data_1UIR
# 
_entry.id   1UIR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UIR         
RCSB  RCSB005867   
WWPDB D_1000005867 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      1inl           . unspecified 
PDB      1iy9           . unspecified 
PDB      1jq3           . unspecified 
PDB      1mjf           . unspecified 
TargetDB ttk003000339.1 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UIR 
_pdbx_database_status.recvd_initial_deposition_date   2003-07-18 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ganbe, T.'                                              1 
'Ohnuma, M.'                                             2 
'Sato, T.'                                               3 
'Kumasaka, T.'                                           4 
'Oshima, T.'                                             5 
'Tanaka, N.'                                             6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures and enzymatic properties of a triamine/agmatine aminopropyltransferase from Thermus thermophilus' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            408 
_citation.page_first                971 
_citation.page_last                 986 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21458463 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2011.03.025 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ohnuma, M.'    1  
primary 'Ganbe, T.'     2  
primary 'Terui, Y.'     3  
primary 'Niitsu, M.'    4  
primary 'Sato, T.'      5  
primary 'Tanaka, N.'    6  
primary 'Tamakoshi, M.' 7  
primary 'Samejima, K.'  8  
primary 'Kumasaka, T.'  9  
primary 'Oshima, T.'    10 
# 
_cell.entry_id           1UIR 
_cell.length_a           87.775 
_cell.length_b           87.775 
_cell.length_c           190.825 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1UIR 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Polyamine Aminopropyltransferase' 36086.266 2   '2.5.1.16, 2.5.1.22' ? ? ? 
2 water   nat water                              18.015    373 ?                    ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKR
VLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLT
DPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQTGMILLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLAS
DAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPYKG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKR
VLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLT
DPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQTGMILLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLAS
DAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPYKG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ttk003000339.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   TYR n 
1 4   GLY n 
1 5   MET n 
1 6   TYR n 
1 7   PHE n 
1 8   PHE n 
1 9   GLU n 
1 10  HIS n 
1 11  VAL n 
1 12  THR n 
1 13  PRO n 
1 14  TYR n 
1 15  GLU n 
1 16  THR n 
1 17  LEU n 
1 18  VAL n 
1 19  ARG n 
1 20  ARG n 
1 21  MET n 
1 22  GLU n 
1 23  ARG n 
1 24  VAL n 
1 25  ILE n 
1 26  ALA n 
1 27  SER n 
1 28  GLY n 
1 29  LYS n 
1 30  THR n 
1 31  PRO n 
1 32  PHE n 
1 33  GLN n 
1 34  ASP n 
1 35  TYR n 
1 36  PHE n 
1 37  LEU n 
1 38  PHE n 
1 39  GLU n 
1 40  SER n 
1 41  LYS n 
1 42  GLY n 
1 43  PHE n 
1 44  GLY n 
1 45  LYS n 
1 46  VAL n 
1 47  LEU n 
1 48  ILE n 
1 49  LEU n 
1 50  ASP n 
1 51  LYS n 
1 52  ASP n 
1 53  VAL n 
1 54  GLN n 
1 55  SER n 
1 56  THR n 
1 57  GLU n 
1 58  ARG n 
1 59  ASP n 
1 60  GLU n 
1 61  TYR n 
1 62  ILE n 
1 63  TYR n 
1 64  HIS n 
1 65  GLU n 
1 66  THR n 
1 67  LEU n 
1 68  VAL n 
1 69  HIS n 
1 70  PRO n 
1 71  ALA n 
1 72  MET n 
1 73  LEU n 
1 74  THR n 
1 75  HIS n 
1 76  PRO n 
1 77  GLU n 
1 78  PRO n 
1 79  LYS n 
1 80  ARG n 
1 81  VAL n 
1 82  LEU n 
1 83  ILE n 
1 84  VAL n 
1 85  GLY n 
1 86  GLY n 
1 87  GLY n 
1 88  GLU n 
1 89  GLY n 
1 90  ALA n 
1 91  THR n 
1 92  LEU n 
1 93  ARG n 
1 94  GLU n 
1 95  VAL n 
1 96  LEU n 
1 97  LYS n 
1 98  HIS n 
1 99  PRO n 
1 100 THR n 
1 101 VAL n 
1 102 GLU n 
1 103 LYS n 
1 104 ALA n 
1 105 VAL n 
1 106 MET n 
1 107 VAL n 
1 108 ASP n 
1 109 ILE n 
1 110 ASP n 
1 111 GLY n 
1 112 GLU n 
1 113 LEU n 
1 114 VAL n 
1 115 GLU n 
1 116 VAL n 
1 117 ALA n 
1 118 LYS n 
1 119 ARG n 
1 120 HIS n 
1 121 MET n 
1 122 PRO n 
1 123 GLU n 
1 124 TRP n 
1 125 HIS n 
1 126 GLN n 
1 127 GLY n 
1 128 ALA n 
1 129 PHE n 
1 130 ASP n 
1 131 ASP n 
1 132 PRO n 
1 133 ARG n 
1 134 ALA n 
1 135 VAL n 
1 136 LEU n 
1 137 VAL n 
1 138 ILE n 
1 139 ASP n 
1 140 ASP n 
1 141 ALA n 
1 142 ARG n 
1 143 ALA n 
1 144 TYR n 
1 145 LEU n 
1 146 GLU n 
1 147 ARG n 
1 148 THR n 
1 149 GLU n 
1 150 GLU n 
1 151 ARG n 
1 152 TYR n 
1 153 ASP n 
1 154 VAL n 
1 155 VAL n 
1 156 ILE n 
1 157 ILE n 
1 158 ASP n 
1 159 LEU n 
1 160 THR n 
1 161 ASP n 
1 162 PRO n 
1 163 VAL n 
1 164 GLY n 
1 165 GLU n 
1 166 ASP n 
1 167 ASN n 
1 168 PRO n 
1 169 ALA n 
1 170 ARG n 
1 171 LEU n 
1 172 LEU n 
1 173 TYR n 
1 174 THR n 
1 175 VAL n 
1 176 GLU n 
1 177 PHE n 
1 178 TYR n 
1 179 ARG n 
1 180 LEU n 
1 181 VAL n 
1 182 LYS n 
1 183 ALA n 
1 184 HIS n 
1 185 LEU n 
1 186 ASN n 
1 187 PRO n 
1 188 GLY n 
1 189 GLY n 
1 190 VAL n 
1 191 MET n 
1 192 GLY n 
1 193 MET n 
1 194 GLN n 
1 195 THR n 
1 196 GLY n 
1 197 MET n 
1 198 ILE n 
1 199 LEU n 
1 200 LEU n 
1 201 THR n 
1 202 HIS n 
1 203 HIS n 
1 204 ARG n 
1 205 VAL n 
1 206 HIS n 
1 207 PRO n 
1 208 VAL n 
1 209 VAL n 
1 210 HIS n 
1 211 ARG n 
1 212 THR n 
1 213 VAL n 
1 214 ARG n 
1 215 GLU n 
1 216 ALA n 
1 217 PHE n 
1 218 ARG n 
1 219 TYR n 
1 220 VAL n 
1 221 ARG n 
1 222 SER n 
1 223 TYR n 
1 224 LYS n 
1 225 ASN n 
1 226 HIS n 
1 227 ILE n 
1 228 PRO n 
1 229 GLY n 
1 230 PHE n 
1 231 PHE n 
1 232 LEU n 
1 233 ASN n 
1 234 PHE n 
1 235 GLY n 
1 236 PHE n 
1 237 LEU n 
1 238 LEU n 
1 239 ALA n 
1 240 SER n 
1 241 ASP n 
1 242 ALA n 
1 243 PHE n 
1 244 ASP n 
1 245 PRO n 
1 246 ALA n 
1 247 ALA n 
1 248 PHE n 
1 249 SER n 
1 250 GLU n 
1 251 GLY n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ALA n 
1 256 ARG n 
1 257 ILE n 
1 258 ARG n 
1 259 GLU n 
1 260 ARG n 
1 261 ASN n 
1 262 LEU n 
1 263 ALA n 
1 264 LEU n 
1 265 ARG n 
1 266 HIS n 
1 267 LEU n 
1 268 THR n 
1 269 ALA n 
1 270 PRO n 
1 271 TYR n 
1 272 LEU n 
1 273 GLU n 
1 274 ALA n 
1 275 MET n 
1 276 PHE n 
1 277 VAL n 
1 278 LEU n 
1 279 PRO n 
1 280 LYS n 
1 281 ASP n 
1 282 LEU n 
1 283 LEU n 
1 284 GLU n 
1 285 ALA n 
1 286 LEU n 
1 287 GLU n 
1 288 LYS n 
1 289 GLU n 
1 290 THR n 
1 291 MET n 
