VAL A HG23 4  
ATOM 6952  N N    . ARG A 1 88  ? 4.983   -5.687  -6.686  1.00 0.00 ? 88  ARG A N    4  
ATOM 6953  C CA   . ARG A 1 88  ? 4.725   -7.095  -6.406  1.00 0.00 ? 88  ARG A CA   4  
ATOM 6954  C C    . ARG A 1 88  ? 3.843   -7.252  -5.171  1.00 0.00 ? 88  ARG A C    4  
ATOM 6955  O O    . ARG A 1 88  ? 2.890   -8.031  -5.172  1.00 0.00 ? 88  ARG A O    4  
ATOM 6956  C CB   . ARG A 1 88  ? 6.043   -7.845  -6.203  1.00 0.00 ? 88  ARG A CB   4  
ATOM 6957  C CG   . ARG A 1 88  ? 6.617   -8.423  -7.487  1.00 0.00 ? 88  ARG A CG   4  
ATOM 6958  C CD   . ARG A 1 88  ? 7.467   -7.402  -8.225  1.00 0.00 ? 88  ARG A CD   4  
ATOM 6959  N NE   . ARG A 1 88  ? 8.437   -8.037  -9.115  1.00 0.00 ? 88  ARG A NE   4  
ATOM 6960  C CZ   . ARG A 1 88  ? 8.122   -8.572  -10.293 1.00 0.00 ? 88  ARG A CZ   4  
ATOM 6961  N NH1  . ARG A 1 88  ? 6.867   -8.551  -10.725 1.00 0.00 ? 88  ARG A NH1  4  
ATOM 6962  N NH2  . ARG A 1 88  ? 9.065   -9.129  -11.040 1.00 0.00 ? 88  ARG A NH2  4  
ATOM 6963  H H    . ARG A 1 88  ? 5.907   -5.362  -6.690  1.00 0.00 ? 88  ARG A H    4  
ATOM 6964  H HA   . ARG A 1 88  ? 4.210   -7.513  -7.256  1.00 0.00 ? 88  ARG A HA   4  
ATOM 6965  H HB2  . ARG A 1 88  ? 6.771   -7.165  -5.783  1.00 0.00 ? 88  ARG A HB2  4  
ATOM 6966  H HB3  . ARG A 1 88  ? 5.880   -8.656  -5.509  1.00 0.00 ? 88  ARG A HB3  4  
ATOM 6967  H HG2  . ARG A 1 88  ? 7.233   -9.278  -7.241  1.00 0.00 ? 88  ARG A HG2  4  
ATOM 6968  H HG3  . ARG A 1 88  ? 5.801   -8.732  -8.126  1.00 0.00 ? 88  ARG A HG3  4  
ATOM 6969  H HD2  . ARG A 1 88  ? 6.818   -6.768  -8.810  1.00 0.00 ? 88  ARG A HD2  4  
ATOM 6970  H HD3  . ARG A 1 88  ? 7.997   -6.802  -7.500  1.00 0.00 ? 88  ARG A HD3  4  
ATOM 6971  H HE   . ARG A 1 88  ? 9.370   -8.066  -8.819  1.00 0.00 ? 88  ARG A HE   4  
ATOM 6972  H HH11 . ARG A 1 88  ? 6.151   -8.133  -10.166 1.00 0.00 ? 88  ARG A HH11 4  
ATOM 6973  H HH12 . ARG A 1 88  ? 6.638   -8.954  -11.610 1.00 0.00 ? 88  ARG A HH12 4  
ATOM 6974  H HH21 . ARG A 1 88  ? 10.012  -9.147  -10.719 1.00 0.00 ? 88  ARG A HH21 4  
ATOM 6975  H HH22 . ARG A 1 88  ? 8.829   -9.532  -11.925 1.00 0.00 ? 88  ARG A HH22 4  
ATOM 6976  N N    . LEU A 1 89  ? 4.166   -6.507  -4.120  1.00 0.00 ? 89  LEU A N    4  
ATOM 6977  C CA   . LEU A 1 89  ? 3.403   -6.564  -2.878  1.00 0.00 ? 89  LEU A CA   4  
ATOM 6978  C C    . LEU A 1 89  ? 1.979   -6.062  -3.091  1.00 0.00 ? 89  LEU A C    4  
ATOM 6979  O O    . LEU A 1 89  ? 1.045   -6.516  -2.431  1.00 0.00 ? 89  LEU A O    4  
ATOM 6980  C CB   . LEU A 1 89  ? 4.093   -5.734  -1.794  1.00 0.00 ? 89  LEU A CB   4  
ATOM 6981  C CG   . LEU A 1 89  ? 3.374   -5.706  -0.444  1.00 0.00 ? 89  LEU A CG   4  
ATOM 6982  C CD1  . LEU A 1 89  ? 3.132   -7.119  0.061   1.00 0.00 ? 89  LEU A CD1  4  
ATOM 6983  C CD2  . LEU A 1 89  ? 4.178   -4.906  0.570   1.00 0.00 ? 89  LEU A CD2  4  
ATOM 6984  H H    . LEU A 1 89  ? 4.937   -5.904  -4.179  1.00 0.00 ? 89  LEU A H    4  
ATOM 6985  H HA   . LEU A 1 89  ? 3.365   -7.595  -2.560  1.00 0.00 ? 89  LEU A HA   4  
ATOM 6986  H HB2  . LEU A 1 89  ? 5.086   -6.133  -1.642  1.00 0.00 ? 89  LEU A HB2  4  
ATOM 6987  H HB3  . LEU A 1 89  ? 4.182   -4.718  -2.149  1.00 0.00 ? 89  LEU A HB3  4  
ATOM 6988  H HG   . LEU A 1 89  ? 2.413   -5.226  -0.565  1.00 0.00 ? 89  LEU A HG   4  
ATOM 6989  H HD11 . LEU A 1 89  ? 2.772   -7.082  1.079   1.00 0.00 ? 89  LEU A HD11 4  
ATOM 6990  H HD12 . LEU A 1 89  ? 4.056   -7.677  0.026   1.00 0.00 ? 89  LEU A HD12 4  
ATOM 6991  H HD13 . LEU A 1 89  ? 2.395   -7.604  -0.563  1.00 0.00 ? 89  LEU A HD13 4  
ATOM 6992  H HD21 . LEU A 1 89  ? 3.504   -4.359  1.213   1.00 0.00 ? 89  LEU A HD21 4  
ATOM 6993  H HD22 . LEU A 1 89  ? 4.823   -4.211  0.052   1.00 0.00 ? 89  LEU A HD22 4  
ATOM 6994  H HD23 . LEU A 1 89  ? 4.777   -5.578  1.167   1.00 0.00 ? 89  LEU A HD23 4  
ATOM 6995  N N    . LEU A 1 90  ? 1.821   -5.121  -4.017  1.00 0.00 ? 90  LEU A N    4  
ATOM 6996  C CA   . LEU A 1 90  ? 0.510   -4.556  -4.317  1.00 0.00 ? 90  LEU A CA   4  
ATOM 6997  C C    . LEU A 1 90  ? -0.315  -5.517  -5.167  1.00 0.00 ? 90  LEU A C    4  
ATOM 6998  O O    . LEU A 1 90  ? -1.534  -5.603  -5.018  1.00 0.00 ? 90  LEU A O    4  
ATOM 6999  C CB   . LEU A 1 90  ? 0.663   -3.218  -5.043  1.00 0.00 ? 90  LEU A CB   4  
ATOM 7000  C CG   . LEU A 1 90  ? 0.890   -2.010  -4.132  1.00 0.00 ? 90  LEU A CG   4  
ATOM 7001  C CD1  . LEU A 1 90  ? 1.370   -0.816  -4.941  1.00 0.00 ? 90  LEU A CD1  4  
ATOM 7002  C CD2  . LEU A 1 90  ? -0.386  -1.667  -3.376  1.00 0.00 ? 90  LEU A CD2  4  
ATOM 7003  H H    . LEU A 1 90  ? 2.604   -4.799  -4.510  1.00 0.00 ? 90  LEU A H    4  
ATOM 7004  H HA   . LEU A 1 90  ? -0.002  -4.393  -3.381  1.00 0.00 ? 90  LEU A HA   4  
ATOM 7005  H HB2  . LEU A 1 90  ? 1.500   -3.295  -5.721  1.00 0.00 ? 90  LEU A HB2  4  
ATOM 7006  H HB3  . LEU A 1 90  ? -0.233  -3.042  -5.620  1.00 0.00 ? 90  LEU A HB3  4  
ATOM 7007  H HG   . LEU A 1 90  ? 1.654   -2.252  -3.408  1.00 0.00 ? 90  LEU A HG   4  
ATOM 7008  H HD11 . LEU A 1 90  ? 2.415   -0.942  -5.183  1.00 0.00 ? 90  LEU A HD11 4  
ATOM 7009  H HD12 . LEU A 1 90  ? 1.241   0.087   -4.362  1.00 0.00 ? 90  LEU A HD12 4  
ATOM 7010  H HD13 . LEU A 1 90  ? 0.796   -0.744  -5.853  1.00 0.00 ? 90  LEU A HD13 4  
ATOM 7011  H HD21 . LEU A 1 90  ? -0.132  -1.219  -2.427  1.00 0.00 ? 90  LEU A HD21 4  
ATOM 7012  H HD22 . LEU A 1 90  ? -0.959  -2.567  -3.209  1.00 0.00 ? 90  LEU A HD22 4  
ATOM 7013  H HD23 . LEU A 1 90  ? -0.972  -0.970  -3.957  1.00 0.00 ? 90  LEU A HD23 4  
ATOM 7014  N N    . LYS A 1 91  ? 0.356   -6.237  -6.060  1.00 0.00 ? 91  LYS A N    4  
ATOM 7015  C CA   . LYS A 1 91  ? -0.317  -7.191  -6.934  1.00 0.00 ? 91  LYS A CA   4  
ATOM 7016  C C    . LYS A 1 91  ? -0.005  -8.625  -6.517  1.00 0.00 ? 91  LYS A C    4  
ATOM 7017  O O    . LYS A 1 91  ? 0.527   -9.412  -7.302  1.00 0.00 ? 91  LYS A O    4  
ATOM 7018  C CB   . LYS A 1 91  ? 0.103   -6.966  -8.390  1.00 0.00 ? 91  LYS A CB   4  
ATOM 7019  C CG   . LYS A 1 91  ? 0.173   -5.500  -8.786  1.00 0.00 ? 91  LYS A CG   4  
ATOM 7020  C CD   . LYS A 1 91  ? -1.150  -4.792  -8.540  1.00 0.00 ? 91  LYS A CD   4  
ATOM 7021  C CE   . LYS A 1 91  ? -1.245  -3.498  -9.331  1.00 0.00 ? 91  LYS A CE   4  
ATOM 7022  N NZ   . LYS A 1 91  ? -0.269  -2.480  -8.853  1.00 0.00 ? 91  LYS A NZ   4  
ATOM 7023  H H    . LYS A 1 91  ? 1.326   -6.124  -6.133  1.00 0.00 ? 91  LYS A H    4  
ATOM 7024  H HA   . LYS A 1 91  ? -1.381  -7.027  -6.847  1.00 0.00 ? 91  LYS A HA   4  
ATOM 7025  H HB2  . LYS A 1 91  ? 1.077   -7.405  -8.543  1.00 0.00 ? 91  LYS A HB2  4  
ATOM 7026  H HB3  . LYS A 1 91  ? -0.610  -7.458  -9.037  1.00 0.00 ? 91  LYS A HB3  4  
ATOM 7027  H HG2  . LYS A 1 91  ? 0.942   -5.016  -8.203  1.00 0.00 ? 91  LYS A HG2  4  
ATOM 7028  H HG3  . LYS A 1 91  ? 0.417   -5.432  -9.836  1.00 0.00 ? 91  LYS A HG3  4  
ATOM 7029  H HD2  . LYS A 1 91  ? -1.957  -5.444  -8.837  1.00 0.00 ? 91  LYS A HD2  4  
ATOM 7030  H HD3  . LYS A 1 91  ? -1.235  -4.566  -7.486  1.00 0.00 ? 91  LYS A HD3  4  
ATOM 7031  H HE2  . LYS A 1 91  ? -1.046  -3.712  -10.371 1.00 0.00 ? 91  LYS A HE2  4  
ATOM 7032  H HE3  . LYS A 1 91  ? -2.244  -3.101  -9.230  1.00 0.00 ? 91  LYS A HE3  4  
ATOM 7033  H HZ1  . LYS A 1 91  ? -0.675  -1.938  -8.064  1.00 0.00 ? 91  LYS A HZ1  4  
ATOM 7034  H HZ2  . LYS A 1 91  ? -0.029  -1.824  -9.623  1.00 0.00 ? 91  LYS A HZ2  4  
ATOM 7035  H HZ3  . LYS A 1 91  ? 0.603   -2.947  -8.526  1.00 0.00 ? 91  LYS A HZ3  4  
ATOM 7036  N N    . SER A 1 92  ? -0.338  -8.960  -5.275  1.00 0.00 ? 92  SER A N    4  
ATOM 7037  C CA   . SER A 1 92  ? -0.093  -10.300 -4.752  1.00 0.00 ? 92  SER A CA   4  
ATOM 7038  C C    . SER A 1 92  ? -1.154  -10.685 -3.727  1.00 0.00 ? 92  SER A C    4  
ATOM 7039  O O    . SER A 1 92  ? -1.751  -11.758 -3.809  1.00 0.00 ? 92  SER A O    4  
ATOM 7040  C CB   . SER A 1 92  ? 1.297   -10.376 -4.118  1.00 0.00 ? 92  SER A CB   4  
ATOM 7041  O OG   . SER A 1 92  ? 1.543   -11.664 -3.582  1.00 0.00 ? 92  SER A OG   4  
ATOM 7042  H H    . SER A 1 92  ? -0.758  -8.290  -4.695  1.00 0.00 ? 92  SER A H    4  
ATOM 7043  H HA   . SER A 1 92  ? -0.140  -10.991 -5.578  1.00 0.00 ? 92  SER A HA   4  
ATOM 7044  H HB2  . SER A 1 92  ? 2.045   -10.163 -4.868  1.00 0.00 ? 92  SER A HB2  4  
ATOM 7045  H HB3  . SER A 1 92  ? 1.369   -9.648  -3.323  1.00 0.00 ? 92  SER A HB3  4  
ATOM 7046  H HG   . SER A 1 92  ? 1.679   -12.289 -4.298  1.00 0.00 ? 92  SER A HG   4  
ATOM 7047  N N    . SER A 1 93  ? -1.384  -9.802  -2.760  1.00 0.00 ? 93  SER A N    4  
ATOM 7048  C CA   . SER A 1 93  ? -2.374  -10.050 -1.719  1.00 0.00 ? 93  SER A CA   4  
ATOM 7049  C C    . SER A 1 93  ? -3.787  -9.839  -2.250  1.00 0.00 ? 93  SER A C    4  
ATOM 7050  O O    . SER A 1 93  ? -4.009  -9.030  -3.151  1.00 0.00 ? 93  SER A O    4  
ATOM 7051  C CB   . SER A 1 93  ? -2.125  -9.132  -0.521  1.00 0.00 ? 93  SER A CB   4  
ATOM 7052  O OG   . SER A 1 93  ? -1.292  -9.759  0.439   1.00 0.00 ? 93  SER A OG   4  
ATOM 7053  H H    . SER A 1 93  ? -0.876  -8.964  -2.747  1.00 0.00 ? 93  SER A H    4  
ATOM 7054  H HA   . SER A 1 93  ? -2.270  -11.077 -1.400  1.00 0.00 ? 93  SER A HA   4  
ATOM 7055  H HB2  . SER A 1 93  ? -1.642  -8.225  -0.859  1.00 0.00 ? 93  SER A HB2  4  
ATOM 7056  H HB3  . SER A 1 93  ? -3.070  -8.887  -0.055  1.00 0.00 ? 93  SER A HB3  4  
ATOM 7057  H HG   . SER A 1 93  ? -0.559  -10.189 -0.006  1.00 0.00 ? 93  SER A HG   4  
ATOM 7058  N N    . ARG A 1 94  ? -4.741  -10.574 -1.687  1.00 0.00 ? 94  ARG A N    4  
ATOM 7059  C CA   . ARG A 1 94  ? -6.134  -10.467 -2.104  1.00 0.00 ? 94  ARG A CA   4  
ATOM 7060  C C    . ARG A 1 94  ? -6.753  -9.164  -1.605  1.00 0.00 ? 94  ARG A C    4  
ATOM 7061  O O    . ARG A 1 94  ? -7.435  -8.464  -2.352  1.00 0.00 ? 94  ARG A O    4  
ATOM 7062  C CB   . ARG A 1 94  ? -6.938  -11.660 -1.583  1.00 0.00 ? 94  ARG A CB   4  
ATOM 7063  C CG   . ARG A 1 94  ? -6.656  -12.954 -2.328  1.00 0.00 ? 94  ARG A CG   4  
ATOM 7064  C CD   . ARG A 1 94  ? -5.489  -13.710 -1.714  1.00 0.00 ? 94  ARG A CD   4  
ATOM 7065  N NE   . ARG A 1 94  ? -5.165  -14.920 -2.465  1.00 0.00 ? 94  ARG A NE   4  
ATOM 7066  C CZ   . ARG A 1 94  ? -4.468  -14.925 -3.599  1.00 0.00 ? 94  ARG A CZ   4  
ATOM 7067  N NH1  . ARG A 1 94  ? -4.021  -13.787 -4.117  1.00 0.00 ? 94  ARG A NH1  4  
ATOM 7068  N NH2  . ARG A 1 94  ? -4.217  -16.070 -4.217  1.00 0.00 ? 94  ARG A NH2  4  
ATOM 7069  H H    . ARG A 1 94  ? -4.503  -11.202 -0.973  1.00 0.00 ? 94  ARG A H    4  
ATOM 7070  H HA   . ARG A 1 94  ? -6.158  -10.472 -3.184  1.00 0.00 ? 94  ARG A HA   4  
ATOM 7071  H HB2  . ARG A 1 94  ? -6.698  -11.812 -0.538  1.00 0.00 ? 94  ARG A HB2  4  
ATOM 7072  H HB3  . ARG A 1 94  ? -7.993  -11.437 -1.675  1.00 0.00 ? 94  ARG A HB3  4  
ATOM 7073  H HG2  . ARG A 1 94  ? -7.537  -13.578 -2.290  1.00 0.00 ? 94  ARG A HG2  4  
ATOM 7074  H HG3  . ARG A 1 94  ? -6.422  -12.722 -3.357  1.00 0.00 ? 94  ARG A HG3  4  
ATOM 7075  H HD2  . ARG A 1 94  ? -4.624  -13.062 -1.703  1.00 0.00 ? 94  ARG A HD2  4  
ATOM 7076  H HD3  . ARG A 1 94  ? -5.746  -13.983 -0.701  1.00 0.00 ? 94  ARG A HD3  4  
ATOM 7077  H HE   . ARG A 1 94  ? -5.482  -15.775 -2.105  1.00 0.00 ? 94  ARG A HE   4  
ATOM 7078  H HH11 . ARG A 1 94  ? -4.207  -12.920 -3.654  1.00 0.00 ? 94  ARG A HH11 4  
ATOM 7079  H HH12 . ARG A 1 94  ? -3.499  -13.797 -4.969  1.00 0.00 ? 94  ARG A HH12 4  
ATOM 7080  H HH21 . ARG A 1 94  ? -4.551  -16.930 -3.832  1.00 0.00 ? 94  ARG A HH21 4  
ATOM 7081  H HH22 . ARG A 1 94  ? -3.694  -16.074 -5.070  1.00 0.00 ? 94  ARG A HH22 4  
ATOM 7082  N N    . HIS A 1 95  ? -6.508  -8.847  -0.339  1.00 0.00 ? 95  HIS A N    4  
ATOM 7083  C CA   . HIS A 1 95  ? -7.040  -7.629  0.260   1.00 0.00 ? 95  HIS A CA   4  
ATOM 7084  C C    . HIS A 1 95  ? -5.993  -6.520  0.255   1.00 0.00 ? 95  HIS A C    4  
ATOM 7085  O O    . HIS A 1 95  ? -4.979  -6.607  0.947   1.00 0.00 ? 95  HIS A O    4  
ATOM 7086  C CB   . HIS A 1 95  ? -7.507  -7.899  1.691   1.00 0.00 ? 95  HIS A CB   4  
ATOM 7087  C CG   . HIS A 1 95  ? -8.766  -7.177  2.056   1.00 0.00 ? 95  HIS A CG   4  
ATOM 7088  N ND1  . HIS A 1 95  ? -9.763  -7.741  2.825   1.00 0.00 ? 95  HIS A ND1  4  
ATOM 7089  C CD2  . HIS A 1 95  ? -9.190  -5.927  1.755   1.00 0.00 ? 95  HIS A CD2  4  
ATOM 7090  C CE1  . HIS A 1 95  ? -10.745 -6.870  2.979   1.00 0.00 ? 95  HIS A CE1  4  
ATOM 7091  N NE2  . HIS A 1 95  ? -10.421 -5.762  2.340   1.00 0.00 ? 95  HIS A NE2  4  
ATOM 7092  H H    . HIS A 1 95  ? -5.956  -9.446  0.207   1.00 0.00 ? 95  HIS A H    4  
ATOM 7093  H HA   . HIS A 1 95  ? -7.886  -7.310  -0.331  1.00 0.00 ? 95  HIS A HA   4  
ATOM 7094  H HB2  . HIS A 1 95  ? -7.686  -8.957  1.810   1.00 0.00 ? 95  HIS A HB2  4  
ATOM 7095  H HB3  . HIS A 1 95  ? -6.734  -7.591  2.379   1.00 0.00 ? 95  HIS A HB3  4  
ATOM 7096  H HD1  . HIS A 1 95  ? -9.753  -8.646  3.201   1.00 0.00 ? 95  HIS A HD1  4  
ATOM 7097  H HD2  . HIS A 1 95  ? -8.658  -5.194  1.163   1.00 0.00 ? 95  HIS A HD2  4  
ATOM 7098  H HE1  . HIS A 1 95  ? -11.656 -7.037  3.534   1.00 0.00 ? 95  HIS A HE1  4  
ATOM 7099  H HE2  . HIS A 1 95  ? -10.932 -4.925  2.367   1.00 0.00 ? 95  HIS A HE2  4  
ATOM 7100  N N    . LEU A 1 96  ? -6.245  -5.478  -0.530  1.00 0.00 ? 96  LEU A N    4  
ATOM 7101  C CA   . LEU A 1 96  ? -5.323  -4.352  -0.626  1.00 0.00 ? 96  LEU A CA   4  
ATOM 7102  C C    . LEU A 1 96  ? -5.966  -3.074  -0.094  1.00 0.00 ? 96  LEU A C    4  
ATOM 7103  O O    . LEU A 1 96  ? -6.967  -2.600  -0.632  1.00 0.00 ? 96  LEU A O    4  
ATOM 7104  C CB   . LEU A 1 96  ? -4.882  -4.148  -2.077  1.00 0.00 ? 96  LEU A CB   4  
ATOM 7105  C CG   . LEU A 1 96  ? -4.481  -5.427  -2.815  1.00 0.00 ? 96  LEU A CG   4  
ATOM 7106  C CD1  . LEU A 1 96  ? -4.328  -5.157  -4.304  1.00 0.00 ? 96  LEU A CD1  4  
ATOM 7107  C CD2  . LEU A 1 96  ? -3.190  -5.990  -2.239  1.00 0.00 ? 96  LEU A CD2  4  
ATOM 7108  H H    . LEU A 1 96  ? -7.070  -5.465  -1.059  1.00 0.00 ? 96  LEU A H    4  
ATOM 7109  H HA   . LEU A 1 96  ? -4.456  -4.580  -0.025  1.00 0.00 ? 96  LEU A HA   4  
ATOM 7110  H HB2  . LEU A 1 96  ? -5.698  -3.685  -2.618  1.00 0.00 ? 96  LEU A HB2  4  
ATOM 7111  H HB3  . LEU A 1 96  ? -4.036  -3.475  -2.083  1.00 0.00 ? 96  LEU A HB3  4  
ATOM 7112  H HG   . LEU A 1 96  ? -5.256  -6.166  -2.688  1.00 0.00 ? 96  LEU A HG   4  
ATOM 7113  H HD11 . LEU A 1 96  ? -3.715  -4.280  -4.451  1.00 0.00 ? 96  LEU A HD11 4  
ATOM 7114  H HD12 . LEU A 1 96  ? -5.302  -4.992  -4.742  1.00 0.00 ? 96  LEU A HD12 4  
ATOM 7115  H HD13 . LEU A 1 96  ? -3.859  -6.006  -4.777  1.00 0.00 ? 96  LEU A HD13 4  
ATOM 7116  H HD21 . LEU A 1 96  ? -3.142  -5.771  -1.183  1.00 0.00 ? 96  LEU A HD21 4  
ATOM 7117  H HD22 . LEU A 1 96  ? -2.346  -5.541  -2.739  1.00 0.00 ? 96  LEU A HD22 4  
ATOM 7118  H HD23 . LEU A 1 96  ? -3.167  -7.060  -2.386  1.00 0.00 ? 96  LEU A HD23 4  
ATOM 7119  N N    . ILE A 1 97  ? -5.383  -2.522  0.965   1.00 0.00 ? 97  ILE A N    4  
ATOM 7120  C CA   . ILE A 1 97  ? -5.897  -1.299  1.569   1.00 0.00 ? 97  ILE A CA   4  
ATOM 7121  C C    . ILE A 1 97  ? -4.857  -0.184  1.526   1.00 0.00 ? 97  ILE A C    4  
ATOM 7122  O O    . ILE A 1 97  ? -4.176  0.082   2.516   1.00 0.00 ? 97  ILE A O    4  
ATOM 7123  C CB   . ILE A 1 97  ? -6.324  -1.531  3.032   1.00 0.00 ? 97  ILE A CB   4  
ATOM 7124  C CG1  . ILE A 1 97  ? -7.218  -2.767  3.137   1.00 0.00 ? 97  ILE A CG1  4  
ATOM 7125  C CG2  . ILE A 1 97  ? -7.039  -0.304  3.577   1.00 0.00 ? 97  ILE A CG2  4  
ATOM 7126  C CD1  . ILE A 1 97  ? -7.339  -3.308  4.544   1.00 0.00 ? 97  ILE A CD1  4  
ATOM 7127  H H    . ILE A 1 97  ? -4.587  -2.946  1.348   1.00 0.00 ? 97  ILE A H    4  
ATOM 7128  H HA   . ILE A 1 97  ? -6.767  -0.988  1.009   1.00 0.00 ? 97  ILE A HA   4  
ATOM 7129  H HB   . ILE A 1 97  ? -5.433  -1.688  3.622   1.00 0.00 ? 97  ILE A HB   4  
ATOM 7130  H HG12 . ILE A 1 97  ? -8.210  -2.516  2.792   1.00 0.00 ? 97  ILE A HG12 4  
ATOM 7131  H HG13 . ILE A 1 97  ? -6.812  -3.551  2.513   1.00 0.00 ? 97  ILE A HG13 4  
ATOM 7132  H HG21 . ILE A 1 97  ? -7.479  0.248   2.760   1.00 0.00 ? 97  ILE A HG21 4  
ATOM 7133  H HG22 . ILE A 1 97  ? -6.331  0.324   4.096   1.00 0.00 ? 97  ILE A HG22 4  
ATOM 7134  H HG23 . ILE A 1 97  ? -7.815  -0.615  4.261   1.00 0.00 ? 97  ILE A HG23 4  
ATOM 7135  H HD11 . ILE A 1 97  ? -8.024  -4.144  4.552   1.00 0.00 ? 97  ILE A HD11 4  
ATOM 7136  H HD12 . ILE A 1 97  ? -7.712  -2.532  5.197   1.00 0.00 ? 97  ILE A HD12 4  
ATOM 7137  H HD13 . ILE A 1 97  ? -6.370  -3.634  4.890   1.00 0.00 ? 97  ILE A HD13 4  
ATOM 7138  N N    . LEU A 1 98  ? -4.738  0.463   0.371   1.00 0.00 ? 98  LEU A N    4  
ATOM 7139  C CA   . LEU A 1 98  ? -3.780  1.549   0.199   1.00 0.00 ? 98  LEU A CA   4  
ATOM 7140  C C    . LEU A 1 98  ? -4.190  2.771   1.015   1.00 0.00 ? 98  LEU A C    4  
ATOM 7141  O O    . LEU A 1 98  ? -5.372  3.099   1.108   1.00 0.00 ? 98  LEU A O    4  
ATOM 7142  C CB   . LEU A 1 98  ? -3.663  1.924   -1.280  1.00 0.00 ? 98  LEU A CB   4  
ATOM 7143  C CG   . LEU A 1 98  ? -2.918  0.908   -2.149  1.00 0.00 ? 98  LEU A CG   4  
ATOM 7144  C CD1  . LEU A 1 98  ? -3.900  -0.020  -2.847  1.00 0.00 ? 98  LEU A CD1  4  
ATOM 7145  C CD2  . LEU A 1 98  ? -2.039  1.620   -3.167  1.00 0.00 ? 98  LEU A CD2  4  
ATOM 7146  H H    . LEU A 1 98  ? -5.309  0.205   -0.382  1.00 0.00 ? 98  LEU A H    4  
ATOM 7147  H HA   . LEU A 1 98  ? -2.820  1.201   0.550   1.00 0.00 ? 98  LEU A HA   4  
ATOM 7148  H HB2  . LEU A 1 98  ? -4.659  2.046   -1.678  1.00 0.00 ? 98  LEU A HB2  4  
ATOM 7149  H HB3  . LEU A 1 98  ? -3.147  2.870   -1.348  1.00 0.00 ? 98  LEU A HB3  4  
ATOM 7150  H HG   . LEU A 1 98  ? -2.280  0.305   -1.519  1.00 0.00 ? 98  LEU A HG   4  
ATOM 7151  H HD11 . LEU A 1 98  ? -4.835  -0.026  -2.306  1.00 0.00 ? 98  LEU A HD11 4  
ATOM 7152  H HD12 . LEU A 1 98  ? -3.493  -1.020  -2.874  1.00 0.00 ? 98  LEU A HD12 4  
ATOM 7153  H HD13 . LEU A 1 98  ? -4.069  0.327   -3.855  1.00 0.00 ? 98  LEU A HD13 4  
ATOM 7154  H HD21 . LEU A 1 98  ? -1.135  1.051   -3.323  1.00 0.00 ? 98  LEU A HD21 4  
ATOM 7155  H HD22 . LEU A 1 98  ? -1.787  2.604   -2.800  1.00 0.00 ? 98  LEU A HD22 4  
ATOM 7156  H HD23 . LEU A 1 98  ? -2.573  1.710   -4.102  1.00 0.00 ? 98  LEU A HD23 4  
ATOM 7157  N N    . THR A 1 99  ? -3.203  3.440   1.603   1.00 0.00 ? 99  THR A N    4  
ATOM 7158  C CA   . THR A 1 99  ? -3.461  4.627   2.411   1.00 0.00 ? 99  THR A CA   4  
ATOM 7159  C C    . THR A 1 99  ? -2.851  5.867   1.766   1.00 0.00 ? 99  THR A C    4  
ATOM 7160  O O    . THR A 1 99  ? -1.683  6.186   1.992   1.00 0.00 ? 99  THR A O    4  
ATOM 7161  C CB   . THR A 1 99  ? -2.896  4.441   3.821   1.00 0.00 ? 99  THR A CB   4  
ATOM 7162  O OG1  . THR A 1 99  ? -3.175  3.139   4.306   1.00 0.00 ? 99  THR A OG1  4  
ATOM 7163  C CG2  . THR A 1 99  ? -3.449  5.431   4.823   1.00 0.00 ? 99  THR A CG2  4  
ATOM 7164  H H    . THR A 1 99  ? -2.281  3.130   1.491   1.00 0.00 ? 99  THR A H    4  
ATOM 7165  H HA   . THR A 1 99  ? -4.530  4.759   2.476   1.00 0.00 ? 99  THR A HA   4  
ATOM 7166  H HB   . THR A 1 99  ? -1.824  4.568   3.788   1.00 0.00 ? 99  THR A HB   4  
ATOM 7167  H HG1  . THR A 1 99  ? -4.091  2.917   4.119   1.00 0.00 ? 99  THR A HG1  4  
ATOM 7168  H HG21 . THR A 1 99  ? -3.050  5.215   5.802   1.00 0.00 ? 99  THR A HG21 4  
ATOM 7169  H HG22 . THR A 1 99  ? -4.526  5.356   4.847   1.00 0.00 ? 99  THR A HG22 4  
ATOM 7170  H HG23 . THR A 1 99  ? -3.166  6.433   4.532   1.00 0.00 ? 99  THR A HG23 4  
ATOM 7171  N N    . VAL A 1 100 ? -3.648  6.563   0.962   1.00 0.00 ? 100 VAL A N    4  
ATOM 7172  C CA   . VAL A 1 100 ? -3.186  7.768   0.285   1.00 0.00 ? 100 VAL A CA   4  
ATOM 7173  C C    . VAL A 1 100 ? -3.722  9.022   0.967   1.00 0.00 ? 100 VAL A C    4  
ATOM 7174  O O    . VAL A 1 100 ? -4.855  9.042   1.448   1.00 0.00 ? 100 VAL A O    4  
ATOM 7175  C CB   . VAL A 1 100 ? -3.613  7.781   -1.195  1.00 0.00 ? 100 VAL A CB   4  
ATOM 7176  C CG1  . VAL A 1 100 ? -2.770  6.807   -2.003  1.00 0.00 ? 100 VAL A CG1  4  
ATOM 7177  C CG2  . VAL A 1 100 ? -5.093  7.454   -1.325  1.00 0.00 ? 100 VAL A CG2  4  
ATOM 7178  H H    . VAL A 1 100 ? -4.568  6.259   0.822   1.00 0.00 ? 100 VAL A H    4  
ATOM 7179  H HA   . VAL A 1 100 ? -2.106  7.781   0.327   1.00 0.00 ? 100 VAL A HA   4  
ATOM 7180  H HB   . VAL A 1 100 ? -3.450  8.775   -1.587  1.00 0.00 ? 100 VAL A HB   4  
ATOM 7181  H HG11 . VAL A 1 100 ? -3.207  6.679   -2.982  1.00 0.00 ? 100 VAL A HG11 4  
ATOM 7182  H HG12 . VAL A 1 100 ? -2.736  5.854   -1.496  1.00 0.00 ? 100 VAL A HG12 4  
ATOM 7183  H HG13 . VAL A 1 100 ? -1.768  7.197   -2.106  1.00 0.00 ? 100 VAL A HG13 4  
ATOM 7184  H HG21 . VAL A 1 100 ? -5.422  7.671   -2.331  1.00 0.00 ? 100 VAL A HG21 4  
ATOM 7185  H HG22 . VAL A 1 100 ? -5.657  8.050   -0.625  1.00 0.00 ? 100 VAL A HG22 4  
ATOM 7186  H HG23 . VAL A 1 100 ? -5.249  6.405   -1.114  1.00 0.00 ? 100 VAL A HG23 4  
ATOM 7187  N N    . LYS A 1 101 ? -2.901  10.066  1.004   1.00 0.00 ? 101 LYS A N    4  
ATOM 7188  C CA   . LYS A 1 101 ? -3.295  11.326  1.626   1.00 0.00 ? 101 LYS A CA   4  
ATOM 7189  C C    . LYS A 1 101 ? -3.733  12.339  0.574   1.00 0.00 ? 101 LYS A C    4  
ATOM 7190  O O    . LYS A 1 101 ? -3.469  12.166  -0.617  1.00 0.00 ? 101 LYS A O    4  
ATOM 7191  C CB   . LYS A 1 101 ? -2.138  11.896  2.449   1.00 0.00 ? 101 LYS A CB   4  
ATOM 7192  C CG   . LYS A 1 101 ? -0.832  11.993  1.677   1.00 0.00 ? 101 LYS A CG   4  
ATOM 7193  C CD   . LYS A 1 101 ? 0.046   13.115  2.206   1.00 0.00 ? 101 LYS A CD   4  
ATOM 7194  C CE   . LYS A 1 101 ? -0.567  14.479  1.931   1.00 0.00 ? 101 LYS A CE   4  
ATOM 7195  N NZ   . LYS A 1 101 ? 0.472   15.511  1.665   1.00 0.00 ? 101 LYS A NZ   4  
ATOM 7196  H H    . LYS A 1 101 ? -2.011  9.990   0.602   1.00 0.00 ? 101 LYS A H    4  
ATOM 7197  H HA   . LYS A 1 101 ? -4.127  11.125  2.283   1.00 0.00 ? 101 LYS A HA   4  
ATOM 7198  H HB2  . LYS A 1 101 ? -2.405  12.885  2.787   1.00 0.00 ? 101 LYS A HB2  4  
ATOM 7199  H HB3  . LYS A 1 101 ? -1.976  11.261  3.308   1.00 0.00 ? 101 LYS A HB3  4  
ATOM 7200  H HG2  . LYS A 1 101 ? -0.299  11.059  1.769   1.00 0.00 ? 101 LYS A HG2  4  
ATOM 7201  H HG3  . LYS A 1 101 ? -1.054  12.182  0.636   1.00 0.00 ? 101 LYS A HG3  4  
ATOM 7202  H HD2  . LYS A 1 101 ? 0.163   12.994  3.273   1.00 0.00 ? 101 LYS A HD2  4  
ATOM 7203  H HD3  . LYS A 1 101 ? 1.012   13.061  1.726   1.00 0.00 ? 101 LYS A HD3  4  
ATOM 7204  H HE2  . LYS A 1 101 ? -1.213  14.401  1.069   1.00 0.00 ? 101 LYS A HE2  4  
ATOM 7205  H HE3  . LYS A 1 101 ? -1.149  14.778  2.790   1.00 0.00 ? 101 LYS A HE3  4  
ATOM 7206  H HZ1  . LYS A 1 101 ? 0.143   16.442  1.991   1.00 0.00 ? 101 LYS A HZ1  4  
ATOM 7207  H HZ2  . LYS A 1 101 ? 0.672   15.564  0.645   1.00 0.00 ? 101 LYS A HZ2  4  
ATOM 7208  H HZ3  . LYS A 1 101 ? 1.352   15.271  2.166   1.00 0.00 ? 101 LYS A HZ3  4  
ATOM 7209  N N    . ASP A 1 102 ? -4.403  13.396  1.020   1.00 0.00 ? 102 ASP A N    4  
ATOM 7210  C CA   . ASP A 1 102 ? -4.878  14.437  0.116   1.00 0.00 ? 102 ASP A CA   4  
ATOM 7211  C C    . ASP A 1 102 ? -3.717  15.278  -0.404  1.00 0.00 ? 102 ASP A C    4  
ATOM 7212  O O    . ASP A 1 102 ? -3.267  16.211  0.259   1.00 0.00 ? 102 ASP A O    4  
ATOM 7213  C CB   . ASP A 1 102 ? -5.895  15.334  0.826   1.00 0.00 ? 102 ASP A CB   4  
ATOM 7214  C CG   . ASP A 1 102 ? -5.322  15.980  2.072   1.00 0.00 ? 102 ASP A CG   4  
ATOM 7215  O OD1  . ASP A 1 102 ? -4.458  15.356  2.723   1.00 0.00 ? 102 ASP A OD1  4  
ATOM 7216  O OD2  . ASP A 1 102 ? -5.737  17.112  2.397   1.00 0.00 ? 102 ASP A OD2  4  
ATOM 7217  H H    . ASP A 1 102 ? -4.584  13.478  1.979   1.00 0.00 ? 102 ASP A H    4  
ATOM 7218  H HA   . ASP A 1 102 ? -5.361  13.954  -0.721  1.00 0.00 ? 102 ASP A HA   4  
ATOM 7219  H HB2  . ASP A 1 102 ? -6.210  16.117  0.149   1.00 0.00 ? 102 ASP A HB2  4  
ATOM 7220  H HB3  . ASP A 1 102 ? -6.752  14.739  1.112   1.00 0.00 ? 102 ASP A HB3  4  
ATOM 7221  N N    . VAL A 1 103 ? -3.236  14.940  -1.597  1.00 0.00 ? 103 VAL A N    4  
ATOM 7222  C CA   . VAL A 1 103 ? -2.127  15.662  -2.206  1.00 0.00 ? 103 VAL A CA   4  
ATOM 7223  C C    . VAL A 1 103 ? -2.626  16.642  -3.264  1.00 0.00 ? 103 VAL A C    4  
ATOM 7224  O O    . VAL A 1 103 ? -2.416  17.849  -3.154  1.00 0.00 ? 103 VAL A O    4  
ATOM 7225  C CB   . VAL A 1 103 ? -1.113  14.698  -2.853  1.00 0.00 ? 103 VAL A CB   4  
ATOM 7226  C CG1  . VAL A 1 103 ? 0.110   15.457  -3.344  1.00 0.00 ? 103 VAL A CG1  4  
ATOM 7227  C CG2  . VAL A 1 103 ? -0.712  13.607  -1.871  1.00 0.00 ? 103 VAL A CG2  4  
ATOM 7228  H H    . VAL A 1 103 ? -3.637  14.185  -2.078  1.00 0.00 ? 103 VAL A H    4  
ATOM 7229  H HA   . VAL A 1 103 ? -1.621  16.216  -1.427  1.00 0.00 ? 103 VAL A HA   4  
ATOM 7230  H HB   . VAL A 1 103 ? -1.584  14.231  -3.704  1.00 0.00 ? 103 VAL A HB   4  
ATOM 7231  H HG11 . VAL A 1 103 ? 0.994   14.857  -3.189  1.00 0.00 ? 103 VAL A HG11 4  
ATOM 7232  H HG12 . VAL A 1 103 ? 0.203   16.383  -2.797  1.00 0.00 ? 103 VAL A HG12 4  
ATOM 7233  H HG13 . VAL A 1 103 ? 0.001   15.672  -4.398  1.00 0.00 ? 103 VAL A HG13 4  
ATOM 7234  H HG21 . VAL A 1 103 ? -0.669  12.658  -2.385  1.00 0.00 ? 103 VAL A HG21 4  
ATOM 7235  H HG22 . VAL A 1 103 ? -1.440  13.551  -1.076  1.00 0.00 ? 103 VAL A HG22 4  
ATOM 7236  H HG23 . VAL A 1 103 ? 0.258   13.835  -1.455  1.00 0.00 ? 103 VAL A HG23 4  
ATOM 7237  N N    . GLY A 1 104 ? -3.287  16.112  -4.288  1.00 0.00 ? 104 GLY A N    4  
ATOM 7238  C CA   . GLY A 1 104 ? -3.807  16.954  -5.350  1.00 0.00 ? 104 GLY A CA   4  
ATOM 7239  C C    . GLY A 1 104 ? -5.283  17.252  -5.184  1.00 0.00 ? 104 GLY A C    4  
ATOM 7240  O O    . GLY A 1 104 ? -6.099  16.866  -6.021  1.00 0.00 ? 104 GLY A O    4  
ATOM 7241  H H    . GLY A 1 104 ? -3.424  15.142  -4.322  1.00 0.00 ? 104 GLY A H    4  
ATOM 7242  H HA2  . GLY A 1 104 ? -3.260  17.885  -5.356  1.00 0.00 ? 104 GLY A HA2  4  
ATOM 7243  H HA3  . GLY A 1 104 ? -3.655  16.455  -6.296  1.00 0.00 ? 104 GLY A HA3  4  
ATOM 7244  N N    . ARG A 1 105 ? -5.628  17.943  -4.102  1.00 0.00 ? 105 ARG A N    4  
ATOM 7245  C CA   . ARG A 1 105 ? -7.016  18.294  -3.828  1.00 0.00 ? 105 ARG A CA   4  
ATOM 7246  C C    . ARG A 1 105 ? -7.204  19.808  -3.832  1.00 0.00 ? 105 ARG A C    4  
ATOM 7247  O O    . ARG A 1 105 ? -8.204  20.319  -4.335  1.00 0.00 ? 105 ARG A O    4  
ATOM 7248  C CB   . ARG A 1 105 ? -7.455  17.713  -2.482  1.00 0.00 ? 105 ARG A CB   4  
ATOM 7249  C CG   . ARG A 1 105 ? -8.767  16.946  -2.550  1.00 0.00 ? 105 ARG A CG   4  
ATOM 7250  C CD   . ARG A 1 105 ? -9.843  17.601  -1.700  1.00 0.00 ? 105 ARG A CD   4  
ATOM 7251  N NE   . ARG A 1 105 ? -10.985 16.715  -1.483  1.00 0.00 ? 105 ARG A NE   4  
ATOM 7252  C CZ   . ARG A 1 105 ? -11.883 16.886  -0.516  1.00 0.00 ? 105 ARG A CZ   4  
ATOM 7253  N NH1  . ARG A 1 105 ? -11.776 17.906  0.327   1.00 0.00 ? 105 ARG A NH1  4  
ATOM 7254  N NH2  . ARG A 1 105 ? -12.891 16.034  -0.389  1.00 0.00 ? 105 ARG A NH2  4  
ATOM 7255  H H    . ARG A 1 105 ? -4.931  18.222  -3.471  1.00 0.00 ? 105 ARG A H    4  
ATOM 7256  H HA   . ARG A 1 105 ? -7.625  17.867  -4.611  1.00 0.00 ? 105 ARG A HA   4  
ATOM 7257  H HB2  . ARG A 1 105 ? -6.688  17.039  -2.128  1.00 0.00 ? 105 ARG A HB2  4  
ATOM 7258  H HB3  . ARG A 1 105 ? -7.568  18.519  -1.772  1.00 0.00 ? 105 ARG A HB3  4  
ATOM 7259  H HG2  . ARG A 1 105 ? -9.102  16.916  -3.576  1.00 0.00 ? 105 ARG A HG2  4  
ATOM 7260  H HG3  . ARG A 1 105 ? -8.602  15.939  -2.195  1.00 0.00 ? 105 ARG A HG3  4  
ATOM 7261  H HD2  . ARG A 1 105 ? -9.418  17.863  -0.742  1.00 0.00 ? 105 ARG A HD2  4  
ATOM 7262  H HD3  . ARG A 1 105 ? -10.183 18.497  -2.199  1.00 0.00 ? 105 ARG A HD3  4  
ATOM 7263  H HE   . ARG A 1 105 ? -11.089 15.953  -2.091  1.00 0.00 ? 105 ARG A HE   4  
ATOM 7264  H HH11 . ARG A 1 105 ? -11.018 18.553  0.237   1.00 0.00 ? 105 ARG A HH11 4  
ATOM 7265  H HH12 . ARG A 1 105 ? -12.454 18.029  1.051   1.00 0.00 ? 105 ARG A HH12 4  
ATOM 7266  H HH21 . ARG A 1 105 ? -12.977 15.263  -1.022  1.00 0.00 ? 105 ARG A HH21 4  
ATOM 7267  H HH22 . ARG A 1 105 ? -13.566 16.162  0.337   1.00 0.00 ? 105 ARG A HH22 4  
ATOM 7268  N N    . LEU A 1 106 ? -6.236  20.520  -3.264  1.00 0.00 ? 106 LEU A N    4  
ATOM 7269  C CA   . LEU A 1 106 ? -6.294  21.976  -3.202  1.00 0.00 ? 106 LEU A CA   4  
ATOM 7270  C C    . LEU A 1 106 ? -5.279  22.602  -4.156  1.00 0.00 ? 106 LEU A C    4  
ATOM 7271  O O    . LEU A 1 106 ? -4.356  21.933  -4.620  1.00 0.00 ? 106 LEU A O    4  
ATOM 7272  C CB   . LEU A 1 106 ? -6.035  22.455  -1.771  1.00 0.00 ? 106 LEU A CB   4  
ATOM 7273  C CG   . LEU A 1 106 ? -7.291  22.777  -0.959  1.00 0.00 ? 106 LEU A CG   4  
ATOM 7274  C CD1  . LEU A 1 106 ? -8.192  21.557  -0.864  1.00 0.00 ? 106 LEU A CD1  4  
ATOM 7275  C CD2  . LEU A 1 106 ? -6.914  23.274  0.429   1.00 0.00 ? 106 LEU A CD2  4  
ATOM 7276  H H    . LEU A 1 106 ? -5.463  20.055  -2.880  1.00 0.00 ? 106 LEU A H    4  
ATOM 7277  H HA   . LEU A 1 106 ? -7.286  22.281  -3.500  1.00 0.00 ? 106 LEU A HA   4  
ATOM 7278  H HB2  . LEU A 1 106 ? -5.483  21.687  -1.251  1.00 0.00 ? 106 LEU A HB2  4  
ATOM 7279  H HB3  . LEU A 1 106 ? -5.426  23.347  -1.815  1.00 0.00 ? 106 LEU A HB3  4  
ATOM 7280  H HG   . LEU A 1 106 ? -7.843  23.562  -1.458  1.00 0.00 ? 106 LEU A HG   4  
ATOM 7281  H HD11 . LEU A 1 106 ? -8.652  21.373  -1.824  1.00 0.00 ? 106 LEU A HD11 4  
ATOM 7282  H HD12 . LEU A 1 106 ? -8.960  21.733  -0.125  1.00 0.00 ? 106 LEU A HD12 4  
ATOM 7283  H HD13 . LEU A 1 106 ? -7.605  20.698  -0.577  1.00 0.00 ? 106 LEU A HD13 4  
ATOM 7284  H HD21 . LEU A 1 106 ? -7.669  22.968  1.137   1.00 0.00 ? 106 LEU A HD21 4  
ATOM 7285  H HD22 . LEU A 1 106 ? -6.845  24.352  0.419   1.00 0.00 ? 106 LEU A HD22 4  
ATOM 7286  H HD23 . LEU A 1 106 ? -5.961  22.855  0.714   1.00 0.00 ? 106 LEU A HD23 4  
ATOM 7287  N N    . PRO A 1 107 ? -5.437  23.903  -4.460  1.00 0.00 ? 107 PRO A N    4  
ATOM 7288  C CA   . PRO A 1 107 ? -4.529  24.619  -5.362  1.00 0.00 ? 107 PRO A CA   4  
ATOM 7289  C C    . PRO A 1 107 ? -3.156  24.848  -4.739  1.00 0.00 ? 107 PRO A C    4  
ATOM 7290  O O    . PRO A 1 107 ? -2.933  24.534  -3.571  1.00 0.00 ? 107 PRO A O    4  
ATOM 7291  C CB   . PRO A 1 107 ? -5.239  25.952  -5.595  1.00 0.00 ? 107 PRO A CB   4  
ATOM 7292  C CG   . PRO A 1 107 ? -6.080  26.149  -4.381  1.00 0.00 ? 107 PRO A CG   4  
ATOM 7293  C CD   . PRO A 1 107 ? -6.510  24.775  -3.948  1.00 0.00 ? 107 PRO A CD   4  
ATOM 7294  H HA   . PRO A 1 107 ? -4.414  24.098  -6.302  1.00 0.00 ? 107 PRO A HA   4  
ATOM 7295  H HB2  . PRO A 1 107 ? -4.506  26.740  -5.702  1.00 0.00 ? 107 PRO A HB2  4  
ATOM 7296  H HB3  . PRO A 1 107 ? -5.846  25.889  -6.489  1.00 0.00 ? 107 PRO A HB3  4  
ATOM 7297  H HG2  . PRO A 1 107 ? -5.497  26.623  -3.605  1.00 0.00 ? 107 PRO A HG2  4  
ATOM 7298  H HG3  . PRO A 1 107 ? -6.941  26.753  -4.625  1.00 0.00 ? 107 PRO A HG3  4  
ATOM 7299  H HD2  . PRO A 1 107 ? -6.571  24.722  -2.870  1.00 0.00 ? 107 PRO A HD2  4  
ATOM 7300  H HD3  . PRO A 1 107 ? -7.461  24.519  -4.395  1.00 0.00 ? 107 PRO A HD3  4  
ATOM 7301  N N    . HIS A 1 108 ? -2.239  25.397  -5.529  1.00 0.00 ? 108 HIS A N    4  
ATOM 7302  C CA   . HIS A 1 108 ? -0.886  25.669  -5.056  1.00 0.00 ? 108 HIS A CA   4  
ATOM 7303  C C    . HIS A 1 108 ? -0.573  27.161  -5.137  1.00 0.00 ? 108 HIS A C    4  
ATOM 7304  O O    . HIS A 1 108 ? -0.703  27.776  -6.194  1.00 0.00 ? 108 HIS A O    4  
ATOM 7305  C CB   . HIS A 1 108 ? 0.133   24.873  -5.875  1.00 0.00 ? 108 HIS A CB   4  
ATOM 7306  C CG   . HIS A 1 108 ? 0.766   23.751  -5.112  1.00 0.00 ? 108 HIS A CG   4  
ATOM 7307  N ND1  . HIS A 1 108 ? 0.427   22.427  -5.300  1.00 0.00 ? 108 HIS A ND1  4  
ATOM 7308  C CD2  . HIS A 1 108 ? 1.723   23.759  -4.155  1.00 0.00 ? 108 HIS A CD2  4  
ATOM 7309  C CE1  . HIS A 1 108 ? 1.148   21.671  -4.492  1.00 0.00 ? 108 HIS A CE1  4  
ATOM 7310  N NE2  . HIS A 1 108 ? 1.942   22.455  -3.787  1.00 0.00 ? 108 HIS A NE2  4  
ATOM 7311  H H    . HIS A 1 108 ? -2.477  25.625  -6.452  1.00 0.00 ? 108 HIS A H    4  
ATOM 7312  H HA   . HIS A 1 108 ? -0.827  25.358  -4.023  1.00 0.00 ? 108 HIS A HA   4  
ATOM 7313  H HB2  . HIS A 1 108 ? -0.360  24.451  -6.737  1.00 0.00 ? 108 HIS A HB2  4  
ATOM 7314  H HB3  . HIS A 1 108 ? 0.919   25.537  -6.204  1.00 0.00 ? 108 HIS A HB3  4  
ATOM 7315  H HD1  . HIS A 1 108 ? -0.243  22.092  -5.933  1.00 0.00 ? 108 HIS A HD1  4  
ATOM 7316  H HD2  . HIS A 1 108 ? 2.222   24.631  -3.754  1.00 0.00 ? 108 HIS A HD2  4  
ATOM 7317  H HE1  . HIS A 1 108 ? 1.097   20.594  -4.420  1.00 0.00 ? 108 HIS A HE1  4  
ATOM 7318  H HE2  . HIS A 1 108 ? 2.643   22.145  -3.175  1.00 0.00 ? 108 HIS A HE2  4  
ATOM 7319  N N    . ALA A 1 109 ? -0.160  27.735  -4.012  1.00 0.00 ? 109 ALA A N    4  
ATOM 7320  C CA   . ALA A 1 109 ? 0.172   29.154  -3.955  1.00 0.00 ? 109 ALA A CA   4  
ATOM 7321  C C    . ALA A 1 109 ? 1.647   29.362  -3.628  1.00 0.00 ? 109 ALA A C    4  
ATOM 7322  O O    . ALA A 1 109 ? 2.296   30.247  -4.183  1.00 0.00 ? 109 ALA A O    4  
ATOM 7323  C CB   . ALA A 1 109 ? -0.702  29.859  -2.928  1.00 0.00 ? 109 ALA A CB   4  
ATOM 7324  H H    . ALA A 1 109 ? -0.076  27.192  -3.200  1.00 0.00 ? 109 ALA A H    4  
ATOM 7325  H HA   . ALA A 1 109 ? -0.036  29.585  -4.924  1.00 0.00 ? 109 ALA A HA   4  
ATOM 7326  H HB1  . ALA A 1 109 ? -0.147  30.668  -2.477  1.00 0.00 ? 109 ALA A HB1  4  
ATOM 7327  H HB2  . ALA A 1 109 ? -0.998  29.156  -2.164  1.00 0.00 ? 109 ALA A HB2  4  
ATOM 7328  H HB3  . ALA A 1 109 ? -1.582  30.254  -3.414  1.00 0.00 ? 109 ALA A HB3  4  
ATOM 7329  N N    . ARG A 1 110 ? 2.168   28.539  -2.722  1.00 0.00 ? 110 ARG A N    4  
ATOM 7330  C CA   . ARG A 1 110 ? 3.568   28.627  -2.317  1.00 0.00 ? 110 ARG A CA   4  
ATOM 7331  C C    . ARG A 1 110 ? 3.862   29.971  -1.656  1.00 0.00 ? 110 ARG A C    4  
ATOM 7332  O O    . ARG A 1 110 ? 3.914   30.071  -0.430  1.00 0.00 ? 110 ARG A O    4  
ATOM 7333  C CB   . ARG A 1 110 ? 4.486   28.422  -3.524  1.00 0.00 ? 110 ARG A CB   4  
ATOM 7334  C CG   . ARG A 1 110 ? 4.715   26.960  -3.874  1.00 0.00 ? 110 ARG A CG   4  
ATOM 7335  C CD   . ARG A 1 110 ? 5.271   26.803  -5.281  1.00 0.00 ? 110 ARG A CD   4  
ATOM 7336  N NE   . ARG A 1 110 ? 6.422   25.905  -5.317  1.00 0.00 ? 110 ARG A NE   4  
ATOM 7337  C CZ   . ARG A 1 110 ? 7.300   25.863  -6.317  1.00 0.00 ? 110 ARG A CZ   4  
ATOM 7338  N NH1  . ARG A 1 110 ? 7.161   26.668  -7.364  1.00 0.00 ? 110 ARG A NH1  4  
ATOM 7339  N NH2  . ARG A 1 110 ? 8.319   25.018  -6.270  1.00 0.00 ? 110 ARG A NH2  4  
ATOM 7340  H H    . ARG A 1 110 ? 1.597   27.854  -2.316  1.00 0.00 ? 110 ARG A H    4  
ATOM 7341  H HA   . ARG A 1 110 ? 3.752   27.841  -1.599  1.00 0.00 ? 110 ARG A HA   4  
ATOM 7342  H HB2  . ARG A 1 110 ? 4.052   28.911  -4.382  1.00 0.00 ? 110 ARG A HB2  4  
ATOM 7343  H HB3  . ARG A 1 110 ? 5.445   28.873  -3.312  1.00 0.00 ? 110 ARG A HB3  4  
ATOM 7344  H HG2  . ARG A 1 110 ? 5.418   26.537  -3.171  1.00 0.00 ? 110 ARG A HG2  4  
ATOM 7345  H HG3  . ARG A 1 110 ? 3.775   26.434  -3.807  1.00 0.00 ? 110 ARG A HG3  4  
ATOM 7346  H HD2  . ARG A 1 110 ? 4.495   26.404  -5.918  1.00 0.00 ? 110 ARG A HD2  4  
ATOM 7347  H HD3  . ARG A 1 110 ? 5.572   27.774  -5.647  1.00 0.00 ? 110 ARG A HD3  4  
ATOM 7348  H HE   . ARG A 1 110 ? 6.548   25.300  -4.556  1.00 0.00 ? 110 ARG A HE   4  
ATOM 7349  H HH11 . ARG A 1 110 ? 6.394   27.308  -7.406  1.00 0.00 ? 110 ARG A HH11 4  
ATOM 7350  H HH12 . ARG A 1 110 ? 7.823   26.632  -8.112  1.00 0.00 ? 110 ARG A HH12 4  
ATOM 7351  H HH21 . ARG A 1 110 ? 8.429   24.410  -5.483  1.00 0.00 ? 110 ARG A HH21 4  
ATOM 7352  H HH22 . ARG A 1 110 ? 8.979   24.986  -7.021  1.00 0.00 ? 110 ARG A HH22 4  
ATOM 7353  N N    . THR A 1 111 ? 4.053   31.003  -2.473  1.00 0.00 ? 111 THR A N    4  
ATOM 7354  C CA   . THR A 1 111 ? 4.342   32.338  -1.964  1.00 0.00 ? 111 THR A CA   4  
ATOM 7355  C C    . THR A 1 111 ? 5.637   32.346  -1.158  1.00 0.00 ? 111 THR A C    4  
ATOM 7356  O O    . THR A 1 111 ? 6.086   31.307  -0.677  1.00 0.00 ? 111 THR A O    4  
ATOM 7357  C CB   . THR A 1 111 ? 3.185   32.838  -1.097  1.00 0.00 ? 111 THR A CB   4  
ATOM 7358  O OG1  . THR A 1 111 ? 1.963   32.247  -1.502  1.00 0.00 ? 111 THR A OG1  4  
ATOM 7359  C CG2  . THR A 1 111 ? 3.007   34.340  -1.144  1.00 0.00 ? 111 THR A CG2  4  
ATOM 7360  H H    . THR A 1 111 ? 3.999   30.863  -3.441  1.00 0.00 ? 111 THR A H    4  
ATOM 7361  H HA   . THR A 1 111 ? 4.455   32.998  -2.811  1.00 0.00 ? 111 THR A HA   4  
ATOM 7362  H HB   . THR A 1 111 ? 3.371   32.560  -0.070  1.00 0.00 ? 111 THR A HB   4  
ATOM 7363  H HG1  . THR A 1 111 ? 1.282   32.443  -0.855  1.00 0.00 ? 111 THR A HG1  4  
ATOM 7364  H HG21 . THR A 1 111 ? 3.893   34.820  -0.758  1.00 0.00 ? 111 THR A HG21 4  
ATOM 7365  H HG22 . THR A 1 111 ? 2.155   34.621  -0.542  1.00 0.00 ? 111 THR A HG22 4  
ATOM 7366  H HG23 . THR A 1 111 ? 2.843   34.651  -2.165  1.00 0.00 ? 111 THR A HG23 4  
ATOM 7367  N N    . THR A 1 112 ? 6.231   33.526  -1.014  1.00 0.00 ? 112 THR A N    4  
ATOM 7368  C CA   . THR A 1 112 ? 7.474   33.670  -0.266  1.00 0.00 ? 112 THR A CA   4  
ATOM 7369  C C    . THR A 1 112 ? 7.248   34.461  1.019   1.00 0.00 ? 112 THR A C    4  
ATOM 7370  O O    . THR A 1 112 ? 6.438   35.387  1.055   1.00 0.00 ? 112 THR A O    4  
ATOM 7371  C CB   . THR A 1 112 ? 8.534   34.361  -1.125  1.00 0.00 ? 112 THR A CB   4  
ATOM 7372  O OG1  . THR A 1 112 ? 7.930   35.255  -2.043  1.00 0.00 ? 112 THR A OG1  4  
ATOM 7373  C CG2  . THR A 1 112 ? 9.386   33.395  -1.917  1.00 0.00 ? 112 THR A CG2  4  
ATOM 7374  H H    . THR A 1 112 ? 5.824   34.320  -1.420  1.00 0.00 ? 112 THR A H    4  
ATOM 7375  H HA   . THR A 1 112 ? 7.822   32.681  -0.008  1.00 0.00 ? 112 THR A HA   4  
ATOM 7376  H HB   . THR A 1 112 ? 9.190   34.930  -0.480  1.00 0.00 ? 112 THR A HB   4  
ATOM 7377  H HG1  . THR A 1 112 ? 7.536   35.988  -1.565  1.00 0.00 ? 112 THR A HG1  4  
ATOM 7378  H HG21 . THR A 1 112 ? 9.769   33.890  -2.797  1.00 0.00 ? 112 THR A HG21 4  
ATOM 7379  H HG22 . THR A 1 112 ? 8.787   32.547  -2.214  1.00 0.00 ? 112 THR A HG22 4  
ATOM 7380  H HG23 . THR A 1 112 ? 10.210  33.056  -1.306  1.00 0.00 ? 112 THR A HG23 4  
ATOM 7381  N N    . VAL A 1 113 ? 7.970   34.089  2.072   1.00 0.00 ? 113 VAL A N    4  
ATOM 7382  C CA   . VAL A 1 113 ? 7.848   34.764  3.358   1.00 0.00 ? 113 VAL A CA   4  
ATOM 7383  C C    . VAL A 1 113 ? 8.429   36.172  3.298   1.00 0.00 ? 113 VAL A C    4  
ATOM 7384  O O    . VAL A 1 113 ? 7.968   37.075  3.997   1.00 0.00 ? 113 VAL A O    4  
ATOM 7385  C CB   . VAL A 1 113 ? 8.558   33.975  4.475   1.00 0.00 ? 113 VAL A CB   4  
ATOM 7386  C CG1  . VAL A 1 113 ? 8.254   34.583  5.836   1.00 0.00 ? 113 VAL A CG1  4  
ATOM 7387  C CG2  . VAL A 1 113 ? 8.154   32.509  4.435   1.00 0.00 ? 113 VAL A CG2  4  
ATOM 7388  H H    . VAL A 1 113 ? 8.599   33.343  1.980   1.00 0.00 ? 113 VAL A H    4  
ATOM 7389  H HA   . VAL A 1 113 ? 6.798   34.827  3.604   1.00 0.00 ? 113 VAL A HA   4  
ATOM 7390  H HB   . VAL A 1 113 ? 9.625   34.037  4.309   1.00 0.00 ? 113 VAL A HB   4  
ATOM 7391  H HG11 . VAL A 1 113 ? 8.199   33.799  6.576   1.00 0.00 ? 113 VAL A HG11 4  
ATOM 7392  H HG12 . VAL A 1 113 ? 7.310   35.105  5.793   1.00 0.00 ? 113 VAL A HG12 4  
ATOM 7393  H HG13 . VAL A 1 113 ? 9.037   35.276  6.104   1.00 0.00 ? 113 VAL A HG13 4  
ATOM 7394  H HG21 . VAL A 1 113 ? 7.077   32.433  4.465   1.00 0.00 ? 113 VAL A HG21 4  
ATOM 7395  H HG22 . VAL A 1 113 ? 8.575   31.996  5.286   1.00 0.00 ? 113 VAL A HG22 4  
ATOM 7396  H HG23 . VAL A 1 113 ? 8.522   32.060  3.524   1.00 0.00 ? 113 VAL A HG23 4  
ATOM 7397  N N    . ASP A 1 114 ? 9.444   36.353  2.459   1.00 0.00 ? 114 ASP A N    4  
ATOM 7398  C CA   . ASP A 1 114 ? 10.088  37.653  2.308   1.00 0.00 ? 114 ASP A CA   4  
ATOM 7399  C C    . ASP A 1 114 ? 9.110   38.684  1.754   1.00 0.00 ? 114 ASP A C    4  
ATOM 7400  O O    . ASP A 1 114 ? 8.341   38.395  0.838   1.00 0.00 ? 114 ASP A O    4  
ATOM 7401  C CB   . ASP A 1 114 ? 11.303  37.537  1.386   1.00 0.00 ? 114 ASP A CB   4  
ATOM 7402  C CG   . ASP A 1 114 ? 12.585  37.267  2.149   1.00 0.00 ? 114 ASP A CG   4  
ATOM 7403  O OD1  . ASP A 1 114 ? 13.011  38.148  2.925   1.00 0.00 ? 114 ASP A OD1  4  
ATOM 7404  O OD2  . ASP A 1 114 ? 13.162  36.173  1.971   1.00 0.00 ? 114 ASP A OD2  4  
ATOM 7405  H H    . ASP A 1 114 ? 9.767   35.595  1.930   1.00 0.00 ? 114 ASP A H    4  
ATOM 7406  H HA   . ASP A 1 114 ? 10.418  37.975  3.285   1.00 0.00 ? 114 ASP A HA   4  
ATOM 7407  H HB2  . ASP A 1 114 ? 11.144  36.728  0.689   1.00 0.00 ? 114 ASP A HB2  4  
ATOM 7408  H HB3  . ASP A 1 114 ? 11.420  38.461  0.838   1.00 0.00 ? 114 ASP A HB3  4  
ATOM 7409  N N    . GLU A 1 115 ? 9.146   39.888  2.317   1.00 0.00 ? 115 GLU A N    4  
ATOM 7410  C CA   . GLU A 1 115 ? 8.264   40.964  1.881   1.00 0.00 ? 115 GLU A CA   4  
ATOM 7411  C C    . GLU A 1 115 ? 9.068   42.140  1.337   1.00 0.00 ? 115 GLU A C    4  
ATOM 7412  O O    . GLU A 1 115 ? 9.740   42.845  2.090   1.00 0.00 ? 115 GLU A O    4  
ATOM 7413  C CB   . GLU A 1 115 ? 7.378   41.427  3.038   1.00 0.00 ? 115 GLU A CB   4  
ATOM 7414  C CG   . GLU A 1 115 ? 6.060   42.035  2.590   1.00 0.00 ? 115 GLU A CG   4  
ATOM 7415  C CD   . GLU A 1 115 ? 4.876   41.127  2.858   1.00 0.00 ? 115 GLU A CD   4  
ATOM 7416  O OE1  . GLU A 1 115 ? 4.576   40.272  1.998   1.00 0.00 ? 115 GLU A OE1  4  
ATOM 7417  O OE2  . GLU A 1 115 ? 4.250   41.269  3.930   1.00 0.00 ? 115 GLU A OE2  4  
ATOM 7418  H H    . GLU A 1 115 ? 9.781   40.056  3.044   1.00 0.00 ? 115 GLU A H    4  
ATOM 7419  H HA   . GLU A 1 115 ? 7.635   40.578  1.091   1.00 0.00 ? 115 GLU A HA   4  
ATOM 7420  H HB2  . GLU A 1 115 ? 7.163   40.580  3.673   1.00 0.00 ? 115 GLU A HB2  4  
ATOM 7421  H HB3  . GLU A 1 115 ? 7.915   42.167  3.612   1.00 0.00 ? 115 GLU A HB3  4  
ATOM 7422  H HG2  . GLU A 1 115 ? 5.907   42.964  3.120   1.00 0.00 ? 115 GLU A HG2  4  
ATOM 7423  H HG3  . GLU A 1 115 ? 6.111   42.232  1.530   1.00 0.00 ? 115 GLU A HG3  4  
ATOM 7424  N N    . THR A 1 116 ? 8.995   42.346  0.027   1.00 0.00 ? 116 THR A N    4  
ATOM 7425  C CA   . THR A 1 116 ? 9.717   43.437  -0.617  1.00 0.00 ? 116 THR A CA   4  
ATOM 7426  C C    . THR A 1 116 ? 8.793   44.243  -1.525  1.00 0.00 ? 116 THR A C    4  
ATOM 7427  O O    . THR A 1 116 ? 8.813   45.473  -1.512  1.00 0.00 ? 116 THR A O    4  
ATOM 7428  C CB   . THR A 1 116 ? 10.896  42.891  -1.424  1.00 0.00 ? 116 THR A CB   4  
ATOM 7429  O OG1  . THR A 1 116 ? 11.297  41.625  -0.932  1.00 0.00 ? 116 THR A OG1  4  
ATOM 7430  C CG2  . THR A 1 116 ? 12.107  43.797  -1.404  1.00 0.00 ? 116 THR A CG2  4  
ATOM 7431  H H    . THR A 1 116 ? 8.444   41.750  -0.521  1.00 0.00 ? 116 THR A H    4  
ATOM 7432  H HA   . THR A 1 116 ? 10.096  44.087  0.158   1.00 0.00 ? 116 THR A HA   4  
ATOM 7433  H HB   . THR A 1 116 ? 10.589  42.772  -2.454  1.00 0.00 ? 116 THR A HB   4  
ATOM 7434  H HG1  . THR A 1 116 ? 10.952  40.935  -1.503  1.00 0.00 ? 116 THR A HG1  4  
ATOM 7435  H HG21 . THR A 1 116 ? 12.308  44.106  -0.388  1.00 0.00 ? 116 THR A HG21 4  
ATOM 7436  H HG22 . THR A 1 116 ? 11.917  44.667  -2.015  1.00 0.00 ? 116 THR A HG22 4  
ATOM 7437  H HG23 . THR A 1 116 ? 12.962  43.264  -1.793  1.00 0.00 ? 116 THR A HG23 4  
ATOM 7438  N N    . LYS A 1 117 ? 7.987   43.540  -2.313  1.00 0.00 ? 117 LYS A N    4  
ATOM 7439  C CA   . LYS A 1 117 ? 7.055   44.189  -3.229  1.00 0.00 ? 117 LYS A CA   4  
ATOM 7440  C C    . LYS A 1 117 ? 7.805   45.013  -4.273  1.00 0.00 ? 117 LYS A C    4  
ATOM 7441  O O    . LYS A 1 117 ? 7.304   46.031  -4.752  1.00 0.00 ? 117 LYS A O    4  
ATOM 7442  C CB   . LYS A 1 117 ? 6.082   45.082  -2.453  1.00 0.00 ? 117 LYS A CB   4  
ATOM 7443  C CG   . LYS A 1 117 ? 4.642   44.598  -2.505  1.00 0.00 ? 117 LYS A CG   4  
ATOM 7444  C CD   . LYS A 1 117 ? 3.713   45.531  -1.744  1.00 0.00 ? 117 LYS A CD   4  
ATOM 7445  C CE   . LYS A 1 117 ? 3.027   46.519  -2.675  1.00 0.00 ? 117 LYS A CE   4  
ATOM 7446  N NZ   . LYS A 1 117 ? 3.522   47.909  -2.471  1.00 0.00 ? 117 LYS A NZ   4  
ATOM 7447  H H    . LYS A 1 117 ? 8.018   42.561  -2.279  1.00 0.00 ? 117 LYS A H    4  
ATOM 7448  H HA   . LYS A 1 117 ? 6.496   43.416  -3.734  1.00 0.00 ? 117 LYS A HA   4  
ATOM 7449  H HB2  . LYS A 1 117 ? 6.390   45.114  -1.418  1.00 0.00 ? 117 LYS A HB2  4  
ATOM 7450  H HB3  . LYS A 1 117 ? 6.119   46.081  -2.861  1.00 0.00 ? 117 LYS A HB3  4  
ATOM 7451  H HG2  . LYS A 1 117 ? 4.325   44.554  -3.536  1.00 0.00 ? 117 LYS A HG2  4  
ATOM 7452  H HG3  . LYS A 1 117 ? 4.587   43.613  -2.066  1.00 0.00 ? 117 LYS A HG3  4  
ATOM 7453  H HD2  . LYS A 1 117 ? 2.960   44.943  -1.243  1.00 0.00 ? 117 LYS A HD2  4  
ATOM 7454  H HD3  . LYS A 1 117 ? 4.290   46.079  -1.013  1.00 0.00 ? 117 LYS A HD3  4  
ATOM 7455  H HE2  . LYS A 1 117 ? 3.215   46.225  -3.696  1.00 0.00 ? 117 LYS A HE2  4  
ATOM 7456  H HE3  . LYS A 1 117 ? 1.964   46.494  -2.484  1.00 0.00 ? 117 LYS A HE3  4  
ATOM 7457  H HZ1  . LYS A 1 117 ? 4.529   47.970  -2.728  1.00 0.00 ? 117 LYS A HZ1  4  
ATOM 7458  H HZ2  . LYS A 1 117 ? 3.413   48.187  -1.476  1.00 0.00 ? 117 LYS A HZ2  4  
ATOM 7459  H HZ3  . LYS A 1 117 ? 2.983   48.571  -3.066  1.00 0.00 ? 117 LYS A HZ3  4  
ATOM 7460  N N    . TRP A 1 118 ? 9.008   44.566  -4.619  1.00 0.00 ? 118 TRP A N    4  
ATOM 7461  C CA   . TRP A 1 118 ? 9.826   45.261  -5.607  1.00 0.00 ? 118 TRP A CA   4  
ATOM 7462  C C    . TRP A 1 118 ? 10.961  44.366  -6.098  1.00 0.00 ? 118 TRP A C    4  
ATOM 7463  O O    . TRP A 1 118 ? 12.057  44.375  -5.539  1.00 0.00 ? 118 TRP A O    4  
ATOM 7464  C CB   . TRP A 1 118 ? 10.397  46.549  -5.010  1.00 0.00 ? 118 TRP A CB   4  
ATOM 7465  C CG   . TRP A 1 118 ? 9.529   47.747  -5.244  1.00 0.00 ? 118 TRP A CG   4  
ATOM 7466  C CD1  . TRP A 1 118 ? 9.115   48.653  -4.311  1.00 0.00 ? 118 TRP A CD1  4  
ATOM 7467  C CD2  . TRP A 1 118 ? 8.969   48.170  -6.492  1.00 0.00 ? 118 TRP A CD2  4  
ATOM 7468  N NE1  . TRP A 1 118 ? 8.331   49.613  -4.902  1.00 0.00 ? 118 TRP A NE1  4  
ATOM 7469  C CE2  . TRP A 1 118 ? 8.226   49.340  -6.240  1.00 0.00 ? 118 TRP A CE2  4  
ATOM 7470  C CE3  . TRP A 1 118 ? 9.024   47.675  -7.798  1.00 0.00 ? 118 TRP A CE3  4  
ATOM 7471  C CZ2  . TRP A 1 118 ? 7.544   50.019  -7.246  1.00 0.00 ? 118 TRP A CZ2  4  
ATOM 7472  C CZ3  . TRP A 1 118 ? 8.346   48.351  -8.796  1.00 0.00 ? 118 TRP A CZ3  4  
ATOM 7473  C CH2  . TRP A 1 118 ? 7.615   49.512  -8.515  1.00 0.00 ? 118 TRP A CH2  4  
ATOM 7474  H H    . TRP A 1 118 ? 9.352   43.749  -4.203  1.00 0.00 ? 118 TRP A H    4  
ATOM 7475  H HA   . TRP A 1 118 ? 9.194   45.512  -6.445  1.00 0.00 ? 118 TRP A HA   4  
ATOM 7476  H HB2  . TRP A 1 118 ? 10.514  46.424  -3.945  1.00 0.00 ? 118 TRP A HB2  4  
ATOM 7477  H HB3  . TRP A 1 118 ? 11.364  46.744  -5.452  1.00 0.00 ? 118 TRP A HB3  4  
ATOM 7478  H HD1  . TRP A 1 118 ? 9.372   48.608  -3.263  1.00 0.00 ? 118 TRP A HD1  4  
ATOM 7479  H HE1  . TRP A 1 118 ? 7.914   50.371  -4.441  1.00 0.00 ? 118 TRP A HE1  4  
ATOM 7480  H HE3  . TRP A 1 118 ? 9.582   46.781  -8.034  1.00 0.00 ? 118 TRP A HE3  4  
ATOM 7481  H HZ2  . TRP A 1 118 ? 6.977   50.916  -7.047  1.00 0.00 ? 118 TRP A HZ2  4  
ATOM 7482  H HZ3  . TRP A 1 118 ? 8.376   47.983  -9.810  1.00 0.00 ? 118 TRP A HZ3  4  
ATOM 7483  H HH2  . TRP A 1 118 ? 7.100   50.007  -9.326  1.00 0.00 ? 118 TRP A HH2  4  
ATOM 7484  N N    . ILE A 1 119 ? 10.689  43.597  -7.146  1.00 0.00 ? 119 ILE A N    4  
ATOM 7485  C CA   . ILE A 1 119 ? 11.687  42.697  -7.711  1.00 0.00 ? 119 ILE A CA   4  
ATOM 7486  C C    . ILE A 1 119 ? 12.285  43.275  -8.992  1.00 0.00 ? 119 ILE A C    4  
ATOM 7487  O O    . ILE A 1 119 ? 11.572  43.533  -9.961  1.00 0.00 ? 119 ILE A O    4  
ATOM 7488  C CB   . ILE A 1 119 ? 11.088  41.307  -8.012  1.00 0.00 ? 119 ILE A CB   4  
ATOM 7489  C CG1  . ILE A 1 119 ? 12.186  40.336  -8.452  1.00 0.00 ? 119 ILE A CG1  4  
ATOM 7490  C CG2  . ILE A 1 119 ? 10.002  41.408  -9.076  1.00 0.00 ? 119 ILE A CG2  4  
ATOM 7491  C CD1  . ILE A 1 119 ? 12.528  39.297  -7.406  1.00 0.00 ? 119 ILE A CD1  4  
ATOM 7492  H H    . ILE A 1 119 ? 9.796   43.635  -7.548  1.00 0.00 ? 119 ILE A H    4  
ATOM 7493  H HA   . ILE A 1 119 ? 12.475  42.576  -6.982  1.00 0.00 ? 119 ILE A HA   4  
ATOM 7494  H HB   . ILE A 1 119 ? 10.632  40.935  -7.107  1.00 0.00 ? 119 ILE A HB   4  
ATOM 7495  H HG12 . ILE A 1 119 ? 11.865  39.815  -9.342  1.00 0.00 ? 119 ILE A HG12 4  
ATOM 7496  H HG13 . ILE A 1 119 ? 13.085  40.894  -8.673  1.00 0.00 ? 119 ILE A HG13 4  
ATOM 7497  H HG21 . ILE A 1 119 ? 9.334   42.221  -8.833  1.00 0.00 ? 119 ILE A HG21 4  
ATOM 7498  H HG22 . ILE A 1 119 ? 9.446   40.484  -9.111  1.00 0.00 ? 119 ILE A HG22 4  
ATOM 7499  H HG23 . ILE A 1 119 ? 10.457  41.591  -10.038 1.00 0.00 ? 119 ILE A HG23 4  
ATOM 7500  H HD11 . ILE A 1 119 ? 13.581  39.061  -7.463  1.00 0.00 ? 119 ILE A HD11 4  
ATOM 7501  H HD12 . ILE A 1 119 ? 11.948  38.403  -7.583  1.00 0.00 ? 119 ILE A HD12 4  
ATOM 7502  H HD13 . ILE A 1 119 ? 12.300  39.686  -6.424  1.00 0.00 ? 119 ILE A HD13 4  
ATOM 7503  N N    . ALA A 1 120 ? 13.599  43.475  -8.986  1.00 0.00 ? 120 ALA A N    4  
ATOM 7504  C CA   . ALA A 1 120 ? 14.293  44.023  -10.146 1.00 0.00 ? 120 ALA A CA   4  
ATOM 7505  C C    . ALA A 1 120 ? 15.332  43.042  -10.678 1.00 0.00 ? 120 ALA A C    4  
ATOM 7506  O O    . ALA A 1 120 ? 16.406  43.443  -11.129 1.00 0.00 ? 120 ALA A O    4  
ATOM 7507  C CB   . ALA A 1 120 ? 14.949  45.348  -9.791  1.00 0.00 ? 120 ALA A CB   4  
ATOM 7508  H H    . ALA A 1 120 ? 14.114  43.250  -8.184  1.00 0.00 ? 120 ALA A H    4  
ATOM 7509  H HA   . ALA A 1 120 ? 13.560  44.207  -10.918 1.00 0.00 ? 120 ALA A HA   4  
ATOM 7510  H HB1  . ALA A 1 120 ? 14.203  46.129  -9.785  1.00 0.00 ? 120 ALA A HB1  4  
ATOM 7511  H HB2  . ALA A 1 120 ? 15.708  45.582  -10.522 1.00 0.00 ? 120 ALA A HB2  4  
ATOM 7512  H HB3  . ALA A 1 120 ? 15.401  45.275  -8.813  1.00 0.00 ? 120 ALA A HB3  4  
ATOM 7513  N N    . SER A 1 121 ? 15.007  41.754  -10.622 1.00 0.00 ? 121 SER A N    4  
ATOM 7514  C CA   . SER A 1 121 ? 15.913  40.716  -11.098 1.00 0.00 ? 121 SER A CA   4  
ATOM 7515  C C    . SER A 1 121 ? 17.239  40.763  -10.348 1.00 0.00 ? 121 SER A C    4  
ATOM 7516  O O    . SER A 1 121 ? 17.484  41.672  -9.555  1.00 0.00 ? 121 SER A O    4  
ATOM 7517  C CB   . SER A 1 121 ? 16.157  40.872  -12.600 1.00 0.00 ? 121 SER A CB   4  
ATOM 7518  O OG   . SER A 1 121 ? 15.183  40.168  -13.352 1.00 0.00 ? 121 SER A OG   4  
ATOM 7519  H H    . SER A 1 121 ? 14.137  41.497  -10.252 1.00 0.00 ? 121 SER A H    4  
ATOM 7520  H HA   . SER A 1 121 ? 15.445  39.760  -10.917 1.00 0.00 ? 121 SER A HA   4  
ATOM 7521  H HB2  . SER A 1 121 ? 16.109  41.918  -12.864 1.00 0.00 ? 121 SER A HB2  4  
ATOM 7522  H HB3  . SER A 1 121 ? 17.135  40.483  -12.846 1.00 0.00 ? 121 SER A HB3  4  
ATOM 7523  H HG   . SER A 1 121 ? 14.313  40.330  -12.981 1.00 0.00 ? 121 SER A HG   4  
ATOM 7524  N N    . SER A 1 122 ? 18.094  39.778  -10.604 1.00 0.00 ? 122 SER A N    4  
ATOM 7525  C CA   . SER A 1 122 ? 19.398  39.708  -9.953  1.00 0.00 ? 122 SER A CA   4  