1 292 VAL n 
1 293 SER n 
1 294 THR n 
1 295 ASP n 
1 296 GLN n 
1 297 ASN n 
1 298 PRO n 
1 299 PHE n 
1 300 TYR n 
1 301 VAL n 
1 302 THR n 
1 303 PRO n 
1 304 GLU n 
1 305 GLY n 
1 306 GLU n 
1 307 ALA n 
1 308 ARG n 
1 309 GLN n 
1 310 ALA n 
1 311 PRO n 
1 312 TYR n 
1 313 LYS n 
1 314 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     274 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P83816_THETH 
_struct_ref.pdbx_db_accession          P83816 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UIR A 1 ? 314 ? P83816 1 ? 314 ? 1 314 
2 1 1UIR B 1 ? 314 ? P83816 1 ? 314 ? 1 314 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1UIR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   48.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'Ammonium sulfate, MES, Norspermidine, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-05-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     1UIR 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.84 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   49522 
_reflns.number_all                   561274 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.035 
_reflns.pdbx_Rsym_value              0.033 
_reflns.pdbx_netI_over_sigmaI        15.6 
_reflns.B_iso_Wilson_estimate        19.4 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   85.0 
_reflns_shell.Rmerge_I_obs           0.159 
_reflns_shell.pdbx_Rsym_value        0.151 
_reflns_shell.meanI_over_sigI_obs    5.1 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6176 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1UIR 
_refine.ls_number_reflns_obs                     49436 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2851636.47 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.87 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    96.4 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  4972 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               32.9 
_refine.aniso_B[1][1]                            -0.99 
_refine.aniso_B[2][2]                            -0.99 
_refine.aniso_B[3][3]                            1.97 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.372936 
_refine.solvent_model_param_bsol                 52.0467 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1INL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             OVERALL 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1UIR 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.14 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.28 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5042 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             373 
_refine_hist.number_atoms_total               5415 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        39.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.93  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             6399 
_refine_ls_shell.R_factor_R_work                  0.215 
_refine_ls_shell.percent_reflns_obs               85.2 
_refine_ls_shell.R_factor_R_free                  0.269 
_refine_ls_shell.R_factor_R_free_error            0.010 
_refine_ls_shell.percent_reflns_R_free            10.1 
_refine_ls_shell.number_reflns_R_free             721 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1UIR 
_struct.title                     'Crystal Structure of Polyamine Aminopropyltransfease from Thermus thermophilus' 
_struct.pdbx_descriptor           'Polyamine Aminopropyltransfease(E.C.2.5.1.16, 2.5.1.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UIR 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;Spermidien Synthase, Spermine Synthase, Polyamine, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, transferase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assembly is a tetramer constructed from chain A and chain B and a symmetry partner generated by crystallographic symmetry.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 59  ? HIS A 75  ? ASP A 59  HIS A 75  1 ? 17 
HELX_P HELX_P2  2  GLY A 89  ? LEU A 96  ? GLY A 89  LEU A 96  1 ? 8  
HELX_P HELX_P3  3  ASP A 110 ? MET A 121 ? ASP A 110 MET A 121 1 ? 12 
HELX_P HELX_P4  4  MET A 121 ? GLN A 126 ? MET A 121 GLN A 126 1 ? 6  
HELX_P HELX_P5  5  GLY A 127 ? ASP A 131 ? GLY A 127 ASP A 131 5 ? 5  
HELX_P HELX_P6  6  ASP A 140 ? THR A 148 ? ASP A 140 THR A 148 1 ? 9  
HELX_P HELX_P7  7  ASN A 167 ? TYR A 173 ? ASN A 167 TYR A 173 5 ? 7  
HELX_P HELX_P8  8  THR A 174 ? HIS A 184 ? THR A 174 HIS A 184 1 ? 11 
HELX_P HELX_P9  9  ARG A 204 ? GLU A 215 ? ARG A 204 GLU A 215 1 ? 12 
HELX_P HELX_P10 10 PRO A 228 ? PHE A 231 ? PRO A 228 PHE A 231 5 ? 4  
HELX_P HELX_P11 11 GLY A 251 ? ARG A 260 ? GLY A 251 ARG A 260 1 ? 10 
HELX_P HELX_P12 12 THR A 268 ? MET A 275 ? THR A 268 MET A 275 1 ? 8  
HELX_P HELX_P13 13 PRO A 279 ? GLU A 289 ? PRO A 279 GLU A 289 1 ? 11 
HELX_P HELX_P14 14 ASP B 59  ? HIS B 75  ? ASP B 59  HIS B 75  1 ? 17 
HELX_P HELX_P15 15 GLY B 89  ? LYS B 97  ? GLY B 89  LYS B 97  1 ? 9  
HELX_P HELX_P16 16 ASP B 110 ? MET B 121 ? ASP B 110 MET B 121 1 ? 12 
HELX_P HELX_P17 17 MET B 121 ? GLN B 126 ? MET B 121 GLN B 126 1 ? 6  
HELX_P HELX_P18 18 GLY B 127 ? ASP B 131 ? GLY B 127 ASP B 131 5 ? 5  
HELX_P HELX_P19 19 ASP B 140 ? ARG B 147 ? ASP B 140 ARG B 147 1 ? 8  
HELX_P HELX_P20 20 ASN B 167 ? TYR B 173 ? ASN B 167 TYR B 173 5 ? 7  
HELX_P HELX_P21 21 THR B 174 ? ALA B 183 ? THR B 174 ALA B 183 1 ? 10 
HELX_P HELX_P22 22 ARG B 204 ? GLU B 215 ? ARG B 204 GLU B 215 1 ? 12 
HELX_P HELX_P23 23 PRO B 228 ? PHE B 231 ? PRO B 228 PHE B 231 5 ? 4  
HELX_P HELX_P24 24 SER B 249 ? ARG B 260 ? SER B 249 ARG B 260 1 ? 12 
HELX_P HELX_P25 25 THR B 268 ? MET B 275 ? THR B 268 MET B 275 1 ? 8  
HELX_P HELX_P26 26 PRO B 279 ? GLU B 289 ? PRO B 279 GLU B 289 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 7 ? 
D ? 2 ? 
E ? 4 ? 
F ? 7 ? 
G ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 6   ? HIS A 10  ? TYR A 6   HIS A 10  
A 2 GLU A 15  ? ARG A 20  ? GLU A 15  ARG A 20  
A 3 GLU B 15  ? ARG B 20  ? GLU B 15  ARG B 20  
A 4 TYR B 6   ? HIS B 10  ? TYR B 6   HIS B 10  
B 1 ARG A 23  ? LYS A 29  ? ARG A 23  LYS A 29  
B 2 ASP A 34  ? SER A 40  ? ASP A 34  SER A 40  
B 3 GLY A 44  ? LEU A 49  ? GLY A 44  LEU A 49  
B 4 ASP A 52  ? THR A 56  ? ASP A 52  THR A 56  
C 1 ALA A 134 ? ILE A 138 ? ALA A 134 ILE A 138 
C 2 LYS A 103 ? ASP A 108 ? LYS A 103 ASP A 108 
C 3 ARG A 80  ? GLY A 85  ? ARG A 80  GLY A 85  
C 4 TYR A 152 ? ASP A 158 ? TYR A 152 ASP A 158 
C 5 LEU A 185 ? ILE A 198 ? LEU A 185 ILE A 198 
C 6 ASN A 233 ? SER A 240 ? ASN A 233 SER A 240 
C 7 TYR A 219 ? HIS A 226 ? TYR A 219 HIS A 226 
D 1 PHE A 299 ? VAL A 301 ? PHE A 299 VAL A 301 
D 2 ALA A 307 ? GLN A 309 ? ALA A 307 GLN A 309 
E 1 ARG B 23  ? LYS B 29  ? ARG B 23  LYS B 29  
E 2 ASP B 34  ? SER B 40  ? ASP B 34  SER B 40  
E 3 GLY B 44  ? LEU B 49  ? GLY B 44  LEU B 49  
E 4 ASP B 52  ? THR B 56  ? ASP B 52  THR B 56  
F 1 ALA B 134 ? ILE B 138 ? ALA B 134 ILE B 138 
F 2 LYS B 103 ? ASP B 108 ? LYS B 103 ASP B 108 
F 3 ARG B 80  ? GLY B 85  ? ARG B 80  GLY B 85  
F 4 TYR B 152 ? ASP B 158 ? TYR B 152 ASP B 158 
F 5 LEU B 185 ? MET B 197 ? LEU B 185 MET B 197 
F 6 ASN B 233 ? SER B 240 ? ASN B 233 SER B 240 
F 7 TYR B 219 ? HIS B 226 ? TYR B 219 HIS B 226 
G 1 PHE B 299 ? VAL B 301 ? PHE B 299 VAL B 301 
G 2 ALA B 307 ? GLN B 309 ? ALA B 307 GLN B 309 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 9   ? N GLU A 9   O LEU A 17  ? O LEU A 17  
A 2 3 N VAL A 18  ? N VAL A 18  O THR B 16  ? O THR B 16  
A 3 4 O LEU B 17  ? O LEU B 17  N GLU B 9   ? N GLU B 9   
B 1 2 N ALA A 26  ? N ALA A 26  O LEU A 37  ? O LEU A 37  
B 2 3 N PHE A 36  ? N PHE A 36  O ILE A 48  ? O ILE A 48  
B 3 4 N LEU A 47  ? N LEU A 47  O GLN A 54  ? O GLN A 54  
C 1 2 O VAL A 137 ? O VAL A 137 N MET A 106 ? N MET A 106 
C 2 3 O VAL A 105 ? O VAL A 105 N ILE A 83  ? N ILE A 83  
C 3 4 N VAL A 84  ? N VAL A 84  O ASP A 158 ? O ASP A 158 
C 4 5 N TYR A 152 ? N TYR A 152 O ASN A 186 ? O ASN A 186 
C 5 6 N ILE A 198 ? N ILE A 198 O ASN A 233 ? O ASN A 233 
C 6 7 O LEU A 238 ? O LEU A 238 N ARG A 221 ? N ARG A 221 
D 1 2 N TYR A 300 ? N TYR A 300 O ARG A 308 ? O ARG A 308 
E 1 2 N ALA B 26  ? N ALA B 26  O LEU B 37  ? O LEU B 37  
E 2 3 N PHE B 36  ? N PHE B 36  O ILE B 48  ? O ILE B 48  
E 3 4 N LEU B 47  ? N LEU B 47  O GLN B 54  ? O GLN B 54  
F 1 2 O VAL B 137 ? O VAL B 137 N MET B 106 ? N MET B 106 
F 2 3 O VAL B 105 ? O VAL B 105 N ILE B 83  ? N ILE B 83  
F 3 4 N VAL B 84  ? N VAL B 84  O ASP B 158 ? O ASP B 158 
F 4 5 N TYR B 152 ? N TYR B 152 O ASN B 186 ? O ASN B 186 
F 5 6 N MET B 191 ? N MET B 191 O ALA B 239 ? O ALA B 239 
F 6 7 O PHE B 234 ? O PHE B 234 N ASN B 225 ? N ASN B 225 
G 1 2 N TYR B 300 ? N TYR B 300 O ARG B 308 ? O ARG B 308 
# 
_database_PDB_matrix.entry_id          1UIR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UIR 
_atom_sites.fract_transf_matrix[1][1]   0.011393 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011393 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005240 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 44.431 42.395 140.917 1.00 40.08 ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 45.309 43.504 140.434 1.00 38.59 ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 46.276 43.940 141.528 1.00 37.22 ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 46.054 43.680 142.711 1.00 35.04 ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 44.460 44.702 140.003 1.00 37.61 ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 43.449 45.139 141.038 1.00 38.29 ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 42.704 46.702 140.575 1.00 41.90 ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 43.496 47.809 141.766 1.00 42.18 ? 1   MET A CE  1 
ATOM   9    N N   . ASP A 1 2   ? 47.343 44.617 141.125 1.00 35.07 ? 2   ASP A N   1 
ATOM   10   C CA  . ASP A 1 2   ? 48.347 45.089 142.068 1.00 36.89 ? 2   ASP A CA  1 
ATOM   11   C C   . ASP A 1 2   ? 47.889 46.306 142.876 1.00 34.96 ? 2   ASP A C   1 
ATOM   12   O O   . ASP A 1 2   ? 47.064 47.103 142.422 1.00 32.90 ? 2   ASP A O   1 
ATOM   13   C CB  . ASP A 1 2   ? 49.631 45.435 141.313 1.00 39.93 ? 2   ASP A CB  1 
ATOM   14   C CG  . ASP A 1 2   ? 50.233 44.231 140.599 1.00 41.06 ? 2   ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 2   ? 50.999 44.442 139.638 1.00 42.07 ? 2   ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 2   ? 49.946 43.080 141.003 1.00 41.00 ? 2   ASP A OD2 1 
ATOM   17   N N   . TYR A 1 3   ? 48.413 46.434 144.088 1.00 31.00 ? 3   TYR A N   1 
ATOM   18   C CA  . TYR A 1 3   ? 48.083 47.586 144.918 1.00 29.12 ? 3   TYR A CA  1 
ATOM   19   C C   . TYR A 1 3   ? 48.849 48.724 144.251 1.00 26.08 ? 3   TYR A C   1 
ATOM   20   O O   . TYR A 1 3   ? 49.712 48.479 143.408 1.00 29.23 ? 3   TYR A O   1 
ATOM   21   C CB  . TYR A 1 3   ? 48.568 47.356 146.352 1.00 26.22 ? 3   TYR A CB  1 
ATOM   22   C CG  . TYR A 1 3   ? 47.842 46.222 147.049 1.00 26.43 ? 3   TYR A CG  1 
ATOM   23   C CD1 . TYR A 1 3   ? 46.505 46.352 147.436 1.00 24.22 ? 3   TYR A CD1 1 
ATOM   24   C CD2 . TYR A 1 3   ? 48.484 45.004 147.295 1.00 25.45 ? 3   TYR A CD2 1 
ATOM   25   C CE1 . TYR A 1 3   ? 45.825 45.296 148.055 1.00 24.27 ? 3   TYR A CE1 1 
ATOM   26   C CE2 . TYR A 1 3   ? 47.816 43.945 147.907 1.00 24.10 ? 3   TYR A CE2 1 
ATOM   27   C CZ  . TYR A 1 3   ? 46.492 44.098 148.286 1.00 23.99 ? 3   TYR A CZ  1 
ATOM   28   O OH  . TYR A 1 3   ? 45.848 43.058 148.912 1.00 25.24 ? 3   TYR A OH  1 
ATOM   29   N N   . GLY A 1 4   ? 48.540 49.962 144.591 1.00 24.38 ? 4   GLY A N   1 
ATOM   30   C CA  . GLY A 1 4   ? 49.250 51.056 143.951 1.00 22.37 ? 4   GLY A CA  1 
ATOM   31   C C   . GLY A 1 4   ? 48.341 52.209 143.585 1.00 18.98 ? 4   GLY A C   1 
ATOM   32   O O   . GLY A 1 4   ? 47.203 52.293 144.071 1.00 19.74 ? 4   GLY A O   1 
ATOM   33   N N   . MET A 1 5   ? 48.840 53.107 142.738 1.00 19.20 ? 5   MET A N   1 
ATOM   34   C CA  . MET A 1 5   ? 48.073 54.270 142.309 1.00 20.46 ? 5   MET A CA  1 
ATOM   35   C C   . MET A 1 5   ? 47.232 53.902 141.100 1.00 22.68 ? 5   MET A C   1 
ATOM   36   O O   . MET A 1 5   ? 47.709 53.252 140.170 1.00 23.88 ? 5   MET A O   1 
ATOM   37   C CB  . MET A 1 5   ? 49.004 55.434 141.947 1.00 20.49 ? 5   MET A CB  1 
ATOM   38   C CG  . MET A 1 5   ? 49.849 55.921 143.114 1.00 18.96 ? 5   MET A CG  1 
ATOM   39   S SD  . MET A 1 5   ? 50.825 57.349 142.672 1.00 24.96 ? 5   MET A SD  1 
ATOM   40   C CE  . MET A 1 5   ? 52.006 56.604 141.500 1.00 20.77 ? 5   MET A CE  1 
ATOM   41   N N   . TYR A 1 6   ? 45.982 54.337 141.110 1.00 21.08 ? 6   TYR A N   1 
ATOM   42   C CA  . TYR A 1 6   ? 45.086 54.015 140.024 1.00 23.72 ? 6   TYR A CA  1 
ATOM   43   C C   . TYR A 1 6   ? 44.170 55.160 139.732 1.00 23.31 ? 6   TYR A C   1 
ATOM   44   O O   . TYR A 1 6   ? 43.934 56.029 140.573 1.00 22.76 ? 6   TYR A O   1 
ATOM   45   C CB  . TYR A 1 6   ? 44.210 52.804 140.381 1.00 23.98 ? 6   TYR A CB  1 