ATOM 7526  C C    . SER A 1 122 ? 20.492  39.375  -10.962 1.00 0.00 ? 122 SER A C    4  
ATOM 7527  O O    . SER A 1 122 ? 20.436  38.347  -11.637 1.00 0.00 ? 122 SER A O    4  
ATOM 7528  C CB   . SER A 1 122 ? 19.379  38.660  -8.839  1.00 0.00 ? 122 SER A CB   4  
ATOM 7529  O OG   . SER A 1 122 ? 20.675  38.465  -8.301  1.00 0.00 ? 122 SER A OG   4  
ATOM 7530  H H    . SER A 1 122 ? 17.843  39.082  -11.247 1.00 0.00 ? 122 SER A H    4  
ATOM 7531  H HA   . SER A 1 122 ? 19.604  40.676  -9.522  1.00 0.00 ? 122 SER A HA   4  
ATOM 7532  H HB2  . SER A 1 122 ? 18.721  38.989  -8.049  1.00 0.00 ? 122 SER A HB2  4  
ATOM 7533  H HB3  . SER A 1 122 ? 19.022  37.722  -9.237  1.00 0.00 ? 122 SER A HB3  4  
ATOM 7534  H HG   . SER A 1 122 ? 20.780  37.546  -8.044  1.00 0.00 ? 122 SER A HG   4  
ATOM 7535  N N    . SER A 1 123 ? 21.488  40.250  -11.059 1.00 0.00 ? 123 SER A N    4  
ATOM 7536  C CA   . SER A 1 123 ? 22.595  40.049  -11.985 1.00 0.00 ? 123 SER A CA   4  
ATOM 7537  C C    . SER A 1 123 ? 23.934  40.275  -11.290 1.00 0.00 ? 123 SER A C    4  
ATOM 7538  O O    . SER A 1 123 ? 24.235  41.384  -10.848 1.00 0.00 ? 123 SER A O    4  
ATOM 7539  C CB   . SER A 1 123 ? 22.464  40.990  -13.184 1.00 0.00 ? 123 SER A CB   4  
ATOM 7540  O OG   . SER A 1 123 ? 22.687  42.336  -12.802 1.00 0.00 ? 123 SER A OG   4  
ATOM 7541  H H    . SER A 1 123 ? 21.477  41.051  -10.494 1.00 0.00 ? 123 SER A H    4  
ATOM 7542  H HA   . SER A 1 123 ? 22.553  39.028  -12.335 1.00 0.00 ? 123 SER A HA   4  
ATOM 7543  H HB2  . SER A 1 123 ? 23.190  40.718  -13.935 1.00 0.00 ? 123 SER A HB2  4  
ATOM 7544  H HB3  . SER A 1 123 ? 21.469  40.906  -13.597 1.00 0.00 ? 123 SER A HB3  4  
ATOM 7545  H HG   . SER A 1 123 ? 22.417  42.921  -13.514 1.00 0.00 ? 123 SER A HG   4  
ATOM 7546  N N    . GLY A 1 124 ? 24.733  39.218  -11.198 1.00 0.00 ? 124 GLY A N    4  
ATOM 7547  C CA   . GLY A 1 124 ? 26.031  39.323  -10.556 1.00 0.00 ? 124 GLY A CA   4  
ATOM 7548  C C    . GLY A 1 124 ? 26.775  38.000  -10.532 1.00 0.00 ? 124 GLY A C    4  
ATOM 7549  O O    . GLY A 1 124 ? 26.875  37.362  -9.484  1.00 0.00 ? 124 GLY A O    4  
ATOM 7550  H H    . GLY A 1 124 ? 24.440  38.359  -11.569 1.00 0.00 ? 124 GLY A H    4  
ATOM 7551  H HA2  . GLY A 1 124 ? 26.626  40.050  -11.089 1.00 0.00 ? 124 GLY A HA2  4  
ATOM 7552  H HA3  . GLY A 1 124 ? 25.890  39.662  -9.540  1.00 0.00 ? 124 GLY A HA3  4  
ATOM 7553  N N    . PRO A 1 125 ? 27.313  37.560  -11.681 1.00 0.00 ? 125 PRO A N    4  
ATOM 7554  C CA   . PRO A 1 125 ? 28.054  36.297  -11.775 1.00 0.00 ? 125 PRO A CA   4  
ATOM 7555  C C    . PRO A 1 125 ? 29.161  36.197  -10.731 1.00 0.00 ? 125 PRO A C    4  
ATOM 7556  O O    . PRO A 1 125 ? 29.883  37.163  -10.484 1.00 0.00 ? 125 PRO A O    4  
ATOM 7557  C CB   . PRO A 1 125 ? 28.649  36.335  -13.183 1.00 0.00 ? 125 PRO A CB   4  
ATOM 7558  C CG   . PRO A 1 125 ? 27.739  37.226  -13.956 1.00 0.00 ? 125 PRO A CG   4  
ATOM 7559  C CD   . PRO A 1 125 ? 27.243  38.256  -12.980 1.00 0.00 ? 125 PRO A CD   4  
ATOM 7560  H HA   . PRO A 1 125 ? 27.395  35.445  -11.681 1.00 0.00 ? 125 PRO A HA   4  
ATOM 7561  H HB2  . PRO A 1 125 ? 29.653  36.733  -13.143 1.00 0.00 ? 125 PRO A HB2  4  
ATOM 7562  H HB3  . PRO A 1 125 ? 28.668  35.338  -13.597 1.00 0.00 ? 125 PRO A HB3  4  
ATOM 7563  H HG2  . PRO A 1 125 ? 28.284  37.701  -14.758 1.00 0.00 ? 125 PRO A HG2  4  
ATOM 7564  H HG3  . PRO A 1 125 ? 26.912  36.654  -14.350 1.00 0.00 ? 125 PRO A HG3  4  
ATOM 7565  H HD2  . PRO A 1 125 ? 27.885  39.124  -12.988 1.00 0.00 ? 125 PRO A HD2  4  
ATOM 7566  H HD3  . PRO A 1 125 ? 26.226  38.536  -13.212 1.00 0.00 ? 125 PRO A HD3  4  
ATOM 7567  N N    . SER A 1 126 ? 29.288  35.022  -10.122 1.00 0.00 ? 126 SER A N    4  
ATOM 7568  C CA   . SER A 1 126 ? 30.307  34.797  -9.104  1.00 0.00 ? 126 SER A CA   4  
ATOM 7569  C C    . SER A 1 126 ? 31.578  34.226  -9.725  1.00 0.00 ? 126 SER A C    4  
ATOM 7570  O O    . SER A 1 126 ? 32.650  34.825  -9.630  1.00 0.00 ? 126 SER A O    4  
ATOM 7571  C CB   . SER A 1 126 ? 29.781  33.845  -8.027  1.00 0.00 ? 126 SER A CB   4  
ATOM 7572  O OG   . SER A 1 126 ? 29.189  34.562  -6.959  1.00 0.00 ? 126 SER A OG   4  
ATOM 7573  H H    . SER A 1 126 ? 28.681  34.291  -10.362 1.00 0.00 ? 126 SER A H    4  
ATOM 7574  H HA   . SER A 1 126 ? 30.539  35.748  -8.649  1.00 0.00 ? 126 SER A HA   4  
ATOM 7575  H HB2  . SER A 1 126 ? 29.039  33.191  -8.460  1.00 0.00 ? 126 SER A HB2  4  
ATOM 7576  H HB3  . SER A 1 126 ? 30.599  33.256  -7.640  1.00 0.00 ? 126 SER A HB3  4  
ATOM 7577  H HG   . SER A 1 126 ? 29.137  33.999  -6.184  1.00 0.00 ? 126 SER A HG   4  
ATOM 7578  N N    . SER A 1 127 ? 31.452  33.065  -10.358 1.00 0.00 ? 127 SER A N    4  
ATOM 7579  C CA   . SER A 1 127 ? 32.591  32.414  -10.995 1.00 0.00 ? 127 SER A CA   4  
ATOM 7580  C C    . SER A 1 127 ? 32.224  31.917  -12.389 1.00 0.00 ? 127 SER A C    4  
ATOM 7581  O O    . SER A 1 127 ? 32.752  30.909  -12.859 1.00 0.00 ? 127 SER A O    4  
ATOM 7582  C CB   . SER A 1 127 ? 33.082  31.246  -10.137 1.00 0.00 ? 127 SER A CB   4  
ATOM 7583  O OG   . SER A 1 127 ? 32.068  30.271  -9.973  1.00 0.00 ? 127 SER A OG   4  
ATOM 7584  H H    . SER A 1 127 ? 30.572  32.636  -10.400 1.00 0.00 ? 127 SER A H    4  
ATOM 7585  H HA   . SER A 1 127 ? 33.383  33.142  -11.083 1.00 0.00 ? 127 SER A HA   4  
ATOM 7586  H HB2  . SER A 1 127 ? 33.934  30.785  -10.615 1.00 0.00 ? 127 SER A HB2  4  
ATOM 7587  H HB3  . SER A 1 127 ? 33.372  31.614  -9.164  1.00 0.00 ? 127 SER A HB3  4  
ATOM 7588  H HG   . SER A 1 127 ? 31.291  30.678  -9.582  1.00 0.00 ? 127 SER A HG   4  
ATOM 7589  N N    . GLY A 1 128 ? 31.315  32.630  -13.046 1.00 0.00 ? 128 GLY A N    4  
ATOM 7590  C CA   . GLY A 1 128 ? 30.893  32.245  -14.380 1.00 0.00 ? 128 GLY A CA   4  
ATOM 7591  C C    . GLY A 1 128 ? 30.415  33.427  -15.201 1.00 0.00 ? 128 GLY A C    4  
ATOM 7592  O O    . GLY A 1 128 ? 29.435  33.266  -15.958 1.00 0.00 ? 128 GLY A O    4  
ATOM 7593  O OXT  . GLY A 1 128 ? 31.022  34.512  -15.087 1.00 0.00 ? 128 GLY A OXT  4  
ATOM 7594  H H    . GLY A 1 128 ? 30.928  33.423  -12.622 1.00 0.00 ? 128 GLY A H    4  
ATOM 7595  H HA2  . GLY A 1 128 ? 31.725  31.780  -14.889 1.00 0.00 ? 128 GLY A HA2  4  
ATOM 7596  H HA3  . GLY A 1 128 ? 30.088  31.529  -14.299 1.00 0.00 ? 128 GLY A HA3  4  
ATOM 7597  N N    . GLY A 1 1   ? 5.834   -16.066 9.593   1.00 0.00 ? 1   GLY A N    5  
ATOM 7598  C CA   . GLY A 1 1   ? 5.275   -17.331 9.043   1.00 0.00 ? 1   GLY A CA   5  
ATOM 7599  C C    . GLY A 1 1   ? 3.760   -17.365 9.093   1.00 0.00 ? 1   GLY A C    5  
ATOM 7600  O O    . GLY A 1 1   ? 3.103   -17.598 8.078   1.00 0.00 ? 1   GLY A O    5  
ATOM 7601  H H1   . GLY A 1 1   ? 6.087   -15.420 8.818   1.00 0.00 ? 1   GLY A H1   5  
ATOM 7602  H H2   . GLY A 1 1   ? 6.687   -16.266 10.154  1.00 0.00 ? 1   GLY A H2   5  
ATOM 7603  H H3   . GLY A 1 1   ? 5.133   -15.600 10.203  1.00 0.00 ? 1   GLY A H3   5  
ATOM 7604  H HA2  . GLY A 1 1   ? 5.592   -17.436 8.016   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7605  H HA3  . GLY A 1 1   ? 5.662   -18.162 9.615   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7606  N N    . SER A 1 2   ? 3.204   -17.135 10.278  1.00 0.00 ? 2   SER A N    5  
ATOM 7607  C CA   . SER A 1 2   ? 1.756   -17.140 10.456  1.00 0.00 ? 2   SER A CA   5  
ATOM 7608  C C    . SER A 1 2   ? 1.347   -16.224 11.604  1.00 0.00 ? 2   SER A C    5  
ATOM 7609  O O    . SER A 1 2   ? 2.173   -15.842 12.434  1.00 0.00 ? 2   SER A O    5  
ATOM 7610  C CB   . SER A 1 2   ? 1.260   -18.563 10.723  1.00 0.00 ? 2   SER A CB   5  
ATOM 7611  O OG   . SER A 1 2   ? 1.834   -19.483 9.811   1.00 0.00 ? 2   SER A OG   5  
ATOM 7612  H H    . SER A 1 2   ? 3.779   -16.957 11.050  1.00 0.00 ? 2   SER A H    5  
ATOM 7613  H HA   . SER A 1 2   ? 1.309   -16.778 9.544   1.00 0.00 ? 2   SER A HA   5  
ATOM 7614  H HB2  . SER A 1 2   ? 1.531   -18.854 11.727  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7615  H HB3  . SER A 1 2   ? 0.185   -18.593 10.617  1.00 0.00 ? 2   SER A HB3  5  
ATOM 7616  H HG   . SER A 1 2   ? 1.265   -20.251 9.730   1.00 0.00 ? 2   SER A HG   5  
ATOM 7617  N N    . SER A 1 3   ? 0.065   -15.872 11.645  1.00 0.00 ? 3   SER A N    5  
ATOM 7618  C CA   . SER A 1 3   ? -0.454  -15.000 12.692  1.00 0.00 ? 3   SER A CA   5  
ATOM 7619  C C    . SER A 1 3   ? -1.966  -14.838 12.564  1.00 0.00 ? 3   SER A C    5  
ATOM 7620  O O    . SER A 1 3   ? -2.535  -15.048 11.494  1.00 0.00 ? 3   SER A O    5  
ATOM 7621  C CB   . SER A 1 3   ? 0.224   -13.630 12.626  1.00 0.00 ? 3   SER A CB   5  
ATOM 7622  O OG   . SER A 1 3   ? 0.452   -13.111 13.925  1.00 0.00 ? 3   SER A OG   5  
ATOM 7623  H H    . SER A 1 3   ? -0.546  -16.208 10.956  1.00 0.00 ? 3   SER A H    5  
ATOM 7624  H HA   . SER A 1 3   ? -0.232  -15.456 13.645  1.00 0.00 ? 3   SER A HA   5  
ATOM 7625  H HB2  . SER A 1 3   ? 1.171   -13.724 12.118  1.00 0.00 ? 3   SER A HB2  5  
ATOM 7626  H HB3  . SER A 1 3   ? -0.410  -12.943 12.083  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7627  H HG   . SER A 1 3   ? 0.978   -13.734 14.431  1.00 0.00 ? 3   SER A HG   5  
ATOM 7628  N N    . GLY A 1 4   ? -2.611  -14.464 13.665  1.00 0.00 ? 4   GLY A N    5  
ATOM 7629  C CA   . GLY A 1 4   ? -4.051  -14.281 13.656  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7630  C C    . GLY A 1 4   ? -4.455  -12.849 13.941  1.00 0.00 ? 4   GLY A C    5  
ATOM 7631  O O    . GLY A 1 4   ? -5.533  -12.596 14.480  1.00 0.00 ? 4   GLY A O    5  
ATOM 7632  H H    . GLY A 1 4   ? -2.105  -14.311 14.490  1.00 0.00 ? 4   GLY A H    5  
ATOM 7633  H HA2  . GLY A 1 4   ? -4.433  -14.566 12.686  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7634  H HA3  . GLY A 1 4   ? -4.489  -14.923 14.406  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7635  N N    . SER A 1 5   ? -3.589  -11.908 13.577  1.00 0.00 ? 5   SER A N    5  
ATOM 7636  C CA   . SER A 1 5   ? -3.861  -10.492 13.797  1.00 0.00 ? 5   SER A CA   5  
ATOM 7637  C C    . SER A 1 5   ? -3.108  -9.630  12.790  1.00 0.00 ? 5   SER A C    5  
ATOM 7638  O O    . SER A 1 5   ? -1.939  -9.301  12.991  1.00 0.00 ? 5   SER A O    5  
ATOM 7639  C CB   . SER A 1 5   ? -3.473  -10.092 15.222  1.00 0.00 ? 5   SER A CB   5  
ATOM 7640  O OG   . SER A 1 5   ? -4.431  -9.213  15.785  1.00 0.00 ? 5   SER A OG   5  
ATOM 7641  H H    . SER A 1 5   ? -2.747  -12.172 13.152  1.00 0.00 ? 5   SER A H    5  
ATOM 7642  H HA   . SER A 1 5   ? -4.922  -10.334 13.666  1.00 0.00 ? 5   SER A HA   5  
ATOM 7643  H HB2  . SER A 1 5   ? -3.409  -10.977 15.838  1.00 0.00 ? 5   SER A HB2  5  
ATOM 7644  H HB3  . SER A 1 5   ? -2.513  -9.596  15.205  1.00 0.00 ? 5   SER A HB3  5  
ATOM 7645  H HG   . SER A 1 5   ? -5.256  -9.684  15.922  1.00 0.00 ? 5   SER A HG   5  
ATOM 7646  N N    . SER A 1 6   ? -3.785  -9.268  11.705  1.00 0.00 ? 6   SER A N    5  
ATOM 7647  C CA   . SER A 1 6   ? -3.180  -8.444  10.665  1.00 0.00 ? 6   SER A CA   5  
ATOM 7648  C C    . SER A 1 6   ? -3.354  -6.960  10.978  1.00 0.00 ? 6   SER A C    5  
ATOM 7649  O O    . SER A 1 6   ? -3.878  -6.200  10.163  1.00 0.00 ? 6   SER A O    5  
ATOM 7650  C CB   . SER A 1 6   ? -3.798  -8.770  9.304   1.00 0.00 ? 6   SER A CB   5  
ATOM 7651  O OG   . SER A 1 6   ? -4.323  -10.086 9.283   1.00 0.00 ? 6   SER A OG   5  
ATOM 7652  H H    . SER A 1 6   ? -4.715  -9.562  11.602  1.00 0.00 ? 6   SER A H    5  
ATOM 7653  H HA   . SER A 1 6   ? -2.125  -8.672  10.635  1.00 0.00 ? 6   SER A HA   5  
ATOM 7654  H HB2  . SER A 1 6   ? -4.597  -8.075  9.097   1.00 0.00 ? 6   SER A HB2  5  
ATOM 7655  H HB3  . SER A 1 6   ? -3.040  -8.686  8.539   1.00 0.00 ? 6   SER A HB3  5  
ATOM 7656  H HG   . SER A 1 6   ? -3.980  -10.556 8.520   1.00 0.00 ? 6   SER A HG   5  
ATOM 7657  N N    . GLY A 1 7   ? -2.909  -6.554  12.163  1.00 0.00 ? 7   GLY A N    5  
ATOM 7658  C CA   . GLY A 1 7   ? -3.025  -5.164  12.561  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7659  C C    . GLY A 1 7   ? -1.818  -4.683  13.342  1.00 0.00 ? 7   GLY A C    5  
ATOM 7660  O O    . GLY A 1 7   ? -1.242  -3.641  13.027  1.00 0.00 ? 7   GLY A O    5  
ATOM 7661  H H    . GLY A 1 7   ? -2.500  -7.205  12.771  1.00 0.00 ? 7   GLY A H    5  
ATOM 7662  H HA2  . GLY A 1 7   ? -3.134  -4.555  11.676  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7663  H HA3  . GLY A 1 7   ? -3.906  -5.050  13.175  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7664  N N    . ASP A 1 8   ? -1.434  -5.442  14.363  1.00 0.00 ? 8   ASP A N    5  
ATOM 7665  C CA   . ASP A 1 8   ? -0.288  -5.087  15.192  1.00 0.00 ? 8   ASP A CA   5  
ATOM 7666  C C    . ASP A 1 8   ? -0.505  -3.740  15.874  1.00 0.00 ? 8   ASP A C    5  
ATOM 7667  O O    . ASP A 1 8   ? -1.481  -3.042  15.595  1.00 0.00 ? 8   ASP A O    5  
ATOM 7668  C CB   . ASP A 1 8   ? 0.986   -5.044  14.345  1.00 0.00 ? 8   ASP A CB   5  
ATOM 7669  C CG   . ASP A 1 8   ? 1.660   -6.398  14.244  1.00 0.00 ? 8   ASP A CG   5  
ATOM 7670  O OD1  . ASP A 1 8   ? 1.280   -7.183  13.350  1.00 0.00 ? 8   ASP A OD1  5  
ATOM 7671  O OD2  . ASP A 1 8   ? 2.567   -6.671  15.056  1.00 0.00 ? 8   ASP A OD2  5  
ATOM 7672  H H    . ASP A 1 8   ? -1.934  -6.261  14.564  1.00 0.00 ? 8   ASP A H    5  
ATOM 7673  H HA   . ASP A 1 8   ? -0.179  -5.848  15.950  1.00 0.00 ? 8   ASP A HA   5  
ATOM 7674  H HB2  . ASP A 1 8   ? 0.737   -4.710  13.349  1.00 0.00 ? 8   ASP A HB2  5  
ATOM 7675  H HB3  . ASP A 1 8   ? 1.682   -4.347  14.789  1.00 0.00 ? 8   ASP A HB3  5  
ATOM 7676  N N    . ARG A 1 9   ? 0.408   -3.382  16.769  1.00 0.00 ? 9   ARG A N    5  
ATOM 7677  C CA   . ARG A 1 9   ? 0.317   -2.119  17.491  1.00 0.00 ? 9   ARG A CA   5  
ATOM 7678  C C    . ARG A 1 9   ? 1.389   -1.142  17.019  1.00 0.00 ? 9   ARG A C    5  
ATOM 7679  O O    . ARG A 1 9   ? 2.573   -1.320  17.301  1.00 0.00 ? 9   ARG A O    5  
ATOM 7680  C CB   . ARG A 1 9   ? 0.457   -2.356  18.996  1.00 0.00 ? 9   ARG A CB   5  
ATOM 7681  C CG   . ARG A 1 9   ? -0.763  -3.012  19.624  1.00 0.00 ? 9   ARG A CG   5  
ATOM 7682  C CD   . ARG A 1 9   ? -1.622  -1.999  20.364  1.00 0.00 ? 9   ARG A CD   5  
ATOM 7683  N NE   . ARG A 1 9   ? -3.029  -2.390  20.390  1.00 0.00 ? 9   ARG A NE   5  
ATOM 7684  C CZ   . ARG A 1 9   ? -3.500  -3.418  21.092  1.00 0.00 ? 9   ARG A CZ   5  
ATOM 7685  N NH1  . ARG A 1 9   ? -2.680  -4.161  21.826  1.00 0.00 ? 9   ARG A NH1  5  
ATOM 7686  N NH2  . ARG A 1 9   ? -4.795  -3.705  21.060  1.00 0.00 ? 9   ARG A NH2  5  
ATOM 7687  H H    . ARG A 1 9   ? 1.163   -3.981  16.948  1.00 0.00 ? 9   ARG A H    5  
ATOM 7688  H HA   . ARG A 1 9   ? -0.655  -1.692  17.293  1.00 0.00 ? 9   ARG A HA   5  
ATOM 7689  H HB2  . ARG A 1 9   ? 1.311   -2.995  19.170  1.00 0.00 ? 9   ARG A HB2  5  
ATOM 7690  H HB3  . ARG A 1 9   ? 0.622   -1.408  19.485  1.00 0.00 ? 9   ARG A HB3  5  
ATOM 7691  H HG2  . ARG A 1 9   ? -1.354  -3.470  18.846  1.00 0.00 ? 9   ARG A HG2  5  
ATOM 7692  H HG3  . ARG A 1 9   ? -0.433  -3.768  20.322  1.00 0.00 ? 9   ARG A HG3  5  
ATOM 7693  H HD2  . ARG A 1 9   ? -1.263  -1.914  21.379  1.00 0.00 ? 9   ARG A HD2  5  
ATOM 7694  H HD3  . ARG A 1 9   ? -1.532  -1.042  19.870  1.00 0.00 ? 9   ARG A HD3  5  
ATOM 7695  H HE   . ARG A 1 9   ? -3.657  -1.859  19.857  1.00 0.00 ? 9   ARG A HE   5  
ATOM 7696  H HH11 . ARG A 1 9   ? -1.703  -3.950  21.854  1.00 0.00 ? 9   ARG A HH11 5  
ATOM 7697  H HH12 . ARG A 1 9   ? -3.040  -4.932  22.350  1.00 0.00 ? 9   ARG A HH12 5  
ATOM 7698  H HH21 . ARG A 1 9   ? -5.416  -3.149  20.509  1.00 0.00 ? 9   ARG A HH21 5  
ATOM 7699  H HH22 . ARG A 1 9   ? -5.148  -4.479  21.587  1.00 0.00 ? 9   ARG A HH22 5  
ATOM 7700  N N    . ARG A 1 10  ? 0.964   -0.110  16.296  1.00 0.00 ? 10  ARG A N    5  
ATOM 7701  C CA   . ARG A 1 10  ? 1.888   0.895   15.783  1.00 0.00 ? 10  ARG A CA   5  
ATOM 7702  C C    . ARG A 1 10  ? 1.963   2.095   16.722  1.00 0.00 ? 10  ARG A C    5  
ATOM 7703  O O    . ARG A 1 10  ? 0.992   2.426   17.402  1.00 0.00 ? 10  ARG A O    5  
ATOM 7704  C CB   . ARG A 1 10  ? 1.456   1.351   14.388  1.00 0.00 ? 10  ARG A CB   5  
ATOM 7705  C CG   . ARG A 1 10  ? 2.501   2.188   13.670  1.00 0.00 ? 10  ARG A CG   5  
ATOM 7706  C CD   . ARG A 1 10  ? 2.100   2.467   12.232  1.00 0.00 ? 10  ARG A CD   5  
ATOM 7707  N NE   . ARG A 1 10  ? 1.176   3.595   12.129  1.00 0.00 ? 10  ARG A NE   5  
ATOM 7708  C CZ   . ARG A 1 10  ? 1.553   4.870   12.185  1.00 0.00 ? 10  ARG A CZ   5  
ATOM 7709  N NH1  . ARG A 1 10  ? 2.834   5.184   12.343  1.00 0.00 ? 10  ARG A NH1  5  
ATOM 7710  N NH2  . ARG A 1 10  ? 0.648   5.834   12.085  1.00 0.00 ? 10  ARG A NH2  5  
ATOM 7711  H H    . ARG A 1 10  ? 0.008   -0.022  16.104  1.00 0.00 ? 10  ARG A H    5  
ATOM 7712  H HA   . ARG A 1 10  ? 2.867   0.443   15.717  1.00 0.00 ? 10  ARG A HA   5  
ATOM 7713  H HB2  . ARG A 1 10  ? 1.248   0.479   13.786  1.00 0.00 ? 10  ARG A HB2  5  
ATOM 7714  H HB3  . ARG A 1 10  ? 0.554   1.939   14.478  1.00 0.00 ? 10  ARG A HB3  5  
ATOM 7715  H HG2  . ARG A 1 10  ? 2.616   3.128   14.189  1.00 0.00 ? 10  ARG A HG2  5  
ATOM 7716  H HG3  . ARG A 1 10  ? 3.442   1.654   13.676  1.00 0.00 ? 10  ARG A HG3  5  
ATOM 7717  H HD2  . ARG A 1 10  ? 2.988   2.690   11.659  1.00 0.00 ? 10  ARG A HD2  5  
ATOM 7718  H HD3  . ARG A 1 10  ? 1.623   1.585   11.826  1.00 0.00 ? 10  ARG A HD3  5  
ATOM 7719  H HE   . ARG A 1 10  ? 0.225   3.390   12.013  1.00 0.00 ? 10  ARG A HE   5  
ATOM 7720  H HH11 . ARG A 1 10  ? 3.521   4.462   12.420  1.00 0.00 ? 10  ARG A HH11 5  
ATOM 7721  H HH12 . ARG A 1 10  ? 3.110   6.144   12.385  1.00 0.00 ? 10  ARG A HH12 5  
ATOM 7722  H HH21 . ARG A 1 10  ? -0.317  5.602   11.966  1.00 0.00 ? 10  ARG A HH21 5  
ATOM 7723  H HH22 . ARG A 1 10  ? 0.931   6.792   12.126  1.00 0.00 ? 10  ARG A HH22 5  
ATOM 7724  N N    . SER A 1 11  ? 3.123   2.743   16.754  1.00 0.00 ? 11  SER A N    5  
ATOM 7725  C CA   . SER A 1 11  ? 3.325   3.907   17.609  1.00 0.00 ? 11  SER A CA   5  
ATOM 7726  C C    . SER A 1 11  ? 3.131   3.543   19.078  1.00 0.00 ? 11  SER A C    5  
ATOM 7727  O O    . SER A 1 11  ? 2.043   3.707   19.629  1.00 0.00 ? 11  SER A O    5  
ATOM 7728  C CB   . SER A 1 11  ? 2.360   5.028   17.217  1.00 0.00 ? 11  SER A CB   5  
ATOM 7729  O OG   . SER A 1 11  ? 2.247   5.134   15.809  1.00 0.00 ? 11  SER A OG   5  
ATOM 7730  H H    . SER A 1 11  ? 3.860   2.431   16.188  1.00 0.00 ? 11  SER A H    5  
ATOM 7731  H HA   . SER A 1 11  ? 4.339   4.250   17.467  1.00 0.00 ? 11  SER A HA   5  
ATOM 7732  H HB2  . SER A 1 11  ? 1.385   4.819   17.629  1.00 0.00 ? 11  SER A HB2  5  
ATOM 7733  H HB3  . SER A 1 11  ? 2.725   5.966   17.609  1.00 0.00 ? 11  SER A HB3  5  
ATOM 7734  H HG   . SER A 1 11  ? 1.727   4.400   15.473  1.00 0.00 ? 11  SER A HG   5  
ATOM 7735  N N    . THR A 1 12  ? 4.193   3.047   19.705  1.00 0.00 ? 12  THR A N    5  
ATOM 7736  C CA   . THR A 1 12  ? 4.139   2.659   21.110  1.00 0.00 ? 12  THR A CA   5  
ATOM 7737  C C    . THR A 1 12  ? 4.209   3.884   22.015  1.00 0.00 ? 12  THR A C    5  
ATOM 7738  O O    . THR A 1 12  ? 3.610   3.910   23.090  1.00 0.00 ? 12  THR A O    5  
ATOM 7739  C CB   . THR A 1 12  ? 5.283   1.700   21.440  1.00 0.00 ? 12  THR A CB   5  
ATOM 7740  O OG1  . THR A 1 12  ? 6.488   2.128   20.832  1.00 0.00 ? 12  THR A OG1  5  
ATOM 7741  C CG2  . THR A 1 12  ? 5.021   0.279   20.990  1.00 0.00 ? 12  THR A CG2  5  
ATOM 7742  H H    . THR A 1 12  ? 5.032   2.939   19.211  1.00 0.00 ? 12  THR A H    5  
ATOM 7743  H HA   . THR A 1 12  ? 3.198   2.156   21.278  1.00 0.00 ? 12  THR A HA   5  
ATOM 7744  H HB   . THR A 1 12  ? 5.429   1.687   22.511  1.00 0.00 ? 12  THR A HB   5  
ATOM 7745  H HG1  . THR A 1 12  ? 6.756   2.970   21.209  1.00 0.00 ? 12  THR A HG1  5  
ATOM 7746  H HG21 . THR A 1 12  ? 4.644   0.285   19.979  1.00 0.00 ? 12  THR A HG21 5  
ATOM 7747  H HG22 . THR A 1 12  ? 4.293   -0.177  21.644  1.00 0.00 ? 12  THR A HG22 5  
ATOM 7748  H HG23 . THR A 1 12  ? 5.942   -0.285  21.028  1.00 0.00 ? 12  THR A HG23 5  
ATOM 7749  N N    . LEU A 1 13  ? 4.944   4.899   21.573  1.00 0.00 ? 13  LEU A N    5  
ATOM 7750  C CA   . LEU A 1 13  ? 5.093   6.128   22.344  1.00 0.00 ? 13  LEU A CA   5  
ATOM 7751  C C    . LEU A 1 13  ? 4.775   7.350   21.486  1.00 0.00 ? 13  LEU A C    5  
ATOM 7752  O O    . LEU A 1 13  ? 4.456   7.225   20.304  1.00 0.00 ? 13  LEU A O    5  
ATOM 7753  C CB   . LEU A 1 13  ? 6.513   6.238   22.900  1.00 0.00 ? 13  LEU A CB   5  
ATOM 7754  C CG   . LEU A 1 13  ? 6.824   5.304   24.072  1.00 0.00 ? 13  LEU A CG   5  
ATOM 7755  C CD1  . LEU A 1 13  ? 7.481   4.026   23.576  1.00 0.00 ? 13  LEU A CD1  5  
ATOM 7756  C CD2  . LEU A 1 13  ? 7.713   6.002   25.091  1.00 0.00 ? 13  LEU A CD2  5  
ATOM 7757  H H    . LEU A 1 13  ? 5.398   4.820   20.708  1.00 0.00 ? 13  LEU A H    5  
ATOM 7758  H HA   . LEU A 1 13  ? 4.395   6.090   23.166  1.00 0.00 ? 13  LEU A HA   5  
ATOM 7759  H HB2  . LEU A 1 13  ? 7.208   6.022   22.102  1.00 0.00 ? 13  LEU A HB2  5  
ATOM 7760  H HB3  . LEU A 1 13  ? 6.672   7.255   23.227  1.00 0.00 ? 13  LEU A HB3  5  
ATOM 7761  H HG   . LEU A 1 13  ? 5.899   5.034   24.563  1.00 0.00 ? 13  LEU A HG   5  
ATOM 7762  H HD11 . LEU A 1 13  ? 8.173   3.664   24.322  1.00 0.00 ? 13  LEU A HD11 5  
ATOM 7763  H HD12 . LEU A 1 13  ? 8.015   4.228   22.659  1.00 0.00 ? 13  LEU A HD12 5  
ATOM 7764  H HD13 . LEU A 1 13  ? 6.724   3.278   23.394  1.00 0.00 ? 13  LEU A HD13 5  
ATOM 7765  H HD21 . LEU A 1 13  ? 8.292   6.768   24.598  1.00 0.00 ? 13  LEU A HD21 5  
ATOM 7766  H HD22 . LEU A 1 13  ? 8.378   5.281   25.542  1.00 0.00 ? 13  LEU A HD22 5  
ATOM 7767  H HD23 . LEU A 1 13  ? 7.097   6.453   25.857  1.00 0.00 ? 13  LEU A HD23 5  
ATOM 7768  N N    . HIS A 1 14  ? 4.866   8.531   22.091  1.00 0.00 ? 14  HIS A N    5  
ATOM 7769  C CA   . HIS A 1 14  ? 4.590   9.775   21.383  1.00 0.00 ? 14  HIS A CA   5  
ATOM 7770  C C    . HIS A 1 14  ? 3.156   9.796   20.862  1.00 0.00 ? 14  HIS A C    5  
ATOM 7771  O O    . HIS A 1 14  ? 2.462   8.780   20.881  1.00 0.00 ? 14  HIS A O    5  
ATOM 7772  C CB   . HIS A 1 14  ? 5.569   9.955   20.222  1.00 0.00 ? 14  HIS A CB   5  
ATOM 7773  C CG   . HIS A 1 14  ? 6.962   10.286  20.660  1.00 0.00 ? 14  HIS A CG   5  
ATOM 7774  N ND1  . HIS A 1 14  ? 7.407   11.579  20.837  1.00 0.00 ? 14  HIS A ND1  5  
ATOM 7775  C CD2  . HIS A 1 14  ? 8.012   9.484   20.960  1.00 0.00 ? 14  HIS A CD2  5  
ATOM 7776  C CE1  . HIS A 1 14  ? 8.671   11.558  21.225  1.00 0.00 ? 14  HIS A CE1  5  
ATOM 7777  N NE2  . HIS A 1 14  ? 9.060   10.299  21.307  1.00 0.00 ? 14  HIS A NE2  5  
ATOM 7778  H H    . HIS A 1 14  ? 5.127   8.565   23.035  1.00 0.00 ? 14  HIS A H    5  
ATOM 7779  H HA   . HIS A 1 14  ? 4.719   10.588  22.080  1.00 0.00 ? 14  HIS A HA   5  
ATOM 7780  H HB2  . HIS A 1 14  ? 5.610   9.040   19.650  1.00 0.00 ? 14  HIS A HB2  5  
ATOM 7781  H HB3  . HIS A 1 14  ? 5.220   10.755  19.586  1.00 0.00 ? 14  HIS A HB3  5  
ATOM 7782  H HD1  . HIS A 1 14  ? 6.878   12.391  20.699  1.00 0.00 ? 14  HIS A HD1  5  
ATOM 7783  H HD2  . HIS A 1 14  ? 8.021   8.404   20.930  1.00 0.00 ? 14  HIS A HD2  5  
ATOM 7784  H HE1  . HIS A 1 14  ? 9.280   12.423  21.439  1.00 0.00 ? 14  HIS A HE1  5  
ATOM 7785  H HE2  . HIS A 1 14  ? 9.924   9.998   21.656  1.00 0.00 ? 14  HIS A HE2  5  
ATOM 7786  N N    . LEU A 1 15  ? 2.719   10.962  20.396  1.00 0.00 ? 15  LEU A N    5  
ATOM 7787  C CA   . LEU A 1 15  ? 1.368   11.116  19.870  1.00 0.00 ? 15  LEU A CA   5  
ATOM 7788  C C    . LEU A 1 15  ? 1.273   12.342  18.967  1.00 0.00 ? 15  LEU A C    5  
ATOM 7789  O O    . LEU A 1 15  ? 1.112   13.465  19.443  1.00 0.00 ? 15  LEU A O    5  
ATOM 7790  C CB   . LEU A 1 15  ? 0.363   11.234  21.016  1.00 0.00 ? 15  LEU A CB   5  
ATOM 7791  C CG   . LEU A 1 15  ? -1.108  11.223  20.592  1.00 0.00 ? 15  LEU A CG   5  
ATOM 7792  C CD1  . LEU A 1 15  ? -1.656  9.805   20.603  1.00 0.00 ? 15  LEU A CD1  5  
ATOM 7793  C CD2  . LEU A 1 15  ? -1.931  12.123  21.501  1.00 0.00 ? 15  LEU A CD2  5  
ATOM 7794  H H    . LEU A 1 15  ? 3.319   11.737  20.407  1.00 0.00 ? 15  LEU A H    5  
ATOM 7795  H HA   . LEU A 1 15  ? 1.136   10.237  19.288  1.00 0.00 ? 15  LEU A HA   5  
ATOM 7796  H HB2  . LEU A 1 15  ? 0.525   10.409  21.695  1.00 0.00 ? 15  LEU A HB2  5  
ATOM 7797  H HB3  . LEU A 1 15  ? 0.555   12.156  21.544  1.00 0.00 ? 15  LEU A HB3  5  
ATOM 7798  H HG   . LEU A 1 15  ? -1.186  11.604  19.583  1.00 0.00 ? 15  LEU A HG   5  
ATOM 7799  H HD11 . LEU A 1 15  ? -0.967  9.149   20.092  1.00 0.00 ? 15  LEU A HD11 5  
ATOM 7800  H HD12 . LEU A 1 15  ? -2.612  9.785   20.100  1.00 0.00 ? 15  LEU A HD12 5  
ATOM 7801  H HD13 . LEU A 1 15  ? -1.779  9.475   21.624  1.00 0.00 ? 15  LEU A HD13 5  
ATOM 7802  H HD21 . LEU A 1 15  ? -2.921  11.708  21.618  1.00 0.00 ? 15  LEU A HD21 5  
ATOM 7803  H HD22 . LEU A 1 15  ? -2.003  13.108  21.064  1.00 0.00 ? 15  LEU A HD22 5  
ATOM 7804  H HD23 . LEU A 1 15  ? -1.454  12.192  22.467  1.00 0.00 ? 15  LEU A HD23 5  
ATOM 7805  N N    . LEU A 1 16  ? 1.372   12.118  17.660  1.00 0.00 ? 16  LEU A N    5  
ATOM 7806  C CA   . LEU A 1 16  ? 1.296   13.205  16.691  1.00 0.00 ? 16  LEU A CA   5  
ATOM 7807  C C    . LEU A 1 16  ? -0.132  13.379  16.181  1.00 0.00 ? 16  LEU A C    5  
ATOM 7808  O O    . LEU A 1 16  ? -0.874  12.407  16.040  1.00 0.00 ? 16  LEU A O    5  
ATOM 7809  C CB   . LEU A 1 16  ? 2.244   12.936  15.518  1.00 0.00 ? 16  LEU A CB   5  
ATOM 7810  C CG   . LEU A 1 16  ? 3.512   13.790  15.504  1.00 0.00 ? 16  LEU A CG   5  
ATOM 7811  C CD1  . LEU A 1 16  ? 4.420   13.378  14.355  1.00 0.00 ? 16  LEU A CD1  5  
ATOM 7812  C CD2  . LEU A 1 16  ? 3.157   15.266  15.401  1.00 0.00 ? 16  LEU A CD2  5  
ATOM 7813  H H    . LEU A 1 16  ? 1.499   11.200  17.341  1.00 0.00 ? 16  LEU A H    5  
ATOM 7814  H HA   . LEU A 1 16  ? 1.601   14.113  17.188  1.00 0.00 ? 16  LEU A HA   5  
ATOM 7815  H HB2  . LEU A 1 16  ? 2.535   11.896  15.550  1.00 0.00 ? 16  LEU A HB2  5  
ATOM 7816  H HB3  . LEU A 1 16  ? 1.708   13.113  14.598  1.00 0.00 ? 16  LEU A HB3  5  
ATOM 7817  H HG   . LEU A 1 16  ? 4.052   13.638  16.427  1.00 0.00 ? 16  LEU A HG   5  
ATOM 7818  H HD11 . LEU A 1 16  ? 5.197   14.118  14.227  1.00 0.00 ? 16  LEU A HD11 5  
ATOM 7819  H HD12 . LEU A 1 16  ? 3.841   13.301  13.448  1.00 0.00 ? 16  LEU A HD12 5  
ATOM 7820  H HD13 . LEU A 1 16  ? 4.869   12.421  14.577  1.00 0.00 ? 16  LEU A HD13 5  
ATOM 7821  H HD21 . LEU A 1 16  ? 2.446   15.411  14.603  1.00 0.00 ? 16  LEU A HD21 5  
ATOM 7822  H HD22 . LEU A 1 16  ? 4.050   15.838  15.195  1.00 0.00 ? 16  LEU A HD22 5  
ATOM 7823  H HD23 . LEU A 1 16  ? 2.726   15.599  16.334  1.00 0.00 ? 16  LEU A HD23 5  
ATOM 7824  N N    . GLN A 1 17  ? -0.508  14.624  15.908  1.00 0.00 ? 17  GLN A N    5  
ATOM 7825  C CA   . GLN A 1 17  ? -1.847  14.925  15.413  1.00 0.00 ? 17  GLN A CA   5  
ATOM 7826  C C    . GLN A 1 17  ? -1.968  14.589  13.930  1.00 0.00 ? 17  GLN A C    5  
ATOM 7827  O O    . GLN A 1 17  ? -1.026  14.087  13.318  1.00 0.00 ? 17  GLN A O    5  
ATOM 7828  C CB   . GLN A 1 17  ? -2.177  16.401  15.643  1.00 0.00 ? 17  GLN A CB   5  
ATOM 7829  C CG   . GLN A 1 17  ? -2.227  16.792  17.111  1.00 0.00 ? 17  GLN A CG   5  
ATOM 7830  C CD   . GLN A 1 17  ? -0.848  17.007  17.703  1.00 0.00 ? 17  GLN A CD   5  
ATOM 7831  O OE1  . GLN A 1 17  ? -0.111  17.899  17.282  1.00 0.00 ? 17  GLN A OE1  5  
ATOM 7832  N NE2  . GLN A 1 17  ? -0.492  16.188  18.686  1.00 0.00 ? 17  GLN A NE2  5  
ATOM 7833  H H    . GLN A 1 17  ? 0.128   15.356  16.040  1.00 0.00 ? 17  GLN A H    5  
ATOM 7834  H HA   . GLN A 1 17  ? -2.549  14.319  15.966  1.00 0.00 ? 17  GLN A HA   5  
ATOM 7835  H HB2  . GLN A 1 17  ? -1.426  17.006  15.156  1.00 0.00 ? 17  GLN A HB2  5  
ATOM 7836  H HB3  . GLN A 1 17  ? -3.140  16.616  15.202  1.00 0.00 ? 17  GLN A HB3  5  
ATOM 7837  H HG2  . GLN A 1 17  ? -2.790  17.709  17.207  1.00 0.00 ? 17  GLN A HG2  5  
ATOM 7838  H HG3  . GLN A 1 17  ? -2.723  16.008  17.662  1.00 0.00 ? 17  GLN A HG3  5  
ATOM 7839  H HE21 . GLN A 1 17  ? -1.131  15.501  18.970  1.00 0.00 ? 17  GLN A HE21 5  
ATOM 7840  H HE22 . GLN A 1 17  ? 0.394   16.305  19.088  1.00 0.00 ? 17  GLN A HE22 5  
ATOM 7841  N N    . GLY A 1 18  ? -3.135  14.869  13.360  1.00 0.00 ? 18  GLY A N    5  
ATOM 7842  C CA   . GLY A 1 18  ? -3.358  14.590  11.953  1.00 0.00 ? 18  GLY A CA   5  
ATOM 7843  C C    . GLY A 1 18  ? -4.770  14.115  11.672  1.00 0.00 ? 18  GLY A C    5  
ATOM 7844  O O    . GLY A 1 18  ? -5.412  13.512  12.532  1.00 0.00 ? 18  GLY A O    5  
ATOM 7845  H H    . GLY A 1 18  ? -3.850  15.269  13.897  1.00 0.00 ? 18  GLY A H    5  
ATOM 7846  H HA2  . GLY A 1 18  ? -3.173  15.490  11.385  1.00 0.00 ? 18  GLY A HA2  5  
ATOM 7847  H HA3  . GLY A 1 18  ? -2.663  13.827  11.634  1.00 0.00 ? 18  GLY A HA3  5  
ATOM 7848  N N    . GLY A 1 19  ? -5.256  14.389  10.465  1.00 0.00 ? 19  GLY A N    5  
ATOM 7849  C CA   . GLY A 1 19  ? -6.597  13.978  10.095  1.00 0.00 ? 19  GLY A CA   5  
ATOM 7850  C C    . GLY A 1 19  ? -6.864  14.139  8.612   1.00 0.00 ? 19  GLY A C    5  
ATOM 7851  O O    . GLY A 1 19  ? -7.913  14.646  8.215   1.00 0.00 ? 19  GLY A O    5  
ATOM 7852  H H    . GLY A 1 19  ? -4.698  14.872  9.821   1.00 0.00 ? 19  GLY A H    5  
ATOM 7853  H HA2  . GLY A 1 19  ? -6.731  12.940  10.364  1.00 0.00 ? 19  GLY A HA2  5  
ATOM 7854  H HA3  . GLY A 1 19  ? -7.309  14.576  10.645  1.00 0.00 ? 19  GLY A HA3  5  
ATOM 7855  N N    . ASP A 1 20  ? -5.913  13.706  7.790   1.00 0.00 ? 20  ASP A N    5  
ATOM 7856  C CA   . ASP A 1 20  ? -6.050  13.805  6.342   1.00 0.00 ? 20  ASP A CA   5  
ATOM 7857  C C    . ASP A 1 20  ? -5.703  12.479  5.672   1.00 0.00 ? 20  ASP A C    5  
ATOM 7858  O O    . ASP A 1 20  ? -5.191  12.454  4.553   1.00 0.00 ? 20  ASP A O    5  
ATOM 7859  C CB   . ASP A 1 20  ? -5.151  14.915  5.799   1.00 0.00 ? 20  ASP A CB   5  
ATOM 7860  C CG   . ASP A 1 20  ? -5.735  15.583  4.570   1.00 0.00 ? 20  ASP A CG   5  
ATOM 7861  O OD1  . ASP A 1 20  ? -5.768  14.936  3.502   1.00 0.00 ? 20  ASP A OD1  5  
ATOM 7862  O OD2  . ASP A 1 20  ? -6.159  16.753  4.674   1.00 0.00 ? 20  ASP A OD2  5  
ATOM 7863  H H    . ASP A 1 20  ? -5.099  13.310  8.168   1.00 0.00 ? 20  ASP A H    5  
ATOM 7864  H HA   . ASP A 1 20  ? -7.079  14.047  6.122   1.00 0.00 ? 20  ASP A HA   5  
ATOM 7865  H HB2  . ASP A 1 20  ? -5.015  15.667  6.562   1.00 0.00 ? 20  ASP A HB2  5  
ATOM 7866  H HB3  . ASP A 1 20  ? -4.191  14.497  5.536   1.00 0.00 ? 20  ASP A HB3  5  
ATOM 7867  N N    . GLU A 1 21  ? -5.985  11.380  6.363   1.00 0.00 ? 21  GLU A N    5  
ATOM 7868  C CA   . GLU A 1 21  ? -5.703  10.051  5.834   1.00 0.00 ? 21  GLU A CA   5  
ATOM 7869  C C    . GLU A 1 21  ? -6.948  9.441   5.200   1.00 0.00 ? 21  GLU A C    5  
ATOM 7870  O O    . GLU A 1 21  ? -8.052  9.567   5.731   1.00 0.00 ? 21  GLU A O    5  
ATOM 7871  C CB   . GLU A 1 21  ? -5.182  9.137   6.944   1.00 0.00 ? 21  GLU A CB   5  
ATOM 7872  C CG   . GLU A 1 21  ? -3.892  9.628   7.582   1.00 0.00 ? 21  GLU A CG   5  
ATOM 7873  C CD   . GLU A 1 21  ? -4.132  10.681  8.646   1.00 0.00 ? 21  GLU A CD   5  
ATOM 7874  O OE1  . GLU A 1 21  ? -5.101  10.532  9.420   1.00 0.00 ? 21  GLU A OE1  5  
ATOM 7875  O OE2  . GLU A 1 21  ? -3.352  11.654  8.705   1.00 0.00 ? 21  GLU A OE2  5  
ATOM 7876  H H    . GLU A 1 21  ? -6.394  11.464  7.250   1.00 0.00 ? 21  GLU A H    5  
ATOM 7877  H HA   . GLU A 1 21  ? -4.940  10.151  5.076   1.00 0.00 ? 21  GLU A HA   5  
ATOM 7878  H HB2  . GLU A 1 21  ? -5.934  9.062   7.716   1.00 0.00 ? 21  GLU A HB2  5  
ATOM 7879  H HB3  . GLU A 1 21  ? -5.004  8.155   6.533   1.00 0.00 ? 21  GLU A HB3  5  
ATOM 7880  H HG2  . GLU A 1 21  ? -3.387  8.787   8.037   1.00 0.00 ? 21  GLU A HG2  5  
ATOM 7881  H HG3  . GLU A 1 21  ? -3.263  10.053  6.810   1.00 0.00 ? 21  GLU A HG3  5  
ATOM 7882  N N    . LYS A 1 22  ? -6.764  8.779   4.062   1.00 0.00 ? 22  LYS A N    5  
ATOM 7883  C CA   . LYS A 1 22  ? -7.874  8.149   3.355   1.00 0.00 ? 22  LYS A CA   5  
ATOM 7884  C C    . LYS A 1 22  ? -7.561  6.690   3.043   1.00 0.00 ? 22  LYS A C    5  
ATOM 7885  O O    . LYS A 1 22  ? -6.701  6.392   2.215   1.00 0.00 ? 22  LYS A O    5  
ATOM 7886  C CB   . LYS A 1 22  ? -8.176  8.907   2.061   1.00 0.00 ? 22  LYS A CB   5  
ATOM 7887  C CG   . LYS A 1 22  ? -9.510  8.532   1.435   1.00 0.00 ? 22  LYS A CG   5  
ATOM 7888  C CD   . LYS A 1 22  ? -9.822  9.401   0.227   1.00 0.00 ? 22  LYS A CD   5  
ATOM 7889  C CE   . LYS A 1 22  ? -9.482  8.689   -1.073  1.00 0.00 ? 22  LYS A CE   5  
ATOM 7890  N NZ   . LYS A 1 22  ? -8.898  9.619   -2.079  1.00 0.00 ? 22  LYS A NZ   5  
ATOM 7891  H H    . LYS A 1 22  ? -5.861  8.714   3.688   1.00 0.00 ? 22  LYS A H    5  
ATOM 7892  H HA   . LYS A 1 22  ? -8.741  8.191   3.997   1.00 0.00 ? 22  LYS A HA   5  
ATOM 7893  H HB2  . LYS A 1 22  ? -8.186  9.966   2.270   1.00 0.00 ? 22  LYS A HB2  5  
ATOM 7894  H HB3  . LYS A 1 22  ? -7.396  8.697   1.344   1.00 0.00 ? 22  LYS A HB3  5  
ATOM 7895  H HG2  . LYS A 1 22  ? -9.474  7.499   1.123   1.00 0.00 ? 22  LYS A HG2  5  
ATOM 7896  H HG3  . LYS A 1 22  ? -10.290 8.661   2.171   1.00 0.00 ? 22  LYS A HG3  5  
ATOM 7897  H HD2  . LYS A 1 22  ? -10.875 9.640   0.229   1.00 0.00 ? 22  LYS A HD2  5  
ATOM 7898  H HD3  . LYS A 1 22  ? -9.243  10.310  0.291   1.00 0.00 ? 22  LYS A HD3  5  
ATOM 7899  H HE2  . LYS A 1 22  ? -8.769  7.905   -0.864  1.00 0.00 ? 22  LYS A HE2  5  
ATOM 7900  H HE3  . LYS A 1 22  ? -10.384 8.255   -1.477  1.00 0.00 ? 22  LYS A HE3  5  
ATOM 7901  H HZ1  . LYS A 1 22  ? -9.311  10.567  -1.971  1.00 0.00 ? 22  LYS A HZ1  5  
ATOM 7902  H HZ2  . LYS A 1 22  ? -9.092  9.274   -3.040  1.00 0.00 ? 22  LYS A HZ2  5  
ATOM 7903  H HZ3  . LYS A 1 22  ? -7.867  9.685   -1.948  1.00 0.00 ? 22  LYS A HZ3  5  
ATOM 7904  N N    . LYS A 1 23  ? -8.265  5.784   3.714   1.00 0.00 ? 23  LYS A N    5  
ATOM 7905  C CA   . LYS A 1 23  ? -8.063  4.354   3.507   1.00 0.00 ? 23  LYS A CA   5  
ATOM 7906  C C    . LYS A 1 23  ? -9.072  3.800   2.506   1.00 0.00 ? 23  LYS A C    5  
ATOM 7907  O O    . LYS A 1 23  ? -10.241 4.186   2.510   1.00 0.00 ? 23  LYS A O    5  
ATOM 7908  C CB   . LYS A 1 23  ? -8.178  3.606   4.838   1.00 0.00 ? 23  LYS A CB   5  
ATOM 7909  C CG   . LYS A 1 23  ? -6.863  3.012   5.317   1.00 0.00 ? 23  LYS A CG   5  
ATOM 7910  C CD   . LYS A 1 23  ? -7.070  2.087   6.506   1.00 0.00 ? 23  LYS A CD   5  
ATOM 7911  C CE   . LYS A 1 23  ? -5.746  1.573   7.051   1.00 0.00 ? 23  LYS A CE   5  
ATOM 7912  N NZ   . LYS A 1 23  ? -5.751  0.092   7.214   1.00 0.00 ? 23  LYS A NZ   5  
ATOM 7913  H H    . LYS A 1 23  ? -8.937  6.082   4.361   1.00 0.00 ? 23  LYS A H    5  
ATOM 7914  H HA   . LYS A 1 23  ? -7.068  4.215   3.112   1.00 0.00 ? 23  LYS A HA   5  
ATOM 7915  H HB2  . LYS A 1 23  ? -8.534  4.290   5.594   1.00 0.00 ? 23  LYS A HB2  5  
ATOM 7916  H HB3  . LYS A 1 23  ? -8.891  2.803   4.728   1.00 0.00 ? 23  LYS A HB3  5  
ATOM 7917  H HG2  . LYS A 1 23  ? -6.418  2.449   4.510   1.00 0.00 ? 23  LYS A HG2  5  
ATOM 7918  H HG3  . LYS A 1 23  ? -6.201  3.814   5.607   1.00 0.00 ? 23  LYS A HG3  5  
ATOM 7919  H HD2  . LYS A 1 23  ? -7.582  2.630   7.287   1.00 0.00 ? 23  LYS A HD2  5  
ATOM 7920  H HD3  . LYS A 1 23  ? -7.672  1.246   6.195   1.00 0.00 ? 23  LYS A HD3  5  
ATOM 7921  H HE2  . LYS A 1 23  ? -4.958  1.848   6.368   1.00 0.00 ? 23  LYS A HE2  5  
ATOM 7922  H HE3  . LYS A 1 23  ? -5.565  2.032   8.013   1.00 0.00 ? 23  LYS A HE3  5  
ATOM 7923  H HZ1  . LYS A 1 23  ? -5.989  -0.159  8.195   1.00 0.00 ? 23  LYS A HZ1  5  
ATOM 7924  H HZ2  . LYS A 1 23  ? -4.813  -0.295  6.988   1.00 0.00 ? 23  LYS A HZ2  5  
ATOM 7925  H HZ3  . LYS A 1 23  ? -6.453  -0.335  6.578   1.00 0.00 ? 23  LYS A HZ3  5  
ATOM 7926  N N    . VAL A 1 24  ? -8.612  2.894   1.650   1.00 0.00 ? 24  VAL A N    5  
ATOM 7927  C CA   . VAL A 1 24  ? -9.473  2.288   0.643   1.00 0.00 ? 24  VAL A CA   5  
ATOM 7928  C C    . VAL A 1 24  ? -9.260  0.779   0.575   1.00 0.00 ? 24  VAL A C    5  
ATOM 7929  O O    . VAL A 1 24  ? -8.275  0.306   0.009   1.00 0.00 ? 24  VAL A O    5  
ATOM 7930  C CB   . VAL A 1 24  ? -9.222  2.892   -0.751  1.00 0.00 ? 24  VAL A CB   5  
ATOM 7931  C CG1  . VAL A 1 24  ? -10.261 2.397   -1.745  1.00 0.00 ? 24  VAL A CG1  5  
ATOM 7932  C CG2  . VAL A 1 24  ? -9.222  4.412   -0.681  1.00 0.00 ? 24  VAL A CG2  5  
ATOM 7933  H H    . VAL A 1 24  ? -7.669  2.628   1.696   1.00 0.00 ? 24  VAL A H    5  
ATOM 7934  H HA   . VAL A 1 24  ? -10.498 2.485   0.919   1.00 0.00 ? 24  VAL A HA   5  
ATOM 7935  H HB   . VAL A 1 24  ? -8.248  2.570   -1.091  1.00 0.00 ? 24  VAL A HB   5  
ATOM 7936  H HG11 . VAL A 1 24  ? -10.499 3.188   -2.441  1.00 0.00 ? 24  VAL A HG11 5  
ATOM 7937  H HG12 . VAL A 1 24  ? -11.154 2.102   -1.215  1.00 0.00 ? 24  VAL A HG12 5  
ATOM 7938  H HG13 . VAL A 1 24  ? -9.867  1.549   -2.285  1.00 0.00 ? 24  VAL A HG13 5  
ATOM 7939  H HG21 . VAL A 1 24  ? -8.209  4.768   -0.566  1.00 0.00 ? 24  VAL A HG21 5  
ATOM 7940  H HG22 . VAL A 1 24  ? -9.813  4.733   0.163   1.00 0.00 ? 24  VAL A HG22 5  
ATOM 7941  H HG23 . VAL A 1 24  ? -9.644  4.815   -1.590  1.00 0.00 ? 24  VAL A HG23 5  
ATOM 7942  N N    . ASN A 1 25  ? -10.191 0.029   1.155   1.00 0.00 ? 25  ASN A N    5  
ATOM 7943  C CA   . ASN A 1 25  ? -10.106 -1.427  1.161   1.00 0.00 ? 25  ASN A CA   5  
ATOM 7944  C C    . ASN A 1 25  ? -10.439 -1.996  -0.215  1.00 0.00 ? 25  ASN A C    5  
ATOM 7945  O O    . ASN A 1 25  ? -11.239 -1.426  -0.956  1.00 0.00 ? 25  ASN A O    5  
ATOM 7946  C CB   . ASN A 1 25  ? -11.053 -2.011  2.210   1.00 0.00 ? 25  ASN A CB   5  
ATOM 7947  C CG   . ASN A 1 25  ? -12.494 -1.597  1.983   1.00 0.00 ? 25  ASN A CG   5  
ATOM 7948  O OD1  . ASN A 1 25  ? -12.803 -0.410  1.884   1.00 0.00 ? 25  ASN A OD1  5  
ATOM 7949  N ND2  . ASN A 1 25  ? -13.385 -2.579  1.900   1.00 0.00 ? 25  ASN A ND2  5  
ATOM 7950  H H    . ASN A 1 25  ? -10.954 0.465   1.590   1.00 0.00 ? 25  ASN A H    5  
ATOM 7951  H HA   . ASN A 1 25  ? -9.092  -1.697  1.413   1.00 0.00 ? 25  ASN A HA   5  
ATOM 7952  H HB2  . ASN A 1 25  ? -10.998 -3.089  2.176   1.00 0.00 ? 25  ASN A HB2  5  
ATOM 7953  H HB3  . ASN A 1 25  ? -10.749 -1.670  3.190   1.00 0.00 ? 25  ASN A HB3  5  
ATOM 7954  H HD21 . ASN A 1 25  ? -13.067 -3.501  1.989   1.00 0.00 ? 25  ASN A HD21 5  
ATOM 7955  H HD22 . ASN A 1 25  ? -14.323 -2.340  1.753   1.00 0.00 ? 25  ASN A HD22 5  
ATOM 7956  N N    . LEU A 1 26  ? -9.820  -3.124  -0.548  1.00 0.00 ? 26  LEU A N    5  
ATOM 7957  C CA   . LEU A 1 26  ? -10.052 -3.772  -1.835  1.00 0.00 ? 26  LEU A CA   5  
ATOM 7958  C C    . LEU A 1 26  ? -9.860  -5.281  -1.727  1.00 0.00 ? 26  LEU A C    5  
ATOM 7959  O O    . LEU A 1 26  ? -8.948  -5.754  -1.048  1.00 0.00 ? 26  LEU A O    5  
ATOM 7960  C CB   . LEU A 1 26  ? -9.107  -3.200  -2.894  1.00 0.00 ? 26  LEU A CB   5  
ATOM 7961  C CG   . LEU A 1 26  ? -9.442  -1.782  -3.363  1.00 0.00 ? 26  LEU A CG   5  
ATOM 7962  C CD1  . LEU A 1 26  ? -8.420  -1.302  -4.382  1.00 0.00 ? 26  LEU A CD1  5  
ATOM 7963  C CD2  . LEU A 1 26  ? -10.845 -1.735  -3.948  1.00 0.00 ? 26  LEU A CD2  5  
ATOM 7964  H H    . LEU A 1 26  ? -9.194  -3.532  0.085   1.00 0.00 ? 26  LEU A H    5  
ATOM 7965  H HA   . LEU A 1 26  ? -11.071 -3.569  -2.128  1.00 0.00 ? 26  LEU A HA   5  
ATOM 7966  H HB2  . LEU A 1 26  ? -8.106  -3.195  -2.487  1.00 0.00 ? 26  LEU A HB2  5  
ATOM 7967  H HB3  . LEU A 1 26  ? -9.126  -3.853  -3.752  1.00 0.00 ? 26  LEU A HB3  5  
ATOM 7968  H HG   . LEU A 1 26  ? -9.409  -1.113  -2.515  1.00 0.00 ? 26  LEU A HG   5  
ATOM 7969  H HD11 . LEU A 1 26  ? -8.231  -0.250  -4.232  1.00 0.00 ? 26  LEU A HD11 5  
ATOM 7970  H HD12 . LEU A 1 26  ? -8.805  -1.460  -5.379  1.00 0.00 ? 26  LEU A HD12 5  
ATOM 7971  H HD13 . LEU A 1 26  ? -7.501  -1.855  -4.258  1.00 0.00 ? 26  LEU A HD13 5  
ATOM 7972  H HD21 . LEU A 1 26  ? -11.546 -1.441  -3.181  1.00 0.00 ? 26  LEU A HD21 5  
ATOM 7973  H HD22 . LEU A 1 26  ? -11.112 -2.712  -4.324  1.00 0.00 ? 26  LEU A HD22 5  
ATOM 7974  H HD23 . LEU A 1 26  ? -10.875 -1.018  -4.756  1.00 0.00 ? 26  LEU A HD23 5  
ATOM 7975  N N    . VAL A 1 27  ? -10.725 -6.032  -2.401  1.00 0.00 ? 27  VAL A N    5  
ATOM 7976  C CA   . VAL A 1 27  ? -10.651 -7.488  -2.382  1.00 0.00 ? 27  VAL A CA   5  
ATOM 7977  C C    . VAL A 1 27  ? -10.402 -8.044  -3.779  1.00 0.00 ? 27  VAL A C    5  
ATOM 7978  O O    . VAL A 1 27  ? -11.291 -8.033  -4.630  1.00 0.00 ? 27  VAL A O    5  
ATOM 7979  C CB   . VAL A 1 27  ? -11.943 -8.108  -1.819  1.00 0.00 ? 27  VAL A CB   5  
ATOM 7980  C CG1  . VAL A 1 27  ? -11.775 -9.606  -1.618  1.00 0.00 ? 27  VAL A CG1  5  
ATOM 7981  C CG2  . VAL A 1 27  ? -12.338 -7.430  -0.515  1.00 0.00 ? 27  VAL A CG2  5  
ATOM 7982  H H    . VAL A 1 27  ? -11.431 -5.596  -2.924  1.00 0.00 ? 27  VAL A H    5  
ATOM 7983  H HA   . VAL A 1 27  ? -9.831  -7.772  -1.739  1.00 0.00 ? 27  VAL A HA   5  
ATOM 7984  H HB   . VAL A 1 27  ? -12.736 -7.951  -2.534  1.00 0.00 ? 27  VAL A HB   5  
ATOM 7985  H HG11 . VAL A 1 27  ? -12.334 -9.919  -0.749  1.00 0.00 ? 27  VAL A HG11 5  
ATOM 7986  H HG12 . VAL A 1 27  ? -10.729 -9.834  -1.475  1.00 0.00 ? 27  VAL A HG12 5  
ATOM 7987  H HG13 . VAL A 1 27  ? -12.141 -10.129 -2.489  1.00 0.00 ? 27  VAL A HG13 5  
ATOM 7988  H HG21 . VAL A 1 27  ? -13.034 -6.631  -0.721  1.00 0.00 ? 27  VAL A HG21 5  
ATOM 7989  H HG22 . VAL A 1 27  ? -11.456 -7.026  -0.039  1.00 0.00 ? 27  VAL A HG22 5  
ATOM 7990  H HG23 . VAL A 1 27  ? -12.801 -8.152  0.141   1.00 0.00 ? 27  VAL A HG23 5  
ATOM 7991  N N    . LEU A 1 28  ? -9.187  -8.531  -4.009  1.00 0.00 ? 28  LEU A N    5  
ATOM 7992  C CA   . LEU A 1 28  ? -8.822  -9.093  -5.304  1.00 0.00 ? 28  LEU A CA   5  
ATOM 7993  C C    . LEU A 1 28  ? -9.356  -10.513 -5.452  1.00 0.00 ? 28  LEU A C    5  
ATOM 7994  O O    . LEU A 1 28  ? -8.960  -11.415 -4.715  1.00 0.00 ? 28  LEU A O    5  
ATOM 7995  C CB   . LEU A 1 28  ? -7.301  -9.086  -5.476  1.00 0.00 ? 28  LEU A CB   5  
ATOM 7996  C CG   . LEU A 1 28  ? -6.651  -7.702  -5.451  1.00 0.00 ? 28  LEU A CG   5  
ATOM 7997  C CD1  . LEU A 1 28  ? -5.136  -7.825  -5.392  1.00 0.00 ? 28  LEU A CD1  5  
ATOM 7998  C CD2  . LEU A 1 28  ? -7.075  -6.893  -6.667  1.00 0.00 ? 28  LEU A CD2  5  
ATOM 7999  H H    . LEU A 1 28  ? -8.521  -8.512  -3.291  1.00 0.00 ? 28  LEU A H    5  
ATOM 8000  H HA   . LEU A 1 28  ? -9.263  -8.473  -6.070  1.00 0.00 ? 28  LEU A HA   5  
ATOM 8001  H HB2  . LEU A 1 28  ? -6.869  -9.679  -4.682  1.00 0.00 ? 28  LEU A HB2  5  
ATOM 8002  H HB3  . LEU A 1 28  ? -7.064  -9.554  -6.420  1.00 0.00 ? 28  LEU A HB3  5  
ATOM 8003  H HG   . LEU A 1 28  ? -6.977  -7.174  -4.567  1.00 0.00 ? 28  LEU A HG   5  
ATOM 8004  H HD11 . LEU A 1 28  ? -4.687  -6.948  -5.835  1.00 0.00 ? 28  LEU A HD11 5  
ATOM 8005  H HD12 . LEU A 1 28  ? -4.824  -8.703  -5.937  1.00 0.00 ? 28  LEU A HD12 5  
ATOM 8006  H HD13 . LEU A 1 28  ? -4.822  -7.909  -4.363  1.00 0.00 ? 28  LEU A HD13 5  
ATOM 8007  H HD21 . LEU A 1 28  ? -6.303  -6.945  -7.422  1.00 0.00 ? 28  LEU A HD21 5  
ATOM 8008  H HD22 . LEU A 1 28  ? -7.229  -5.863  -6.379  1.00 0.00 ? 28  LEU A HD22 5  
ATOM 8009  H HD23 . LEU A 1 28  ? -7.995  -7.296  -7.066  1.00 0.00 ? 28  LEU A HD23 5  
ATOM 8010  N N    . GLY A 1 29  ? -10.259 -10.704 -6.408  1.00 0.00 ? 29  GLY A N    5  
ATOM 8011  C CA   . GLY A 1 29  ? -10.835 -12.016 -6.634  1.00 0.00 ? 29  GLY A CA   5  
ATOM 8012  C C    . GLY A 1 29  ? -9.842  -12.987 -7.245  1.00 0.00 ? 29  GLY A C    5  
ATOM 8013  O O    . GLY A 1 29  ? -9.947  -13.332 -8.422  1.00 0.00 ? 29  GLY A O    5  
ATOM 8014  H H    . GLY A 1 29  ? -10.538 -9.946  -6.964  1.00 0.00 ? 29  GLY A H    5  
ATOM 8015  H HA2  . GLY A 1 29  ? -11.177 -12.415 -5.688  1.00 0.00 ? 29  GLY A HA2  5  
ATOM 8016  H HA3  . GLY A 1 29  ? -11.681 -11.916 -7.301  1.00 0.00 ? 29  GLY A HA3  5  
ATOM 8017  N N    . ASP A 1 30  ? -8.878  -13.427 -6.443  1.00 0.00 ? 30  ASP A N    5  
ATOM 8018  C CA   . ASP A 1 30  ? -7.861  -14.364 -6.907  1.00 0.00 ? 30  ASP A CA   5  
ATOM 8019  C C    . ASP A 1 30  ? -7.006  -13.743 -8.009  1.00 0.00 ? 30  ASP A C    5  
ATOM 8020  O O    . ASP A 1 30  ? -5.889  -13.291 -7.759  1.00 0.00 ? 30  ASP A O    5  
ATOM 8021  C CB   . ASP A 1 30  ? -8.514  -15.653 -7.414  1.00 0.00 ? 30  ASP A CB   5  
ATOM 8022  C CG   . ASP A 1 30  ? -8.646  -16.701 -6.326  1.00 0.00 ? 30  ASP A CG   5  
ATOM 8023  O OD1  . ASP A 1 30  ? -7.719  -16.815 -5.496  1.00 0.00 ? 30  ASP A OD1  5  
ATOM 8024  O OD2  . ASP A 1 30  ? -9.676  -17.408 -6.305  1.00 0.00 ? 30  ASP A OD2  5  
ATOM 8025  H H    . ASP A 1 30  ? -8.850  -13.114 -5.514  1.00 0.00 ? 30  ASP A H    5  
ATOM 8026  H HA   . ASP A 1 30  ? -7.224  -14.602 -6.068  1.00 0.00 ? 30  ASP A HA   5  
ATOM 8027  H HB2  . ASP A 1 30  ? -9.501  -15.426 -7.789  1.00 0.00 ? 30  ASP A HB2  5  
ATOM 8028  H HB3  . ASP A 1 30  ? -7.915  -16.063 -8.214  1.00 0.00 ? 30  ASP A HB3  5  
ATOM 8029  N N    . GLY A 1 31  ? -7.537  -13.724 -9.227  1.00 0.00 ? 31  GLY A N    5  
ATOM 8030  C CA   . GLY A 1 31  ? -6.808  -13.157 -10.346 1.00 0.00 ? 31  GLY A CA   5  
ATOM 8031  C C    . GLY A 1 31  ? -7.220  -11.728 -10.642 1.00 0.00 ? 31  GLY A C    5  
ATOM 8032  O O    . GLY A 1 31  ? -7.935  -11.469 -11.610 1.00 0.00 ? 31  GLY A O    5  
ATOM 8033  H H    . GLY A 1 31  ? -8.431  -14.100 -9.368  1.00 0.00 ? 31  GLY A H    5  
ATOM 8034  H HA2  . GLY A 1 31  ? -5.749  -13.175 -10.118 1.00 0.00 ? 31  GLY A HA2  5  
ATOM 8035  H HA3  . GLY A 1 31  ? -6.990  -13.761 -11.225 1.00 0.00 ? 31  GLY A HA3  5  
ATOM 8036  N N    . ARG A 1 32  ? -6.766  -10.798 -9.807  1.00 0.00 ? 32  ARG A N    5  
ATOM 8037  C CA   . ARG A 1 32  ? -7.092  -9.388  -9.983  1.00 0.00 ? 32  ARG A CA   5  
ATOM 8038  C C    . ARG A 1 32  ? -5.910  -8.504  -9.599  1.00 0.00 ? 32  ARG A C    5  
ATOM 8039  O O    . ARG A 1 32  ? -4.957  -8.965  -8.971  1.00 0.00 ? 32  ARG A O    5  
ATOM 8040  C CB   . ARG A 1 32  ? -8.316  -9.016  -9.143  1.00 0.00 ? 32  ARG A CB   5  
ATOM 8041  C CG   . ARG A 1 32  ? -9.557  -9.826  -9.486  1.00 0.00 ? 32  ARG A CG   5  
ATOM 8042  C CD   . ARG A 1 32  ? -10.810 -8.965  -9.467  1.00 0.00 ? 32  ARG A CD   5  
ATOM 8043  N NE   . ARG A 1 32  ? -11.600 -9.122  -10.687 1.00 0.00 ? 32  ARG A NE   5  
ATOM 8044  C CZ   . ARG A 1 32  ? -11.208 -8.690  -11.883 1.00 0.00 ? 32  ARG A CZ   5  
ATOM 8045  N NH1  . ARG A 1 32  ? -10.040 -8.078  -12.026 1.00 0.00 ? 32  ARG A NH1  5  
ATOM 8046  N NH2  . ARG A 1 32  ? -11.988 -8.871  -12.940 1.00 0.00 ? 32  ARG A NH2  5  
ATOM 8047  H H    . ARG A 1 32  ? -6.199  -11.067 -9.054  1.00 0.00 ? 32  ARG A H    5  
ATOM 8048  H HA   . ARG A 1 32  ? -7.321  -9.229  -11.027 1.00 0.00 ? 32  ARG A HA   5  
ATOM 8049  H HB2  . ARG A 1 32  ? -8.083  -9.177  -8.101  1.00 0.00 ? 32  ARG A HB2  5  
ATOM 8050  H HB3  . ARG A 1 32  ? -8.538  -7.971  -9.297  1.00 0.00 ? 32  ARG A HB3  5  
ATOM 8051  H HG2  . ARG A 1 32  ? -9.438  -10.249 -10.472 1.00 0.00 ? 32  ARG A HG2  5  
ATOM 8052  H HG3  . ARG A 1 32  ? -9.666  -10.620 -8.762  1.00 0.00 ? 32  ARG A HG3  5  
ATOM 8053  H HD2  . ARG A 1 32  ? -11.416 -9.251  -8.620  1.00 0.00 ? 32  ARG A HD2  5  
ATOM 8054  H HD3  . ARG A 1 32  ? -10.521 -7.929  -9.368  1.00 0.00 ? 32  ARG A HD3  5  
ATOM 8055  H HE   . ARG A 1 32  ? -12.467 -9.572  -10.609 1.00 0.00 ? 32  ARG A HE   5  
ATOM 8056  H HH11 . ARG A 1 32  ? -9.447  -7.937  -11.233 1.00 0.00 ? 32  ARG A HH11 5  
ATOM 8057  H HH12 . ARG A 1 32  ? -9.751  -7.755  -12.928 1.00 0.00 ? 32  ARG A HH12 5  
ATOM 8058  H HH21 . ARG A 1 32  ? -12.869 -9.333  -12.839 1.00 0.00 ? 32  ARG A HH21 5  
ATOM 8059  H HH22 . ARG A 1 32  ? -11.694 -8.546  -13.839 1.00 0.00 ? 32  ARG A HH22 5  
ATOM 8060  N N    . SER A 1 33  ? -5.978  -7.233  -9.982  1.00 0.00 ? 33  SER A N    5  
ATOM 8061  C CA   . SER A 1 33  ? -4.912  -6.286  -9.678  1.00 0.00 ? 33  SER A CA   5  
ATOM 8062  C C    . SER A 1 33  ? -5.480  -4.897  -9.404  1.00 0.00 ? 33  SER A C    5  
ATOM 8063  O O    . SER A 1 33  ? -6.684  -4.673  -9.521  1.00 0.00 ? 33  SER A O    5  
ATOM 8064  C CB   . SER A 1 33  ? -3.913  -6.222  -10.835 1.00 0.00 ? 33  SER A CB   5  
ATOM 8065  O OG   . SER A 1 33  ? -3.959  -7.405  -11.615 1.00 0.00 ? 33  SER A OG   5  
ATOM 8066  H H    . SER A 1 33  ? -6.763  -6.926  -10.481 1.00 0.00 ? 33  SER A H    5  
ATOM 8067  H HA   . SER A 1 33  ? -4.402  -6.634  -8.792  1.00 0.00 ? 33  SER A HA   5  
ATOM 8068  H HB2  . SER A 1 33  ? -4.150  -5.380  -11.467 1.00 0.00 ? 33  SER A HB2  5  
ATOM 8069  H HB3  . SER A 1 33  ? -2.914  -6.105  -10.440 1.00 0.00 ? 33  SER A HB3  5  
ATOM 8070  H HG   . SER A 1 33  ? -3.732  -7.198  -12.524 1.00 0.00 ? 33  SER A HG   5  
ATOM 8071  N N    . LEU A 1 34  ? -4.603  -3.966  -9.040  1.00 0.00 ? 34  LEU A N    5  
ATOM 8072  C CA   . LEU A 1 34  ? -5.016  -2.598  -8.750  1.00 0.00 ? 34  LEU A CA   5  
ATOM 8073  C C    . LEU A 1 34  ? -5.023  -1.751  -10.017 1.00 0.00 ? 34  LEU A C    5  
ATOM 8074  O O    . LEU A 1 34  ? -5.973  -1.013  -10.278 1.00 0.00 ? 34  LEU A O    5  
ATOM 8075  C CB   . LEU A 1 34  ? -4.085  -1.971  -7.709  1.00 0.00 ? 34  LEU A CB   5  
ATOM 8076  C CG   . LEU A 1 34  ? -4.041  -2.694  -6.362  1.00 0.00 ? 34  LEU A CG   5  
ATOM 8077  C CD1  . LEU A 1 34  ? -2.789  -2.307  -5.590  1.00 0.00 ? 34  LEU A CD1  5  
ATOM 8078  C CD2  . LEU A 1 34  ? -5.288  -2.381  -5.550  1.00 0.00 ? 34  LEU A CD2  5  
ATOM 8079  H H    . LEU A 1 34  ? -3.655  -4.205  -8.965  1.00 0.00 ? 34  LEU A H    5  
ATOM 8080  H HA   . LEU A 1 34  ? -6.018  -2.633  -8.349  1.00 0.00 ? 34  LEU A HA   5  
ATOM 8081  H HB2  . LEU A 1 34  ? -3.083  -1.954  -8.118  1.00 0.00 ? 34  LEU A HB2  5  
ATOM 8082  H HB3  . LEU A 1 34  ? -4.406  -0.953  -7.536  1.00 0.00 ? 34  LEU A HB3  5  
ATOM 8083  H HG   . LEU A 1 34  ? -4.010  -3.760  -6.534  1.00 0.00 ? 34  LEU A HG   5  
ATOM 8084  H HD11 . LEU A 1 34  ? -2.003  -2.047  -6.284  1.00 0.00 ? 34  LEU A HD11 5  
ATOM 8085  H HD12 . LEU A 1 34  ? -2.471  -3.139  -4.981  1.00 0.00 ? 34  LEU A HD12 5  
ATOM 8086  H HD13 . LEU A 1 34  ? -3.004  -1.458  -4.958  1.00 0.00 ? 34  LEU A HD13 5  
ATOM 8087  H HD21 . LEU A 1 34  ? -6.164  -2.524  -6.165  1.00 0.00 ? 34  LEU A HD21 5  
ATOM 8088  H HD22 . LEU A 1 34  ? -5.250  -1.357  -5.211  1.00 0.00 ? 34  LEU A HD22 5  
ATOM 8089  H HD23 . LEU A 1 34  ? -5.337  -3.041  -4.696  1.00 0.00 ? 34  LEU A HD23 5  
ATOM 8090  N N    . GLY A 1 35  ? -3.956  -1.862  -10.803 1.00 0.00 ? 35  GLY A N    5  
ATOM 8091  C CA   . GLY A 1 35  ? -3.859  -1.101  -12.034 1.00 0.00 ? 35  GLY A CA   5  
ATOM 8092  C C    . GLY A 1 35  ? -3.388  0.320   -11.798 1.00 0.00 ? 35  GLY A C    5  
ATOM 8093  O O    . GLY A 1 35  ? -3.946  1.266   -12.357 1.00 0.00 ? 35  GLY A O    5  
ATOM 8094  H H    . GLY A 1 35  ? -3.230  -2.467  -10.543 1.00 0.00 ? 35  GLY A H    5  
ATOM 8095  H HA2  . GLY A 1 35  ? -3.160  -1.596  -12.696 1.00 0.00 ? 35  GLY A HA2  5  
ATOM 8096  H HA3  . GLY A 1 35  ? -4.833  -1.073  -12.505 1.00 0.00 ? 35  GLY A HA3  5  
ATOM 8097  N N    . LEU A 1 36  ? -2.361  0.472   -10.970 1.00 0.00 ? 36  LEU A N    5  
ATOM 8098  C CA   . LEU A 1 36  ? -1.816  1.789   -10.660 1.00 0.00 ? 36  LEU A CA   5  
ATOM 8099  C C    . LEU A 1 36  ? -0.349  1.882   -11.069 1.00 0.00 ? 36  LEU A C    5  
ATOM 8100  O O    . LEU A 1 36  ? 0.443   0.986   -10.782 1.00 0.00 ? 36  LEU A O    5  
ATOM 8101  C CB   . LEU A 1 36  ? -1.960  2.085   -9.166  1.00 0.00 ? 36  LEU A CB   5  
ATOM 8102  C CG   . LEU A 1 36  ? -3.381  1.955   -8.615  1.00 0.00 ? 36  LEU A CG   5  
ATOM 8103  C CD1  . LEU A 1 36  ? -3.354  1.810   -7.101  1.00 0.00 ? 36  LEU A CD1  5  
ATOM 8104  C CD2  . LEU A 1 36  ? -4.221  3.155   -9.023  1.00 0.00 ? 36  LEU A CD2  5  
ATOM 8105  H H    . LEU A 1 36  ? -1.960  -0.320  -10.556 1.00 0.00 ? 36  LEU A H    5  
ATOM 8106  H HA   . LEU A 1 36  ? -2.380  2.521   -11.218 1.00 0.00 ? 36  LEU A HA   5  
ATOM 8107  H HB2  . LEU A 1 36  ? -1.321  1.403   -8.623  1.00 0.00 ? 36  LEU A HB2  5  
ATOM 8108  H HB3  . LEU A 1 36  ? -1.619  3.092   -8.985  1.00 0.00 ? 36  LEU A HB3  5  
ATOM 8109  H HG   . LEU A 1 36  ? -3.840  1.068   -9.027  1.00 0.00 ? 36  LEU A HG   5  
ATOM 8110  H HD11 . LEU A 1 36  ? -4.365  1.816   -6.721  1.00 0.00 ? 36  LEU A HD11 5  
ATOM 8111  H HD12 . LEU A 1 36  ? -2.803  2.631   -6.670  1.00 0.00 ? 36  LEU A HD12 5  
ATOM 8112  H HD13 . LEU A 1 36  ? -2.877  0.877   -6.837  1.00 0.00 ? 36  LEU A HD13 5  
ATOM 8113  H HD21 . LEU A 1 36  ? -4.893  3.416   -8.219  1.00 0.00 ? 36  LEU A HD21 5  
ATOM 8114  H HD22 . LEU A 1 36  ? -4.796  2.910   -9.905  1.00 0.00 ? 36  LEU A HD22 5  
ATOM 8115  H HD23 . LEU A 1 36  ? -3.574  3.992   -9.237  1.00 0.00 ? 36  LEU A HD23 5  
ATOM 8116  N N    . THR A 1 37  ? 0.005   2.974   -11.739 1.00 0.00 ? 37  THR A N    5  
ATOM 8117  C CA   . THR A 1 37  ? 1.376   3.186   -12.186 1.00 0.00 ? 37  THR A CA   5  
ATOM 8118  C C    . THR A 1 37  ? 2.164   3.991   -11.156 1.00 0.00 ? 37  THR A C    5  
ATOM 8119  O O    . THR A 1 37  ? 2.468   5.165   -11.370 1.00 0.00 ? 37  THR A O    5  
ATOM 8120  C CB   . THR A 1 37  ? 1.390   3.906   -13.535 1.00 0.00 ? 37  THR A CB   5  
ATOM 8121  O OG1  . THR A 1 37  ? 0.479   3.301   -14.436 1.00 0.00 ? 37  THR A OG1  5  
ATOM 8122  C CG2  . THR A 1 37  ? 2.752   3.914   -14.196 1.00 0.00 ? 37  THR A CG2  5  
ATOM 8123  H H    . THR A 1 37  ? -0.672  3.654   -11.937 1.00 0.00 ? 37  THR A H    5  
ATOM 8124  H HA   . THR A 1 37  ? 1.841   2.217   -12.300 1.00 0.00 ? 37  THR A HA   5  
ATOM 8125  H HB   . THR A 1 37  ? 1.089   4.933   -13.386 1.00 0.00 ? 37  THR A HB   5  
ATOM 8126  H HG1  . THR A 1 37  ? 0.794   2.425   -14.669 1.00 0.00 ? 37  THR A HG1  5  
ATOM 8127  H HG21 . THR A 1 37  ? 3.288   3.016   -13.927 1.00 0.00 ? 37  THR A HG21 5  
ATOM 8128  H HG22 . THR A 1 37  ? 3.308   4.778   -13.864 1.00 0.00 ? 37  THR A HG22 5  
ATOM 8129  H HG23 . THR A 1 37  ? 2.631   3.953   -15.268 1.00 0.00 ? 37  THR A HG23 5  
ATOM 8130  N N    . ILE A 1 38  ? 2.491   3.351   -10.038 1.00 0.00 ? 38  ILE A N    5  
ATOM 8131  C CA   . ILE A 1 38  ? 3.241   4.007   -8.975  1.00 0.00 ? 38  ILE A CA   5  
ATOM 8132  C C    . ILE A 1 38  ? 4.684   4.265   -9.397  1.00 0.00 ? 38  ILE A C    5  
ATOM 8133  O O    . ILE A 1 38  ? 5.249   3.521   -10.198 1.00 0.00 ? 38  ILE A O    5  
ATOM 8134  C CB   . ILE A 1 38  ? 3.239   3.167   -7.684  1.00 0.00 ? 38  ILE A CB   5  
ATOM 8135  C CG1  . ILE A 1 38  ? 3.668   1.729   -7.984  1.00 0.00 ? 38  ILE A CG1  5  
ATOM 8136  C CG2  . ILE A 1 38  ? 1.863   3.191   -7.037  1.00 0.00 ? 38  ILE A CG2  5  
ATOM 8137  C CD1  . ILE A 1 38  ? 4.567   1.131   -6.924  1.00 0.00 ? 38  ILE A CD1  5  
ATOM 8138  H H    . ILE A 1 38  ? 2.220   2.417   -9.925  1.00 0.00 ? 38  ILE A H    5  
ATOM 8139  H HA   . ILE A 1 38  ? 2.764   4.954   -8.763  1.00 0.00 ? 38  ILE A HA   5  
ATOM 8140  H HB   . ILE A 1 38  ? 3.942   3.607   -6.993  1.00 0.00 ? 38  ILE A HB   5  
ATOM 8141  H HG12 . ILE A 1 38  ? 2.789   1.108   -8.062  1.00 0.00 ? 38  ILE A HG12 5  
ATOM 8142  H HG13 . ILE A 1 38  ? 4.202   1.708   -8.923  1.00 0.00 ? 38  ILE A HG13 5  
ATOM 8143  H HG21 . ILE A 1 38  ? 1.367   4.120   -7.280  1.00 0.00 ? 38  ILE A HG21 5  
ATOM 8144  H HG22 . ILE A 1 38  ? 1.968   3.110   -5.965  1.00 0.00 ? 38  ILE A HG22 5  
ATOM 8145  H HG23 . ILE A 1 38  ? 1.277   2.363   -7.405  1.00 0.00 ? 38  ILE A HG23 5  
ATOM 8146  H HD11 . ILE A 1 38  ? 4.364   1.604   -5.973  1.00 0.00 ? 38  ILE A HD11 5  
ATOM 8147  H HD12 . ILE A 1 38  ? 5.599   1.294   -7.194  1.00 0.00 ? 38  ILE A HD12 5  
ATOM 8148  H HD13 . ILE A 1 38  ? 4.378   0.071   -6.848  1.00 0.00 ? 38  ILE A HD13 5  
ATOM 8149  N N    . ARG A 1 39  ? 5.274   5.323   -8.852  1.00 0.00 ? 39  ARG A N    5  
ATOM 8150  C CA   . ARG A 1 39  ? 6.652   5.679   -9.170  1.00 0.00 ? 39  ARG A CA   5  
ATOM 8151  C C    . ARG A 1 39  ? 7.390   6.166   -7.928  1.00 0.00 ? 39  ARG A C    5  
ATOM 8152  O O    . ARG A 1 39  ? 6.799   6.800   -7.052  1.00 0.00 ? 39  ARG A O    5  
ATOM 8153  C CB   . ARG A 1 39  ? 6.684   6.759   -10.254 1.00 0.00 ? 39  ARG A CB   5  
ATOM 8154  C CG   . ARG A 1 39  ? 6.068   8.079   -9.816  1.00 0.00 ? 39  ARG A CG   5  
ATOM 8155  C CD   . ARG A 1 39  ? 7.095   9.201   -9.806  1.00 0.00 ? 39  ARG A CD   5  
ATOM 8156  N NE   . ARG A 1 39  ? 7.405   9.671   -11.155 1.00 0.00 ? 39  ARG A NE   5  
ATOM 8157  C CZ   . ARG A 1 39  ? 6.629   10.499  -11.848 1.00 0.00 ? 39  ARG A CZ   5  
ATOM 8158  N NH1  . ARG A 1 39  ? 5.495   10.951  -11.326 1.00 0.00 ? 39  ARG A NH1  5  
ATOM 8159  N NH2  . ARG A 1 39  ? 6.986   10.878  -13.068 1.00 0.00 ? 39  ARG A NH2  5  
ATOM 8160  H H    . ARG A 1 39  ? 4.772   5.877   -8.219  1.00 0.00 ? 39  ARG A H    5  
ATOM 8161  H HA   . ARG A 1 39  ? 7.145   4.793   -9.544  1.00 0.00 ? 39  ARG A HA   5  
ATOM 8162  H HB2  . ARG A 1 39  ? 7.711   6.939   -10.536 1.00 0.00 ? 39  ARG A HB2  5  
ATOM 8163  H HB3  . ARG A 1 39  ? 6.141   6.402   -11.117 1.00 0.00 ? 39  ARG A HB3  5  
ATOM 8164  H HG2  . ARG A 1 39  ? 5.274   8.339   -10.500 1.00 0.00 ? 39  ARG A HG2  5  
ATOM 8165  H HG3  . ARG A 1 39  ? 5.664   7.964   -8.821  1.00 0.00 ? 39  ARG A HG3  5  
ATOM 8166  H HD2  . ARG A 1 39  ? 6.702   10.025  -9.230  1.00 0.00 ? 39  ARG A HD2  5  
ATOM 8167  H HD3  . ARG A 1 39  ? 8.000   8.837   -9.344  1.00 0.00 ? 39  ARG A HD3  5  
ATOM 8168  H HE   . ARG A 1 39  ? 8.236   9.351   -11.565 1.00 0.00 ? 39  ARG A HE   5  
ATOM 8169  H HH11 . ARG A 1 39  ? 5.220   10.670  -10.407 1.00 0.00 ? 39  ARG A HH11 5  
ATOM 8170  H HH12 . ARG A 1 39  ? 4.916   11.575  -11.851 1.00 0.00 ? 39  ARG A HH12 5  
ATOM 8171  H HH21 . ARG A 1 39  ? 7.839   10.540  -13.466 1.00 0.00 ? 39  ARG A HH21 5  
ATOM 8172  H HH22 . ARG A 1 39  ? 6.402   11.500  -13.589 1.00 0.00 ? 39  ARG A HH22 5  
ATOM 8173  N N    . GLY A 1 40  ? 8.681   5.865   -7.856  1.00 0.00 ? 40  GLY A N    5  
ATOM 8174  C CA   . GLY A 1 40  ? 9.477   6.279   -6.716  1.00 0.00 ? 40  GLY A CA   5  
ATOM 8175  C C    . GLY A 1 40  ? 9.440   5.269   -5.587  1.00 0.00 ? 40  GLY A C    5  
ATOM 8176  O O    . GLY A 1 40  ? 8.494   4.490   -5.472  1.00 0.00 ? 40  GLY A O    5  
ATOM 8177  H H    . GLY A 1 40  ? 9.097   5.357   -8.584  1.00 0.00 ? 40  GLY A H    5  
ATOM 8178  H HA2  . GLY A 1 40  ? 10.501  6.411   -7.034  1.00 0.00 ? 40  GLY A HA2  5  
ATOM 8179  H HA3  . GLY A 1 40  ? 9.100   7.223   -6.352  1.00 0.00 ? 40  GLY A HA3  5  
ATOM 8180  N N    . GLY A 1 41  ? 10.473  5.281   -4.751  1.00 0.00 ? 41  GLY A N    5  
ATOM 8181  C CA   . GLY A 1 41  ? 10.536  4.355   -3.635  1.00 0.00 ? 41  GLY A CA   5  
ATOM 8182  C C    . GLY A 1 41  ? 11.851  4.438   -2.886  1.00 0.00 ? 41  GLY A C    5  
ATOM 8183  O O    . GLY A 1 41  ? 12.581  5.423   -3.007  1.00 0.00 ? 41  GLY A O    5  
ATOM 8184  H H    . GLY A 1 41  ? 11.198  5.925   -4.891  1.00 0.00 ? 41  GLY A H    5  
ATOM 8185  H HA2  . GLY A 1 41  ? 9.729   4.579   -2.949  1.00 0.00 ? 41  GLY A HA2  5  
ATOM 8186  H HA3  . GLY A 1 41  ? 10.411  3.348   -4.011  1.00 0.00 ? 41  GLY A HA3  5  
ATOM 8187  N N    . ALA A 1 42  ? 12.155  3.403   -2.111  1.00 0.00 ? 42  ALA A N    5  
ATOM 8188  C CA   . ALA A 1 42  ? 13.391  3.363   -1.340  1.00 0.00 ? 42  ALA A CA   5  
ATOM 8189  C C    . ALA A 1 42  ? 14.610  3.378   -2.255  1.00 0.00 ? 42  ALA A C    5  
ATOM 8190  O O    . ALA A 1 42  ? 15.673  3.875   -1.882  1.00 0.00 ? 42  ALA A O    5  
ATOM 8191  C CB   . ALA A 1 42  ? 13.415  2.134   -0.445  1.00 0.00 ? 42  ALA A CB   5  
ATOM 8192  H H    . ALA A 1 42  ? 11.533  2.648   -2.057  1.00 0.00 ? 42  ALA A H    5  
ATOM 8193  H HA   . ALA A 1 42  ? 13.417  4.239   -0.708  1.00 0.00 ? 42  ALA A HA   5  
ATOM 8194  H HB1  . ALA A 1 42  ? 13.855  2.389   0.508   1.00 0.00 ? 42  ALA A HB1  5  
ATOM 8195  H HB2  . ALA A 1 42  ? 14.000  1.357   -0.916  1.00 0.00 ? 42  ALA A HB2  5  
ATOM 8196  H HB3  . ALA A 1 42  ? 12.405  1.780   -0.292  1.00 0.00 ? 42  ALA A HB3  5  
ATOM 8197  N N    . GLU A 1 43  ? 14.452  2.828   -3.455  1.00 0.00 ? 43  GLU A N    5  
ATOM 8198  C CA   . GLU A 1 43  ? 15.541  2.778   -4.423  1.00 0.00 ? 43  GLU A CA   5  
ATOM 8199  C C    . GLU A 1 43  ? 15.963  4.184   -4.840  1.00 0.00 ? 43  GLU A C    5  
ATOM 8200  O O    . GLU A 1 43  ? 17.148  4.514   -4.836  1.00 0.00 ? 43  GLU A O    5  
ATOM 8201  C CB   . GLU A 1 43  ? 15.122  1.970   -5.653  1.00 0.00 ? 43  GLU A CB   5  
ATOM 8202  C CG   . GLU A 1 43  ? 16.199  1.022   -6.153  1.00 0.00 ? 43  GLU A CG   5  
ATOM 8203  C CD   . GLU A 1 43  ? 16.177  0.855   -7.660  1.00 0.00 ? 43  GLU A CD   5  
ATOM 8204  O OE1  . GLU A 1 43  ? 15.076  0.682   -8.222  1.00 0.00 ? 43  GLU A OE1  5  
ATOM 8205  O OE2  . GLU A 1 43  ? 17.262  0.898   -8.277  1.00 0.00 ? 43  GLU A OE2  5  
ATOM 8206  H H    . GLU A 1 43  ? 13.581  2.447   -3.695  1.00 0.00 ? 43  GLU A H    5  
ATOM 8207  H HA   . GLU A 1 43  ? 16.381  2.290   -3.952  1.00 0.00 ? 43  GLU A HA   5  
ATOM 8208  H HB2  . GLU A 1 43  ? 14.247  1.389   -5.407  1.00 0.00 ? 43  GLU A HB2  5  
ATOM 8209  H HB3  . GLU A 1 43  ? 14.876  2.654   -6.453  1.00 0.00 ? 43  GLU A HB3  5  
ATOM 8210  H HG2  . GLU A 1 43  ? 17.165  1.409   -5.864  1.00 0.00 ? 43  GLU A HG2  5  
ATOM 8211  H HG3  . GLU A 1 43  ? 16.049  0.055   -5.696  1.00 0.00 ? 43  GLU A HG3  5  
ATOM 8212  N N    . TYR A 1 44  ? 14.984  5.008   -5.200  1.00 0.00 ? 44  TYR A N    5  
ATOM 8213  C CA   . TYR A 1 44  ? 15.255  6.379   -5.620  1.00 0.00 ? 44  TYR A CA   5  
ATOM 8214  C C    . TYR A 1 44  ? 15.068  7.359   -4.464  1.00 0.00 ? 44  TYR A C    5  
ATOM 8215  O O    . TYR A 1 44  ? 14.923  8.562   -4.678  1.00 0.00 ? 44  TYR A O    5  
ATOM 8216  C CB   . TYR A 1 44  ? 14.340  6.767   -6.783  1.00 0.00 ? 44  TYR A CB   5  
ATOM 8217  C CG   . TYR A 1 44  ? 14.447  5.841   -7.973  1.00 0.00 ? 44  TYR A CG   5  
ATOM 8218  C CD1  . TYR A 1 44  ? 13.874  4.575   -7.946  1.00 0.00 ? 44  TYR A CD1  5  
ATOM 8219  C CD2  . TYR A 1 44  ? 15.119  6.233   -9.125  1.00 0.00 ? 44  TYR A CD2  5  
ATOM 8220  C CE1  . TYR A 1 44  ? 13.969  3.726   -9.032  1.00 0.00 ? 44  TYR A CE1  5  
ATOM 8221  C CE2  . TYR A 1 44  ? 15.217  5.389   -10.214 1.00 0.00 ? 44  TYR A CE2  5  
ATOM 8222  C CZ   . TYR A 1 44  ? 14.642  4.137   -10.163 1.00 0.00 ? 44  TYR A CZ   5  
ATOM 8223  O OH   . TYR A 1 44  ? 14.738  3.294   -11.247 1.00 0.00 ? 44  TYR A OH   5  
ATOM 8224  H H    . TYR A 1 44  ? 14.058  4.687   -5.184  1.00 0.00 ? 44  TYR A H    5  
ATOM 8225  H HA   . TYR A 1 44  ? 16.281  6.426   -5.952  1.00 0.00 ? 44  TYR A HA   5  
ATOM 8226  H HB2  . TYR A 1 44  ? 13.315  6.755   -6.445  1.00 0.00 ? 44  TYR A HB2  5  
ATOM 8227  H HB3  . TYR A 1 44  ? 14.594  7.764   -7.113  1.00 0.00 ? 44  TYR A HB3  5  
ATOM 8228  H HD1  . TYR A 1 44  ? 13.349  4.255   -7.059  1.00 0.00 ? 44  TYR A HD1  5  
ATOM 8229  H HD2  . TYR A 1 44  ? 15.569  7.213   -9.161  1.00 0.00 ? 44  TYR A HD2  5  
ATOM 8230  H HE1  . TYR A 1 44  ? 13.518  2.746   -8.992  1.00 0.00 ? 44  TYR A HE1  5  
ATOM 8231  H HE2  . TYR A 1 44  ? 15.744  5.712   -11.101 1.00 0.00 ? 44  TYR A HE2  5  
ATOM 8232  H HH   . TYR A 1 44  ? 15.154  2.471   -10.977 1.00 0.00 ? 44  TYR A HH   5  
ATOM 8233  N N    . GLY A 1 45  ? 15.073  6.838   -3.238  1.00 0.00 ? 45  GLY A N    5  
ATOM 8234  C CA   . GLY A 1 45  ? 14.904  7.686   -2.070  1.00 0.00 ? 45  GLY A CA   5  
ATOM 8235  C C    . GLY A 1 45  ? 13.679  8.578   -2.164  1.00 0.00 ? 45  GLY A C    5  
ATOM 8236  O O    . GLY A 1 45  ? 13.633  9.645   -1.553  1.00 0.00 ? 45  GLY A O    5  
ATOM 8237  H H    . GLY A 1 45  ? 15.193  5.873   -3.124  1.00 0.00 ? 45  GLY A H    5  
ATOM 8238  H HA2  . GLY A 1 45  ? 14.811  7.060   -1.195  1.00 0.00 ? 45  GLY A HA2  5  
ATOM 8239  H HA3  . GLY A 1 45  ? 15.780  8.308   -1.962  1.00 0.00 ? 45  GLY A HA3  5  
ATOM 8240  N N    . LEU A 1 46  ? 12.687  8.141   -2.931  1.00 0.00 ? 46  LEU A N    5  
ATOM 8241  C CA   . LEU A 1 46  ? 11.458  8.907   -3.103  1.00 0.00 ? 46  LEU A CA   5  
ATOM 8242  C C    . LEU A 1 46  ? 10.250  8.121   -2.604  1.00 0.00 ? 46  LEU A C    5  
ATOM 8243  O O    . LEU A 1 46  ? 10.245  6.889   -2.629  1.00 0.00 ? 46  LEU A O    5  
ATOM 8244  C CB   . LEU A 1 46  ? 11.265  9.280   -4.574  1.00 0.00 ? 46  LEU A CB   5  
ATOM 8245  C CG   . LEU A 1 46  ? 10.138  10.279  -4.846  1.00 0.00 ? 46  LEU A CG   5  
ATOM 8246  C CD1  . LEU A 1 46  ? 10.639  11.705  -4.679  1.00 0.00 ? 46  LEU A CD1  5  
ATOM 8247  C CD2  . LEU A 1 46  ? 9.567   10.071  -6.241  1.00 0.00 ? 46  LEU A CD2  5  
ATOM 8248  H H    . LEU A 1 46  ? 12.782  7.281   -3.394  1.00 0.00 ? 46  LEU A H    5  
ATOM 8249  H HA   . LEU A 1 46  ? 11.547  9.812   -2.521  1.00 0.00 ? 46  LEU A HA   5  
ATOM 8250  H HB2  . LEU A 1 46  ? 12.192  9.706   -4.939  1.00 0.00 ? 46  LEU A HB2  5  
ATOM 8251  H HB3  . LEU A 1 46  ? 11.055  8.376   -5.129  1.00 0.00 ? 46  LEU A HB3  5  
ATOM 8252  H HG   . LEU A 1 46  ? 9.345   10.118  -4.131  1.00 0.00 ? 46  LEU A HG   5  
ATOM 8253  H HD11 . LEU A 1 46  ? 11.664  11.768  -5.014  1.00 0.00 ? 46  LEU A HD11 5  
ATOM 8254  H HD12 . LEU A 1 46  ? 10.582  11.988  -3.638  1.00 0.00 ? 46  LEU A HD12 5  
ATOM 8255  H HD13 . LEU A 1 46  ? 10.026  12.372  -5.266  1.00 0.00 ? 46  LEU A HD13 5  
ATOM 8256  H HD21 . LEU A 1 46  ? 9.993   10.800  -6.916  1.00 0.00 ? 46  LEU A HD21 5  
ATOM 8257  H HD22 . LEU A 1 46  ? 8.495   10.191  -6.212  1.00 0.00 ? 46  LEU A HD22 5  
ATOM 8258  H HD23 . LEU A 1 46  ? 9.810   9.077   -6.585  1.00 0.00 ? 46  LEU A HD23 5  
ATOM 8259  N N    . GLY A 1 47  ? 9.228   8.839   -2.152  1.00 0.00 ? 47  GLY A N    5  
ATOM 8260  C CA   . GLY A 1 47  ? 8.029   8.192   -1.655  1.00 0.00 ? 47  GLY A CA   5  
ATOM 8261  C C    . GLY A 1 47  ? 7.299   7.415   -2.734  1.00 0.00 ? 47  GLY A C    5  
ATOM 8262  O O    . GLY A 1 47  ? 7.719   7.404   -3.891  1.00 0.00 ? 47  GLY A O    5  
ATOM 8263  H H    . GLY A 1 47  ? 9.288   9.817   -2.157  1.00 0.00 ? 47  GLY A H    5  
ATOM 8264  H HA2  . GLY A 1 47  ? 8.301   7.513   -0.860  1.00 0.00 ? 47  GLY A HA2  5  
ATOM 8265  H HA3  . GLY A 1 47  ? 7.364   8.945   -1.258  1.00 0.00 ? 47  GLY A HA3  5  
ATOM 8266  N N    . ILE A 1 48  ? 6.205   6.764   -2.354  1.00 0.00 ? 48  ILE A N    5  
ATOM 8267  C CA   . ILE A 1 48  ? 5.416   5.980   -3.297  1.00 0.00 ? 48  ILE A CA   5  
ATOM 8268  C C    . ILE A 1 48  ? 4.251   6.795   -3.847  1.00 0.00 ? 48  ILE A C    5  
ATOM 8269  O O    . ILE A 1 48  ? 3.184   6.862   -3.236  1.00 0.00 ? 48  ILE A O    5  
ATOM 8270  C CB   . ILE A 1 48  ? 4.868   4.698   -2.643  1.00 0.00 ? 48  ILE A CB   5  
ATOM 8271  C CG1  . ILE A 1 48  ? 5.985   3.961   -1.901  1.00 0.00 ? 48  ILE A CG1  5  
ATOM 8272  C CG2  . ILE A 1 48  ? 4.237   3.796   -3.693  1.00 0.00 ? 48  ILE A CG2  5  
ATOM 8273  C CD1  . ILE A 1 48  ? 7.080   3.449   -2.811  1.00 0.00 ? 48  ILE A CD1  5  
ATOM 8274  H H    . ILE A 1 48  ? 5.922   6.811   -1.417  1.00 0.00 ? 48  ILE A H    5  
ATOM 8275  H HA   . ILE A 1 48  ? 6.061   5.696   -4.116  1.00 0.00 ? 48  ILE A HA   5  
ATOM 8276  H HB   . ILE A 1 48  ? 4.102   4.979   -1.938  1.00 0.00 ? 48  ILE A HB   5  
ATOM 8277  H HG12 . ILE A 1 48  ? 6.436   4.631   -1.185  1.00 0.00 ? 48  ILE A HG12 5  
ATOM 8278  H HG13 . ILE A 1 48  ? 5.563   3.114   -1.379  1.00 0.00 ? 48  ILE A HG13 5  
ATOM 8279  H HG21 . ILE A 1 48  ? 3.801   2.934   -3.211  1.00 0.00 ? 48  ILE A HG21 5  
ATOM 8280  H HG22 . ILE A 1 48  ? 4.993   3.475   -4.394  1.00 0.00 ? 48  ILE A HG22 5  
ATOM 8281  H HG23 . ILE A 1 48  ? 3.467   4.341   -4.219  1.00 0.00 ? 48  ILE A HG23 5  
ATOM 8282  H HD11 . ILE A 1 48  ? 8.010   3.401   -2.263  1.00 0.00 ? 48  ILE A HD11 5  
ATOM 8283  H HD12 . ILE A 1 48  ? 7.193   4.118   -3.652  1.00 0.00 ? 48  ILE A HD12 5  
ATOM 8284  H HD13 . ILE A 1 48  ? 6.821   2.464   -3.167  1.00 0.00 ? 48  ILE A HD13 5  
ATOM 8285  N N    . TYR A 1 49  ? 4.461   7.413   -5.005  1.00 0.00 ? 49  TYR A N    5  
ATOM 8286  C CA   . TYR A 1 49  ? 3.427   8.223   -5.638  1.00 0.00 ? 49  TYR A CA   5  
ATOM 8287  C C    . TYR A 1 49  ? 2.724   7.440   -6.743  1.00 0.00 ? 49  TYR A C    5  
ATOM 8288  O O    . TYR A 1 49  ? 3.017   6.266   -6.969  1.00 0.00 ? 49  TYR A O    5  
ATOM 8289  C CB   . TYR A 1 49  ? 4.033   9.504   -6.212  1.00 0.00 ? 49  TYR A CB   5  
ATOM 8290  C CG   . TYR A 1 49  ? 4.523   10.469  -5.156  1.00 0.00 ? 49  TYR A CG   5  
ATOM 8291  C CD1  . TYR A 1 49  ? 3.660   11.392  -4.578  1.00 0.00 ? 49  TYR A CD1  5  
ATOM 8292  C CD2  . TYR A 1 49  ? 5.848   10.458  -4.740  1.00 0.00 ? 49  TYR A CD2  5  
ATOM 8293  C CE1  . TYR A 1 49  ? 4.104   12.276  -3.613  1.00 0.00 ? 49  TYR A CE1  5  
ATOM 8294  C CE2  . TYR A 1 49  ? 6.299   11.339  -3.775  1.00 0.00 ? 49  TYR A CE2  5  
ATOM 8295  C CZ   . TYR A 1 49  ? 5.424   12.246  -3.215  1.00 0.00 ? 49  TYR A CZ   5  
ATOM 8296  O OH   . TYR A 1 49  ? 5.869   13.124  -2.255  1.00 0.00 ? 49  TYR A OH   5  
ATOM 8297  H H    . TYR A 1 49  ? 5.332   7.321   -5.444  1.00 0.00 ? 49  TYR A H    5  
ATOM 8298  H HA   . TYR A 1 49  ? 2.701   8.485   -4.882  1.00 0.00 ? 49  TYR A HA   5  
ATOM 8299  H HB2  . TYR A 1 49  ? 4.872   9.247   -6.841  1.00 0.00 ? 49  TYR A HB2  5  
ATOM 8300  H HB3  . TYR A 1 49  ? 3.287   10.012  -6.807  1.00 0.00 ? 49  TYR A HB3  5  
ATOM 8301  H HD1  . TYR A 1 49  ? 2.627   11.411  -4.891  1.00 0.00 ? 49  TYR A HD1  5  
ATOM 8302  H HD2  . TYR A 1 49  ? 6.531   9.747   -5.181  1.00 0.00 ? 49  TYR A HD2  5  
ATOM 8303  H HE1  . TYR A 1 49  ? 3.418   12.985  -3.174  1.00 0.00 ? 49  TYR A HE1  5  
ATOM 8304  H HE2  . TYR A 1 49  ? 7.333   11.316  -3.464  1.00 0.00 ? 49  TYR A HE2  5  
ATOM 8305  H HH   . TYR A 1 49  ? 6.342   12.641  -1.573  1.00 0.00 ? 49  TYR A HH   5  
ATOM 8306  N N    . ILE A 1 50  ? 1.796   8.099   -7.429  1.00 0.00 ? 50  ILE A N    5  
ATOM 8307  C CA   . ILE A 1 50  ? 1.052   7.467   -8.511  1.00 0.00 ? 50  ILE A CA   5  
ATOM 8308  C C    . ILE A 1 50  ? 1.072   8.331   -9.768  1.00 0.00 ? 50  ILE A C    5  
ATOM 8309  O O    . ILE A 1 50  ? 1.255   9.546   -9.694  1.00 0.00 ? 50  ILE A O    5  
ATOM 8310  C CB   . ILE A 1 50  ? -0.411  7.202   -8.106  1.00 0.00 ? 50  ILE A CB   5  
ATOM 8311  C CG1  . ILE A 1 50  ? -0.466  6.479   -6.759  1.00 0.00 ? 50  ILE A CG1  5  
ATOM 8312  C CG2  . ILE A 1 50  ? -1.120  6.389   -9.180  1.00 0.00 ? 50  ILE A CG2  5  
ATOM 8313  C CD1  . ILE A 1 50  ? -1.863  6.378   -6.186  1.00 0.00 ? 50  ILE A CD1  5  
ATOM 8314  H H    . ILE A 1 50  ? 1.607   9.034   -7.203  1.00 0.00 ? 50  ILE A H    5  
ATOM 8315  H HA   . ILE A 1 50  ? 1.521   6.519   -8.729  1.00 0.00 ? 50  ILE A HA   5  
ATOM 8316  H HB   . ILE A 1 50  ? -0.914  8.153   -8.017  1.00 0.00 ? 50  ILE A HB   5  
ATOM 8317  H HG12 . ILE A 1 50  ? -0.085  5.477   -6.879  1.00 0.00 ? 50  ILE A HG12 5  
ATOM 8318  H HG13 . ILE A 1 50  ? 0.147   7.011   -6.046  1.00 0.00 ? 50  ILE A HG13 5  
ATOM 8319  H HG21 . ILE A 1 50  ? -2.112  6.131   -8.838  1.00 0.00 ? 50  ILE A HG21 5  
ATOM 8320  H HG22 . ILE A 1 50  ? -0.561  5.487   -9.376  1.00 0.00 ? 50  ILE A HG22 5  
ATOM 8321  H HG23 . ILE A 1 50  ? -1.191  6.973   -10.085 1.00 0.00 ? 50  ILE A HG23 5  
ATOM 8322  H HD11 . ILE A 1 50  ? -1.926  6.971   -5.284  1.00 0.00 ? 50  ILE A HD11 5  
ATOM 8323  H HD12 . ILE A 1 50  ? -2.084  5.347   -5.954  1.00 0.00 ? 50  ILE A HD12 5  
ATOM 8324  H HD13 . ILE A 1 50  ? -2.577  6.747   -6.909  1.00 0.00 ? 50  ILE A HD13 5  
ATOM 8325  N N    . THR A 1 51  ? 0.881   7.697   -10.919 1.00 0.00 ? 51  THR A N    5  
ATOM 8326  C CA   . THR A 1 51  ? 0.879   8.409   -12.192 1.00 0.00 ? 51  THR A CA   5  
ATOM 8327  C C    . THR A 1 51  ? 0.322   7.529   -13.307 1.00 0.00 ? 51  THR A C    5  
ATOM 8328  O O    . THR A 1 51  ? 0.859   7.498   -14.414 1.00 0.00 ? 51  THR A O    5  
ATOM 8329  C CB   . THR A 1 51  ? 2.294   8.869   -12.546 1.00 0.00 ? 51  THR A CB   5  
ATOM 8330  O OG1  . THR A 1 51  ? 2.327   9.438   -13.842 1.00 0.00 ? 51  THR A OG1  5  
ATOM 8331  C CG2  . THR A 1 51  ? 3.313   7.750   -12.509 1.00 0.00 ? 51  THR A CG2  5  
ATOM 8332  H H    . THR A 1 51  ? 0.741   6.727   -10.914 1.00 0.00 ? 51  THR A H    5  
ATOM 8333  H HA   . THR A 1 51  ? 0.245   9.276   -12.084 1.00 0.00 ? 51  THR A HA   5  
ATOM 8334  H HB   . THR A 1 51  ? 2.604   9.622   -11.836 1.00 0.00 ? 51  THR A HB   5  
ATOM 8335  H HG1  . THR A 1 51  ? 1.688   10.153  -13.894 1.00 0.00 ? 51  THR A HG1  5  
ATOM 8336  H HG21 . THR A 1 51  ? 3.326   7.307   -11.524 1.00 0.00 ? 51  THR A HG21 5  
ATOM 8337  H HG22 . THR A 1 51  ? 4.291   8.147   -12.738 1.00 0.00 ? 51  THR A HG22 5  
ATOM 8338  H HG23 . THR A 1 51  ? 3.049   7.000   -13.238 1.00 0.00 ? 51  THR A HG23 5  
ATOM 8339  N N    . GLY A 1 52  ? -0.758  6.815   -13.008 1.00 0.00 ? 52  GLY A N    5  
ATOM 8340  C CA   . GLY A 1 52  ? -1.369  5.945   -13.995 1.00 0.00 ? 52  GLY A CA   5  
ATOM 8341  C C    . GLY A 1 52  ? -2.535  5.156   -13.434 1.00 0.00 ? 52  GLY A C    5  
ATOM 8342  O O    . GLY A 1 52  ? -2.489  4.695   -12.293 1.00 0.00 ? 52  GLY A O    5  
ATOM 8343  H H    . GLY A 1 52  ? -1.143  6.880   -12.109 1.00 0.00 ? 52  GLY A H    5  
ATOM 8344  H HA2  . GLY A 1 52  ? -1.719  6.547   -14.820 1.00 0.00 ? 52  GLY A HA2  5  
ATOM 8345  H HA3  . GLY A 1 52  ? -0.623  5.254   -14.360 1.00 0.00 ? 52  GLY A HA3  5  
ATOM 8346  N N    . VAL A 1 53  ? -3.581  5.001   -14.237 1.00 0.00 ? 53  VAL A N    5  
ATOM 8347  C CA   . VAL A 1 53  ? -4.766  4.261   -13.817 1.00 0.00 ? 53  VAL A CA   5  
ATOM 8348  C C    . VAL A 1 53  ? -5.404  3.533   -14.994 1.00 0.00 ? 53  VAL A C    5  
ATOM 8349  O O    . VAL A 1 53  ? -5.582  4.106   -16.070 1.00 0.00 ? 53  VAL A O    5  
ATOM 8350  C CB   . VAL A 1 53  ? -5.813  5.192   -13.176 1.00 0.00 ? 53  VAL A CB   5  
ATOM 8351  C CG1  . VAL A 1 53  ? -6.946  4.382   -12.567 1.00 0.00 ? 53  VAL A CG1  5  
ATOM 8352  C CG2  . VAL A 1 53  ? -5.163  6.087   -12.132 1.00 0.00 ? 53  VAL A CG2  5  
ATOM 8353  H H    . VAL A 1 53  ? -3.556  5.392   -15.136 1.00 0.00 ? 53  VAL A H    5  
ATOM 8354  H HA   . VAL A 1 53  ? -4.460  3.535   -13.078 1.00 0.00 ? 53  VAL A HA   5  
ATOM 8355  H HB   . VAL A 1 53  ? -6.227  5.821   -13.951 1.00 0.00 ? 53  VAL A HB   5  
ATOM 8356  H HG11 . VAL A 1 53  ? -6.972  3.401   -13.018 1.00 0.00 ? 53  VAL A HG11 5  
ATOM 8357  H HG12 . VAL A 1 53  ? -7.885  4.885   -12.745 1.00 0.00 ? 53  VAL A HG12 5  
ATOM 8358  H HG13 . VAL A 1 53  ? -6.787  4.284   -11.503 1.00 0.00 ? 53  VAL A HG13 5  
ATOM 8359  H HG21 . VAL A 1 53  ? -4.657  6.905   -12.623 1.00 0.00 ? 53  VAL A HG21 5  
ATOM 8360  H HG22 . VAL A 1 53  ? -4.451  5.513   -11.559 1.00 0.00 ? 53  VAL A HG22 5  
ATOM 8361  H HG23 . VAL A 1 53  ? -5.924  6.479   -11.471 1.00 0.00 ? 53  VAL A HG23 5  
ATOM 8362  N N    . ASP A 1 54  ? -5.746  2.266   -14.786 1.00 0.00 ? 54  ASP A N    5  
ATOM 8363  C CA   . ASP A 1 54  ? -6.364  1.459   -15.832 1.00 0.00 ? 54  ASP A CA   5  
ATOM 8364  C C    . ASP A 1 54  ? -7.884  1.447   -15.683 1.00 0.00 ? 54  ASP A C    5  
ATOM 8365  O O    . ASP A 1 54  ? -8.406  1.378   -14.571 1.00 0.00 ? 54  ASP A O    5  
ATOM 8366  C CB   . ASP A 1 54  ? -5.826  0.028   -15.787 1.00 0.00 ? 54  ASP A CB   5  
ATOM 8367  C CG   . ASP A 1 54  ? -4.420  -0.079  -16.345 1.00 0.00 ? 54  ASP A CG   5  
ATOM 8368  O OD1  . ASP A 1 54  ? -4.131  0.590   -17.359 1.00 0.00 ? 54  ASP A OD1  5  
ATOM 8369  O OD2  . ASP A 1 54  ? -3.608  -0.832  -15.767 1.00 0.00 ? 54  ASP A OD2  5  
ATOM 8370  H H    . ASP A 1 54  ? -5.578  1.863   -13.908 1.00 0.00 ? 54  ASP A H    5  
ATOM 8371  H HA   . ASP A 1 54  ? -6.108  1.901   -16.783 1.00 0.00 ? 54  ASP A HA   5  
ATOM 8372  H HB2  . ASP A 1 54  ? -5.813  -0.313  -14.763 1.00 0.00 ? 54  ASP A HB2  5  
ATOM 8373  H HB3  . ASP A 1 54  ? -6.474  -0.612  -16.368 1.00 0.00 ? 54  ASP A HB3  5  
ATOM 8374  N N    . PRO A 1 55  ? -8.620  1.514   -16.809 1.00 0.00 ? 55  PRO A N    5  
ATOM 8375  C CA   . PRO A 1 55  ? -10.085 1.510   -16.793 1.00 0.00 ? 55  PRO A CA   5  
ATOM 8376  C C    . PRO A 1 55  ? -10.657 0.123   -16.521 1.00 0.00 ? 55  PRO A C    5  
ATOM 8377  O O    . PRO A 1 55  ? -10.452 -0.807  -17.301 1.00 0.00 ? 55  PRO A O    5  
ATOM 8378  C CB   . PRO A 1 55  ? -10.448 1.971   -18.203 1.00 0.00 ? 55  PRO A CB   5  
ATOM 8379  C CG   . PRO A 1 55  ? -9.311  1.517   -19.050 1.00 0.00 ? 55  PRO A CG   5  
ATOM 8380  C CD   . PRO A 1 55  ? -8.083  1.600   -18.181 1.00 0.00 ? 55  PRO A CD   5  
ATOM 8381  H HA   . PRO A 1 55  ? -10.476 2.210   -16.069 1.00 0.00 ? 55  PRO A HA   5  
ATOM 8382  H HB2  . PRO A 1 55  ? -11.378 1.511   -18.507 1.00 0.00 ? 55  PRO A HB2  5  
ATOM 8383  H HB3  . PRO A 1 55  ? -10.548 3.046   -18.220 1.00 0.00 ? 55  PRO A HB3  5  
ATOM 8384  H HG2  . PRO A 1 55  ? -9.475  0.499   -19.370 1.00 0.00 ? 55  PRO A HG2  5  
ATOM 8385  H HG3  . PRO A 1 55  ? -9.208  2.168   -19.905 1.00 0.00 ? 55  PRO A HG3  5  
ATOM 8386  H HD2  . PRO A 1 55  ? -7.420  0.773   -18.387 1.00 0.00 ? 55  PRO A HD2  5  
ATOM 8387  H HD3  . PRO A 1 55  ? -7.574  2.540   -18.337 1.00 0.00 ? 55  PRO A HD3  5  
ATOM 8388  N N    . GLY A 1 56  ? -11.377 -0.009  -15.411 1.00 0.00 ? 56  GLY A N    5  
ATOM 8389  C CA   . GLY A 1 56  ? -11.967 -1.288  -15.058 1.00 0.00 ? 56  GLY A CA   5  
ATOM 8390  C C    . GLY A 1 56  ? -11.300 -1.928  -13.858 1.00 0.00 ? 56  GLY A C    5  
ATOM 8391  O O    . GLY A 1 56  ? -11.909 -2.737  -13.159 1.00 0.00 ? 56  GLY A O    5  
ATOM 8392  H H    . GLY A 1 56  ? -11.508 0.767   -14.827 1.00 0.00 ? 56  GLY A H    5  
ATOM 8393  H HA2  . GLY A 1 56  ? -13.014 -1.138  -14.836 1.00 0.00 ? 56  GLY A HA2  5  
ATOM 8394  H HA3  . GLY A 1 56  ? -11.882 -1.955  -15.903 1.00 0.00 ? 56  GLY A HA3  5  
ATOM 8395  N N    . SER A 1 57  ? -10.041 -1.569  -13.617 1.00 0.00 ? 57  SER A N    5  
ATOM 8396  C CA   . SER A 1 57  ? -9.291  -2.118  -12.492 1.00 0.00 ? 57  SER A CA   5  
ATOM 8397  C C    . SER A 1 57  ? -10.005 -1.841  -11.172 1.00 0.00 ? 57  SER A C    5  
ATOM 8398  O O    . SER A 1 57  ? -10.988 -1.101  -11.130 1.00 0.00 ? 57  SER A O    5  
ATOM 8399  C CB   . SER A 1 57  ? -7.882  -1.526  -12.456 1.00 0.00 ? 57  SER A CB   5  
ATOM 8400  O OG   . SER A 1 57  ? -7.907  -0.171  -12.043 1.00 0.00 ? 57  SER A OG   5  
ATOM 8401  H H    . SER A 1 57  ? -9.608  -0.921  -14.210 1.00 0.00 ? 57  SER A H    5  
ATOM 8402  H HA   . SER A 1 57  ? -9.220  -3.185  -12.631 1.00 0.00 ? 57  SER A HA   5  
ATOM 8403  H HB2  . SER A 1 57  ? -7.275  -2.089  -11.760 1.00 0.00 ? 57  SER A HB2  5  
ATOM 8404  H HB3  . SER A 1 57  ? -7.445  -1.581  -13.445 1.00 0.00 ? 57  SER A HB3  5  
ATOM 8405  H HG   . SER A 1 57  ? -7.852  0.400   -12.813 1.00 0.00 ? 57  SER A HG   5  
ATOM 8406  N N    . GLU A 1 58  ? -9.503  -2.440  -10.097 1.00 0.00 ? 58  GLU A N    5  
ATOM 8407  C CA   . GLU A 1 58  ? -10.093 -2.258  -8.776  1.00 0.00 ? 58  GLU A CA   5  
ATOM 8408  C C    . GLU A 1 58  ? -9.817  -0.855  -8.245  1.00 0.00 ? 58  GLU A C    5  
ATOM 8409  O O    . GLU A 1 58  ? -10.675 -0.240  -7.612  1.00 0.00 ? 58  GLU A O    5  
ATOM 8410  C CB   . GLU A 1 58  ? -9.542  -3.302  -7.802  1.00 0.00 ? 58  GLU A CB   5  
ATOM 8411  C CG   . GLU A 1 58  ? -10.327 -4.604  -7.798  1.00 0.00 ? 58  GLU A CG   5  
ATOM 8412  C CD   . GLU A 1 58  ? -11.288 -4.701  -6.628  1.00 0.00 ? 58  GLU A CD   5  
ATOM 8413  O OE1  . GLU A 1 58  ? -10.817 -4.913  -5.491  1.00 0.00 ? 58  GLU A OE1  5  
ATOM 8414  O OE2  . GLU A 1 58  ? -12.508 -4.564  -6.850  1.00 0.00 ? 58  GLU A OE2  5  
ATOM 8415  H H    . GLU A 1 58  ? -8.717  -3.018  -10.196 1.00 0.00 ? 58  GLU A H    5  
ATOM 8416  H HA   . GLU A 1 58  ? -11.160 -2.393  -8.868  1.00 0.00 ? 58  GLU A HA   5  
ATOM 8417  H HB2  . GLU A 1 58  ? -8.520  -3.524  -8.070  1.00 0.00 ? 58  GLU A HB2  5  
ATOM 8418  H HB3  . GLU A 1 58  ? -9.562  -2.890  -6.804  1.00 0.00 ? 58  GLU A HB3  5  
ATOM 8419  H HG2  . GLU A 1 58  ? -10.893 -4.670  -8.715  1.00 0.00 ? 58  GLU A HG2  5  
ATOM 8420  H HG3  . GLU A 1 58  ? -9.631  -5.428  -7.744  1.00 0.00 ? 58  GLU A HG3  5  
ATOM 8421  N N    . ALA A 1 59  ? -8.614  -0.355  -8.506  1.00 0.00 ? 59  ALA A N    5  
ATOM 8422  C CA   . ALA A 1 59  ? -8.225  0.975   -8.054  1.00 0.00 ? 59  ALA A CA   5  
ATOM 8423  C C    . ALA A 1 59  ? -9.045  2.055   -8.752  1.00 0.00 ? 59  ALA A C    5  
ATOM 8424  O O    . ALA A 1 59  ? -9.446  3.041   -8.134  1.00 0.00 ? 59  ALA A O    5  
ATOM 8425  C CB   . ALA A 1 59  ? -6.739  1.201   -8.294  1.00 0.00 ? 59  ALA A CB   5  
ATOM 8426  H H    . ALA A 1 59  ? -7.972  -0.893  -9.015  1.00 0.00 ? 59  ALA A H    5  
ATOM 8427  H HA   . ALA A 1 59  ? -8.406  1.032   -6.990  1.00 0.00 ? 59  ALA A HA   5  
ATOM 8428  H HB1  . ALA A 1 59  ? -6.509  1.009   -9.332  1.00 0.00 ? 59  ALA A HB1  5  
ATOM 8429  H HB2  . ALA A 1 59  ? -6.168  0.530   -7.669  1.00 0.00 ? 59  ALA A HB2  5  
ATOM 8430  H HB3  . ALA A 1 59  ? -6.487  2.222   -8.053  1.00 0.00 ? 59  ALA A HB3  5  
ATOM 8431  N N    . GLU A 1 60  ? -9.292  1.861   -10.044 1.00 0.00 ? 60  GLU A N    5  
ATOM 8432  C CA   . GLU A 1 60  ? -10.065 2.817   -10.827 1.00 0.00 ? 60  GLU A CA   5  
ATOM 8433  C C    . GLU A 1 60  ? -11.479 2.956   -10.273 1.00 0.00 ? 60  GLU A C    5  
ATOM 8434  O O    . GLU A 1 60  ? -12.018 4.060   -10.188 1.00 0.00 ? 60  GLU A O    5  
ATOM 8435  C CB   . GLU A 1 60  ? -10.119 2.385   -12.293 1.00 0.00 ? 60  GLU A CB   5  
ATOM 8436  C CG   . GLU A 1 60  ? -10.224 3.546   -13.268 1.00 0.00 ? 60  GLU A CG   5  
ATOM 8437  C CD   . GLU A 1 60  ? -11.528 3.544   -14.041 1.00 0.00 ? 60  GLU A CD   5  
ATOM 8438  O OE1  . GLU A 1 60  ? -12.067 2.446   -14.294 1.00 0.00 ? 60  GLU A OE1  5  
ATOM 8439  O OE2  . GLU A 1 60  ? -12.011 4.640   -14.396 1.00 0.00 ? 60  GLU A OE2  5  
ATOM 8440  H H    . GLU A 1 60  ? -8.945  1.055   -10.481 1.00 0.00 ? 60  GLU A H    5  
ATOM 8441  H HA   . GLU A 1 60  ? -9.570  3.775   -10.761 1.00 0.00 ? 60  GLU A HA   5  
ATOM 8442  H HB2  . GLU A 1 60  ? -9.222  1.828   -12.525 1.00 0.00 ? 60  GLU A HB2  5  
ATOM 8443  H HB3  . GLU A 1 60  ? -10.976 1.743   -12.435 1.00 0.00 ? 60  GLU A HB3  5  
ATOM 8444  H HG2  . GLU A 1 60  ? -10.155 4.471   -12.714 1.00 0.00 ? 60  GLU A HG2  5  
ATOM 8445  H HG3  . GLU A 1 60  ? -9.406  3.486   -13.970 1.00 0.00 ? 60  GLU A HG3  5  
ATOM 8446  N N    . GLY A 1 61  ? -12.076 1.829   -9.899  1.00 0.00 ? 61  GLY A N    5  
ATOM 8447  C CA   . GLY A 1 61  ? -13.423 1.847   -9.359  1.00 0.00 ? 61  GLY A CA   5  
ATOM 8448  C C    . GLY A 1 61  ? -13.489 2.484   -7.985  1.00 0.00 ? 61  GLY A C    5  
ATOM 8449  O O    . GLY A 1 61  ? -14.447 3.189   -7.666  1.00 0.00 ? 61  GLY A O    5  
ATOM 8450  H H    . GLY A 1 61  ? -11.597 0.979   -9.991  1.00 0.00 ? 61  GLY A H    5  
ATOM 8451  H HA2  . GLY A 1 61  ? -14.061 2.400   -10.032 1.00 0.00 ? 61  GLY A HA2  5  
ATOM 8452  H HA3  . GLY A 1 61  ? -13.784 0.832   -9.290  1.00 0.00 ? 61  GLY A HA3  5  
ATOM 8453  N N    . SER A 1 62  ? -12.469 2.236   -7.170  1.00 0.00 ? 62  SER A N    5  
ATOM 8454  C CA   . SER A 1 62  ? -12.416 2.790   -5.822  1.00 0.00 ? 62  SER A CA   5  
ATOM 8455  C C    . SER A 1 62  ? -12.399 4.315   -5.861  1.00 0.00 ? 62  SER A C    5  
ATOM 8456  O O    . SER A 1 62  ? -13.326 4.969   -5.384  1.00 0.00 ? 62  SER A O    5  
ATOM 8457  C CB   . SER A 1 62  ? -11.179 2.273   -5.084  1.00 0.00 ? 62  SER A CB   5  
ATOM 8458  O OG   . SER A 1 62  ? -11.480 1.104   -4.342  1.00 0.00 ? 62  SER A OG   5  
ATOM 8459  H H    . SER A 1 62  ? -11.735 1.666   -7.481  1.00 0.00 ? 62  SER A H    5  
ATOM 8460  H HA   . SER A 1 62  ? -13.301 2.465   -5.295  1.00 0.00 ? 62  SER A HA   5  
ATOM 8461  H HB2  . SER A 1 62  ? -10.407 2.040   -5.801  1.00 0.00 ? 62  SER A HB2  5  
ATOM 8462  H HB3  . SER A 1 62  ? -10.823 3.035   -4.405  1.00 0.00 ? 62  SER A HB3  5  
ATOM 8463  H HG   . SER A 1 62  ? -11.851 1.351   -3.492  1.00 0.00 ? 62  SER A HG   5  
ATOM 8464  N N    . GLY A 1 63  ? -11.336 4.875   -6.430  1.00 0.00 ? 63  GLY A N    5  
ATOM 8465  C CA   . GLY A 1 63  ? -11.217 6.319   -6.520  1.00 0.00 ? 63  GLY A CA   5  
ATOM 8466  C C    . GLY A 1 63  ? -9.778  6.787   -6.427  1.00 0.00 ? 63  GLY A C    5  
ATOM 8467  O O    . GLY A 1 63  ? -9.473  7.739   -5.709  1.00 0.00 ? 63  GLY A O    5  
ATOM 8468  H H    . GLY A 1 63  ? -10.628 4.303   -6.792  1.00 0.00 ? 63  GLY A H    5  
ATOM 8469  H HA2  . GLY A 1 63  ? -11.630 6.645   -7.462  1.00 0.00 ? 63  GLY A HA2  5  
ATOM 8470  H HA3  . GLY A 1 63  ? -11.782 6.766   -5.716  1.00 0.00 ? 63  GLY A HA3  5  
ATOM 8471  N N    . LEU A 1 64  ? -8.892  6.117   -7.156  1.00 0.00 ? 64  LEU A N    5  
ATOM 8472  C CA   . LEU A 1 64  ? -7.477  6.469   -7.154  1.00 0.00 ? 64  LEU A CA   5  
ATOM 8473  C C    . LEU A 1 64  ? -7.090  7.176   -8.448  1.00 0.00 ? 64  LEU A C    5  
ATOM 8474  O O    . LEU A 1 64  ? -7.336  6.668   -9.543  1.00 0.00 ? 64  LEU A O    5  
ATOM 8475  C CB   . LEU A 1 64  ? -6.619  5.216   -6.967  1.00 0.00 ? 64  LEU A CB   5  
ATOM 8476  C CG   . LEU A 1 64  ? -6.531  4.699   -5.528  1.00 0.00 ? 64  LEU A CG   5  
ATOM 8477  C CD1  . LEU A 1 64  ? -6.758  3.196   -5.482  1.00 0.00 ? 64  LEU A CD1  5  
ATOM 8478  C CD2  . LEU A 1 64  ? -5.186  5.056   -4.913  1.00 0.00 ? 64  LEU A CD2  5  
ATOM 8479  H H    . LEU A 1 64  ? -9.197  5.367   -7.709  1.00 0.00 ? 64  LEU A H    5  
ATOM 8480  H HA   . LEU A 1 64  ? -7.303  7.139   -6.325  1.00 0.00 ? 64  LEU A HA   5  
ATOM 8481  H HB2  . LEU A 1 64  ? -7.029  4.430   -7.587  1.00 0.00 ? 64  LEU A HB2  5  
ATOM 8482  H HB3  . LEU A 1 64  ? -5.619  5.435   -7.309  1.00 0.00 ? 64  LEU A HB3  5  
ATOM 8483  H HG   . LEU A 1 64  ? -7.304  5.170   -4.937  1.00 0.00 ? 64  LEU A HG   5  
ATOM 8484  H HD11 . LEU A 1 64  ? -6.621  2.842   -4.471  1.00 0.00 ? 64  LEU A HD11 5  
ATOM 8485  H HD12 . LEU A 1 64  ? -6.051  2.705   -6.133  1.00 0.00 ? 64  LEU A HD12 5  
ATOM 8486  H HD13 . LEU A 1 64  ? -7.763  2.973   -5.809  1.00 0.00 ? 64  LEU A HD13 5  
ATOM 8487  H HD21 . LEU A 1 64  ? -4.760  5.895   -5.443  1.00 0.00 ? 64  LEU A HD21 5  
ATOM 8488  H HD22 . LEU A 1 64  ? -4.521  4.209   -4.986  1.00 0.00 ? 64  LEU A HD22 5  
ATOM 8489  H HD23 . LEU A 1 64  ? -5.322  5.318   -3.875  1.00 0.00 ? 64  LEU A HD23 5  
ATOM 8490  N N    . LYS A 1 65  ? -6.484  8.351   -8.316  1.00 0.00 ? 65  LYS A N    5  
ATOM 8491  C CA   . LYS A 1 65  ? -6.063  9.130   -9.475  1.00 0.00 ? 65  LYS A CA   5  
ATOM 8492  C C    . LYS A 1 65  ? -4.545  9.277   -9.509  1.00 0.00 ? 65  LYS A C    5  
ATOM 8493  O O    . LYS A 1 65  ? -3.844  8.795   -8.620  1.00 0.00 ? 65  LYS A O    5  
ATOM 8494  C CB   . LYS A 1 65  ? -6.720  10.510  -9.453  1.00 0.00 ? 65  LYS A CB   5  
ATOM 8495  C CG   . LYS A 1 65  ? -8.220  10.474  -9.705  1.00 0.00 ? 65  LYS A CG   5  
ATOM 8496  C CD   . LYS A 1 65  ? -8.961  11.468  -8.822  1.00 0.00 ? 65  LYS A CD   5  
ATOM 8497  C CE   . LYS A 1 65  ? -9.633  12.555  -9.646  1.00 0.00 ? 65  LYS A CE   5  
ATOM 8498  N NZ   . LYS A 1 65  ? -10.788 12.029  -10.425 1.00 0.00 ? 65  LYS A NZ   5  
ATOM 8499  H H    . LYS A 1 65  ? -6.316  8.704   -7.417  1.00 0.00 ? 65  LYS A H    5  
ATOM 8500  H HA   . LYS A 1 65  ? -6.382  8.603   -10.361 1.00 0.00 ? 65  LYS A HA   5  
ATOM 8501  H HB2  . LYS A 1 65  ? -6.550  10.963  -8.487  1.00 0.00 ? 65  LYS A HB2  5  
ATOM 8502  H HB3  . LYS A 1 65  ? -6.265  11.126  -10.215 1.00 0.00 ? 65  LYS A HB3  5  
ATOM 8503  H HG2  . LYS A 1 65  ? -8.407  10.717  -10.740 1.00 0.00 ? 65  LYS A HG2  5  
ATOM 8504  H HG3  . LYS A 1 65  ? -8.585  9.478   -9.496  1.00 0.00 ? 65  LYS A HG3  5  
ATOM 8505  H HD2  . LYS A 1 65  ? -9.717  10.940  -8.259  1.00 0.00 ? 65  LYS A HD2  5  
ATOM 8506  H HD3  . LYS A 1 65  ? -8.259  11.927  -8.142  1.00 0.00 ? 65  LYS A HD3  5  
ATOM 8507  H HE2  . LYS A 1 65  ? -9.984  13.329  -8.980  1.00 0.00 ? 65  LYS A HE2  5  
ATOM 8508  H HE3  . LYS A 1 65  ? -8.907  12.970  -10.330 1.00 0.00 ? 65  LYS A HE3  5  
ATOM 8509  H HZ1  . LYS A 1 65  ? -10.974 12.640  -11.246 1.00 0.00 ? 65  LYS A HZ1  5  
ATOM 8510  H HZ2  . LYS A 1 65  ? -11.639 12.002  -9.828  1.00 0.00 ? 65  LYS A HZ2  5  
ATOM 8511  H HZ3  . LYS A 1 65  ? -10.583 11.066  -10.761 1.00 0.00 ? 65  LYS A HZ3  5  
ATOM 8512  N N    . VAL A 1 66  ? -4.044  9.949   -10.541 1.00 0.00 ? 66  VAL A N    5  
ATOM 8513  C CA   . VAL A 1 66  ? -2.610  10.160  -10.692 1.00 0.00 ? 66  VAL A CA   5  
ATOM 8514  C C    . VAL A 1 66  ? -2.122  11.291  -9.792  1.00 0.00 ? 66  VAL A C    5  
ATOM 8515  O O    . VAL A 1 66  ? -2.763  12.337  -9.691  1.00 0.00 ? 66  VAL A O    5  
ATOM 8516  C CB   . VAL A 1 66  ? -2.242  10.490  -12.151 1.00 0.00 ? 66  VAL A CB   5  
ATOM 8517  C CG1  . VAL A 1 66  ? -2.441  9.272   -13.041 1.00 0.00 ? 66  VAL A CG1  5  
ATOM 8518  C CG2  . VAL A 1 66  ? -3.060  11.667  -12.655 1.00 0.00 ? 66  VAL A CG2  5  
ATOM 8519  H H    . VAL A 1 66  ? -4.654  10.310  -11.218 1.00 0.00 ? 66  VAL A H    5  
ATOM 8520  H HA   . VAL A 1 66  ? -2.106  9.247   -10.413 1.00 0.00 ? 66  VAL A HA   5  
ATOM 8521  H HB   . VAL A 1 66  ? -1.197  10.764  -12.184 1.00 0.00 ? 66  VAL A HB   5  
ATOM 8522  H HG11 . VAL A 1 66  ? -1.642  9.222   -13.766 1.00 0.00 ? 66  VAL A HG11 5  
ATOM 8523  H HG12 . VAL A 1 66  ? -3.388  9.351   -13.553 1.00 0.00 ? 66  VAL A HG12 5  
ATOM 8524  H HG13 . VAL A 1 66  ? -2.432  8.378   -12.434 1.00 0.00 ? 66  VAL A HG13 5  
ATOM 8525  H HG21 . VAL A 1 66  ? -4.077  11.350  -12.833 1.00 0.00 ? 66  VAL A HG21 5  
ATOM 8526  H HG22 . VAL A 1 66  ? -2.632  12.035  -13.576 1.00 0.00 ? 66  VAL A HG22 5  
ATOM 8527  H HG23 . VAL A 1 66  ? -3.052  12.454  -11.915 1.00 0.00 ? 66  VAL A HG23 5  
ATOM 8528  N N    . GLY A 1 67  ? -0.986  11.071  -9.138  1.00 0.00 ? 67  GLY A N    5  
ATOM 8529  C CA   . GLY A 1 67  ? -0.433  12.081  -8.254  1.00 0.00 ? 67  GLY A CA   5  
ATOM 8530  C C    . GLY A 1 67  ? -0.600  11.727  -6.789  1.00 0.00 ? 67  GLY A C    5  
ATOM 8531  O O    . GLY A 1 67  ? 0.162   12.192  -5.941  1.00 0.00 ? 67  GLY A O    5  
ATOM 8532  H H    . GLY A 1 67  ? -0.519  10.218  -9.257  1.00 0.00 ? 67  GLY A H    5  
ATOM 8533  H HA2  . GLY A 1 67  ? 0.622   12.191  -8.468  1.00 0.00 ? 67  GLY A HA2  5  
ATOM 8534  H HA3  . GLY A 1 67  ? -0.931  13.023  -8.445  1.00 0.00 ? 67  GLY A HA3  5  
ATOM 8535  N N    . ASP A 1 68  ? -1.600  10.904  -6.490  1.00 0.00 ? 68  ASP A N    5  
ATOM 8536  C CA   . ASP A 1 68  ? -1.864  10.489  -5.116  1.00 0.00 ? 68  ASP A CA   5  
ATOM 8537  C C    . ASP A 1 68  ? -0.644  9.802   -4.509  1.00 0.00 ? 68  ASP A C    5  
ATOM 8538  O O    . ASP A 1 68  ? 0.085   9.087   -5.198  1.00 0.00 ? 68  ASP A O    5  
ATOM 8539  C CB   . ASP A 1 68  ? -3.070  9.550   -5.067  1.00 0.00 ? 68  ASP A CB   5  
ATOM 8540  C CG   . ASP A 1 68  ? -4.374  10.270  -5.350  1.00 0.00 ? 68  ASP A CG   5  
ATOM 8541  O OD1  . ASP A 1 68  ? -4.471  10.930  -6.407  1.00 0.00 ? 68  ASP A OD1  5  
ATOM 8542  O OD2  . ASP A 1 68  ? -5.297  10.175  -4.516  1.00 0.00 ? 68  ASP A OD2  5  
ATOM 8543  H H    . ASP A 1 68  ? -2.173  10.567  -7.208  1.00 0.00 ? 68  ASP A H    5  
ATOM 8544  H HA   . ASP A 1 68  ? -2.086  11.375  -4.540  1.00 0.00 ? 68  ASP A HA   5  
ATOM 8545  H HB2  . ASP A 1 68  ? -2.943  8.771   -5.809  1.00 0.00 ? 68  ASP A HB2  5  
ATOM 8546  H HB3  . ASP A 1 68  ? -3.131  9.103   -4.084  1.00 0.00 ? 68  ASP A HB3  5  
ATOM 8547  N N    . GLN A 1 69  ? -0.430  10.022  -3.216  1.00 0.00 ? 69  GLN A N    5  
ATOM 8548  C CA   . GLN A 1 69  ? 0.701   9.424   -2.515  1.00 0.00 ? 69  GLN A CA   5  
ATOM 8549  C C    . GLN A 1 69  ? 0.235   8.331   -1.560  1.00 0.00 ? 69  GLN A C    5  
ATOM 8550  O O    . GLN A 1 69  ? -0.679  8.537   -0.762  1.00 0.00 ? 69  GLN A O    5  
ATOM 8551  C CB   . GLN A 1 69  ? 1.472   10.497  -1.743  1.00 0.00 ? 69  GLN A CB   5  
ATOM 8552  C CG   . GLN A 1 69  ? 2.865   10.060  -1.323  1.00 0.00 ? 69  GLN A CG   5  
ATOM 8553  C CD   . GLN A 1 69  ? 3.400   10.865  -0.154  1.00 0.00 ? 69  GLN A CD   5  
ATOM 8554  O OE1  . GLN A 1 69  ? 3.442   12.094  -0.199  1.00 0.00 ? 69  GLN A OE1  5  
ATOM 8555  N NE2  . GLN A 1 69  ? 3.811   10.173  0.903   1.00 0.00 ? 69  GLN A NE2  5  
ATOM 8556  H H    . GLN A 1 69  ? -1.047  10.601  -2.721  1.00 0.00 ? 69  GLN A H    5  
ATOM 8557  H HA   . GLN A 1 69  ? 1.355   8.987   -3.255  1.00 0.00 ? 69  GLN A HA   5  
ATOM 8558  H HB2  . GLN A 1 69  ? 1.566   11.375  -2.366  1.00 0.00 ? 69  GLN A HB2  5  
ATOM 8559  H HB3  . GLN A 1 69  ? 0.915   10.755  -0.854  1.00 0.00 ? 69  GLN A HB3  5  
ATOM 8560  H HG2  . GLN A 1 69  ? 2.833   9.019   -1.038  1.00 0.00 ? 69  GLN A HG2  5  
ATOM 8561  H HG3  . GLN A 1 69  ? 3.536   10.182  -2.161  1.00 0.00 ? 69  GLN A HG3  5  
ATOM 8562  H HE21 . GLN A 1 69  ? 3.748   9.195   0.868   1.00 0.00 ? 69  GLN A HE21 5  
ATOM 8563  H HE22 . GLN A 1 69  ? 4.161   10.667  1.673   1.00 0.00 ? 69  GLN A HE22 5  
ATOM 8564  N N    . ILE A 1 70  ? 0.871   7.166   -1.647  1.00 0.00 ? 70  ILE A N    5  
ATOM 8565  C CA   . ILE A 1 70  ? 0.522   6.040   -0.790  1.00 0.00 ? 70  ILE A CA   5  
ATOM 8566  C C    . ILE A 1 70  ? 1.335   6.060   0.501   1.00 0.00 ? 70  ILE A C    5  
ATOM 8567  O O    . ILE A 1 70  ? 2.564   6.125   0.472   1.00 0.00 ? 70  ILE A O    5  
ATOM 8568  C CB   . ILE A 1 70  ? 0.753   4.695   -1.505  1.00 0.00 ? 70  ILE A CB   5  
ATOM 8569  C CG1  . ILE A 1 70  ? 0.120   4.716   -2.897  1.00 0.00 ? 70  ILE A CG1  5  
ATOM 8570  C CG2  . ILE A 1 70  ? 0.190   3.550   -0.677  1.00 0.00 ? 70  ILE A CG2  5  
ATOM 8571  C CD1  . ILE A 1 70  ? 0.550   3.560   -3.773  1.00 0.00 ? 70  ILE A CD1  5  
ATOM 8572  H H    . ILE A 1 70  ? 1.592   7.063   -2.303  1.00 0.00 ? 70  ILE A H    5  
ATOM 8573  H HA   . ILE A 1 70  ? -0.526  6.118   -0.544  1.00 0.00 ? 70  ILE A HA   5  
ATOM 8574  H HB   . ILE A 1 70  ? 1.819   4.544   -1.605  1.00 0.00 ? 70  ILE A HB   5  
ATOM 8575  H HG12 . ILE A 1 70  ? -0.955  4.672   -2.796  1.00 0.00 ? 70  ILE A HG12 5  
ATOM 8576  H HG13 . ILE A 1 70  ? 0.393   5.633   -3.397  1.00 0.00 ? 70  ILE A HG13 5  
ATOM 8577  H HG21 . ILE A 1 70  ? -0.596  3.921   -0.037  1.00 0.00 ? 70  ILE A HG21 5  
ATOM 8578  H HG22 . ILE A 1 70  ? 0.975   3.123   -0.070  1.00 0.00 ? 70  ILE A HG22 5  
ATOM 8579  H HG23 . ILE A 1 70  ? -0.208  2.792   -1.334  1.00 0.00 ? 70  ILE A HG23 5  
ATOM 8580  H HD11 . ILE A 1 70  ? 0.296   2.628   -3.292  1.00 0.00 ? 70  ILE A HD11 5  
ATOM 8581  H HD12 . ILE A 1 70  ? 1.617   3.605   -3.930  1.00 0.00 ? 70  ILE A HD12 5  
ATOM 8582  H HD13 . ILE A 1 70  ? 0.043   3.623   -4.725  1.00 0.00 ? 70  ILE A HD13 5  
ATOM 8583  N N    . LEU A 1 71  ? 0.641   6.007   1.633   1.00 0.00 ? 71  LEU A N    5  
ATOM 8584  C CA   . LEU A 1 71  ? 1.298   6.019   2.934   1.00 0.00 ? 71  LEU A CA   5  
ATOM 8585  C C    . LEU A 1 71  ? 1.622   4.600   3.393   1.00 0.00 ? 71  LEU A C    5  
ATOM 8586  O O    . LEU A 1 71  ? 2.788   4.233   3.531   1.00 0.00 ? 71  LEU A O    5  
ATOM 8587  C CB   . LEU A 1 71  ? 0.413   6.713   3.970   1.00 0.00 ? 71  LEU A CB   5  
ATOM 8588  C CG   . LEU A 1 71  ? 0.135   8.192   3.696   1.00 0.00 ? 71  LEU A CG   5  
ATOM 8589  C CD1  . LEU A 1 71  ? -0.864  8.742   4.703   1.00 0.00 ? 71  LEU A CD1  5  
ATOM 8590  C CD2  . LEU A 1 71  ? 1.429   8.993   3.736   1.00 0.00 ? 71  LEU A CD2  5  
ATOM 8591  H H    . LEU A 1 71  ? -0.338  5.956   1.592   1.00 0.00 ? 71  LEU A H    5  
ATOM 8592  H HA   . LEU A 1 71  ? 2.221   6.570   2.833   1.00 0.00 ? 71  LEU A HA   5  
ATOM 8593  H HB2  . LEU A 1 71  ? -0.532  6.192   4.013   1.00 0.00 ? 71  LEU A HB2  5  
ATOM 8594  H HB3  . LEU A 1 71  ? 0.892   6.633   4.934   1.00 0.00 ? 71  LEU A HB3  5  
ATOM 8595  H HG   . LEU A 1 71  ? -0.294  8.295   2.710   1.00 0.00 ? 71  LEU A HG   5  
ATOM 8596  H HD11 . LEU A 1 71  ? -1.450  7.930   5.108   1.00 0.00 ? 71  LEU A HD11 5  
ATOM 8597  H HD12 . LEU A 1 71  ? -1.518  9.447   4.212   1.00 0.00 ? 71  LEU A HD12 5  
ATOM 8598  H HD13 . LEU A 1 71  ? -0.334  9.237   5.503   1.00 0.00 ? 71  LEU A HD13 5  
ATOM 8599  H HD21 . LEU A 1 71  ? 1.852   8.945   4.728   1.00 0.00 ? 71  LEU A HD21 5  
ATOM 8600  H HD22 . LEU A 1 71  ? 1.223   10.022  3.482   1.00 0.00 ? 71  LEU A HD22 5  
ATOM 8601  H HD23 . LEU A 1 71  ? 2.129   8.579   3.026   1.00 0.00 ? 71  LEU A HD23 5  
ATOM 8602  N N    . GLU A 1 72  ? 0.581   3.807   3.626   1.00 0.00 ? 72  GLU A N    5  
ATOM 8603  C CA   . GLU A 1 72  ? 0.754   2.429   4.069   1.00 0.00 ? 72  GLU A CA   5  
ATOM 8604  C C    . GLU A 1 72  ? -0.172  1.491   3.300   1.00 0.00 ? 72  GLU A C    5  
ATOM 8605  O O    . GLU A 1 72  ? -1.113  1.935   2.643   1.00 0.00 ? 72  GLU A O    5  
ATOM 8606  C CB   . GLU A 1 72  ? 0.483   2.315   5.570   1.00 0.00 ? 72  GLU A CB   5  
ATOM 8607  C CG   . GLU A 1 72  ? -0.943  2.668   5.960   1.00 0.00 ? 72  GLU A CG   5  
ATOM 8608  C CD   . GLU A 1 72  ? -1.042  4.010   6.658   1.00 0.00 ? 72  GLU A CD   5  
ATOM 8609  O OE1  . GLU A 1 72  ? -0.104  4.823   6.518   1.00 0.00 ? 72  GLU A OE1  5  
ATOM 8610  O OE2  . GLU A 1 72  ? -2.057  4.249   7.345   1.00 0.00 ? 72  GLU A OE2  5  
ATOM 8611  H H    . GLU A 1 72  ? -0.325  4.158   3.498   1.00 0.00 ? 72  GLU A H    5  
ATOM 8612  H HA   . GLU A 1 72  ? 1.777   2.144   3.873   1.00 0.00 ? 72  GLU A HA   5  
ATOM 8613  H HB2  . GLU A 1 72  ? 0.679   1.299   5.883   1.00 0.00 ? 72  GLU A HB2  5  
ATOM 8614  H HB3  . GLU A 1 72  ? 1.154   2.979   6.097   1.00 0.00 ? 72  GLU A HB3  5  
ATOM 8615  H HG2  . GLU A 1 72  ? -1.549  2.698   5.067   1.00 0.00 ? 72  GLU A HG2  5  
ATOM 8616  H HG3  . GLU A 1 72  ? -1.320  1.903   6.625   1.00 0.00 ? 72  GLU A HG3  5  
ATOM 8617  N N    . VAL A 1 73  ? 0.102   0.194   3.388   1.00 0.00 ? 73  VAL A N    5  
ATOM 8618  C CA   . VAL A 1 73  ? -0.707  -0.804  2.701   1.00 0.00 ? 73  VAL A CA   5  
ATOM 8619  C C    . VAL A 1 73  ? -0.693  -2.133  3.449   1.00 0.00 ? 73  VAL A C    5  
ATOM 8620  O O    . VAL A 1 73  ? 0.368   -2.713  3.684   1.00 0.00 ? 73  VAL A O    5  
ATOM 8621  C CB   . VAL A 1 73  ? -0.213  -1.035  1.261   1.00 0.00 ? 73  VAL A CB   5  
ATOM 8622  C CG1  . VAL A 1 73  ? -1.185  -1.919  0.496   1.00 0.00 ? 73  VAL A CG1  5  
ATOM 8623  C CG2  . VAL A 1 73  ? -0.013  0.294   0.547   1.00 0.00 ? 73  VAL A CG2  5  
ATOM 8624  H H    . VAL A 1 73  ? 0.866   -0.098  3.928   1.00 0.00 ? 73  VAL A H    5  
ATOM 8625  H HA   . VAL A 1 73  ? -1.723  -0.438  2.656   1.00 0.00 ? 73  VAL A HA   5  
ATOM 8626  H HB   . VAL A 1 73  ? 0.740   -1.541  1.305   1.00 0.00 ? 73  VAL A HB   5  
ATOM 8627  H HG11 . VAL A 1 73  ? -1.787  -2.480  1.195   1.00 0.00 ? 73  VAL A HG11 5  
ATOM 8628  H HG12 . VAL A 1 73  ? -0.633  -2.602  -0.133  1.00 0.00 ? 73  VAL A HG12 5  
ATOM 8629  H HG13 . VAL A 1 73  ? -1.826  -1.302  -0.118  1.00 0.00 ? 73  VAL A HG13 5  
ATOM 8630  H HG21 . VAL A 1 73  ? -0.941  0.846   0.547   1.00 0.00 ? 73  VAL A HG21 5  
ATOM 8631  H HG22 . VAL A 1 73  ? 0.297   0.112   -0.472  1.00 0.00 ? 73  VAL A HG22 5  
ATOM 8632  H HG23 . VAL A 1 73  ? 0.747   0.867   1.058   1.00 0.00 ? 73  VAL A HG23 5  
ATOM 8633  N N    . ASN A 1 74  ? -1.876  -2.611  3.819   1.00 0.00 ? 74  ASN A N    5  
ATOM 8634  C CA   . ASN A 1 74  ? -2.000  -3.872  4.541   1.00 0.00 ? 74  ASN A CA   5  
ATOM 8635  C C    . ASN A 1 74  ? -1.251  -3.816  5.868   1.00 0.00 ? 74  ASN A C    5  
ATOM 8636  O O    . ASN A 1 74  ? -0.744  -4.829  6.349   1.00 0.00 ? 74  ASN A O    5  
ATOM 8637  C CB   . ASN A 1 74  ? -1.467  -5.026  3.689   1.00 0.00 ? 74  ASN A CB   5  
ATOM 8638  C CG   . ASN A 1 74  ? -2.486  -5.518  2.681   1.00 0.00 ? 74  ASN A CG   5  
ATOM 8639  O OD1  . ASN A 1 74  ? -3.477  -6.152  3.041   1.00 0.00 ? 74  ASN A OD1  5  
ATOM 8640  N ND2  . ASN A 1 74  ? -2.246  -5.228  1.407   1.00 0.00 ? 74  ASN A ND2  5  
ATOM 8641  H H    . ASN A 1 74  ? -2.686  -2.103  3.602   1.00 0.00 ? 74  ASN A H    5  
ATOM 8642  H HA   . ASN A 1 74  ? -3.049  -4.039  4.739   1.00 0.00 ? 74  ASN A HA   5  
ATOM 8643  H HB2  . ASN A 1 74  ? -0.589  -4.693  3.152   1.00 0.00 ? 74  ASN A HB2  5  
ATOM 8644  H HB3  . ASN A 1 74  ? -1.201  -5.850  4.337   1.00 0.00 ? 74  ASN A HB3  5  
ATOM 8645  H HD21 . ASN A 1 74  ? -1.436  -4.720  1.193   1.00 0.00 ? 74  ASN A HD21 5  
ATOM 8646  H HD22 . ASN A 1 74  ? -2.888  -5.534  0.734   1.00 0.00 ? 74  ASN A HD22 5  
ATOM 8647  N N    . GLY A 1 75  ? -1.187  -2.626  6.456   1.00 0.00 ? 75  GLY A N    5  
ATOM 8648  C CA   . GLY A 1 75  ? -0.498  -2.461  7.721   1.00 0.00 ? 75  GLY A CA   5  
ATOM 8649  C C    . GLY A 1 75  ? 1.006   -2.362  7.555   1.00 0.00 ? 75  GLY A C    5  
ATOM 8650  O O    . GLY A 1 75  ? 1.763   -2.729  8.455   1.00 0.00 ? 75  GLY A O    5  
ATOM 8651  H H    . GLY A 1 75  ? -1.610  -1.853  6.025   1.00 0.00 ? 75  GLY A H    5  
ATOM 8652  H HA2  . GLY A 1 75  ? -0.856  -1.560  8.199   1.00 0.00 ? 75  GLY A HA2  5  
ATOM 8653  H HA3  . GLY A 1 75  ? -0.723  -3.305  8.355   1.00 0.00 ? 75  GLY A HA3  5  
ATOM 8654  N N    . ARG A 1 76  ? 1.441   -1.865  6.401   1.00 0.00 ? 76  ARG A N    5  
ATOM 8655  C CA   . ARG A 1 76  ? 2.865   -1.720  6.120   1.00 0.00 ? 76  ARG A CA   5  
ATOM 8656  C C    . ARG A 1 76  ? 3.182   -0.309  5.636   1.00 0.00 ? 76  ARG A C    5  
ATOM 8657  O O    . ARG A 1 76  ? 2.521   0.214   4.738   1.00 0.00 ? 76  ARG A O    5  
ATOM 8658  C CB   . ARG A 1 76  ? 3.305   -2.742  5.071   1.00 0.00 ? 76  ARG A CB   5  
ATOM 8659  C CG   . ARG A 1 76  ? 4.809   -2.778  4.852   1.00 0.00 ? 76  ARG A CG   5  
ATOM 8660  C CD   . ARG A 1 76  ? 5.288   -4.181  4.512   1.00 0.00 ? 76  ARG A CD   5  
ATOM 8661  N NE   . ARG A 1 76  ? 6.551   -4.502  5.174   1.00 0.00 ? 76  ARG A NE   5  
ATOM 8662  C CZ   . ARG A 1 76  ? 7.358   -5.488  4.789   1.00 0.00 ? 76  ARG A CZ   5  
ATOM 8663  N NH1  . ARG A 1 76  ? 7.042   -6.249  3.749   1.00 0.00 ? 76  ARG A NH1  5  
ATOM 8664  N NH2  . ARG A 1 76  ? 8.488   -5.713  5.447   1.00 0.00 ? 76  ARG A NH2  5  
ATOM 8665  H H    . ARG A 1 76  ? 0.788   -1.590  5.723   1.00 0.00 ? 76  ARG A H    5  
ATOM 8666  H HA   . ARG A 1 76  ? 3.404   -1.903  7.037   1.00 0.00 ? 76  ARG A HA   5  
ATOM 8667  H HB2  . ARG A 1 76  ? 2.985   -3.725  5.386   1.00 0.00 ? 76  ARG A HB2  5  
ATOM 8668  H HB3  . ARG A 1 76  ? 2.831   -2.504  4.131   1.00 0.00 ? 76  ARG A HB3  5  
ATOM 8669  H HG2  . ARG A 1 76  ? 5.060   -2.115  4.038   1.00 0.00 ? 76  ARG A HG2  5  
ATOM 8670  H HG3  . ARG A 1 76  ? 5.302   -2.447  5.755   1.00 0.00 ? 76  ARG A HG3  5  
ATOM 8671  H HD2  . ARG A 1 76  ? 4.538   -4.891  4.824   1.00 0.00 ? 76  ARG A HD2  5  