ATOM   46   C CG  . TYR A 1 6   ? 44.919 51.475 140.335 1.00 25.26 ? 6   TYR A CG  1 
ATOM   47   C CD1 . TYR A 1 6   ? 45.700 51.037 141.405 1.00 21.10 ? 6   TYR A CD1 1 
ATOM   48   C CD2 . TYR A 1 6   ? 44.817 50.658 139.207 1.00 24.90 ? 6   TYR A CD2 1 
ATOM   49   C CE1 . TYR A 1 6   ? 46.360 49.824 141.351 1.00 28.52 ? 6   TYR A CE1 1 
ATOM   50   C CE2 . TYR A 1 6   ? 45.471 49.447 139.137 1.00 25.51 ? 6   TYR A CE2 1 
ATOM   51   C CZ  . TYR A 1 6   ? 46.241 49.029 140.206 1.00 27.76 ? 6   TYR A CZ  1 
ATOM   52   O OH  . TYR A 1 6   ? 46.890 47.820 140.121 1.00 30.27 ? 6   TYR A OH  1 
ATOM   53   N N   . PHE A 1 7   ? 43.640 55.157 138.521 1.00 22.24 ? 7   PHE A N   1 
ATOM   54   C CA  . PHE A 1 7   ? 42.694 56.174 138.172 1.00 19.40 ? 7   PHE A CA  1 
ATOM   55   C C   . PHE A 1 7   ? 41.380 55.459 137.908 1.00 24.15 ? 7   PHE A C   1 
ATOM   56   O O   . PHE A 1 7   ? 41.348 54.440 137.207 1.00 22.76 ? 7   PHE A O   1 
ATOM   57   C CB  . PHE A 1 7   ? 43.134 56.939 136.941 1.00 21.30 ? 7   PHE A CB  1 
ATOM   58   C CG  . PHE A 1 7   ? 42.245 58.090 136.642 1.00 25.38 ? 7   PHE A CG  1 
ATOM   59   C CD1 . PHE A 1 7   ? 41.033 57.894 135.993 1.00 27.25 ? 7   PHE A CD1 1 
ATOM   60   C CD2 . PHE A 1 7   ? 42.556 59.358 137.126 1.00 25.79 ? 7   PHE A CD2 1 
ATOM   61   C CE1 . PHE A 1 7   ? 40.141 58.944 135.839 1.00 30.12 ? 7   PHE A CE1 1 
ATOM   62   C CE2 . PHE A 1 7   ? 41.676 60.400 136.975 1.00 27.86 ? 7   PHE A CE2 1 
ATOM   63   C CZ  . PHE A 1 7   ? 40.462 60.194 136.332 1.00 27.92 ? 7   PHE A CZ  1 
ATOM   64   N N   . PHE A 1 8   ? 40.299 55.981 138.476 1.00 24.06 ? 8   PHE A N   1 
ATOM   65   C CA  . PHE A 1 8   ? 38.975 55.384 138.293 1.00 24.01 ? 8   PHE A CA  1 
ATOM   66   C C   . PHE A 1 8   ? 38.288 56.032 137.113 1.00 23.55 ? 8   PHE A C   1 
ATOM   67   O O   . PHE A 1 8   ? 37.759 57.146 137.226 1.00 23.57 ? 8   PHE A O   1 
ATOM   68   C CB  . PHE A 1 8   ? 38.112 55.585 139.541 1.00 24.94 ? 8   PHE A CB  1 
ATOM   69   C CG  . PHE A 1 8   ? 38.109 54.419 140.461 1.00 27.03 ? 8   PHE A CG  1 
ATOM   70   C CD1 . PHE A 1 8   ? 39.221 54.125 141.240 1.00 31.57 ? 8   PHE A CD1 1 
ATOM   71   C CD2 . PHE A 1 8   ? 36.993 53.600 140.548 1.00 32.88 ? 8   PHE A CD2 1 
ATOM   72   C CE1 . PHE A 1 8   ? 39.220 53.028 142.096 1.00 36.31 ? 8   PHE A CE1 1 
ATOM   73   C CE2 . PHE A 1 8   ? 36.980 52.499 141.402 1.00 35.78 ? 8   PHE A CE2 1 
ATOM   74   C CZ  . PHE A 1 8   ? 38.100 52.214 142.179 1.00 35.24 ? 8   PHE A CZ  1 
ATOM   75   N N   . GLU A 1 9   ? 38.278 55.342 135.979 1.00 19.70 ? 9   GLU A N   1 
ATOM   76   C CA  . GLU A 1 9   ? 37.664 55.916 134.799 1.00 22.17 ? 9   GLU A CA  1 
ATOM   77   C C   . GLU A 1 9   ? 36.232 55.482 134.554 1.00 22.55 ? 9   GLU A C   1 
ATOM   78   O O   . GLU A 1 9   ? 35.923 54.291 134.479 1.00 20.26 ? 9   GLU A O   1 
ATOM   79   C CB  . GLU A 1 9   ? 38.469 55.596 133.537 1.00 23.55 ? 9   GLU A CB  1 
ATOM   80   C CG  . GLU A 1 9   ? 37.915 56.352 132.324 1.00 26.47 ? 9   GLU A CG  1 
ATOM   81   C CD  . GLU A 1 9   ? 38.110 55.618 131.009 1.00 25.50 ? 9   GLU A CD  1 
ATOM   82   O OE1 . GLU A 1 9   ? 38.751 54.554 131.008 1.00 25.09 ? 9   GLU A OE1 1 
ATOM   83   O OE2 . GLU A 1 9   ? 37.614 56.116 129.979 1.00 24.79 ? 9   GLU A OE2 1 
ATOM   84   N N   . HIS A 1 10  ? 35.355 56.463 134.421 1.00 25.74 ? 10  HIS A N   1 
ATOM   85   C CA  . HIS A 1 10  ? 33.969 56.167 134.131 1.00 30.55 ? 10  HIS A CA  1 
ATOM   86   C C   . HIS A 1 10  ? 33.963 55.643 132.700 1.00 30.18 ? 10  HIS A C   1 
ATOM   87   O O   . HIS A 1 10  ? 34.734 56.115 131.848 1.00 29.90 ? 10  HIS A O   1 
ATOM   88   C CB  . HIS A 1 10  ? 33.113 57.440 134.208 1.00 33.83 ? 10  HIS A CB  1 
ATOM   89   C CG  . HIS A 1 10  ? 31.936 57.433 133.278 1.00 33.85 ? 10  HIS A CG  1 
ATOM   90   N ND1 . HIS A 1 10  ? 32.049 57.715 131.932 1.00 33.53 ? 10  HIS A ND1 1 
ATOM   91   C CD2 . HIS A 1 10  ? 30.624 57.161 133.498 1.00 31.92 ? 10  HIS A CD2 1 
ATOM   92   C CE1 . HIS A 1 10  ? 30.858 57.618 131.363 1.00 35.57 ? 10  HIS A CE1 1 
ATOM   93   N NE2 . HIS A 1 10  ? 29.977 57.283 132.292 1.00 32.82 ? 10  HIS A NE2 1 
ATOM   94   N N   . VAL A 1 11  ? 33.141 54.640 132.437 1.00 26.59 ? 11  VAL A N   1 
ATOM   95   C CA  . VAL A 1 11  ? 33.033 54.133 131.074 1.00 25.79 ? 11  VAL A CA  1 
ATOM   96   C C   . VAL A 1 11  ? 31.545 54.134 130.800 1.00 24.39 ? 11  VAL A C   1 
ATOM   97   O O   . VAL A 1 11  ? 31.095 54.733 129.834 1.00 25.38 ? 11  VAL A O   1 
ATOM   98   C CB  . VAL A 1 11  ? 33.631 52.726 130.919 1.00 26.57 ? 11  VAL A CB  1 
ATOM   99   C CG1 . VAL A 1 11  ? 33.485 52.259 129.469 1.00 28.23 ? 11  VAL A CG1 1 
ATOM   100  C CG2 . VAL A 1 11  ? 35.113 52.763 131.290 1.00 26.75 ? 11  VAL A CG2 1 
ATOM   101  N N   . THR A 1 12  ? 30.793 53.477 131.677 1.00 23.57 ? 12  THR A N   1 
ATOM   102  C CA  . THR A 1 12  ? 29.335 53.434 131.595 1.00 26.01 ? 12  THR A CA  1 
ATOM   103  C C   . THR A 1 12  ? 28.874 53.522 133.046 1.00 28.29 ? 12  THR A C   1 
ATOM   104  O O   . THR A 1 12  ? 29.702 53.589 133.962 1.00 25.64 ? 12  THR A O   1 
ATOM   105  C CB  . THR A 1 12  ? 28.804 52.106 131.012 1.00 24.56 ? 12  THR A CB  1 
ATOM   106  O OG1 . THR A 1 12  ? 28.841 51.101 132.025 1.00 25.88 ? 12  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 12  ? 29.639 51.653 129.814 1.00 24.60 ? 12  THR A CG2 1 
ATOM   108  N N   . PRO A 1 13  ? 27.553 53.539 133.287 1.00 29.49 ? 13  PRO A N   1 
ATOM   109  C CA  . PRO A 1 13  ? 27.184 53.616 134.698 1.00 29.05 ? 13  PRO A CA  1 
ATOM   110  C C   . PRO A 1 13  ? 27.362 52.285 135.424 1.00 27.23 ? 13  PRO A C   1 
ATOM   111  O O   . PRO A 1 13  ? 27.287 52.232 136.645 1.00 29.21 ? 13  PRO A O   1 
ATOM   112  C CB  . PRO A 1 13  ? 25.722 54.082 134.653 1.00 32.96 ? 13  PRO A CB  1 
ATOM   113  C CG  . PRO A 1 13  ? 25.232 53.574 133.344 1.00 33.81 ? 13  PRO A CG  1 
ATOM   114  C CD  . PRO A 1 13  ? 26.397 53.827 132.418 1.00 30.11 ? 13  PRO A CD  1 
ATOM   115  N N   . TYR A 1 14  ? 27.642 51.217 134.678 1.00 25.29 ? 14  TYR A N   1 
ATOM   116  C CA  . TYR A 1 14  ? 27.797 49.894 135.283 1.00 24.90 ? 14  TYR A CA  1 
ATOM   117  C C   . TYR A 1 14  ? 29.168 49.262 135.118 1.00 22.44 ? 14  TYR A C   1 
ATOM   118  O O   . TYR A 1 14  ? 29.426 48.188 135.654 1.00 23.50 ? 14  TYR A O   1 
ATOM   119  C CB  . TYR A 1 14  ? 26.730 48.950 134.721 1.00 24.87 ? 14  TYR A CB  1 
ATOM   120  C CG  . TYR A 1 14  ? 25.379 49.618 134.648 1.00 28.57 ? 14  TYR A CG  1 
ATOM   121  C CD1 . TYR A 1 14  ? 24.785 49.903 133.418 1.00 30.74 ? 14  TYR A CD1 1 