ATOM 8672  H HD3  . ARG A 1 76  ? 5.425   -4.250  3.443   1.00 0.00 ? 76  ARG A HD3  5  
ATOM 8673  H HE   . ARG A 1 76  ? 6.809   -3.956  5.945   1.00 0.00 ? 76  ARG A HE   5  
ATOM 8674  H HH11 . ARG A 1 76  ? 6.192   -6.085  3.249   1.00 0.00 ? 76  ARG A HH11 5  
ATOM 8675  H HH12 . ARG A 1 76  ? 7.653   -6.987  3.466   1.00 0.00 ? 76  ARG A HH12 5  
ATOM 8676  H HH21 . ARG A 1 76  ? 8.732   -5.142  6.232   1.00 0.00 ? 76  ARG A HH21 5  
ATOM 8677  H HH22 . ARG A 1 76  ? 9.096   -6.453  5.159   1.00 0.00 ? 76  ARG A HH22 5  
ATOM 8678  N N    . SER A 1 77  ? 4.198   0.302   6.237   1.00 0.00 ? 77  SER A N    5  
ATOM 8679  C CA   . SER A 1 77  ? 4.604   1.653   5.868   1.00 0.00 ? 77  SER A CA   5  
ATOM 8680  C C    . SER A 1 77  ? 5.258   1.668   4.490   1.00 0.00 ? 77  SER A C    5  
ATOM 8681  O O    . SER A 1 77  ? 6.296   1.041   4.278   1.00 0.00 ? 77  SER A O    5  
ATOM 8682  C CB   . SER A 1 77  ? 5.569   2.220   6.911   1.00 0.00 ? 77  SER A CB   5  
ATOM 8683  O OG   . SER A 1 77  ? 5.309   3.592   7.154   1.00 0.00 ? 77  SER A OG   5  
ATOM 8684  H H    . SER A 1 77  ? 4.686   -0.167  6.946   1.00 0.00 ? 77  SER A H    5  
ATOM 8685  H HA   . SER A 1 77  ? 3.717   2.269   5.839   1.00 0.00 ? 77  SER A HA   5  
ATOM 8686  H HB2  . SER A 1 77  ? 5.455   1.676   7.836   1.00 0.00 ? 77  SER A HB2  5  
ATOM 8687  H HB3  . SER A 1 77  ? 6.583   2.116   6.555   1.00 0.00 ? 77  SER A HB3  5  
ATOM 8688  H HG   . SER A 1 77  ? 5.004   3.705   8.057   1.00 0.00 ? 77  SER A HG   5  
ATOM 8689  N N    . PHE A 1 78  ? 4.644   2.388   3.558   1.00 0.00 ? 78  PHE A N    5  
ATOM 8690  C CA   . PHE A 1 78  ? 5.166   2.485   2.199   1.00 0.00 ? 78  PHE A CA   5  
ATOM 8691  C C    . PHE A 1 78  ? 5.935   3.789   2.004   1.00 0.00 ? 78  PHE A C    5  
ATOM 8692  O O    . PHE A 1 78  ? 5.821   4.439   0.966   1.00 0.00 ? 78  PHE A O    5  
ATOM 8693  C CB   . PHE A 1 78  ? 4.023   2.394   1.186   1.00 0.00 ? 78  PHE A CB   5  
ATOM 8694  C CG   . PHE A 1 78  ? 3.721   0.989   0.747   1.00 0.00 ? 78  PHE A CG   5  
ATOM 8695  C CD1  . PHE A 1 78  ? 3.508   -0.012  1.682   1.00 0.00 ? 78  PHE A CD1  5  
ATOM 8696  C CD2  . PHE A 1 78  ? 3.647   0.671   -0.599  1.00 0.00 ? 78  PHE A CD2  5  
ATOM 8697  C CE1  . PHE A 1 78  ? 3.230   -1.305  1.282   1.00 0.00 ? 78  PHE A CE1  5  
ATOM 8698  C CE2  . PHE A 1 78  ? 3.369   -0.620  -1.005  1.00 0.00 ? 78  PHE A CE2  5  
ATOM 8699  C CZ   . PHE A 1 78  ? 3.159   -1.609  -0.064  1.00 0.00 ? 78  PHE A CZ   5  
ATOM 8700  H H    . PHE A 1 78  ? 3.820   2.865   3.788   1.00 0.00 ? 78  PHE A H    5  
ATOM 8701  H HA   . PHE A 1 78  ? 5.841   1.657   2.043   1.00 0.00 ? 78  PHE A HA   5  
ATOM 8702  H HB2  . PHE A 1 78  ? 3.127   2.805   1.626   1.00 0.00 ? 78  PHE A HB2  5  
ATOM 8703  H HB3  . PHE A 1 78  ? 4.282   2.968   0.308   1.00 0.00 ? 78  PHE A HB3  5  
ATOM 8704  H HD1  . PHE A 1 78  ? 3.563   0.225   2.734   1.00 0.00 ? 78  PHE A HD1  5  
ATOM 8705  H HD2  . PHE A 1 78  ? 3.811   1.443   -1.336  1.00 0.00 ? 78  PHE A HD2  5  
ATOM 8706  H HE1  . PHE A 1 78  ? 3.066   -2.076  2.019   1.00 0.00 ? 78  PHE A HE1  5  
ATOM 8707  H HE2  . PHE A 1 78  ? 3.314   -0.855  -2.058  1.00 0.00 ? 78  PHE A HE2  5  
ATOM 8708  H HZ   . PHE A 1 78  ? 2.942   -2.619  -0.380  1.00 0.00 ? 78  PHE A HZ   5  
ATOM 8709  N N    . LEU A 1 79  ? 6.718   4.163   3.010   1.00 0.00 ? 79  LEU A N    5  
ATOM 8710  C CA   . LEU A 1 79  ? 7.505   5.390   2.949   1.00 0.00 ? 79  LEU A CA   5  
ATOM 8711  C C    . LEU A 1 79  ? 8.914   5.107   2.433   1.00 0.00 ? 79  LEU A C    5  
ATOM 8712  O O    . LEU A 1 79  ? 9.528   5.954   1.785   1.00 0.00 ? 79  LEU A O    5  
ATOM 8713  C CB   . LEU A 1 79  ? 7.578   6.043   4.330   1.00 0.00 ? 79  LEU A CB   5  
ATOM 8714  C CG   . LEU A 1 79  ? 6.345   6.858   4.726   1.00 0.00 ? 79  LEU A CG   5  
ATOM 8715  C CD1  . LEU A 1 79  ? 6.337   7.121   6.224   1.00 0.00 ? 79  LEU A CD1  5  
ATOM 8716  C CD2  . LEU A 1 79  ? 6.304   8.169   3.953   1.00 0.00 ? 79  LEU A CD2  5  
ATOM 8717  H H    . LEU A 1 79  ? 6.767   3.604   3.813   1.00 0.00 ? 79  LEU A H    5  
ATOM 8718  H HA   . LEU A 1 79  ? 7.013   6.065   2.266   1.00 0.00 ? 79  LEU A HA   5  
ATOM 8719  H HB2  . LEU A 1 79  ? 7.721   5.265   5.066   1.00 0.00 ? 79  LEU A HB2  5  
ATOM 8720  H HB3  . LEU A 1 79  ? 8.435   6.698   4.351   1.00 0.00 ? 79  LEU A HB3  5  
ATOM 8721  H HG   . LEU A 1 79  ? 5.456   6.296   4.481   1.00 0.00 ? 79  LEU A HG   5  
ATOM 8722  H HD11 . LEU A 1 79  ? 7.332   7.389   6.548   1.00 0.00 ? 79  LEU A HD11 5  
ATOM 8723  H HD12 . LEU A 1 79  ? 6.017   6.230   6.743   1.00 0.00 ? 79  LEU A HD12 5  
ATOM 8724  H HD13 . LEU A 1 79  ? 5.657   7.930   6.444   1.00 0.00 ? 79  LEU A HD13 5  
ATOM 8725  H HD21 . LEU A 1 79  ? 5.279   8.412   3.713   1.00 0.00 ? 79  LEU A HD21 5  
ATOM 8726  H HD22 . LEU A 1 79  ? 6.873   8.067   3.041   1.00 0.00 ? 79  LEU A HD22 5  
ATOM 8727  H HD23 . LEU A 1 79  ? 6.729   8.957   4.556   1.00 0.00 ? 79  LEU A HD23 5  
ATOM 8728  N N    . ASN A 1 80  ? 9.418   3.913   2.725   1.00 0.00 ? 80  ASN A N    5  
ATOM 8729  C CA   . ASN A 1 80  ? 10.753  3.521   2.291   1.00 0.00 ? 80  ASN A CA   5  
ATOM 8730  C C    . ASN A 1 80  ? 10.737  2.128   1.669   1.00 0.00 ? 80  ASN A C    5  
ATOM 8731  O O    . ASN A 1 80  ? 11.646  1.327   1.890   1.00 0.00 ? 80  ASN A O    5  
ATOM 8732  C CB   . ASN A 1 80  ? 11.728  3.556   3.470   1.00 0.00 ? 80  ASN A CB   5  
ATOM 8733  C CG   . ASN A 1 80  ? 13.170  3.389   3.034   1.00 0.00 ? 80  ASN A CG   5  
ATOM 8734  O OD1  . ASN A 1 80  ? 13.681  4.169   2.229   1.00 0.00 ? 80  ASN A OD1  5  
ATOM 8735  N ND2  . ASN A 1 80  ? 13.835  2.369   3.564   1.00 0.00 ? 80  ASN A ND2  5  
ATOM 8736  H H    . ASN A 1 80  ? 8.880   3.281   3.246   1.00 0.00 ? 80  ASN A H    5  
ATOM 8737  H HA   . ASN A 1 80  ? 11.080  4.230   1.545   1.00 0.00 ? 80  ASN A HA   5  
ATOM 8738  H HB2  . ASN A 1 80  ? 11.632  4.503   3.980   1.00 0.00 ? 80  ASN A HB2  5  
ATOM 8739  H HB3  . ASN A 1 80  ? 11.482  2.757   4.155   1.00 0.00 ? 80  ASN A HB3  5  
ATOM 8740  H HD21 . ASN A 1 80  ? 13.363  1.789   4.198   1.00 0.00 ? 80  ASN A HD21 5  
ATOM 8741  H HD22 . ASN A 1 80  ? 14.769  2.238   3.300   1.00 0.00 ? 80  ASN A HD22 5  
ATOM 8742  N N    . ILE A 1 81  ? 9.697   1.845   0.891   1.00 0.00 ? 81  ILE A N    5  
ATOM 8743  C CA   . ILE A 1 81  ? 9.563   0.548   0.238   1.00 0.00 ? 81  ILE A CA   5  
ATOM 8744  C C    . ILE A 1 81  ? 10.134  0.586   -1.177  1.00 0.00 ? 81  ILE A C    5  
ATOM 8745  O O    . ILE A 1 81  ? 10.062  1.608   -1.859  1.00 0.00 ? 81  ILE A O    5  
ATOM 8746  C CB   . ILE A 1 81  ? 8.088   0.098   0.181   1.00 0.00 ? 81  ILE A CB   5  
ATOM 8747  C CG1  . ILE A 1 81  ? 7.979   -1.302  -0.429  1.00 0.00 ? 81  ILE A CG1  5  
ATOM 8748  C CG2  . ILE A 1 81  ? 7.255   1.096   -0.610  1.00 0.00 ? 81  ILE A CG2  5  
ATOM 8749  C CD1  . ILE A 1 81  ? 6.905   -2.157  0.208   1.00 0.00 ? 81  ILE A CD1  5  
ATOM 8750  H H    . ILE A 1 81  ? 9.004   2.523   0.753   1.00 0.00 ? 81  ILE A H    5  
ATOM 8751  H HA   . ILE A 1 81  ? 10.117  -0.176  0.818   1.00 0.00 ? 81  ILE A HA   5  
ATOM 8752  H HB   . ILE A 1 81  ? 7.706   0.071   1.191   1.00 0.00 ? 81  ILE A HB   5  
ATOM 8753  H HG12 . ILE A 1 81  ? 7.750   -1.212  -1.481  1.00 0.00 ? 81  ILE A HG12 5  
ATOM 8754  H HG13 . ILE A 1 81  ? 8.923   -1.813  -0.314  1.00 0.00 ? 81  ILE A HG13 5  
ATOM 8755  H HG21 . ILE A 1 81  ? 6.734   1.751   0.071   1.00 0.00 ? 81  ILE A HG21 5  
ATOM 8756  H HG22 . ILE A 1 81  ? 6.538   0.566   -1.219  1.00 0.00 ? 81  ILE A HG22 5  
ATOM 8757  H HG23 . ILE A 1 81  ? 7.903   1.682   -1.246  1.00 0.00 ? 81  ILE A HG23 5  
ATOM 8758  H HD11 . ILE A 1 81  ? 7.357   -2.827  0.923   1.00 0.00 ? 81  ILE A HD11 5  
ATOM 8759  H HD12 . ILE A 1 81  ? 6.402   -2.731  -0.556  1.00 0.00 ? 81  ILE A HD12 5  
ATOM 8760  H HD13 . ILE A 1 81  ? 6.191   -1.522  0.710   1.00 0.00 ? 81  ILE A HD13 5  
ATOM 8761  N N    . LEU A 1 82  ? 10.699  -0.535  -1.611  1.00 0.00 ? 82  LEU A N    5  
ATOM 8762  C CA   . LEU A 1 82  ? 11.282  -0.631  -2.945  1.00 0.00 ? 82  LEU A CA   5  
ATOM 8763  C C    . LEU A 1 82  ? 10.232  -0.360  -4.019  1.00 0.00 ? 82  LEU A C    5  
ATOM 8764  O O    . LEU A 1 82  ? 9.031   -0.430  -3.758  1.00 0.00 ? 82  LEU A O    5  
ATOM 8765  C CB   . LEU A 1 82  ? 11.899  -2.015  -3.156  1.00 0.00 ? 82  LEU A CB   5  
ATOM 8766  C CG   . LEU A 1 82  ? 13.374  -2.133  -2.762  1.00 0.00 ? 82  LEU A CG   5  
ATOM 8767  C CD1  . LEU A 1 82  ? 13.659  -3.502  -2.164  1.00 0.00 ? 82  LEU A CD1  5  
ATOM 8768  C CD2  . LEU A 1 82  ? 14.268  -1.877  -3.965  1.00 0.00 ? 82  LEU A CD2  5  
ATOM 8769  H H    . LEU A 1 82  ? 10.725  -1.317  -1.022  1.00 0.00 ? 82  LEU A H    5  
ATOM 8770  H HA   . LEU A 1 82  ? 12.058  0.115   -3.021  1.00 0.00 ? 82  LEU A HA   5  
ATOM 8771  H HB2  . LEU A 1 82  ? 11.334  -2.730  -2.576  1.00 0.00 ? 82  LEU A HB2  5  
ATOM 8772  H HB3  . LEU A 1 82  ? 11.809  -2.272  -4.200  1.00 0.00 ? 82  LEU A HB3  5  
ATOM 8773  H HG   . LEU A 1 82  ? 13.599  -1.388  -2.012  1.00 0.00 ? 82  LEU A HG   5  
ATOM 8774  H HD11 . LEU A 1 82  ? 13.339  -4.270  -2.852  1.00 0.00 ? 82  LEU A HD11 5  
ATOM 8775  H HD12 . LEU A 1 82  ? 13.122  -3.608  -1.233  1.00 0.00 ? 82  LEU A HD12 5  
ATOM 8776  H HD13 . LEU A 1 82  ? 14.719  -3.601  -1.981  1.00 0.00 ? 82  LEU A HD13 5  
ATOM 8777  H HD21 . LEU A 1 82  ? 14.267  -2.747  -4.605  1.00 0.00 ? 82  LEU A HD21 5  
ATOM 8778  H HD22 . LEU A 1 82  ? 15.275  -1.679  -3.629  1.00 0.00 ? 82  LEU A HD22 5  
ATOM 8779  H HD23 . LEU A 1 82  ? 13.897  -1.026  -4.515  1.00 0.00 ? 82  LEU A HD23 5  
ATOM 8780  N N    . HIS A 1 83  ? 10.694  -0.051  -5.225  1.00 0.00 ? 83  HIS A N    5  
ATOM 8781  C CA   . HIS A 1 83  ? 9.796   0.230   -6.340  1.00 0.00 ? 83  HIS A CA   5  
ATOM 8782  C C    . HIS A 1 83  ? 9.226   -1.061  -6.919  1.00 0.00 ? 83  HIS A C    5  
ATOM 8783  O O    . HIS A 1 83  ? 8.075   -1.103  -7.353  1.00 0.00 ? 83  HIS A O    5  
ATOM 8784  C CB   . HIS A 1 83  ? 10.532  1.011   -7.430  1.00 0.00 ? 83  HIS A CB   5  
ATOM 8785  C CG   . HIS A 1 83  ? 9.657   1.397   -8.583  1.00 0.00 ? 83  HIS A CG   5  
ATOM 8786  N ND1  . HIS A 1 83  ? 8.279   1.376   -8.522  1.00 0.00 ? 83  HIS A ND1  5  
ATOM 8787  C CD2  . HIS A 1 83  ? 9.971   1.816   -9.832  1.00 0.00 ? 83  HIS A CD2  5  
ATOM 8788  C CE1  . HIS A 1 83  ? 7.784   1.765   -9.684  1.00 0.00 ? 83  HIS A CE1  5  
ATOM 8789  N NE2  . HIS A 1 83  ? 8.789   2.038   -10.494 1.00 0.00 ? 83  HIS A NE2  5  
ATOM 8790  H H    . HIS A 1 83  ? 11.662  -0.012  -5.371  1.00 0.00 ? 83  HIS A H    5  
ATOM 8791  H HA   . HIS A 1 83  ? 8.983   0.832   -5.965  1.00 0.00 ? 83  HIS A HA   5  
ATOM 8792  H HB2  . HIS A 1 83  ? 10.936  1.919   -7.002  1.00 0.00 ? 83  HIS A HB2  5  
ATOM 8793  H HB3  . HIS A 1 83  ? 11.342  0.404   -7.814  1.00 0.00 ? 83  HIS A HB3  5  
ATOM 8794  H HD1  . HIS A 1 83  ? 7.744   1.115   -7.745  1.00 0.00 ? 83  HIS A HD1  5  
ATOM 8795  H HD2  . HIS A 1 83  ? 10.966  1.951   -10.231 1.00 0.00 ? 83  HIS A HD2  5  
ATOM 8796  H HE1  . HIS A 1 83  ? 6.735   1.847   -9.929  1.00 0.00 ? 83  HIS A HE1  5  
ATOM 8797  H HE2  . HIS A 1 83  ? 8.704   2.265   -11.445 1.00 0.00 ? 83  HIS A HE2  5  
ATOM 8798  N N    . ASP A 1 84  ? 10.039  -2.112  -6.922  1.00 0.00 ? 84  ASP A N    5  
ATOM 8799  C CA   . ASP A 1 84  ? 9.616   -3.404  -7.448  1.00 0.00 ? 84  ASP A CA   5  
ATOM 8800  C C    . ASP A 1 84  ? 8.771   -4.158  -6.425  1.00 0.00 ? 84  ASP A C    5  
ATOM 8801  O O    . ASP A 1 84  ? 7.876   -4.922  -6.786  1.00 0.00 ? 84  ASP A O    5  
ATOM 8802  C CB   . ASP A 1 84  ? 10.833  -4.243  -7.841  1.00 0.00 ? 84  ASP A CB   5  
ATOM 8803  C CG   . ASP A 1 84  ? 10.617  -5.009  -9.131  1.00 0.00 ? 84  ASP A CG   5  
ATOM 8804  O OD1  . ASP A 1 84  ? 9.476   -5.461  -9.369  1.00 0.00 ? 84  ASP A OD1  5  
ATOM 8805  O OD2  . ASP A 1 84  ? 11.587  -5.156  -9.904  1.00 0.00 ? 84  ASP A OD2  5  
ATOM 8806  H H    . ASP A 1 84  ? 10.946  -2.016  -6.563  1.00 0.00 ? 84  ASP A H    5  
ATOM 8807  H HA   . ASP A 1 84  ? 9.016   -3.223  -8.328  1.00 0.00 ? 84  ASP A HA   5  
ATOM 8808  H HB2  . ASP A 1 84  ? 11.685  -3.592  -7.969  1.00 0.00 ? 84  ASP A HB2  5  
ATOM 8809  H HB3  . ASP A 1 84  ? 11.044  -4.952  -7.053  1.00 0.00 ? 84  ASP A HB3  5  
ATOM 8810  N N    . GLU A 1 85  ? 9.063   -3.938  -5.147  1.00 0.00 ? 85  GLU A N    5  
ATOM 8811  C CA   . GLU A 1 85  ? 8.331   -4.596  -4.072  1.00 0.00 ? 85  GLU A CA   5  
ATOM 8812  C C    . GLU A 1 85  ? 6.944   -3.985  -3.905  1.00 0.00 ? 85  GLU A C    5  
ATOM 8813  O O    . GLU A 1 85  ? 5.982   -4.682  -3.581  1.00 0.00 ? 85  GLU A O    5  
ATOM 8814  C CB   . GLU A 1 85  ? 9.108   -4.490  -2.758  1.00 0.00 ? 85  GLU A CB   5  
ATOM 8815  C CG   . GLU A 1 85  ? 8.719   -5.544  -1.735  1.00 0.00 ? 85  GLU A CG   5  
ATOM 8816  C CD   . GLU A 1 85  ? 9.557   -5.470  -0.474  1.00 0.00 ? 85  GLU A CD   5  
ATOM 8817  O OE1  . GLU A 1 85  ? 9.761   -4.350  0.039   1.00 0.00 ? 85  GLU A OE1  5  
ATOM 8818  O OE2  . GLU A 1 85  ? 10.010  -6.534  0.001   1.00 0.00 ? 85  GLU A OE2  5  
ATOM 8819  H H    . GLU A 1 85  ? 9.788   -3.318  -4.923  1.00 0.00 ? 85  GLU A H    5  
ATOM 8820  H HA   . GLU A 1 85  ? 8.224   -5.638  -4.334  1.00 0.00 ? 85  GLU A HA   5  
ATOM 8821  H HB2  . GLU A 1 85  ? 10.163  -4.595  -2.967  1.00 0.00 ? 85  GLU A HB2  5  
ATOM 8822  H HB3  . GLU A 1 85  ? 8.931   -3.517  -2.326  1.00 0.00 ? 85  GLU A HB3  5  
ATOM 8823  H HG2  . GLU A 1 85  ? 7.682   -5.402  -1.468  1.00 0.00 ? 85  GLU A HG2  5  
ATOM 8824  H HG3  . GLU A 1 85  ? 8.844   -6.522  -2.178  1.00 0.00 ? 85  GLU A HG3  5  
ATOM 8825  N N    . ALA A 1 86  ? 6.847   -2.678  -4.131  1.00 0.00 ? 86  ALA A N    5  
ATOM 8826  C CA   . ALA A 1 86  ? 5.577   -1.974  -4.007  1.00 0.00 ? 86  ALA A CA   5  
ATOM 8827  C C    . ALA A 1 86  ? 4.569   -2.474  -5.036  1.00 0.00 ? 86  ALA A C    5  
ATOM 8828  O O    . ALA A 1 86  ? 3.362   -2.470  -4.790  1.00 0.00 ? 86  ALA A O    5  
ATOM 8829  C CB   . ALA A 1 86  ? 5.789   -0.475  -4.157  1.00 0.00 ? 86  ALA A CB   5  
ATOM 8830  H H    . ALA A 1 86  ? 7.649   -2.177  -4.387  1.00 0.00 ? 86  ALA A H    5  
ATOM 8831  H HA   . ALA A 1 86  ? 5.188   -2.161  -3.016  1.00 0.00 ? 86  ALA A HA   5  
ATOM 8832  H HB1  . ALA A 1 86  ? 4.847   0.037   -4.024  1.00 0.00 ? 86  ALA A HB1  5  
ATOM 8833  H HB2  . ALA A 1 86  ? 6.177   -0.263  -5.143  1.00 0.00 ? 86  ALA A HB2  5  
ATOM 8834  H HB3  . ALA A 1 86  ? 6.492   -0.133  -3.413  1.00 0.00 ? 86  ALA A HB3  5  
ATOM 8835  N N    . VAL A 1 87  ? 5.071   -2.903  -6.188  1.00 0.00 ? 87  VAL A N    5  
ATOM 8836  C CA   . VAL A 1 87  ? 4.213   -3.406  -7.254  1.00 0.00 ? 87  VAL A CA   5  
ATOM 8837  C C    . VAL A 1 87  ? 3.902   -4.885  -7.059  1.00 0.00 ? 87  VAL A C    5  
ATOM 8838  O O    . VAL A 1 87  ? 2.742   -5.294  -7.087  1.00 0.00 ? 87  VAL A O    5  
ATOM 8839  C CB   . VAL A 1 87  ? 4.862   -3.209  -8.638  1.00 0.00 ? 87  VAL A CB   5  
ATOM 8840  C CG1  . VAL A 1 87  ? 3.877   -3.553  -9.744  1.00 0.00 ? 87  VAL A CG1  5  
ATOM 8841  C CG2  . VAL A 1 87  ? 5.373   -1.785  -8.791  1.00 0.00 ? 87  VAL A CG2  5  
ATOM 8842  H H    . VAL A 1 87  ? 6.041   -2.881  -6.325  1.00 0.00 ? 87  VAL A H    5  
ATOM 8843  H HA   . VAL A 1 87  ? 3.290   -2.847  -7.231  1.00 0.00 ? 87  VAL A HA   5  
ATOM 8844  H HB   . VAL A 1 87  ? 5.705   -3.881  -8.717  1.00 0.00 ? 87  VAL A HB   5  
ATOM 8845  H HG11 . VAL A 1 87  ? 3.227   -2.708  -9.921  1.00 0.00 ? 87  VAL A HG11 5  
ATOM 8846  H HG12 . VAL A 1 87  ? 3.285   -4.406  -9.447  1.00 0.00 ? 87  VAL A HG12 5  
ATOM 8847  H HG13 . VAL A 1 87  ? 4.418   -3.787  -10.649 1.00 0.00 ? 87  VAL A HG13 5  
ATOM 8848  H HG21 . VAL A 1 87  ? 6.006   -1.721  -9.663  1.00 0.00 ? 87  VAL A HG21 5  
ATOM 8849  H HG22 . VAL A 1 87  ? 5.939   -1.508  -7.914  1.00 0.00 ? 87  VAL A HG22 5  
ATOM 8850  H HG23 . VAL A 1 87  ? 4.535   -1.112  -8.905  1.00 0.00 ? 87  VAL A HG23 5  
ATOM 8851  N N    . ARG A 1 88  ? 4.946   -5.683  -6.860  1.00 0.00 ? 88  ARG A N    5  
ATOM 8852  C CA   . ARG A 1 88  ? 4.784   -7.119  -6.659  1.00 0.00 ? 88  ARG A CA   5  
ATOM 8853  C C    . ARG A 1 88  ? 3.921   -7.403  -5.434  1.00 0.00 ? 88  ARG A C    5  
ATOM 8854  O O    . ARG A 1 88  ? 3.064   -8.287  -5.456  1.00 0.00 ? 88  ARG A O    5  
ATOM 8855  C CB   . ARG A 1 88  ? 6.150   -7.791  -6.504  1.00 0.00 ? 88  ARG A CB   5  
ATOM 8856  C CG   . ARG A 1 88  ? 6.675   -8.405  -7.793  1.00 0.00 ? 88  ARG A CG   5  
ATOM 8857  C CD   . ARG A 1 88  ? 7.828   -9.358  -7.525  1.00 0.00 ? 88  ARG A CD   5  
ATOM 8858  N NE   . ARG A 1 88  ? 7.412   -10.516 -6.736  1.00 0.00 ? 88  ARG A NE   5  
ATOM 8859  C CZ   . ARG A 1 88  ? 8.115   -11.642 -6.643  1.00 0.00 ? 88  ARG A CZ   5  
ATOM 8860  N NH1  . ARG A 1 88  ? 9.269   -11.767 -7.287  1.00 0.00 ? 88  ARG A NH1  5  
ATOM 8861  N NH2  . ARG A 1 88  ? 7.665   -12.646 -5.903  1.00 0.00 ? 88  ARG A NH2  5  
ATOM 8862  H H    . ARG A 1 88  ? 5.847   -5.299  -6.848  1.00 0.00 ? 88  ARG A H    5  
ATOM 8863  H HA   . ARG A 1 88  ? 4.292   -7.521  -7.532  1.00 0.00 ? 88  ARG A HA   5  
ATOM 8864  H HB2  . ARG A 1 88  ? 6.864   -7.056  -6.164  1.00 0.00 ? 88  ARG A HB2  5  
ATOM 8865  H HB3  . ARG A 1 88  ? 6.073   -8.574  -5.764  1.00 0.00 ? 88  ARG A HB3  5  
ATOM 8866  H HG2  . ARG A 1 88  ? 5.874   -8.951  -8.273  1.00 0.00 ? 88  ARG A HG2  5  
ATOM 8867  H HG3  . ARG A 1 88  ? 7.019   -7.612  -8.444  1.00 0.00 ? 88  ARG A HG3  5  
ATOM 8868  H HD2  . ARG A 1 88  ? 8.222   -9.703  -8.470  1.00 0.00 ? 88  ARG A HD2  5  
ATOM 8869  H HD3  . ARG A 1 88  ? 8.600   -8.827  -6.988  1.00 0.00 ? 88  ARG A HD3  5  
ATOM 8870  H HE   . ARG A 1 88  ? 6.563   -10.451 -6.251  1.00 0.00 ? 88  ARG A HE   5  
ATOM 8871  H HH11 . ARG A 1 88  ? 9.615   -11.014 -7.847  1.00 0.00 ? 88  ARG A HH11 5  
ATOM 8872  H HH12 . ARG A 1 88  ? 9.793   -12.616 -7.212  1.00 0.00 ? 88  ARG A HH12 5  
ATOM 8873  H HH21 . ARG A 1 88  ? 6.796   -12.557 -5.416  1.00 0.00 ? 88  ARG A HH21 5  
ATOM 8874  H HH22 . ARG A 1 88  ? 8.193   -13.492 -5.833  1.00 0.00 ? 88  ARG A HH22 5  
ATOM 8875  N N    . LEU A 1 89  ? 4.153   -6.650  -4.364  1.00 0.00 ? 89  LEU A N    5  
ATOM 8876  C CA   . LEU A 1 89  ? 3.396   -6.822  -3.129  1.00 0.00 ? 89  LEU A CA   5  
ATOM 8877  C C    . LEU A 1 89  ? 1.954   -6.360  -3.305  1.00 0.00 ? 89  LEU A C    5  
ATOM 8878  O O    . LEU A 1 89  ? 1.033   -6.930  -2.720  1.00 0.00 ? 89  LEU A O    5  
ATOM 8879  C CB   . LEU A 1 89  ? 4.057   -6.045  -1.988  1.00 0.00 ? 89  LEU A CB   5  
ATOM 8880  C CG   . LEU A 1 89  ? 3.348   -6.153  -0.636  1.00 0.00 ? 89  LEU A CG   5  
ATOM 8881  C CD1  . LEU A 1 89  ? 3.410   -7.579  -0.112  1.00 0.00 ? 89  LEU A CD1  5  
ATOM 8882  C CD2  . LEU A 1 89  ? 3.965   -5.189  0.366   1.00 0.00 ? 89  LEU A CD2  5  
ATOM 8883  H H    . LEU A 1 89  ? 4.850   -5.961  -4.406  1.00 0.00 ? 89  LEU A H    5  
ATOM 8884  H HA   . LEU A 1 89  ? 3.397   -7.873  -2.885  1.00 0.00 ? 89  LEU A HA   5  
ATOM 8885  H HB2  . LEU A 1 89  ? 5.068   -6.410  -1.871  1.00 0.00 ? 89  LEU A HB2  5  
ATOM 8886  H HB3  . LEU A 1 89  ? 4.098   -5.004  -2.265  1.00 0.00 ? 89  LEU A HB3  5  
ATOM 8887  H HG   . LEU A 1 89  ? 2.308   -5.888  -0.760  1.00 0.00 ? 89  LEU A HG   5  
ATOM 8888  H HD11 . LEU A 1 89  ? 3.584   -8.258  -0.934  1.00 0.00 ? 89  LEU A HD11 5  
ATOM 8889  H HD12 . LEU A 1 89  ? 2.474   -7.828  0.367   1.00 0.00 ? 89  LEU A HD12 5  
ATOM 8890  H HD13 . LEU A 1 89  ? 4.215   -7.666  0.603   1.00 0.00 ? 89  LEU A HD13 5  
ATOM 8891  H HD21 . LEU A 1 89  ? 3.310   -5.088  1.218   1.00 0.00 ? 89  LEU A HD21 5  
ATOM 8892  H HD22 . LEU A 1 89  ? 4.100   -4.223  -0.100  1.00 0.00 ? 89  LEU A HD22 5  
ATOM 8893  H HD23 . LEU A 1 89  ? 4.922   -5.568  0.689   1.00 0.00 ? 89  LEU A HD23 5  
ATOM 8894  N N    . LEU A 1 90  ? 1.764   -5.323  -4.116  1.00 0.00 ? 90  LEU A N    5  
ATOM 8895  C CA   . LEU A 1 90  ? 0.432   -4.785  -4.368  1.00 0.00 ? 90  LEU A CA   5  
ATOM 8896  C C    . LEU A 1 90  ? -0.333  -5.666  -5.351  1.00 0.00 ? 90  LEU A C    5  
ATOM 8897  O O    . LEU A 1 90  ? -1.556  -5.775  -5.280  1.00 0.00 ? 90  LEU A O    5  
ATOM 8898  C CB   . LEU A 1 90  ? 0.530   -3.359  -4.914  1.00 0.00 ? 90  LEU A CB   5  
ATOM 8899  C CG   . LEU A 1 90  ? 0.611   -2.263  -3.851  1.00 0.00 ? 90  LEU A CG   5  
ATOM 8900  C CD1  . LEU A 1 90  ? 0.991   -0.933  -4.482  1.00 0.00 ? 90  LEU A CD1  5  
ATOM 8901  C CD2  . LEU A 1 90  ? -0.712  -2.144  -3.108  1.00 0.00 ? 90  LEU A CD2  5  
ATOM 8902  H H    . LEU A 1 90  ? 2.537   -4.911  -4.554  1.00 0.00 ? 90  LEU A H    5  
ATOM 8903  H HA   . LEU A 1 90  ? -0.102  -4.767  -3.430  1.00 0.00 ? 90  LEU A HA   5  
ATOM 8904  H HB2  . LEU A 1 90  ? 1.411   -3.295  -5.537  1.00 0.00 ? 90  LEU A HB2  5  
ATOM 8905  H HB3  . LEU A 1 90  ? -0.337  -3.170  -5.527  1.00 0.00 ? 90  LEU A HB3  5  
ATOM 8906  H HG   . LEU A 1 90  ? 1.377   -2.523  -3.133  1.00 0.00 ? 90  LEU A HG   5  
ATOM 8907  H HD11 . LEU A 1 90  ? 1.648   -1.108  -5.321  1.00 0.00 ? 90  LEU A HD11 5  
ATOM 8908  H HD12 . LEU A 1 90  ? 1.496   -0.318  -3.752  1.00 0.00 ? 90  LEU A HD12 5  
ATOM 8909  H HD13 . LEU A 1 90  ? 0.099   -0.429  -4.823  1.00 0.00 ? 90  LEU A HD13 5  
ATOM 8910  H HD21 . LEU A 1 90  ? -0.535  -1.742  -2.121  1.00 0.00 ? 90  LEU A HD21 5  
ATOM 8911  H HD22 . LEU A 1 90  ? -1.165  -3.121  -3.022  1.00 0.00 ? 90  LEU A HD22 5  
ATOM 8912  H HD23 . LEU A 1 90  ? -1.373  -1.486  -3.652  1.00 0.00 ? 90  LEU A HD23 5  
ATOM 8913  N N    . LYS A 1 91  ? 0.398   -6.293  -6.268  1.00 0.00 ? 91  LYS A N    5  
ATOM 8914  C CA   . LYS A 1 91  ? -0.212  -7.164  -7.266  1.00 0.00 ? 91  LYS A CA   5  
ATOM 8915  C C    . LYS A 1 91  ? 0.149   -8.624  -7.006  1.00 0.00 ? 91  LYS A C    5  
ATOM 8916  O O    . LYS A 1 91  ? 0.980   -9.203  -7.705  1.00 0.00 ? 91  LYS A O    5  
ATOM 8917  C CB   . LYS A 1 91  ? 0.238   -6.757  -8.670  1.00 0.00 ? 91  LYS A CB   5  
ATOM 8918  C CG   . LYS A 1 91  ? -0.502  -5.548  -9.220  1.00 0.00 ? 91  LYS A CG   5  
ATOM 8919  C CD   . LYS A 1 91  ? -0.033  -4.261  -8.561  1.00 0.00 ? 91  LYS A CD   5  
ATOM 8920  C CE   . LYS A 1 91  ? 0.109   -3.134  -9.573  1.00 0.00 ? 91  LYS A CE   5  
ATOM 8921  N NZ   . LYS A 1 91  ? -0.482  -1.862  -9.075  1.00 0.00 ? 91  LYS A NZ   5  
ATOM 8922  H H    . LYS A 1 91  ? 1.369   -6.166  -6.273  1.00 0.00 ? 91  LYS A H    5  
ATOM 8923  H HA   . LYS A 1 91  ? -1.283  -7.052  -7.194  1.00 0.00 ? 91  LYS A HA   5  
ATOM 8924  H HB2  . LYS A 1 91  ? 1.293   -6.525  -8.646  1.00 0.00 ? 91  LYS A HB2  5  
ATOM 8925  H HB3  . LYS A 1 91  ? 0.077   -7.587  -9.342  1.00 0.00 ? 91  LYS A HB3  5  
ATOM 8926  H HG2  . LYS A 1 91  ? -0.325  -5.483  -10.283 1.00 0.00 ? 91  LYS A HG2  5  
ATOM 8927  H HG3  . LYS A 1 91  ? -1.559  -5.672  -9.036  1.00 0.00 ? 91  LYS A HG3  5  
ATOM 8928  H HD2  . LYS A 1 91  ? -0.754  -3.967  -7.813  1.00 0.00 ? 91  LYS A HD2  5  
ATOM 8929  H HD3  . LYS A 1 91  ? 0.924   -4.435  -8.092  1.00 0.00 ? 91  LYS A HD3  5  
ATOM 8930  H HE2  . LYS A 1 91  ? 1.159   -2.978  -9.774  1.00 0.00 ? 91  LYS A HE2  5  
ATOM 8931  H HE3  . LYS A 1 91  ? -0.392  -3.422  -10.487 1.00 0.00 ? 91  LYS A HE3  5  
ATOM 8932  H HZ1  . LYS A 1 91  ? -0.384  -1.803  -8.041  1.00 0.00 ? 91  LYS A HZ1  5  
ATOM 8933  H HZ2  . LYS A 1 91  ? -1.491  -1.816  -9.321  1.00 0.00 ? 91  LYS A HZ2  5  
ATOM 8934  H HZ3  . LYS A 1 91  ? 0.005   -1.049  -9.505  1.00 0.00 ? 91  LYS A HZ3  5  
ATOM 8935  N N    . SER A 1 92  ? -0.483  -9.213  -5.996  1.00 0.00 ? 92  SER A N    5  
ATOM 8936  C CA   . SER A 1 92  ? -0.230  -10.605 -5.643  1.00 0.00 ? 92  SER A CA   5  
ATOM 8937  C C    . SER A 1 92  ? -1.134  -11.050 -4.498  1.00 0.00 ? 92  SER A C    5  
ATOM 8938  O O    . SER A 1 92  ? -1.729  -12.127 -4.546  1.00 0.00 ? 92  SER A O    5  
ATOM 8939  C CB   . SER A 1 92  ? 1.237   -10.797 -5.254  1.00 0.00 ? 92  SER A CB   5  
ATOM 8940  O OG   . SER A 1 92  ? 2.036   -11.072 -6.392  1.00 0.00 ? 92  SER A OG   5  
ATOM 8941  H H    . SER A 1 92  ? -1.136  -8.699  -5.475  1.00 0.00 ? 92  SER A H    5  
ATOM 8942  H HA   . SER A 1 92  ? -0.445  -11.211 -6.511  1.00 0.00 ? 92  SER A HA   5  
ATOM 8943  H HB2  . SER A 1 92  ? 1.603   -9.896  -4.784  1.00 0.00 ? 92  SER A HB2  5  
ATOM 8944  H HB3  . SER A 1 92  ? 1.319   -11.622 -4.563  1.00 0.00 ? 92  SER A HB3  5  
ATOM 8945  H HG   . SER A 1 92  ? 2.929   -10.753 -6.242  1.00 0.00 ? 92  SER A HG   5  
ATOM 8946  N N    . SER A 1 93  ? -1.232  -10.214 -3.470  1.00 0.00 ? 93  SER A N    5  
ATOM 8947  C CA   . SER A 1 93  ? -2.064  -10.520 -2.312  1.00 0.00 ? 93  SER A CA   5  
ATOM 8948  C C    . SER A 1 93  ? -3.544  -10.392 -2.655  1.00 0.00 ? 93  SER A C    5  
ATOM 8949  O O    . SER A 1 93  ? -3.903  -10.037 -3.778  1.00 0.00 ? 93  SER A O    5  
ATOM 8950  C CB   . SER A 1 93  ? -1.716  -9.592  -1.148  1.00 0.00 ? 93  SER A CB   5  
ATOM 8951  O OG   . SER A 1 93  ? -2.031  -10.194 0.096   1.00 0.00 ? 93  SER A OG   5  
ATOM 8952  H H    . SER A 1 93  ? -0.733  -9.371  -3.490  1.00 0.00 ? 93  SER A H    5  
ATOM 8953  H HA   . SER A 1 93  ? -1.861  -11.540 -2.020  1.00 0.00 ? 93  SER A HA   5  
ATOM 8954  H HB2  . SER A 1 93  ? -0.656  -9.374  -1.168  1.00 0.00 ? 93  SER A HB2  5  
ATOM 8955  H HB3  . SER A 1 93  ? -2.278  -8.672  -1.242  1.00 0.00 ? 93  SER A HB3  5  
ATOM 8956  H HG   . SER A 1 93  ? -1.734  -11.106 0.096   1.00 0.00 ? 93  SER A HG   5  
ATOM 8957  N N    . ARG A 1 94  ? -4.400  -10.684 -1.680  1.00 0.00 ? 94  ARG A N    5  
ATOM 8958  C CA   . ARG A 1 94  ? -5.842  -10.600 -1.879  1.00 0.00 ? 94  ARG A CA   5  
ATOM 8959  C C    . ARG A 1 94  ? -6.381  -9.258  -1.397  1.00 0.00 ? 94  ARG A C    5  
ATOM 8960  O O    . ARG A 1 94  ? -6.712  -8.385  -2.200  1.00 0.00 ? 94  ARG A O    5  
ATOM 8961  C CB   . ARG A 1 94  ? -6.546  -11.741 -1.142  1.00 0.00 ? 94  ARG A CB   5  
ATOM 8962  C CG   . ARG A 1 94  ? -6.291  -13.109 -1.754  1.00 0.00 ? 94  ARG A CG   5  
ATOM 8963  C CD   . ARG A 1 94  ? -6.706  -13.154 -3.216  1.00 0.00 ? 94  ARG A CD   5  
ATOM 8964  N NE   . ARG A 1 94  ? -7.606  -14.271 -3.496  1.00 0.00 ? 94  ARG A NE   5  
ATOM 8965  C CZ   . ARG A 1 94  ? -8.908  -14.260 -3.219  1.00 0.00 ? 94  ARG A CZ   5  
ATOM 8966  N NH1  . ARG A 1 94  ? -9.467  -13.196 -2.656  1.00 0.00 ? 94  ARG A NH1  5  
ATOM 8967  N NH2  . ARG A 1 94  ? -9.654  -15.319 -3.505  1.00 0.00 ? 94  ARG A NH2  5  
ATOM 8968  H H    . ARG A 1 94  ? -4.053  -10.961 -0.807  1.00 0.00 ? 94  ARG A H    5  
ATOM 8969  H HA   . ARG A 1 94  ? -6.036  -10.694 -2.937  1.00 0.00 ? 94  ARG A HA   5  
ATOM 8970  H HB2  . ARG A 1 94  ? -6.201  -11.759 -0.116  1.00 0.00 ? 94  ARG A HB2  5  
ATOM 8971  H HB3  . ARG A 1 94  ? -7.613  -11.558 -1.154  1.00 0.00 ? 94  ARG A HB3  5  
ATOM 8972  H HG2  . ARG A 1 94  ? -5.237  -13.333 -1.683  1.00 0.00 ? 94  ARG A HG2  5  
ATOM 8973  H HG3  . ARG A 1 94  ? -6.856  -13.848 -1.205  1.00 0.00 ? 94  ARG A HG3  5  
ATOM 8974  H HD2  . ARG A 1 94  ? -7.207  -12.230 -3.466  1.00 0.00 ? 94  ARG A HD2  5  
ATOM 8975  H HD3  . ARG A 1 94  ? -5.820  -13.258 -3.826  1.00 0.00 ? 94  ARG A HD3  5  
ATOM 8976  H HE   . ARG A 1 94  ? -7.220  -15.069 -3.911  1.00 0.00 ? 94  ARG A HE   5  
ATOM 8977  H HH11 . ARG A 1 94  ? -8.911  -12.394 -2.437  1.00 0.00 ? 94  ARG A HH11 5  
ATOM 8978  H HH12 . ARG A 1 94  ? -10.446 -13.195 -2.451  1.00 0.00 ? 94  ARG A HH12 5  
ATOM 8979  H HH21 . ARG A 1 94  ? -9.239  -16.123 -3.930  1.00 0.00 ? 94  ARG A HH21 5  
ATOM 8980  H HH22 . ARG A 1 94  ? -10.632 -15.313 -3.297  1.00 0.00 ? 94  ARG A HH22 5  
ATOM 8981  N N    . HIS A 1 95  ? -6.467  -9.098  -0.080  1.00 0.00 ? 95  HIS A N    5  
ATOM 8982  C CA   . HIS A 1 95  ? -6.967  -7.861  0.509   1.00 0.00 ? 95  HIS A CA   5  
ATOM 8983  C C    . HIS A 1 95  ? -5.943  -6.740  0.368   1.00 0.00 ? 95  HIS A C    5  
ATOM 8984  O O    . HIS A 1 95  ? -4.767  -6.915  0.689   1.00 0.00 ? 95  HIS A O    5  
ATOM 8985  C CB   . HIS A 1 95  ? -7.306  -8.076  1.986   1.00 0.00 ? 95  HIS A CB   5  
ATOM 8986  C CG   . HIS A 1 95  ? -8.477  -7.270  2.453   1.00 0.00 ? 95  HIS A CG   5  
ATOM 8987  N ND1  . HIS A 1 95  ? -9.338  -7.697  3.443   1.00 0.00 ? 95  HIS A ND1  5  
ATOM 8988  C CD2  . HIS A 1 95  ? -8.930  -6.055  2.063   1.00 0.00 ? 95  HIS A CD2  5  
ATOM 8989  C CE1  . HIS A 1 95  ? -10.270 -6.780  3.639   1.00 0.00 ? 95  HIS A CE1  5  
ATOM 8990  N NE2  . HIS A 1 95  ? -10.045 -5.775  2.815   1.00 0.00 ? 95  HIS A NE2  5  
ATOM 8991  H H    . HIS A 1 95  ? -6.189  -9.830  0.509   1.00 0.00 ? 95  HIS A H    5  
ATOM 8992  H HA   . HIS A 1 95  ? -7.865  -7.582  -0.020  1.00 0.00 ? 95  HIS A HA   5  
ATOM 8993  H HB2  . HIS A 1 95  ? -7.534  -9.118  2.148   1.00 0.00 ? 95  HIS A HB2  5  
ATOM 8994  H HB3  . HIS A 1 95  ? -6.451  -7.802  2.587   1.00 0.00 ? 95  HIS A HB3  5  
ATOM 8995  H HD1  . HIS A 1 95  ? -9.276  -8.546  3.928   1.00 0.00 ? 95  HIS A HD1  5  
ATOM 8996  H HD2  . HIS A 1 95  ? -8.496  -5.424  1.300   1.00 0.00 ? 95  HIS A HD2  5  
ATOM 8997  H HE1  . HIS A 1 95  ? -11.077 -6.843  4.354   1.00 0.00 ? 95  HIS A HE1  5  
ATOM 8998  H HE2  . HIS A 1 95  ? -10.536 -4.927  2.811   1.00 0.00 ? 95  HIS A HE2  5  
ATOM 8999  N N    . LEU A 1 96  ? -6.396  -5.589  -0.115  1.00 0.00 ? 96  LEU A N    5  
ATOM 9000  C CA   . LEU A 1 96  ? -5.519  -4.438  -0.299  1.00 0.00 ? 96  LEU A CA   5  
ATOM 9001  C C    . LEU A 1 96  ? -6.164  -3.168  0.247   1.00 0.00 ? 96  LEU A C    5  
ATOM 9002  O O    . LEU A 1 96  ? -7.201  -2.725  -0.246  1.00 0.00 ? 96  LEU A O    5  
ATOM 9003  C CB   . LEU A 1 96  ? -5.184  -4.258  -1.781  1.00 0.00 ? 96  LEU A CB   5  
ATOM 9004  C CG   . LEU A 1 96  ? -4.536  -5.471  -2.450  1.00 0.00 ? 96  LEU A CG   5  
ATOM 9005  C CD1  . LEU A 1 96  ? -4.348  -5.222  -3.938  1.00 0.00 ? 96  LEU A CD1  5  
ATOM 9006  C CD2  . LEU A 1 96  ? -3.204  -5.794  -1.789  1.00 0.00 ? 96  LEU A CD2  5  
ATOM 9007  H H    . LEU A 1 96  ? -7.344  -5.510  -0.354  1.00 0.00 ? 96  LEU A H    5  
ATOM 9008  H HA   . LEU A 1 96  ? -4.607  -4.627  0.246   1.00 0.00 ? 96  LEU A HA   5  
ATOM 9009  H HB2  . LEU A 1 96  ? -6.101  -4.027  -2.310  1.00 0.00 ? 96  LEU A HB2  5  
ATOM 9010  H HB3  . LEU A 1 96  ? -4.507  -3.418  -1.876  1.00 0.00 ? 96  LEU A HB3  5  
ATOM 9011  H HG   . LEU A 1 96  ? -5.185  -6.327  -2.334  1.00 0.00 ? 96  LEU A HG   5  
ATOM 9012  H HD11 . LEU A 1 96  ? -5.311  -5.225  -4.428  1.00 0.00 ? 96  LEU A HD11 5  
ATOM 9013  H HD12 . LEU A 1 96  ? -3.729  -6.001  -4.358  1.00 0.00 ? 96  LEU A HD12 5  
ATOM 9014  H HD13 . LEU A 1 96  ? -3.872  -4.264  -4.086  1.00 0.00 ? 96  LEU A HD13 5  
ATOM 9015  H HD21 . LEU A 1 96  ? -3.355  -6.534  -1.017  1.00 0.00 ? 96  LEU A HD21 5  
ATOM 9016  H HD22 . LEU A 1 96  ? -2.792  -4.897  -1.352  1.00 0.00 ? 96  LEU A HD22 5  
ATOM 9017  H HD23 . LEU A 1 96  ? -2.520  -6.181  -2.530  1.00 0.00 ? 96  LEU A HD23 5  
ATOM 9018  N N    . ILE A 1 97  ? -5.543  -2.587  1.268   1.00 0.00 ? 97  ILE A N    5  
ATOM 9019  C CA   . ILE A 1 97  ? -6.056  -1.368  1.881   1.00 0.00 ? 97  ILE A CA   5  
ATOM 9020  C C    . ILE A 1 97  ? -5.017  -0.252  1.836   1.00 0.00 ? 97  ILE A C    5  
ATOM 9021  O O    . ILE A 1 97  ? -4.176  -0.138  2.729   1.00 0.00 ? 97  ILE A O    5  
ATOM 9022  C CB   . ILE A 1 97  ? -6.473  -1.608  3.345   1.00 0.00 ? 97  ILE A CB   5  
ATOM 9023  C CG1  . ILE A 1 97  ? -7.365  -2.845  3.450   1.00 0.00 ? 97  ILE A CG1  5  
ATOM 9024  C CG2  . ILE A 1 97  ? -7.187  -0.383  3.901   1.00 0.00 ? 97  ILE A CG2  5  
ATOM 9025  C CD1  . ILE A 1 97  ? -7.473  -3.396  4.855   1.00 0.00 ? 97  ILE A CD1  5  
ATOM 9026  H H    . ILE A 1 97  ? -4.720  -2.988  1.617   1.00 0.00 ? 97  ILE A H    5  
ATOM 9027  H HA   . ILE A 1 97  ? -6.929  -1.057  1.327   1.00 0.00 ? 97  ILE A HA   5  
ATOM 9028  H HB   . ILE A 1 97  ? -5.579  -1.766  3.929   1.00 0.00 ? 97  ILE A HB   5  
ATOM 9029  H HG12 . ILE A 1 97  ? -8.361  -2.592  3.117   1.00 0.00 ? 97  ILE A HG12 5  
ATOM 9030  H HG13 . ILE A 1 97  ? -6.966  -3.623  2.817   1.00 0.00 ? 97  ILE A HG13 5  
ATOM 9031  H HG21 . ILE A 1 97  ? -8.025  -0.138  3.265   1.00 0.00 ? 97  ILE A HG21 5  
ATOM 9032  H HG22 . ILE A 1 97  ? -6.501  0.451   3.930   1.00 0.00 ? 97  ILE A HG22 5  
ATOM 9033  H HG23 . ILE A 1 97  ? -7.541  -0.595  4.898   1.00 0.00 ? 97  ILE A HG23 5  
ATOM 9034  H HD11 . ILE A 1 97  ? -8.089  -4.283  4.848   1.00 0.00 ? 97  ILE A HD11 5  
ATOM 9035  H HD12 . ILE A 1 97  ? -7.919  -2.653  5.500   1.00 0.00 ? 97  ILE A HD12 5  
ATOM 9036  H HD13 . ILE A 1 97  ? -6.488  -3.646  5.220   1.00 0.00 ? 97  ILE A HD13 5  
ATOM 9037  N N    . LEU A 1 98  ? -5.081  0.568   0.793   1.00 0.00 ? 98  LEU A N    5  
ATOM 9038  C CA   . LEU A 1 98  ? -4.146  1.674   0.632   1.00 0.00 ? 98  LEU A CA   5  
ATOM 9039  C C    . LEU A 1 98  ? -4.610  2.897   1.416   1.00 0.00 ? 98  LEU A C    5  
ATOM 9040  O O    . LEU A 1 98  ? -5.808  3.151   1.538   1.00 0.00 ? 98  LEU A O    5  
ATOM 9041  C CB   . LEU A 1 98  ? -3.992  2.030   -0.849  1.00 0.00 ? 98  LEU A CB   5  
ATOM 9042  C CG   . LEU A 1 98  ? -3.541  0.879   -1.749  1.00 0.00 ? 98  LEU A CG   5  
ATOM 9043  C CD1  . LEU A 1 98  ? -4.732  0.258   -2.462  1.00 0.00 ? 98  LEU A CD1  5  
ATOM 9044  C CD2  . LEU A 1 98  ? -2.507  1.361   -2.756  1.00 0.00 ? 98  LEU A CD2  5  
ATOM 9045  H H    . LEU A 1 98  ? -5.774  0.425   0.114   1.00 0.00 ? 98  LEU A H    5  
ATOM 9046  H HA   . LEU A 1 98  ? -3.188  1.357   1.017   1.00 0.00 ? 98  LEU A HA   5  
ATOM 9047  H HB2  . LEU A 1 98  ? -4.945  2.392   -1.210  1.00 0.00 ? 98  LEU A HB2  5  
ATOM 9048  H HB3  . LEU A 1 98  ? -3.269  2.829   -0.932  1.00 0.00 ? 98  LEU A HB3  5  
ATOM 9049  H HG   . LEU A 1 98  ? -3.082  0.113   -1.139  1.00 0.00 ? 98  LEU A HG   5  
ATOM 9050  H HD11 . LEU A 1 98  ? -4.570  -0.802  -2.580  1.00 0.00 ? 98  LEU A HD11 5  
ATOM 9051  H HD12 . LEU A 1 98  ? -4.847  0.715   -3.435  1.00 0.00 ? 98  LEU A HD12 5  
ATOM 9052  H HD13 . LEU A 1 98  ? -5.627  0.423   -1.880  1.00 0.00 ? 98  LEU A HD13 5  
ATOM 9053  H HD21 . LEU A 1 98  ? -2.648  2.416   -2.940  1.00 0.00 ? 98  LEU A HD21 5  
ATOM 9054  H HD22 . LEU A 1 98  ? -2.623  0.816   -3.681  1.00 0.00 ? 98  LEU A HD22 5  
ATOM 9055  H HD23 . LEU A 1 98  ? -1.516  1.195   -2.362  1.00 0.00 ? 98  LEU A HD23 5  
ATOM 9056  N N    . THR A 1 99  ? -3.652  3.653   1.945   1.00 0.00 ? 99  THR A N    5  
ATOM 9057  C CA   . THR A 1 99  ? -3.962  4.850   2.718   1.00 0.00 ? 99  THR A CA   5  
ATOM 9058  C C    . THR A 1 99  ? -3.329  6.085   2.083   1.00 0.00 ? 99  THR A C    5  
ATOM 9059  O O    . THR A 1 99  ? -2.253  6.522   2.492   1.00 0.00 ? 99  THR A O    5  
ATOM 9060  C CB   . THR A 1 99  ? -3.473  4.695   4.158   1.00 0.00 ? 99  THR A CB   5  
ATOM 9061  O OG1  . THR A 1 99  ? -3.643  3.361   4.604   1.00 0.00 ? 99  THR A OG1  5  
ATOM 9062  C CG2  . THR A 1 99  ? -4.191  5.600   5.135   1.00 0.00 ? 99  THR A CG2  5  
ATOM 9063  H H    . THR A 1 99  ? -2.715  3.399   1.813   1.00 0.00 ? 99  THR A H    5  
ATOM 9064  H HA   . THR A 1 99  ? -5.036  4.974   2.722   1.00 0.00 ? 99  THR A HA   5  
ATOM 9065  H HB   . THR A 1 99  ? -2.420  4.934   4.197   1.00 0.00 ? 99  THR A HB   5  
ATOM 9066  H HG1  . THR A 1 99  ? -4.518  3.051   4.361   1.00 0.00 ? 99  THR A HG1  5  
ATOM 9067  H HG21 . THR A 1 99  ? -4.970  6.141   4.619   1.00 0.00 ? 99  THR A HG21 5  
ATOM 9068  H HG22 . THR A 1 99  ? -3.487  6.302   5.559   1.00 0.00 ? 99  THR A HG22 5  
ATOM 9069  H HG23 . THR A 1 99  ? -4.626  5.005   5.924   1.00 0.00 ? 99  THR A HG23 5  
ATOM 9070  N N    . VAL A 1 100 ? -4.003  6.643   1.084   1.00 0.00 ? 100 VAL A N    5  
ATOM 9071  C CA   . VAL A 1 100 ? -3.507  7.827   0.394   1.00 0.00 ? 100 VAL A CA   5  
ATOM 9072  C C    . VAL A 1 100 ? -4.012  9.103   1.059   1.00 0.00 ? 100 VAL A C    5  
ATOM 9073  O O    . VAL A 1 100 ? -4.960  9.073   1.843   1.00 0.00 ? 100 VAL A O    5  
ATOM 9074  C CB   . VAL A 1 100 ? -3.929  7.834   -1.087  1.00 0.00 ? 100 VAL A CB   5  
ATOM 9075  C CG1  . VAL A 1 100 ? -3.201  6.743   -1.856  1.00 0.00 ? 100 VAL A CG1  5  
ATOM 9076  C CG2  . VAL A 1 100 ? -5.437  7.670   -1.214  1.00 0.00 ? 100 VAL A CG2  5  
ATOM 9077  H H    . VAL A 1 100 ? -4.856  6.249   0.803   1.00 0.00 ? 100 VAL A H    5  
ATOM 9078  H HA   . VAL A 1 100 ? -2.428  7.812   0.439   1.00 0.00 ? 100 VAL A HA   5  
ATOM 9079  H HB   . VAL A 1 100 ? -3.656  8.788   -1.514  1.00 0.00 ? 100 VAL A HB   5  
ATOM 9080  H HG11 . VAL A 1 100 ? -2.319  7.158   -2.323  1.00 0.00 ? 100 VAL A HG11 5  
ATOM 9081  H HG12 . VAL A 1 100 ? -3.854  6.340   -2.615  1.00 0.00 ? 100 VAL A HG12 5  
ATOM 9082  H HG13 . VAL A 1 100 ? -2.910  5.956   -1.176  1.00 0.00 ? 100 VAL A HG13 5  
ATOM 9083  H HG21 . VAL A 1 100 ? -5.913  8.020   -0.309  1.00 0.00 ? 100 VAL A HG21 5  
ATOM 9084  H HG22 . VAL A 1 100 ? -5.674  6.628   -1.365  1.00 0.00 ? 100 VAL A HG22 5  
ATOM 9085  H HG23 . VAL A 1 100 ? -5.791  8.247   -2.055  1.00 0.00 ? 100 VAL A HG23 5  
ATOM 9086  N N    . LYS A 1 101 ? -3.370  10.223  0.741   1.00 0.00 ? 101 LYS A N    5  
ATOM 9087  C CA   . LYS A 1 101 ? -3.754  11.511  1.308   1.00 0.00 ? 101 LYS A CA   5  
ATOM 9088  C C    . LYS A 1 101 ? -4.012  12.534  0.206   1.00 0.00 ? 101 LYS A C    5  
ATOM 9089  O O    . LYS A 1 101 ? -3.764  12.271  -0.970  1.00 0.00 ? 101 LYS A O    5  
ATOM 9090  C CB   . LYS A 1 101 ? -2.664  12.023  2.250   1.00 0.00 ? 101 LYS A CB   5  
ATOM 9091  C CG   . LYS A 1 101 ? -1.261  11.924  1.669   1.00 0.00 ? 101 LYS A CG   5  
ATOM 9092  C CD   . LYS A 1 101 ? -0.449  13.177  1.951   1.00 0.00 ? 101 LYS A CD   5  
ATOM 9093  C CE   . LYS A 1 101 ? 0.413   13.562  0.760   1.00 0.00 ? 101 LYS A CE   5  
ATOM 9094  N NZ   . LYS A 1 101 ? -0.204  14.653  -0.044  1.00 0.00 ? 101 LYS A NZ   5  
ATOM 9095  H H    . LYS A 1 101 ? -2.621  10.183  0.110   1.00 0.00 ? 101 LYS A H    5  
ATOM 9096  H HA   . LYS A 1 101 ? -4.665  11.368  1.870   1.00 0.00 ? 101 LYS A HA   5  
ATOM 9097  H HB2  . LYS A 1 101 ? -2.862  13.059  2.483   1.00 0.00 ? 101 LYS A HB2  5  
ATOM 9098  H HB3  . LYS A 1 101 ? -2.694  11.447  3.163   1.00 0.00 ? 101 LYS A HB3  5  
ATOM 9099  H HG2  . LYS A 1 101 ? -0.760  11.075  2.109   1.00 0.00 ? 101 LYS A HG2  5  
ATOM 9100  H HG3  . LYS A 1 101 ? -1.335  11.786  0.600   1.00 0.00 ? 101 LYS A HG3  5  
ATOM 9101  H HD2  . LYS A 1 101 ? -1.124  13.991  2.172   1.00 0.00 ? 101 LYS A HD2  5  
ATOM 9102  H HD3  . LYS A 1 101 ? 0.190   12.995  2.803   1.00 0.00 ? 101 LYS A HD3  5  
ATOM 9103  H HE2  . LYS A 1 101 ? 1.376   13.893  1.120   1.00 0.00 ? 101 LYS A HE2  5  
ATOM 9104  H HE3  . LYS A 1 101 ? 0.545   12.693  0.131   1.00 0.00 ? 101 LYS A HE3  5  
ATOM 9105  H HZ1  . LYS A 1 101 ? 0.361   14.830  -0.899  1.00 0.00 ? 101 LYS A HZ1  5  
ATOM 9106  H HZ2  . LYS A 1 101 ? -0.250  15.528  0.516   1.00 0.00 ? 101 LYS A HZ2  5  
ATOM 9107  H HZ3  . LYS A 1 101 ? -1.169  14.386  -0.327  1.00 0.00 ? 101 LYS A HZ3  5  
ATOM 9108  N N    . ASP A 1 102 ? -4.510  13.702  0.596   1.00 0.00 ? 102 ASP A N    5  
ATOM 9109  C CA   . ASP A 1 102 ? -4.800  14.767  -0.359  1.00 0.00 ? 102 ASP A CA   5  
ATOM 9110  C C    . ASP A 1 102 ? -3.513  15.412  -0.860  1.00 0.00 ? 102 ASP A C    5  
ATOM 9111  O O    . ASP A 1 102 ? -2.821  16.105  -0.114  1.00 0.00 ? 102 ASP A O    5  
ATOM 9112  C CB   . ASP A 1 102 ? -5.697  15.826  0.285   1.00 0.00 ? 102 ASP A CB   5  
ATOM 9113  C CG   . ASP A 1 102 ? -7.171  15.525  0.097   1.00 0.00 ? 102 ASP A CG   5  
ATOM 9114  O OD1  . ASP A 1 102 ? -7.702  14.671  0.836   1.00 0.00 ? 102 ASP A OD1  5  
ATOM 9115  O OD2  . ASP A 1 102 ? -7.795  16.145  -0.791  1.00 0.00 ? 102 ASP A OD2  5  
ATOM 9116  H H    . ASP A 1 102 ? -4.686  13.853  1.548   1.00 0.00 ? 102 ASP A H    5  
ATOM 9117  H HA   . ASP A 1 102 ? -5.319  14.328  -1.197  1.00 0.00 ? 102 ASP A HA   5  
ATOM 9118  H HB2  . ASP A 1 102 ? -5.491  15.868  1.345   1.00 0.00 ? 102 ASP A HB2  5  
ATOM 9119  H HB3  . ASP A 1 102 ? -5.484  16.788  -0.162  1.00 0.00 ? 102 ASP A HB3  5  
ATOM 9120  N N    . VAL A 1 103 ? -3.197  15.182  -2.131  1.00 0.00 ? 103 VAL A N    5  
ATOM 9121  C CA   . VAL A 1 103 ? -1.993  15.742  -2.732  1.00 0.00 ? 103 VAL A CA   5  
ATOM 9122  C C    . VAL A 1 103 ? -2.272  17.105  -3.356  1.00 0.00 ? 103 VAL A C    5  
ATOM 9123  O O    . VAL A 1 103 ? -1.580  18.082  -3.073  1.00 0.00 ? 103 VAL A O    5  
ATOM 9124  C CB   . VAL A 1 103 ? -1.415  14.805  -3.810  1.00 0.00 ? 103 VAL A CB   5  
ATOM 9125  C CG1  . VAL A 1 103 ? -0.059  15.308  -4.282  1.00 0.00 ? 103 VAL A CG1  5  
ATOM 9126  C CG2  . VAL A 1 103 ? -1.311  13.383  -3.281  1.00 0.00 ? 103 VAL A CG2  5  
ATOM 9127  H H    . VAL A 1 103 ? -3.789  14.622  -2.677  1.00 0.00 ? 103 VAL A H    5  
ATOM 9128  H HA   . VAL A 1 103 ? -1.255  15.859  -1.953  1.00 0.00 ? 103 VAL A HA   5  
ATOM 9129  H HB   . VAL A 1 103 ? -2.087  14.805  -4.655  1.00 0.00 ? 103 VAL A HB   5  
ATOM 9130  H HG11 . VAL A 1 103 ? 0.123   14.959  -5.288  1.00 0.00 ? 103 VAL A HG11 5  
ATOM 9131  H HG12 . VAL A 1 103 ? 0.713   14.931  -3.626  1.00 0.00 ? 103 VAL A HG12 5  
ATOM 9132  H HG13 . VAL A 1 103 ? -0.050  16.387  -4.267  1.00 0.00 ? 103 VAL A HG13 5  
ATOM 9133  H HG21 . VAL A 1 103 ? -2.301  12.973  -3.154  1.00 0.00 ? 103 VAL A HG21 5  
ATOM 9134  H HG22 . VAL A 1 103 ? -0.800  13.390  -2.329  1.00 0.00 ? 103 VAL A HG22 5  
ATOM 9135  H HG23 . VAL A 1 103 ? -0.758  12.778  -3.983  1.00 0.00 ? 103 VAL A HG23 5  
ATOM 9136  N N    . GLY A 1 104 ? -3.291  17.162  -4.207  1.00 0.00 ? 104 GLY A N    5  
ATOM 9137  C CA   . GLY A 1 104 ? -3.644  18.410  -4.859  1.00 0.00 ? 104 GLY A CA   5  
ATOM 9138  C C    . GLY A 1 104 ? -4.697  19.186  -4.093  1.00 0.00 ? 104 GLY A C    5  
ATOM 9139  O O    . GLY A 1 104 ? -5.838  18.742  -3.968  1.00 0.00 ? 104 GLY A O    5  
ATOM 9140  H H    . GLY A 1 104 ? -3.807  16.351  -4.395  1.00 0.00 ? 104 GLY A H    5  
ATOM 9141  H HA2  . GLY A 1 104 ? -2.757  19.020  -4.949  1.00 0.00 ? 104 GLY A HA2  5  
ATOM 9142  H HA3  . GLY A 1 104 ? -4.021  18.194  -5.848  1.00 0.00 ? 104 GLY A HA3  5  
ATOM 9143  N N    . ARG A 1 105 ? -4.314  20.351  -3.578  1.00 0.00 ? 105 ARG A N    5  
ATOM 9144  C CA   . ARG A 1 105 ? -5.234  21.190  -2.820  1.00 0.00 ? 105 ARG A CA   5  
ATOM 9145  C C    . ARG A 1 105 ? -4.928  22.672  -3.033  1.00 0.00 ? 105 ARG A C    5  
ATOM 9146  O O    . ARG A 1 105 ? -5.290  23.512  -2.209  1.00 0.00 ? 105 ARG A O    5  
ATOM 9147  C CB   . ARG A 1 105 ? -5.155  20.849  -1.330  1.00 0.00 ? 105 ARG A CB   5  
ATOM 9148  C CG   . ARG A 1 105 ? -6.446  20.274  -0.769  1.00 0.00 ? 105 ARG A CG   5  
ATOM 9149  C CD   . ARG A 1 105 ? -6.928  21.056  0.444   1.00 0.00 ? 105 ARG A CD   5  
ATOM 9150  N NE   . ARG A 1 105 ? -8.382  21.186  0.469   1.00 0.00 ? 105 ARG A NE   5  
ATOM 9151  C CZ   . ARG A 1 105 ? -9.081  21.490  1.561   1.00 0.00 ? 105 ARG A CZ   5  
ATOM 9152  N NH1  . ARG A 1 105 ? -8.463  21.697  2.716   1.00 0.00 ? 105 ARG A NH1  5  
ATOM 9153  N NH2  . ARG A 1 105 ? -10.402 21.586  1.496   1.00 0.00 ? 105 ARG A NH2  5  
ATOM 9154  H H    . ARG A 1 105 ? -3.391  20.652  -3.711  1.00 0.00 ? 105 ARG A H    5  
ATOM 9155  H HA   . ARG A 1 105 ? -6.234  20.988  -3.173  1.00 0.00 ? 105 ARG A HA   5  
ATOM 9156  H HB2  . ARG A 1 105 ? -4.370  20.122  -1.182  1.00 0.00 ? 105 ARG A HB2  5  
ATOM 9157  H HB3  . ARG A 1 105 ? -4.913  21.745  -0.779  1.00 0.00 ? 105 ARG A HB3  5  
ATOM 9158  H HG2  . ARG A 1 105 ? -7.208  20.312  -1.534  1.00 0.00 ? 105 ARG A HG2  5  
ATOM 9159  H HG3  . ARG A 1 105 ? -6.276  19.248  -0.480  1.00 0.00 ? 105 ARG A HG3  5  
ATOM 9160  H HD2  . ARG A 1 105 ? -6.607  20.542  1.337   1.00 0.00 ? 105 ARG A HD2  5  
ATOM 9161  H HD3  . ARG A 1 105 ? -6.487  22.041  0.418   1.00 0.00 ? 105 ARG A HD3  5  
ATOM 9162  H HE   . ARG A 1 105 ? -8.865  21.039  -0.372  1.00 0.00 ? 105 ARG A HE   5  
ATOM 9163  H HH11 . ARG A 1 105 ? -7.467  21.625  2.772   1.00 0.00 ? 105 ARG A HH11 5  
ATOM 9164  H HH12 . ARG A 1 105 ? -8.994  21.925  3.533   1.00 0.00 ? 105 ARG A HH12 5  
ATOM 9165  H HH21 . ARG A 1 105 ? -10.873 21.432  0.627   1.00 0.00 ? 105 ARG A HH21 5  
ATOM 9166  H HH22 . ARG A 1 105 ? -10.927 21.814  2.315   1.00 0.00 ? 105 ARG A HH22 5  
ATOM 9167  N N    . LEU A 1 106 ? -4.264  22.984  -4.140  1.00 0.00 ? 106 LEU A N    5  
ATOM 9168  C CA   . LEU A 1 106 ? -3.913  24.364  -4.457  1.00 0.00 ? 106 LEU A CA   5  
ATOM 9169  C C    . LEU A 1 106 ? -3.000  24.955  -3.384  1.00 0.00 ? 106 LEU A C    5  
ATOM 9170  O O    . LEU A 1 106 ? -3.474  25.495  -2.385  1.00 0.00 ? 106 LEU A O    5  
ATOM 9171  C CB   . LEU A 1 106 ? -5.176  25.216  -4.593  1.00 0.00 ? 106 LEU A CB   5  
ATOM 9172  C CG   . LEU A 1 106 ? -4.934  26.680  -4.972  1.00 0.00 ? 106 LEU A CG   5  
ATOM 9173  C CD1  . LEU A 1 106 ? -5.854  27.100  -6.108  1.00 0.00 ? 106 LEU A CD1  5  
ATOM 9174  C CD2  . LEU A 1 106 ? -5.130  27.585  -3.763  1.00 0.00 ? 106 LEU A CD2  5  
ATOM 9175  H H    . LEU A 1 106 ? -4.003  22.272  -4.759  1.00 0.00 ? 106 LEU A H    5  
ATOM 9176  H HA   . LEU A 1 106 ? -3.388  24.363  -5.400  1.00 0.00 ? 106 LEU A HA   5  
ATOM 9177  H HB2  . LEU A 1 106 ? -5.807  24.767  -5.348  1.00 0.00 ? 106 LEU A HB2  5  
ATOM 9178  H HB3  . LEU A 1 106 ? -5.703  25.193  -3.650  1.00 0.00 ? 106 LEU A HB3  5  
ATOM 9179  H HG   . LEU A 1 106 ? -3.914  26.792  -5.310  1.00 0.00 ? 106 LEU A HG   5  
ATOM 9180  H HD11 . LEU A 1 106 ? -6.129  28.137  -5.984  1.00 0.00 ? 106 LEU A HD11 5  
ATOM 9181  H HD12 . LEU A 1 106 ? -6.742  26.487  -6.097  1.00 0.00 ? 106 LEU A HD12 5  
ATOM 9182  H HD13 . LEU A 1 106 ? -5.342  26.973  -7.051  1.00 0.00 ? 106 LEU A HD13 5  
ATOM 9183  H HD21 . LEU A 1 106 ? -5.067  26.997  -2.859  1.00 0.00 ? 106 LEU A HD21 5  
ATOM 9184  H HD22 . LEU A 1 106 ? -6.101  28.055  -3.820  1.00 0.00 ? 106 LEU A HD22 5  
ATOM 9185  H HD23 . LEU A 1 106 ? -4.363  28.345  -3.754  1.00 0.00 ? 106 LEU A HD23 5  
ATOM 9186  N N    . PRO A 1 107 ? -1.671  24.862  -3.577  1.00 0.00 ? 107 PRO A N    5  
ATOM 9187  C CA   . PRO A 1 107 ? -0.697  25.392  -2.618  1.00 0.00 ? 107 PRO A CA   5  
ATOM 9188  C C    . PRO A 1 107 ? -0.700  26.917  -2.573  1.00 0.00 ? 107 PRO A C    5  
ATOM 9189  O O    . PRO A 1 107 ? -0.992  27.576  -3.570  1.00 0.00 ? 107 PRO A O    5  
ATOM 9190  C CB   . PRO A 1 107 ? 0.643   24.875  -3.147  1.00 0.00 ? 107 PRO A CB   5  
ATOM 9191  C CG   . PRO A 1 107 ? 0.418   24.659  -4.603  1.00 0.00 ? 107 PRO A CG   5  
ATOM 9192  C CD   . PRO A 1 107 ? -1.018  24.234  -4.741  1.00 0.00 ? 107 PRO A CD   5  
ATOM 9193  H HA   . PRO A 1 107 ? -0.870  25.005  -1.624  1.00 0.00 ? 107 PRO A HA   5  
ATOM 9194  H HB2  . PRO A 1 107 ? 1.412   25.615  -2.970  1.00 0.00 ? 107 PRO A HB2  5  
ATOM 9195  H HB3  . PRO A 1 107 ? 0.899   23.951  -2.646  1.00 0.00 ? 107 PRO A HB3  5  
ATOM 9196  H HG2  . PRO A 1 107 ? 0.591   25.578  -5.141  1.00 0.00 ? 107 PRO A HG2  5  
ATOM 9197  H HG3  . PRO A 1 107 ? 1.075   23.881  -4.964  1.00 0.00 ? 107 PRO A HG3  5  
ATOM 9198  H HD2  . PRO A 1 107 ? -1.434  24.609  -5.666  1.00 0.00 ? 107 PRO A HD2  5  
ATOM 9199  H HD3  . PRO A 1 107 ? -1.100  23.158  -4.694  1.00 0.00 ? 107 PRO A HD3  5  
ATOM 9200  N N    . HIS A 1 108 ? -0.374  27.470  -1.410  1.00 0.00 ? 108 HIS A N    5  
ATOM 9201  C CA   . HIS A 1 108 ? -0.340  28.917  -1.235  1.00 0.00 ? 108 HIS A CA   5  
ATOM 9202  C C    . HIS A 1 108 ? 0.825   29.532  -2.004  1.00 0.00 ? 108 HIS A C    5  
ATOM 9203  O O    . HIS A 1 108 ? 0.672   30.563  -2.660  1.00 0.00 ? 108 HIS A O    5  
ATOM 9204  C CB   . HIS A 1 108 ? -0.229  29.268  0.252   1.00 0.00 ? 108 HIS A CB   5  
ATOM 9205  C CG   . HIS A 1 108 ? -1.190  30.331  0.688   1.00 0.00 ? 108 HIS A CG   5  
ATOM 9206  N ND1  . HIS A 1 108 ? -1.572  30.507  2.002   1.00 0.00 ? 108 HIS A ND1  5  
ATOM 9207  C CD2  . HIS A 1 108 ? -1.848  31.278  -0.022  1.00 0.00 ? 108 HIS A CD2  5  
ATOM 9208  C CE1  . HIS A 1 108 ? -2.423  31.515  2.080   1.00 0.00 ? 108 HIS A CE1  5  
ATOM 9209  N NE2  . HIS A 1 108 ? -2.606  32.000  0.866   1.00 0.00 ? 108 HIS A NE2  5  
ATOM 9210  H H    . HIS A 1 108 ? -0.152  26.891  -0.651  1.00 0.00 ? 108 HIS A H    5  
ATOM 9211  H HA   . HIS A 1 108 ? -1.264  29.319  -1.622  1.00 0.00 ? 108 HIS A HA   5  
ATOM 9212  H HB2  . HIS A 1 108 ? -0.425  28.384  0.838   1.00 0.00 ? 108 HIS A HB2  5  
ATOM 9213  H HB3  . HIS A 1 108 ? 0.772   29.618  0.460   1.00 0.00 ? 108 HIS A HB3  5  
ATOM 9214  H HD1  . HIS A 1 108 ? -1.265  29.972  2.763   1.00 0.00 ? 108 HIS A HD1  5  
ATOM 9215  H HD2  . HIS A 1 108 ? -1.787  31.436  -1.090  1.00 0.00 ? 108 HIS A HD2  5  
ATOM 9216  H HE1  . HIS A 1 108 ? -2.888  31.880  2.984   1.00 0.00 ? 108 HIS A HE1  5  
ATOM 9217  H HE2  . HIS A 1 108 ? -3.121  32.806  0.652   1.00 0.00 ? 108 HIS A HE2  5  
ATOM 9218  N N    . ALA A 1 109 ? 1.988   28.894  -1.919  1.00 0.00 ? 109 ALA A N    5  
ATOM 9219  C CA   . ALA A 1 109 ? 3.177   29.379  -2.608  1.00 0.00 ? 109 ALA A CA   5  
ATOM 9220  C C    . ALA A 1 109 ? 3.116   29.066  -4.098  1.00 0.00 ? 109 ALA A C    5  
ATOM 9221  O O    . ALA A 1 109 ? 2.641   28.004  -4.501  1.00 0.00 ? 109 ALA A O    5  
ATOM 9222  C CB   . ALA A 1 109 ? 4.428   28.771  -1.990  1.00 0.00 ? 109 ALA A CB   5  
ATOM 9223  H H    . ALA A 1 109 ? 2.046   28.078  -1.381  1.00 0.00 ? 109 ALA A H    5  
ATOM 9224  H HA   . ALA A 1 109 ? 3.224   30.451  -2.477  1.00 0.00 ? 109 ALA A HA   5  
ATOM 9225  H HB1  . ALA A 1 109 ? 4.249   27.730  -1.768  1.00 0.00 ? 109 ALA A HB1  5  
ATOM 9226  H HB2  . ALA A 1 109 ? 4.672   29.298  -1.079  1.00 0.00 ? 109 ALA A HB2  5  
ATOM 9227  H HB3  . ALA A 1 109 ? 5.250   28.855  -2.686  1.00 0.00 ? 109 ALA A HB3  5  
ATOM 9228  N N    . ARG A 1 110 ? 3.599   29.999  -4.914  1.00 0.00 ? 110 ARG A N    5  
ATOM 9229  C CA   . ARG A 1 110 ? 3.599   29.822  -6.361  1.00 0.00 ? 110 ARG A CA   5  
ATOM 9230  C C    . ARG A 1 110 ? 4.448   28.620  -6.762  1.00 0.00 ? 110 ARG A C    5  
ATOM 9231  O O    . ARG A 1 110 ? 3.935   27.634  -7.291  1.00 0.00 ? 110 ARG A O    5  
ATOM 9232  C CB   . ARG A 1 110 ? 4.124   31.084  -7.049  1.00 0.00 ? 110 ARG A CB   5  
ATOM 9233  C CG   . ARG A 1 110 ? 3.084   32.187  -7.174  1.00 0.00 ? 110 ARG A CG   5  
ATOM 9234  C CD   . ARG A 1 110 ? 3.552   33.295  -8.104  1.00 0.00 ? 110 ARG A CD   5  
ATOM 9235  N NE   . ARG A 1 110 ? 3.687   34.572  -7.409  1.00 0.00 ? 110 ARG A NE   5  
ATOM 9236  C CZ   . ARG A 1 110 ? 4.393   35.600  -7.875  1.00 0.00 ? 110 ARG A CZ   5  
ATOM 9237  N NH1  . ARG A 1 110 ? 5.028   35.505  -9.037  1.00 0.00 ? 110 ARG A NH1  5  
ATOM 9238  N NH2  . ARG A 1 110 ? 4.463   36.727  -7.179  1.00 0.00 ? 110 ARG A NH2  5  
ATOM 9239  H H    . ARG A 1 110 ? 3.964   30.824  -4.533  1.00 0.00 ? 110 ARG A H    5  
ATOM 9240  H HA   . ARG A 1 110 ? 2.580   29.649  -6.674  1.00 0.00 ? 110 ARG A HA   5  
ATOM 9241  H HB2  . ARG A 1 110 ? 4.958   31.468  -6.482  1.00 0.00 ? 110 ARG A HB2  5  
ATOM 9242  H HB3  . ARG A 1 110 ? 4.463   30.824  -8.041  1.00 0.00 ? 110 ARG A HB3  5  
ATOM 9243  H HG2  . ARG A 1 110 ? 2.171   31.764  -7.566  1.00 0.00 ? 110 ARG A HG2  5  
ATOM 9244  H HG3  . ARG A 1 110 ? 2.898   32.604  -6.195  1.00 0.00 ? 110 ARG A HG3  5  
ATOM 9245  H HD2  . ARG A 1 110 ? 4.511   33.021  -8.519  1.00 0.00 ? 110 ARG A HD2  5  
ATOM 9246  H HD3  . ARG A 1 110 ? 2.834   33.404  -8.902  1.00 0.00 ? 110 ARG A HD3  5  
ATOM 9247  H HE   . ARG A 1 110 ? 3.228   34.670  -6.548  1.00 0.00 ? 110 ARG A HE   5  
ATOM 9248  H HH11 . ARG A 1 110 ? 4.980   34.659  -9.566  1.00 0.00 ? 110 ARG A HH11 5  
ATOM 9249  H HH12 . ARG A 1 110 ? 5.557   36.280  -9.382  1.00 0.00 ? 110 ARG A HH12 5  
ATOM 9250  H HH21 . ARG A 1 110 ? 3.985   36.804  -6.304  1.00 0.00 ? 110 ARG A HH21 5  
ATOM 9251  H HH22 . ARG A 1 110 ? 4.993   37.499  -7.530  1.00 0.00 ? 110 ARG A HH22 5  
ATOM 9252  N N    . THR A 1 111 ? 5.750   28.711  -6.507  1.00 0.00 ? 111 THR A N    5  
ATOM 9253  C CA   . THR A 1 111 ? 6.670   27.630  -6.842  1.00 0.00 ? 111 THR A CA   5  
ATOM 9254  C C    . THR A 1 111 ? 6.668   27.360  -8.344  1.00 0.00 ? 111 THR A C    5  
ATOM 9255  O O    . THR A 1 111 ? 5.946   26.488  -8.827  1.00 0.00 ? 111 THR A O    5  
ATOM 9256  C CB   . THR A 1 111 ? 6.294   26.357  -6.083  1.00 0.00 ? 111 THR A CB   5  
ATOM 9257  O OG1  . THR A 1 111 ? 6.058   26.640  -4.715  1.00 0.00 ? 111 THR A OG1  5  
ATOM 9258  C CG2  . THR A 1 111 ? 7.358   25.283  -6.153  1.00 0.00 ? 111 THR A CG2  5  
ATOM 9259  H H    . THR A 1 111 ? 6.099   29.523  -6.085  1.00 0.00 ? 111 THR A H    5  
ATOM 9260  H HA   . THR A 1 111 ? 7.662   27.936  -6.545  1.00 0.00 ? 111 THR A HA   5  
ATOM 9261  H HB   . THR A 1 111 ? 5.386   25.952  -6.507  1.00 0.00 ? 111 THR A HB   5  
ATOM 9262  H HG1  . THR A 1 111 ? 5.222   26.250  -4.448  1.00 0.00 ? 111 THR A HG1  5  
ATOM 9263  H HG21 . THR A 1 111 ? 8.134   25.498  -5.432  1.00 0.00 ? 111 THR A HG21 5  
ATOM 9264  H HG22 . THR A 1 111 ? 7.783   25.260  -7.145  1.00 0.00 ? 111 THR A HG22 5  
ATOM 9265  H HG23 . THR A 1 111 ? 6.916   24.323  -5.928  1.00 0.00 ? 111 THR A HG23 5  
ATOM 9266  N N    . THR A 1 112 ? 7.483   28.112  -9.076  1.00 0.00 ? 112 THR A N    5  
ATOM 9267  C CA   . THR A 1 112 ? 7.576   27.954  -10.523 1.00 0.00 ? 112 THR A CA   5  
ATOM 9268  C C    . THR A 1 112 ? 8.376   26.706  -10.883 1.00 0.00 ? 112 THR A C    5  
ATOM 9269  O O    . THR A 1 112 ? 7.973   25.925  -11.746 1.00 0.00 ? 112 THR A O    5  
ATOM 9270  C CB   . THR A 1 112 ? 8.224   29.188  -11.151 1.00 0.00 ? 112 THR A CB   5  
ATOM 9271  O OG1  . THR A 1 112 ? 9.530   29.385  -10.639 1.00 0.00 ? 112 THR A OG1  5  
ATOM 9272  C CG2  . THR A 1 112 ? 7.441   30.462  -10.914 1.00 0.00 ? 112 THR A CG2  5  
ATOM 9273  H H    . THR A 1 112 ? 8.035   28.790  -8.634  1.00 0.00 ? 112 THR A H    5  
ATOM 9274  H HA   . THR A 1 112 ? 6.573   27.848  -10.910 1.00 0.00 ? 112 THR A HA   5  
ATOM 9275  H HB   . THR A 1 112 ? 8.297   29.040  -12.219 1.00 0.00 ? 112 THR A HB   5  
ATOM 9276  H HG1  . THR A 1 112 ? 9.476   29.644  -9.716  1.00 0.00 ? 112 THR A HG1  5  
ATOM 9277  H HG21 . THR A 1 112 ? 6.409   30.216  -10.711 1.00 0.00 ? 112 THR A HG21 5  
ATOM 9278  H HG22 . THR A 1 112 ? 7.497   31.089  -11.791 1.00 0.00 ? 112 THR A HG22 5  
ATOM 9279  H HG23 . THR A 1 112 ? 7.858   30.988  -10.067 1.00 0.00 ? 112 THR A HG23 5  
ATOM 9280  N N    . VAL A 1 113 ? 9.511   26.523  -10.216 1.00 0.00 ? 113 VAL A N    5  
ATOM 9281  C CA   . VAL A 1 113 ? 10.367  25.370  -10.464 1.00 0.00 ? 113 VAL A CA   5  
ATOM 9282  C C    . VAL A 1 113 ? 10.696  24.644  -9.164  1.00 0.00 ? 113 VAL A C    5  
ATOM 9283  O O    . VAL A 1 113 ? 10.258  23.515  -8.944  1.00 0.00 ? 113 VAL A O    5  
ATOM 9284  C CB   . VAL A 1 113 ? 11.681  25.783  -11.157 1.00 0.00 ? 113 VAL A CB   5  
ATOM 9285  C CG1  . VAL A 1 113 ? 12.491  24.554  -11.544 1.00 0.00 ? 113 VAL A CG1  5  
ATOM 9286  C CG2  . VAL A 1 113 ? 11.394  26.646  -12.376 1.00 0.00 ? 113 VAL A CG2  5  
ATOM 9287  H H    . VAL A 1 113 ? 9.778   27.180  -9.540  1.00 0.00 ? 113 VAL A H    5  
ATOM 9288  H HA   . VAL A 1 113 ? 9.836   24.695  -11.118 1.00 0.00 ? 113 VAL A HA   5  
ATOM 9289  H HB   . VAL A 1 113 ? 12.264  26.365  -10.460 1.00 0.00 ? 113 VAL A HB   5  
ATOM 9290  H HG11 . VAL A 1 113 ? 13.522  24.837  -11.700 1.00 0.00 ? 113 VAL A HG11 5  
ATOM 9291  H HG12 . VAL A 1 113 ? 12.092  24.133  -12.455 1.00 0.00 ? 113 VAL A HG12 5  
ATOM 9292  H HG13 . VAL A 1 113 ? 12.435  23.822  -10.753 1.00 0.00 ? 113 VAL A HG13 5  
ATOM 9293  H HG21 . VAL A 1 113 ? 10.398  27.058  -12.302 1.00 0.00 ? 113 VAL A HG21 5  
ATOM 9294  H HG22 . VAL A 1 113 ? 11.469  26.044  -13.269 1.00 0.00 ? 113 VAL A HG22 5  
ATOM 9295  H HG23 . VAL A 1 113 ? 12.113  27.451  -12.425 1.00 0.00 ? 113 VAL A HG23 5  
ATOM 9296  N N    . ASP A 1 114 ? 11.470  25.300  -8.304  1.00 0.00 ? 114 ASP A N    5  
ATOM 9297  C CA   . ASP A 1 114 ? 11.857  24.718  -7.024  1.00 0.00 ? 114 ASP A CA   5  
ATOM 9298  C C    . ASP A 1 114 ? 12.572  23.385  -7.224  1.00 0.00 ? 114 ASP A C    5  
ATOM 9299  O O    . ASP A 1 114 ? 12.482  22.489  -6.384  1.00 0.00 ? 114 ASP A O    5  
ATOM 9300  C CB   . ASP A 1 114 ? 10.626  24.523  -6.137  1.00 0.00 ? 114 ASP A CB   5  
ATOM 9301  C CG   . ASP A 1 114 ? 10.911  24.829  -4.679  1.00 0.00 ? 114 ASP A CG   5  
ATOM 9302  O OD1  . ASP A 1 114 ? 11.649  25.800  -4.410  1.00 0.00 ? 114 ASP A OD1  5  
ATOM 9303  O OD2  . ASP A 1 114 ? 10.395  24.098  -3.807  1.00 0.00 ? 114 ASP A OD2  5  
ATOM 9304  H H    . ASP A 1 114 ? 11.787  26.198  -8.537  1.00 0.00 ? 114 ASP A H    5  
ATOM 9305  H HA   . ASP A 1 114 ? 12.533  25.406  -6.539  1.00 0.00 ? 114 ASP A HA   5  
ATOM 9306  H HB2  . ASP A 1 114 ? 9.838   25.178  -6.475  1.00 0.00 ? 114 ASP A HB2  5  
ATOM 9307  H HB3  . ASP A 1 114 ? 10.295  23.497  -6.212  1.00 0.00 ? 114 ASP A HB3  5  
ATOM 9308  N N    . GLU A 1 115 ? 13.283  23.261  -8.340  1.00 0.00 ? 115 GLU A N    5  
ATOM 9309  C CA   . GLU A 1 115 ? 14.014  22.037  -8.649  1.00 0.00 ? 115 GLU A CA   5  
ATOM 9310  C C    . GLU A 1 115 ? 15.318  22.350  -9.374  1.00 0.00 ? 115 GLU A C    5  
ATOM 9311  O O    . GLU A 1 115 ? 15.321  22.643  -10.569 1.00 0.00 ? 115 GLU A O    5  
ATOM 9312  C CB   . GLU A 1 115 ? 13.151  21.106  -9.503  1.00 0.00 ? 115 GLU A CB   5  
ATOM 9313  C CG   . GLU A 1 115 ? 13.334  19.634  -9.173  1.00 0.00 ? 115 GLU A CG   5  
ATOM 9314  C CD   . GLU A 1 115 ? 12.542  18.727  -10.095 1.00 0.00 ? 115 GLU A CD   5  
ATOM 9315  O OE1  . GLU A 1 115 ? 13.078  18.347  -11.157 1.00 0.00 ? 115 GLU A OE1  5  
ATOM 9316  O OE2  . GLU A 1 115 ? 11.387  18.398  -9.754  1.00 0.00 ? 115 GLU A OE2  5  
ATOM 9317  H H    . GLU A 1 115 ? 13.317  24.010  -8.971  1.00 0.00 ? 115 GLU A H    5  
ATOM 9318  H HA   . GLU A 1 115 ? 14.243  21.545  -7.716  1.00 0.00 ? 115 GLU A HA   5  
ATOM 9319  H HB2  . GLU A 1 115 ? 12.112  21.359  -9.355  1.00 0.00 ? 115 GLU A HB2  5  
ATOM 9320  H HB3  . GLU A 1 115 ? 13.403  21.254  -10.543 1.00 0.00 ? 115 GLU A HB3  5  
ATOM 9321  H HG2  . GLU A 1 115 ? 14.382  19.385  -9.262  1.00 0.00 ? 115 GLU A HG2  5  
ATOM 9322  H HG3  . GLU A 1 115 ? 13.010  19.463  -8.157  1.00 0.00 ? 115 GLU A HG3  5  
ATOM 9323  N N    . THR A 1 116 ? 16.426  22.285  -8.641  1.00 0.00 ? 116 THR A N    5  
ATOM 9324  C CA   . THR A 1 116 ? 17.738  22.560  -9.215  1.00 0.00 ? 116 THR A CA   5  
ATOM 9325  C C    . THR A 1 116 ? 18.798  21.642  -8.612  1.00 0.00 ? 116 THR A C    5  
ATOM 9326  O O    . THR A 1 116 ? 19.764  22.105  -8.004  1.00 0.00 ? 116 THR A O    5  
ATOM 9327  C CB   . THR A 1 116 ? 18.119  24.024  -8.986  1.00 0.00 ? 116 THR A CB   5  
ATOM 9328  O OG1  . THR A 1 116 ? 17.761  24.438  -7.680  1.00 0.00 ? 116 THR A OG1  5  
ATOM 9329  C CG2  . THR A 1 116 ? 17.464  24.973  -9.965  1.00 0.00 ? 116 THR A CG2  5  
ATOM 9330  H H    . THR A 1 116 ? 16.359  22.045  -7.693  1.00 0.00 ? 116 THR A H    5  
ATOM 9331  H HA   . THR A 1 116 ? 17.680  22.374  -10.276 1.00 0.00 ? 116 THR A HA   5  
ATOM 9332  H HB   . THR A 1 116 ? 19.190  24.127  -9.092  1.00 0.00 ? 116 THR A HB   5  
ATOM 9333  H HG1  . THR A 1 116 ? 18.152  23.843  -7.036  1.00 0.00 ? 116 THR A HG1  5  
ATOM 9334  H HG21 . THR A 1 116 ? 18.192  25.692  -10.312 1.00 0.00 ? 116 THR A HG21 5  
ATOM 9335  H HG22 . THR A 1 116 ? 16.652  25.492  -9.476  1.00 0.00 ? 116 THR A HG22 5  
ATOM 9336  H HG23 . THR A 1 116 ? 17.080  24.415  -10.805 1.00 0.00 ? 116 THR A HG23 5  
ATOM 9337  N N    . LYS A 1 117 ? 18.609  20.338  -8.784  1.00 0.00 ? 117 LYS A N    5  
ATOM 9338  C CA   . LYS A 1 117 ? 19.546  19.353  -8.257  1.00 0.00 ? 117 LYS A CA   5  
ATOM 9339  C C    . LYS A 1 117 ? 19.625  18.135  -9.171  1.00 0.00 ? 117 LYS A C    5  
ATOM 9340  O O    . LYS A 1 117 ? 20.713  17.674  -9.516  1.00 0.00 ? 117 LYS A O    5  
ATOM 9341  C CB   . LYS A 1 117 ? 19.129  18.924  -6.849  1.00 0.00 ? 117 LYS A CB   5  
ATOM 9342  C CG   . LYS A 1 117 ? 19.549  19.904  -5.765  1.00 0.00 ? 117 LYS A CG   5  
ATOM 9343  C CD   . LYS A 1 117 ? 20.489  19.258  -4.758  1.00 0.00 ? 117 LYS A CD   5  
ATOM 9344  C CE   . LYS A 1 117 ? 21.390  20.288  -4.097  1.00 0.00 ? 117 LYS A CE   5  
ATOM 9345  N NZ   . LYS A 1 117 ? 20.775  20.859  -2.867  1.00 0.00 ? 117 LYS A NZ   5  
ATOM 9346  H H    . LYS A 1 117 ? 17.820  20.030  -9.277  1.00 0.00 ? 117 LYS A H    5  
ATOM 9347  H HA   . LYS A 1 117 ? 20.521  19.816  -8.209  1.00 0.00 ? 117 LYS A HA   5  
ATOM 9348  H HB2  . LYS A 1 117 ? 18.055  18.826  -6.819  1.00 0.00 ? 117 LYS A HB2  5  
ATOM 9349  H HB3  . LYS A 1 117 ? 19.575  17.964  -6.632  1.00 0.00 ? 117 LYS A HB3  5  
ATOM 9350  H HG2  . LYS A 1 117 ? 20.053  20.740  -6.225  1.00 0.00 ? 117 LYS A HG2  5  
ATOM 9351  H HG3  . LYS A 1 117 ? 18.667  20.252  -5.248  1.00 0.00 ? 117 LYS A HG3  5  
ATOM 9352  H HD2  . LYS A 1 117 ? 19.901  18.767  -3.997  1.00 0.00 ? 117 LYS A HD2  5  
ATOM 9353  H HD3  . LYS A 1 117 ? 21.101  18.529  -5.269  1.00 0.00 ? 117 LYS A HD3  5  
ATOM 9354  H HE2  . LYS A 1 117 ? 22.325  19.815  -3.835  1.00 0.00 ? 117 LYS A HE2  5  
ATOM 9355  H HE3  . LYS A 1 117 ? 21.577  21.087  -4.800  1.00 0.00 ? 117 LYS A HE3  5  
ATOM 9356  H HZ1  . LYS A 1 117 ? 21.025  21.864  -2.775  1.00 0.00 ? 117 LYS A HZ1  5  
ATOM 9357  H HZ2  . LYS A 1 117 ? 21.117  20.350  -2.027  1.00 0.00 ? 117 LYS A HZ2  5  
ATOM 9358  H HZ3  . LYS A 1 117 ? 19.739  20.772  -2.913  1.00 0.00 ? 117 LYS A HZ3  5  
ATOM 9359  N N    . TRP A 1 118 ? 18.464  17.617  -9.559  1.00 0.00 ? 118 TRP A N    5  
ATOM 9360  C CA   . TRP A 1 118 ? 18.401  16.452  -10.433 1.00 0.00 ? 118 TRP A CA   5  
ATOM 9361  C C    . TRP A 1 118 ? 17.465  16.705  -11.610 1.00 0.00 ? 118 TRP A C    5  
ATOM 9362  O O    . TRP A 1 118 ? 16.252  16.823  -11.438 1.00 0.00 ? 118 TRP A O    5  
ATOM 9363  C CB   . TRP A 1 118 ? 17.930  15.225  -9.649  1.00 0.00 ? 118 TRP A CB   5  
ATOM 9364  C CG   . TRP A 1 118 ? 18.529  13.942  -10.137 1.00 0.00 ? 118 TRP A CG   5  
ATOM 9365  C CD1  . TRP A 1 118 ? 19.469  13.182  -9.502  1.00 0.00 ? 118 TRP A CD1  5  
ATOM 9366  C CD2  . TRP A 1 118 ? 18.231  13.269  -11.366 1.00 0.00 ? 118 TRP A CD2  5  
ATOM 9367  N NE1  . TRP A 1 118 ? 19.773  12.077  -10.259 1.00 0.00 ? 118 TRP A NE1  5  
ATOM 9368  C CE2  . TRP A 1 118 ? 19.026  12.108  -11.408 1.00 0.00 ? 118 TRP A CE2  5  
ATOM 9369  C CE3  . TRP A 1 118 ? 17.369  13.534  -12.433 1.00 0.00 ? 118 TRP A CE3  5  
ATOM 9370  C CZ2  . TRP A 1 118 ? 18.984  11.214  -12.476 1.00 0.00 ? 118 TRP A CZ2  5  
ATOM 9371  C CZ3  . TRP A 1 118 ? 17.328  12.647  -13.492 1.00 0.00 ? 118 TRP A CZ3  5  
ATOM 9372  C CH2  . TRP A 1 118 ? 18.130  11.499  -13.507 1.00 0.00 ? 118 TRP A CH2  5  
ATOM 9373  H H    . TRP A 1 118 ? 17.630  18.029  -9.250  1.00 0.00 ? 118 TRP A H    5  
ATOM 9374  H HA   . TRP A 1 118 ? 19.395  16.266  -10.811 1.00 0.00 ? 118 TRP A HA   5  
ATOM 9375  H HB2  . TRP A 1 118 ? 18.200  15.345  -8.610  1.00 0.00 ? 118 TRP A HB2  5  
ATOM 9376  H HB3  . TRP A 1 118 ? 16.855  15.145  -9.730  1.00 0.00 ? 118 TRP A HB3  5  
ATOM 9377  H HD1  . TRP A 1 118 ? 19.902  13.426  -8.543  1.00 0.00 ? 118 TRP A HD1  5  
ATOM 9378  H HE1  . TRP A 1 118 ? 20.418  11.380  -10.017 1.00 0.00 ? 118 TRP A HE1  5  
ATOM 9379  H HE3  . TRP A 1 118 ? 16.742  14.414  -12.439 1.00 0.00 ? 118 TRP A HE3  5  
ATOM 9380  H HZ2  . TRP A 1 118 ? 19.595  10.325  -12.503 1.00 0.00 ? 118 TRP A HZ2  5  
ATOM 9381  H HZ3  . TRP A 1 118 ? 16.667  12.835  -14.326 1.00 0.00 ? 118 TRP A HZ3  5  
ATOM 9382  H HH2  . TRP A 1 118 ? 18.065  10.834  -14.355 1.00 0.00 ? 118 TRP A HH2  5  
ATOM 9383  N N    . ILE A 1 119 ? 18.038  16.789  -12.807 1.00 0.00 ? 119 ILE A N    5  
ATOM 9384  C CA   . ILE A 1 119 ? 17.256  17.029  -14.014 1.00 0.00 ? 119 ILE A CA   5  
ATOM 9385  C C    . ILE A 1 119 ? 17.558  15.981  -15.079 1.00 0.00 ? 119 ILE A C    5  
ATOM 9386  O O    . ILE A 1 119 ? 18.670  15.457  -15.153 1.00 0.00 ? 119 ILE A O    5  
ATOM 9387  C CB   . ILE A 1 119 ? 17.532  18.431  -14.594 1.00 0.00 ? 119 ILE A CB   5  
ATOM 9388  C CG1  . ILE A 1 119 ? 17.389  19.498  -13.505 1.00 0.00 ? 119 ILE A CG1  5  
ATOM 9389  C CG2  . ILE A 1 119 ? 16.590  18.720  -15.753 1.00 0.00 ? 119 ILE A CG2  5  
ATOM 9390  C CD1  . ILE A 1 119 ? 18.448  20.575  -13.573 1.00 0.00 ? 119 ILE A CD1  5  
ATOM 9391  H H    . ILE A 1 119 ? 19.010  16.687  -12.879 1.00 0.00 ? 119 ILE A H    5  
ATOM 9392  H HA   . ILE A 1 119 ? 16.210  16.971  -13.750 1.00 0.00 ? 119 ILE A HA   5  
ATOM 9393  H HB   . ILE A 1 119 ? 18.543  18.446  -14.972 1.00 0.00 ? 119 ILE A HB   5  
ATOM 9394  H HG12 . ILE A 1 119 ? 16.425  19.974  -13.603 1.00 0.00 ? 119 ILE A HG12 5  
ATOM 9395  H HG13 . ILE A 1 119 ? 17.455  19.026  -12.536 1.00 0.00 ? 119 ILE A HG13 5  
ATOM 9396  H HG21 . ILE A 1 119 ? 16.938  18.205  -16.637 1.00 0.00 ? 119 ILE A HG21 5  
ATOM 9397  H HG22 . ILE A 1 119 ? 16.566  19.783  -15.941 1.00 0.00 ? 119 ILE A HG22 5  
ATOM 9398  H HG23 . ILE A 1 119 ? 15.597  18.376  -15.504 1.00 0.00 ? 119 ILE A HG23 5  
ATOM 9399  H HD11 . ILE A 1 119 ? 19.195  20.301  -14.303 1.00 0.00 ? 119 ILE A HD11 5  
ATOM 9400  H HD12 . ILE A 1 119 ? 18.914  20.683  -12.604 1.00 0.00 ? 119 ILE A HD12 5  
ATOM 9401  H HD13 . ILE A 1 119 ? 17.992  21.511  -13.859 1.00 0.00 ? 119 ILE A HD13 5  
ATOM 9402  N N    . ALA A 1 120 ? 16.560  15.679  -15.905 1.00 0.00 ? 120 ALA A N    5  
ATOM 9403  C CA   . ALA A 1 120 ? 16.718  14.693  -16.966 1.00 0.00 ? 120 ALA A CA   5  
ATOM 9404  C C    . ALA A 1 120 ? 17.100  15.361  -18.283 1.00 0.00 ? 120 ALA A C    5  
ATOM 9405  O O    . ALA A 1 120 ? 17.053  16.584  -18.407 1.00 0.00 ? 120 ALA A O    5  
ATOM 9406  C CB   . ALA A 1 120 ? 15.439  13.888  -17.132 1.00 0.00 ? 120 ALA A CB   5  
ATOM 9407  H H    . ALA A 1 120 ? 15.697  16.130  -15.795 1.00 0.00 ? 120 ALA A H    5  
ATOM 9408  H HA   . ALA A 1 120 ? 17.507  14.015  -16.676 1.00 0.00 ? 120 ALA A HA   5  
ATOM 9409  H HB1  . ALA A 1 120 ? 14.867  14.287  -17.956 1.00 0.00 ? 120 ALA A HB1  5  
ATOM 9410  H HB2  . ALA A 1 120 ? 14.855  13.949  -16.226 1.00 0.00 ? 120 ALA A HB2  5  
ATOM 9411  H HB3  . ALA A 1 120 ? 15.686  12.856  -17.332 1.00 0.00 ? 120 ALA A HB3  5  
ATOM 9412  N N    . SER A 1 121 ? 17.477  14.548  -19.264 1.00 0.00 ? 121 SER A N    5  
ATOM 9413  C CA   . SER A 1 121 ? 17.867  15.059  -20.574 1.00 0.00 ? 121 SER A CA   5  
ATOM 9414  C C    . SER A 1 121 ? 16.641  15.306  -21.447 1.00 0.00 ? 121 SER A C    5  
ATOM 9415  O O    . SER A 1 121 ? 16.605  16.256  -22.229 1.00 0.00 ? 121 SER A O    5  
ATOM 9416  C CB   . SER A 1 121 ? 18.813  14.078  -21.266 1.00 0.00 ? 121 SER A CB   5  
ATOM 9417  O OG   . SER A 1 121 ? 19.515  14.706  -22.324 1.00 0.00 ? 121 SER A OG   5  
ATOM 9418  H H    . SER A 1 121 ? 17.494  13.582  -19.105 1.00 0.00 ? 121 SER A H    5  
ATOM 9419  H HA   . SER A 1 121 ? 18.381  15.997  -20.423 1.00 0.00 ? 121 SER A HA   5  
ATOM 9420  H HB2  . SER A 1 121 ? 19.528  13.704  -20.549 1.00 0.00 ? 121 SER A HB2  5  
ATOM 9421  H HB3  . SER A 1 121 ? 18.242  13.253  -21.668 1.00 0.00 ? 121 SER A HB3  5  
ATOM 9422  H HG   . SER A 1 121 ? 19.744  14.053  -22.990 1.00 0.00 ? 121 SER A HG   5  
ATOM 9423  N N    . SER A 1 122 ? 15.640  14.443  -21.310 1.00 0.00 ? 122 SER A N    5  
ATOM 9424  C CA   . SER A 1 122 ? 14.413  14.567  -22.088 1.00 0.00 ? 122 SER A CA   5  
ATOM 9425  C C    . SER A 1 122 ? 13.233  13.946  -21.345 1.00 0.00 ? 122 SER A C    5  
ATOM 9426  O O    . SER A 1 122 ? 12.228  14.609  -21.090 1.00 0.00 ? 122 SER A O    5  
ATOM 9427  C CB   . SER A 1 122 ? 14.579  13.899  -23.454 1.00 0.00 ? 122 SER A CB   5  
ATOM 9428  O OG   . SER A 1 122 ? 15.013  14.831  -24.428 1.00 0.00 ? 122 SER A OG   5  
ATOM 9429  H H    . SER A 1 122 ? 15.729  13.706  -20.672 1.00 0.00 ? 122 SER A H    5  
ATOM 9430  H HA   . SER A 1 122 ? 14.217  15.618  -22.233 1.00 0.00 ? 122 SER A HA   5  
ATOM 9431  H HB2  . SER A 1 122 ? 15.312  13.108  -23.379 1.00 0.00 ? 122 SER A HB2  5  
ATOM 9432  H HB3  . SER A 1 122 ? 13.633  13.483  -23.767 1.00 0.00 ? 122 SER A HB3  5  
ATOM 9433  H HG   . SER A 1 122 ? 14.317  15.471  -24.593 1.00 0.00 ? 122 SER A HG   5  
ATOM 9434  N N    . SER A 1 123 ? 13.364  12.668  -21.002 1.00 0.00 ? 123 SER A N    5  
ATOM 9435  C CA   . SER A 1 123 ? 12.309  11.957  -20.289 1.00 0.00 ? 123 SER A CA   5  
ATOM 9436  C C    . SER A 1 123 ? 12.750  10.540  -19.939 1.00 0.00 ? 123 SER A C    5  
ATOM 9437  O O    . SER A 1 123 ? 12.862  10.184  -18.766 1.00 0.00 ? 123 SER A O    5  
ATOM 9438  C CB   . SER A 1 123 ? 11.034  11.914  -21.132 1.00 0.00 ? 123 SER A CB   5  
ATOM 9439  O OG   . SER A 1 123 ? 11.295  11.401  -22.427 1.00 0.00 ? 123 SER A OG   5  
ATOM 9440  H H    . SER A 1 123 ? 14.188  12.193  -21.234 1.00 0.00 ? 123 SER A H    5  
ATOM 9441  H HA   . SER A 1 123 ? 12.108  12.495  -19.374 1.00 0.00 ? 123 SER A HA   5  
ATOM 9442  H HB2  . SER A 1 123 ? 10.306  11.280  -20.648 1.00 0.00 ? 123 SER A HB2  5  
ATOM 9443  H HB3  . SER A 1 123 ? 10.634  12.913  -21.228 1.00 0.00 ? 123 SER A HB3  5  
ATOM 9444  H HG   . SER A 1 123 ? 11.887  11.996  -22.894 1.00 0.00 ? 123 SER A HG   5  
ATOM 9445  N N    . GLY A 1 124 ? 12.999  9.733   -20.966 1.00 0.00 ? 124 GLY A N    5  
ATOM 9446  C CA   . GLY A 1 124 ? 13.425  8.363   -20.747 1.00 0.00 ? 124 GLY A CA   5  
ATOM 9447  C C    . GLY A 1 124 ? 13.026  7.442   -21.885 1.00 0.00 ? 124 GLY A C    5  
ATOM 9448  O O    . GLY A 1 124 ? 11.997  7.656   -22.526 1.00 0.00 ? 124 GLY A O    5  
ATOM 9449  H H    . GLY A 1 124 ? 12.893  10.070  -21.880 1.00 0.00 ? 124 GLY A H    5  
ATOM 9450  H HA2  . GLY A 1 124 ? 14.500  8.345   -20.644 1.00 0.00 ? 124 GLY A HA2  5  
ATOM 9451  H HA3  . GLY A 1 124 ? 12.980  8.002   -19.832 1.00 0.00 ? 124 GLY A HA3  5  
ATOM 9452  N N    . PRO A 1 125 ? 13.825  6.397   -22.161 1.00 0.00 ? 125 PRO A N    5  
ATOM 9453  C CA   . PRO A 1 125 ? 13.536  5.444   -23.237 1.00 0.00 ? 125 PRO A CA   5  
ATOM 9454  C C    . PRO A 1 125 ? 12.357  4.536   -22.905 1.00 0.00 ? 125 PRO A C    5  
ATOM 9455  O O    . PRO A 1 125 ? 12.306  3.935   -21.831 1.00 0.00 ? 125 PRO A O    5  
ATOM 9456  C CB   . PRO A 1 125 ? 14.826  4.628   -23.344 1.00 0.00 ? 125 PRO A CB   5  
ATOM 9457  C CG   . PRO A 1 125 ? 15.435  4.707   -21.987 1.00 0.00 ? 125 PRO A CG   5  
ATOM 9458  C CD   . PRO A 1 125 ? 15.074  6.063   -21.447 1.00 0.00 ? 125 PRO A CD   5  
ATOM 9459  H HA   . PRO A 1 125 ? 13.347  5.949   -24.173 1.00 0.00 ? 125 PRO A HA   5  
ATOM 9460  H HB2  . PRO A 1 125 ? 14.589  3.609   -23.614 1.00 0.00 ? 125 PRO A HB2  5  
ATOM 9461  H HB3  . PRO A 1 125 ? 15.470  5.065   -24.091 1.00 0.00 ? 125 PRO A HB3  5  
ATOM 9462  H HG2  . PRO A 1 125 ? 15.026  3.931   -21.356 1.00 0.00 ? 125 PRO A HG2  5  
ATOM 9463  H HG3  . PRO A 1 125 ? 16.507  4.607   -22.060 1.00 0.00 ? 125 PRO A HG3  5  
ATOM 9464  H HD2  . PRO A 1 125 ? 14.906  6.013   -20.382 1.00 0.00 ? 125 PRO A HD2  5  
ATOM 9465  H HD3  . PRO A 1 125 ? 15.849  6.779   -21.675 1.00 0.00 ? 125 PRO A HD3  5  
ATOM 9466  N N    . SER A 1 126 ? 11.410  4.440   -23.833 1.00 0.00 ? 126 SER A N    5  
ATOM 9467  C CA   . SER A 1 126 ? 10.230  3.605   -23.637 1.00 0.00 ? 126 SER A CA   5  
ATOM 9468  C C    . SER A 1 126 ? 9.520   3.350   -24.962 1.00 0.00 ? 126 SER A C    5  
ATOM 9469  O O    . SER A 1 126 ? 9.451   2.215   -25.433 1.00 0.00 ? 126 SER A O    5  
ATOM 9470  C CB   . SER A 1 126 ? 9.269   4.266   -22.648 1.00 0.00 ? 126 SER A CB   5  
ATOM 9471  O OG   . SER A 1 126 ? 9.784   4.221   -21.329 1.00 0.00 ? 126 SER A OG   5  
ATOM 9472  H H    . SER A 1 126 ? 11.506  4.943   -24.668 1.00 0.00 ? 126 SER A H    5  
ATOM 9473  H HA   . SER A 1 126 ? 10.558  2.660   -23.230 1.00 0.00 ? 126 SER A HA   5  
ATOM 9474  H HB2  . SER A 1 126 ? 9.121   5.298   -22.928 1.00 0.00 ? 126 SER A HB2  5  
ATOM 9475  H HB3  . SER A 1 126 ? 8.321   3.748   -22.669 1.00 0.00 ? 126 SER A HB3  5  
ATOM 9476  H HG   . SER A 1 126 ? 9.261   4.792   -20.761 1.00 0.00 ? 126 SER A HG   5  
ATOM 9477  N N    . SER A 1 127 ? 8.992   4.414   -25.559 1.00 0.00 ? 127 SER A N    5  
ATOM 9478  C CA   . SER A 1 127 ? 8.285   4.306   -26.830 1.00 0.00 ? 127 SER A CA   5  
ATOM 9479  C C    . SER A 1 127 ? 9.028   5.056   -27.931 1.00 0.00 ? 127 SER A C    5  
ATOM 9480  O O    . SER A 1 127 ? 10.098  5.619   -27.699 1.00 0.00 ? 127 SER A O    5  
ATOM 9481  C CB   . SER A 1 127 ? 6.863   4.854   -26.695 1.00 0.00 ? 127 SER A CB   5  
ATOM 9482  O OG   . SER A 1 127 ? 6.827   5.972   -25.825 1.00 0.00 ? 127 SER A OG   5  
ATOM 9483  H H    . SER A 1 127 ? 9.079   5.293   -25.134 1.00 0.00 ? 127 SER A H    5  
ATOM 9484  H HA   . SER A 1 127 ? 8.234   3.261   -27.094 1.00 0.00 ? 127 SER A HA   5  
ATOM 9485  H HB2  . SER A 1 127 ? 6.503   5.159   -27.666 1.00 0.00 ? 127 SER A HB2  5  
ATOM 9486  H HB3  . SER A 1 127 ? 6.219   4.084   -26.298 1.00 0.00 ? 127 SER A HB3  5  
ATOM 9487  H HG   . SER A 1 127 ? 5.914   6.206   -25.642 1.00 0.00 ? 127 SER A HG   5  
ATOM 9488  N N    . GLY A 1 128 ? 8.455   5.058   -29.129 1.00 0.00 ? 128 GLY A N    5  
ATOM 9489  C CA   . GLY A 1 128 ? 9.077   5.741   -30.248 1.00 0.00 ? 128 GLY A CA   5  
ATOM 9490  C C    . GLY A 1 128 ? 8.506   5.306   -31.583 1.00 0.00 ? 128 GLY A C    5  
ATOM 9491  O O    . GLY A 1 128 ? 7.414   5.791   -31.948 1.00 0.00 ? 128 GLY A O    5  
ATOM 9492  O OXT  . GLY A 1 128 ? 9.151   4.482   -32.265 1.00 0.00 ? 128 GLY A OXT  5  
ATOM 9493  H H    . GLY A 1 128 ? 7.601   4.592   -29.256 1.00 0.00 ? 128 GLY A H    5  
ATOM 9494  H HA2  . GLY A 1 128 ? 8.927   6.805   -30.134 1.00 0.00 ? 128 GLY A HA2  5  
ATOM 9495  H HA3  . GLY A 1 128 ? 10.136  5.534   -30.238 1.00 0.00 ? 128 GLY A HA3  5  
ATOM 9496  N N    . GLY A 1 1   ? -13.010 15.655  48.455  1.00 0.00 ? 1   GLY A N    6  
ATOM 9497  C CA   . GLY A 1 1   ? -11.975 16.531  49.068  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9498  C C    . GLY A 1 1   ? -10.705 16.592  48.242  1.00 0.00 ? 1   GLY A C    6  
ATOM 9499  O O    . GLY A 1 1   ? -10.380 15.649  47.521  1.00 0.00 ? 1   GLY A O    6  
ATOM 9500  H H1   . GLY A 1 1   ? -13.958 15.948  48.768  1.00 0.00 ? 1   GLY A H1   6  
ATOM 9501  H H2   . GLY A 1 1   ? -12.856 14.666  48.735  1.00 0.00 ? 1   GLY A H2   6  
ATOM 9502  H H3   . GLY A 1 1   ? -12.965 15.720  47.417  1.00 0.00 ? 1   GLY A H3   6  
ATOM 9503  H HA2  . GLY A 1 1   ? -12.375 17.528  49.166  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9504  H HA3  . GLY A 1 1   ? -11.734 16.151  50.050  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9505  N N    . SER A 1 2   ? -9.986  17.705  48.347  1.00 0.00 ? 2   SER A N    6  
ATOM 9506  C CA   . SER A 1 2   ? -8.744  17.886  47.603  1.00 0.00 ? 2   SER A CA   6  
ATOM 9507  C C    . SER A 1 2   ? -8.995  17.816  46.101  1.00 0.00 ? 2   SER A C    6  
ATOM 9508  O O    . SER A 1 2   ? -9.154  16.733  45.537  1.00 0.00 ? 2   SER A O    6  
ATOM 9509  C CB   . SER A 1 2   ? -7.721  16.824  48.012  1.00 0.00 ? 2   SER A CB   6  
ATOM 9510  O OG   . SER A 1 2   ? -7.993  16.327  49.310  1.00 0.00 ? 2   SER A OG   6  
ATOM 9511  H H    . SER A 1 2   ? -10.298 18.422  48.938  1.00 0.00 ? 2   SER A H    6  
ATOM 9512  H HA   . SER A 1 2   ? -8.353  18.863  47.846  1.00 0.00 ? 2   SER A HA   6  
ATOM 9513  H HB2  . SER A 1 2   ? -7.758  16.004  47.311  1.00 0.00 ? 2   SER A HB2  6  
ATOM 9514  H HB3  . SER A 1 2   ? -6.732  17.259  48.005  1.00 0.00 ? 2   SER A HB3  6  
ATOM 9515  H HG   . SER A 1 2   ? -8.111  17.062  49.917  1.00 0.00 ? 2   SER A HG   6  
ATOM 9516  N N    . SER A 1 3   ? -9.030  18.979  45.457  1.00 0.00 ? 3   SER A N    6  
ATOM 9517  C CA   . SER A 1 3   ? -9.262  19.050  44.019  1.00 0.00 ? 3   SER A CA   6  
ATOM 9518  C C    . SER A 1 3   ? -8.023  18.613  43.244  1.00 0.00 ? 3   SER A C    6  
ATOM 9519  O O    . SER A 1 3   ? -6.968  18.367  43.828  1.00 0.00 ? 3   SER A O    6  
ATOM 9520  C CB   . SER A 1 3   ? -9.655  20.472  43.615  1.00 0.00 ? 3   SER A CB   6  
ATOM 9521  O OG   . SER A 1 3   ? -10.195 20.499  42.305  1.00 0.00 ? 3   SER A OG   6  
ATOM 9522  H H    . SER A 1 3   ? -8.897  19.808  45.962  1.00 0.00 ? 3   SER A H    6  
ATOM 9523  H HA   . SER A 1 3   ? -10.075 18.380  43.781  1.00 0.00 ? 3   SER A HA   6  
ATOM 9524  H HB2  . SER A 1 3   ? -10.397 20.847  44.304  1.00 0.00 ? 3   SER A HB2  6  
ATOM 9525  H HB3  . SER A 1 3   ? -8.782  21.106  43.646  1.00 0.00 ? 3   SER A HB3  6  
ATOM 9526  H HG   . SER A 1 3   ? -11.146 20.625  42.353  1.00 0.00 ? 3   SER A HG   6  
ATOM 9527  N N    . GLY A 1 4   ? -8.159  18.519  41.926  1.00 0.00 ? 4   GLY A N    6  
ATOM 9528  C CA   . GLY A 1 4   ? -7.043  18.114  41.091  1.00 0.00 ? 4   GLY A CA   6  
ATOM 9529  C C    . GLY A 1 4   ? -6.638  16.672  41.323  1.00 0.00 ? 4   GLY A C    6  
ATOM 9530  O O    . GLY A 1 4   ? -6.293  16.288  42.441  1.00 0.00 ? 4   GLY A O    6  
ATOM 9531  H H    . GLY A 1 4   ? -9.024  18.729  41.516  1.00 0.00 ? 4   GLY A H    6  
ATOM 9532  H HA2  . GLY A 1 4   ? -7.320  18.237  40.055  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9533  H HA3  . GLY A 1 4   ? -6.198  18.752  41.305  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9534  N N    . SER A 1 5   ? -6.680  15.871  40.263  1.00 0.00 ? 5   SER A N    6  
ATOM 9535  C CA   . SER A 1 5   ? -6.313  14.463  40.353  1.00 0.00 ? 5   SER A CA   6  
ATOM 9536  C C    . SER A 1 5   ? -5.596  14.007  39.086  1.00 0.00 ? 5   SER A C    6  
ATOM 9537  O O    . SER A 1 5   ? -5.404  14.788  38.154  1.00 0.00 ? 5   SER A O    6  
ATOM 9538  C CB   . SER A 1 5   ? -7.558  13.604  40.584  1.00 0.00 ? 5   SER A CB   6  
ATOM 9539  O OG   . SER A 1 5   ? -8.648  14.064  39.804  1.00 0.00 ? 5   SER A OG   6  
ATOM 9540  H H    . SER A 1 5   ? -6.963  16.237  39.399  1.00 0.00 ? 5   SER A H    6  
ATOM 9541  H HA   . SER A 1 5   ? -5.645  14.347  41.192  1.00 0.00 ? 5   SER A HA   6  
ATOM 9542  H HB2  . SER A 1 5   ? -7.343  12.581  40.313  1.00 0.00 ? 5   SER A HB2  6  
ATOM 9543  H HB3  . SER A 1 5   ? -7.834  13.650  41.628  1.00 0.00 ? 5   SER A HB3  6  
ATOM 9544  H HG   . SER A 1 5   ? -8.979  14.888  40.169  1.00 0.00 ? 5   SER A HG   6  
ATOM 9545  N N    . SER A 1 6   ? -5.199  12.738  39.060  1.00 0.00 ? 6   SER A N    6  
ATOM 9546  C CA   . SER A 1 6   ? -4.500  12.174  37.908  1.00 0.00 ? 6   SER A CA   6  
ATOM 9547  C C    . SER A 1 6   ? -3.273  13.009  37.549  1.00 0.00 ? 6   SER A C    6  
ATOM 9548  O O    . SER A 1 6   ? -3.329  13.865  36.666  1.00 0.00 ? 6   SER A O    6  
ATOM 9549  C CB   . SER A 1 6   ? -5.443  12.083  36.706  1.00 0.00 ? 6   SER A CB   6  
ATOM 9550  O OG   . SER A 1 6   ? -5.699  13.364  36.156  1.00 0.00 ? 6   SER A OG   6  
ATOM 9551  H H    . SER A 1 6   ? -5.380  12.165  39.834  1.00 0.00 ? 6   SER A H    6  
ATOM 9552  H HA   . SER A 1 6   ? -4.176  11.179  38.174  1.00 0.00 ? 6   SER A HA   6  
ATOM 9553  H HB2  . SER A 1 6   ? -4.992  11.464  35.944  1.00 0.00 ? 6   SER A HB2  6  
ATOM 9554  H HB3  . SER A 1 6   ? -6.380  11.646  37.018  1.00 0.00 ? 6   SER A HB3  6  
ATOM 9555  H HG   . SER A 1 6   ? -4.895  13.711  35.763  1.00 0.00 ? 6   SER A HG   6  
ATOM 9556  N N    . GLY A 1 7   ? -2.168  12.753  38.238  1.00 0.00 ? 7   GLY A N    6  
ATOM 9557  C CA   . GLY A 1 7   ? -0.945  13.489  37.978  1.00 0.00 ? 7   GLY A CA   6  
ATOM 9558  C C    . GLY A 1 7   ? 0.286   12.605  38.027  1.00 0.00 ? 7   GLY A C    6  
ATOM 9559  O O    . GLY A 1 7   ? 1.082   12.689  38.963  1.00 0.00 ? 7   GLY A O    6  
ATOM 9560  H H    . GLY A 1 7   ? -2.181  12.060  38.931  1.00 0.00 ? 7   GLY A H    6  
ATOM 9561  H HA2  . GLY A 1 7   ? -1.011  13.940  36.999  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9562  H HA3  . GLY A 1 7   ? -0.842  14.271  38.716  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9563  N N    . ASP A 1 8   ? 0.442   11.754  37.018  1.00 0.00 ? 8   ASP A N    6  
ATOM 9564  C CA   . ASP A 1 8   ? 1.585   10.851  36.951  1.00 0.00 ? 8   ASP A CA   6  
ATOM 9565  C C    . ASP A 1 8   ? 2.189   10.842  35.551  1.00 0.00 ? 8   ASP A C    6  
ATOM 9566  O O    . ASP A 1 8   ? 1.686   11.501  34.642  1.00 0.00 ? 8   ASP A O    6  
ATOM 9567  C CB   . ASP A 1 8   ? 1.164   9.433   37.346  1.00 0.00 ? 8   ASP A CB   6  
ATOM 9568  C CG   . ASP A 1 8   ? 0.107   8.865   36.421  1.00 0.00 ? 8   ASP A CG   6  
ATOM 9569  O OD1  . ASP A 1 8   ? -0.594  9.662   35.760  1.00 0.00 ? 8   ASP A OD1  6  
ATOM 9570  O OD2  . ASP A 1 8   ? -0.020  7.625   36.354  1.00 0.00 ? 8   ASP A OD2  6  
ATOM 9571  H H    . ASP A 1 8   ? -0.227  11.733  36.303  1.00 0.00 ? 8   ASP A H    6  
ATOM 9572  H HA   . ASP A 1 8   ? 2.328   11.204  37.649  1.00 0.00 ? 8   ASP A HA   6  
ATOM 9573  H HB2  . ASP A 1 8   ? 2.028   8.787   37.316  1.00 0.00 ? 8   ASP A HB2  6  
ATOM 9574  H HB3  . ASP A 1 8   ? 0.766   9.451   38.350  1.00 0.00 ? 8   ASP A HB3  6  
ATOM 9575  N N    . ARG A 1 9   ? 3.272   10.089  35.385  1.00 0.00 ? 9   ARG A N    6  
ATOM 9576  C CA   . ARG A 1 9   ? 3.946   9.993   34.096  1.00 0.00 ? 9   ARG A CA   6  
ATOM 9577  C C    . ARG A 1 9   ? 4.499   8.590   33.874  1.00 0.00 ? 9   ARG A C    6  
ATOM 9578  O O    . ARG A 1 9   ? 5.146   8.020   34.753  1.00 0.00 ? 9   ARG A O    6  
ATOM 9579  C CB   . ARG A 1 9   ? 5.079   11.019  34.012  1.00 0.00 ? 9   ARG A CB   6  
ATOM 9580  C CG   . ARG A 1 9   ? 5.278   11.592  32.617  1.00 0.00 ? 9   ARG A CG   6  
ATOM 9581  C CD   . ARG A 1 9   ? 6.725   11.472  32.163  1.00 0.00 ? 9   ARG A CD   6  
ATOM 9582  N NE   . ARG A 1 9   ? 7.582   12.471  32.798  1.00 0.00 ? 9   ARG A NE   6  
ATOM 9583  C CZ   . ARG A 1 9   ? 8.790   12.802  32.349  1.00 0.00 ? 9   ARG A CZ   6  
ATOM 9584  N NH1  . ARG A 1 9   ? 9.287   12.218  31.265  1.00 0.00 ? 9   ARG A NH1  6  
ATOM 9585  N NH2  . ARG A 1 9   ? 9.505   13.720  32.986  1.00 0.00 ? 9   ARG A NH2  6  
ATOM 9586  H H    . ARG A 1 9   ? 3.626   9.586   36.148  1.00 0.00 ? 9   ARG A H    6  
ATOM 9587  H HA   . ARG A 1 9   ? 3.220   10.208  33.326  1.00 0.00 ? 9   ARG A HA   6  
ATOM 9588  H HB2  . ARG A 1 9   ? 4.861   11.835  34.685  1.00 0.00 ? 9   ARG A HB2  6  
ATOM 9589  H HB3  . ARG A 1 9   ? 6.000   10.546  34.320  1.00 0.00 ? 9   ARG A HB3  6  
ATOM 9590  H HG2  . ARG A 1 9   ? 4.649   11.054  31.925  1.00 0.00 ? 9   ARG A HG2  6  
ATOM 9591  H HG3  . ARG A 1 9   ? 4.997   12.635  32.624  1.00 0.00 ? 9   ARG A HG3  6  
ATOM 9592  H HD2  . ARG A 1 9   ? 7.088   10.487  32.417  1.00 0.00 ? 9   ARG A HD2  6  
ATOM 9593  H HD3  . ARG A 1 9   ? 6.764   11.605  31.092  1.00 0.00 ? 9   ARG A HD3  6  
ATOM 9594  H HE   . ARG A 1 9   ? 7.239   12.918  33.600  1.00 0.00 ? 9   ARG A HE   6  
ATOM 9595  H HH11 . ARG A 1 9   ? 8.754   11.525  30.781  1.00 0.00 ? 9   ARG A HH11 6  
ATOM 9596  H HH12 . ARG A 1 9   ? 10.196  12.471  30.934  1.00 0.00 ? 9   ARG A HH12 6  
ATOM 9597  H HH21 . ARG A 1 9   ? 9.135   14.164  33.802  1.00 0.00 ? 9   ARG A HH21 6  
ATOM 9598  H HH22 . ARG A 1 9   ? 10.412  13.969  32.649  1.00 0.00 ? 9   ARG A HH22 6  
ATOM 9599  N N    . ARG A 1 10  ? 4.239   8.036   32.695  1.00 0.00 ? 10  ARG A N    6  
ATOM 9600  C CA   . ARG A 1 10  ? 4.710   6.698   32.359  1.00 0.00 ? 10  ARG A CA   6  
ATOM 9601  C C    . ARG A 1 10  ? 4.644   6.458   30.854  1.00 0.00 ? 10  ARG A C    6  
ATOM 9602  O O    . ARG A 1 10  ? 5.639   6.087   30.230  1.00 0.00 ? 10  ARG A O    6  
ATOM 9603  C CB   . ARG A 1 10  ? 3.880   5.643   33.093  1.00 0.00 ? 10  ARG A CB   6  
ATOM 9604  C CG   . ARG A 1 10  ? 4.702   4.473   33.608  1.00 0.00 ? 10  ARG A CG   6  
ATOM 9605  C CD   . ARG A 1 10  ? 4.005   3.768   34.761  1.00 0.00 ? 10  ARG A CD   6  
ATOM 9606  N NE   . ARG A 1 10  ? 2.636   3.385   34.421  1.00 0.00 ? 10  ARG A NE   6  
ATOM 9607  C CZ   . ARG A 1 10  ? 1.857   2.648   35.209  1.00 0.00 ? 10  ARG A CZ   6  
ATOM 9608  N NH1  . ARG A 1 10  ? 2.305   2.213   36.380  1.00 0.00 ? 10  ARG A NH1  6  
ATOM 9609  N NH2  . ARG A 1 10  ? 0.623   2.346   34.825  1.00 0.00 ? 10  ARG A NH2  6  
ATOM 9610  H H    . ARG A 1 10  ? 3.717   8.539   32.035  1.00 0.00 ? 10  ARG A H    6  
ATOM 9611  H HA   . ARG A 1 10  ? 5.739   6.620   32.678  1.00 0.00 ? 10  ARG A HA   6  
ATOM 9612  H HB2  . ARG A 1 10  ? 3.390   6.110   33.935  1.00 0.00 ? 10  ARG A HB2  6  
ATOM 9613  H HB3  . ARG A 1 10  ? 3.128   5.259   32.418  1.00 0.00 ? 10  ARG A HB3  6  
ATOM 9614  H HG2  . ARG A 1 10  ? 4.848   3.768   32.804  1.00 0.00 ? 10  ARG A HG2  6  
ATOM 9615  H HG3  . ARG A 1 10  ? 5.659   4.840   33.947  1.00 0.00 ? 10  ARG A HG3  6  
ATOM 9616  H HD2  . ARG A 1 10  ? 4.565   2.879   35.013  1.00 0.00 ? 10  ARG A HD2  6  
ATOM 9617  H HD3  . ARG A 1 10  ? 3.983   4.432   35.611  1.00 0.00 ? 10  ARG A HD3  6  
ATOM 9618  H HE   . ARG A 1 10  ? 2.280   3.693   33.562  1.00 0.00 ? 10  ARG A HE   6  
ATOM 9619  H HH11 . ARG A 1 10  ? 3.233   2.438   36.676  1.00 0.00 ? 10  ARG A HH11 6  
ATOM 9620  H HH12 . ARG A 1 10  ? 1.713   1.660   36.967  1.00 0.00 ? 10  ARG A HH12 6  
ATOM 9621  H HH21 . ARG A 1 10  ? 0.281   2.672   33.943  1.00 0.00 ? 10  ARG A HH21 6  
ATOM 9622  H HH22 . ARG A 1 10  ? 0.037   1.792   35.415  1.00 0.00 ? 10  ARG A HH22 6  
ATOM 9623  N N    . SER A 1 11  ? 3.467   6.672   30.275  1.00 0.00 ? 11  SER A N    6  
ATOM 9624  C CA   . SER A 1 11  ? 3.272   6.479   28.844  1.00 0.00 ? 11  SER A CA   6  
ATOM 9625  C C    . SER A 1 11  ? 3.796   7.676   28.057  1.00 0.00 ? 11  SER A C    6  
ATOM 9626  O O    . SER A 1 11  ? 3.915   8.778   28.592  1.00 0.00 ? 11  SER A O    6  
ATOM 9627  C CB   . SER A 1 11  ? 1.790   6.262   28.534  1.00 0.00 ? 11  SER A CB   6  
ATOM 9628  O OG   . SER A 1 11  ? 1.036   7.432   28.797  1.00 0.00 ? 11  SER A OG   6  
ATOM 9629  H H    . SER A 1 11  ? 2.711   6.967   30.826  1.00 0.00 ? 11  SER A H    6  
ATOM 9630  H HA   . SER A 1 11  ? 3.825   5.600   28.549  1.00 0.00 ? 11  SER A HA   6  
ATOM 9631  H HB2  . SER A 1 11  ? 1.676   6.002   27.491  1.00 0.00 ? 11  SER A HB2  6  
ATOM 9632  H HB3  . SER A 1 11  ? 1.410   5.457   29.147  1.00 0.00 ? 11  SER A HB3  6  
ATOM 9633  H HG   . SER A 1 11  ? 1.282   8.119   28.174  1.00 0.00 ? 11  SER A HG   6  
ATOM 9634  N N    . THR A 1 12  ? 4.108   7.451   26.785  1.00 0.00 ? 12  THR A N    6  
ATOM 9635  C CA   . THR A 1 12  ? 4.619   8.511   25.925  1.00 0.00 ? 12  THR A CA   6  
ATOM 9636  C C    . THR A 1 12  ? 4.126   8.333   24.491  1.00 0.00 ? 12  THR A C    6  
ATOM 9637  O O    . THR A 1 12  ? 4.913   8.075   23.581  1.00 0.00 ? 12  THR A O    6  
ATOM 9638  C CB   . THR A 1 12  ? 6.148   8.528   25.957  1.00 0.00 ? 12  THR A CB   6  
ATOM 9639  O OG1  . THR A 1 12  ? 6.630   8.010   27.183  1.00 0.00 ? 12  THR A OG1  6  
ATOM 9640  C CG2  . THR A 1 12  ? 6.735   9.912   25.780  1.00 0.00 ? 12  THR A CG2  6  
ATOM 9641  H H    . THR A 1 12  ? 3.991   6.551   26.416  1.00 0.00 ? 12  THR A H    6  
ATOM 9642  H HA   . THR A 1 12  ? 4.250   9.452   26.306  1.00 0.00 ? 12  THR A HA   6  
ATOM 9643  H HB   . THR A 1 12  ? 6.522   7.905   25.155  1.00 0.00 ? 12  THR A HB   6  
ATOM 9644  H HG1  . THR A 1 12  ? 7.586   7.924   27.142  1.00 0.00 ? 12  THR A HG1  6  
ATOM 9645  H HG21 . THR A 1 12  ? 6.340   10.570  26.539  1.00 0.00 ? 12  THR A HG21 6  
ATOM 9646  H HG22 . THR A 1 12  ? 6.475   10.291  24.803  1.00 0.00 ? 12  THR A HG22 6  
ATOM 9647  H HG23 . THR A 1 12  ? 7.811   9.861   25.871  1.00 0.00 ? 12  THR A HG23 6  
ATOM 9648  N N    . LEU A 1 13  ? 2.819   8.477   24.299  1.00 0.00 ? 13  LEU A N    6  
ATOM 9649  C CA   . LEU A 1 13  ? 2.221   8.333   22.977  1.00 0.00 ? 13  LEU A CA   6  
ATOM 9650  C C    . LEU A 1 13  ? 1.777   9.687   22.430  1.00 0.00 ? 13  LEU A C    6  
ATOM 9651  O O    . LEU A 1 13  ? 1.924   10.713  23.093  1.00 0.00 ? 13  LEU A O    6  
ATOM 9652  C CB   . LEU A 1 13  ? 1.028   7.376   23.033  1.00 0.00 ? 13  LEU A CB   6  
ATOM 9653  C CG   . LEU A 1 13  ? 0.906   6.424   21.842  1.00 0.00 ? 13  LEU A CG   6  
ATOM 9654  C CD1  . LEU A 1 13  ? 1.596   5.103   22.141  1.00 0.00 ? 13  LEU A CD1  6  
ATOM 9655  C CD2  . LEU A 1 13  ? -0.557  6.195   21.489  1.00 0.00 ? 13  LEU A CD2  6  
ATOM 9656  H H    . LEU A 1 13  ? 2.243   8.683   25.064  1.00 0.00 ? 13  LEU A H    6  
ATOM 9657  H HA   . LEU A 1 13  ? 2.970   7.921   22.317  1.00 0.00 ? 13  LEU A HA   6  
ATOM 9658  H HB2  . LEU A 1 13  ? 1.111   6.785   23.934  1.00 0.00 ? 13  LEU A HB2  6  
ATOM 9659  H HB3  . LEU A 1 13  ? 0.124   7.963   23.091  1.00 0.00 ? 13  LEU A HB3  6  
ATOM 9660  H HG   . LEU A 1 13  ? 1.392   6.867   20.984  1.00 0.00 ? 13  LEU A HG   6  
ATOM 9661  H HD11 . LEU A 1 13  ? 2.486   5.286   22.726  1.00 0.00 ? 13  LEU A HD11 6  
ATOM 9662  H HD12 . LEU A 1 13  ? 1.868   4.620   21.214  1.00 0.00 ? 13  LEU A HD12 6  
ATOM 9663  H HD13 . LEU A 1 13  ? 0.926   4.464   22.697  1.00 0.00 ? 13  LEU A HD13 6  
ATOM 9664  H HD21 . LEU A 1 13  ? -0.624  5.712   20.525  1.00 0.00 ? 13  LEU A HD21 6  
ATOM 9665  H HD22 . LEU A 1 13  ? -1.072  7.143   21.454  1.00 0.00 ? 13  LEU A HD22 6  
ATOM 9666  H HD23 . LEU A 1 13  ? -1.013  5.565   22.239  1.00 0.00 ? 13  LEU A HD23 6  
ATOM 9667  N N    . HIS A 1 14  ? 1.236   9.680   21.217  1.00 0.00 ? 14  HIS A N    6  
ATOM 9668  C CA   . HIS A 1 14  ? 0.770   10.907  20.579  1.00 0.00 ? 14  HIS A CA   6  
ATOM 9669  C C    . HIS A 1 14  ? -0.680  10.769  20.126  1.00 0.00 ? 14  HIS A C    6  
ATOM 9670  O O    . HIS A 1 14  ? -1.094  9.710   19.654  1.00 0.00 ? 14  HIS A O    6  
ATOM 9671  C CB   . HIS A 1 14  ? 1.660   11.253  19.385  1.00 0.00 ? 14  HIS A CB   6  
ATOM 9672  C CG   . HIS A 1 14  ? 1.815   12.724  19.160  1.00 0.00 ? 14  HIS A CG   6  
ATOM 9673  N ND1  . HIS A 1 14  ? 1.884   13.641  20.189  1.00 0.00 ? 14  HIS A ND1  6  
ATOM 9674  C CD2  . HIS A 1 14  ? 1.916   13.441  18.016  1.00 0.00 ? 14  HIS A CD2  6  
ATOM 9675  C CE1  . HIS A 1 14  ? 2.019   14.855  19.688  1.00 0.00 ? 14  HIS A CE1  6  
ATOM 9676  N NE2  . HIS A 1 14  ? 2.042   14.761  18.371  1.00 0.00 ? 14  HIS A NE2  6  
ATOM 9677  H H    . HIS A 1 14  ? 1.145   8.830   20.737  1.00 0.00 ? 14  HIS A H    6  
ATOM 9678  H HA   . HIS A 1 14  ? 0.834   11.703  21.306  1.00 0.00 ? 14  HIS A HA   6  
ATOM 9679  H HB2  . HIS A 1 14  ? 2.643   10.836  19.544  1.00 0.00 ? 14  HIS A HB2  6  
ATOM 9680  H HB3  . HIS A 1 14  ? 1.232   10.823  18.490  1.00 0.00 ? 14  HIS A HB3  6  
ATOM 9681  H HD1  . HIS A 1 14  ? 1.839   13.431  21.145  1.00 0.00 ? 14  HIS A HD1  6  
ATOM 9682  H HD2  . HIS A 1 14  ? 1.901   13.047  17.009  1.00 0.00 ? 14  HIS A HD2  6  
ATOM 9683  H HE1  . HIS A 1 14  ? 2.100   15.769  20.257  1.00 0.00 ? 14  HIS A HE1  6  
ATOM 9684  H HE2  . HIS A 1 14  ? 2.229   15.501  17.756  1.00 0.00 ? 14  HIS A HE2  6  
ATOM 9685  N N    . LEU A 1 15  ? -1.446  11.845  20.273  1.00 0.00 ? 15  LEU A N    6  
ATOM 9686  C CA   . LEU A 1 15  ? -2.850  11.844  19.879  1.00 0.00 ? 15  LEU A CA   6  
ATOM 9687  C C    . LEU A 1 15  ? -3.111  12.884  18.793  1.00 0.00 ? 15  LEU A C    6  
ATOM 9688  O O    . LEU A 1 15  ? -4.146  13.551  18.794  1.00 0.00 ? 15  LEU A O    6  
ATOM 9689  C CB   . LEU A 1 15  ? -3.741  12.120  21.092  1.00 0.00 ? 15  LEU A CB   6  
ATOM 9690  C CG   . LEU A 1 15  ? -3.356  11.361  22.363  1.00 0.00 ? 15  LEU A CG   6  
ATOM 9691  C CD1  . LEU A 1 15  ? -2.347  12.158  23.176  1.00 0.00 ? 15  LEU A CD1  6  
ATOM 9692  C CD2  . LEU A 1 15  ? -4.592  11.056  23.197  1.00 0.00 ? 15  LEU A CD2  6  
ATOM 9693  H H    . LEU A 1 15  ? -1.057  12.659  20.656  1.00 0.00 ? 15  LEU A H    6  
ATOM 9694  H HA   . LEU A 1 15  ? -3.083  10.865  19.488  1.00 0.00 ? 15  LEU A HA   6  
ATOM 9695  H HB2  . LEU A 1 15  ? -3.706  13.178  21.304  1.00 0.00 ? 15  LEU A HB2  6  
ATOM 9696  H HB3  . LEU A 1 15  ? -4.755  11.854  20.835  1.00 0.00 ? 15  LEU A HB3  6  
ATOM 9697  H HG   . LEU A 1 15  ? -2.896  10.423  22.089  1.00 0.00 ? 15  LEU A HG   6  
ATOM 9698  H HD11 . LEU A 1 15  ? -2.870  12.787  23.882  1.00 0.00 ? 15  LEU A HD11 6  
ATOM 9699  H HD12 . LEU A 1 15  ? -1.758  12.774  22.514  1.00 0.00 ? 15  LEU A HD12 6  
ATOM 9700  H HD13 . LEU A 1 15  ? -1.698  11.480  23.710  1.00 0.00 ? 15  LEU A HD13 6  
ATOM 9701  H HD21 . LEU A 1 15  ? -5.327  11.834  23.049  1.00 0.00 ? 15  LEU A HD21 6  
ATOM 9702  H HD22 . LEU A 1 15  ? -4.321  11.011  24.241  1.00 0.00 ? 15  LEU A HD22 6  
ATOM 9703  H HD23 . LEU A 1 15  ? -5.007  10.107  22.891  1.00 0.00 ? 15  LEU A HD23 6  
ATOM 9704  N N    . LEU A 1 16  ? -2.166  13.014  17.868  1.00 0.00 ? 16  LEU A N    6  
ATOM 9705  C CA   . LEU A 1 16  ? -2.293  13.971  16.775  1.00 0.00 ? 16  LEU A CA   6  
ATOM 9706  C C    . LEU A 1 16  ? -2.001  13.307  15.434  1.00 0.00 ? 16  LEU A C    6  
ATOM 9707  O O    . LEU A 1 16  ? -1.383  13.907  14.554  1.00 0.00 ? 16  LEU A O    6  
ATOM 9708  C CB   . LEU A 1 16  ? -1.344  15.153  16.992  1.00 0.00 ? 16  LEU A CB   6  
ATOM 9709  C CG   . LEU A 1 16  ? -1.829  16.487  16.419  1.00 0.00 ? 16  LEU A CG   6  
ATOM 9710  C CD1  . LEU A 1 16  ? -1.511  17.628  17.373  1.00 0.00 ? 16  LEU A CD1  6  
ATOM 9711  C CD2  . LEU A 1 16  ? -1.204  16.739  15.055  1.00 0.00 ? 16  LEU A CD2  6  
ATOM 9712  H H    . LEU A 1 16  ? -1.364  12.454  17.921  1.00 0.00 ? 16  LEU A H    6  
ATOM 9713  H HA   . LEU A 1 16  ? -3.310  14.334  16.770  1.00 0.00 ? 16  LEU A HA   6  
ATOM 9714  H HB2  . LEU A 1 16  ? -1.192  15.274  18.055  1.00 0.00 ? 16  LEU A HB2  6  
ATOM 9715  H HB3  . LEU A 1 16  ? -0.396  14.914  16.535  1.00 0.00 ? 16  LEU A HB3  6  
ATOM 9716  H HG   . LEU A 1 16  ? -2.902  16.447  16.293  1.00 0.00 ? 16  LEU A HG   6  
ATOM 9717  H HD11 . LEU A 1 16  ? -0.519  18.002  17.166  1.00 0.00 ? 16  LEU A HD11 6  
ATOM 9718  H HD12 . LEU A 1 16  ? -1.555  17.269  18.390  1.00 0.00 ? 16  LEU A HD12 6  
ATOM 9719  H HD13 . LEU A 1 16  ? -2.230  18.421  17.239  1.00 0.00 ? 16  LEU A HD13 6  
ATOM 9720  H HD21 . LEU A 1 16  ? -1.214  17.798  14.845  1.00 0.00 ? 16  LEU A HD21 6  
ATOM 9721  H HD22 . LEU A 1 16  ? -1.768  16.216  14.298  1.00 0.00 ? 16  LEU A HD22 6  
ATOM 9722  H HD23 . LEU A 1 16  ? -0.184  16.382  15.056  1.00 0.00 ? 16  LEU A HD23 6  
ATOM 9723  N N    . GLN A 1 17  ? -2.446  12.064  15.287  1.00 0.00 ? 17  GLN A N    6  
ATOM 9724  C CA   . GLN A 1 17  ? -2.233  11.316  14.054  1.00 0.00 ? 17  GLN A CA   6  
ATOM 9725  C C    . GLN A 1 17  ? -3.497  11.302  13.200  1.00 0.00 ? 17  GLN A C    6  
ATOM 9726  O O    . GLN A 1 17  ? -4.601  11.116  13.711  1.00 0.00 ? 17  GLN A O    6  
ATOM 9727  C CB   . GLN A 1 17  ? -1.801  9.883   14.371  1.00 0.00 ? 17  GLN A CB   6  
ATOM 9728  C CG   . GLN A 1 17  ? -0.353  9.769   14.818  1.00 0.00 ? 17  GLN A CG   6  
ATOM 9729  C CD   . GLN A 1 17  ? 0.620   9.798   13.655  1.00 0.00 ? 17  GLN A CD   6  
ATOM 9730  O OE1  . GLN A 1 17  ? 0.432   9.103   12.656  1.00 0.00 ? 17  GLN A OE1  6  
ATOM 9731  N NE2  . GLN A 1 17  ? 1.667   10.605  13.780  1.00 0.00 ? 17  GLN A NE2  6  
ATOM 9732  H H    . GLN A 1 17  ? -2.931  11.639  16.025  1.00 0.00 ? 17  GLN A H    6  
ATOM 9733  H HA   . GLN A 1 17  ? -1.445  11.806  13.501  1.00 0.00 ? 17  GLN A HA   6  
ATOM 9734  H HB2  . GLN A 1 17  ? -2.431  9.496   15.158  1.00 0.00 ? 17  GLN A HB2  6  
ATOM 9735  H HB3  . GLN A 1 17  ? -1.932  9.276   13.486  1.00 0.00 ? 17  GLN A HB3  6  
ATOM 9736  H HG2  . GLN A 1 17  ? -0.127  10.594  15.477  1.00 0.00 ? 17  GLN A HG2  6  
ATOM 9737  H HG3  . GLN A 1 17  ? -0.226  8.838   15.351  1.00 0.00 ? 17  GLN A HG3  6  
ATOM 9738  H HE21 . GLN A 1 17  ? 1.752   11.128  14.603  1.00 0.00 ? 17  GLN A HE21 6  
ATOM 9739  H HE22 . GLN A 1 17  ? 2.312   10.643  13.044  1.00 0.00 ? 17  GLN A HE22 6  
ATOM 9740  N N    . GLY A 1 18  ? -3.327  11.499  11.896  1.00 0.00 ? 18  GLY A N    6  
ATOM 9741  C CA   . GLY A 1 18  ? -4.463  11.504  10.993  1.00 0.00 ? 18  GLY A CA   6  
ATOM 9742  C C    . GLY A 1 18  ? -4.799  12.895  10.492  1.00 0.00 ? 18  GLY A C    6  
ATOM 9743  O O    . GLY A 1 18  ? -3.945  13.781  10.477  1.00 0.00 ? 18  GLY A O    6  
ATOM 9744  H H    . GLY A 1 18  ? -2.424  11.641  11.545  1.00 0.00 ? 18  GLY A H    6  
ATOM 9745  H HA2  . GLY A 1 18  ? -4.238  10.873  10.145  1.00 0.00 ? 18  GLY A HA2  6  
ATOM 9746  H HA3  . GLY A 1 18  ? -5.321  11.102  11.510  1.00 0.00 ? 18  GLY A HA3  6  
ATOM 9747  N N    . GLY A 1 19  ? -6.049  13.087  10.082  1.00 0.00 ? 19  GLY A N    6  
ATOM 9748  C CA   . GLY A 1 19  ? -6.474  14.383  9.585   1.00 0.00 ? 19  GLY A CA   6  
ATOM 9749  C C    . GLY A 1 19  ? -6.591  14.414  8.073   1.00 0.00 ? 19  GLY A C    6  
ATOM 9750  O O    . GLY A 1 19  ? -7.574  14.918  7.531   1.00 0.00 ? 19  GLY A O    6  
ATOM 9751  H H    . GLY A 1 19  ? -6.686  12.344  10.118  1.00 0.00 ? 19  GLY A H    6  
ATOM 9752  H HA2  . GLY A 1 19  ? -7.435  14.622  10.014  1.00 0.00 ? 19  GLY A HA2  6  
ATOM 9753  H HA3  . GLY A 1 19  ? -5.757  15.128  9.895   1.00 0.00 ? 19  GLY A HA3  6  
ATOM 9754  N N    . ASP A 1 20  ? -5.585  13.875  7.393   1.00 0.00 ? 20  ASP A N    6  
ATOM 9755  C CA   . ASP A 1 20  ? -5.579  13.845  5.935   1.00 0.00 ? 20  ASP A CA   6  
ATOM 9756  C C    . ASP A 1 20  ? -5.248  12.447  5.420   1.00 0.00 ? 20  ASP A C    6  
ATOM 9757  O O    . ASP A 1 20  ? -4.649  12.292  4.355   1.00 0.00 ? 20  ASP A O    6  
ATOM 9758  C CB   . ASP A 1 20  ? -4.569  14.854  5.386   1.00 0.00 ? 20  ASP A CB   6  
ATOM 9759  C CG   . ASP A 1 20  ? -5.190  16.214  5.135   1.00 0.00 ? 20  ASP A CG   6  
ATOM 9760  O OD1  . ASP A 1 20  ? -6.257  16.497  5.720   1.00 0.00 ? 20  ASP A OD1  6  
ATOM 9761  O OD2  . ASP A 1 20  ? -4.610  16.997  4.354   1.00 0.00 ? 20  ASP A OD2  6  
ATOM 9762  H H    . ASP A 1 20  ? -4.829  13.488  7.882   1.00 0.00 ? 20  ASP A H    6  
ATOM 9763  H HA   . ASP A 1 20  ? -6.568  14.116  5.593   1.00 0.00 ? 20  ASP A HA   6  
ATOM 9764  H HB2  . ASP A 1 20  ? -3.766  14.973  6.097   1.00 0.00 ? 20  ASP A HB2  6  
ATOM 9765  H HB3  . ASP A 1 20  ? -4.168  14.484  4.454   1.00 0.00 ? 20  ASP A HB3  6  
ATOM 9766  N N    . GLU A 1 21  ? -5.644  11.432  6.181   1.00 0.00 ? 21  GLU A N    6  
ATOM 9767  C CA   . GLU A 1 21  ? -5.389  10.048  5.801   1.00 0.00 ? 21  GLU A CA   6  
ATOM 9768  C C    . GLU A 1 21  ? -6.670  9.372   5.322   1.00 0.00 ? 21  GLU A C    6  
ATOM 9769  O O    . GLU A 1 21  ? -7.701  9.427   5.992   1.00 0.00 ? 21  GLU A O    6  
ATOM 9770  C CB   . GLU A 1 21  ? -4.799  9.273   6.981   1.00 0.00 ? 21  GLU A CB   6  
ATOM 9771  C CG   . GLU A 1 21  ? -3.279  9.246   6.993   1.00 0.00 ? 21  GLU A CG   6  
ATOM 9772  C CD   . GLU A 1 21  ? -2.691  9.978   8.183   1.00 0.00 ? 21  GLU A CD   6  
ATOM 9773  O OE1  . GLU A 1 21  ? -2.750  9.431   9.305   1.00 0.00 ? 21  GLU A OE1  6  
ATOM 9774  O OE2  . GLU A 1 21  ? -2.172  11.098  7.994   1.00 0.00 ? 21  GLU A OE2  6  
ATOM 9775  H H    . GLU A 1 21  ? -6.118  11.619  7.019   1.00 0.00 ? 21  GLU A H    6  
ATOM 9776  H HA   . GLU A 1 21  ? -4.675  10.053  4.992   1.00 0.00 ? 21  GLU A HA   6  
ATOM 9777  H HB2  . GLU A 1 21  ? -5.138  9.727   7.900   1.00 0.00 ? 21  GLU A HB2  6  
ATOM 9778  H HB3  . GLU A 1 21  ? -5.155  8.253   6.942   1.00 0.00 ? 21  GLU A HB3  6  
ATOM 9779  H HG2  . GLU A 1 21  ? -2.950  8.216   7.026   1.00 0.00 ? 21  GLU A HG2  6  
ATOM 9780  H HG3  . GLU A 1 21  ? -2.917  9.712   6.086   1.00 0.00 ? 21  GLU A HG3  6  
ATOM 9781  N N    . LYS A 1 22  ? -6.596  8.733   4.158   1.00 0.00 ? 22  LYS A N    6  
ATOM 9782  C CA   . LYS A 1 22  ? -7.750  8.045   3.589   1.00 0.00 ? 22  LYS A CA   6  
ATOM 9783  C C    . LYS A 1 22  ? -7.480  6.550   3.456   1.00 0.00 ? 22  LYS A C    6  
ATOM 9784  O O    . LYS A 1 22  ? -6.388  6.139   3.064   1.00 0.00 ? 22  LYS A O    6  
ATOM 9785  C CB   . LYS A 1 22  ? -8.100  8.636   2.223   1.00 0.00 ? 22  LYS A CB   6  
ATOM 9786  C CG   . LYS A 1 22  ? -9.507  8.298   1.757   1.00 0.00 ? 22  LYS A CG   6  
ATOM 9787  C CD   . LYS A 1 22  ? -9.911  9.135   0.555   1.00 0.00 ? 22  LYS A CD   6  
ATOM 9788  C CE   . LYS A 1 22  ? -9.681  8.387   -0.749  1.00 0.00 ? 22  LYS A CE   6  
ATOM 9789  N NZ   . LYS A 1 22  ? -9.986  9.233   -1.937  1.00 0.00 ? 22  LYS A NZ   6  
ATOM 9790  H H    . LYS A 1 22  ? -5.747  8.724   3.671   1.00 0.00 ? 22  LYS A H    6  
ATOM 9791  H HA   . LYS A 1 22  ? -8.585  8.189   4.259   1.00 0.00 ? 22  LYS A HA   6  
ATOM 9792  H HB2  . LYS A 1 22  ? -8.010  9.711   2.274   1.00 0.00 ? 22  LYS A HB2  6  
ATOM 9793  H HB3  . LYS A 1 22  ? -7.401  8.259   1.490   1.00 0.00 ? 22  LYS A HB3  6  
ATOM 9794  H HG2  . LYS A 1 22  ? -9.544  7.254   1.484   1.00 0.00 ? 22  LYS A HG2  6  
ATOM 9795  H HG3  . LYS A 1 22  ? -10.198 8.487   2.565   1.00 0.00 ? 22  LYS A HG3  6  
ATOM 9796  H HD2  . LYS A 1 22  ? -10.959 9.382   0.636   1.00 0.00 ? 22  LYS A HD2  6  
ATOM 9797  H HD3  . LYS A 1 22  ? -9.326  10.043  0.547   1.00 0.00 ? 22  LYS A HD3  6  
ATOM 9798  H HE2  . LYS A 1 22  ? -8.648  8.079   -0.794  1.00 0.00 ? 22  LYS A HE2  6  
ATOM 9799  H HE3  . LYS A 1 22  ? -10.318 7.515   -0.765  1.00 0.00 ? 22  LYS A HE3  6  
ATOM 9800  H HZ1  . LYS A 1 22  ? -9.918  10.240  -1.685  1.00 0.00 ? 22  LYS A HZ1  6  
ATOM 9801  H HZ2  . LYS A 1 22  ? -10.948 9.036   -2.278  1.00 0.00 ? 22  LYS A HZ2  6  
ATOM 9802  H HZ3  . LYS A 1 22  ? -9.311  9.030   -2.702  1.00 0.00 ? 22  LYS A HZ3  6  
ATOM 9803  N N    . LYS A 1 23  ? -8.482  5.741   3.785   1.00 0.00 ? 23  LYS A N    6  
ATOM 9804  C CA   . LYS A 1 23  ? -8.351  4.291   3.703   1.00 0.00 ? 23  LYS A CA   6  
ATOM 9805  C C    . LYS A 1 23  ? -9.176  3.735   2.546   1.00 0.00 ? 23  LYS A C    6  
ATOM 9806  O O    . LYS A 1 23  ? -10.363 4.035   2.415   1.00 0.00 ? 23  LYS A O    6  
ATOM 9807  C CB   . LYS A 1 23  ? -8.794  3.645   5.017   1.00 0.00 ? 23  LYS A CB   6  
ATOM 9808  C CG   . LYS A 1 23  ? -7.901  2.499   5.464   1.00 0.00 ? 23  LYS A CG   6  
ATOM 9809  C CD   . LYS A 1 23  ? -7.892  2.357   6.978   1.00 0.00 ? 23  LYS A CD   6  
ATOM 9810  C CE   . LYS A 1 23  ? -6.591  1.746   7.472   1.00 0.00 ? 23  LYS A CE   6  
ATOM 9811  N NZ   . LYS A 1 23  ? -5.457  2.709   7.386   1.00 0.00 ? 23  LYS A NZ   6  
ATOM 9812  H H    . LYS A 1 23  ? -9.328  6.129   4.091   1.00 0.00 ? 23  LYS A H    6  
ATOM 9813  H HA   . LYS A 1 23  ? -7.311  4.060   3.531   1.00 0.00 ? 23  LYS A HA   6  
ATOM 9814  H HB2  . LYS A 1 23  ? -8.793  4.397   5.793   1.00 0.00 ? 23  LYS A HB2  6  
ATOM 9815  H HB3  . LYS A 1 23  ? -9.798  3.265   4.900   1.00 0.00 ? 23  LYS A HB3  6  
ATOM 9816  H HG2  . LYS A 1 23  ? -8.264  1.580   5.029   1.00 0.00 ? 23  LYS A HG2  6  
ATOM 9817  H HG3  . LYS A 1 23  ? -6.893  2.687   5.123   1.00 0.00 ? 23  LYS A HG3  6  