ATOM   122  C CD2 . TYR A 1 14  ? 24.722 50.023 135.809 1.00 28.89 ? 14  TYR A CD2 1 
ATOM   123  C CE1 . TYR A 1 14  ? 23.564 50.582 133.348 1.00 33.07 ? 14  TYR A CE1 1 
ATOM   124  C CE2 . TYR A 1 14  ? 23.502 50.704 135.753 1.00 33.87 ? 14  TYR A CE2 1 
ATOM   125  C CZ  . TYR A 1 14  ? 22.933 50.980 134.521 1.00 31.80 ? 14  TYR A CZ  1 
ATOM   126  O OH  . TYR A 1 14  ? 21.753 51.677 134.462 1.00 37.03 ? 14  TYR A OH  1 
ATOM   127  N N   . GLU A 1 15  ? 30.034 49.925 134.363 1.00 19.06 ? 15  GLU A N   1 
ATOM   128  C CA  . GLU A 1 15  ? 31.381 49.439 134.148 1.00 21.08 ? 15  GLU A CA  1 
ATOM   129  C C   . GLU A 1 15  ? 32.367 50.588 134.340 1.00 22.28 ? 15  GLU A C   1 
ATOM   130  O O   . GLU A 1 15  ? 32.186 51.677 133.787 1.00 18.01 ? 15  GLU A O   1 
ATOM   131  C CB  . GLU A 1 15  ? 31.537 48.873 132.732 1.00 19.63 ? 15  GLU A CB  1 
ATOM   132  C CG  . GLU A 1 15  ? 30.847 47.541 132.503 1.00 18.46 ? 15  GLU A CG  1 
ATOM   133  C CD  . GLU A 1 15  ? 29.395 47.678 132.115 1.00 19.16 ? 15  GLU A CD  1 
ATOM   134  O OE1 . GLU A 1 15  ? 29.044 48.669 131.456 1.00 21.07 ? 15  GLU A OE1 1 
ATOM   135  O OE2 . GLU A 1 15  ? 28.604 46.785 132.453 1.00 23.28 ? 15  GLU A OE2 1 
ATOM   136  N N   . THR A 1 16  ? 33.410 50.333 135.121 1.00 18.32 ? 16  THR A N   1 
ATOM   137  C CA  . THR A 1 16  ? 34.420 51.342 135.383 1.00 21.99 ? 16  THR A CA  1 
ATOM   138  C C   . THR A 1 16  ? 35.806 50.768 135.114 1.00 17.14 ? 16  THR A C   1 
ATOM   139  O O   . THR A 1 16  ? 36.102 49.644 135.492 1.00 18.69 ? 16  THR A O   1 
ATOM   140  C CB  . THR A 1 16  ? 34.341 51.823 136.855 1.00 24.04 ? 16  THR A CB  1 
ATOM   141  O OG1 . THR A 1 16  ? 33.080 52.468 137.068 1.00 26.87 ? 16  THR A OG1 1 
ATOM   142  C CG2 . THR A 1 16  ? 35.467 52.825 137.173 1.00 27.01 ? 16  THR A CG2 1 
ATOM   143  N N   . LEU A 1 17  ? 36.648 51.528 134.436 1.00 17.29 ? 17  LEU A N   1 
ATOM   144  C CA  . LEU A 1 17  ? 38.003 51.058 134.185 1.00 21.87 ? 17  LEU A CA  1 
ATOM   145  C C   . LEU A 1 17  ? 38.932 51.632 135.251 1.00 22.69 ? 17  LEU A C   1 
ATOM   146  O O   . LEU A 1 17  ? 38.961 52.837 135.482 1.00 22.46 ? 17  LEU A O   1 
ATOM   147  C CB  . LEU A 1 17  ? 38.495 51.492 132.806 1.00 23.08 ? 17  LEU A CB  1 
ATOM   148  C CG  . LEU A 1 17  ? 38.235 50.481 131.692 1.00 26.53 ? 17  LEU A CG  1 
ATOM   149  C CD1 . LEU A 1 17  ? 38.526 51.092 130.326 1.00 24.39 ? 17  LEU A CD1 1 
ATOM   150  C CD2 . LEU A 1 17  ? 39.103 49.263 131.944 1.00 23.19 ? 17  LEU A CD2 1 
ATOM   151  N N   . VAL A 1 18  ? 39.674 50.753 135.906 1.00 21.18 ? 18  VAL A N   1 
ATOM   152  C CA  . VAL A 1 18  ? 40.619 51.160 136.932 1.00 22.09 ? 18  VAL A CA  1 
ATOM   153  C C   . VAL A 1 18  ? 41.989 50.979 136.266 1.00 21.31 ? 18  VAL A C   1 
ATOM   154  O O   . VAL A 1 18  ? 42.449 49.858 136.065 1.00 20.71 ? 18  VAL A O   1 
ATOM   155  C CB  . VAL A 1 18  ? 40.448 50.261 138.185 1.00 27.43 ? 18  VAL A CB  1 
ATOM   156  C CG1 . VAL A 1 18  ? 41.562 50.501 139.173 1.00 27.78 ? 18  VAL A CG1 1 
ATOM   157  C CG2 . VAL A 1 18  ? 39.098 50.575 138.850 1.00 24.29 ? 18  VAL A CG2 1 
ATOM   158  N N   . ARG A 1 19  ? 42.619 52.094 135.910 1.00 19.77 ? 19  ARG A N   1 
ATOM   159  C CA  . ARG A 1 19  ? 43.896 52.071 135.214 1.00 18.07 ? 19  ARG A CA  1 
ATOM   160  C C   . ARG A 1 19  ? 45.054 52.379 136.136 1.00 21.86 ? 19  ARG A C   1 
ATOM   161  O O   . ARG A 1 19  ? 45.041 53.390 136.833 1.00 20.32 ? 19  ARG A O   1 
ATOM   162  C CB  . ARG A 1 19  ? 43.886 53.102 134.082 1.00 20.52 ? 19  ARG A CB  1 
ATOM   163  C CG  . ARG A 1 19  ? 42.681 53.012 133.159 1.00 18.53 ? 19  ARG A CG  1 
ATOM   164  C CD  . ARG A 1 19  ? 42.691 54.134 132.147 1.00 20.55 ? 19  ARG A CD  1 
ATOM   165  N NE  . ARG A 1 19  ? 41.595 54.019 131.182 1.00 25.21 ? 19  ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 19  ? 41.765 53.752 129.890 1.00 22.47 ? 19  ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 19  ? 42.986 53.567 129.405 1.00 20.79 ? 19  ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 19  ? 40.715 53.682 129.081 1.00 23.26 ? 19  ARG A NH2 1 
ATOM   169  N N   . ARG A 1 20  ? 46.065 51.521 136.103 1.00 21.01 ? 20  ARG A N   1 
ATOM   170  C CA  . ARG A 1 20  ? 47.240 51.687 136.944 1.00 23.39 ? 20  ARG A CA  1 
ATOM   171  C C   . ARG A 1 20  ? 48.094 52.873 136.517 1.00 21.97 ? 20  ARG A C   1 
ATOM   172  O O   . ARG A 1 20  ? 48.416 53.023 135.335 1.00 21.84 ? 20  ARG A O   1 
ATOM   173  C CB  . ARG A 1 20  ? 48.083 50.412 136.910 1.00 24.01 ? 20  ARG A CB  1 
ATOM   174  C CG  . ARG A 1 20  ? 49.216 50.377 137.937 1.00 31.10 ? 20  ARG A CG  1 
ATOM   175  C CD  . ARG A 1 20  ? 50.018 49.078 137.830 1.00 40.44 ? 20  ARG A CD  1 
ATOM   176  N NE  . ARG A 1 20  ? 51.184 49.098 138.708 1.00 47.10 ? 20  ARG A NE  1 
ATOM   177  C CZ  . ARG A 1 20  ? 51.125 49.008 140.033 1.00 48.29 ? 20  ARG A CZ  1 
ATOM   178  N NH1 . ARG A 1 20  ? 49.955 48.878 140.641 1.00 49.01 ? 20  ARG A NH1 1 
ATOM   179  N NH2 . ARG A 1 20  ? 52.237 49.074 140.752 1.00 50.33 ? 20  ARG A NH2 1 
ATOM   180  N N   . MET A 1 21  ? 48.439 53.728 137.475 1.00 20.43 ? 21  MET A N   1 
ATOM   181  C CA  . MET A 1 21  ? 49.293 54.875 137.191 1.00 22.33 ? 21  MET A CA  1 
ATOM   182  C C   . MET A 1 21  ? 50.689 54.575 137.750 1.00 26.86 ? 21  MET A C   1 
ATOM   183  O O   . MET A 1 21  ? 50.851 54.372 138.955 1.00 28.13 ? 21  MET A O   1 
ATOM   184  C CB  . MET A 1 21  ? 48.747 56.149 137.851 1.00 23.24 ? 21  MET A CB  1 
ATOM   185  C CG  . MET A 1 21  ? 47.266 56.416 137.591 1.00 21.58 ? 21  MET A CG  1 
ATOM   186  S SD  . MET A 1 21  ? 46.772 58.078 138.061 1.00 22.46 ? 21  MET A SD  1 
ATOM   187  C CE  . MET A 1 21  ? 47.117 58.053 139.880 1.00 20.91 ? 21  MET A CE  1 
ATOM   188  N N   . GLU A 1 22  ? 51.690 54.526 136.879 1.00 29.92 ? 22  GLU A N   1 
ATOM   189  C CA  . GLU A 1 22  ? 53.058 54.268 137.320 1.00 34.74 ? 22  GLU A CA  1 
ATOM   190  C C   . GLU A 1 22  ? 53.587 55.522 138.005 1.00 35.23 ? 22  GLU A C   1 
ATOM   191  O O   . GLU A 1 22  ? 54.286 55.454 139.016 1.00 37.06 ? 22  GLU A O   1 
ATOM   192  C CB  . GLU A 1 22  ? 53.964 53.925 136.131 1.00 36.52 ? 22  GLU A CB  1 
ATOM   193  C CG  . GLU A 1 22  ? 53.651 52.595 135.462 1.00 40.37 ? 22  GLU A CG  1 
ATOM   194  C CD  . GLU A 1 22  ? 53.529 51.454 136.458 1.00 42.82 ? 22  GLU A CD  1 
ATOM   195  O OE1 . GLU A 1 22  ? 54.461 51.274 137.278 1.00 44.42 ? 22  GLU A OE1 1 
ATOM   196  O OE2 . GLU A 1 22  ? 52.501 50.738 136.418 1.00 35.66 ? 22  GLU A OE2 1 