ATOM 9818  H HD2  . LYS A 1 23  ? -8.011  3.334   7.421   1.00 0.00 ? 23  LYS A HD2  6  
ATOM 9819  H HD3  . LYS A 1 23  ? -8.714  1.722   7.274   1.00 0.00 ? 23  LYS A HD3  6  
ATOM 9820  H HE2  . LYS A 1 23  ? -6.718  1.445   8.501   1.00 0.00 ? 23  LYS A HE2  6  
ATOM 9821  H HE3  . LYS A 1 23  ? -6.363  0.879   6.869   1.00 0.00 ? 23  LYS A HE3  6  
ATOM 9822  H HZ1  . LYS A 1 23  ? -4.813  2.574   8.192   1.00 0.00 ? 23  LYS A HZ1  6  
ATOM 9823  H HZ2  . LYS A 1 23  ? -5.815  3.685   7.401   1.00 0.00 ? 23  LYS A HZ2  6  
ATOM 9824  H HZ3  . LYS A 1 23  ? -4.928  2.559   6.504   1.00 0.00 ? 23  LYS A HZ3  6  
ATOM 9825  N N    . VAL A 1 24  ? -8.539  2.921   1.709   1.00 0.00 ? 24  VAL A N    6  
ATOM 9826  C CA   . VAL A 1 24  ? -9.214  2.323   0.564   1.00 0.00 ? 24  VAL A CA   6  
ATOM 9827  C C    . VAL A 1 24  ? -9.040  0.808   0.556   1.00 0.00 ? 24  VAL A C    6  
ATOM 9828  O O    . VAL A 1 24  ? -8.027  0.292   0.086   1.00 0.00 ? 24  VAL A O    6  
ATOM 9829  C CB   . VAL A 1 24  ? -8.684  2.896   -0.764  1.00 0.00 ? 24  VAL A CB   6  
ATOM 9830  C CG1  . VAL A 1 24  ? -9.530  2.412   -1.931  1.00 0.00 ? 24  VAL A CG1  6  
ATOM 9831  C CG2  . VAL A 1 24  ? -8.650  4.415   -0.713  1.00 0.00 ? 24  VAL A CG2  6  
ATOM 9832  H H    . VAL A 1 24  ? -7.593  2.719   1.866   1.00 0.00 ? 24  VAL A H    6  
ATOM 9833  H HA   . VAL A 1 24  ? -10.266 2.554   0.638   1.00 0.00 ? 24  VAL A HA   6  
ATOM 9834  H HB   . VAL A 1 24  ? -7.675  2.540   -0.909  1.00 0.00 ? 24  VAL A HB   6  
ATOM 9835  H HG11 . VAL A 1 24  ? -9.163  1.455   -2.269  1.00 0.00 ? 24  VAL A HG11 6  
ATOM 9836  H HG12 . VAL A 1 24  ? -9.473  3.127   -2.738  1.00 0.00 ? 24  VAL A HG12 6  
ATOM 9837  H HG13 . VAL A 1 24  ? -10.558 2.311   -1.612  1.00 0.00 ? 24  VAL A HG13 6  
ATOM 9838  H HG21 . VAL A 1 24  ? -9.383  4.769   -0.003  1.00 0.00 ? 24  VAL A HG21 6  
ATOM 9839  H HG22 . VAL A 1 24  ? -8.878  4.813   -1.692  1.00 0.00 ? 24  VAL A HG22 6  
ATOM 9840  H HG23 . VAL A 1 24  ? -7.667  4.745   -0.411  1.00 0.00 ? 24  VAL A HG23 6  
ATOM 9841  N N    . ASN A 1 25  ? -10.036 0.101   1.078   1.00 0.00 ? 25  ASN A N    6  
ATOM 9842  C CA   . ASN A 1 25  ? -9.995  -1.356  1.131   1.00 0.00 ? 25  ASN A CA   6  
ATOM 9843  C C    . ASN A 1 25  ? -10.393 -1.960  -0.211  1.00 0.00 ? 25  ASN A C    6  
ATOM 9844  O O    . ASN A 1 25  ? -11.431 -1.615  -0.775  1.00 0.00 ? 25  ASN A O    6  
ATOM 9845  C CB   . ASN A 1 25  ? -10.921 -1.874  2.233   1.00 0.00 ? 25  ASN A CB   6  
ATOM 9846  C CG   . ASN A 1 25  ? -12.326 -1.312  2.119   1.00 0.00 ? 25  ASN A CG   6  
ATOM 9847  O OD1  . ASN A 1 25  ? -12.516 -0.100  2.030   1.00 0.00 ? 25  ASN A OD1  6  
ATOM 9848  N ND2  . ASN A 1 25  ? -13.317 -2.194  2.122   1.00 0.00 ? 25  ASN A ND2  6  
ATOM 9849  H H    . ASN A 1 25  ? -10.819 0.570   1.437   1.00 0.00 ? 25  ASN A H    6  
ATOM 9850  H HA   . ASN A 1 25  ? -8.981  -1.650  1.359   1.00 0.00 ? 25  ASN A HA   6  
ATOM 9851  H HB2  . ASN A 1 25  ? -10.979 -2.950  2.170   1.00 0.00 ? 25  ASN A HB2  6  
ATOM 9852  H HB3  . ASN A 1 25  ? -10.519 -1.595  3.194   1.00 0.00 ? 25  ASN A HB3  6  
ATOM 9853  H HD21 . ASN A 1 25  ? -13.092 -3.146  2.196   1.00 0.00 ? 25  ASN A HD21 6  
ATOM 9854  H HD22 . ASN A 1 25  ? -14.236 -1.859  2.049   1.00 0.00 ? 25  ASN A HD22 6  
ATOM 9855  N N    . LEU A 1 26  ? -9.560  -2.863  -0.719  1.00 0.00 ? 26  LEU A N    6  
ATOM 9856  C CA   . LEU A 1 26  ? -9.825  -3.516  -1.996  1.00 0.00 ? 26  LEU A CA   6  
ATOM 9857  C C    . LEU A 1 26  ? -9.821  -5.033  -1.843  1.00 0.00 ? 26  LEU A C    6  
ATOM 9858  O O    . LEU A 1 26  ? -8.881  -5.610  -1.296  1.00 0.00 ? 26  LEU A O    6  
ATOM 9859  C CB   . LEU A 1 26  ? -8.782  -3.094  -3.033  1.00 0.00 ? 26  LEU A CB   6  
ATOM 9860  C CG   . LEU A 1 26  ? -8.910  -1.653  -3.533  1.00 0.00 ? 26  LEU A CG   6  
ATOM 9861  C CD1  . LEU A 1 26  ? -7.765  -1.312  -4.472  1.00 0.00 ? 26  LEU A CD1  6  
ATOM 9862  C CD2  . LEU A 1 26  ? -10.249 -1.447  -4.224  1.00 0.00 ? 26  LEU A CD2  6  
ATOM 9863  H H    . LEU A 1 26  ? -8.748  -3.096  -0.223  1.00 0.00 ? 26  LEU A H    6  
ATOM 9864  H HA   . LEU A 1 26  ? -10.801 -3.201  -2.333  1.00 0.00 ? 26  LEU A HA   6  
ATOM 9865  H HB2  . LEU A 1 26  ? -7.801  -3.216  -2.597  1.00 0.00 ? 26  LEU A HB2  6  
ATOM 9866  H HB3  . LEU A 1 26  ? -8.864  -3.754  -3.883  1.00 0.00 ? 26  LEU A HB3  6  
ATOM 9867  H HG   . LEU A 1 26  ? -8.861  -0.981  -2.688  1.00 0.00 ? 26  LEU A HG   6  
ATOM 9868  H HD11 . LEU A 1 26  ? -7.821  -0.267  -4.743  1.00 0.00 ? 26  LEU A HD11 6  
ATOM 9869  H HD12 . LEU A 1 26  ? -7.837  -1.918  -5.362  1.00 0.00 ? 26  LEU A HD12 6  
ATOM 9870  H HD13 . LEU A 1 26  ? -6.824  -1.506  -3.979  1.00 0.00 ? 26  LEU A HD13 6  
ATOM 9871  H HD21 . LEU A 1 26  ? -10.133 -0.736  -5.029  1.00 0.00 ? 26  LEU A HD21 6  
ATOM 9872  H HD22 . LEU A 1 26  ? -10.968 -1.071  -3.511  1.00 0.00 ? 26  LEU A HD22 6  
ATOM 9873  H HD23 . LEU A 1 26  ? -10.597 -2.389  -4.622  1.00 0.00 ? 26  LEU A HD23 6  
ATOM 9874  N N    . VAL A 1 27  ? -10.878 -5.674  -2.330  1.00 0.00 ? 27  VAL A N    6  
ATOM 9875  C CA   . VAL A 1 27  ? -10.998 -7.124  -2.249  1.00 0.00 ? 27  VAL A CA   6  
ATOM 9876  C C    . VAL A 1 27  ? -10.912 -7.761  -3.632  1.00 0.00 ? 27  VAL A C    6  
ATOM 9877  O O    . VAL A 1 27  ? -11.832 -7.639  -4.441  1.00 0.00 ? 27  VAL A O    6  
ATOM 9878  C CB   . VAL A 1 27  ? -12.323 -7.543  -1.585  1.00 0.00 ? 27  VAL A CB   6  
ATOM 9879  C CG1  . VAL A 1 27  ? -12.342 -9.041  -1.327  1.00 0.00 ? 27  VAL A CG1  6  
ATOM 9880  C CG2  . VAL A 1 27  ? -12.540 -6.768  -0.293  1.00 0.00 ? 27  VAL A CG2  6  
ATOM 9881  H H    . VAL A 1 27  ? -11.596 -5.158  -2.755  1.00 0.00 ? 27  VAL A H    6  
ATOM 9882  H HA   . VAL A 1 27  ? -10.182 -7.493  -1.642  1.00 0.00 ? 27  VAL A HA   6  
ATOM 9883  H HB   . VAL A 1 27  ? -13.132 -7.306  -2.261  1.00 0.00 ? 27  VAL A HB   6  
ATOM 9884  H HG11 . VAL A 1 27  ? -12.672 -9.555  -2.218  1.00 0.00 ? 27  VAL A HG11 6  
ATOM 9885  H HG12 . VAL A 1 27  ? -13.021 -9.258  -0.515  1.00 0.00 ? 27  VAL A HG12 6  
ATOM 9886  H HG13 . VAL A 1 27  ? -11.350 -9.374  -1.065  1.00 0.00 ? 27  VAL A HG13 6  
ATOM 9887  H HG21 . VAL A 1 27  ? -11.914 -7.182  0.484   1.00 0.00 ? 27  VAL A HG21 6  
ATOM 9888  H HG22 . VAL A 1 27  ? -13.576 -6.843  0.001   1.00 0.00 ? 27  VAL A HG22 6  
ATOM 9889  H HG23 . VAL A 1 27  ? -12.283 -5.731  -0.448  1.00 0.00 ? 27  VAL A HG23 6  
ATOM 9890  N N    . LEU A 1 28  ? -9.800  -8.439  -3.898  1.00 0.00 ? 28  LEU A N    6  
ATOM 9891  C CA   . LEU A 1 28  ? -9.593  -9.094  -5.184  1.00 0.00 ? 28  LEU A CA   6  
ATOM 9892  C C    . LEU A 1 28  ? -10.154 -10.513 -5.170  1.00 0.00 ? 28  LEU A C    6  
ATOM 9893  O O    . LEU A 1 28  ? -9.945  -11.263 -4.218  1.00 0.00 ? 28  LEU A O    6  
ATOM 9894  C CB   . LEU A 1 28  ? -8.103  -9.125  -5.529  1.00 0.00 ? 28  LEU A CB   6  
ATOM 9895  C CG   . LEU A 1 28  ? -7.427  -7.756  -5.607  1.00 0.00 ? 28  LEU A CG   6  
ATOM 9896  C CD1  . LEU A 1 28  ? -5.916  -7.909  -5.657  1.00 0.00 ? 28  LEU A CD1  6  
ATOM 9897  C CD2  . LEU A 1 28  ? -7.928  -6.984  -6.818  1.00 0.00 ? 28  LEU A CD2  6  
ATOM 9898  H H    . LEU A 1 28  ? -9.102  -8.500  -3.213  1.00 0.00 ? 28  LEU A H    6  
ATOM 9899  H HA   . LEU A 1 28  ? -10.116 -8.521  -5.935  1.00 0.00 ? 28  LEU A HA   6  
ATOM 9900  H HB2  . LEU A 1 28  ? -7.594  -9.715  -4.780  1.00 0.00 ? 28  LEU A HB2  6  
ATOM 9901  H HB3  . LEU A 1 28  ? -7.987  -9.614  -6.486  1.00 0.00 ? 28  LEU A HB3  6  
ATOM 9902  H HG   . LEU A 1 28  ? -7.676  -7.189  -4.722  1.00 0.00 ? 28  LEU A HG   6  
ATOM 9903  H HD11 . LEU A 1 28  ? -5.636  -8.864  -5.235  1.00 0.00 ? 28  LEU A HD11 6  
ATOM 9904  H HD12 . LEU A 1 28  ? -5.454  -7.115  -5.090  1.00 0.00 ? 28  LEU A HD12 6  
ATOM 9905  H HD13 . LEU A 1 28  ? -5.583  -7.859  -6.684  1.00 0.00 ? 28  LEU A HD13 6  
ATOM 9906  H HD21 . LEU A 1 28  ? -7.765  -5.927  -6.664  1.00 0.00 ? 28  LEU A HD21 6  
ATOM 9907  H HD22 . LEU A 1 28  ? -8.983  -7.169  -6.953  1.00 0.00 ? 28  LEU A HD22 6  
ATOM 9908  H HD23 . LEU A 1 28  ? -7.390  -7.306  -7.698  1.00 0.00 ? 28  LEU A HD23 6  
ATOM 9909  N N    . GLY A 1 29  ? -10.865 -10.872 -6.232  1.00 0.00 ? 29  GLY A N    6  
ATOM 9910  C CA   . GLY A 1 29  ? -11.444 -12.200 -6.322  1.00 0.00 ? 29  GLY A CA   6  
ATOM 9911  C C    . GLY A 1 29  ? -10.389 -13.286 -6.396  1.00 0.00 ? 29  GLY A C    6  
ATOM 9912  O O    . GLY A 1 29  ? -9.600  -13.458 -5.466  1.00 0.00 ? 29  GLY A O    6  
ATOM 9913  H H    . GLY A 1 29  ? -10.999 -10.231 -6.962  1.00 0.00 ? 29  GLY A H    6  
ATOM 9914  H HA2  . GLY A 1 29  ? -12.063 -12.371 -5.451  1.00 0.00 ? 29  GLY A HA2  6  
ATOM 9915  H HA3  . GLY A 1 29  ? -12.062 -12.252 -7.210  1.00 0.00 ? 29  GLY A HA3  6  
ATOM 9916  N N    . ASP A 1 30  ? -10.373 -14.021 -7.503  1.00 0.00 ? 30  ASP A N    6  
ATOM 9917  C CA   . ASP A 1 30  ? -9.407  -15.095 -7.693  1.00 0.00 ? 30  ASP A CA   6  
ATOM 9918  C C    . ASP A 1 30  ? -8.022  -14.533 -7.997  1.00 0.00 ? 30  ASP A C    6  
ATOM 9919  O O    . ASP A 1 30  ? -7.138  -14.537 -7.140  1.00 0.00 ? 30  ASP A O    6  
ATOM 9920  C CB   . ASP A 1 30  ? -9.856  -16.019 -8.827  1.00 0.00 ? 30  ASP A CB   6  
ATOM 9921  C CG   . ASP A 1 30  ? -10.634 -17.218 -8.322  1.00 0.00 ? 30  ASP A CG   6  
ATOM 9922  O OD1  . ASP A 1 30  ? -10.056 -18.021 -7.560  1.00 0.00 ? 30  ASP A OD1  6  
ATOM 9923  O OD2  . ASP A 1 30  ? -11.820 -17.355 -8.689  1.00 0.00 ? 30  ASP A OD2  6  
ATOM 9924  H H    . ASP A 1 30  ? -11.028 -13.835 -8.209  1.00 0.00 ? 30  ASP A H    6  
ATOM 9925  H HA   . ASP A 1 30  ? -9.359  -15.664 -6.777  1.00 0.00 ? 30  ASP A HA   6  
ATOM 9926  H HB2  . ASP A 1 30  ? -10.488 -15.465 -9.506  1.00 0.00 ? 30  ASP A HB2  6  
ATOM 9927  H HB3  . ASP A 1 30  ? -8.987  -16.374 -9.361  1.00 0.00 ? 30  ASP A HB3  6  
ATOM 9928  N N    . GLY A 1 31  ? -7.840  -14.049 -9.221  1.00 0.00 ? 31  GLY A N    6  
ATOM 9929  C CA   . GLY A 1 31  ? -6.559  -13.491 -9.615  1.00 0.00 ? 31  GLY A CA   6  
ATOM 9930  C C    . GLY A 1 31  ? -6.703  -12.166 -10.338 1.00 0.00 ? 31  GLY A C    6  
ATOM 9931  O O    . GLY A 1 31  ? -6.548  -12.095 -11.557 1.00 0.00 ? 31  GLY A O    6  
ATOM 9932  H H    . GLY A 1 31  ? -8.580  -14.072 -9.863  1.00 0.00 ? 31  GLY A H    6  
ATOM 9933  H HA2  . GLY A 1 31  ? -5.956  -13.341 -8.729  1.00 0.00 ? 31  GLY A HA2  6  
ATOM 9934  H HA3  . GLY A 1 31  ? -6.059  -14.193 -10.269 1.00 0.00 ? 31  GLY A HA3  6  
ATOM 9935  N N    . ARG A 1 32  ? -7.001  -11.112 -9.584  1.00 0.00 ? 32  ARG A N    6  
ATOM 9936  C CA   . ARG A 1 32  ? -7.166  -9.782  -10.160 1.00 0.00 ? 32  ARG A CA   6  
ATOM 9937  C C    . ARG A 1 32  ? -5.948  -8.911  -9.870  1.00 0.00 ? 32  ARG A C    6  
ATOM 9938  O O    . ARG A 1 32  ? -4.949  -9.382  -9.327  1.00 0.00 ? 32  ARG A O    6  
ATOM 9939  C CB   . ARG A 1 32  ? -8.429  -9.118  -9.607  1.00 0.00 ? 32  ARG A CB   6  
ATOM 9940  C CG   . ARG A 1 32  ? -9.673  -9.984  -9.725  1.00 0.00 ? 32  ARG A CG   6  
ATOM 9941  C CD   . ARG A 1 32  ? -10.610 -9.472  -10.808 1.00 0.00 ? 32  ARG A CD   6  
ATOM 9942  N NE   . ARG A 1 32  ? -9.920  -9.266  -12.078 1.00 0.00 ? 32  ARG A NE   6  
ATOM 9943  C CZ   . ARG A 1 32  ? -10.539 -9.172  -13.253 1.00 0.00 ? 32  ARG A CZ   6  
ATOM 9944  N NH1  . ARG A 1 32  ? -11.861 -9.263  -13.322 1.00 0.00 ? 32  ARG A NH1  6  
ATOM 9945  N NH2  . ARG A 1 32  ? -9.836  -8.983  -14.361 1.00 0.00 ? 32  ARG A NH2  6  
ATOM 9946  H H    . ARG A 1 32  ? -7.112  -11.232 -8.618  1.00 0.00 ? 32  ARG A H    6  
ATOM 9947  H HA   . ARG A 1 32  ? -7.267  -9.895  -11.229 1.00 0.00 ? 32  ARG A HA   6  
ATOM 9948  H HB2  . ARG A 1 32  ? -8.273  -8.890  -8.562  1.00 0.00 ? 32  ARG A HB2  6  
ATOM 9949  H HB3  . ARG A 1 32  ? -8.603  -8.198  -10.144 1.00 0.00 ? 32  ARG A HB3  6  
ATOM 9950  H HG2  . ARG A 1 32  ? -9.375  -10.993 -9.970  1.00 0.00 ? 32  ARG A HG2  6  
ATOM 9951  H HG3  . ARG A 1 32  ? -10.193 -9.980  -8.779  1.00 0.00 ? 32  ARG A HG3  6  
ATOM 9952  H HD2  . ARG A 1 32  ? -11.401 -10.193 -10.952 1.00 0.00 ? 32  ARG A HD2  6  
ATOM 9953  H HD3  . ARG A 1 32  ? -11.035 -8.534  -10.483 1.00 0.00 ? 32  ARG A HD3  6  
ATOM 9954  H HE   . ARG A 1 32  ? -8.942  -9.194  -12.056 1.00 0.00 ? 32  ARG A HE   6  
ATOM 9955  H HH11 . ARG A 1 32  ? -12.399 -9.404  -12.491 1.00 0.00 ? 32  ARG A HH11 6  
ATOM 9956  H HH12 . ARG A 1 32  ? -12.322 -9.191  -14.208 1.00 0.00 ? 32  ARG A HH12 6  
ATOM 9957  H HH21 . ARG A 1 32  ? -8.839  -8.914  -14.313 1.00 0.00 ? 32  ARG A HH21 6  
ATOM 9958  H HH22 . ARG A 1 32  ? -10.301 -8.913  -15.243 1.00 0.00 ? 32  ARG A HH22 6  
ATOM 9959  N N    . SER A 1 33  ? -6.038  -7.635  -10.235 1.00 0.00 ? 33  SER A N    6  
ATOM 9960  C CA   . SER A 1 33  ? -4.942  -6.699  -10.015 1.00 0.00 ? 33  SER A CA   6  
ATOM 9961  C C    . SER A 1 33  ? -5.473  -5.304  -9.697  1.00 0.00 ? 33  SER A C    6  
ATOM 9962  O O    . SER A 1 33  ? -6.679  -5.102  -9.567  1.00 0.00 ? 33  SER A O    6  
ATOM 9963  C CB   . SER A 1 33  ? -4.035  -6.643  -11.245 1.00 0.00 ? 33  SER A CB   6  
ATOM 9964  O OG   . SER A 1 33  ? -3.549  -7.933  -11.579 1.00 0.00 ? 33  SER A OG   6  
ATOM 9965  H H    . SER A 1 33  ? -6.860  -7.317  -10.664 1.00 0.00 ? 33  SER A H    6  
ATOM 9966  H HA   . SER A 1 33  ? -4.369  -7.053  -9.171  1.00 0.00 ? 33  SER A HA   6  
ATOM 9967  H HB2  . SER A 1 33  ? -4.592  -6.254  -12.083 1.00 0.00 ? 33  SER A HB2  6  
ATOM 9968  H HB3  . SER A 1 33  ? -3.194  -5.997  -11.040 1.00 0.00 ? 33  SER A HB3  6  
ATOM 9969  H HG   . SER A 1 33  ? -3.132  -7.903  -12.443 1.00 0.00 ? 33  SER A HG   6  
ATOM 9970  N N    . LEU A 1 34  ? -4.561  -4.344  -9.574  1.00 0.00 ? 34  LEU A N    6  
ATOM 9971  C CA   . LEU A 1 34  ? -4.936  -2.967  -9.271  1.00 0.00 ? 34  LEU A CA   6  
ATOM 9972  C C    . LEU A 1 34  ? -4.931  -2.111  -10.534 1.00 0.00 ? 34  LEU A C    6  
ATOM 9973  O O    . LEU A 1 34  ? -5.917  -1.447  -10.850 1.00 0.00 ? 34  LEU A O    6  
ATOM 9974  C CB   . LEU A 1 34  ? -3.981  -2.374  -8.234  1.00 0.00 ? 34  LEU A CB   6  
ATOM 9975  C CG   . LEU A 1 34  ? -4.246  -2.802  -6.790  1.00 0.00 ? 34  LEU A CG   6  
ATOM 9976  C CD1  . LEU A 1 34  ? -3.056  -2.465  -5.906  1.00 0.00 ? 34  LEU A CD1  6  
ATOM 9977  C CD2  . LEU A 1 34  ? -5.510  -2.141  -6.263  1.00 0.00 ? 34  LEU A CD2  6  
ATOM 9978  H H    . LEU A 1 34  ? -3.613  -4.567  -9.688  1.00 0.00 ? 34  LEU A H    6  
ATOM 9979  H HA   . LEU A 1 34  ? -5.935  -2.978  -8.862  1.00 0.00 ? 34  LEU A HA   6  
ATOM 9980  H HB2  . LEU A 1 34  ? -2.972  -2.665  -8.496  1.00 0.00 ? 34  LEU A HB2  6  
ATOM 9981  H HB3  . LEU A 1 34  ? -4.054  -1.294  -8.285  1.00 0.00 ? 34  LEU A HB3  6  
ATOM 9982  H HG   . LEU A 1 34  ? -4.390  -3.873  -6.760  1.00 0.00 ? 34  LEU A HG   6  
ATOM 9983  H HD11 . LEU A 1 34  ? -3.389  -2.348  -4.884  1.00 0.00 ? 34  LEU A HD11 6  
ATOM 9984  H HD12 . LEU A 1 34  ? -2.605  -1.545  -6.245  1.00 0.00 ? 34  LEU A HD12 6  
ATOM 9985  H HD13 . LEU A 1 34  ? -2.331  -3.262  -5.959  1.00 0.00 ? 34  LEU A HD13 6  
ATOM 9986  H HD21 . LEU A 1 34  ? -5.829  -2.642  -5.360  1.00 0.00 ? 34  LEU A HD21 6  
ATOM 9987  H HD22 . LEU A 1 34  ? -6.290  -2.208  -7.007  1.00 0.00 ? 34  LEU A HD22 6  
ATOM 9988  H HD23 . LEU A 1 34  ? -5.309  -1.101  -6.046  1.00 0.00 ? 34  LEU A HD23 6  
ATOM 9989  N N    . GLY A 1 35  ? -3.812  -2.134  -11.253 1.00 0.00 ? 35  GLY A N    6  
ATOM 9990  C CA   . GLY A 1 35  ? -3.700  -1.357  -12.473 1.00 0.00 ? 35  GLY A CA   6  
ATOM 9991  C C    . GLY A 1 35  ? -3.204  0.053   -12.221 1.00 0.00 ? 35  GLY A C    6  
ATOM 9992  O O    . GLY A 1 35  ? -3.521  0.973   -12.975 1.00 0.00 ? 35  GLY A O    6  
ATOM 9993  H H    . GLY A 1 35  ? -3.059  -2.683  -10.953 1.00 0.00 ? 35  GLY A H    6  
ATOM 9994  H HA2  . GLY A 1 35  ? -3.010  -1.855  -13.142 1.00 0.00 ? 35  GLY A HA2  6  
ATOM 9995  H HA3  . GLY A 1 35  ? -4.673  -1.306  -12.945 1.00 0.00 ? 35  GLY A HA3  6  
ATOM 9996  N N    . LEU A 1 36  ? -2.423  0.223   -11.159 1.00 0.00 ? 36  LEU A N    6  
ATOM 9997  C CA   . LEU A 1 36  ? -1.882  1.532   -10.810 1.00 0.00 ? 36  LEU A CA   6  
ATOM 9998  C C    . LEU A 1 36  ? -0.401  1.621   -11.162 1.00 0.00 ? 36  LEU A C    6  
ATOM 9999  O O    . LEU A 1 36  ? 0.348   0.660   -10.983 1.00 0.00 ? 36  LEU A O    6  
ATOM 10000 C CB   . LEU A 1 36  ? -2.081  1.810   -9.318  1.00 0.00 ? 36  LEU A CB   6  
ATOM 10001 C CG   . LEU A 1 36  ? -3.539  1.924   -8.869  1.00 0.00 ? 36  LEU A CG   6  
ATOM 10002 C CD1  . LEU A 1 36  ? -3.644  1.780   -7.359  1.00 0.00 ? 36  LEU A CD1  6  
ATOM 10003 C CD2  . LEU A 1 36  ? -4.132  3.250   -9.322  1.00 0.00 ? 36  LEU A CD2  6  
ATOM 10004 H H    . LEU A 1 36  ? -2.206  -0.550  -10.596 1.00 0.00 ? 36  LEU A H    6  
ATOM 10005 H HA   . LEU A 1 36  ? -2.421  2.275   -11.379 1.00 0.00 ? 36  LEU A HA   6  
ATOM 10006 H HB2  . LEU A 1 36  ? -1.616  1.010   -8.760  1.00 0.00 ? 36  LEU A HB2  6  
ATOM 10007 H HB3  . LEU A 1 36  ? -1.580  2.735   -9.076  1.00 0.00 ? 36  LEU A HB3  6  
ATOM 10008 H HG   . LEU A 1 36  ? -4.112  1.128   -9.321  1.00 0.00 ? 36  LEU A HG   6  
ATOM 10009 H HD11 . LEU A 1 36  ? -3.048  2.543   -6.881  1.00 0.00 ? 36  LEU A HD11 6  
ATOM 10010 H HD12 . LEU A 1 36  ? -3.284  0.805   -7.065  1.00 0.00 ? 36  LEU A HD12 6  
ATOM 10011 H HD13 . LEU A 1 36  ? -4.676  1.888   -7.058  1.00 0.00 ? 36  LEU A HD13 6  
ATOM 10012 H HD21 . LEU A 1 36  ? -3.595  4.062   -8.856  1.00 0.00 ? 36  LEU A HD21 6  
ATOM 10013 H HD22 . LEU A 1 36  ? -5.173  3.295   -9.036  1.00 0.00 ? 36  LEU A HD22 6  
ATOM 10014 H HD23 . LEU A 1 36  ? -4.050  3.333   -10.396 1.00 0.00 ? 36  LEU A HD23 6  
ATOM 10015 N N    . THR A 1 37  ? 0.015   2.779   -11.662 1.00 0.00 ? 37  THR A N    6  
ATOM 10016 C CA   . THR A 1 37  ? 1.408   2.994   -12.039 1.00 0.00 ? 37  THR A CA   6  
ATOM 10017 C C    . THR A 1 37  ? 2.123   3.860   -11.008 1.00 0.00 ? 37  THR A C    6  
ATOM 10018 O O    . THR A 1 37  ? 2.293   5.064   -11.204 1.00 0.00 ? 37  THR A O    6  
ATOM 10019 C CB   . THR A 1 37  ? 1.490   3.650   -13.418 1.00 0.00 ? 37  THR A CB   6  
ATOM 10020 O OG1  . THR A 1 37  ? 0.674   2.962   -14.350 1.00 0.00 ? 37  THR A OG1  6  
ATOM 10021 C CG2  . THR A 1 37  ? 2.894   3.689   -13.980 1.00 0.00 ? 37  THR A CG2  6  
ATOM 10022 H H    . THR A 1 37  ? -0.630  3.508   -11.781 1.00 0.00 ? 37  THR A H    6  
ATOM 10023 H HA   . THR A 1 37  ? 1.892   2.029   -12.080 1.00 0.00 ? 37  THR A HA   6  
ATOM 10024 H HB   . THR A 1 37  ? 1.135   4.667   -13.344 1.00 0.00 ? 37  THR A HB   6  
ATOM 10025 H HG1  . THR A 1 37  ? -0.217  2.884   -14.000 1.00 0.00 ? 37  THR A HG1  6  
ATOM 10026 H HG21 . THR A 1 37  ? 3.476   2.885   -13.552 1.00 0.00 ? 37  THR A HG21 6  
ATOM 10027 H HG22 . THR A 1 37  ? 3.354   4.635   -13.735 1.00 0.00 ? 37  THR A HG22 6  
ATOM 10028 H HG23 . THR A 1 37  ? 2.857   3.575   -15.053 1.00 0.00 ? 37  THR A HG23 6  
ATOM 10029 N N    . ILE A 1 38  ? 2.540   3.240   -9.909  1.00 0.00 ? 38  ILE A N    6  
ATOM 10030 C CA   . ILE A 1 38  ? 3.237   3.955   -8.847  1.00 0.00 ? 38  ILE A CA   6  
ATOM 10031 C C    . ILE A 1 38  ? 4.649   4.338   -9.276  1.00 0.00 ? 38  ILE A C    6  
ATOM 10032 O O    . ILE A 1 38  ? 5.227   3.717   -10.168 1.00 0.00 ? 38  ILE A O    6  
ATOM 10033 C CB   . ILE A 1 38  ? 3.315   3.112   -7.560  1.00 0.00 ? 38  ILE A CB   6  
ATOM 10034 C CG1  . ILE A 1 38  ? 4.020   1.783   -7.835  1.00 0.00 ? 38  ILE A CG1  6  
ATOM 10035 C CG2  . ILE A 1 38  ? 1.921   2.873   -6.998  1.00 0.00 ? 38  ILE A CG2  6  
ATOM 10036 C CD1  . ILE A 1 38  ? 4.565   1.118   -6.590  1.00 0.00 ? 38  ILE A CD1  6  
ATOM 10037 H H    . ILE A 1 38  ? 2.375   2.279   -9.810  1.00 0.00 ? 38  ILE A H    6  
ATOM 10038 H HA   . ILE A 1 38  ? 2.680   4.856   -8.630  1.00 0.00 ? 38  ILE A HA   6  
ATOM 10039 H HB   . ILE A 1 38  ? 3.882   3.667   -6.826  1.00 0.00 ? 38  ILE A HB   6  
ATOM 10040 H HG12 . ILE A 1 38  ? 3.322   1.101   -8.297  1.00 0.00 ? 38  ILE A HG12 6  
ATOM 10041 H HG13 . ILE A 1 38  ? 4.847   1.956   -8.509  1.00 0.00 ? 38  ILE A HG13 6  
ATOM 10042 H HG21 . ILE A 1 38  ? 1.881   1.896   -6.539  1.00 0.00 ? 38  ILE A HG21 6  
ATOM 10043 H HG22 . ILE A 1 38  ? 1.197   2.927   -7.797  1.00 0.00 ? 38  ILE A HG22 6  
ATOM 10044 H HG23 . ILE A 1 38  ? 1.698   3.627   -6.258  1.00 0.00 ? 38  ILE A HG23 6  
ATOM 10045 H HD11 . ILE A 1 38  ? 3.949   0.266   -6.338  1.00 0.00 ? 38  ILE A HD11 6  
ATOM 10046 H HD12 . ILE A 1 38  ? 4.556   1.824   -5.772  1.00 0.00 ? 38  ILE A HD12 6  
ATOM 10047 H HD13 . ILE A 1 38  ? 5.577   0.789   -6.771  1.00 0.00 ? 38  ILE A HD13 6  
ATOM 10048 N N    . ARG A 1 39  ? 5.200   5.363   -8.635  1.00 0.00 ? 39  ARG A N    6  
ATOM 10049 C CA   . ARG A 1 39  ? 6.545   5.828   -8.951  1.00 0.00 ? 39  ARG A CA   6  
ATOM 10050 C C    . ARG A 1 39  ? 7.340   6.095   -7.678  1.00 0.00 ? 39  ARG A C    6  
ATOM 10051 O O    . ARG A 1 39  ? 6.768   6.346   -6.617  1.00 0.00 ? 39  ARG A O    6  
ATOM 10052 C CB   . ARG A 1 39  ? 6.482   7.098   -9.802  1.00 0.00 ? 39  ARG A CB   6  
ATOM 10053 C CG   . ARG A 1 39  ? 5.566   8.168   -9.232  1.00 0.00 ? 39  ARG A CG   6  
ATOM 10054 C CD   . ARG A 1 39  ? 5.865   9.534   -9.828  1.00 0.00 ? 39  ARG A CD   6  
ATOM 10055 N NE   . ARG A 1 39  ? 5.523   9.599   -11.247 1.00 0.00 ? 39  ARG A NE   6  
ATOM 10056 C CZ   . ARG A 1 39  ? 5.367   10.737  -11.920 1.00 0.00 ? 39  ARG A CZ   6  
ATOM 10057 N NH1  . ARG A 1 39  ? 5.521   11.906  -11.309 1.00 0.00 ? 39  ARG A NH1  6  
ATOM 10058 N NH2  . ARG A 1 39  ? 5.056   10.707  -13.208 1.00 0.00 ? 39  ARG A NH2  6  
ATOM 10059 H H    . ARG A 1 39  ? 4.689   5.818   -7.933  1.00 0.00 ? 39  ARG A H    6  
ATOM 10060 H HA   . ARG A 1 39  ? 7.041   5.052   -9.515  1.00 0.00 ? 39  ARG A HA   6  
ATOM 10061 H HB2  . ARG A 1 39  ? 7.476   7.513   -9.884  1.00 0.00 ? 39  ARG A HB2  6  
ATOM 10062 H HB3  . ARG A 1 39  ? 6.127   6.839   -10.789 1.00 0.00 ? 39  ARG A HB3  6  
ATOM 10063 H HG2  . ARG A 1 39  ? 4.541   7.907   -9.455  1.00 0.00 ? 39  ARG A HG2  6  
ATOM 10064 H HG3  . ARG A 1 39  ? 5.702   8.213   -8.162  1.00 0.00 ? 39  ARG A HG3  6  
ATOM 10065 H HD2  . ARG A 1 39  ? 5.293   10.279  -9.295  1.00 0.00 ? 39  ARG A HD2  6  
ATOM 10066 H HD3  . ARG A 1 39  ? 6.920   9.740   -9.710  1.00 0.00 ? 39  ARG A HD3  6  
ATOM 10067 H HE   . ARG A 1 39  ? 5.404   8.752   -11.723 1.00 0.00 ? 39  ARG A HE   6  
ATOM 10068 H HH11 . ARG A 1 39  ? 5.756   11.935  -10.337 1.00 0.00 ? 39  ARG A HH11 6  
ATOM 10069 H HH12 . ARG A 1 39  ? 5.403   12.757  -11.820 1.00 0.00 ? 39  ARG A HH12 6  
ATOM 10070 H HH21 . ARG A 1 39  ? 4.939   9.831   -13.674 1.00 0.00 ? 39  ARG A HH21 6  
ATOM 10071 H HH22 . ARG A 1 39  ? 4.939   11.562  -13.714 1.00 0.00 ? 39  ARG A HH22 6  
ATOM 10072 N N    . GLY A 1 40  ? 8.664   6.037   -7.790  1.00 0.00 ? 40  GLY A N    6  
ATOM 10073 C CA   . GLY A 1 40  ? 9.517   6.274   -6.639  1.00 0.00 ? 40  GLY A CA   6  
ATOM 10074 C C    . GLY A 1 40  ? 9.403   5.179   -5.598  1.00 0.00 ? 40  GLY A C    6  
ATOM 10075 O O    . GLY A 1 40  ? 8.383   4.494   -5.516  1.00 0.00 ? 40  GLY A O    6  
ATOM 10076 H H    . GLY A 1 40  ? 9.065   5.831   -8.660  1.00 0.00 ? 40  GLY A H    6  
ATOM 10077 H HA2  . GLY A 1 40  ? 10.542  6.334   -6.972  1.00 0.00 ? 40  GLY A HA2  6  
ATOM 10078 H HA3  . GLY A 1 40  ? 9.240   7.215   -6.188  1.00 0.00 ? 40  GLY A HA3  6  
ATOM 10079 N N    . GLY A 1 41  ? 10.451  5.014   -4.799  1.00 0.00 ? 41  GLY A N    6  
ATOM 10080 C CA   . GLY A 1 41  ? 10.445  3.992   -3.768  1.00 0.00 ? 41  GLY A CA   6  
ATOM 10081 C C    . GLY A 1 41  ? 11.571  4.172   -2.768  1.00 0.00 ? 41  GLY A C    6  
ATOM 10082 O O    . GLY A 1 41  ? 11.589  5.141   -2.010  1.00 0.00 ? 41  GLY A O    6  
ATOM 10083 H H    . GLY A 1 41  ? 11.237  5.590   -4.911  1.00 0.00 ? 41  GLY A H    6  
ATOM 10084 H HA2  . GLY A 1 41  ? 9.501   4.035   -3.242  1.00 0.00 ? 41  GLY A HA2  6  
ATOM 10085 H HA3  . GLY A 1 41  ? 10.545  3.022   -4.237  1.00 0.00 ? 41  GLY A HA3  6  
ATOM 10086 N N    . ALA A 1 42  ? 12.512  3.233   -2.766  1.00 0.00 ? 42  ALA A N    6  
ATOM 10087 C CA   . ALA A 1 42  ? 13.647  3.291   -1.853  1.00 0.00 ? 42  ALA A CA   6  
ATOM 10088 C C    . ALA A 1 42  ? 14.954  3.488   -2.613  1.00 0.00 ? 42  ALA A C    6  
ATOM 10089 O O    . ALA A 1 42  ? 15.814  4.265   -2.197  1.00 0.00 ? 42  ALA A O    6  
ATOM 10090 C CB   . ALA A 1 42  ? 13.710  2.026   -1.010  1.00 0.00 ? 42  ALA A CB   6  
ATOM 10091 H H    . ALA A 1 42  ? 12.442  2.484   -3.394  1.00 0.00 ? 42  ALA A H    6  
ATOM 10092 H HA   . ALA A 1 42  ? 13.498  4.131   -1.188  1.00 0.00 ? 42  ALA A HA   6  
ATOM 10093 H HB1  . ALA A 1 42  ? 12.720  1.784   -0.649  1.00 0.00 ? 42  ALA A HB1  6  
ATOM 10094 H HB2  . ALA A 1 42  ? 14.370  2.186   -0.170  1.00 0.00 ? 42  ALA A HB2  6  
ATOM 10095 H HB3  . ALA A 1 42  ? 14.083  1.211   -1.611  1.00 0.00 ? 42  ALA A HB3  6  
ATOM 10096 N N    . GLU A 1 43  ? 15.096  2.781   -3.729  1.00 0.00 ? 43  GLU A N    6  
ATOM 10097 C CA   . GLU A 1 43  ? 16.298  2.879   -4.548  1.00 0.00 ? 43  GLU A CA   6  
ATOM 10098 C C    . GLU A 1 43  ? 16.499  4.305   -5.050  1.00 0.00 ? 43  GLU A C    6  
ATOM 10099 O O    . GLU A 1 43  ? 17.600  4.851   -4.978  1.00 0.00 ? 43  GLU A O    6  
ATOM 10100 C CB   . GLU A 1 43  ? 16.214  1.914   -5.732  1.00 0.00 ? 43  GLU A CB   6  
ATOM 10101 C CG   . GLU A 1 43  ? 17.527  1.756   -6.482  1.00 0.00 ? 43  GLU A CG   6  
ATOM 10102 C CD   . GLU A 1 43  ? 17.329  1.287   -7.910  1.00 0.00 ? 43  GLU A CD   6  
ATOM 10103 O OE1  . GLU A 1 43  ? 16.688  0.234   -8.106  1.00 0.00 ? 43  GLU A OE1  6  
ATOM 10104 O OE2  . GLU A 1 43  ? 17.815  1.975   -8.833  1.00 0.00 ? 43  GLU A OE2  6  
ATOM 10105 H H    . GLU A 1 43  ? 14.375  2.179   -4.009  1.00 0.00 ? 43  GLU A H    6  
ATOM 10106 H HA   . GLU A 1 43  ? 17.142  2.605   -3.932  1.00 0.00 ? 43  GLU A HA   6  
ATOM 10107 H HB2  . GLU A 1 43  ? 15.912  0.943   -5.370  1.00 0.00 ? 43  GLU A HB2  6  
ATOM 10108 H HB3  . GLU A 1 43  ? 15.470  2.277   -6.425  1.00 0.00 ? 43  GLU A HB3  6  
ATOM 10109 H HG2  . GLU A 1 43  ? 18.034  2.709   -6.499  1.00 0.00 ? 43  GLU A HG2  6  
ATOM 10110 H HG3  . GLU A 1 43  ? 18.138  1.032   -5.963  1.00 0.00 ? 43  GLU A HG3  6  
ATOM 10111 N N    . TYR A 1 44  ? 15.427  4.903   -5.561  1.00 0.00 ? 44  TYR A N    6  
ATOM 10112 C CA   . TYR A 1 44  ? 15.485  6.266   -6.075  1.00 0.00 ? 44  TYR A CA   6  
ATOM 10113 C C    . TYR A 1 44  ? 15.463  7.279   -4.935  1.00 0.00 ? 44  TYR A C    6  
ATOM 10114 O O    . TYR A 1 44  ? 16.046  8.358   -5.039  1.00 0.00 ? 44  TYR A O    6  
ATOM 10115 C CB   . TYR A 1 44  ? 14.315  6.526   -7.025  1.00 0.00 ? 44  TYR A CB   6  
ATOM 10116 C CG   . TYR A 1 44  ? 14.268  5.577   -8.202  1.00 0.00 ? 44  TYR A CG   6  
ATOM 10117 C CD1  . TYR A 1 44  ? 15.334  5.484   -9.086  1.00 0.00 ? 44  TYR A CD1  6  
ATOM 10118 C CD2  . TYR A 1 44  ? 13.157  4.773   -8.426  1.00 0.00 ? 44  TYR A CD2  6  
ATOM 10119 C CE1  . TYR A 1 44  ? 15.295  4.617   -10.163 1.00 0.00 ? 44  TYR A CE1  6  
ATOM 10120 C CE2  . TYR A 1 44  ? 13.110  3.904   -9.500  1.00 0.00 ? 44  TYR A CE2  6  
ATOM 10121 C CZ   . TYR A 1 44  ? 14.181  3.831   -10.365 1.00 0.00 ? 44  TYR A CZ   6  
ATOM 10122 O OH   . TYR A 1 44  ? 14.138  2.966   -11.435 1.00 0.00 ? 44  TYR A OH   6  
ATOM 10123 H H    . TYR A 1 44  ? 14.577  4.416   -5.591  1.00 0.00 ? 44  TYR A H    6  
ATOM 10124 H HA   . TYR A 1 44  ? 16.411  6.375   -6.620  1.00 0.00 ? 44  TYR A HA   6  
ATOM 10125 H HB2  . TYR A 1 44  ? 13.389  6.423   -6.481  1.00 0.00 ? 44  TYR A HB2  6  
ATOM 10126 H HB3  . TYR A 1 44  ? 14.391  7.531   -7.412  1.00 0.00 ? 44  TYR A HB3  6  
ATOM 10127 H HD1  . TYR A 1 44  ? 16.205  6.101   -8.926  1.00 0.00 ? 44  TYR A HD1  6  
ATOM 10128 H HD2  . TYR A 1 44  ? 12.319  4.833   -7.747  1.00 0.00 ? 44  TYR A HD2  6  
ATOM 10129 H HE1  . TYR A 1 44  ? 16.134  4.560   -10.840 1.00 0.00 ? 44  TYR A HE1  6  
ATOM 10130 H HE2  . TYR A 1 44  ? 12.237  3.288   -9.658  1.00 0.00 ? 44  TYR A HE2  6  
ATOM 10131 H HH   . TYR A 1 44  ? 14.982  2.514   -11.516 1.00 0.00 ? 44  TYR A HH   6  
ATOM 10132 N N    . GLY A 1 45  ? 14.786  6.924   -3.848  1.00 0.00 ? 45  GLY A N    6  
ATOM 10133 C CA   . GLY A 1 45  ? 14.701  7.812   -2.704  1.00 0.00 ? 45  GLY A CA   6  
ATOM 10134 C C    . GLY A 1 45  ? 13.490  8.723   -2.765  1.00 0.00 ? 45  GLY A C    6  
ATOM 10135 O O    . GLY A 1 45  ? 13.510  9.831   -2.228  1.00 0.00 ? 45  GLY A O    6  
ATOM 10136 H H    . GLY A 1 45  ? 14.342  6.051   -3.822  1.00 0.00 ? 45  GLY A H    6  
ATOM 10137 H HA2  . GLY A 1 45  ? 14.645  7.218   -1.803  1.00 0.00 ? 45  GLY A HA2  6  
ATOM 10138 H HA3  . GLY A 1 45  ? 15.593  8.420   -2.666  1.00 0.00 ? 45  GLY A HA3  6  
ATOM 10139 N N    . LEU A 1 46  ? 12.433  8.254   -3.421  1.00 0.00 ? 46  LEU A N    6  
ATOM 10140 C CA   . LEU A 1 46  ? 11.207  9.034   -3.551  1.00 0.00 ? 46  LEU A CA   6  
ATOM 10141 C C    . LEU A 1 46  ? 10.021  8.287   -2.948  1.00 0.00 ? 46  LEU A C    6  
ATOM 10142 O O    . LEU A 1 46  ? 9.972   7.057   -2.972  1.00 0.00 ? 46  LEU A O    6  
ATOM 10143 C CB   . LEU A 1 46  ? 10.931  9.348   -5.023  1.00 0.00 ? 46  LEU A CB   6  
ATOM 10144 C CG   . LEU A 1 46  ? 9.661   10.159  -5.283  1.00 0.00 ? 46  LEU A CG   6  
ATOM 10145 C CD1  . LEU A 1 46  ? 9.860   11.610  -4.872  1.00 0.00 ? 46  LEU A CD1  6  
ATOM 10146 C CD2  . LEU A 1 46  ? 9.263   10.068  -6.749  1.00 0.00 ? 46  LEU A CD2  6  
ATOM 10147 H H    . LEU A 1 46  ? 12.478  7.364   -3.827  1.00 0.00 ? 46  LEU A H    6  
ATOM 10148 H HA   . LEU A 1 46  ? 11.344  9.960   -3.013  1.00 0.00 ? 46  LEU A HA   6  
ATOM 10149 H HB2  . LEU A 1 46  ? 11.775  9.902   -5.415  1.00 0.00 ? 46  LEU A HB2  6  
ATOM 10150 H HB3  . LEU A 1 46  ? 10.851  8.412   -5.560  1.00 0.00 ? 46  LEU A HB3  6  
ATOM 10151 H HG   . LEU A 1 46  ? 8.854   9.752   -4.692  1.00 0.00 ? 46  LEU A HG   6  
ATOM 10152 H HD11 . LEU A 1 46  ? 10.652  11.671  -4.140  1.00 0.00 ? 46  LEU A HD11 6  
ATOM 10153 H HD12 . LEU A 1 46  ? 8.945   11.991  -4.445  1.00 0.00 ? 46  LEU A HD12 6  
ATOM 10154 H HD13 . LEU A 1 46  ? 10.125  12.196  -5.739  1.00 0.00 ? 46  LEU A HD13 6  
ATOM 10155 H HD21 . LEU A 1 46  ? 10.067  10.446  -7.364  1.00 0.00 ? 46  LEU A HD21 6  
ATOM 10156 H HD22 . LEU A 1 46  ? 8.373   10.656  -6.919  1.00 0.00 ? 46  LEU A HD22 6  
ATOM 10157 H HD23 . LEU A 1 46  ? 9.068   9.036   -7.006  1.00 0.00 ? 46  LEU A HD23 6  
ATOM 10158 N N    . GLY A 1 47  ? 9.067   9.039   -2.409  1.00 0.00 ? 47  GLY A N    6  
ATOM 10159 C CA   . GLY A 1 47  ? 7.894   8.430   -1.808  1.00 0.00 ? 47  GLY A CA   6  
ATOM 10160 C C    . GLY A 1 47  ? 7.086   7.623   -2.805  1.00 0.00 ? 47  GLY A C    6  
ATOM 10161 O O    . GLY A 1 47  ? 7.264   7.760   -4.014  1.00 0.00 ? 47  GLY A O    6  
ATOM 10162 H H    . GLY A 1 47  ? 9.160   10.015  -2.419  1.00 0.00 ? 47  GLY A H    6  
ATOM 10163 H HA2  . GLY A 1 47  ? 8.211   7.781   -1.006  1.00 0.00 ? 47  GLY A HA2  6  
ATOM 10164 H HA3  . GLY A 1 47  ? 7.268   9.209   -1.400  1.00 0.00 ? 47  GLY A HA3  6  
ATOM 10165 N N    . ILE A 1 48  ? 6.196   6.777   -2.294  1.00 0.00 ? 48  ILE A N    6  
ATOM 10166 C CA   . ILE A 1 48  ? 5.359   5.944   -3.148  1.00 0.00 ? 48  ILE A CA   6  
ATOM 10167 C C    . ILE A 1 48  ? 4.149   6.720   -3.657  1.00 0.00 ? 48  ILE A C    6  
ATOM 10168 O O    . ILE A 1 48  ? 3.107   6.765   -3.003  1.00 0.00 ? 48  ILE A O    6  
ATOM 10169 C CB   . ILE A 1 48  ? 4.871   4.687   -2.403  1.00 0.00 ? 48  ILE A CB   6  
ATOM 10170 C CG1  . ILE A 1 48  ? 6.044   3.992   -1.707  1.00 0.00 ? 48  ILE A CG1  6  
ATOM 10171 C CG2  . ILE A 1 48  ? 4.179   3.734   -3.365  1.00 0.00 ? 48  ILE A CG2  6  
ATOM 10172 C CD1  . ILE A 1 48  ? 7.082   3.452   -2.668  1.00 0.00 ? 48  ILE A CD1  6  
ATOM 10173 H H    . ILE A 1 48  ? 6.101   6.713   -1.322  1.00 0.00 ? 48  ILE A H    6  
ATOM 10174 H HA   . ILE A 1 48  ? 5.954   5.628   -3.993  1.00 0.00 ? 48  ILE A HA   6  
ATOM 10175 H HB   . ILE A 1 48  ? 4.152   4.993   -1.659  1.00 0.00 ? 48  ILE A HB   6  
ATOM 10176 H HG12 . ILE A 1 48  ? 6.535   4.697   -1.053  1.00 0.00 ? 48  ILE A HG12 6  
ATOM 10177 H HG13 . ILE A 1 48  ? 5.669   3.165   -1.123  1.00 0.00 ? 48  ILE A HG13 6  
ATOM 10178 H HG21 . ILE A 1 48  ? 4.384   2.715   -3.073  1.00 0.00 ? 48  ILE A HG21 6  
ATOM 10179 H HG22 . ILE A 1 48  ? 4.549   3.903   -4.366  1.00 0.00 ? 48  ILE A HG22 6  
ATOM 10180 H HG23 . ILE A 1 48  ? 3.114   3.910   -3.341  1.00 0.00 ? 48  ILE A HG23 6  
ATOM 10181 H HD11 . ILE A 1 48  ? 7.325   4.209   -3.399  1.00 0.00 ? 48  ILE A HD11 6  
ATOM 10182 H HD12 . ILE A 1 48  ? 6.688   2.580   -3.169  1.00 0.00 ? 48  ILE A HD12 6  
ATOM 10183 H HD13 . ILE A 1 48  ? 7.972   3.181   -2.120  1.00 0.00 ? 48  ILE A HD13 6  
ATOM 10184 N N    . TYR A 1 49  ? 4.293   7.330   -4.829  1.00 0.00 ? 49  TYR A N    6  
ATOM 10185 C CA   . TYR A 1 49  ? 3.213   8.104   -5.428  1.00 0.00 ? 49  TYR A CA   6  
ATOM 10186 C C    . TYR A 1 49  ? 2.519   7.309   -6.530  1.00 0.00 ? 49  TYR A C    6  
ATOM 10187 O O    . TYR A 1 49  ? 2.911   6.184   -6.837  1.00 0.00 ? 49  TYR A O    6  
ATOM 10188 C CB   . TYR A 1 49  ? 3.752   9.418   -5.995  1.00 0.00 ? 49  TYR A CB   6  
ATOM 10189 C CG   . TYR A 1 49  ? 4.432   10.291  -4.965  1.00 0.00 ? 49  TYR A CG   6  
ATOM 10190 C CD1  . TYR A 1 49  ? 5.788   10.153  -4.697  1.00 0.00 ? 49  TYR A CD1  6  
ATOM 10191 C CD2  . TYR A 1 49  ? 3.718   11.253  -4.261  1.00 0.00 ? 49  TYR A CD2  6  
ATOM 10192 C CE1  . TYR A 1 49  ? 6.414   10.949  -3.755  1.00 0.00 ? 49  TYR A CE1  6  
ATOM 10193 C CE2  . TYR A 1 49  ? 4.338   12.053  -3.319  1.00 0.00 ? 49  TYR A CE2  6  
ATOM 10194 C CZ   . TYR A 1 49  ? 5.685   11.896  -3.070  1.00 0.00 ? 49  TYR A CZ   6  
ATOM 10195 O OH   . TYR A 1 49  ? 6.304   12.691  -2.133  1.00 0.00 ? 49  TYR A OH   6  
ATOM 10196 H H    . TYR A 1 49  ? 5.148   7.257   -5.304  1.00 0.00 ? 49  TYR A H    6  
ATOM 10197 H HA   . TYR A 1 49  ? 2.494   8.325   -4.653  1.00 0.00 ? 49  TYR A HA   6  
ATOM 10198 H HB2  . TYR A 1 49  ? 4.471   9.199   -6.770  1.00 0.00 ? 49  TYR A HB2  6  
ATOM 10199 H HB3  . TYR A 1 49  ? 2.933   9.982   -6.420  1.00 0.00 ? 49  TYR A HB3  6  
ATOM 10200 H HD1  . TYR A 1 49  ? 6.357   9.410   -5.235  1.00 0.00 ? 49  TYR A HD1  6  
ATOM 10201 H HD2  . TYR A 1 49  ? 2.663   11.373  -4.458  1.00 0.00 ? 49  TYR A HD2  6  
ATOM 10202 H HE1  . TYR A 1 49  ? 7.469   10.826  -3.561  1.00 0.00 ? 49  TYR A HE1  6  
ATOM 10203 H HE2  . TYR A 1 49  ? 3.766   12.795  -2.781  1.00 0.00 ? 49  TYR A HE2  6  
ATOM 10204 H HH   . TYR A 1 49  ? 6.014   13.599  -2.240  1.00 0.00 ? 49  TYR A HH   6  
ATOM 10205 N N    . ILE A 1 50  ? 1.488   7.904   -7.122  1.00 0.00 ? 50  ILE A N    6  
ATOM 10206 C CA   . ILE A 1 50  ? 0.741   7.252   -8.191  1.00 0.00 ? 50  ILE A CA   6  
ATOM 10207 C C    . ILE A 1 50  ? 0.724   8.112   -9.450  1.00 0.00 ? 50  ILE A C    6  
ATOM 10208 O O    . ILE A 1 50  ? 0.749   9.340   -9.377  1.00 0.00 ? 50  ILE A O    6  
ATOM 10209 C CB   . ILE A 1 50  ? -0.711  6.958   -7.767  1.00 0.00 ? 50  ILE A CB   6  
ATOM 10210 C CG1  . ILE A 1 50  ? -0.738  6.274   -6.399  1.00 0.00 ? 50  ILE A CG1  6  
ATOM 10211 C CG2  . ILE A 1 50  ? -1.403  6.095   -8.811  1.00 0.00 ? 50  ILE A CG2  6  
ATOM 10212 C CD1  . ILE A 1 50  ? -2.123  6.181   -5.798  1.00 0.00 ? 50  ILE A CD1  6  
ATOM 10213 H H    . ILE A 1 50  ? 1.225   8.802   -6.834  1.00 0.00 ? 50  ILE A H    6  
ATOM 10214 H HA   . ILE A 1 50  ? 1.226   6.313   -8.414  1.00 0.00 ? 50  ILE A HA   6  
ATOM 10215 H HB   . ILE A 1 50  ? -1.241  7.897   -7.702  1.00 0.00 ? 50  ILE A HB   6  
ATOM 10216 H HG12 . ILE A 1 50  ? -0.353  5.270   -6.498  1.00 0.00 ? 50  ILE A HG12 6  
ATOM 10217 H HG13 . ILE A 1 50  ? -0.114  6.829   -5.713  1.00 0.00 ? 50  ILE A HG13 6  
ATOM 10218 H HG21 . ILE A 1 50  ? -1.744  6.718   -9.624  1.00 0.00 ? 50  ILE A HG21 6  
ATOM 10219 H HG22 . ILE A 1 50  ? -2.250  5.596   -8.361  1.00 0.00 ? 50  ILE A HG22 6  
ATOM 10220 H HG23 . ILE A 1 50  ? -0.710  5.358   -9.187  1.00 0.00 ? 50  ILE A HG23 6  
ATOM 10221 H HD11 . ILE A 1 50  ? -2.159  6.758   -4.886  1.00 0.00 ? 50  ILE A HD11 6  
ATOM 10222 H HD12 . ILE A 1 50  ? -2.353  5.148   -5.579  1.00 0.00 ? 50  ILE A HD12 6  
ATOM 10223 H HD13 . ILE A 1 50  ? -2.847  6.570   -6.498  1.00 0.00 ? 50  ILE A HD13 6  
ATOM 10224 N N    . THR A 1 51  ? 0.678   7.457   -10.606 1.00 0.00 ? 51  THR A N    6  
ATOM 10225 C CA   . THR A 1 51  ? 0.657   8.160   -11.883 1.00 0.00 ? 51  THR A CA   6  
ATOM 10226 C C    . THR A 1 51  ? 0.099   7.265   -12.984 1.00 0.00 ? 51  THR A C    6  
ATOM 10227 O O    . THR A 1 51  ? 0.566   7.298   -14.123 1.00 0.00 ? 51  THR A O    6  
ATOM 10228 C CB   . THR A 1 51  ? 2.063   8.631   -12.255 1.00 0.00 ? 51  THR A CB   6  
ATOM 10229 O OG1  . THR A 1 51  ? 2.045   9.349   -13.476 1.00 0.00 ? 51  THR A OG1  6  
ATOM 10230 C CG2  . THR A 1 51  ? 3.056   7.499   -12.401 1.00 0.00 ? 51  THR A CG2  6  
ATOM 10231 H H    . THR A 1 51  ? 0.659   6.477   -10.599 1.00 0.00 ? 51  THR A H    6  
ATOM 10232 H HA   . THR A 1 51  ? 0.015   9.021   -11.776 1.00 0.00 ? 51  THR A HA   6  
ATOM 10233 H HB   . THR A 1 51  ? 2.427   9.292   -11.480 1.00 0.00 ? 51  THR A HB   6  
ATOM 10234 H HG1  . THR A 1 51  ? 2.844   9.877   -13.550 1.00 0.00 ? 51  THR A HG1  6  
ATOM 10235 H HG21 . THR A 1 51  ? 3.964   7.873   -12.850 1.00 0.00 ? 51  THR A HG21 6  
ATOM 10236 H HG22 . THR A 1 51  ? 2.634   6.730   -13.033 1.00 0.00 ? 51  THR A HG22 6  
ATOM 10237 H HG23 . THR A 1 51  ? 3.277   7.085   -11.429 1.00 0.00 ? 51  THR A HG23 6  
ATOM 10238 N N    . GLY A 1 52  ? -0.905  6.465   -12.638 1.00 0.00 ? 52  GLY A N    6  
ATOM 10239 C CA   . GLY A 1 52  ? -1.510  5.572   -13.607 1.00 0.00 ? 52  GLY A CA   6  
ATOM 10240 C C    . GLY A 1 52  ? -2.791  4.941   -13.094 1.00 0.00 ? 52  GLY A C    6  
ATOM 10241 O O    . GLY A 1 52  ? -2.843  4.458   -11.964 1.00 0.00 ? 52  GLY A O    6  
ATOM 10242 H H    . GLY A 1 52  ? -1.236  6.482   -11.715 1.00 0.00 ? 52  GLY A H    6  
ATOM 10243 H HA2  . GLY A 1 52  ? -1.730  6.129   -14.505 1.00 0.00 ? 52  GLY A HA2  6  
ATOM 10244 H HA3  . GLY A 1 52  ? -0.807  4.787   -13.845 1.00 0.00 ? 52  GLY A HA3  6  
ATOM 10245 N N    . VAL A 1 53  ? -3.825  4.947   -13.930 1.00 0.00 ? 53  VAL A N    6  
ATOM 10246 C CA   . VAL A 1 53  ? -5.112  4.373   -13.557 1.00 0.00 ? 53  VAL A CA   6  
ATOM 10247 C C    . VAL A 1 53  ? -5.710  3.573   -14.709 1.00 0.00 ? 53  VAL A C    6  
ATOM 10248 O O    . VAL A 1 53  ? -6.327  4.136   -15.614 1.00 0.00 ? 53  VAL A O    6  
ATOM 10249 C CB   . VAL A 1 53  ? -6.112  5.462   -13.129 1.00 0.00 ? 53  VAL A CB   6  
ATOM 10250 C CG1  . VAL A 1 53  ? -7.374  4.837   -12.559 1.00 0.00 ? 53  VAL A CG1  6  
ATOM 10251 C CG2  . VAL A 1 53  ? -5.474  6.407   -12.122 1.00 0.00 ? 53  VAL A CG2  6  
ATOM 10252 H H    . VAL A 1 53  ? -3.720  5.348   -14.817 1.00 0.00 ? 53  VAL A H    6  
ATOM 10253 H HA   . VAL A 1 53  ? -4.951  3.712   -12.718 1.00 0.00 ? 53  VAL A HA   6  
ATOM 10254 H HB   . VAL A 1 53  ? -6.385  6.035   -14.004 1.00 0.00 ? 53  VAL A HB   6  
ATOM 10255 H HG11 . VAL A 1 53  ? -7.176  4.472   -11.562 1.00 0.00 ? 53  VAL A HG11 6  
ATOM 10256 H HG12 . VAL A 1 53  ? -7.685  4.016   -13.187 1.00 0.00 ? 53  VAL A HG12 6  
ATOM 10257 H HG13 . VAL A 1 53  ? -8.159  5.579   -12.520 1.00 0.00 ? 53  VAL A HG13 6  
ATOM 10258 H HG21 . VAL A 1 53  ? -6.068  7.306   -12.046 1.00 0.00 ? 53  VAL A HG21 6  
ATOM 10259 H HG22 . VAL A 1 53  ? -4.477  6.663   -12.450 1.00 0.00 ? 53  VAL A HG22 6  
ATOM 10260 H HG23 . VAL A 1 53  ? -5.424  5.925   -11.158 1.00 0.00 ? 53  VAL A HG23 6  
ATOM 10261 N N    . ASP A 1 54  ? -5.521  2.258   -14.671 1.00 0.00 ? 54  ASP A N    6  
ATOM 10262 C CA   . ASP A 1 54  ? -6.039  1.380   -15.714 1.00 0.00 ? 54  ASP A CA   6  
ATOM 10263 C C    . ASP A 1 54  ? -7.562  1.483   -15.807 1.00 0.00 ? 54  ASP A C    6  
ATOM 10264 O O    . ASP A 1 54  ? -8.277  1.036   -14.910 1.00 0.00 ? 54  ASP A O    6  
ATOM 10265 C CB   . ASP A 1 54  ? -5.630  -0.069  -15.434 1.00 0.00 ? 54  ASP A CB   6  
ATOM 10266 C CG   . ASP A 1 54  ? -4.872  -0.689  -16.593 1.00 0.00 ? 54  ASP A CG   6  
ATOM 10267 O OD1  . ASP A 1 54  ? -5.527  -1.199  -17.526 1.00 0.00 ? 54  ASP A OD1  6  
ATOM 10268 O OD2  . ASP A 1 54  ? -3.624  -0.663  -16.567 1.00 0.00 ? 54  ASP A OD2  6  
ATOM 10269 H H    . ASP A 1 54  ? -5.019  1.869   -13.925 1.00 0.00 ? 54  ASP A H    6  
ATOM 10270 H HA   . ASP A 1 54  ? -5.607  1.690   -16.652 1.00 0.00 ? 54  ASP A HA   6  
ATOM 10271 H HB2  . ASP A 1 54  ? -4.997  -0.096  -14.561 1.00 0.00 ? 54  ASP A HB2  6  
ATOM 10272 H HB3  . ASP A 1 54  ? -6.515  -0.661  -15.250 1.00 0.00 ? 54  ASP A HB3  6  
ATOM 10273 N N    . PRO A 1 55  ? -8.084  2.075   -16.898 1.00 0.00 ? 55  PRO A N    6  
ATOM 10274 C CA   . PRO A 1 55  ? -9.529  2.230   -17.094 1.00 0.00 ? 55  PRO A CA   6  
ATOM 10275 C C    . PRO A 1 55  ? -10.267 0.896   -17.033 1.00 0.00 ? 55  PRO A C    6  
ATOM 10276 O O    . PRO A 1 55  ? -10.022 0.002   -17.844 1.00 0.00 ? 55  PRO A O    6  
ATOM 10277 C CB   . PRO A 1 55  ? -9.643  2.836   -18.497 1.00 0.00 ? 55  PRO A CB   6  
ATOM 10278 C CG   . PRO A 1 55  ? -8.324  3.482   -18.743 1.00 0.00 ? 55  PRO A CG   6  
ATOM 10279 C CD   . PRO A 1 55  ? -7.312  2.639   -18.021 1.00 0.00 ? 55  PRO A CD   6  
ATOM 10280 H HA   . PRO A 1 55  ? -9.956  2.908   -16.370 1.00 0.00 ? 55  PRO A HA   6  
ATOM 10281 H HB2  . PRO A 1 55  ? -9.840  2.053   -19.215 1.00 0.00 ? 55  PRO A HB2  6  
ATOM 10282 H HB3  . PRO A 1 55  ? -10.445 3.558   -18.516 1.00 0.00 ? 55  PRO A HB3  6  
ATOM 10283 H HG2  . PRO A 1 55  ? -8.113  3.497   -19.802 1.00 0.00 ? 55  PRO A HG2  6  
ATOM 10284 H HG3  . PRO A 1 55  ? -8.326  4.486   -18.345 1.00 0.00 ? 55  PRO A HG3  6  
ATOM 10285 H HD2  . PRO A 1 55  ? -6.943  1.856   -18.667 1.00 0.00 ? 55  PRO A HD2  6  
ATOM 10286 H HD3  . PRO A 1 55  ? -6.498  3.249   -17.661 1.00 0.00 ? 55  PRO A HD3  6  
ATOM 10287 N N    . GLY A 1 56  ? -11.171 0.768   -16.068 1.00 0.00 ? 56  GLY A N    6  
ATOM 10288 C CA   . GLY A 1 56  ? -11.930 -0.459  -15.921 1.00 0.00 ? 56  GLY A CA   6  
ATOM 10289 C C    . GLY A 1 56  ? -11.231 -1.472  -15.033 1.00 0.00 ? 56  GLY A C    6  
ATOM 10290 O O    . GLY A 1 56  ? -11.379 -2.679  -15.223 1.00 0.00 ? 56  GLY A O    6  
ATOM 10291 H H    . GLY A 1 56  ? -11.324 1.514   -15.450 1.00 0.00 ? 56  GLY A H    6  
ATOM 10292 H HA2  . GLY A 1 56  ? -12.892 -0.225  -15.490 1.00 0.00 ? 56  GLY A HA2  6  
ATOM 10293 H HA3  . GLY A 1 56  ? -12.081 -0.896  -16.896 1.00 0.00 ? 56  GLY A HA3  6  
ATOM 10294 N N    . SER A 1 57  ? -10.468 -0.979  -14.064 1.00 0.00 ? 57  SER A N    6  
ATOM 10295 C CA   . SER A 1 57  ? -9.744  -1.849  -13.145 1.00 0.00 ? 57  SER A CA   6  
ATOM 10296 C C    . SER A 1 57  ? -10.364 -1.806  -11.753 1.00 0.00 ? 57  SER A C    6  
ATOM 10297 O O    . SER A 1 57  ? -11.340 -1.092  -11.519 1.00 0.00 ? 57  SER A O    6  
ATOM 10298 C CB   . SER A 1 57  ? -8.272  -1.438  -13.073 1.00 0.00 ? 57  SER A CB   6  
ATOM 10299 O OG   . SER A 1 57  ? -8.141  -0.081  -12.687 1.00 0.00 ? 57  SER A OG   6  
ATOM 10300 H H    . SER A 1 57  ? -10.390 -0.007  -13.963 1.00 0.00 ? 57  SER A H    6  
ATOM 10301 H HA   . SER A 1 57  ? -9.808  -2.859  -13.523 1.00 0.00 ? 57  SER A HA   6  
ATOM 10302 H HB2  . SER A 1 57  ? -7.763  -2.056  -12.345 1.00 0.00 ? 57  SER A HB2  6  
ATOM 10303 H HB3  . SER A 1 57  ? -7.816  -1.570  -14.045 1.00 0.00 ? 57  SER A HB3  6  
ATOM 10304 H HG   . SER A 1 57  ? -7.564  -0.019  -11.922 1.00 0.00 ? 57  SER A HG   6  
ATOM 10305 N N    . GLU A 1 58  ? -9.793  -2.574  -10.831 1.00 0.00 ? 58  GLU A N    6  
ATOM 10306 C CA   . GLU A 1 58  ? -10.291 -2.622  -9.461  1.00 0.00 ? 58  GLU A CA   6  
ATOM 10307 C C    . GLU A 1 58  ? -9.947  -1.338  -8.713  1.00 0.00 ? 58  GLU A C    6  
ATOM 10308 O O    . GLU A 1 58  ? -10.778 -0.786  -7.992  1.00 0.00 ? 58  GLU A O    6  
ATOM 10309 C CB   . GLU A 1 58  ? -9.707  -3.831  -8.725  1.00 0.00 ? 58  GLU A CB   6  
ATOM 10310 C CG   . GLU A 1 58  ? -10.735 -4.606  -7.917  1.00 0.00 ? 58  GLU A CG   6  
ATOM 10311 C CD   . GLU A 1 58  ? -10.892 -4.073  -6.507  1.00 0.00 ? 58  GLU A CD   6  
ATOM 10312 O OE1  . GLU A 1 58  ? -10.081 -4.449  -5.636  1.00 0.00 ? 58  GLU A OE1  6  
ATOM 10313 O OE2  . GLU A 1 58  ? -11.826 -3.277  -6.275  1.00 0.00 ? 58  GLU A OE2  6  
ATOM 10314 H H    . GLU A 1 58  ? -9.018  -3.121  -11.077 1.00 0.00 ? 58  GLU A H    6  
ATOM 10315 H HA   . GLU A 1 58  ? -11.365 -2.722  -9.503  1.00 0.00 ? 58  GLU A HA   6  
ATOM 10316 H HB2  . GLU A 1 58  ? -9.270  -4.501  -9.451  1.00 0.00 ? 58  GLU A HB2  6  
ATOM 10317 H HB3  . GLU A 1 58  ? -8.934  -3.490  -8.052  1.00 0.00 ? 58  GLU A HB3  6  
ATOM 10318 H HG2  . GLU A 1 58  ? -11.689 -4.542  -8.418  1.00 0.00 ? 58  GLU A HG2  6  
ATOM 10319 H HG3  . GLU A 1 58  ? -10.426 -5.640  -7.864  1.00 0.00 ? 58  GLU A HG3  6  
ATOM 10320 N N    . ALA A 1 59  ? -8.717  -0.866  -8.892  1.00 0.00 ? 59  ALA A N    6  
ATOM 10321 C CA   . ALA A 1 59  ? -8.264  0.354   -8.236  1.00 0.00 ? 59  ALA A CA   6  
ATOM 10322 C C    . ALA A 1 59  ? -8.977  1.576   -8.804  1.00 0.00 ? 59  ALA A C    6  
ATOM 10323 O O    . ALA A 1 59  ? -9.254  2.536   -8.086  1.00 0.00 ? 59  ALA A O    6  
ATOM 10324 C CB   . ALA A 1 59  ? -6.757  0.502   -8.382  1.00 0.00 ? 59  ALA A CB   6  
ATOM 10325 H H    . ALA A 1 59  ? -8.101  -1.350  -9.480  1.00 0.00 ? 59  ALA A H    6  
ATOM 10326 H HA   . ALA A 1 59  ? -8.494  0.272   -7.183  1.00 0.00 ? 59  ALA A HA   6  
ATOM 10327 H HB1  . ALA A 1 59  ? -6.539  1.231   -9.149  1.00 0.00 ? 59  ALA A HB1  6  
ATOM 10328 H HB2  . ALA A 1 59  ? -6.326  -0.450  -8.657  1.00 0.00 ? 59  ALA A HB2  6  
ATOM 10329 H HB3  . ALA A 1 59  ? -6.335  0.830   -7.443  1.00 0.00 ? 59  ALA A HB3  6  
ATOM 10330 N N    . GLU A 1 60  ? -9.270  1.532   -10.099 1.00 0.00 ? 60  GLU A N    6  
ATOM 10331 C CA   . GLU A 1 60  ? -9.951  2.635   -10.768 1.00 0.00 ? 60  GLU A CA   6  
ATOM 10332 C C    . GLU A 1 60  ? -11.370 2.804   -10.234 1.00 0.00 ? 60  GLU A C    6  
ATOM 10333 O O    . GLU A 1 60  ? -11.860 3.924   -10.089 1.00 0.00 ? 60  GLU A O    6  
ATOM 10334 C CB   . GLU A 1 60  ? -9.988  2.395   -12.279 1.00 0.00 ? 60  GLU A CB   6  
ATOM 10335 C CG   . GLU A 1 60  ? -10.407 3.616   -13.080 1.00 0.00 ? 60  GLU A CG   6  
ATOM 10336 C CD   . GLU A 1 60  ? -11.743 3.430   -13.774 1.00 0.00 ? 60  GLU A CD   6  
ATOM 10337 O OE1  . GLU A 1 60  ? -12.654 2.837   -13.159 1.00 0.00 ? 60  GLU A OE1  6  
ATOM 10338 O OE2  . GLU A 1 60  ? -11.877 3.878   -14.932 1.00 0.00 ? 60  GLU A OE2  6  
ATOM 10339 H H    . GLU A 1 60  ? -9.023  0.738   -10.619 1.00 0.00 ? 60  GLU A H    6  
ATOM 10340 H HA   . GLU A 1 60  ? -9.394  3.538   -10.570 1.00 0.00 ? 60  GLU A HA   6  
ATOM 10341 H HB2  . GLU A 1 60  ? -9.004  2.095   -12.608 1.00 0.00 ? 60  GLU A HB2  6  
ATOM 10342 H HB3  . GLU A 1 60  ? -10.686 1.597   -12.487 1.00 0.00 ? 60  GLU A HB3  6  
ATOM 10343 H HG2  . GLU A 1 60  ? -10.482 4.461   -12.411 1.00 0.00 ? 60  GLU A HG2  6  
ATOM 10344 H HG3  . GLU A 1 60  ? -9.654  3.816   -13.828 1.00 0.00 ? 60  GLU A HG3  6  
ATOM 10345 N N    . GLY A 1 61  ? -12.024 1.684   -9.943  1.00 0.00 ? 61  GLY A N    6  
ATOM 10346 C CA   . GLY A 1 61  ? -13.381 1.730   -9.431  1.00 0.00 ? 61  GLY A CA   6  
ATOM 10347 C C    . GLY A 1 61  ? -13.451 2.266   -8.013  1.00 0.00 ? 61  GLY A C    6  
ATOM 10348 O O    . GLY A 1 61  ? -14.461 2.844   -7.612  1.00 0.00 ? 61  GLY A O    6  
ATOM 10349 H H    . GLY A 1 61  ? -11.583 0.821   -10.080 1.00 0.00 ? 61  GLY A H    6  
ATOM 10350 H HA2  . GLY A 1 61  ? -13.976 2.362   -10.073 1.00 0.00 ? 61  GLY A HA2  6  
ATOM 10351 H HA3  . GLY A 1 61  ? -13.793 0.732   -9.445  1.00 0.00 ? 61  GLY A HA3  6  
ATOM 10352 N N    . SER A 1 62  ? -12.377 2.074   -7.255  1.00 0.00 ? 62  SER A N    6  
ATOM 10353 C CA   . SER A 1 62  ? -12.324 2.542   -5.875  1.00 0.00 ? 62  SER A CA   6  
ATOM 10354 C C    . SER A 1 62  ? -12.262 4.065   -5.817  1.00 0.00 ? 62  SER A C    6  
ATOM 10355 O O    . SER A 1 62  ? -13.202 4.718   -5.362  1.00 0.00 ? 62  SER A O    6  
ATOM 10356 C CB   . SER A 1 62  ? -11.113 1.943   -5.157  1.00 0.00 ? 62  SER A CB   6  
ATOM 10357 O OG   . SER A 1 62  ? -11.421 1.628   -3.810  1.00 0.00 ? 62  SER A OG   6  
ATOM 10358 H H    . SER A 1 62  ? -11.604 1.605   -7.631  1.00 0.00 ? 62  SER A H    6  
ATOM 10359 H HA   . SER A 1 62  ? -13.224 2.212   -5.378  1.00 0.00 ? 62  SER A HA   6  
ATOM 10360 H HB2  . SER A 1 62  ? -10.807 1.041   -5.665  1.00 0.00 ? 62  SER A HB2  6  
ATOM 10361 H HB3  . SER A 1 62  ? -10.301 2.656   -5.171  1.00 0.00 ? 62  SER A HB3  6  
ATOM 10362 H HG   . SER A 1 62  ? -12.081 0.930   -3.788  1.00 0.00 ? 62  SER A HG   6  
ATOM 10363 N N    . GLY A 1 63  ? -11.151 4.625   -6.281  1.00 0.00 ? 63  GLY A N    6  
ATOM 10364 C CA   . GLY A 1 63  ? -10.985 6.067   -6.273  1.00 0.00 ? 63  GLY A CA   6  
ATOM 10365 C C    . GLY A 1 63  ? -9.532  6.481   -6.166  1.00 0.00 ? 63  GLY A C    6  
ATOM 10366 O O    . GLY A 1 63  ? -9.186  7.362   -5.378  1.00 0.00 ? 63  GLY A O    6  
ATOM 10367 H H    . GLY A 1 63  ? -10.435 4.054   -6.632  1.00 0.00 ? 63  GLY A H    6  
ATOM 10368 H HA2  . GLY A 1 63  ? -11.398 6.469   -7.186  1.00 0.00 ? 63  GLY A HA2  6  
ATOM 10369 H HA3  . GLY A 1 63  ? -11.529 6.475   -5.434  1.00 0.00 ? 63  GLY A HA3  6  
ATOM 10370 N N    . LEU A 1 64  ? -8.677  5.846   -6.962  1.00 0.00 ? 64  LEU A N    6  
ATOM 10371 C CA   . LEU A 1 64  ? -7.252  6.151   -6.954  1.00 0.00 ? 64  LEU A CA   6  
ATOM 10372 C C    . LEU A 1 64  ? -6.827  6.797   -8.269  1.00 0.00 ? 64  LEU A C    6  
ATOM 10373 O O    . LEU A 1 64  ? -6.784  6.140   -9.309  1.00 0.00 ? 64  LEU A O    6  
ATOM 10374 C CB   . LEU A 1 64  ? -6.438  4.879   -6.712  1.00 0.00 ? 64  LEU A CB   6  
ATOM 10375 C CG   . LEU A 1 64  ? -6.480  4.346   -5.278  1.00 0.00 ? 64  LEU A CG   6  
ATOM 10376 C CD1  . LEU A 1 64  ? -6.126  2.867   -5.248  1.00 0.00 ? 64  LEU A CD1  6  
ATOM 10377 C CD2  . LEU A 1 64  ? -5.536  5.140   -4.389  1.00 0.00 ? 64  LEU A CD2  6  
ATOM 10378 H H    . LEU A 1 64  ? -9.014  5.153   -7.568  1.00 0.00 ? 64  LEU A H    6  
ATOM 10379 H HA   . LEU A 1 64  ? -7.065  6.846   -6.148  1.00 0.00 ? 64  LEU A HA   6  
ATOM 10380 H HB2  . LEU A 1 64  ? -6.811  4.108   -7.372  1.00 0.00 ? 64  LEU A HB2  6  
ATOM 10381 H HB3  . LEU A 1 64  ? -5.409  5.080   -6.967  1.00 0.00 ? 64  LEU A HB3  6  
ATOM 10382 H HG   . LEU A 1 64  ? -7.481  4.458   -4.890  1.00 0.00 ? 64  LEU A HG   6  
ATOM 10383 H HD11 . LEU A 1 64  ? -5.053  2.753   -5.274  1.00 0.00 ? 64  LEU A HD11 6  
ATOM 10384 H HD12 . LEU A 1 64  ? -6.562  2.375   -6.105  1.00 0.00 ? 64  LEU A HD12 6  
ATOM 10385 H HD13 . LEU A 1 64  ? -6.514  2.423   -4.343  1.00 0.00 ? 64  LEU A HD13 6  
ATOM 10386 H HD21 . LEU A 1 64  ? -5.932  6.133   -4.240  1.00 0.00 ? 64  LEU A HD21 6  
ATOM 10387 H HD22 . LEU A 1 64  ? -4.566  5.207   -4.862  1.00 0.00 ? 64  LEU A HD22 6  
ATOM 10388 H HD23 . LEU A 1 64  ? -5.437  4.644   -3.435  1.00 0.00 ? 64  LEU A HD23 6  
ATOM 10389 N N    . LYS A 1 65  ? -6.514  8.088   -8.215  1.00 0.00 ? 65  LYS A N    6  
ATOM 10390 C CA   . LYS A 1 65  ? -6.092  8.823   -9.403  1.00 0.00 ? 65  LYS A CA   6  
ATOM 10391 C C    . LYS A 1 65  ? -4.630  9.240   -9.294  1.00 0.00 ? 65  LYS A C    6  
ATOM 10392 O O    . LYS A 1 65  ? -3.986  9.024   -8.267  1.00 0.00 ? 65  LYS A O    6  
ATOM 10393 C CB   . LYS A 1 65  ? -6.973  10.058  -9.601  1.00 0.00 ? 65  LYS A CB   6  
ATOM 10394 C CG   . LYS A 1 65  ? -8.197  9.800   -10.466 1.00 0.00 ? 65  LYS A CG   6  
ATOM 10395 C CD   . LYS A 1 65  ? -9.459  9.682   -9.627  1.00 0.00 ? 65  LYS A CD   6  
ATOM 10396 C CE   . LYS A 1 65  ? -10.644 10.350  -10.305 1.00 0.00 ? 65  LYS A CE   6  
ATOM 10397 N NZ   . LYS A 1 65  ? -11.942 9.862   -9.763  1.00 0.00 ? 65  LYS A NZ   6  
ATOM 10398 H H    . LYS A 1 65  ? -6.568  8.557   -7.357  1.00 0.00 ? 65  LYS A H    6  
ATOM 10399 H HA   . LYS A 1 65  ? -6.207  8.170   -10.254 1.00 0.00 ? 65  LYS A HA   6  
ATOM 10400 H HB2  . LYS A 1 65  ? -7.307  10.407  -8.636  1.00 0.00 ? 65  LYS A HB2  6  
ATOM 10401 H HB3  . LYS A 1 65  ? -6.385  10.834  -10.071 1.00 0.00 ? 65  LYS A HB3  6  
ATOM 10402 H HG2  . LYS A 1 65  ? -8.314  10.619  -11.160 1.00 0.00 ? 65  LYS A HG2  6  
ATOM 10403 H HG3  . LYS A 1 65  ? -8.051  8.880   -11.013 1.00 0.00 ? 65  LYS A HG3  6  
ATOM 10404 H HD2  . LYS A 1 65  ? -9.685  8.637   -9.478  1.00 0.00 ? 65  LYS A HD2  6  
ATOM 10405 H HD3  . LYS A 1 65  ? -9.289  10.156  -8.670  1.00 0.00 ? 65  LYS A HD3  6  
ATOM 10406 H HE2  . LYS A 1 65  ? -10.577 11.416  -10.150 1.00 0.00 ? 65  LYS A HE2  6  
ATOM 10407 H HE3  . LYS A 1 65  ? -10.603 10.138  -11.364 1.00 0.00 ? 65  LYS A HE3  6  
ATOM 10408 H HZ1  . LYS A 1 65  ? -12.118 10.280  -8.827  1.00 0.00 ? 65  LYS A HZ1  6  
ATOM 10409 H HZ2  . LYS A 1 65  ? -11.925 8.827   -9.669  1.00 0.00 ? 65  LYS A HZ2  6  
ATOM 10410 H HZ3  . LYS A 1 65  ? -12.718 10.128  -10.402 1.00 0.00 ? 65  LYS A HZ3  6  
ATOM 10411 N N    . VAL A 1 66  ? -4.111  9.838   -10.362 1.00 0.00 ? 66  VAL A N    6  
ATOM 10412 C CA   . VAL A 1 66  ? -2.724  10.286  -10.388 1.00 0.00 ? 66  VAL A CA   6  
ATOM 10413 C C    . VAL A 1 66  ? -2.503  11.443  -9.419  1.00 0.00 ? 66  VAL A C    6  
ATOM 10414 O O    . VAL A 1 66  ? -3.331  12.349  -9.319  1.00 0.00 ? 66  VAL A O    6  
ATOM 10415 C CB   . VAL A 1 66  ? -2.301  10.729  -11.801 1.00 0.00 ? 66  VAL A CB   6  
ATOM 10416 C CG1  . VAL A 1 66  ? -2.230  9.531   -12.737 1.00 0.00 ? 66  VAL A CG1  6  
ATOM 10417 C CG2  . VAL A 1 66  ? -3.259  11.780  -12.340 1.00 0.00 ? 66  VAL A CG2  6  
ATOM 10418 H H    . VAL A 1 66  ? -4.674  9.982   -11.150 1.00 0.00 ? 66  VAL A H    6  
ATOM 10419 H HA   . VAL A 1 66  ? -2.099  9.456   -10.091 1.00 0.00 ? 66  VAL A HA   6  
ATOM 10420 H HB   . VAL A 1 66  ? -1.317  11.168  -11.740 1.00 0.00 ? 66  VAL A HB   6  
ATOM 10421 H HG11 . VAL A 1 66  ? -2.020  8.639   -12.165 1.00 0.00 ? 66  VAL A HG11 6  
ATOM 10422 H HG12 . VAL A 1 66  ? -1.445  9.688   -13.462 1.00 0.00 ? 66  VAL A HG12 6  
ATOM 10423 H HG13 . VAL A 1 66  ? -3.174  9.417   -13.248 1.00 0.00 ? 66  VAL A HG13 6  
ATOM 10424 H HG21 . VAL A 1 66  ? -3.977  11.310  -12.997 1.00 0.00 ? 66  VAL A HG21 6  
ATOM 10425 H HG22 . VAL A 1 66  ? -2.704  12.525  -12.889 1.00 0.00 ? 66  VAL A HG22 6  
ATOM 10426 H HG23 . VAL A 1 66  ? -3.779  12.250  -11.518 1.00 0.00 ? 66  VAL A HG23 6  
ATOM 10427 N N    . GLY A 1 67  ? -1.382  11.406  -8.705  1.00 0.00 ? 67  GLY A N    6  
ATOM 10428 C CA   . GLY A 1 67  ? -1.074  12.458  -7.754  1.00 0.00 ? 67  GLY A CA   6  
ATOM 10429 C C    . GLY A 1 67  ? -1.203  11.995  -6.316  1.00 0.00 ? 67  GLY A C    6  
ATOM 10430 O O    . GLY A 1 67  ? -0.568  12.549  -5.419  1.00 0.00 ? 67  GLY A O    6  
ATOM 10431 H H    . GLY A 1 67  ? -0.759  10.659  -8.827  1.00 0.00 ? 67  GLY A H    6  
ATOM 10432 H HA2  . GLY A 1 67  ? -0.059  12.794  -7.922  1.00 0.00 ? 67  GLY A HA2  6  
ATOM 10433 H HA3  . GLY A 1 67  ? -1.752  13.285  -7.916  1.00 0.00 ? 67  GLY A HA3  6  
ATOM 10434 N N    . ASP A 1 68  ? -2.029  10.976  -6.094  1.00 0.00 ? 68  ASP A N    6  
ATOM 10435 C CA   . ASP A 1 68  ? -2.239  10.440  -4.754  1.00 0.00 ? 68  ASP A CA   6  
ATOM 10436 C C    . ASP A 1 68  ? -0.923  9.974   -4.139  1.00 0.00 ? 68  ASP A C    6  
ATOM 10437 O O    . ASP A 1 68  ? -0.050  9.455   -4.835  1.00 0.00 ? 68  ASP A O    6  
ATOM 10438 C CB   . ASP A 1 68  ? -3.234  9.278   -4.799  1.00 0.00 ? 68  ASP A CB   6  
ATOM 10439 C CG   . ASP A 1 68  ? -4.671  9.742   -4.670  1.00 0.00 ? 68  ASP A CG   6  
ATOM 10440 O OD1  . ASP A 1 68  ? -4.953  10.906  -5.025  1.00 0.00 ? 68  ASP A OD1  6  
ATOM 10441 O OD2  . ASP A 1 68  ? -5.515  8.942   -4.216  1.00 0.00 ? 68  ASP A OD2  6  
ATOM 10442 H H    . ASP A 1 68  ? -2.507  10.575  -6.849  1.00 0.00 ? 68  ASP A H    6  
ATOM 10443 H HA   . ASP A 1 68  ? -2.649  11.229  -4.142  1.00 0.00 ? 68  ASP A HA   6  
ATOM 10444 H HB2  . ASP A 1 68  ? -3.127  8.756   -5.740  1.00 0.00 ? 68  ASP A HB2  6  
ATOM 10445 H HB3  . ASP A 1 68  ? -3.020  8.598   -3.984  1.00 0.00 ? 68  ASP A HB3  6  
ATOM 10446 N N    . GLN A 1 69  ? -0.788  10.162  -2.830  1.00 0.00 ? 69  GLN A N    6  
ATOM 10447 C CA   . GLN A 1 69  ? 0.420   9.761   -2.120  1.00 0.00 ? 69  GLN A CA   6  
ATOM 10448 C C    . GLN A 1 69  ? 0.141   8.585   -1.190  1.00 0.00 ? 69  GLN A C    6  
ATOM 10449 O O    . GLN A 1 69  ? -0.518  8.738   -0.162  1.00 0.00 ? 69  GLN A O    6  
ATOM 10450 C CB   . GLN A 1 69  ? 0.981   10.938  -1.319  1.00 0.00 ? 69  GLN A CB   6  
ATOM 10451 C CG   . GLN A 1 69  ? 2.461   10.808  -1.000  1.00 0.00 ? 69  GLN A CG   6  
ATOM 10452 C CD   . GLN A 1 69  ? 2.720   10.521  0.465   1.00 0.00 ? 69  GLN A CD   6  
ATOM 10453 O OE1  . GLN A 1 69  ? 2.485   11.368  1.328   1.00 0.00 ? 69  GLN A OE1  6  
ATOM 10454 N NE2  . GLN A 1 69  ? 3.207   9.320   0.757   1.00 0.00 ? 69  GLN A NE2  6  
ATOM 10455 H H    . GLN A 1 69  ? -1.520  10.581  -2.329  1.00 0.00 ? 69  GLN A H    6  
ATOM 10456 H HA   . GLN A 1 69  ? 1.152   9.458   -2.855  1.00 0.00 ? 69  GLN A HA   6  
ATOM 10457 H HB2  . GLN A 1 69  ? 0.835   11.846  -1.885  1.00 0.00 ? 69  GLN A HB2  6  
ATOM 10458 H HB3  . GLN A 1 69  ? 0.438   11.015  -0.388  1.00 0.00 ? 69  GLN A HB3  6  
ATOM 10459 H HG2  . GLN A 1 69  ? 2.873   10.000  -1.587  1.00 0.00 ? 69  GLN A HG2  6  
ATOM 10460 H HG3  . GLN A 1 69  ? 2.955   11.732  -1.264  1.00 0.00 ? 69  GLN A HG3  6  
ATOM 10461 H HE21 . GLN A 1 69  ? 3.370   8.696   0.020   1.00 0.00 ? 69  GLN A HE21 6  
ATOM 10462 H HE22 . GLN A 1 69  ? 3.384   9.108   1.697   1.00 0.00 ? 69  GLN A HE22 6  
ATOM 10463 N N    . ILE A 1 70  ? 0.646   7.412   -1.558  1.00 0.00 ? 70  ILE A N    6  
ATOM 10464 C CA   . ILE A 1 70  ? 0.450   6.211   -0.757  1.00 0.00 ? 70  ILE A CA   6  
ATOM 10465 C C    . ILE A 1 70  ? 1.302   6.250   0.507   1.00 0.00 ? 70  ILE A C    6  
ATOM 10466 O O    . ILE A 1 70  ? 2.531   6.228   0.440   1.00 0.00 ? 70  ILE A O    6  
ATOM 10467 C CB   . ILE A 1 70  ? 0.793   4.939   -1.556  1.00 0.00 ? 70  ILE A CB   6  
ATOM 10468 C CG1  . ILE A 1 70  ? 0.076   4.948   -2.907  1.00 0.00 ? 70  ILE A CG1  6  
ATOM 10469 C CG2  . ILE A 1 70  ? 0.419   3.696   -0.761  1.00 0.00 ? 70  ILE A CG2  6  
ATOM 10470 C CD1  . ILE A 1 70  ? 0.600   3.911   -3.875  1.00 0.00 ? 70  ILE A CD1  6  
ATOM 10471 H H    . ILE A 1 70  ? 1.162   7.354   -2.389  1.00 0.00 ? 70  ILE A H    6  
ATOM 10472 H HA   . ILE A 1 70  ? -0.593  6.165   -0.476  1.00 0.00 ? 70  ILE A HA   6  
ATOM 10473 H HB   . ILE A 1 70  ? 1.859   4.921   -1.722  1.00 0.00 ? 70  ILE A HB   6  
ATOM 10474 H HG12 . ILE A 1 70  ? -0.975  4.754   -2.752  1.00 0.00 ? 70  ILE A HG12 6  
ATOM 10475 H HG13 . ILE A 1 70  ? 0.195   5.920   -3.363  1.00 0.00 ? 70  ILE A HG13 6  
ATOM 10476 H HG21 . ILE A 1 70  ? -0.367  3.939   -0.062  1.00 0.00 ? 70  ILE A HG21 6  
ATOM 10477 H HG22 . ILE A 1 70  ? 1.283   3.340   -0.221  1.00 0.00 ? 70  ILE A HG22 6  
ATOM 10478 H HG23 . ILE A 1 70  ? 0.075   2.927   -1.437  1.00 0.00 ? 70  ILE A HG23 6  
ATOM 10479 H HD11 . ILE A 1 70  ? 0.881   3.020   -3.333  1.00 0.00 ? 70  ILE A HD11 6  
ATOM 10480 H HD12 . ILE A 1 70  ? 1.463   4.304   -4.393  1.00 0.00 ? 70  ILE A HD12 6  
ATOM 10481 H HD13 . ILE A 1 70  ? -0.169  3.667   -4.594  1.00 0.00 ? 70  ILE A HD13 6  
ATOM 10482 N N    . LEU A 1 71  ? 0.641   6.309   1.658   1.00 0.00 ? 71  LEU A N    6  
ATOM 10483 C CA   . LEU A 1 71  ? 1.338   6.352   2.939   1.00 0.00 ? 71  LEU A CA   6  
ATOM 10484 C C    . LEU A 1 71  ? 1.676   4.945   3.422   1.00 0.00 ? 71  LEU A C    6  
ATOM 10485 O O    . LEU A 1 71  ? 2.802   4.677   3.843   1.00 0.00 ? 71  LEU A O    6  
ATOM 10486 C CB   . LEU A 1 71  ? 0.483   7.071   3.984   1.00 0.00 ? 71  LEU A CB   6  
ATOM 10487 C CG   . LEU A 1 71  ? -0.015  8.457   3.572   1.00 0.00 ? 71  LEU A CG   6  
ATOM 10488 C CD1  . LEU A 1 71  ? -0.980  9.008   4.610   1.00 0.00 ? 71  LEU A CD1  6  
ATOM 10489 C CD2  . LEU A 1 71  ? 1.156   9.407   3.373   1.00 0.00 ? 71  LEU A CD2  6  
ATOM 10490 H H    . LEU A 1 71  ? -0.339  6.324   1.647   1.00 0.00 ? 71  LEU A H    6  
ATOM 10491 H HA   . LEU A 1 71  ? 2.257   6.902   2.797   1.00 0.00 ? 71  LEU A HA   6  
ATOM 10492 H HB2  . LEU A 1 71  ? -0.374  6.452   4.204   1.00 0.00 ? 71  LEU A HB2  6  
ATOM 10493 H HB3  . LEU A 1 71  ? 1.069   7.179   4.885   1.00 0.00 ? 71  LEU A HB3  6  
ATOM 10494 H HG   . LEU A 1 71  ? -0.545  8.376   2.633   1.00 0.00 ? 71  LEU A HG   6  
ATOM 10495 H HD11 . LEU A 1 71  ? -1.993  8.760   4.328   1.00 0.00 ? 71  LEU A HD11 6  
ATOM 10496 H HD12 . LEU A 1 71  ? -0.874  10.081  4.667   1.00 0.00 ? 71  LEU A HD12 6  
ATOM 10497 H HD13 . LEU A 1 71  ? -0.759  8.572   5.573   1.00 0.00 ? 71  LEU A HD13 6  
ATOM 10498 H HD21 . LEU A 1 71  ? 1.450   9.403   2.334   1.00 0.00 ? 71  LEU A HD21 6  
ATOM 10499 H HD22 . LEU A 1 71  ? 1.987   9.087   3.984   1.00 0.00 ? 71  LEU A HD22 6  
ATOM 10500 H HD23 . LEU A 1 71  ? 0.862   10.406  3.660   1.00 0.00 ? 71  LEU A HD23 6  
ATOM 10501 N N    . GLU A 1 72  ? 0.695   4.052   3.358   1.00 0.00 ? 72  GLU A N    6  
ATOM 10502 C CA   . GLU A 1 72  ? 0.890   2.672   3.790   1.00 0.00 ? 72  GLU A CA   6  
ATOM 10503 C C    . GLU A 1 72  ? -0.159  1.754   3.171   1.00 0.00 ? 72  GLU A C    6  
ATOM 10504 O O    . GLU A 1 72  ? -1.252  2.195   2.815   1.00 0.00 ? 72  GLU A O    6  
ATOM 10505 C CB   . GLU A 1 72  ? 0.828   2.580   5.315   1.00 0.00 ? 72  GLU A CB   6  
ATOM 10506 C CG   . GLU A 1 72  ? -0.503  3.024   5.899   1.00 0.00 ? 72  GLU A CG   6  
ATOM 10507 C CD   . GLU A 1 72  ? -0.444  4.417   6.494   1.00 0.00 ? 72  GLU A CD   6  
ATOM 10508 O OE1  . GLU A 1 72  ? 0.375   5.232   6.020   1.00 0.00 ? 72  GLU A OE1  6  
ATOM 10509 O OE2  . GLU A 1 72  ? -1.217  4.693   7.436   1.00 0.00 ? 72  GLU A OE2  6  
ATOM 10510 H H    . GLU A 1 72  ? -0.180  4.325   3.012   1.00 0.00 ? 72  GLU A H    6  
ATOM 10511 H HA   . GLU A 1 72  ? 1.867   2.356   3.458   1.00 0.00 ? 72  GLU A HA   6  
ATOM 10512 H HB2  . GLU A 1 72  ? 1.002   1.555   5.610   1.00 0.00 ? 72  GLU A HB2  6  
ATOM 10513 H HB3  . GLU A 1 72  ? 1.605   3.202   5.734   1.00 0.00 ? 72  GLU A HB3  6  
ATOM 10514 H HG2  . GLU A 1 72  ? -1.246  3.016   5.115   1.00 0.00 ? 72  GLU A HG2  6  
ATOM 10515 H HG3  . GLU A 1 72  ? -0.792  2.328   6.673   1.00 0.00 ? 72  GLU A HG3  6  
ATOM 10516 N N    . VAL A 1 73  ? 0.181   0.476   3.045   1.00 0.00 ? 73  VAL A N    6  
ATOM 10517 C CA   . VAL A 1 73  ? -0.732  -0.504  2.469   1.00 0.00 ? 73  VAL A CA   6  
ATOM 10518 C C    . VAL A 1 73  ? -0.679  -1.821  3.238   1.00 0.00 ? 73  VAL A C    6  
ATOM 10519 O O    . VAL A 1 73  ? 0.399   -2.315  3.568   1.00 0.00 ? 73  VAL A O    6  
ATOM 10520 C CB   . VAL A 1 73  ? -0.406  -0.774  0.989   1.00 0.00 ? 73  VAL A CB   6  
ATOM 10521 C CG1  . VAL A 1 73  ? -1.482  -1.642  0.354   1.00 0.00 ? 73  VAL A CG1  6  
ATOM 10522 C CG2  . VAL A 1 73  ? -0.250  0.535   0.230   1.00 0.00 ? 73  VAL A CG2  6  
ATOM 10523 H H    . VAL A 1 73  ? 1.067   0.185   3.347   1.00 0.00 ? 73  VAL A H    6  
ATOM 10524 H HA   . VAL A 1 73  ? -1.734  -0.104  2.529   1.00 0.00 ? 73  VAL A HA   6  
ATOM 10525 H HB   . VAL A 1 73  ? 0.531   -1.309  0.939   1.00 0.00 ? 73  VAL A HB   6  
ATOM 10526 H HG11 . VAL A 1 73  ? -2.412  -1.511  0.888   1.00 0.00 ? 73  VAL A HG11 6  
ATOM 10527 H HG12 . VAL A 1 73  ? -1.182  -2.678  0.400   1.00 0.00 ? 73  VAL A HG12 6  
ATOM 10528 H HG13 . VAL A 1 73  ? -1.616  -1.351  -0.678  1.00 0.00 ? 73  VAL A HG13 6  
ATOM 10529 H HG21 . VAL A 1 73  ? -0.980  1.247   0.586   1.00 0.00 ? 73  VAL A HG21 6  
ATOM 10530 H HG22 . VAL A 1 73  ? -0.403  0.360   -0.825  1.00 0.00 ? 73  VAL A HG22 6  
ATOM 10531 H HG23 . VAL A 1 73  ? 0.744   0.927   0.389   1.00 0.00 ? 73  VAL A HG23 6  
ATOM 10532 N N    . ASN A 1 74  ? -1.850  -2.385  3.518   1.00 0.00 ? 74  ASN A N    6  
ATOM 10533 C CA   . ASN A 1 74  ? -1.937  -3.645  4.247   1.00 0.00 ? 74  ASN A CA   6  
ATOM 10534 C C    . ASN A 1 74  ? -1.320  -3.513  5.636   1.00 0.00 ? 74  ASN A C    6  
ATOM 10535 O O    . ASN A 1 74  ? -0.799  -4.481  6.190   1.00 0.00 ? 74  ASN A O    6  
ATOM 10536 C CB   . ASN A 1 74  ? -1.239  -4.759  3.465   1.00 0.00 ? 74  ASN A CB   6  
ATOM 10537 C CG   . ASN A 1 74  ? -2.223  -5.666  2.751   1.00 0.00 ? 74  ASN A CG   6  
ATOM 10538 O OD1  . ASN A 1 74  ? -2.641  -6.692  3.287   1.00 0.00 ? 74  ASN A OD1  6  
ATOM 10539 N ND2  . ASN A 1 74  ? -2.597  -5.292  1.532   1.00 0.00 ? 74  ASN A ND2  6  
ATOM 10540 H H    . ASN A 1 74  ? -2.675  -1.942  3.227   1.00 0.00 ? 74  ASN A H    6  
ATOM 10541 H HA   . ASN A 1 74  ? -2.982  -3.892  4.354   1.00 0.00 ? 74  ASN A HA   6  
ATOM 10542 H HB2  . ASN A 1 74  ? -0.585  -4.316  2.725   1.00 0.00 ? 74  ASN A HB2  6  
ATOM 10543 H HB3  . ASN A 1 74  ? -0.653  -5.361  4.148   1.00 0.00 ? 74  ASN A HB3  6  
ATOM 10544 H HD21 . ASN A 1 74  ? -2.223  -4.463  1.168   1.00 0.00 ? 74  ASN A HD21 6  
ATOM 10545 H HD22 . ASN A 1 74  ? -3.231  -5.860  1.048   1.00 0.00 ? 74  ASN A HD22 6  
ATOM 10546 N N    . GLY A 1 75  ? -1.382  -2.309  6.195   1.00 0.00 ? 75  GLY A N    6  
ATOM 10547 C CA   . GLY A 1 75  ? -0.826  -2.073  7.515   1.00 0.00 ? 75  GLY A CA   6  
ATOM 10548 C C    . GLY A 1 75  ? 0.687   -2.154  7.530   1.00 0.00 ? 75  GLY A C    6  
ATOM 10549 O O    . GLY A 1 75  ? 1.280   -2.640  8.493   1.00 0.00 ? 75  GLY A O    6  
ATOM 10550 H H    . GLY A 1 75  ? -1.809  -1.574  5.708   1.00 0.00 ? 75  GLY A H    6  
ATOM 10551 H HA2  . GLY A 1 75  ? -1.126  -1.091  7.850   1.00 0.00 ? 75  GLY A HA2  6  
ATOM 10552 H HA3  . GLY A 1 75  ? -1.222  -2.811  8.197   1.00 0.00 ? 75  GLY A HA3  6  
ATOM 10553 N N    . ARG A 1 76  ? 1.315   -1.677  6.461   1.00 0.00 ? 76  ARG A N    6  
ATOM 10554 C CA   . ARG A 1 76  ? 2.770   -1.698  6.356   1.00 0.00 ? 76  ARG A CA   6  
ATOM 10555 C C    . ARG A 1 76  ? 3.299   -0.353  5.870   1.00 0.00 ? 76  ARG A C    6  
ATOM 10556 O O    . ARG A 1 76  ? 2.725   0.265   4.974   1.00 0.00 ? 76  ARG A O    6  
ATOM 10557 C CB   . ARG A 1 76  ? 3.218   -2.809  5.404   1.00 0.00 ? 76  ARG A CB   6  
ATOM 10558 C CG   . ARG A 1 76  ? 4.728   -2.964  5.319   1.00 0.00 ? 76  ARG A CG   6  
ATOM 10559 C CD   . ARG A 1 76  ? 5.155   -4.421  5.438   1.00 0.00 ? 76  ARG A CD   6  
ATOM 10560 N NE   . ARG A 1 76  ? 6.072   -4.632  6.556   1.00 0.00 ? 76  ARG A NE   6  
ATOM 10561 C CZ   . ARG A 1 76  ? 6.807   -5.731  6.714   1.00 0.00 ? 76  ARG A CZ   6  
ATOM 10562 N NH1  . ARG A 1 76  ? 6.736   -6.718  5.829   1.00 0.00 ? 76  ARG A NH1  6  
ATOM 10563 N NH2  . ARG A 1 76  ? 7.616   -5.842  7.759   1.00 0.00 ? 76  ARG A NH2  6  
ATOM 10564 H H    . ARG A 1 76  ? 0.788   -1.302  5.725   1.00 0.00 ? 76  ARG A H    6  
ATOM 10565 H HA   . ARG A 1 76  ? 3.170   -1.896  7.339   1.00 0.00 ? 76  ARG A HA   6  
ATOM 10566 H HB2  . ARG A 1 76  ? 2.798   -3.746  5.741   1.00 0.00 ? 76  ARG A HB2  6  
ATOM 10567 H HB3  . ARG A 1 76  ? 2.843   -2.593  4.415   1.00 0.00 ? 76  ARG A HB3  6  
ATOM 10568 H HG2  . ARG A 1 76  ? 5.066   -2.578  4.369   1.00 0.00 ? 76  ARG A HG2  6  
ATOM 10569 H HG3  . ARG A 1 76  ? 5.182   -2.399  6.120   1.00 0.00 ? 76  ARG A HG3  6  
ATOM 10570 H HD2  . ARG A 1 76  ? 4.277   -5.031  5.585   1.00 0.00 ? 76  ARG A HD2  6  
ATOM 10571 H HD3  . ARG A 1 76  ? 5.646   -4.714  4.522   1.00 0.00 ? 76  ARG A HD3  6  
ATOM 10572 H HE   . ARG A 1 76  ? 6.143   -3.918  7.224   1.00 0.00 ? 76  ARG A HE   6  
ATOM 10573 H HH11 . ARG A 1 76  ? 6.128   -6.640  5.040   1.00 0.00 ? 76  ARG A HH11 6  
ATOM 10574 H HH12 . ARG A 1 76  ? 7.291   -7.540  5.953   1.00 0.00 ? 76  ARG A HH12 6  
ATOM 10575 H HH21 . ARG A 1 76  ? 7.673   -5.102  8.428   1.00 0.00 ? 76  ARG A HH21 6  
ATOM 10576 H HH22 . ARG A 1 76  ? 8.168   -6.667  7.877   1.00 0.00 ? 76  ARG A HH22 6  
ATOM 10577 N N    . SER A 1 77  ? 4.398   0.094   6.467   1.00 0.00 ? 77  SER A N    6  
ATOM 10578 C CA   . SER A 1 77  ? 5.006   1.367   6.095   1.00 0.00 ? 77  SER A CA   6  
ATOM 10579 C C    . SER A 1 77  ? 5.478   1.340   4.645   1.00 0.00 ? 77  SER A C    6  
ATOM 10580 O O    . SER A 1 77  ? 6.245   0.463   4.248   1.00 0.00 ? 77  SER A O    6  
ATOM 10581 C CB   . SER A 1 77  ? 6.181   1.685   7.022   1.00 0.00 ? 77  SER A CB   6  
ATOM 10582 O OG   . SER A 1 77  ? 5.752   2.411   8.161   1.00 0.00 ? 77  SER A OG   6  
ATOM 10583 H H    . SER A 1 77  ? 4.811   -0.443  7.175   1.00 0.00 ? 77  SER A H    6  
ATOM 10584 H HA   . SER A 1 77  ? 4.256   2.136   6.202   1.00 0.00 ? 77  SER A HA   6  
ATOM 10585 H HB2  . SER A 1 77  ? 6.639   0.763   7.348   1.00 0.00 ? 77  SER A HB2  6  
ATOM 10586 H HB3  . SER A 1 77  ? 6.909   2.277   6.485   1.00 0.00 ? 77  SER A HB3  6  
ATOM 10587 H HG   . SER A 1 77  ? 6.475   2.950   8.488   1.00 0.00 ? 77  SER A HG   6  
ATOM 10588 N N    . PHE A 1 78  ? 5.014   2.306   3.859   1.00 0.00 ? 78  PHE A N    6  
ATOM 10589 C CA   . PHE A 1 78  ? 5.388   2.393   2.451   1.00 0.00 ? 78  PHE A CA   6  
ATOM 10590 C C    . PHE A 1 78  ? 6.297   3.593   2.202   1.00 0.00 ? 78  PHE A C    6  
ATOM 10591 O O    . PHE A 1 78  ? 6.292   4.171   1.115   1.00 0.00 ? 78  PHE A O    6  
ATOM 10592 C CB   . PHE A 1 78  ? 4.136   2.492   1.577   1.00 0.00 ? 78  PHE A CB   6  
ATOM 10593 C CG   . PHE A 1 78  ? 3.717   1.182   0.975   1.00 0.00 ? 78  PHE A CG   6  
ATOM 10594 C CD1  . PHE A 1 78  ? 3.411   0.098   1.783   1.00 0.00 ? 78  PHE A CD1  6  
ATOM 10595 C CD2  . PHE A 1 78  ? 3.629   1.032   -0.399  1.00 0.00 ? 78  PHE A CD2  6  
ATOM 10596 C CE1  . PHE A 1 78  ? 3.025   -1.109  1.233   1.00 0.00 ? 78  PHE A CE1  6  
ATOM 10597 C CE2  . PHE A 1 78  ? 3.244   -0.173  -0.956  1.00 0.00 ? 78  PHE A CE2  6  
ATOM 10598 C CZ   . PHE A 1 78  ? 2.942   -1.244  -0.139  1.00 0.00 ? 78  PHE A CZ   6  
ATOM 10599 H H    . PHE A 1 78  ? 4.405   2.976   4.233   1.00 0.00 ? 78  PHE A H    6  
ATOM 10600 H HA   . PHE A 1 78  ? 5.923   1.491   2.195   1.00 0.00 ? 78  PHE A HA   6  
ATOM 10601 H HB2  . PHE A 1 78  ? 3.315   2.859   2.175   1.00 0.00 ? 78  PHE A HB2  6  
ATOM 10602 H HB3  . PHE A 1 78  ? 4.322   3.185   0.768   1.00 0.00 ? 78  PHE A HB3  6  
ATOM 10603 H HD1  . PHE A 1 78  ? 3.476   0.204   2.856   1.00 0.00 ? 78  PHE A HD1  6  
ATOM 10604 H HD2  . PHE A 1 78  ? 3.865   1.870   -1.040  1.00 0.00 ? 78  PHE A HD2  6  
ATOM 10605 H HE1  . PHE A 1 78  ? 2.789   -1.945  1.874   1.00 0.00 ? 78  PHE A HE1  6  
ATOM 10606 H HE2  . PHE A 1 78  ? 3.179   -0.276  -2.030  1.00 0.00 ? 78  PHE A HE2  6  
ATOM 10607 H HZ   . PHE A 1 78  ? 2.641   -2.187  -0.573  1.00 0.00 ? 78  PHE A HZ   6  
ATOM 10608 N N    . LEU A 1 79  ? 7.076   3.961   3.213   1.00 0.00 ? 79  LEU A N    6  
ATOM 10609 C CA   . LEU A 1 79  ? 7.989   5.092   3.101   1.00 0.00 ? 79  LEU A CA   6  
ATOM 10610 C C    . LEU A 1 79  ? 9.334   4.652   2.532   1.00 0.00 ? 79  LEU A C    6  
ATOM 10611 O O    . LEU A 1 79  ? 9.789   5.172   1.513   1.00 0.00 ? 79  LEU A O    6  
ATOM 10612 C CB   . LEU A 1 79  ? 8.193   5.750   4.467   1.00 0.00 ? 79  LEU A CB   6  
ATOM 10613 C CG   . LEU A 1 79  ? 7.003   6.564   4.978   1.00 0.00 ? 79  LEU A CG   6  
ATOM 10614 C CD1  . LEU A 1 79  ? 7.162   6.870   6.458   1.00 0.00 ? 79  LEU A CD1  6  
ATOM 10615 C CD2  . LEU A 1 79  ? 6.855   7.849   4.179   1.00 0.00 ? 79  LEU A CD2  6  
ATOM 10616 H H    . LEU A 1 79  ? 7.036   3.461   4.054   1.00 0.00 ? 79  LEU A H    6  
ATOM 10617 H HA   . LEU A 1 79  ? 7.546   5.811   2.428   1.00 0.00 ? 79  LEU A HA   6  
ATOM 10618 H HB2  . LEU A 1 79  ? 8.408   4.974   5.187   1.00 0.00 ? 79  LEU A HB2  6  
ATOM 10619 H HB3  . LEU A 1 79  ? 9.048   6.406   4.404   1.00 0.00 ? 79  LEU A HB3  6  
ATOM 10620 H HG   . LEU A 1 79  ? 6.099   5.985   4.852   1.00 0.00 ? 79  LEU A HG   6  
ATOM 10621 H HD11 . LEU A 1 79  ? 6.268   7.350   6.826   1.00 0.00 ? 79  LEU A HD11 6  
ATOM 10622 H HD12 . LEU A 1 79  ? 8.007   7.526   6.601   1.00 0.00 ? 79  LEU A HD12 6  
ATOM 10623 H HD13 . LEU A 1 79  ? 7.325   5.950   7.000   1.00 0.00 ? 79  LEU A HD13 6  
ATOM 10624 H HD21 . LEU A 1 79  ? 7.318   7.728   3.211   1.00 0.00 ? 79  LEU A HD21 6  
ATOM 10625 H HD22 . LEU A 1 79  ? 7.335   8.660   4.708   1.00 0.00 ? 79  LEU A HD22 6  
ATOM 10626 H HD23 . LEU A 1 79  ? 5.807   8.074   4.049   1.00 0.00 ? 79  LEU A HD23 6  
ATOM 10627 N N    . ASN A 1 80  ? 9.967   3.692   3.199   1.00 0.00 ? 80  ASN A N    6  
ATOM 10628 C CA   . ASN A 1 80  ? 11.261  3.182   2.760   1.00 0.00 ? 80  ASN A CA   6  
ATOM 10629 C C    . ASN A 1 80  ? 11.098  1.886   1.974   1.00 0.00 ? 80  ASN A C    6  
ATOM 10630 O O    . ASN A 1 80  ? 11.963  1.011   2.014   1.00 0.00 ? 80  ASN A O    6  
ATOM 10631 C CB   . ASN A 1 80  ? 12.174  2.949   3.965   1.00 0.00 ? 80  ASN A CB   6  
ATOM 10632 C CG   . ASN A 1 80  ? 11.607  1.925   4.929   1.00 0.00 ? 80  ASN A CG   6  
ATOM 10633 O OD1  . ASN A 1 80  ? 10.581  2.157   5.568   1.00 0.00 ? 80  ASN A OD1  6  
ATOM 10634 N ND2  . ASN A 1 80  ? 12.277  0.783   5.040   1.00 0.00 ? 80  ASN A ND2  6  
ATOM 10635 H H    . ASN A 1 80  ? 9.554   3.318   4.005   1.00 0.00 ? 80  ASN A H    6  
ATOM 10636 H HA   . ASN A 1 80  ? 11.709  3.925   2.118   1.00 0.00 ? 80  ASN A HA   6  
ATOM 10637 H HB2  . ASN A 1 80  ? 13.134  2.597   3.619   1.00 0.00 ? 80  ASN A HB2  6  
ATOM 10638 H HB3  . ASN A 1 80  ? 12.306  3.881   4.495   1.00 0.00 ? 80  ASN A HB3  6  
ATOM 10639 H HD21 . ASN A 1 80  ? 13.086  0.667   4.501   1.00 0.00 ? 80  ASN A HD21 6  
ATOM 10640 H HD22 . ASN A 1 80  ? 11.933  0.103   5.656   1.00 0.00 ? 80  ASN A HD22 6  
ATOM 10641 N N    . ILE A 1 81  ? 9.984   1.770   1.258   1.00 0.00 ? 81  ILE A N    6  
ATOM 10642 C CA   . ILE A 1 81  ? 9.709   0.580   0.462   1.00 0.00 ? 81  ILE A CA   6  
ATOM 10643 C C    . ILE A 1 81  ? 10.268  0.723   -0.950  1.00 0.00 ? 81  ILE A C    6  
ATOM 10644 O O    . ILE A 1 81  ? 10.136  1.774   -1.577  1.00 0.00 ? 81  ILE A O    6  
ATOM 10645 C CB   . ILE A 1 81  ? 8.195   0.293   0.383   1.00 0.00 ? 81  ILE A CB   6  
ATOM 10646 C CG1  . ILE A 1 81  ? 7.938   -1.033  -0.338  1.00 0.00 ? 81  ILE A CG1  6  
ATOM 10647 C CG2  . ILE A 1 81  ? 7.470   1.435   -0.317  1.00 0.00 ? 81  ILE A CG2  6  
ATOM 10648 C CD1  . ILE A 1 81  ? 7.681   -2.191  0.602   1.00 0.00 ? 81  ILE A CD1  6  
ATOM 10649 H H    . ILE A 1 81  ? 9.332   2.501   1.265   1.00 0.00 ? 81  ILE A H    6  
ATOM 10650 H HA   . ILE A 1 81  ? 10.188  -0.260  0.943   1.00 0.00 ? 81  ILE A HA   6  
ATOM 10651 H HB   . ILE A 1 81  ? 7.813   0.225   1.391   1.00 0.00 ? 81  ILE A HB   6  
ATOM 10652 H HG12 . ILE A 1 81  ? 7.075   -0.928  -0.976  1.00 0.00 ? 81  ILE A HG12 6  
ATOM 10653 H HG13 . ILE A 1 81  ? 8.799   -1.279  -0.941  1.00 0.00 ? 81  ILE A HG13 6  
ATOM 10654 H HG21 . ILE A 1 81  ? 8.092   2.318   -0.304  1.00 0.00 ? 81  ILE A HG21 6  
ATOM 10655 H HG22 . ILE A 1 81  ? 6.542   1.640   0.197   1.00 0.00 ? 81  ILE A HG22 6  
ATOM 10656 H HG23 . ILE A 1 81  ? 7.263   1.156   -1.339  1.00 0.00 ? 81  ILE A HG23 6  
ATOM 10657 H HD11 . ILE A 1 81  ? 8.172   -2.004  1.547   1.00 0.00 ? 81  ILE A HD11 6  
ATOM 10658 H HD12 . ILE A 1 81  ? 8.070   -3.100  0.168   1.00 0.00 ? 81  ILE A HD12 6  
ATOM 10659 H HD13 . ILE A 1 81  ? 6.619   -2.295  0.763   1.00 0.00 ? 81  ILE A HD13 6  
ATOM 10660 N N    . LEU A 1 82  ? 10.893  -0.341  -1.444  1.00 0.00 ? 82  LEU A N    6  
ATOM 10661 C CA   . LEU A 1 82  ? 11.472  -0.334  -2.783  1.00 0.00 ? 82  LEU A CA   6  
ATOM 10662 C C    . LEU A 1 82  ? 10.382  -0.224  -3.844  1.00 0.00 ? 82  LEU A C    6  
ATOM 10663 O O    . LEU A 1 82  ? 9.201   -0.421  -3.559  1.00 0.00 ? 82  LEU A O    6  
ATOM 10664 C CB   . LEU A 1 82  ? 12.295  -1.603  -3.011  1.00 0.00 ? 82  LEU A CB   6  
ATOM 10665 C CG   . LEU A 1 82  ? 13.476  -1.790  -2.057  1.00 0.00 ? 82  LEU A CG   6  
ATOM 10666 C CD1  . LEU A 1 82  ? 13.591  -3.243  -1.623  1.00 0.00 ? 82  LEU A CD1  6  
ATOM 10667 C CD2  . LEU A 1 82  ? 14.769  -1.324  -2.711  1.00 0.00 ? 82  LEU A CD2  6  
ATOM 10668 H H    . LEU A 1 82  ? 10.966  -1.150  -0.896  1.00 0.00 ? 82  LEU A H    6  
ATOM 10669 H HA   . LEU A 1 82  ? 12.121  0.525   -2.859  1.00 0.00 ? 82  LEU A HA   6  
ATOM 10670 H HB2  . LEU A 1 82  ? 11.638  -2.455  -2.911  1.00 0.00 ? 82  LEU A HB2  6  
ATOM 10671 H HB3  . LEU A 1 82  ? 12.677  -1.582  -4.022  1.00 0.00 ? 82  LEU A HB3  6  
ATOM 10672 H HG   . LEU A 1 82  ? 13.314  -1.191  -1.172  1.00 0.00 ? 82  LEU A HG   6  
ATOM 10673 H HD11 . LEU A 1 82  ? 14.359  -3.336  -0.870  1.00 0.00 ? 82  LEU A HD11 6  
ATOM 10674 H HD12 . LEU A 1 82  ? 13.848  -3.855  -2.476  1.00 0.00 ? 82  LEU A HD12 6  
ATOM 10675 H HD13 . LEU A 1 82  ? 12.646  -3.572  -1.216  1.00 0.00 ? 82  LEU A HD13 6  
ATOM 10676 H HD21 . LEU A 1 82  ? 15.293  -2.177  -3.118  1.00 0.00 ? 82  LEU A HD21 6  
ATOM 10677 H HD22 . LEU A 1 82  ? 15.390  -0.838  -1.974  1.00 0.00 ? 82  LEU A HD22 6  
ATOM 10678 H HD23 . LEU A 1 82  ? 14.540  -0.630  -3.505  1.00 0.00 ? 82  LEU A HD23 6  
ATOM 10679 N N    . HIS A 1 83  ? 10.786  0.091   -5.070  1.00 0.00 ? 83  HIS A N    6  
ATOM 10680 C CA   . HIS A 1 83  ? 9.844   0.226   -6.173  1.00 0.00 ? 83  HIS A CA   6  
ATOM 10681 C C    . HIS A 1 83  ? 9.331   -1.139  -6.620  1.00 0.00 ? 83  HIS A C    6  
ATOM 10682 O O    . HIS A 1 83  ? 8.125   -1.348  -6.752  1.00 0.00 ? 83  HIS A O    6  
ATOM 10683 C CB   . HIS A 1 83  ? 10.503  0.946   -7.351  1.00 0.00 ? 83  HIS A CB   6  
ATOM 10684 C CG   . HIS A 1 83  ? 9.573   1.185   -8.501  1.00 0.00 ? 83  HIS A CG   6  
ATOM 10685 N ND1  . HIS A 1 83  ? 8.220   0.921   -8.443  1.00 0.00 ? 83  HIS A ND1  6  
ATOM 10686 C CD2  . HIS A 1 83  ? 9.808   1.667   -9.744  1.00 0.00 ? 83  HIS A CD2  6  
ATOM 10687 C CE1  . HIS A 1 83  ? 7.664   1.229   -9.601  1.00 0.00 ? 83  HIS A CE1  6  
ATOM 10688 N NE2  . HIS A 1 83  ? 8.605   1.684   -10.407 1.00 0.00 ? 83  HIS A NE2  6  
ATOM 10689 H H    . HIS A 1 83  ? 11.742  0.236   -5.237  1.00 0.00 ? 83  HIS A H    6  
ATOM 10690 H HA   . HIS A 1 83  ? 9.008   0.815   -5.825  1.00 0.00 ? 83  HIS A HA   6  
ATOM 10691 H HB2  . HIS A 1 83  ? 10.871  1.907   -7.017  1.00 0.00 ? 83  HIS A HB2  6  
ATOM 10692 H HB3  . HIS A 1 83  ? 11.331  0.350   -7.710  1.00 0.00 ? 83  HIS A HB3  6  
ATOM 10693 H HD1  . HIS A 1 83  ? 7.740   0.561   -7.668  1.00 0.00 ? 83  HIS A HD1  6  
ATOM 10694 H HD2  . HIS A 1 83  ? 10.763  1.980   -10.142 1.00 0.00 ? 83  HIS A HD2  6  
ATOM 10695 H HE1  . HIS A 1 83  ? 6.617   1.128   -9.846  1.00 0.00 ? 83  HIS A HE1  6  
ATOM 10696 H HE2  . HIS A 1 83  ? 8.480   1.903   -11.355 1.00 0.00 ? 83  HIS A HE2  6  
ATOM 10697 N N    . ASP A 1 84  ? 10.255  -2.065  -6.850  1.00 0.00 ? 84  ASP A N    6  
ATOM 10698 C CA   . ASP A 1 84  ? 9.898   -3.411  -7.281  1.00 0.00 ? 84  ASP A CA   6  
ATOM 10699 C C    . ASP A 1 84  ? 9.086   -4.130  -6.208  1.00 0.00 ? 84  ASP A C    6  
ATOM 10700 O O    . ASP A 1 84  ? 8.233   -4.963  -6.515  1.00 0.00 ? 84  ASP A O    6  
ATOM 10701 C CB   . ASP A 1 84  ? 11.157  -4.216  -7.608  1.00 0.00 ? 84  ASP A CB   6  
ATOM 10702 C CG   . ASP A 1 84  ? 12.137  -4.251  -6.451  1.00 0.00 ? 84  ASP A CG   6  
ATOM 10703 O OD1  . ASP A 1 84  ? 13.001  -3.351  -6.378  1.00 0.00 ? 84  ASP A OD1  6  
ATOM 10704 O OD2  . ASP A 1 84  ? 12.042  -5.178  -5.620  1.00 0.00 ? 84  ASP A OD2  6  
ATOM 10705 H H    . ASP A 1 84  ? 11.201  -1.838  -6.727  1.00 0.00 ? 84  ASP A H    6  
ATOM 10706 H HA   . ASP A 1 84  ? 9.296   -3.325  -8.173  1.00 0.00 ? 84  ASP A HA   6  
ATOM 10707 H HB2  . ASP A 1 84  ? 10.877  -5.231  -7.848  1.00 0.00 ? 84  ASP A HB2  6  
ATOM 10708 H HB3  . ASP A 1 84  ? 11.649  -3.772  -8.461  1.00 0.00 ? 84  ASP A HB3  6  
ATOM 10709 N N    . GLU A 1 85  ? 9.356   -3.804  -4.949  1.00 0.00 ? 85  GLU A N    6  
ATOM 10710 C CA   . GLU A 1 85  ? 8.651   -4.420  -3.831  1.00 0.00 ? 85  GLU A CA   6  
ATOM 10711 C C    . GLU A 1 85  ? 7.237   -3.861  -3.706  1.00 0.00 ? 85  GLU A C    6  
ATOM 10712 O O    . GLU A 1 85  ? 6.320   -4.558  -3.271  1.00 0.00 ? 85  GLU A O    6  
ATOM 10713 C CB   . GLU A 1 85  ? 9.419   -4.193  -2.528  1.00 0.00 ? 85  GLU A CB   6  
ATOM 10714 C CG   . GLU A 1 85  ? 9.017   -5.145  -1.413  1.00 0.00 ? 85  GLU A CG   6  
ATOM 10715 C CD   . GLU A 1 85  ? 9.964   -5.087  -0.229  1.00 0.00 ? 85  GLU A CD   6  
ATOM 10716 O OE1  . GLU A 1 85  ? 11.186  -5.240  -0.438  1.00 0.00 ? 85  GLU A OE1  6  
ATOM 10717 O OE2  . GLU A 1 85  ? 9.483   -4.891  0.906   1.00 0.00 ? 85  GLU A OE2  6  
ATOM 10718 H H    . GLU A 1 85  ? 10.048  -3.133  -4.767  1.00 0.00 ? 85  GLU A H    6  
ATOM 10719 H HA   . GLU A 1 85  ? 8.590   -5.480  -4.023  1.00 0.00 ? 85  GLU A HA   6  
ATOM 10720 H HB2  . GLU A 1 85  ? 10.475  -4.320  -2.719  1.00 0.00 ? 85  GLU A HB2  6  
ATOM 10721 H HB3  . GLU A 1 85  ? 9.243   -3.182  -2.191  1.00 0.00 ? 85  GLU A HB3  6  
ATOM 10722 H HG2  . GLU A 1 85  ? 8.027   -4.885  -1.074  1.00 0.00 ? 85  GLU A HG2  6  
ATOM 10723 H HG3  . GLU A 1 85  ? 9.011   -6.152  -1.802  1.00 0.00 ? 85  GLU A HG3  6  
ATOM 10724 N N    . ALA A 1 86  ? 7.068   -2.599  -4.088  1.00 0.00 ? 86  ALA A N    6  
ATOM 10725 C CA   . ALA A 1 86  ? 5.766   -1.948  -4.017  1.00 0.00 ? 86  ALA A CA   6  
ATOM 10726 C C    . ALA A 1 86  ? 4.832   -2.472  -5.103  1.00 0.00 ? 86  ALA A C    6  
ATOM 10727 O O    . ALA A 1 86  ? 3.623   -2.577  -4.898  1.00 0.00 ? 86  ALA A O    6  
ATOM 10728 C CB   . ALA A 1 86  ? 5.923   -0.440  -4.136  1.00 0.00 ? 86  ALA A CB   6  
ATOM 10729 H H    . ALA A 1 86  ? 7.837   -2.094  -4.425  1.00 0.00 ? 86  ALA A H    6  
ATOM 10730 H HA   . ALA A 1 86  ? 5.335   -2.166  -3.051  1.00 0.00 ? 86  ALA A HA   6  
ATOM 10731 H HB1  . ALA A 1 86  ? 4.950   0.029   -4.088  1.00 0.00 ? 86  ALA A HB1  6  
ATOM 10732 H HB2  . ALA A 1 86  ? 6.392   -0.200  -5.079  1.00 0.00 ? 86  ALA A HB2  6  
ATOM 10733 H HB3  . ALA A 1 86  ? 6.537   -0.077  -3.326  1.00 0.00 ? 86  ALA A HB3  6  
ATOM 10734 N N    . VAL A 1 87  ? 5.400   -2.797  -6.259  1.00 0.00 ? 87  VAL A N    6  
ATOM 10735 C CA   . VAL A 1 87  ? 4.619   -3.310  -7.377  1.00 0.00 ? 87  VAL A CA   6  
ATOM 10736 C C    . VAL A 1 87  ? 4.302   -4.790  -7.192  1.00 0.00 ? 87  VAL A C    6  
ATOM 10737 O O    . VAL A 1 87  ? 3.261   -5.273  -7.638  1.00 0.00 ? 87  VAL A O    6  
ATOM 10738 C CB   . VAL A 1 87  ? 5.360   -3.119  -8.715  1.00 0.00 ? 87  VAL A CB   6  
ATOM 10739 C CG1  . VAL A 1 87  ? 4.463   -3.500  -9.883  1.00 0.00 ? 87  VAL A CG1  6  
ATOM 10740 C CG2  . VAL A 1 87  ? 5.848   -1.685  -8.855  1.00 0.00 ? 87  VAL A CG2  6  
ATOM 10741 H H    . VAL A 1 87  ? 6.369   -2.691  -6.362  1.00 0.00 ? 87  VAL A H    6  
ATOM 10742 H HA   . VAL A 1 87  ? 3.693   -2.756  -7.420  1.00 0.00 ? 87  VAL A HA   6  
ATOM 10743 H HB   . VAL A 1 87  ? 6.221   -3.772  -8.723  1.00 0.00 ? 87  VAL A HB   6  
ATOM 10744 H HG11 . VAL A 1 87  ? 4.649   -4.529  -10.158 1.00 0.00 ? 87  VAL A HG11 6  
ATOM 10745 H HG12 . VAL A 1 87  ? 4.676   -2.858  -10.725 1.00 0.00 ? 87  VAL A HG12 6  
ATOM 10746 H HG13 . VAL A 1 87  ? 3.429   -3.386  -9.595  1.00 0.00 ? 87  VAL A HG13 6  
ATOM 10747 H HG21 . VAL A 1 87  ? 6.655   -1.648  -9.571  1.00 0.00 ? 87  VAL A HG21 6  
ATOM 10748 H HG22 . VAL A 1 87  ? 6.200   -1.329  -7.898  1.00 0.00 ? 87  VAL A HG22 6  
ATOM 10749 H HG23 . VAL A 1 87  ? 5.036   -1.060  -9.196  1.00 0.00 ? 87  VAL A HG23 6  
ATOM 10750 N N    . ARG A 1 88  ? 5.206   -5.506  -6.530  1.00 0.00 ? 88  ARG A N    6  
ATOM 10751 C CA   . ARG A 1 88  ? 5.021   -6.931  -6.285  1.00 0.00 ? 88  ARG A CA   6  
ATOM 10752 C C    . ARG A 1 88  ? 4.145   -7.163  -5.058  1.00 0.00 ? 88  ARG A C    6  
ATOM 10753 O O    . ARG A 1 88  ? 3.409   -8.148  -4.985  1.00 0.00 ? 88  ARG A O    6  
ATOM 10754 C CB   . ARG A 1 88  ? 6.378   -7.618  -6.100  1.00 0.00 ? 88  ARG A CB   6  
ATOM 10755 C CG   . ARG A 1 88  ? 6.764   -8.521  -7.261  1.00 0.00 ? 88  ARG A CG   6  
ATOM 10756 C CD   . ARG A 1 88  ? 8.152   -8.192  -7.789  1.00 0.00 ? 88  ARG A CD   6  
ATOM 10757 N NE   . ARG A 1 88  ? 9.165   -9.110  -7.272  1.00 0.00 ? 88  ARG A NE   6  
ATOM 10758 C CZ   . ARG A 1 88  ? 9.333   -10.354 -7.714  1.00 0.00 ? 88  ARG A CZ   6  
ATOM 10759 N NH1  . ARG A 1 88  ? 8.559   -10.833 -8.680  1.00 0.00 ? 88  ARG A NH1  6  
ATOM 10760 N NH2  . ARG A 1 88  ? 10.279  -11.121 -7.189  1.00 0.00 ? 88  ARG A NH2  6  
ATOM 10761 H H    . ARG A 1 88  ? 6.015   -5.065  -6.198  1.00 0.00 ? 88  ARG A H    6  
ATOM 10762 H HA   . ARG A 1 88  ? 4.529   -7.354  -7.148  1.00 0.00 ? 88  ARG A HA   6  
ATOM 10763 H HB2  . ARG A 1 88  ? 7.139   -6.859  -5.991  1.00 0.00 ? 88  ARG A HB2  6  
ATOM 10764 H HB3  . ARG A 1 88  ? 6.348   -8.216  -5.201  1.00 0.00 ? 88  ARG A HB3  6  
ATOM 10765 H HG2  . ARG A 1 88  ? 6.753   -9.549  -6.923  1.00 0.00 ? 88  ARG A HG2  6  
ATOM 10766 H HG3  . ARG A 1 88  ? 6.045   -8.392  -8.058  1.00 0.00 ? 88  ARG A HG3  6  
ATOM 10767 H HD2  . ARG A 1 88  ? 8.137   -8.257  -8.867  1.00 0.00 ? 88  ARG A HD2  6  
ATOM 10768 H HD3  . ARG A 1 88  ? 8.406   -7.185  -7.493  1.00 0.00 ? 88  ARG A HD3  6  
ATOM 10769 H HE   . ARG A 1 88  ? 9.752   -8.781  -6.559  1.00 0.00 ? 88  ARG A HE   6  
ATOM 10770 H HH11 . ARG A 1 88  ? 7.845   -10.260 -9.081  1.00 0.00 ? 88  ARG A HH11 6  
ATOM 10771 H HH12 . ARG A 1 88  ? 8.690   -11.769 -9.007  1.00 0.00 ? 88  ARG A HH12 6  
ATOM 10772 H HH21 . ARG A 1 88  ? 10.864  -10.765 -6.462  1.00 0.00 ? 88  ARG A HH21 6  
ATOM 10773 H HH22 . ARG A 1 88  ? 10.405  -12.056 -7.521  1.00 0.00 ? 88  ARG A HH22 6  
ATOM 10774 N N    . LEU A 1 89  ? 4.230   -6.252  -4.094  1.00 0.00 ? 89  LEU A N    6  
ATOM 10775 C CA   . LEU A 1 89  ? 3.445   -6.359  -2.870  1.00 0.00 ? 89  LEU A CA   6  
ATOM 10776 C C    . LEU A 1 89  ? 2.000   -5.933  -3.111  1.00 0.00 ? 89  LEU A C    6  
ATOM 10777 O O    . LEU A 1 89  ? 1.073   -6.487  -2.519  1.00 0.00 ? 89  LEU A O    6  
ATOM 10778 C CB   . LEU A 1 89  ? 4.064   -5.500  -1.764  1.00 0.00 ? 89  LEU A CB   6  
ATOM 10779 C CG   . LEU A 1 89  ? 3.503   -5.748  -0.363  1.00 0.00 ? 89  LEU A CG   6  
ATOM 10780 C CD1  . LEU A 1 89  ? 3.924   -7.118  0.145   1.00 0.00 ? 89  LEU A CD1  6  
ATOM 10781 C CD2  . LEU A 1 89  ? 3.962   -4.659  0.594   1.00 0.00 ? 89  LEU A CD2  6  
ATOM 10782 H H    . LEU A 1 89  ? 4.834   -5.489  -4.210  1.00 0.00 ? 89  LEU A H    6  
ATOM 10783 H HA   . LEU A 1 89  ? 3.456   -7.392  -2.559  1.00 0.00 ? 89  LEU A HA   6  
ATOM 10784 H HB2  . LEU A 1 89  ? 5.127   -5.690  -1.744  1.00 0.00 ? 89  LEU A HB2  6  
ATOM 10785 H HB3  . LEU A 1 89  ? 3.906   -4.461  -2.013  1.00 0.00 ? 89  LEU A HB3  6  
ATOM 10786 H HG   . LEU A 1 89  ? 2.423   -5.725  -0.405  1.00 0.00 ? 89  LEU A HG   6  
ATOM 10787 H HD11 . LEU A 1 89  ? 3.304   -7.396  0.984   1.00 0.00 ? 89  LEU A HD11 6  
ATOM 10788 H HD12 . LEU A 1 89  ? 4.958   -7.085  0.456   1.00 0.00 ? 89  LEU A HD12 6  
ATOM 10789 H HD13 . LEU A 1 89  ? 3.808   -7.846  -0.645  1.00 0.00 ? 89  LEU A HD13 6  
ATOM 10790 H HD21 . LEU A 1 89  ? 5.024   -4.757  0.768   1.00 0.00 ? 89  LEU A HD21 6  
ATOM 10791 H HD22 . LEU A 1 89  ? 3.433   -4.756  1.530   1.00 0.00 ? 89  LEU A HD22 6  
ATOM 10792 H HD23 . LEU A 1 89  ? 3.756   -3.690  0.163   1.00 0.00 ? 89  LEU A HD23 6  
ATOM 10793 N N    . LEU A 1 90  ? 1.815   -4.948  -3.982  1.00 0.00 ? 90  LEU A N    6  
ATOM 10794 C CA   . LEU A 1 90  ? 0.482   -4.450  -4.300  1.00 0.00 ? 90  LEU A CA   6  
ATOM 10795 C C    . LEU A 1 90  ? -0.232  -5.388  -5.269  1.00 0.00 ? 90  LEU A C    6  
ATOM 10796 O O    . LEU A 1 90  ? -1.455  -5.525  -5.230  1.00 0.00 ? 90  LEU A O    6  
ATOM 10797 C CB   . LEU A 1 90  ? 0.567   -3.046  -4.901  1.00 0.00 ? 90  LEU A CB   6  
ATOM 10798 C CG   . LEU A 1 90  ? 0.927   -1.938  -3.909  1.00 0.00 ? 90  LEU A CG   6  
ATOM 10799 C CD1  . LEU A 1 90  ? 1.339   -0.674  -4.647  1.00 0.00 ? 90  LEU A CD1  6  
ATOM 10800 C CD2  . LEU A 1 90  ? -0.243  -1.657  -2.978  1.00 0.00 ? 90  LEU A CD2  6  
ATOM 10801 H H    . LEU A 1 90  ? 2.593   -4.545  -4.423  1.00 0.00 ? 90  LEU A H    6  
ATOM 10802 H HA   . LEU A 1 90  ? -0.083  -4.405  -3.381  1.00 0.00 ? 90  LEU A HA   6  
ATOM 10803 H HB2  . LEU A 1 90  ? 1.313   -3.057  -5.683  1.00 0.00 ? 90  LEU A HB2  6  
ATOM 10804 H HB3  . LEU A 1 90  ? -0.388  -2.806  -5.342  1.00 0.00 ? 90  LEU A HB3  6  
ATOM 10805 H HG   . LEU A 1 90  ? 1.765   -2.261  -3.308  1.00 0.00 ? 90  LEU A HG   6  
ATOM 10806 H HD11 . LEU A 1 90  ? 0.461   -0.191  -5.049  1.00 0.00 ? 90  LEU A HD11 6  
ATOM 10807 H HD12 . LEU A 1 90  ? 2.010   -0.930  -5.453  1.00 0.00 ? 90  LEU A HD12 6  
ATOM 10808 H HD13 . LEU A 1 90  ? 1.836   -0.004  -3.962  1.00 0.00 ? 90  LEU A HD13 6  
ATOM 10809 H HD21 . LEU A 1 90  ? -0.255  -0.609  -2.721  1.00 0.00 ? 90  LEU A HD21 6  
ATOM 10810 H HD22 . LEU A 1 90  ? -0.137  -2.247  -2.078  1.00 0.00 ? 90  LEU A HD22 6  
ATOM 10811 H HD23 . LEU A 1 90  ? -1.167  -1.919  -3.472  1.00 0.00 ? 90  LEU A HD23 6  
ATOM 10812 N N    . LYS A 1 91  ? 0.540   -6.032  -6.138  1.00 0.00 ? 91  LYS A N    6  
ATOM 10813 C CA   . LYS A 1 91  ? -0.017  -6.958  -7.116  1.00 0.00 ? 91  LYS A CA   6  
ATOM 10814 C C    . LYS A 1 91  ? 0.244   -8.404  -6.705  1.00 0.00 ? 91  LYS A C    6  
ATOM 10815 O O    . LYS A 1 91  ? 0.886   -9.163  -7.431  1.00 0.00 ? 91  LYS A O    6  
ATOM 10816 C CB   . LYS A 1 91  ? 0.579   -6.691  -8.500  1.00 0.00 ? 91  LYS A CB   6  
ATOM 10817 C CG   . LYS A 1 91  ? 0.657   -5.214  -8.854  1.00 0.00 ? 91  LYS A CG   6  
ATOM 10818 C CD   . LYS A 1 91  ? -0.724  -4.623  -9.080  1.00 0.00 ? 91  LYS A CD   6  
ATOM 10819 C CE   . LYS A 1 91  ? -0.698  -3.539  -10.144 1.00 0.00 ? 91  LYS A CE   6  
ATOM 10820 N NZ   . LYS A 1 91  ? -1.074  -4.066  -11.485 1.00 0.00 ? 91  LYS A NZ   6  
ATOM 10821 H H    . LYS A 1 91  ? 1.508   -5.882  -6.120  1.00 0.00 ? 91  LYS A H    6  
ATOM 10822 H HA   . LYS A 1 91  ? -1.084  -6.795  -7.156  1.00 0.00 ? 91  LYS A HA   6  
ATOM 10823 H HB2  . LYS A 1 91  ? 1.578   -7.100  -8.534  1.00 0.00 ? 91  LYS A HB2  6  
ATOM 10824 H HB3  . LYS A 1 91  ? -0.028  -7.185  -9.243  1.00 0.00 ? 91  LYS A HB3  6  
ATOM 10825 H HG2  . LYS A 1 91  ? 1.136   -4.685  -8.044  1.00 0.00 ? 91  LYS A HG2  6  
ATOM 10826 H HG3  . LYS A 1 91  ? 1.240   -5.102  -9.756  1.00 0.00 ? 91  LYS A HG3  6  
ATOM 10827 H HD2  . LYS A 1 91  ? -1.395  -5.408  -9.397  1.00 0.00 ? 91  LYS A HD2  6  
ATOM 10828 H HD3  . LYS A 1 91  ? -1.079  -4.197  -8.152  1.00 0.00 ? 91  LYS A HD3  6  
ATOM 10829 H HE2  . LYS A 1 91  ? -1.394  -2.761  -9.865  1.00 0.00 ? 91  LYS A HE2  6  
ATOM 10830 H HE3  . LYS A 1 91  ? 0.300   -3.126  -10.194 1.00 0.00 ? 91  LYS A HE3  6  
ATOM 10831 H HZ1  . LYS A 1 91  ? -0.917  -3.338  -12.212 1.00 0.00 ? 91  LYS A HZ1  6  
ATOM 10832 H HZ2  . LYS A 1 91  ? -2.077  -4.338  -11.493 1.00 0.00 ? 91  LYS A HZ2  6  
ATOM 10833 H HZ3  . LYS A 1 91  ? -0.497  -4.901  -11.714 1.00 0.00 ? 91  LYS A HZ3  6  
ATOM 10834 N N    . SER A 1 92  ? -0.260  -8.781  -5.533  1.00 0.00 ? 92  SER A N    6  
ATOM 10835 C CA   . SER A 1 92  ? -0.080  -10.135 -5.025  1.00 0.00 ? 92  SER A CA   6  
ATOM 10836 C C    . SER A 1 92  ? -1.203  -10.511 -4.062  1.00 0.00 ? 92  SER A C    6  
ATOM 10837 O O    . SER A 1 92  ? -1.950  -11.459 -4.304  1.00 0.00 ? 92  SER A O    6  
ATOM 10838 C CB   . SER A 1 92  ? 1.273   -10.264 -4.322  1.00 0.00 ? 92  SER A CB   6  
ATOM 10839 O OG   . SER A 1 92  ? 1.510   -11.599 -3.910  1.00 0.00 ? 92  SER A OG   6  
ATOM 10840 H H    . SER A 1 92  ? -0.762  -8.132  -4.998  1.00 0.00 ? 92  SER A H    6  
ATOM 10841 H HA   . SER A 1 92  ? -0.103  -10.811 -5.867  1.00 0.00 ? 92  SER A HA   6  
ATOM 10842 H HB2  . SER A 1 92  ? 2.058   -9.965  -5.000  1.00 0.00 ? 92  SER A HB2  6  
ATOM 10843 H HB3  . SER A 1 92  ? 1.286   -9.623  -3.452  1.00 0.00 ? 92  SER A HB3  6  
ATOM 10844 H HG   . SER A 1 92  ? 0.791   -11.892 -3.346  1.00 0.00 ? 92  SER A HG   6  
ATOM 10845 N N    . SER A 1 93  ? -1.314  -9.761  -2.971  1.00 0.00 ? 93  SER A N    6  
ATOM 10846 C CA   . SER A 1 93  ? -2.346  -10.016 -1.970  1.00 0.00 ? 93  SER A CA   6  
ATOM 10847 C C    . SER A 1 93  ? -3.734  -9.728  -2.533  1.00 0.00 ? 93  SER A C    6  
ATOM 10848 O O    . SER A 1 93  ? -3.885  -8.942  -3.468  1.00 0.00 ? 93  SER A O    6  
ATOM 10849 C CB   . SER A 1 93  ? -2.100  -9.163  -0.725  1.00 0.00 ? 93  SER A CB   6  
ATOM 10850 O OG   . SER A 1 93  ? -1.277  -9.844  0.205   1.00 0.00 ? 93  SER A OG   6  
ATOM 10851 H H    . SER A 1 93  ? -0.689  -9.020  -2.833  1.00 0.00 ? 93  SER A H    6  
ATOM 10852 H HA   . SER A 1 93  ? -2.291  -11.060 -1.698  1.00 0.00 ? 93  SER A HA   6  
ATOM 10853 H HB2  . SER A 1 93  ? -1.609  -8.242  -1.013  1.00 0.00 ? 93  SER A HB2  6  
ATOM 10854 H HB3  . SER A 1 93  ? -3.047  -8.937  -0.253  1.00 0.00 ? 93  SER A HB3  6  
ATOM 10855 H HG   . SER A 1 93  ? -0.798  -9.205  0.738   1.00 0.00 ? 93  SER A HG   6  
ATOM 10856 N N    . ARG A 1 94  ? -4.745  -10.370 -1.956  1.00 0.00 ? 94  ARG A N    6  
ATOM 10857 C CA   . ARG A 1 94  ? -6.123  -10.183 -2.400  1.00 0.00 ? 94  ARG A CA   6  
ATOM 10858 C C    . ARG A 1 94  ? -6.759  -8.981  -1.710  1.00 0.00 ? 94  ARG A C    6  
ATOM 10859 O O    . ARG A 1 94  ? -7.606  -8.299  -2.288  1.00 0.00 ? 94  ARG A O    6  
ATOM 10860 C CB   . ARG A 1 94  ? -6.946  -11.441 -2.118  1.00 0.00 ? 94  ARG A CB   6  
ATOM 10861 C CG   . ARG A 1 94  ? -6.803  -11.954 -0.693  1.00 0.00 ? 94  ARG A CG   6  
ATOM 10862 C CD   . ARG A 1 94  ? -5.869  -13.153 -0.618  1.00 0.00 ? 94  ARG A CD   6  
ATOM 10863 N NE   . ARG A 1 94  ? -6.540  -14.338 -0.089  1.00 0.00 ? 94  ARG A NE   6  
ATOM 10864 C CZ   . ARG A 1 94  ? -5.923  -15.490 0.161   1.00 0.00 ? 94  ARG A CZ   6  
ATOM 10865 N NH1  . ARG A 1 94  ? -4.621  -15.617 -0.067  1.00 0.00 ? 94  ARG A NH1  6  
ATOM 10866 N NH2  . ARG A 1 94  ? -6.608  -16.518 0.641   1.00 0.00 ? 94  ARG A NH2  6  
ATOM 10867 H H    . ARG A 1 94  ? -4.561  -10.983 -1.215  1.00 0.00 ? 94  ARG A H    6  
ATOM 10868 H HA   . ARG A 1 94  ? -6.106  -10.006 -3.465  1.00 0.00 ? 94  ARG A HA   6  
ATOM 10869 H HB2  . ARG A 1 94  ? -7.990  -11.221 -2.295  1.00 0.00 ? 94  ARG A HB2  6  
ATOM 10870 H HB3  . ARG A 1 94  ? -6.628  -12.224 -2.794  1.00 0.00 ? 94  ARG A HB3  6  
ATOM 10871 H HG2  . ARG A 1 94  ? -6.406  -11.164 -0.075  1.00 0.00 ? 94  ARG A HG2  6  
ATOM 10872 H HG3  . ARG A 1 94  ? -7.777  -12.244 -0.327  1.00 0.00 ? 94  ARG A HG3  6  
ATOM 10873 H HD2  . ARG A 1 94  ? -5.502  -13.371 -1.610  1.00 0.00 ? 94  ARG A HD2  6  
ATOM 10874 H HD3  . ARG A 1 94  ? -5.038  -12.904 0.025   1.00 0.00 ? 94  ARG A HD3  6  
ATOM 10875 H HE   . ARG A 1 94  ? -7.503  -14.272 0.088   1.00 0.00 ? 94  ARG A HE   6  
ATOM 10876 H HH11 . ARG A 1 94  ? -4.099  -14.846 -0.428  1.00 0.00 ? 94  ARG A HH11 6  
ATOM 10877 H HH12 . ARG A 1 94  ? -4.163  -16.486 0.123   1.00 0.00 ? 94  ARG A HH12 6  
ATOM 10878 H HH21 . ARG A 1 94  ? -7.589  -16.428 0.816   1.00 0.00 ? 94  ARG A HH21 6  
ATOM 10879 H HH22 . ARG A 1 94  ? -6.145  -17.384 0.830   1.00 0.00 ? 94  ARG A HH22 6  
ATOM 10880 N N    . HIS A 1 95  ? -6.346  -8.726  -0.474  1.00 0.00 ? 95  HIS A N    6  
ATOM 10881 C CA   . HIS A 1 95  ? -6.877  -7.605  0.294   1.00 0.00 ? 95  HIS A CA   6  
ATOM 10882 C C    . HIS A 1 95  ? -5.872  -6.459  0.350   1.00 0.00 ? 95  HIS A C    6  
ATOM 10883 O O    . HIS A 1 95  ? -4.928  -6.486  1.142   1.00 0.00 ? 95  HIS A O    6  
ATOM 10884 C CB   . HIS A 1 95  ? -7.238  -8.055  1.712   1.00 0.00 ? 95  HIS A CB   6  
ATOM 10885 C CG   . HIS A 1 95  ? -8.505  -7.449  2.229   1.00 0.00 ? 95  HIS A CG   6  
ATOM 10886 N ND1  . HIS A 1 95  ? -9.324  -8.079  3.141   1.00 0.00 ? 95  HIS A ND1  6  
ATOM 10887 C CD2  . HIS A 1 95  ? -9.094  -6.260  1.957   1.00 0.00 ? 95  HIS A CD2  6  
ATOM 10888 C CE1  . HIS A 1 95  ? -10.362 -7.305  3.407   1.00 0.00 ? 95  HIS A CE1  6  
ATOM 10889 N NE2  . HIS A 1 95  ? -10.246 -6.196  2.702   1.00 0.00 ? 95  HIS A NE2  6  
ATOM 10890 H H    . HIS A 1 95  ? -5.668  -9.305  -0.067  1.00 0.00 ? 95  HIS A H    6  
ATOM 10891 H HA   . HIS A 1 95  ? -7.771  -7.259  -0.202  1.00 0.00 ? 95  HIS A HA   6  
ATOM 10892 H HB2  . HIS A 1 95  ? -7.355  -9.128  1.722   1.00 0.00 ? 95  HIS A HB2  6  
ATOM 10893 H HB3  . HIS A 1 95  ? -6.438  -7.779  2.384   1.00 0.00 ? 95  HIS A HB3  6  
ATOM 10894 H HD1  . HIS A 1 95  ? -9.168  -8.963  3.535   1.00 0.00 ? 95  HIS A HD1  6  
ATOM 10895 H HD2  . HIS A 1 95  ? -8.726  -5.502  1.279   1.00 0.00 ? 95  HIS A HD2  6  
ATOM 10896 H HE1  . HIS A 1 95  ? -11.167 -7.540  4.088   1.00 0.00 ? 95  HIS A HE1  6  
ATOM 10897 H HE2  . HIS A 1 95  ? -10.923 -5.489  2.645   1.00 0.00 ? 95  HIS A HE2  6  
ATOM 10898 N N    . LEU A 1 96  ? -6.078  -5.456  -0.495  1.00 0.00 ? 96  LEU A N    6  
ATOM 10899 C CA   . LEU A 1 96  ? -5.189  -4.300  -0.543  1.00 0.00 ? 96  LEU A CA   6  
ATOM 10900 C C    . LEU A 1 96  ? -5.871  -3.065  0.038   1.00 0.00 ? 96  LEU A C    6  
ATOM 10901 O O    . LEU A 1 96  ? -6.797  -2.515  -0.559  1.00 0.00 ? 96  LEU A O    6  
ATOM 10902 C CB   . LEU A 1 96  ? -4.751  -4.025  -1.982  1.00 0.00 ? 96  LEU A CB   6  
ATOM 10903 C CG   . LEU A 1 96  ? -4.308  -5.259  -2.770  1.00 0.00 ? 96  LEU A CG   6  
ATOM 10904 C CD1  . LEU A 1 96  ? -3.995  -4.887  -4.211  1.00 0.00 ? 96  LEU A CD1  6  
ATOM 10905 C CD2  . LEU A 1 96  ? -3.099  -5.906  -2.110  1.00 0.00 ? 96  LEU A CD2  6  
ATOM 10906 H H    . LEU A 1 96  ? -6.847  -5.492  -1.102  1.00 0.00 ? 96  LEU A H    6  
ATOM 10907 H HA   . LEU A 1 96  ? -4.318  -4.528  0.052   1.00 0.00 ? 96  LEU A HA   6  
ATOM 10908 H HB2  . LEU A 1 96  ? -5.579  -3.566  -2.507  1.00 0.00 ? 96  LEU A HB2  6  
ATOM 10909 H HB3  . LEU A 1 96  ? -3.925  -3.326  -1.957  1.00 0.00 ? 96  LEU A HB3  6  
ATOM 10910 H HG   . LEU A 1 96  ? -5.112  -5.981  -2.779  1.00 0.00 ? 96  LEU A HG   6  
ATOM 10911 H HD11 . LEU A 1 96  ? -3.074  -4.326  -4.246  1.00 0.00 ? 96  LEU A HD11 6  
ATOM 10912 H HD12 . LEU A 1 96  ? -4.799  -4.286  -4.610  1.00 0.00 ? 96  LEU A HD12 6  
ATOM 10913 H HD13 . LEU A 1 96  ? -3.892  -5.786  -4.800  1.00 0.00 ? 96  LEU A HD13 6  
ATOM 10914 H HD21 . LEU A 1 96  ? -3.173  -6.979  -2.199  1.00 0.00 ? 96  LEU A HD21 6  
ATOM 10915 H HD22 . LEU A 1 96  ? -3.069  -5.632  -1.067  1.00 0.00 ? 96  LEU A HD22 6  
ATOM 10916 H HD23 . LEU A 1 96  ? -2.197  -5.566  -2.599  1.00 0.00 ? 96  LEU A HD23 6  
ATOM 10917 N N    . ILE A 1 97  ? -5.405  -2.633  1.205   1.00 0.00 ? 97  ILE A N    6  
ATOM 10918 C CA   . ILE A 1 97  ? -5.968  -1.462  1.867   1.00 0.00 ? 97  ILE A CA   6  
ATOM 10919 C C    . ILE A 1 97  ? -5.010  -0.277  1.792   1.00 0.00 ? 97  ILE A C    6  
ATOM 10920 O O    . ILE A 1 97  ? -4.394  0.103   2.788   1.00 0.00 ? 97  ILE A O    6  
ATOM 10921 C CB   . ILE A 1 97  ? -6.295  -1.754  3.344   1.00 0.00 ? 97  ILE A CB   6  
ATOM 10922 C CG1  . ILE A 1 97  ? -7.095  -3.052  3.466   1.00 0.00 ? 97  ILE A CG1  6  
ATOM 10923 C CG2  . ILE A 1 97  ? -7.063  -0.592  3.957   1.00 0.00 ? 97  ILE A CG2  6  
ATOM 10924 C CD1  . ILE A 1 97  ? -7.168  -3.588  4.878   1.00 0.00 ? 97  ILE A CD1  6  
ATOM 10925 H H    . ILE A 1 97  ? -4.664  -3.113  1.632   1.00 0.00 ? 97  ILE A H    6  
ATOM 10926 H HA   . ILE A 1 97  ? -6.886  -1.202  1.360   1.00 0.00 ? 97  ILE A HA   6  
ATOM 10927 H HB   . ILE A 1 97  ? -5.365  -1.862  3.882   1.00 0.00 ? 97  ILE A HB   6  
ATOM 10928 H HG12 . ILE A 1 97  ? -8.105  -2.878  3.126   1.00 0.00 ? 97  ILE A HG12 6  
ATOM 10929 H HG13 . ILE A 1 97  ? -6.637  -3.808  2.846   1.00 0.00 ? 97  ILE A HG13 6  
ATOM 10930 H HG21 . ILE A 1 97  ? -8.122  -0.750  3.823   1.00 0.00 ? 97  ILE A HG21 6  
ATOM 10931 H HG22 . ILE A 1 97  ? -6.771  0.327   3.472   1.00 0.00 ? 97  ILE A HG22 6  
ATOM 10932 H HG23 . ILE A 1 97  ? -6.839  -0.529  5.011   1.00 0.00 ? 97  ILE A HG23 6  
ATOM 10933 H HD11 . ILE A 1 97  ? -8.079  -3.247  5.346   1.00 0.00 ? 97  ILE A HD11 6  
ATOM 10934 H HD12 . ILE A 1 97  ? -6.318  -3.230  5.443   1.00 0.00 ? 97  ILE A HD12 6  
ATOM 10935 H HD13 . ILE A 1 97  ? -7.156  -4.667  4.855   1.00 0.00 ? 97  ILE A HD13 6  
ATOM 10936 N N    . LEU A 1 98  ? -4.887  0.301   0.602   1.00 0.00 ? 98  LEU A N    6  
ATOM 10937 C CA   . LEU A 1 98  ? -4.003  1.442   0.391   1.00 0.00 ? 98  LEU A CA   6  
ATOM 10938 C C    . LEU A 1 98  ? -4.414  2.620   1.269   1.00 0.00 ? 98  LEU A C    6  
ATOM 10939 O O    . LEU A 1 98  ? -5.597  2.817   1.547   1.00 0.00 ? 98  LEU A O    6  
ATOM 10940 C CB   . LEU A 1 98  ? -4.016  1.859   -1.080  1.00 0.00 ? 98  LEU A CB   6  
ATOM 10941 C CG   . LEU A 1 98  ? -3.093  1.046   -1.991  1.00 0.00 ? 98  LEU A CG   6  
ATOM 10942 C CD1  . LEU A 1 98  ? -3.861  -0.088  -2.653  1.00 0.00 ? 98  LEU A CD1  6  
ATOM 10943 C CD2  . LEU A 1 98  ? -2.455  1.944   -3.041  1.00 0.00 ? 98  LEU A CD2  6  
ATOM 10944 H H    . LEU A 1 98  ? -5.403  -0.049  -0.155  1.00 0.00 ? 98  LEU A H    6  
ATOM 10945 H HA   . LEU A 1 98  ? -3.003  1.139   0.663   1.00 0.00 ? 98  LEU A HA   6  
ATOM 10946 H HB2  . LEU A 1 98  ? -5.027  1.766   -1.449  1.00 0.00 ? 98  LEU A HB2  6  
ATOM 10947 H HB3  . LEU A 1 98  ? -3.723  2.897   -1.140  1.00 0.00 ? 98  LEU A HB3  6  
ATOM 10948 H HG   . LEU A 1 98  ? -2.303  0.611   -1.396  1.00 0.00 ? 98  LEU A HG   6  
ATOM 10949 H HD11 . LEU A 1 98  ? -3.415  -0.312  -3.611  1.00 0.00 ? 98  LEU A HD11 6  
ATOM 10950 H HD12 . LEU A 1 98  ? -4.889  0.209   -2.795  1.00 0.00 ? 98  LEU A HD12 6  
ATOM 10951 H HD13 . LEU A 1 98  ? -3.822  -0.964  -2.024  1.00 0.00 ? 98  LEU A HD13 6  
ATOM 10952 H HD21 . LEU A 1 98  ? -2.305  2.931   -2.628  1.00 0.00 ? 98  LEU A HD21 6  
ATOM 10953 H HD22 . LEU A 1 98  ? -3.104  2.009   -3.902  1.00 0.00 ? 98  LEU A HD22 6  
ATOM 10954 H HD23 . LEU A 1 98  ? -1.503  1.530   -3.339  1.00 0.00 ? 98  LEU A HD23 6  
ATOM 10955 N N    . THR A 1 99  ? -3.429  3.401   1.700   1.00 0.00 ? 99  THR A N    6  
ATOM 10956 C CA   . THR A 1 99  ? -3.687  4.563   2.545   1.00 0.00 ? 99  THR A CA   6  
ATOM 10957 C C    . THR A 1 99  ? -3.127  5.831   1.910   1.00 0.00 ? 99  THR A C    6  
ATOM 10958 O O    . THR A 1 99  ? -1.993  6.226   2.185   1.00 0.00 ? 99  THR A O    6  
ATOM 10959 C CB   . THR A 1 99  ? -3.072  4.358   3.930   1.00 0.00 ? 99  THR A CB   6  
ATOM 10960 O OG1  . THR A 1 99  ? -3.468  3.112   4.475   1.00 0.00 ? 99  THR A OG1  6  
ATOM 10961 C CG2  . THR A 1 99  ? -3.456  5.436   4.920   1.00 0.00 ? 99  THR A CG2  6  
ATOM 10962 H H    . THR A 1 99  ? -2.507  3.193   1.443   1.00 0.00 ? 99  THR A H    6  
ATOM 10963 H HA   . THR A 1 99  ? -4.756  4.667   2.647   1.00 0.00 ? 99  THR A HA   6  
ATOM 10964 H HB   . THR A 1 99  ? -1.995  4.361   3.839   1.00 0.00 ? 99  THR A HB   6  
ATOM 10965 H HG1  . THR A 1 99  ? -3.061  2.400   3.976   1.00 0.00 ? 99  THR A HG1  6  