ATOM   197  N N   . ARG A 1 23  ? 53.237 56.668 137.439 1.00 32.65 ? 23  ARG A N   1 
ATOM   198  C CA  . ARG A 1 23  ? 53.660 57.951 137.961 1.00 32.49 ? 23  ARG A CA  1 
ATOM   199  C C   . ARG A 1 23  ? 52.717 59.010 137.412 1.00 31.30 ? 23  ARG A C   1 
ATOM   200  O O   . ARG A 1 23  ? 52.220 58.872 136.300 1.00 30.10 ? 23  ARG A O   1 
ATOM   201  C CB  . ARG A 1 23  ? 55.093 58.241 137.505 1.00 35.76 ? 23  ARG A CB  1 
ATOM   202  C CG  . ARG A 1 23  ? 55.494 59.710 137.528 1.00 39.96 ? 23  ARG A CG  1 
ATOM   203  C CD  . ARG A 1 23  ? 56.984 59.870 137.227 1.00 47.92 ? 23  ARG A CD  1 
ATOM   204  N NE  . ARG A 1 23  ? 57.346 59.346 135.909 1.00 55.38 ? 23  ARG A NE  1 
ATOM   205  C CZ  . ARG A 1 23  ? 57.111 59.974 134.757 1.00 58.39 ? 23  ARG A CZ  1 
ATOM   206  N NH1 . ARG A 1 23  ? 56.513 61.161 134.753 1.00 59.97 ? 23  ARG A NH1 1 
ATOM   207  N NH2 . ARG A 1 23  ? 57.469 59.415 133.607 1.00 58.80 ? 23  ARG A NH2 1 
ATOM   208  N N   . VAL A 1 24  ? 52.464 60.060 138.190 1.00 29.28 ? 24  VAL A N   1 
ATOM   209  C CA  . VAL A 1 24  ? 51.601 61.148 137.733 1.00 27.01 ? 24  VAL A CA  1 
ATOM   210  C C   . VAL A 1 24  ? 52.488 62.276 137.247 1.00 31.75 ? 24  VAL A C   1 
ATOM   211  O O   . VAL A 1 24  ? 53.221 62.889 138.032 1.00 32.11 ? 24  VAL A O   1 
ATOM   212  C CB  . VAL A 1 24  ? 50.691 61.674 138.862 1.00 25.68 ? 24  VAL A CB  1 
ATOM   213  C CG1 . VAL A 1 24  ? 49.833 62.851 138.352 1.00 25.95 ? 24  VAL A CG1 1 
ATOM   214  C CG2 . VAL A 1 24  ? 49.809 60.536 139.370 1.00 25.68 ? 24  VAL A CG2 1 
ATOM   215  N N   . ILE A 1 25  ? 52.418 62.536 135.946 1.00 31.53 ? 25  ILE A N   1 
ATOM   216  C CA  . ILE A 1 25  ? 53.205 63.562 135.287 1.00 34.00 ? 25  ILE A CA  1 
ATOM   217  C C   . ILE A 1 25  ? 52.673 64.940 135.605 1.00 35.36 ? 25  ILE A C   1 
ATOM   218  O O   . ILE A 1 25  ? 53.433 65.853 135.921 1.00 35.56 ? 25  ILE A O   1 
ATOM   219  C CB  . ILE A 1 25  ? 53.172 63.369 133.761 1.00 34.41 ? 25  ILE A CB  1 
ATOM   220  C CG1 . ILE A 1 25  ? 53.724 61.986 133.414 1.00 33.22 ? 25  ILE A CG1 1 
ATOM   221  C CG2 . ILE A 1 25  ? 53.954 64.480 133.076 1.00 34.44 ? 25  ILE A CG2 1 
ATOM   222  C CD1 . ILE A 1 25  ? 53.528 61.607 131.955 1.00 35.27 ? 25  ILE A CD1 1 
ATOM   223  N N   . ALA A 1 26  ? 51.361 65.092 135.499 1.00 34.49 ? 26  ALA A N   1 
ATOM   224  C CA  . ALA A 1 26  ? 50.727 66.370 135.785 1.00 35.16 ? 26  ALA A CA  1 
ATOM   225  C C   . ALA A 1 26  ? 49.246 66.161 136.089 1.00 37.04 ? 26  ALA A C   1 
ATOM   226  O O   . ALA A 1 26  ? 48.592 65.300 135.503 1.00 34.38 ? 26  ALA A O   1 
ATOM   227  C CB  . ALA A 1 26  ? 50.895 67.309 134.608 1.00 33.50 ? 26  ALA A CB  1 
ATOM   228  N N   . SER A 1 27  ? 48.729 66.942 137.026 1.00 37.15 ? 27  SER A N   1 
ATOM   229  C CA  . SER A 1 27  ? 47.327 66.850 137.392 1.00 36.82 ? 27  SER A CA  1 
ATOM   230  C C   . SER A 1 27  ? 46.936 68.235 137.819 1.00 37.26 ? 27  SER A C   1 
ATOM   231  O O   . SER A 1 27  ? 47.713 68.925 138.474 1.00 37.12 ? 27  SER A O   1 
ATOM   232  C CB  . SER A 1 27  ? 47.117 65.863 138.546 1.00 36.94 ? 27  SER A CB  1 
ATOM   233  O OG  . SER A 1 27  ? 47.689 66.341 139.754 1.00 34.63 ? 27  SER A OG  1 
ATOM   234  N N   . GLY A 1 28  ? 45.738 68.652 137.437 1.00 38.55 ? 28  GLY A N   1 
ATOM   235  C CA  . GLY A 1 28  ? 45.297 69.980 137.802 1.00 40.05 ? 28  GLY A CA  1 
ATOM   236  C C   . GLY A 1 28  ? 43.880 70.291 137.381 1.00 40.48 ? 28  GLY A C   1 
ATOM   237  O O   . GLY A 1 28  ? 43.076 69.393 137.109 1.00 37.30 ? 28  GLY A O   1 
ATOM   238  N N   . LYS A 1 29  ? 43.586 71.584 137.316 1.00 39.54 ? 29  LYS A N   1 
ATOM   239  C CA  . LYS A 1 29  ? 42.265 72.056 136.944 1.00 43.71 ? 29  LYS A CA  1 
ATOM   240  C C   . LYS A 1 29  ? 42.337 73.383 136.203 1.00 41.14 ? 29  LYS A C   1 
ATOM   241  O O   . LYS A 1 29  ? 43.003 74.317 136.639 1.00 43.10 ? 29  LYS A O   1 
ATOM   242  C CB  . LYS A 1 29  ? 41.403 72.213 138.208 1.00 45.92 ? 29  LYS A CB  1 
ATOM   243  C CG  . LYS A 1 29  ? 40.392 73.362 138.168 1.00 51.98 ? 29  LYS A CG  1 
ATOM   244  C CD  . LYS A 1 29  ? 38.943 72.866 138.192 1.00 54.61 ? 29  LYS A CD  1 
ATOM   245  C CE  . LYS A 1 29  ? 38.582 72.120 136.908 1.00 56.16 ? 29  LYS A CE  1 
ATOM   246  N NZ  . LYS A 1 29  ? 37.166 71.644 136.882 1.00 52.96 ? 29  LYS A NZ  1 
ATOM   247  N N   . THR A 1 30  ? 41.657 73.451 135.069 1.00 39.41 ? 30  THR A N   1 
ATOM   248  C CA  . THR A 1 30  ? 41.600 74.676 134.285 1.00 38.36 ? 30  THR A CA  1 
ATOM   249  C C   . THR A 1 30  ? 40.226 75.248 134.612 1.00 40.83 ? 30  THR A C   1 
ATOM   250  O O   . THR A 1 30  ? 39.498 74.690 135.438 1.00 40.67 ? 30  THR A O   1 
ATOM   251  C CB  . THR A 1 30  ? 41.647 74.390 132.777 1.00 38.37 ? 30  THR A CB  1 
ATOM   252  O OG1 . THR A 1 30  ? 40.416 73.778 132.378 1.00 37.27 ? 30  THR A OG1 1 
ATOM   253  C CG2 . THR A 1 30  ? 42.815 73.467 132.435 1.00 37.53 ? 30  THR A CG2 1 
ATOM   254  N N   . PRO A 1 31  ? 39.847 76.366 133.979 1.00 41.47 ? 31  PRO A N   1 
ATOM   255  C CA  . PRO A 1 31  ? 38.528 76.926 134.275 1.00 43.70 ? 31  PRO A CA  1 
ATOM   256  C C   . PRO A 1 31  ? 37.419 76.141 133.588 1.00 44.64 ? 31  PRO A C   1 
ATOM   257  O O   . PRO A 1 31  ? 36.239 76.420 133.790 1.00 45.47 ? 31  PRO A O   1 
ATOM   258  C CB  . PRO A 1 31  ? 38.631 78.349 133.734 1.00 44.59 ? 31  PRO A CB  1 
ATOM   259  C CG  . PRO A 1 31  ? 39.536 78.183 132.569 1.00 46.74 ? 31  PRO A CG  1 
ATOM   260  C CD  . PRO A 1 31  ? 40.623 77.292 133.138 1.00 44.13 ? 31  PRO A CD  1 
ATOM   261  N N   . PHE A 1 32  ? 37.803 75.153 132.785 1.00 43.28 ? 32  PHE A N   1 
ATOM   262  C CA  . PHE A 1 32  ? 36.829 74.360 132.043 1.00 41.50 ? 32  PHE A CA  1 
ATOM   263  C C   . PHE A 1 32  ? 36.726 72.900 132.439 1.00 39.83 ? 32  PHE A C   1 
ATOM   264  O O   . PHE A 1 32  ? 35.673 72.289 132.258 1.00 39.19 ? 32  PHE A O   1 
ATOM   265  C CB  . PHE A 1 32  ? 37.144 74.429 130.554 1.00 43.28 ? 32  PHE A CB  1 
ATOM   266  C CG  . PHE A 1 32  ? 37.029 75.804 129.976 1.00 44.63 ? 32  PHE A CG  1 
ATOM   267  C CD1 . PHE A 1 32  ? 35.795 76.300 129.573 1.00 44.39 ? 32  PHE A CD1 1 
ATOM   268  C CD2 . PHE A 1 32  ? 38.158 76.601 129.824 1.00 45.57 ? 32  PHE A CD2 1 
ATOM   269  C CE1 . PHE A 1 32  ? 35.685 77.571 129.020 1.00 46.59 ? 32  PHE A CE1 1 
ATOM   270  C CE2 . PHE A 1 32  ? 38.060 77.873 129.273 1.00 46.70 ? 32  PHE A CE2 1 
ATOM   271  C CZ  . PHE A 1 32  ? 36.822 78.360 128.868 1.00 45.41 ? 32  PHE A CZ  1 
ATOM   272  N N   . GLN A 1 33  ? 37.805 72.333 132.969 1.00 36.27 ? 33  GLN A N   1 