ATOM 10966 H HG21 . THR A 1 99  ? -2.769  6.265   4.834   1.00 0.00 ? 99  THR A HG21 6  
ATOM 10967 H HG22 . THR A 1 99  ? -3.413  5.035   5.922   1.00 0.00 ? 99  THR A HG22 6  
ATOM 10968 H HG23 . THR A 1 99  ? -4.459  5.777   4.710   1.00 0.00 ? 99  THR A HG23 6  
ATOM 10969 N N    . VAL A 1 100 ? -3.927  6.464   1.059   1.00 0.00 ? 100 VAL A N    6  
ATOM 10970 C CA   . VAL A 1 100 ? -3.510  7.688   0.385   1.00 0.00 ? 100 VAL A CA   6  
ATOM 10971 C C    . VAL A 1 100 ? -4.178  8.912   1.003   1.00 0.00 ? 100 VAL A C    6  
ATOM 10972 O O    . VAL A 1 100 ? -5.230  8.804   1.635   1.00 0.00 ? 100 VAL A O    6  
ATOM 10973 C CB   . VAL A 1 100 ? -3.841  7.642   -1.119  1.00 0.00 ? 100 VAL A CB   6  
ATOM 10974 C CG1  . VAL A 1 100 ? -2.908  6.686   -1.843  1.00 0.00 ? 100 VAL A CG1  6  
ATOM 10975 C CG2  . VAL A 1 100 ? -5.295  7.246   -1.332  1.00 0.00 ? 100 VAL A CG2  6  
ATOM 10976 H H    . VAL A 1 100 ? -4.819  6.100   0.880   1.00 0.00 ? 100 VAL A H    6  
ATOM 10977 H HA   . VAL A 1 100 ? -2.440  7.781   0.494   1.00 0.00 ? 100 VAL A HA   6  
ATOM 10978 H HB   . VAL A 1 100 ? -3.697  8.631   -1.529  1.00 0.00 ? 100 VAL A HB   6  
ATOM 10979 H HG11 . VAL A 1 100 ? -2.546  5.941   -1.149  1.00 0.00 ? 100 VAL A HG11 6  
ATOM 10980 H HG12 . VAL A 1 100 ? -2.072  7.235   -2.248  1.00 0.00 ? 100 VAL A HG12 6  
ATOM 10981 H HG13 . VAL A 1 100 ? -3.443  6.199   -2.646  1.00 0.00 ? 100 VAL A HG13 6  
ATOM 10982 H HG21 . VAL A 1 100 ? -5.642  7.646   -2.274  1.00 0.00 ? 100 VAL A HG21 6  
ATOM 10983 H HG22 . VAL A 1 100 ? -5.898  7.642   -0.529  1.00 0.00 ? 100 VAL A HG22 6  
ATOM 10984 H HG23 . VAL A 1 100 ? -5.376  6.169   -1.347  1.00 0.00 ? 100 VAL A HG23 6  
ATOM 10985 N N    . LYS A 1 101 ? -3.562  10.074  0.817   1.00 0.00 ? 101 LYS A N    6  
ATOM 10986 C CA   . LYS A 1 101 ? -4.098  11.318  1.357   1.00 0.00 ? 101 LYS A CA   6  
ATOM 10987 C C    . LYS A 1 101 ? -4.707  12.173  0.250   1.00 0.00 ? 101 LYS A C    6  
ATOM 10988 O O    . LYS A 1 101 ? -4.354  12.035  -0.921  1.00 0.00 ? 101 LYS A O    6  
ATOM 10989 C CB   . LYS A 1 101 ? -3.000  12.102  2.076   1.00 0.00 ? 101 LYS A CB   6  
ATOM 10990 C CG   . LYS A 1 101 ? -1.864  12.536  1.164   1.00 0.00 ? 101 LYS A CG   6  
ATOM 10991 C CD   . LYS A 1 101 ? -0.676  13.052  1.960   1.00 0.00 ? 101 LYS A CD   6  
ATOM 10992 C CE   . LYS A 1 101 ? 0.170   14.012  1.139   1.00 0.00 ? 101 LYS A CE   6  
ATOM 10993 N NZ   . LYS A 1 101 ? 0.700   15.132  1.967   1.00 0.00 ? 101 LYS A NZ   6  
ATOM 10994 H H    . LYS A 1 101 ? -2.727  10.096  0.304   1.00 0.00 ? 101 LYS A H    6  
ATOM 10995 H HA   . LYS A 1 101 ? -4.872  11.065  2.066   1.00 0.00 ? 101 LYS A HA   6  
ATOM 10996 H HB2  . LYS A 1 101 ? -3.435  12.985  2.519   1.00 0.00 ? 101 LYS A HB2  6  
ATOM 10997 H HB3  . LYS A 1 101 ? -2.586  11.484  2.860   1.00 0.00 ? 101 LYS A HB3  6  
ATOM 10998 H HG2  . LYS A 1 101 ? -1.548  11.692  0.571   1.00 0.00 ? 101 LYS A HG2  6  
ATOM 10999 H HG3  . LYS A 1 101 ? -2.219  13.323  0.514   1.00 0.00 ? 101 LYS A HG3  6  
ATOM 11000 H HD2  . LYS A 1 101 ? -1.038  13.567  2.836   1.00 0.00 ? 101 LYS A HD2  6  
ATOM 11001 H HD3  . LYS A 1 101 ? -0.065  12.213  2.260   1.00 0.00 ? 101 LYS A HD3  6  
ATOM 11002 H HE2  . LYS A 1 101 ? 1.000   13.468  0.714   1.00 0.00 ? 101 LYS A HE2  6  
ATOM 11003 H HE3  . LYS A 1 101 ? -0.438  14.419  0.345   1.00 0.00 ? 101 LYS A HE3  6  
ATOM 11004 H HZ1  . LYS A 1 101 ? 1.421   14.778  2.627   1.00 0.00 ? 101 LYS A HZ1  6  
ATOM 11005 H HZ2  . LYS A 1 101 ? -0.069  15.568  2.513   1.00 0.00 ? 101 LYS A HZ2  6  
ATOM 11006 H HZ3  . LYS A 1 101 ? 1.130   15.855  1.355   1.00 0.00 ? 101 LYS A HZ3  6  
ATOM 11007 N N    . ASP A 1 102 ? -5.625  13.056  0.629   1.00 0.00 ? 102 ASP A N    6  
ATOM 11008 C CA   . ASP A 1 102 ? -6.284  13.934  -0.331  1.00 0.00 ? 102 ASP A CA   6  
ATOM 11009 C C    . ASP A 1 102 ? -5.301  14.947  -0.908  1.00 0.00 ? 102 ASP A C    6  
ATOM 11010 O O    . ASP A 1 102 ? -5.154  16.052  -0.385  1.00 0.00 ? 102 ASP A O    6  
ATOM 11011 C CB   . ASP A 1 102 ? -7.455  14.663  0.331   1.00 0.00 ? 102 ASP A CB   6  
ATOM 11012 C CG   . ASP A 1 102 ? -7.068  15.300  1.651   1.00 0.00 ? 102 ASP A CG   6  
ATOM 11013 O OD1  . ASP A 1 102 ? -5.854  15.422  1.920   1.00 0.00 ? 102 ASP A OD1  6  
ATOM 11014 O OD2  . ASP A 1 102 ? -7.979  15.678  2.418   1.00 0.00 ? 102 ASP A OD2  6  
ATOM 11015 H H    . ASP A 1 102 ? -5.865  13.118  1.577   1.00 0.00 ? 102 ASP A H    6  
ATOM 11016 H HA   . ASP A 1 102 ? -6.663  13.320  -1.135  1.00 0.00 ? 102 ASP A HA   6  
ATOM 11017 H HB2  . ASP A 1 102 ? -7.808  15.441  -0.332  1.00 0.00 ? 102 ASP A HB2  6  
ATOM 11018 H HB3  . ASP A 1 102 ? -8.254  13.955  0.514   1.00 0.00 ? 102 ASP A HB3  6  
ATOM 11019 N N    . VAL A 1 103 ? -4.628  14.563  -1.988  1.00 0.00 ? 103 VAL A N    6  
ATOM 11020 C CA   . VAL A 1 103 ? -3.658  15.439  -2.635  1.00 0.00 ? 103 VAL A CA   6  
ATOM 11021 C C    . VAL A 1 103 ? -4.311  16.261  -3.740  1.00 0.00 ? 103 VAL A C    6  
ATOM 11022 O O    . VAL A 1 103 ? -4.359  17.489  -3.670  1.00 0.00 ? 103 VAL A O    6  
ATOM 11023 C CB   . VAL A 1 103 ? -2.486  14.637  -3.232  1.00 0.00 ? 103 VAL A CB   6  
ATOM 11024 C CG1  . VAL A 1 103 ? -1.395  15.572  -3.727  1.00 0.00 ? 103 VAL A CG1  6  
ATOM 11025 C CG2  . VAL A 1 103 ? -1.935  13.656  -2.208  1.00 0.00 ? 103 VAL A CG2  6  
ATOM 11026 H H    . VAL A 1 103 ? -4.788  13.671  -2.359  1.00 0.00 ? 103 VAL A H    6  
ATOM 11027 H HA   . VAL A 1 103 ? -3.263  16.110  -1.886  1.00 0.00 ? 103 VAL A HA   6  
ATOM 11028 H HB   . VAL A 1 103 ? -2.856  14.073  -4.076  1.00 0.00 ? 103 VAL A HB   6  
ATOM 11029 H HG11 . VAL A 1 103 ? -0.982  15.187  -4.648  1.00 0.00 ? 103 VAL A HG11 6  
ATOM 11030 H HG12 . VAL A 1 103 ? -0.615  15.640  -2.984  1.00 0.00 ? 103 VAL A HG12 6  
ATOM 11031 H HG13 . VAL A 1 103 ? -1.812  16.552  -3.902  1.00 0.00 ? 103 VAL A HG13 6  
ATOM 11032 H HG21 . VAL A 1 103 ? -2.617  12.826  -2.101  1.00 0.00 ? 103 VAL A HG21 6  
ATOM 11033 H HG22 . VAL A 1 103 ? -1.821  14.155  -1.256  1.00 0.00 ? 103 VAL A HG22 6  
ATOM 11034 H HG23 . VAL A 1 103 ? -0.974  13.292  -2.541  1.00 0.00 ? 103 VAL A HG23 6  
ATOM 11035 N N    . GLY A 1 104 ? -4.814  15.575  -4.763  1.00 0.00 ? 104 GLY A N    6  
ATOM 11036 C CA   . GLY A 1 104 ? -5.459  16.260  -5.869  1.00 0.00 ? 104 GLY A CA   6  
ATOM 11037 C C    . GLY A 1 104 ? -6.959  16.044  -5.892  1.00 0.00 ? 104 GLY A C    6  
ATOM 11038 O O    . GLY A 1 104 ? -7.450  15.104  -6.516  1.00 0.00 ? 104 GLY A O    6  
ATOM 11039 H H    . GLY A 1 104 ? -4.749  14.598  -4.765  1.00 0.00 ? 104 GLY A H    6  
ATOM 11040 H HA2  . GLY A 1 104 ? -5.258  17.317  -5.790  1.00 0.00 ? 104 GLY A HA2  6  
ATOM 11041 H HA3  . GLY A 1 104 ? -5.040  15.893  -6.795  1.00 0.00 ? 104 GLY A HA3  6  
ATOM 11042 N N    . ARG A 1 105 ? -7.689  16.920  -5.208  1.00 0.00 ? 105 ARG A N    6  
ATOM 11043 C CA   . ARG A 1 105 ? -9.144  16.823  -5.151  1.00 0.00 ? 105 ARG A CA   6  
ATOM 11044 C C    . ARG A 1 105 ? -9.789  17.708  -6.214  1.00 0.00 ? 105 ARG A C    6  
ATOM 11045 O O    . ARG A 1 105 ? -9.535  18.911  -6.271  1.00 0.00 ? 105 ARG A O    6  
ATOM 11046 C CB   . ARG A 1 105 ? -9.647  17.219  -3.761  1.00 0.00 ? 105 ARG A CB   6  
ATOM 11047 C CG   . ARG A 1 105 ? -10.330 16.084  -3.016  1.00 0.00 ? 105 ARG A CG   6  
ATOM 11048 C CD   . ARG A 1 105 ? -11.839 16.123  -3.199  1.00 0.00 ? 105 ARG A CD   6  
ATOM 11049 N NE   . ARG A 1 105 ? -12.397 17.429  -2.859  1.00 0.00 ? 105 ARG A NE   6  
ATOM 11050 C CZ   . ARG A 1 105 ? -12.514 17.886  -1.614  1.00 0.00 ? 105 ARG A CZ   6  
ATOM 11051 N NH1  . ARG A 1 105 ? -12.108 17.146  -0.588  1.00 0.00 ? 105 ARG A NH1  6  
ATOM 11052 N NH2  . ARG A 1 105 ? -13.034 19.085  -1.393  1.00 0.00 ? 105 ARG A NH2  6  
ATOM 11053 H H    . ARG A 1 105 ? -7.241  17.649  -4.731  1.00 0.00 ? 105 ARG A H    6  
ATOM 11054 H HA   . ARG A 1 105 ? -9.415  15.796  -5.344  1.00 0.00 ? 105 ARG A HA   6  
ATOM 11055 H HB2  . ARG A 1 105 ? -8.809  17.555  -3.170  1.00 0.00 ? 105 ARG A HB2  6  
ATOM 11056 H HB3  . ARG A 1 105 ? -10.354 18.030  -3.861  1.00 0.00 ? 105 ARG A HB3  6  
ATOM 11057 H HG2  . ARG A 1 105 ? -9.957  15.143  -3.392  1.00 0.00 ? 105 ARG A HG2  6  
ATOM 11058 H HG3  . ARG A 1 105 ? -10.102 16.169  -1.963  1.00 0.00 ? 105 ARG A HG3  6  
ATOM 11059 H HD2  . ARG A 1 105 ? -12.069 15.902  -4.231  1.00 0.00 ? 105 ARG A HD2  6  
ATOM 11060 H HD3  . ARG A 1 105 ? -12.285 15.373  -2.563  1.00 0.00 ? 105 ARG A HD3  6  
ATOM 11061 H HE   . ARG A 1 105 ? -12.705 17.997  -3.598  1.00 0.00 ? 105 ARG A HE   6  
ATOM 11062 H HH11 . ARG A 1 105 ? -11.714 16.241  -0.748  1.00 0.00 ? 105 ARG A HH11 6  
ATOM 11063 H HH12 . ARG A 1 105 ? -12.198 17.493  0.345   1.00 0.00 ? 105 ARG A HH12 6  
ATOM 11064 H HH21 . ARG A 1 105 ? -13.341 19.646  -2.161  1.00 0.00 ? 105 ARG A HH21 6  
ATOM 11065 H HH22 . ARG A 1 105 ? -13.121 19.427  -0.457  1.00 0.00 ? 105 ARG A HH22 6  
ATOM 11066 N N    . LEU A 1 106 ? -10.623 17.105  -7.055  1.00 0.00 ? 106 LEU A N    6  
ATOM 11067 C CA   . LEU A 1 106 ? -11.304 17.840  -8.114  1.00 0.00 ? 106 LEU A CA   6  
ATOM 11068 C C    . LEU A 1 106 ? -12.602 18.460  -7.602  1.00 0.00 ? 106 LEU A C    6  
ATOM 11069 O O    . LEU A 1 106 ? -13.180 17.990  -6.622  1.00 0.00 ? 106 LEU A O    6  
ATOM 11070 C CB   . LEU A 1 106 ? -11.601 16.918  -9.299  1.00 0.00 ? 106 LEU A CB   6  
ATOM 11071 C CG   . LEU A 1 106 ? -12.197 15.557  -8.929  1.00 0.00 ? 106 LEU A CG   6  
ATOM 11072 C CD1  . LEU A 1 106 ? -13.293 15.168  -9.909  1.00 0.00 ? 106 LEU A CD1  6  
ATOM 11073 C CD2  . LEU A 1 106 ? -11.110 14.492  -8.890  1.00 0.00 ? 106 LEU A CD2  6  
ATOM 11074 H H    . LEU A 1 106 ? -10.786 16.143  -6.959  1.00 0.00 ? 106 LEU A H    6  
ATOM 11075 H HA   . LEU A 1 106 ? -10.647 18.631  -8.442  1.00 0.00 ? 106 LEU A HA   6  
ATOM 11076 H HB2  . LEU A 1 106 ? -12.292 17.424  -9.957  1.00 0.00 ? 106 LEU A HB2  6  
ATOM 11077 H HB3  . LEU A 1 106 ? -10.679 16.748  -9.834  1.00 0.00 ? 106 LEU A HB3  6  
ATOM 11078 H HG   . LEU A 1 106 ? -12.638 15.621  -7.944  1.00 0.00 ? 106 LEU A HG   6  
ATOM 11079 H HD11 . LEU A 1 106 ? -12.936 15.302  -10.920 1.00 0.00 ? 106 LEU A HD11 6  
ATOM 11080 H HD12 . LEU A 1 106 ? -14.158 15.794  -9.748  1.00 0.00 ? 106 LEU A HD12 6  
ATOM 11081 H HD13 . LEU A 1 106 ? -13.563 14.134  -9.756  1.00 0.00 ? 106 LEU A HD13 6  
ATOM 11082 H HD21 . LEU A 1 106 ? -10.793 14.339  -7.870  1.00 0.00 ? 106 LEU A HD21 6  
ATOM 11083 H HD22 . LEU A 1 106 ? -10.269 14.815  -9.485  1.00 0.00 ? 106 LEU A HD22 6  
ATOM 11084 H HD23 . LEU A 1 106 ? -11.499 13.566  -9.290  1.00 0.00 ? 106 LEU A HD23 6  
ATOM 11085 N N    . PRO A 1 107 ? -13.077 19.530  -8.262  1.00 0.00 ? 107 PRO A N    6  
ATOM 11086 C CA   . PRO A 1 107 ? -14.313 20.214  -7.869  1.00 0.00 ? 107 PRO A CA   6  
ATOM 11087 C C    . PRO A 1 107 ? -15.557 19.390  -8.180  1.00 0.00 ? 107 PRO A C    6  
ATOM 11088 O O    . PRO A 1 107 ? -15.462 18.217  -8.543  1.00 0.00 ? 107 PRO A O    6  
ATOM 11089 C CB   . PRO A 1 107 ? -14.292 21.492  -8.710  1.00 0.00 ? 107 PRO A CB   6  
ATOM 11090 C CG   . PRO A 1 107 ? -13.486 21.138  -9.912  1.00 0.00 ? 107 PRO A CG   6  
ATOM 11091 C CD   . PRO A 1 107 ? -12.448 20.155  -9.441  1.00 0.00 ? 107 PRO A CD   6  
ATOM 11092 H HA   . PRO A 1 107 ? -14.305 20.470  -6.820  1.00 0.00 ? 107 PRO A HA   6  
ATOM 11093 H HB2  . PRO A 1 107 ? -15.304 21.766  -8.979  1.00 0.00 ? 107 PRO A HB2  6  
ATOM 11094 H HB3  . PRO A 1 107 ? -13.831 22.290  -8.147  1.00 0.00 ? 107 PRO A HB3  6  
ATOM 11095 H HG2  . PRO A 1 107 ? -14.120 20.685  -10.659 1.00 0.00 ? 107 PRO A HG2  6  
ATOM 11096 H HG3  . PRO A 1 107 ? -13.011 22.023  -10.309 1.00 0.00 ? 107 PRO A HG3  6  
ATOM 11097 H HD2  . PRO A 1 107 ? -12.252 19.419  -10.209 1.00 0.00 ? 107 PRO A HD2  6  
ATOM 11098 H HD3  . PRO A 1 107 ? -11.539 20.671  -9.165  1.00 0.00 ? 107 PRO A HD3  6  
ATOM 11099 N N    . HIS A 1 108 ? -16.723 20.012  -8.036  1.00 0.00 ? 108 HIS A N    6  
ATOM 11100 C CA   . HIS A 1 108 ? -17.988 19.337  -8.301  1.00 0.00 ? 108 HIS A CA   6  
ATOM 11101 C C    . HIS A 1 108 ? -18.450 19.588  -9.733  1.00 0.00 ? 108 HIS A C    6  
ATOM 11102 O O    . HIS A 1 108 ? -18.544 18.660  -10.536 1.00 0.00 ? 108 HIS A O    6  
ATOM 11103 C CB   . HIS A 1 108 ? -19.059 19.811  -7.316  1.00 0.00 ? 108 HIS A CB   6  
ATOM 11104 C CG   . HIS A 1 108 ? -20.370 19.106  -7.470  1.00 0.00 ? 108 HIS A CG   6  
ATOM 11105 N ND1  . HIS A 1 108 ? -21.456 19.350  -6.656  1.00 0.00 ? 108 HIS A ND1  6  
ATOM 11106 C CD2  . HIS A 1 108 ? -20.768 18.157  -8.350  1.00 0.00 ? 108 HIS A CD2  6  
ATOM 11107 C CE1  . HIS A 1 108 ? -22.465 18.582  -7.029  1.00 0.00 ? 108 HIS A CE1  6  
ATOM 11108 N NE2  . HIS A 1 108 ? -22.073 17.850  -8.055  1.00 0.00 ? 108 HIS A NE2  6  
ATOM 11109 H H    . HIS A 1 108 ? -16.733 20.947  -7.743  1.00 0.00 ? 108 HIS A H    6  
ATOM 11110 H HA   . HIS A 1 108 ? -17.833 18.277  -8.165  1.00 0.00 ? 108 HIS A HA   6  
ATOM 11111 H HB2  . HIS A 1 108 ? -18.710 19.646  -6.308  1.00 0.00 ? 108 HIS A HB2  6  
ATOM 11112 H HB3  . HIS A 1 108 ? -19.229 20.867  -7.463  1.00 0.00 ? 108 HIS A HB3  6  
ATOM 11113 H HD1  . HIS A 1 108 ? -21.483 19.989  -5.915  1.00 0.00 ? 108 HIS A HD1  6  
ATOM 11114 H HD2  . HIS A 1 108 ? -20.170 17.723  -9.140  1.00 0.00 ? 108 HIS A HD2  6  
ATOM 11115 H HE1  . HIS A 1 108 ? -23.443 18.559  -6.573  1.00 0.00 ? 108 HIS A HE1  6  
ATOM 11116 H HE2  . HIS A 1 108 ? -22.653 17.260  -8.581  1.00 0.00 ? 108 HIS A HE2  6  
ATOM 11117 N N    . ALA A 1 109 ? -18.738 20.847  -10.045 1.00 0.00 ? 109 ALA A N    6  
ATOM 11118 C CA   . ALA A 1 109 ? -19.190 21.221  -11.379 1.00 0.00 ? 109 ALA A CA   6  
ATOM 11119 C C    . ALA A 1 109 ? -19.244 22.737  -11.536 1.00 0.00 ? 109 ALA A C    6  
ATOM 11120 O O    . ALA A 1 109 ? -19.301 23.471  -10.549 1.00 0.00 ? 109 ALA A O    6  
ATOM 11121 C CB   . ALA A 1 109 ? -20.555 20.610  -11.663 1.00 0.00 ? 109 ALA A CB   6  
ATOM 11122 H H    . ALA A 1 109 ? -18.644 21.542  -9.360  1.00 0.00 ? 109 ALA A H    6  
ATOM 11123 H HA   . ALA A 1 109 ? -18.486 20.819  -12.094 1.00 0.00 ? 109 ALA A HA   6  
ATOM 11124 H HB1  . ALA A 1 109 ? -21.116 21.268  -12.309 1.00 0.00 ? 109 ALA A HB1  6  
ATOM 11125 H HB2  . ALA A 1 109 ? -21.089 20.476  -10.734 1.00 0.00 ? 109 ALA A HB2  6  
ATOM 11126 H HB3  . ALA A 1 109 ? -20.427 19.653  -12.147 1.00 0.00 ? 109 ALA A HB3  6  
ATOM 11127 N N    . ARG A 1 110 ? -19.223 23.198  -12.782 1.00 0.00 ? 110 ARG A N    6  
ATOM 11128 C CA   . ARG A 1 110 ? -19.269 24.628  -13.068 1.00 0.00 ? 110 ARG A CA   6  
ATOM 11129 C C    . ARG A 1 110 ? -20.334 24.940  -14.115 1.00 0.00 ? 110 ARG A C    6  
ATOM 11130 O O    . ARG A 1 110 ? -21.342 25.581  -13.818 1.00 0.00 ? 110 ARG A O    6  
ATOM 11131 C CB   . ARG A 1 110 ? -17.901 25.117  -13.552 1.00 0.00 ? 110 ARG A CB   6  
ATOM 11132 C CG   . ARG A 1 110 ? -17.475 26.440  -12.937 1.00 0.00 ? 110 ARG A CG   6  
ATOM 11133 C CD   . ARG A 1 110 ? -18.524 27.521  -13.153 1.00 0.00 ? 110 ARG A CD   6  
ATOM 11134 N NE   . ARG A 1 110 ? -19.336 27.740  -11.957 1.00 0.00 ? 110 ARG A NE   6  
ATOM 11135 C CZ   . ARG A 1 110 ? -20.520 28.347  -11.967 1.00 0.00 ? 110 ARG A CZ   6  
ATOM 11136 N NH1  . ARG A 1 110 ? -21.036 28.794  -13.106 1.00 0.00 ? 110 ARG A NH1  6  
ATOM 11137 N NH2  . ARG A 1 110 ? -21.193 28.506  -10.835 1.00 0.00 ? 110 ARG A NH2  6  
ATOM 11138 H H    . ARG A 1 110 ? -19.176 22.563  -13.528 1.00 0.00 ? 110 ARG A H    6  
ATOM 11139 H HA   . ARG A 1 110 ? -19.521 25.141  -12.152 1.00 0.00 ? 110 ARG A HA   6  
ATOM 11140 H HB2  . ARG A 1 110 ? -17.158 24.374  -13.303 1.00 0.00 ? 110 ARG A HB2  6  
ATOM 11141 H HB3  . ARG A 1 110 ? -17.933 25.237  -14.625 1.00 0.00 ? 110 ARG A HB3  6  
ATOM 11142 H HG2  . ARG A 1 110 ? -17.328 26.303  -11.877 1.00 0.00 ? 110 ARG A HG2  6  
ATOM 11143 H HG3  . ARG A 1 110 ? -16.548 26.756  -13.393 1.00 0.00 ? 110 ARG A HG3  6  
ATOM 11144 H HD2  . ARG A 1 110 ? -18.025 28.442  -13.411 1.00 0.00 ? 110 ARG A HD2  6  
ATOM 11145 H HD3  . ARG A 1 110 ? -19.170 27.220  -13.964 1.00 0.00 ? 110 ARG A HD3  6  
ATOM 11146 H HE   . ARG A 1 110 ? -18.979 27.420  -11.103 1.00 0.00 ? 110 ARG A HE   6  
ATOM 11147 H HH11 . ARG A 1 110 ? -20.534 28.677  -13.963 1.00 0.00 ? 110 ARG A HH11 6  
ATOM 11148 H HH12 . ARG A 1 110 ? -21.926 29.249  -13.107 1.00 0.00 ? 110 ARG A HH12 6  
ATOM 11149 H HH21 . ARG A 1 110 ? -20.809 28.170  -9.975  1.00 0.00 ? 110 ARG A HH21 6  
ATOM 11150 H HH22 . ARG A 1 110 ? -22.083 28.962  -10.843 1.00 0.00 ? 110 ARG A HH22 6  
ATOM 11151 N N    . THR A 1 111 ? -20.104 24.480  -15.341 1.00 0.00 ? 111 THR A N    6  
ATOM 11152 C CA   . THR A 1 111 ? -21.043 24.710  -16.432 1.00 0.00 ? 111 THR A CA   6  
ATOM 11153 C C    . THR A 1 111 ? -21.928 23.488  -16.652 1.00 0.00 ? 111 THR A C    6  
ATOM 11154 O O    . THR A 1 111 ? -21.809 22.487  -15.945 1.00 0.00 ? 111 THR A O    6  
ATOM 11155 C CB   . THR A 1 111 ? -20.290 25.047  -17.720 1.00 0.00 ? 111 THR A CB   6  
ATOM 11156 O OG1  . THR A 1 111 ? -19.013 24.433  -17.730 1.00 0.00 ? 111 THR A OG1  6  
ATOM 11157 C CG2  . THR A 1 111 ? -20.087 26.533  -17.924 1.00 0.00 ? 111 THR A CG2  6  
ATOM 11158 H H    . THR A 1 111 ? -19.282 23.976  -15.515 1.00 0.00 ? 111 THR A H    6  
ATOM 11159 H HA   . THR A 1 111 ? -21.668 25.547  -16.161 1.00 0.00 ? 111 THR A HA   6  
ATOM 11160 H HB   . THR A 1 111 ? -20.853 24.671  -18.563 1.00 0.00 ? 111 THR A HB   6  
ATOM 11161 H HG1  . THR A 1 111 ? -18.445 24.864  -17.088 1.00 0.00 ? 111 THR A HG1  6  
ATOM 11162 H HG21 . THR A 1 111 ? -20.404 27.064  -17.038 1.00 0.00 ? 111 THR A HG21 6  
ATOM 11163 H HG22 . THR A 1 111 ? -20.671 26.863  -18.771 1.00 0.00 ? 111 THR A HG22 6  
ATOM 11164 H HG23 . THR A 1 111 ? -19.042 26.732  -18.108 1.00 0.00 ? 111 THR A HG23 6  
ATOM 11165 N N    . THR A 1 112 ? -22.817 23.575  -17.637 1.00 0.00 ? 112 THR A N    6  
ATOM 11166 C CA   . THR A 1 112 ? -23.721 22.475  -17.949 1.00 0.00 ? 112 THR A CA   6  
ATOM 11167 C C    . THR A 1 112 ? -23.375 21.850  -19.297 1.00 0.00 ? 112 THR A C    6  
ATOM 11168 O O    . THR A 1 112 ? -23.329 20.628  -19.432 1.00 0.00 ? 112 THR A O    6  
ATOM 11169 C CB   . THR A 1 112 ? -25.170 22.966  -17.958 1.00 0.00 ? 112 THR A CB   6  
ATOM 11170 O OG1  . THR A 1 112 ? -25.318 24.106  -17.130 1.00 0.00 ? 112 THR A OG1  6  
ATOM 11171 C CG2  . THR A 1 112 ? -26.158 21.923  -17.483 1.00 0.00 ? 112 THR A CG2  6  
ATOM 11172 H H    . THR A 1 112 ? -22.864 24.398  -18.166 1.00 0.00 ? 112 THR A H    6  
ATOM 11173 H HA   . THR A 1 112 ? -23.610 21.726  -17.180 1.00 0.00 ? 112 THR A HA   6  
ATOM 11174 H HB   . THR A 1 112 ? -25.440 23.241  -18.968 1.00 0.00 ? 112 THR A HB   6  
ATOM 11175 H HG1  . THR A 1 112 ? -24.991 23.906  -16.251 1.00 0.00 ? 112 THR A HG1  6  
ATOM 11176 H HG21 . THR A 1 112 ? -26.529 22.196  -16.506 1.00 0.00 ? 112 THR A HG21 6  
ATOM 11177 H HG22 . THR A 1 112 ? -25.669 20.961  -17.427 1.00 0.00 ? 112 THR A HG22 6  
ATOM 11178 H HG23 . THR A 1 112 ? -26.984 21.866  -18.178 1.00 0.00 ? 112 THR A HG23 6  
ATOM 11179 N N    . VAL A 1 113 ? -23.131 22.698  -20.292 1.00 0.00 ? 113 VAL A N    6  
ATOM 11180 C CA   . VAL A 1 113 ? -22.788 22.229  -21.630 1.00 0.00 ? 113 VAL A CA   6  
ATOM 11181 C C    . VAL A 1 113 ? -22.546 23.399  -22.581 1.00 0.00 ? 113 VAL A C    6  
ATOM 11182 O O    . VAL A 1 113 ? -21.663 23.343  -23.436 1.00 0.00 ? 113 VAL A O    6  
ATOM 11183 C CB   . VAL A 1 113 ? -23.896 21.327  -22.212 1.00 0.00 ? 113 VAL A CB   6  
ATOM 11184 C CG1  . VAL A 1 113 ? -25.200 22.096  -22.346 1.00 0.00 ? 113 VAL A CG1  6  
ATOM 11185 C CG2  . VAL A 1 113 ? -23.467 20.749  -23.552 1.00 0.00 ? 113 VAL A CG2  6  
ATOM 11186 H H    . VAL A 1 113 ? -23.182 23.661  -20.122 1.00 0.00 ? 113 VAL A H    6  
ATOM 11187 H HA   . VAL A 1 113 ? -21.881 21.646  -21.556 1.00 0.00 ? 113 VAL A HA   6  
ATOM 11188 H HB   . VAL A 1 113 ? -24.058 20.506  -21.528 1.00 0.00 ? 113 VAL A HB   6  
ATOM 11189 H HG11 . VAL A 1 113 ? -25.051 22.947  -22.996 1.00 0.00 ? 113 VAL A HG11 6  
ATOM 11190 H HG12 . VAL A 1 113 ? -25.518 22.439  -21.372 1.00 0.00 ? 113 VAL A HG12 6  
ATOM 11191 H HG13 . VAL A 1 113 ? -25.957 21.452  -22.766 1.00 0.00 ? 113 VAL A HG13 6  
ATOM 11192 H HG21 . VAL A 1 113 ? -24.105 19.915  -23.807 1.00 0.00 ? 113 VAL A HG21 6  
ATOM 11193 H HG22 . VAL A 1 113 ? -22.443 20.413  -23.490 1.00 0.00 ? 113 VAL A HG22 6  
ATOM 11194 H HG23 . VAL A 1 113 ? -23.549 21.511  -24.315 1.00 0.00 ? 113 VAL A HG23 6  
ATOM 11195 N N    . ASP A 1 114 ? -23.338 24.456  -22.425 1.00 0.00 ? 114 ASP A N    6  
ATOM 11196 C CA   . ASP A 1 114 ? -23.213 25.639  -23.270 1.00 0.00 ? 114 ASP A CA   6  
ATOM 11197 C C    . ASP A 1 114 ? -23.524 25.301  -24.724 1.00 0.00 ? 114 ASP A C    6  
ATOM 11198 O O    . ASP A 1 114 ? -22.717 25.555  -25.620 1.00 0.00 ? 114 ASP A O    6  
ATOM 11199 C CB   . ASP A 1 114 ? -21.804 26.228  -23.156 1.00 0.00 ? 114 ASP A CB   6  
ATOM 11200 C CG   . ASP A 1 114 ? -21.698 27.263  -22.054 1.00 0.00 ? 114 ASP A CG   6  
ATOM 11201 O OD1  . ASP A 1 114 ? -22.010 28.444  -22.315 1.00 0.00 ? 114 ASP A OD1  6  
ATOM 11202 O OD2  . ASP A 1 114 ? -21.300 26.892  -20.929 1.00 0.00 ? 114 ASP A OD2  6  
ATOM 11203 H H    . ASP A 1 114 ? -24.025 24.439  -21.726 1.00 0.00 ? 114 ASP A H    6  
ATOM 11204 H HA   . ASP A 1 114 ? -23.927 26.369  -22.922 1.00 0.00 ? 114 ASP A HA   6  
ATOM 11205 H HB2  . ASP A 1 114 ? -21.103 25.434  -22.948 1.00 0.00 ? 114 ASP A HB2  6  
ATOM 11206 H HB3  . ASP A 1 114 ? -21.541 26.698  -24.093 1.00 0.00 ? 114 ASP A HB3  6  
ATOM 11207 N N    . GLU A 1 115 ? -24.702 24.728  -24.954 1.00 0.00 ? 115 GLU A N    6  
ATOM 11208 C CA   . GLU A 1 115 ? -25.121 24.356  -26.300 1.00 0.00 ? 115 GLU A CA   6  
ATOM 11209 C C    . GLU A 1 115 ? -26.613 24.034  -26.336 1.00 0.00 ? 115 GLU A C    6  
ATOM 11210 O O    . GLU A 1 115 ? -27.006 22.878  -26.490 1.00 0.00 ? 115 GLU A O    6  
ATOM 11211 C CB   . GLU A 1 115 ? -24.315 23.154  -26.795 1.00 0.00 ? 115 GLU A CB   6  
ATOM 11212 C CG   . GLU A 1 115 ? -24.101 23.143  -28.300 1.00 0.00 ? 115 GLU A CG   6  
ATOM 11213 C CD   . GLU A 1 115 ? -24.634 21.885  -28.957 1.00 0.00 ? 115 GLU A CD   6  
ATOM 11214 O OE1  . GLU A 1 115 ? -24.185 20.782  -28.582 1.00 0.00 ? 115 GLU A OE1  6  
ATOM 11215 O OE2  . GLU A 1 115 ? -25.501 22.003  -29.849 1.00 0.00 ? 115 GLU A OE2  6  
ATOM 11216 H H    . GLU A 1 115 ? -25.302 24.552  -24.200 1.00 0.00 ? 115 GLU A H    6  
ATOM 11217 H HA   . GLU A 1 115 ? -24.932 25.197  -26.950 1.00 0.00 ? 115 GLU A HA   6  
ATOM 11218 H HB2  . GLU A 1 115 ? -23.347 23.163  -26.315 1.00 0.00 ? 115 GLU A HB2  6  
ATOM 11219 H HB3  . GLU A 1 115 ? -24.834 22.249  -26.519 1.00 0.00 ? 115 GLU A HB3  6  
ATOM 11220 H HG2  . GLU A 1 115 ? -24.606 23.995  -28.729 1.00 0.00 ? 115 GLU A HG2  6  
ATOM 11221 H HG3  . GLU A 1 115 ? -23.042 23.216  -28.500 1.00 0.00 ? 115 GLU A HG3  6  
ATOM 11222 N N    . THR A 1 116 ? -27.439 25.066  -26.194 1.00 0.00 ? 116 THR A N    6  
ATOM 11223 C CA   . THR A 1 116 ? -28.887 24.894  -26.212 1.00 0.00 ? 116 THR A CA   6  
ATOM 11224 C C    . THR A 1 116 ? -29.524 25.751  -27.300 1.00 0.00 ? 116 THR A C    6  
ATOM 11225 O O    . THR A 1 116 ? -30.076 26.817  -27.023 1.00 0.00 ? 116 THR A O    6  
ATOM 11226 C CB   . THR A 1 116 ? -29.482 25.255  -24.848 1.00 0.00 ? 116 THR A CB   6  
ATOM 11227 O OG1  . THR A 1 116 ? -28.556 24.985  -23.810 1.00 0.00 ? 116 THR A OG1  6  
ATOM 11228 C CG2  . THR A 1 116 ? -30.757 24.504  -24.534 1.00 0.00 ? 116 THR A CG2  6  
ATOM 11229 H H    . THR A 1 116 ? -27.066 25.964  -26.076 1.00 0.00 ? 116 THR A H    6  
ATOM 11230 H HA   . THR A 1 116 ? -29.096 23.855  -26.420 1.00 0.00 ? 116 THR A HA   6  
ATOM 11231 H HB   . THR A 1 116 ? -29.708 26.312  -24.835 1.00 0.00 ? 116 THR A HB   6  
ATOM 11232 H HG1  . THR A 1 116 ? -27.950 25.724  -23.720 1.00 0.00 ? 116 THR A HG1  6  
ATOM 11233 H HG21 . THR A 1 116 ? -30.518 23.485  -24.264 1.00 0.00 ? 116 THR A HG21 6  
ATOM 11234 H HG22 . THR A 1 116 ? -31.399 24.505  -25.403 1.00 0.00 ? 116 THR A HG22 6  
ATOM 11235 H HG23 . THR A 1 116 ? -31.265 24.984  -23.710 1.00 0.00 ? 116 THR A HG23 6  
ATOM 11236 N N    . LYS A 1 117 ? -29.445 25.279  -28.540 1.00 0.00 ? 117 LYS A N    6  
ATOM 11237 C CA   . LYS A 1 117 ? -30.015 26.001  -29.671 1.00 0.00 ? 117 LYS A CA   6  
ATOM 11238 C C    . LYS A 1 117 ? -31.497 25.681  -29.831 1.00 0.00 ? 117 LYS A C    6  
ATOM 11239 O O    . LYS A 1 117 ? -31.863 24.659  -30.411 1.00 0.00 ? 117 LYS A O    6  
ATOM 11240 C CB   . LYS A 1 117 ? -29.263 25.651  -30.957 1.00 0.00 ? 117 LYS A CB   6  
ATOM 11241 C CG   . LYS A 1 117 ? -29.466 26.662  -32.074 1.00 0.00 ? 117 LYS A CG   6  
ATOM 11242 C CD   . LYS A 1 117 ? -28.499 27.829  -31.952 1.00 0.00 ? 117 LYS A CD   6  
ATOM 11243 C CE   . LYS A 1 117 ? -27.114 27.460  -32.460 1.00 0.00 ? 117 LYS A CE   6  
ATOM 11244 N NZ   . LYS A 1 117 ? -26.983 27.685  -33.926 1.00 0.00 ? 117 LYS A NZ   6  
ATOM 11245 H H    . LYS A 1 117 ? -28.993 24.423  -28.698 1.00 0.00 ? 117 LYS A H    6  
ATOM 11246 H HA   . LYS A 1 117 ? -29.906 27.058  -29.478 1.00 0.00 ? 117 LYS A HA   6  
ATOM 11247 H HB2  . LYS A 1 117 ? -28.207 25.595  -30.739 1.00 0.00 ? 117 LYS A HB2  6  
ATOM 11248 H HB3  . LYS A 1 117 ? -29.602 24.687  -31.307 1.00 0.00 ? 117 LYS A HB3  6  
ATOM 11249 H HG2  . LYS A 1 117 ? -29.305 26.172  -33.022 1.00 0.00 ? 117 LYS A HG2  6  
ATOM 11250 H HG3  . LYS A 1 117 ? -30.477 27.038  -32.028 1.00 0.00 ? 117 LYS A HG3  6  
ATOM 11251 H HD2  . LYS A 1 117 ? -28.875 28.657  -32.532 1.00 0.00 ? 117 LYS A HD2  6  
ATOM 11252 H HD3  . LYS A 1 117 ? -28.427 28.116  -30.913 1.00 0.00 ? 117 LYS A HD3  6  
ATOM 11253 H HE2  . LYS A 1 117 ? -26.383 28.065  -31.945 1.00 0.00 ? 117 LYS A HE2  6  
ATOM 11254 H HE3  . LYS A 1 117 ? -26.932 26.417  -32.246 1.00 0.00 ? 117 LYS A HE3  6  
ATOM 11255 H HZ1  . LYS A 1 117 ? -25.980 27.789  -34.182 1.00 0.00 ? 117 LYS A HZ1  6  
ATOM 11256 H HZ2  . LYS A 1 117 ? -27.491 28.548  -34.203 1.00 0.00 ? 117 LYS A HZ2  6  
ATOM 11257 H HZ3  . LYS A 1 117 ? -27.380 26.878  -34.448 1.00 0.00 ? 117 LYS A HZ3  6  
ATOM 11258 N N    . TRP A 1 118 ? -32.346 26.561  -29.311 1.00 0.00 ? 118 TRP A N    6  
ATOM 11259 C CA   . TRP A 1 118 ? -33.790 26.372  -29.395 1.00 0.00 ? 118 TRP A CA   6  
ATOM 11260 C C    . TRP A 1 118 ? -34.527 27.685  -29.148 1.00 0.00 ? 118 TRP A C    6  
ATOM 11261 O O    . TRP A 1 118 ? -34.887 28.001  -28.015 1.00 0.00 ? 118 TRP A O    6  
ATOM 11262 C CB   . TRP A 1 118 ? -34.246 25.320  -28.382 1.00 0.00 ? 118 TRP A CB   6  
ATOM 11263 C CG   . TRP A 1 118 ? -35.389 24.481  -28.868 1.00 0.00 ? 118 TRP A CG   6  
ATOM 11264 C CD1  . TRP A 1 118 ? -35.658 24.131  -30.159 1.00 0.00 ? 118 TRP A CD1  6  
ATOM 11265 C CD2  . TRP A 1 118 ? -36.417 23.888  -28.067 1.00 0.00 ? 118 TRP A CD2  6  
ATOM 11266 N NE1  . TRP A 1 118 ? -36.792 23.355  -30.211 1.00 0.00 ? 118 TRP A NE1  6  
ATOM 11267 C CE2  . TRP A 1 118 ? -37.276 23.192  -28.939 1.00 0.00 ? 118 TRP A CE2  6  
ATOM 11268 C CE3  . TRP A 1 118 ? -36.695 23.877  -26.697 1.00 0.00 ? 118 TRP A CE3  6  
ATOM 11269 C CZ2  . TRP A 1 118 ? -38.391 22.492  -28.486 1.00 0.00 ? 118 TRP A CZ2  6  
ATOM 11270 C CZ3  . TRP A 1 118 ? -37.804 23.183  -26.248 1.00 0.00 ? 118 TRP A CZ3  6  
ATOM 11271 C CH2  . TRP A 1 118 ? -38.639 22.498  -27.140 1.00 0.00 ? 118 TRP A CH2  6  
ATOM 11272 H H    . TRP A 1 118 ? -31.995 27.357  -28.861 1.00 0.00 ? 118 TRP A H    6  
ATOM 11273 H HA   . TRP A 1 118 ? -34.022 26.024  -30.391 1.00 0.00 ? 118 TRP A HA   6  
ATOM 11274 H HB2  . TRP A 1 118 ? -33.420 24.661  -28.162 1.00 0.00 ? 118 TRP A HB2  6  
ATOM 11275 H HB3  . TRP A 1 118 ? -34.557 25.816  -27.474 1.00 0.00 ? 118 TRP A HB3  6  
ATOM 11276 H HD1  . TRP A 1 118 ? -35.060 24.428  -31.007 1.00 0.00 ? 118 TRP A HD1  6  
ATOM 11277 H HE1  . TRP A 1 118 ? -37.187 22.979  -31.025 1.00 0.00 ? 118 TRP A HE1  6  
ATOM 11278 H HE3  . TRP A 1 118 ? -36.063 24.398  -25.994 1.00 0.00 ? 118 TRP A HE3  6  
ATOM 11279 H HZ2  . TRP A 1 118 ? -39.045 21.960  -29.160 1.00 0.00 ? 118 TRP A HZ2  6  
ATOM 11280 H HZ3  . TRP A 1 118 ? -38.035 23.163  -25.193 1.00 0.00 ? 118 TRP A HZ3  6  
ATOM 11281 H HH2  . TRP A 1 118 ? -39.494 21.970  -26.745 1.00 0.00 ? 118 TRP A HH2  6  
ATOM 11282 N N    . ILE A 1 119 ? -34.746 28.445  -30.216 1.00 0.00 ? 119 ILE A N    6  
ATOM 11283 C CA   . ILE A 1 119 ? -35.437 29.725  -30.114 1.00 0.00 ? 119 ILE A CA   6  
ATOM 11284 C C    . ILE A 1 119 ? -36.835 29.644  -30.720 1.00 0.00 ? 119 ILE A C    6  
ATOM 11285 O O    . ILE A 1 119 ? -37.354 30.629  -31.245 1.00 0.00 ? 119 ILE A O    6  
ATOM 11286 C CB   . ILE A 1 119 ? -34.650 30.848  -30.816 1.00 0.00 ? 119 ILE A CB   6  
ATOM 11287 C CG1  . ILE A 1 119 ? -33.177 30.803  -30.407 1.00 0.00 ? 119 ILE A CG1  6  
ATOM 11288 C CG2  . ILE A 1 119 ? -35.255 32.204  -30.486 1.00 0.00 ? 119 ILE A CG2  6  
ATOM 11289 C CD1  . ILE A 1 119 ? -32.280 31.654  -31.279 1.00 0.00 ? 119 ILE A CD1  6  
ATOM 11290 H H    . ILE A 1 119 ? -34.434 28.139  -31.094 1.00 0.00 ? 119 ILE A H    6  
ATOM 11291 H HA   . ILE A 1 119 ? -35.524 29.974  -29.067 1.00 0.00 ? 119 ILE A HA   6  
ATOM 11292 H HB   . ILE A 1 119 ? -34.725 30.699  -31.883 1.00 0.00 ? 119 ILE A HB   6  
ATOM 11293 H HG12 . ILE A 1 119 ? -33.081 31.155  -29.391 1.00 0.00 ? 119 ILE A HG12 6  
ATOM 11294 H HG13 . ILE A 1 119 ? -32.826 29.783  -30.464 1.00 0.00 ? 119 ILE A HG13 6  
ATOM 11295 H HG21 . ILE A 1 119 ? -34.469 32.942  -30.420 1.00 0.00 ? 119 ILE A HG21 6  
ATOM 11296 H HG22 . ILE A 1 119 ? -35.774 32.147  -29.541 1.00 0.00 ? 119 ILE A HG22 6  
ATOM 11297 H HG23 . ILE A 1 119 ? -35.949 32.488  -31.263 1.00 0.00 ? 119 ILE A HG23 6  
ATOM 11298 H HD11 . ILE A 1 119 ? -32.829 32.520  -31.622 1.00 0.00 ? 119 ILE A HD11 6  
ATOM 11299 H HD12 . ILE A 1 119 ? -31.952 31.076  -32.131 1.00 0.00 ? 119 ILE A HD12 6  
ATOM 11300 H HD13 . ILE A 1 119 ? -31.422 31.974  -30.708 1.00 0.00 ? 119 ILE A HD13 6  
ATOM 11301 N N    . ALA A 1 120 ? -37.442 28.463  -30.643 1.00 0.00 ? 120 ALA A N    6  
ATOM 11302 C CA   . ALA A 1 120 ? -38.779 28.255  -31.183 1.00 0.00 ? 120 ALA A CA   6  
ATOM 11303 C C    . ALA A 1 120 ? -39.427 27.014  -30.578 1.00 0.00 ? 120 ALA A C    6  
ATOM 11304 O O    . ALA A 1 120 ? -38.857 26.370  -29.699 1.00 0.00 ? 120 ALA A O    6  
ATOM 11305 C CB   . ALA A 1 120 ? -38.725 28.139  -32.698 1.00 0.00 ? 120 ALA A CB   6  
ATOM 11306 H H    . ALA A 1 120 ? -36.978 27.715  -30.212 1.00 0.00 ? 120 ALA A H    6  
ATOM 11307 H HA   . ALA A 1 120 ? -39.378 29.120  -30.933 1.00 0.00 ? 120 ALA A HA   6  
ATOM 11308 H HB1  . ALA A 1 120 ? -39.499 27.467  -33.036 1.00 0.00 ? 120 ALA A HB1  6  
ATOM 11309 H HB2  . ALA A 1 120 ? -37.760 27.756  -32.996 1.00 0.00 ? 120 ALA A HB2  6  
ATOM 11310 H HB3  . ALA A 1 120 ? -38.878 29.114  -33.139 1.00 0.00 ? 120 ALA A HB3  6  
ATOM 11311 N N    . SER A 1 121 ? -40.624 26.685  -31.055 1.00 0.00 ? 121 SER A N    6  
ATOM 11312 C CA   . SER A 1 121 ? -41.350 25.522  -30.561 1.00 0.00 ? 121 SER A CA   6  
ATOM 11313 C C    . SER A 1 121 ? -41.615 24.525  -31.683 1.00 0.00 ? 121 SER A C    6  
ATOM 11314 O O    . SER A 1 121 ? -42.734 24.424  -32.188 1.00 0.00 ? 121 SER A O    6  
ATOM 11315 C CB   . SER A 1 121 ? -42.672 25.952  -29.922 1.00 0.00 ? 121 SER A CB   6  
ATOM 11316 O OG   . SER A 1 121 ? -42.481 27.043  -29.037 1.00 0.00 ? 121 SER A OG   6  
ATOM 11317 H H    . SER A 1 121 ? -41.029 27.239  -31.756 1.00 0.00 ? 121 SER A H    6  
ATOM 11318 H HA   . SER A 1 121 ? -40.738 25.044  -29.809 1.00 0.00 ? 121 SER A HA   6  
ATOM 11319 H HB2  . SER A 1 121 ? -43.363 26.252  -30.697 1.00 0.00 ? 121 SER A HB2  6  
ATOM 11320 H HB3  . SER A 1 121 ? -43.089 25.125  -29.368 1.00 0.00 ? 121 SER A HB3  6  
ATOM 11321 H HG   . SER A 1 121 ? -42.071 27.771  -29.509 1.00 0.00 ? 121 SER A HG   6  
ATOM 11322 N N    . SER A 1 122 ? -40.579 23.787  -32.070 1.00 0.00 ? 122 SER A N    6  
ATOM 11323 C CA   . SER A 1 122 ? -40.700 22.796  -33.132 1.00 0.00 ? 122 SER A CA   6  
ATOM 11324 C C    . SER A 1 122 ? -40.801 21.390  -32.552 1.00 0.00 ? 122 SER A C    6  
ATOM 11325 O O    . SER A 1 122 ? -40.031 21.016  -31.666 1.00 0.00 ? 122 SER A O    6  
ATOM 11326 C CB   . SER A 1 122 ? -39.502 22.883  -34.081 1.00 0.00 ? 122 SER A CB   6  
ATOM 11327 O OG   . SER A 1 122 ? -38.320 22.413  -33.455 1.00 0.00 ? 122 SER A OG   6  
ATOM 11328 H H    . SER A 1 122 ? -39.712 23.912  -31.629 1.00 0.00 ? 122 SER A H    6  
ATOM 11329 H HA   . SER A 1 122 ? -41.601 23.010  -33.686 1.00 0.00 ? 122 SER A HA   6  
ATOM 11330 H HB2  . SER A 1 122 ? -39.693 22.283  -34.956 1.00 0.00 ? 122 SER A HB2  6  
ATOM 11331 H HB3  . SER A 1 122 ? -39.353 23.912  -34.376 1.00 0.00 ? 122 SER A HB3  6  
ATOM 11332 H HG   . SER A 1 122 ? -37.972 23.093  -32.874 1.00 0.00 ? 122 SER A HG   6  
ATOM 11333 N N    . SER A 1 123 ? -41.754 20.613  -33.055 1.00 0.00 ? 123 SER A N    6  
ATOM 11334 C CA   . SER A 1 123 ? -41.954 19.247  -32.582 1.00 0.00 ? 123 SER A CA   6  
ATOM 11335 C C    . SER A 1 123 ? -42.936 18.499  -33.477 1.00 0.00 ? 123 SER A C    6  
ATOM 11336 O O    . SER A 1 123 ? -43.534 19.080  -34.382 1.00 0.00 ? 123 SER A O    6  
ATOM 11337 C CB   . SER A 1 123 ? -42.463 19.254  -31.140 1.00 0.00 ? 123 SER A CB   6  
ATOM 11338 O OG   . SER A 1 123 ? -41.815 18.261  -30.365 1.00 0.00 ? 123 SER A OG   6  
ATOM 11339 H H    . SER A 1 123 ? -42.338 20.965  -33.758 1.00 0.00 ? 123 SER A H    6  
ATOM 11340 H HA   . SER A 1 123 ? -41.000 18.743  -32.614 1.00 0.00 ? 123 SER A HA   6  
ATOM 11341 H HB2  . SER A 1 123 ? -42.271 20.220  -30.696 1.00 0.00 ? 123 SER A HB2  6  
ATOM 11342 H HB3  . SER A 1 123 ? -43.526 19.061  -31.133 1.00 0.00 ? 123 SER A HB3  6  
ATOM 11343 H HG   . SER A 1 123 ? -42.126 17.393  -30.632 1.00 0.00 ? 123 SER A HG   6  
ATOM 11344 N N    . GLY A 1 124 ? -43.097 17.205  -33.217 1.00 0.00 ? 124 GLY A N    6  
ATOM 11345 C CA   . GLY A 1 124 ? -44.007 16.396  -34.005 1.00 0.00 ? 124 GLY A CA   6  
ATOM 11346 C C    . GLY A 1 124 ? -43.350 15.135  -34.535 1.00 0.00 ? 124 GLY A C    6  
ATOM 11347 O O    . GLY A 1 124 ? -42.153 15.131  -34.821 1.00 0.00 ? 124 GLY A O    6  
ATOM 11348 H H    . GLY A 1 124 ? -42.594 16.797  -32.481 1.00 0.00 ? 124 GLY A H    6  
ATOM 11349 H HA2  . GLY A 1 124 ? -44.850 16.118  -33.390 1.00 0.00 ? 124 GLY A HA2  6  
ATOM 11350 H HA3  . GLY A 1 124 ? -44.363 16.982  -34.840 1.00 0.00 ? 124 GLY A HA3  6  
ATOM 11351 N N    . PRO A 1 125 ? -44.114 14.038  -34.680 1.00 0.00 ? 125 PRO A N    6  
ATOM 11352 C CA   . PRO A 1 125 ? -43.583 12.767  -35.182 1.00 0.00 ? 125 PRO A CA   6  
ATOM 11353 C C    . PRO A 1 125 ? -43.266 12.816  -36.675 1.00 0.00 ? 125 PRO A C    6  
ATOM 11354 O O    . PRO A 1 125 ? -42.548 11.961  -37.193 1.00 0.00 ? 125 PRO A O    6  
ATOM 11355 C CB   . PRO A 1 125 ? -44.715 11.777  -34.910 1.00 0.00 ? 125 PRO A CB   6  
ATOM 11356 C CG   . PRO A 1 125 ? -45.951 12.607  -34.915 1.00 0.00 ? 125 PRO A CG   6  
ATOM 11357 C CD   . PRO A 1 125 ? -45.554 13.950  -34.364 1.00 0.00 ? 125 PRO A CD   6  
ATOM 11358 H HA   . PRO A 1 125 ? -42.699 12.467  -34.639 1.00 0.00 ? 125 PRO A HA   6  
ATOM 11359 H HB2  . PRO A 1 125 ? -44.737 11.028  -35.687 1.00 0.00 ? 125 PRO A HB2  6  
ATOM 11360 H HB3  . PRO A 1 125 ? -44.562 11.305  -33.950 1.00 0.00 ? 125 PRO A HB3  6  
ATOM 11361 H HG2  . PRO A 1 125 ? -46.320 12.711  -35.925 1.00 0.00 ? 125 PRO A HG2  6  
ATOM 11362 H HG3  . PRO A 1 125 ? -46.702 12.153  -34.286 1.00 0.00 ? 125 PRO A HG3  6  
ATOM 11363 H HD2  . PRO A 1 125 ? -46.104 14.738  -34.856 1.00 0.00 ? 125 PRO A HD2  6  
ATOM 11364 H HD3  . PRO A 1 125 ? -45.716 13.983  -33.297 1.00 0.00 ? 125 PRO A HD3  6  
ATOM 11365 N N    . SER A 1 126 ? -43.805 13.819  -37.363 1.00 0.00 ? 126 SER A N    6  
ATOM 11366 C CA   . SER A 1 126 ? -43.576 13.971  -38.795 1.00 0.00 ? 126 SER A CA   6  
ATOM 11367 C C    . SER A 1 126 ? -43.515 15.444  -39.189 1.00 0.00 ? 126 SER A C    6  
ATOM 11368 O O    . SER A 1 126 ? -42.637 15.857  -39.947 1.00 0.00 ? 126 SER A O    6  
ATOM 11369 C CB   . SER A 1 126 ? -44.679 13.264  -39.585 1.00 0.00 ? 126 SER A CB   6  
ATOM 11370 O OG   . SER A 1 126 ? -44.144 12.566  -40.696 1.00 0.00 ? 126 SER A OG   6  
ATOM 11371 H H    . SER A 1 126 ? -44.369 14.470  -36.898 1.00 0.00 ? 126 SER A H    6  
ATOM 11372 H HA   . SER A 1 126 ? -42.628 13.509  -39.029 1.00 0.00 ? 126 SER A HA   6  
ATOM 11373 H HB2  . SER A 1 126 ? -45.184 12.559  -38.943 1.00 0.00 ? 126 SER A HB2  6  
ATOM 11374 H HB3  . SER A 1 126 ? -45.388 13.996  -39.943 1.00 0.00 ? 126 SER A HB3  6  
ATOM 11375 H HG   . SER A 1 126 ? -44.169 11.622  -40.524 1.00 0.00 ? 126 SER A HG   6  
ATOM 11376 N N    . SER A 1 127 ? -44.453 16.232  -38.673 1.00 0.00 ? 127 SER A N    6  
ATOM 11377 C CA   . SER A 1 127 ? -44.507 17.659  -38.973 1.00 0.00 ? 127 SER A CA   6  
ATOM 11378 C C    . SER A 1 127 ? -44.855 17.892  -40.439 1.00 0.00 ? 127 SER A C    6  
ATOM 11379 O O    . SER A 1 127 ? -44.032 17.665  -41.326 1.00 0.00 ? 127 SER A O    6  
ATOM 11380 C CB   . SER A 1 127 ? -43.171 18.328  -38.640 1.00 0.00 ? 127 SER A CB   6  
ATOM 11381 O OG   . SER A 1 127 ? -42.421 17.545  -37.728 1.00 0.00 ? 127 SER A OG   6  
ATOM 11382 H H    . SER A 1 127 ? -45.128 15.843  -38.076 1.00 0.00 ? 127 SER A H    6  
ATOM 11383 H HA   . SER A 1 127 ? -45.281 18.096  -38.359 1.00 0.00 ? 127 SER A HA   6  
ATOM 11384 H HB2  . SER A 1 127 ? -42.596 18.450  -39.547 1.00 0.00 ? 127 SER A HB2  6  
ATOM 11385 H HB3  . SER A 1 127 ? -43.355 19.297  -38.198 1.00 0.00 ? 127 SER A HB3  6  
ATOM 11386 H HG   . SER A 1 127 ? -41.485 17.640  -37.917 1.00 0.00 ? 127 SER A HG   6  
ATOM 11387 N N    . GLY A 1 128 ? -46.079 18.347  -40.687 1.00 0.00 ? 128 GLY A N    6  
ATOM 11388 C CA   . GLY A 1 128 ? -46.515 18.603  -42.048 1.00 0.00 ? 128 GLY A CA   6  
ATOM 11389 C C    . GLY A 1 128 ? -46.658 20.083  -42.342 1.00 0.00 ? 128 GLY A C    6  
ATOM 11390 O O    . GLY A 1 128 ? -47.745 20.639  -42.078 1.00 0.00 ? 128 GLY A O    6  
ATOM 11391 O OXT  . GLY A 1 128 ? -45.683 20.687  -42.837 1.00 0.00 ? 128 GLY A OXT  6  
ATOM 11392 H H    . GLY A 1 128 ? -46.692 18.509  -39.939 1.00 0.00 ? 128 GLY A H    6  
ATOM 11393 H HA2  . GLY A 1 128 ? -45.794 18.179  -42.731 1.00 0.00 ? 128 GLY A HA2  6  
ATOM 11394 H HA3  . GLY A 1 128 ? -47.469 18.122  -42.204 1.00 0.00 ? 128 GLY A HA3  6  
ATOM 11395 N N    . GLY A 1 1   ? -5.833  -0.456  11.323  1.00 0.00 ? 1   GLY A N    7  
ATOM 11396 C CA   . GLY A 1 1   ? -6.928  -0.341  12.325  1.00 0.00 ? 1   GLY A CA   7  
ATOM 11397 C C    . GLY A 1 1   ? -7.563  -1.680  12.646  1.00 0.00 ? 1   GLY A C    7  
ATOM 11398 O O    . GLY A 1 1   ? -6.866  -2.648  12.947  1.00 0.00 ? 1   GLY A O    7  
ATOM 11399 H H1   . GLY A 1 1   ? -5.050  0.182   11.574  1.00 0.00 ? 1   GLY A H1   7  
ATOM 11400 H H2   . GLY A 1 1   ? -6.185  -0.200  10.378  1.00 0.00 ? 1   GLY A H2   7  
ATOM 11401 H H3   . GLY A 1 1   ? -5.475  -1.432  11.295  1.00 0.00 ? 1   GLY A H3   7  
ATOM 11402 H HA2  . GLY A 1 1   ? -6.526  0.081   13.234  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 11403 H HA3  . GLY A 1 1   ? -7.688  0.322   11.937  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 11404 N N    . SER A 1 2   ? -8.890  -1.733  12.582  1.00 0.00 ? 2   SER A N    7  
ATOM 11405 C CA   . SER A 1 2   ? -9.622  -2.963  12.869  1.00 0.00 ? 2   SER A CA   7  
ATOM 11406 C C    . SER A 1 2   ? -9.423  -3.391  14.319  1.00 0.00 ? 2   SER A C    7  
ATOM 11407 O O    . SER A 1 2   ? -8.300  -3.410  14.824  1.00 0.00 ? 2   SER A O    7  
ATOM 11408 C CB   . SER A 1 2   ? -9.170  -4.083  11.929  1.00 0.00 ? 2   SER A CB   7  
ATOM 11409 O OG   . SER A 1 2   ? -9.318  -3.700  10.572  1.00 0.00 ? 2   SER A OG   7  
ATOM 11410 H H    . SER A 1 2   ? -9.389  -0.928  12.337  1.00 0.00 ? 2   SER A H    7  
ATOM 11411 H HA   . SER A 1 2   ? -10.670 -2.769  12.704  1.00 0.00 ? 2   SER A HA   7  
ATOM 11412 H HB2  . SER A 1 2   ? -8.131  -4.309  12.114  1.00 0.00 ? 2   SER A HB2  7  
ATOM 11413 H HB3  . SER A 1 2   ? -9.767  -4.964  12.109  1.00 0.00 ? 2   SER A HB3  7  
ATOM 11414 H HG   . SER A 1 2   ? -8.941  -2.828  10.442  1.00 0.00 ? 2   SER A HG   7  
ATOM 11415 N N    . SER A 1 3   ? -10.522 -3.732  14.985  1.00 0.00 ? 3   SER A N    7  
ATOM 11416 C CA   . SER A 1 3   ? -10.468 -4.160  16.379  1.00 0.00 ? 3   SER A CA   7  
ATOM 11417 C C    . SER A 1 3   ? -9.899  -3.058  17.265  1.00 0.00 ? 3   SER A C    7  
ATOM 11418 O O    . SER A 1 3   ? -9.618  -1.954  16.797  1.00 0.00 ? 3   SER A O    7  
ATOM 11419 C CB   . SER A 1 3   ? -9.621  -5.427  16.513  1.00 0.00 ? 3   SER A CB   7  
ATOM 11420 O OG   . SER A 1 3   ? -9.683  -5.944  17.831  1.00 0.00 ? 3   SER A OG   7  
ATOM 11421 H H    . SER A 1 3   ? -11.388 -3.696  14.529  1.00 0.00 ? 3   SER A H    7  
ATOM 11422 H HA   . SER A 1 3   ? -11.477 -4.377  16.697  1.00 0.00 ? 3   SER A HA   7  
ATOM 11423 H HB2  . SER A 1 3   ? -9.988  -6.177  15.828  1.00 0.00 ? 3   SER A HB2  7  
ATOM 11424 H HB3  . SER A 1 3   ? -8.593  -5.196  16.276  1.00 0.00 ? 3   SER A HB3  7  
ATOM 11425 H HG   . SER A 1 3   ? -10.339 -6.644  17.871  1.00 0.00 ? 3   SER A HG   7  
ATOM 11426 N N    . GLY A 1 4   ? -9.730  -3.364  18.547  1.00 0.00 ? 4   GLY A N    7  
ATOM 11427 C CA   . GLY A 1 4   ? -9.194  -2.388  19.478  1.00 0.00 ? 4   GLY A CA   7  
ATOM 11428 C C    . GLY A 1 4   ? -9.853  -2.466  20.842  1.00 0.00 ? 4   GLY A C    7  
ATOM 11429 O O    . GLY A 1 4   ? -10.841 -3.177  21.022  1.00 0.00 ? 4   GLY A O    7  
ATOM 11430 H H    . GLY A 1 4   ? -9.971  -4.260  18.863  1.00 0.00 ? 4   GLY A H    7  
ATOM 11431 H HA2  . GLY A 1 4   ? -8.135  -2.560  19.593  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 11432 H HA3  . GLY A 1 4   ? -9.347  -1.399  19.073  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 11433 N N    . SER A 1 5   ? -9.303  -1.732  21.805  1.00 0.00 ? 5   SER A N    7  
ATOM 11434 C CA   . SER A 1 5   ? -9.842  -1.720  23.159  1.00 0.00 ? 5   SER A CA   7  
ATOM 11435 C C    . SER A 1 5   ? -9.588  -0.375  23.835  1.00 0.00 ? 5   SER A C    7  
ATOM 11436 O O    . SER A 1 5   ? -9.442  -0.301  25.055  1.00 0.00 ? 5   SER A O    7  
ATOM 11437 C CB   . SER A 1 5   ? -9.222  -2.848  23.986  1.00 0.00 ? 5   SER A CB   7  
ATOM 11438 O OG   . SER A 1 5   ? -10.105 -3.953  24.085  1.00 0.00 ? 5   SER A OG   7  
ATOM 11439 H H    . SER A 1 5   ? -8.516  -1.185  21.599  1.00 0.00 ? 5   SER A H    7  
ATOM 11440 H HA   . SER A 1 5   ? -10.909 -1.879  23.092  1.00 0.00 ? 5   SER A HA   7  
ATOM 11441 H HB2  . SER A 1 5   ? -8.308  -3.176  23.515  1.00 0.00 ? 5   SER A HB2  7  
ATOM 11442 H HB3  . SER A 1 5   ? -9.005  -2.487  24.981  1.00 0.00 ? 5   SER A HB3  7  
ATOM 11443 H HG   . SER A 1 5   ? -10.552 -3.930  24.934  1.00 0.00 ? 5   SER A HG   7  
ATOM 11444 N N    . SER A 1 6   ? -9.538  0.684   23.034  1.00 0.00 ? 6   SER A N    7  
ATOM 11445 C CA   . SER A 1 6   ? -9.302  2.026   23.556  1.00 0.00 ? 6   SER A CA   7  
ATOM 11446 C C    . SER A 1 6   ? -7.964  2.099   24.286  1.00 0.00 ? 6   SER A C    7  
ATOM 11447 O O    . SER A 1 6   ? -7.858  1.711   25.449  1.00 0.00 ? 6   SER A O    7  
ATOM 11448 C CB   . SER A 1 6   ? -10.434 2.435   24.500  1.00 0.00 ? 6   SER A CB   7  
ATOM 11449 O OG   . SER A 1 6   ? -11.692 2.352   23.853  1.00 0.00 ? 6   SER A OG   7  
ATOM 11450 H H    . SER A 1 6   ? -9.663  0.562   22.070  1.00 0.00 ? 6   SER A H    7  
ATOM 11451 H HA   . SER A 1 6   ? -9.279  2.707   22.719  1.00 0.00 ? 6   SER A HA   7  
ATOM 11452 H HB2  . SER A 1 6   ? -10.440 1.778   25.357  1.00 0.00 ? 6   SER A HB2  7  
ATOM 11453 H HB3  . SER A 1 6   ? -10.277 3.453   24.827  1.00 0.00 ? 6   SER A HB3  7  
ATOM 11454 H HG   . SER A 1 6   ? -12.101 1.507   24.054  1.00 0.00 ? 6   SER A HG   7  
ATOM 11455 N N    . GLY A 1 7   ? -6.945  2.599   23.595  1.00 0.00 ? 7   GLY A N    7  
ATOM 11456 C CA   . GLY A 1 7   ? -5.628  2.714   24.194  1.00 0.00 ? 7   GLY A CA   7  
ATOM 11457 C C    . GLY A 1 7   ? -4.765  3.751   23.503  1.00 0.00 ? 7   GLY A C    7  
ATOM 11458 O O    . GLY A 1 7   ? -3.937  3.415   22.655  1.00 0.00 ? 7   GLY A O    7  
ATOM 11459 H H    . GLY A 1 7   ? -7.088  2.893   22.670  1.00 0.00 ? 7   GLY A H    7  
ATOM 11460 H HA2  . GLY A 1 7   ? -5.740  2.989   25.232  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 11461 H HA3  . GLY A 1 7   ? -5.135  1.756   24.138  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 11462 N N    . ASP A 1 8   ? -4.955  5.015   23.866  1.00 0.00 ? 8   ASP A N    7  
ATOM 11463 C CA   . ASP A 1 8   ? -4.187  6.105   23.276  1.00 0.00 ? 8   ASP A CA   7  
ATOM 11464 C C    . ASP A 1 8   ? -2.842  6.263   23.976  1.00 0.00 ? 8   ASP A C    7  
ATOM 11465 O O    . ASP A 1 8   ? -2.665  7.155   24.806  1.00 0.00 ? 8   ASP A O    7  
ATOM 11466 C CB   . ASP A 1 8   ? -4.975  7.413   23.355  1.00 0.00 ? 8   ASP A CB   7  
ATOM 11467 C CG   . ASP A 1 8   ? -5.877  7.620   22.155  1.00 0.00 ? 8   ASP A CG   7  
ATOM 11468 O OD1  . ASP A 1 8   ? -5.346  7.819   21.041  1.00 0.00 ? 8   ASP A OD1  7  
ATOM 11469 O OD2  . ASP A 1 8   ? -7.113  7.583   22.327  1.00 0.00 ? 8   ASP A OD2  7  
ATOM 11470 H H    . ASP A 1 8   ? -5.630  5.219   24.548  1.00 0.00 ? 8   ASP A H    7  
ATOM 11471 H HA   . ASP A 1 8   ? -4.013  5.863   22.238  1.00 0.00 ? 8   ASP A HA   7  
ATOM 11472 H HB2  . ASP A 1 8   ? -5.588  7.404   24.244  1.00 0.00 ? 8   ASP A HB2  7  
ATOM 11473 H HB3  . ASP A 1 8   ? -4.282  8.240   23.409  1.00 0.00 ? 8   ASP A HB3  7  
ATOM 11474 N N    . ARG A 1 9   ? -1.897  5.391   23.637  1.00 0.00 ? 9   ARG A N    7  
ATOM 11475 C CA   . ARG A 1 9   ? -0.568  5.435   24.234  1.00 0.00 ? 9   ARG A CA   7  
ATOM 11476 C C    . ARG A 1 9   ? 0.514   5.363   23.161  1.00 0.00 ? 9   ARG A C    7  
ATOM 11477 O O    . ARG A 1 9   ? 1.475   6.133   23.183  1.00 0.00 ? 9   ARG A O    7  
ATOM 11478 C CB   . ARG A 1 9   ? -0.396  4.285   25.230  1.00 0.00 ? 9   ARG A CB   7  
ATOM 11479 C CG   . ARG A 1 9   ? 0.202   4.716   26.559  1.00 0.00 ? 9   ARG A CG   7  
ATOM 11480 C CD   . ARG A 1 9   ? 0.251   3.563   27.549  1.00 0.00 ? 9   ARG A CD   7  
ATOM 11481 N NE   . ARG A 1 9   ? 0.166   4.025   28.933  1.00 0.00 ? 9   ARG A NE   7  
ATOM 11482 C CZ   . ARG A 1 9   ? 0.520   3.288   29.983  1.00 0.00 ? 9   ARG A CZ   7  
ATOM 11483 N NH1  . ARG A 1 9   ? 0.983   2.056   29.813  1.00 0.00 ? 9   ARG A NH1  7  
ATOM 11484 N NH2  . ARG A 1 9   ? 0.410   3.784   31.207  1.00 0.00 ? 9   ARG A NH2  7  
ATOM 11485 H H    . ARG A 1 9   ? -2.100  4.703   22.970  1.00 0.00 ? 9   ARG A H    7  
ATOM 11486 H HA   . ARG A 1 9   ? -0.473  6.372   24.762  1.00 0.00 ? 9   ARG A HA   7  
ATOM 11487 H HB2  . ARG A 1 9   ? -1.363  3.843   25.422  1.00 0.00 ? 9   ARG A HB2  7  
ATOM 11488 H HB3  . ARG A 1 9   ? 0.251   3.538   24.793  1.00 0.00 ? 9   ARG A HB3  7  
ATOM 11489 H HG2  . ARG A 1 9   ? 1.206   5.075   26.391  1.00 0.00 ? 9   ARG A HG2  7  
ATOM 11490 H HG3  . ARG A 1 9   ? -0.401  5.510   26.974  1.00 0.00 ? 9   ARG A HG3  7  
ATOM 11491 H HD2  . ARG A 1 9   ? -0.577  2.899   27.350  1.00 0.00 ? 9   ARG A HD2  7  
ATOM 11492 H HD3  . ARG A 1 9   ? 1.179   3.028   27.414  1.00 0.00 ? 9   ARG A HD3  7  
ATOM 11493 H HE   . ARG A 1 9   ? -0.174  4.931   29.087  1.00 0.00 ? 9   ARG A HE   7  
ATOM 11494 H HH11 . ARG A 1 9   ? 1.069   1.676   28.892  1.00 0.00 ? 9   ARG A HH11 7  
ATOM 11495 H HH12 . ARG A 1 9   ? 1.248   1.507   30.606  1.00 0.00 ? 9   ARG A HH12 7  
ATOM 11496 H HH21 . ARG A 1 9   ? 0.062   4.711   31.343  1.00 0.00 ? 9   ARG A HH21 7  
ATOM 11497 H HH22 . ARG A 1 9   ? 0.676   3.231   31.997  1.00 0.00 ? 9   ARG A HH22 7  
ATOM 11498 N N    . ARG A 1 10  ? 0.351   4.435   22.224  1.00 0.00 ? 10  ARG A N    7  
ATOM 11499 C CA   . ARG A 1 10  ? 1.313   4.264   21.142  1.00 0.00 ? 10  ARG A CA   7  
ATOM 11500 C C    . ARG A 1 10  ? 0.999   5.202   19.980  1.00 0.00 ? 10  ARG A C    7  
ATOM 11501 O O    . ARG A 1 10  ? 1.759   6.125   19.691  1.00 0.00 ? 10  ARG A O    7  
ATOM 11502 C CB   . ARG A 1 10  ? 1.315   2.814   20.656  1.00 0.00 ? 10  ARG A CB   7  
ATOM 11503 C CG   . ARG A 1 10  ? 2.424   2.507   19.662  1.00 0.00 ? 10  ARG A CG   7  
ATOM 11504 C CD   . ARG A 1 10  ? 2.973   1.102   19.856  1.00 0.00 ? 10  ARG A CD   7  
ATOM 11505 N NE   . ARG A 1 10  ? 3.937   0.743   18.819  1.00 0.00 ? 10  ARG A NE   7  
ATOM 11506 C CZ   . ARG A 1 10  ? 3.597   0.348   17.594  1.00 0.00 ? 10  ARG A CZ   7  
ATOM 11507 N NH1  . ARG A 1 10  ? 2.319   0.260   17.248  1.00 0.00 ? 10  ARG A NH1  7  
ATOM 11508 N NH2  . ARG A 1 10  ? 4.538   0.041   16.712  1.00 0.00 ? 10  ARG A NH2  7  
ATOM 11509 H H    . ARG A 1 10  ? -0.437  3.852   22.260  1.00 0.00 ? 10  ARG A H    7  
ATOM 11510 H HA   . ARG A 1 10  ? 2.291   4.506   21.529  1.00 0.00 ? 10  ARG A HA   7  
ATOM 11511 H HB2  . ARG A 1 10  ? 1.433   2.161   21.508  1.00 0.00 ? 10  ARG A HB2  7  
ATOM 11512 H HB3  . ARG A 1 10  ? 0.368   2.604   20.182  1.00 0.00 ? 10  ARG A HB3  7  
ATOM 11513 H HG2  . ARG A 1 10  ? 2.031   2.593   18.661  1.00 0.00 ? 10  ARG A HG2  7  
ATOM 11514 H HG3  . ARG A 1 10  ? 3.225   3.219   19.800  1.00 0.00 ? 10  ARG A HG3  7  
ATOM 11515 H HD2  . ARG A 1 10  ? 3.457   1.048   20.819  1.00 0.00 ? 10  ARG A HD2  7  
ATOM 11516 H HD3  . ARG A 1 10  ? 2.150   0.402   19.829  1.00 0.00 ? 10  ARG A HD3  7  
ATOM 11517 H HE   . ARG A 1 10  ? 4.889   0.799   19.047  1.00 0.00 ? 10  ARG A HE   7  
ATOM 11518 H HH11 . ARG A 1 10  ? 1.604   0.491   17.908  1.00 0.00 ? 10  ARG A HH11 7  
ATOM 11519 H HH12 . ARG A 1 10  ? 2.070   -0.036  16.326  1.00 0.00 ? 10  ARG A HH12 7  
ATOM 11520 H HH21 . ARG A 1 10  ? 5.503   0.106   16.967  1.00 0.00 ? 10  ARG A HH21 7  
ATOM 11521 H HH22 . ARG A 1 10  ? 4.283   -0.256  15.792  1.00 0.00 ? 10  ARG A HH22 7  
ATOM 11522 N N    . SER A 1 11  ? -0.126  4.956   19.317  1.00 0.00 ? 11  SER A N    7  
ATOM 11523 C CA   . SER A 1 11  ? -0.541  5.778   18.185  1.00 0.00 ? 11  SER A CA   7  
ATOM 11524 C C    . SER A 1 11  ? 0.494   5.725   17.066  1.00 0.00 ? 11  SER A C    7  
ATOM 11525 O O    . SER A 1 11  ? 1.588   5.191   17.244  1.00 0.00 ? 11  SER A O    7  
ATOM 11526 C CB   . SER A 1 11  ? -0.754  7.225   18.631  1.00 0.00 ? 11  SER A CB   7  
ATOM 11527 O OG   . SER A 1 11  ? -2.114  7.464   18.957  1.00 0.00 ? 11  SER A OG   7  
ATOM 11528 H H    . SER A 1 11  ? -0.691  4.205   19.594  1.00 0.00 ? 11  SER A H    7  
ATOM 11529 H HA   . SER A 1 11  ? -1.476  5.383   17.814  1.00 0.00 ? 11  SER A HA   7  
ATOM 11530 H HB2  . SER A 1 11  ? -0.150  7.425   19.502  1.00 0.00 ? 11  SER A HB2  7  
ATOM 11531 H HB3  . SER A 1 11  ? -0.466  7.892   17.833  1.00 0.00 ? 11  SER A HB3  7  
ATOM 11532 H HG   . SER A 1 11  ? -2.449  6.736   19.486  1.00 0.00 ? 11  SER A HG   7  
ATOM 11533 N N    . THR A 1 12  ? 0.139   6.281   15.912  1.00 0.00 ? 12  THR A N    7  
ATOM 11534 C CA   . THR A 1 12  ? 1.036   6.298   14.762  1.00 0.00 ? 12  THR A CA   7  
ATOM 11535 C C    . THR A 1 12  ? 1.348   7.729   14.336  1.00 0.00 ? 12  THR A C    7  
ATOM 11536 O O    . THR A 1 12  ? 2.484   8.189   14.453  1.00 0.00 ? 12  THR A O    7  
ATOM 11537 C CB   . THR A 1 12  ? 0.417   5.528   13.595  1.00 0.00 ? 12  THR A CB   7  
ATOM 11538 O OG1  . THR A 1 12  ? -0.474  4.532   14.067  1.00 0.00 ? 12  THR A OG1  7  
ATOM 11539 C CG2