ATOM   273  C CA  . GLN A 1 33  ? 37.785 70.923 133.341 1.00 35.58 ? 33  GLN A CA  1 
ATOM   274  C C   . GLN A 1 33  ? 39.017 70.513 134.128 1.00 34.95 ? 33  GLN A C   1 
ATOM   275  O O   . GLN A 1 33  ? 39.999 71.256 134.210 1.00 34.10 ? 33  GLN A O   1 
ATOM   276  C CB  . GLN A 1 33  ? 37.698 70.073 132.065 1.00 36.34 ? 33  GLN A CB  1 
ATOM   277  C CG  . GLN A 1 33  ? 38.935 70.207 131.173 1.00 38.62 ? 33  GLN A CG  1 
ATOM   278  C CD  . GLN A 1 33  ? 38.618 70.179 129.691 1.00 39.90 ? 33  GLN A CD  1 
ATOM   279  O OE1 . GLN A 1 33  ? 39.071 71.045 128.940 1.00 41.01 ? 33  GLN A OE1 1 
ATOM   280  N NE2 . GLN A 1 33  ? 37.842 69.185 129.258 1.00 34.55 ? 33  GLN A NE2 1 
ATOM   281  N N   . ASP A 1 34  ? 38.958 69.325 134.713 1.00 33.50 ? 34  ASP A N   1 
ATOM   282  C CA  . ASP A 1 34  ? 40.088 68.795 135.450 1.00 35.31 ? 34  ASP A CA  1 
ATOM   283  C C   . ASP A 1 34  ? 40.901 67.948 134.475 1.00 35.36 ? 34  ASP A C   1 
ATOM   284  O O   . ASP A 1 34  ? 40.350 67.405 133.514 1.00 31.94 ? 34  ASP A O   1 
ATOM   285  C CB  . ASP A 1 34  ? 39.614 67.918 136.609 1.00 38.52 ? 34  ASP A CB  1 
ATOM   286  C CG  . ASP A 1 34  ? 38.858 68.701 137.659 1.00 44.56 ? 34  ASP A CG  1 
ATOM   287  O OD1 . ASP A 1 34  ? 39.408 69.700 138.174 1.00 44.91 ? 34  ASP A OD1 1 
ATOM   288  O OD2 . ASP A 1 34  ? 37.716 68.311 137.973 1.00 48.69 ? 34  ASP A OD2 1 
ATOM   289  N N   . TYR A 1 35  ? 42.204 67.835 134.706 1.00 32.90 ? 35  TYR A N   1 
ATOM   290  C CA  . TYR A 1 35  ? 43.021 67.016 133.820 1.00 33.38 ? 35  TYR A CA  1 
ATOM   291  C C   . TYR A 1 35  ? 43.993 66.188 134.640 1.00 31.66 ? 35  TYR A C   1 
ATOM   292  O O   . TYR A 1 35  ? 44.439 66.611 135.701 1.00 33.41 ? 35  TYR A O   1 
ATOM   293  C CB  . TYR A 1 35  ? 43.754 67.895 132.796 1.00 32.93 ? 35  TYR A CB  1 
ATOM   294  C CG  . TYR A 1 35  ? 44.781 68.849 133.378 1.00 38.28 ? 35  TYR A CG  1 
ATOM   295  C CD1 . TYR A 1 35  ? 46.050 68.401 133.753 1.00 39.39 ? 35  TYR A CD1 1 
ATOM   296  C CD2 . TYR A 1 35  ? 44.487 70.200 133.549 1.00 40.15 ? 35  TYR A CD2 1 
ATOM   297  C CE1 . TYR A 1 35  ? 47.000 69.279 134.281 1.00 41.45 ? 35  TYR A CE1 1 
ATOM   298  C CE2 . TYR A 1 35  ? 45.429 71.086 134.080 1.00 40.67 ? 35  TYR A CE2 1 
ATOM   299  C CZ  . TYR A 1 35  ? 46.679 70.619 134.442 1.00 41.72 ? 35  TYR A CZ  1 
ATOM   300  O OH  . TYR A 1 35  ? 47.609 71.483 134.974 1.00 45.20 ? 35  TYR A OH  1 
ATOM   301  N N   . PHE A 1 36  ? 44.281 64.984 134.166 1.00 30.64 ? 36  PHE A N   1 
ATOM   302  C CA  . PHE A 1 36  ? 45.212 64.087 134.843 1.00 31.60 ? 36  PHE A CA  1 
ATOM   303  C C   . PHE A 1 36  ? 46.058 63.466 133.745 1.00 31.04 ? 36  PHE A C   1 
ATOM   304  O O   . PHE A 1 36  ? 45.519 62.871 132.813 1.00 33.25 ? 36  PHE A O   1 
ATOM   305  C CB  . PHE A 1 36  ? 44.475 62.952 135.584 1.00 27.12 ? 36  PHE A CB  1 
ATOM   306  C CG  . PHE A 1 36  ? 43.445 63.424 136.565 1.00 31.71 ? 36  PHE A CG  1 
ATOM   307  C CD1 . PHE A 1 36  ? 43.768 63.605 137.911 1.00 30.77 ? 36  PHE A CD1 1 
ATOM   308  C CD2 . PHE A 1 36  ? 42.144 63.687 136.149 1.00 31.01 ? 36  PHE A CD2 1 
ATOM   309  C CE1 . PHE A 1 36  ? 42.805 64.041 138.826 1.00 32.59 ? 36  PHE A CE1 1 
ATOM   310  C CE2 . PHE A 1 36  ? 41.173 64.126 137.061 1.00 33.06 ? 36  PHE A CE2 1 
ATOM   311  C CZ  . PHE A 1 36  ? 41.510 64.301 138.402 1.00 33.18 ? 36  PHE A CZ  1 
ATOM   312  N N   . LEU A 1 37  ? 47.373 63.610 133.840 1.00 27.24 ? 37  LEU A N   1 
ATOM   313  C CA  . LEU A 1 37  ? 48.242 63.009 132.845 1.00 26.24 ? 37  LEU A CA  1 
ATOM   314  C C   . LEU A 1 37  ? 49.164 62.071 133.591 1.00 26.93 ? 37  LEU A C   1 
ATOM   315  O O   . LEU A 1 37  ? 49.937 62.510 134.451 1.00 27.09 ? 37  LEU A O   1 
ATOM   316  C CB  . LEU A 1 37  ? 49.057 64.074 132.112 1.00 28.20 ? 37  LEU A CB  1 
ATOM   317  C CG  . LEU A 1 37  ? 49.869 63.512 130.940 1.00 27.45 ? 37  LEU A CG  1 
ATOM   318  C CD1 . LEU A 1 37  ? 48.919 63.267 129.756 1.00 26.11 ? 37  LEU A CD1 1 
ATOM   319  C CD2 . LEU A 1 37  ? 50.978 64.489 130.548 1.00 30.70 ? 37  LEU A CD2 1 
ATOM   320  N N   . PHE A 1 38  ? 49.091 60.784 133.275 1.00 24.93 ? 38  PHE A N   1 
ATOM   321  C CA  . PHE A 1 38  ? 49.934 59.817 133.953 1.00 24.60 ? 38  PHE A CA  1 
ATOM   322  C C   . PHE A 1 38  ? 50.601 58.795 133.058 1.00 27.25 ? 38  PHE A C   1 
ATOM   323  O O   . PHE A 1 38  ? 50.174 58.565 131.929 1.00 29.51 ? 38  PHE A O   1 
ATOM   324  C CB  . PHE A 1 38  ? 49.137 59.085 135.047 1.00 24.62 ? 38  PHE A CB  1 
ATOM   325  C CG  . PHE A 1 38  ? 47.948 58.297 134.538 1.00 22.50 ? 38  PHE A CG  1 
ATOM   326  C CD1 . PHE A 1 38  ? 46.694 58.893 134.402 1.00 22.87 ? 38  PHE A CD1 1 
ATOM   327  C CD2 . PHE A 1 38  ? 48.074 56.941 134.249 1.00 24.27 ? 38  PHE A CD2 1 
ATOM   328  C CE1 . PHE A 1 38  ? 45.565 58.132 133.990 1.00 16.47 ? 38  PHE A CE1 1 
ATOM   329  C CE2 . PHE A 1 38  ? 46.963 56.182 133.837 1.00 24.81 ? 38  PHE A CE2 1 
ATOM   330  C CZ  . PHE A 1 38  ? 45.709 56.789 133.713 1.00 24.52 ? 38  PHE A CZ  1 
ATOM   331  N N   . GLU A 1 39  ? 51.661 58.187 133.581 1.00 27.32 ? 39  GLU A N   1 
ATOM   332  C CA  . GLU A 1 39  ? 52.407 57.144 132.881 1.00 31.69 ? 39  GLU A CA  1 
ATOM   333  C C   . GLU A 1 39  ? 51.770 55.799 133.190 1.00 28.88 ? 39  GLU A C   1 
ATOM   334  O O   . GLU A 1 39  ? 51.514 55.485 134.348 1.00 29.81 ? 39  GLU A O   1 
ATOM   335  C CB  . GLU A 1 39  ? 53.862 57.071 133.370 1.00 33.14 ? 39  GLU A CB  1 
ATOM   336  C CG  . GLU A 1 39  ? 54.790 58.138 132.842 1.00 39.57 ? 39  GLU A CG  1 
ATOM   337  C CD  . GLU A 1 39  ? 55.118 57.950 131.372 1.00 42.20 ? 39  GLU A CD  1 
ATOM   338  O OE1 . GLU A 1 39  ? 55.866 58.794 130.834 1.00 44.77 ? 39  GLU A OE1 1 
ATOM   339  O OE2 . GLU A 1 39  ? 54.629 56.967 130.761 1.00 37.47 ? 39  GLU A OE2 1 
ATOM   340  N N   . SER A 1 40  ? 51.511 55.012 132.153 1.00 29.80 ? 40  SER A N   1 
ATOM   341  C CA  . SER A 1 40  ? 50.959 53.676 132.330 1.00 29.52 ? 40  SER A CA  1 
ATOM   342  C C   . SER A 1 40  ? 51.916 52.803 131.536 1.00 29.59 ? 40  SER A C   1 
ATOM   343  O O   . SER A 1 40  ? 52.450 53.234 130.512 1.00 27.95 ? 40  SER A O   1 
ATOM   344  C CB  . SER A 1 40  ? 49.532 53.579 131.772 1.00 30.78 ? 40  SER A CB  1 
ATOM   345  O OG  . SER A 1 40  ? 49.506 53.750 130.368 1.00 31.50 ? 40  SER A OG  1 
ATOM   346  N N   . LYS A 1 41  ? 52.149 51.589 132.012 1.00 30.05 ? 41  LYS A N   1 
ATOM   347  C CA  . LYS A 1 41  ? 53.074 50.690 131.349 1.00 32.24 ? 41  LYS A CA  1 
ATOM   348  C C   . LYS A 1 41  ? 52.589 50.157 130.004 1.00 32.97 ? 41  LYS A C   1 
ATOM   349  O O   . LYS A 1 41  ? 53.406 49.825 129.142 1.00 34.94 ? 41  LYS A O   1 
ATOM   350  C CB  . LYS A 1 41  ? 53.419 49.520 132.281 1.00 35.74 ? 41  LYS A CB  1 
ATOM   351  C CG  . LYS A 1 41  ? 54.446 49.876 133.353 1.00 43.91 ? 41  LYS A CG  1 
ATOM   352  C CD  . LYS A 1 41  ? 54.842 48.660 134.185 1.00 49.18 ? 41  LYS A CD  1 
ATOM   353  C CE  . LYS A 1 41  ? 56.009 48.977 135.114 1.00 50.89 ? 41  LYS A CE  1 
ATOM   354  N NZ  . LYS A 1 41  ? 56.404 47.806 135.952 1.00 51.48 ? 41  LYS A NZ  1 
ATOM   355  N N   . GLY A 1 42  ? 51.273 50.086 129.821 1.00 27.30 ? 42  GLY A N   1 
ATOM   356  C CA  . GLY A 1 42  ? 50.732 49.567 128.576 1.00 26.74 ? 42  GLY A CA  1 
ATOM   357  C C   . GLY A 1 42  ? 50.576 50.593 127.472 1.00 25.62 ? 42  GLY A C   1 
ATOM   358  O O   . GLY A 1 42  ? 51.199 50.467 126.410 1.00 28.46 ? 42  GLY A O   1 
ATOM   359  N N   . PHE A 1 43  ? 49.760 51.613 127.722 1.00 21.90 ? 43  PHE A N   1 
ATOM   360  C CA  . PHE A 1 43  ? 49.510 52.663 126.730 1.00 23.68 ? 43  PHE A CA  1 
ATOM   361  C C   . PHE A 1 43  ? 50.440 53.864 126.817 1.00 25.67 ? 43  PHE A C   1 
ATOM   362  O O   . PHE A 1 43  ? 50.304 54.814 126.041 1.00 25.22 ? 43  PHE A O   1 
ATOM   363  C CB  . PHE A 1 43  ? 48.061 53.146 126.845 1.00 20.58 ? 43  PHE A CB  1 
ATOM   364  C CG  . PHE A 1 43  ? 47.054 52.077 126.541 1.00 22.10 ? 43  PHE A CG  1 
ATOM   365  C CD1 . PHE A 1 43  ? 46.864 51.638 125.229 1.00 20.77 ? 43  PHE A CD1 1 
ATOM   366  C CD2 . PHE A 1 43  ? 46.332 51.474 127.567 1.00 23.10 ? 43  PHE A CD2 1 
ATOM   367  C CE1 . PHE A 1 43  ? 45.981 50.618 124.943 1.00 18.98 ? 43  PHE A CE1 1 
ATOM   368  C CE2 . PHE A 1 43  ? 45.438 50.447 127.293 1.00 25.29 ? 43  PHE A CE2 1 
ATOM   369  C CZ  . PHE A 1 43  ? 45.264 50.016 125.968 1.00 20.81 ? 43  PHE A CZ  1 
ATOM   370  N N   . GLY A 1 44  ? 51.383 53.830 127.753 1.00 27.18 ? 44  GLY A N   1 
ATOM   371  C CA  . GLY A 1 44  ? 52.285 54.958 127.898 1.00 26.82 ? 44  GLY A CA  1 
ATOM   372  C C   . GLY A 1 44  ? 51.538 56.085 128.583 1.00 26.93 ? 44  GLY A C   1 
ATOM   373  O O   . GLY A 1 44  ? 50.730 55.828 129.475 1.00 25.74 ? 44  GLY A O   1 
ATOM   374  N N   . LYS A 1 45  ? 51.787 57.328 128.182 1.00 25.32 ? 45  LYS A N   1 
ATOM   375  C CA  . LYS A 1 45  ? 51.106 58.463 128.806 1.00 26.59 ? 45  LYS A CA  1 
ATOM   376  C C   . LYS A 1 45  ? 49.603 58.466 128.530 1.00 26.89 ? 45  LYS A C   1 
ATOM   377  O O   . LYS A 1 45  ? 49.163 58.204 127.413 1.00 24.91 ? 45  LYS A O   1 
ATOM   378  C CB  . LYS A 1 45  ? 51.693 59.786 128.313 1.00 21.50 ? 45  LYS A CB  1 
ATOM   379  C CG  . LYS A 1 45  ? 53.138 60.038 128.706 1.00 27.78 ? 45  LYS A CG  1 
ATOM   380  C CD  . LYS A 1 45  ? 53.565 61.415 128.212 1.00 28.60 ? 45  LYS A CD  1 
ATOM   381  C CE  . LYS A 1 45  ? 55.043 61.698 128.486 1.00 30.37 ? 45  LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 45  ? 55.449 63.022 127.912 1.00 23.22 ? 45  LYS A NZ  1 
ATOM   383  N N   . VAL A 1 46  ? 48.818 58.784 129.554 1.00 27.62 ? 46  VAL A N   1 
ATOM   384  C CA  . VAL A 1 46  ? 47.367 58.823 129.421 1.00 25.96 ? 46  VAL A CA  1 
ATOM   385  C C   . VAL A 1 46  ? 46.816 60.127 129.967 1.00 25.71 ? 46  VAL A C   1 
ATOM   386  O O   . VAL A 1 46  ? 47.118 60.521 131.101 1.00 26.52 ? 46  VAL A O   1 
ATOM   387  C CB  . VAL A 1 46  ? 46.699 57.648 130.180 1.00 25.91 ? 46  VAL A CB  1 
ATOM   388  C CG1 . VAL A 1 46  ? 45.167 57.795 130.148 1.00 23.04 ? 46  VAL A CG1 1 
ATOM   389  C CG2 . VAL A 1 46  ? 47.133 56.335 129.573 1.00 27.37 ? 46  VAL A CG2 1 
ATOM   390  N N   . LEU A 1 47  ? 46.002 60.786 129.153 1.00 22.81 ? 47  LEU A N   1 
ATOM   391  C CA  . LEU A 1 47  ? 45.378 62.048 129.521 1.00 25.56 ? 47  LEU A CA  1 
ATOM   392  C C   . LEU A 1 47  ? 43.909 61.824 129.868 1.00 28.99 ? 47  LEU A C   1 
ATOM   393  O O   . LEU A 1 47  ? 43.141 61.312 129.053 1.00 27.45 ? 47  LEU A O   1 
ATOM   394  C CB  . LEU A 1 47  ? 45.453 63.029 128.357 1.00 23.65 ? 47  LEU A CB  1 
ATOM   395  C CG  . LEU A 1 47  ? 45.367 64.562 128.503 1.00 30.92 ? 47  LEU A CG  1 
ATOM   396  C CD1 . LEU A 1 47  ? 44.218 65.063 127.679 1.00 25.92 ? 47  LEU A CD1 1 
ATOM   397  C CD2 . LEU A 1 47  ? 45.254 65.013 129.961 1.00 26.68 ? 47  LEU A CD2 1 
ATOM   398  N N   . ILE A 1 48  ? 43.530 62.208 131.079 1.00 28.12 ? 48  ILE A N   1 
ATOM   399  C CA  . ILE A 1 48  ? 42.146 62.091 131.515 1.00 31.02 ? 48  ILE A CA  1 
ATOM   400  C C   . ILE A 1 48  ? 41.592 63.504 131.601 1.00 28.34 ? 48  ILE A C   1 
ATOM   401  O O   . ILE A 1 48  ? 42.248 64.391 132.148 1.00 32.42 ? 48  ILE A O   1 
ATOM   402  C CB  . ILE A 1 48  ? 42.017 61.482 132.931 1.00 28.09 ? 48  ILE A CB  1 
ATOM   403  C CG1 . ILE A 1 48  ? 42.718 60.124 133.010 1.00 29.17 ? 48  ILE A CG1 1 
ATOM   404  C CG2 . ILE A 1 48  ? 40.543 61.385 133.305 1.00 30.55 ? 48  ILE A CG2 1 
ATOM   405  C CD1 . ILE A 1 48  ? 42.057 59.012 132.236 1.00 36.45 ? 48  ILE A CD1 1 
ATOM   406  N N   . LEU A 1 49  ? 40.411 63.735 131.036 1.00 31.10 ? 49  LEU A N   1 
ATOM   407  C CA  . LEU A 1 49  ? 39.784 65.049 131.148 1.00 29.09 ? 49  LEU A CA  1 
ATOM   408  C C   . LEU A 1 49  ? 38.499 64.789 131.928 1.00 32.01 ? 49  LEU A C   1 
ATOM   409  O O   . LEU A 1 49  ? 37.597 64.096 131.459 1.00 28.49 ? 49  LEU A O   1 
ATOM   410  C CB  . LEU A 1 49  ? 39.498 65.669 129.782 1.00 31.27 ? 49  LEU A CB  1 
ATOM   411  C CG  . LEU A 1 49  ? 40.766 66.117 129.033 1.00 29.46 ? 49  LEU A CG  1 
ATOM   412  C CD1 . LEU A 1 49  ? 40.346 66.750 127.732 1.00 27.49 ? 49  LEU A CD1 1 
ATOM   413  C CD2 . LEU A 1 49  ? 41.604 67.116 129.875 1.00 24.37 ? 49  LEU A CD2 1 
ATOM   414  N N   . ASP A 1 50  ? 38.460 65.331 133.141 1.00 31.20 ? 50  ASP A N   1 
ATOM   415  C CA  . ASP A 1 50  ? 37.352 65.152 134.067 1.00 33.79 ? 50  ASP A CA  1 
ATOM   416  C C   . ASP A 1 50  ? 37.318 63.712 134.542 1.00 33.12 ? 50  ASP A C   1 
ATOM   417  O O   . ASP A 1 50  ? 38.122 63.325 135.380 1.00 36.82 ? 50  ASP A O   1 
ATOM   418  C CB  . ASP A 1 50  ? 36.017 65.550 133.435 1.00 34.18 ? 50  ASP A CB  1 
ATOM   419  C CG  . ASP A 1 50  ? 35.870 67.054 133.307 1.00 37.63 ? 50  ASP A CG  1 
ATOM   420  O OD1 . ASP A 1 50  ? 36.356 67.769 134.215 1.00 37.24 ? 50  ASP A OD1 1 
ATOM   421  O OD2 . ASP A 1 50  ? 35.271 67.521 132.313 1.00 38.40 ? 50  ASP A OD2 1 
ATOM   422  N N   . LYS A 1 51  ? 36.410 62.908 134.008 1.00 33.81 ? 51  LYS A N   1 
ATOM   423  C CA  . LYS A 1 51  ? 36.329 61.524 134.442 1.00 32.32 ? 51  LYS A CA  1 
ATOM   424  C C   . LYS A 1 51  ? 36.517 60.542 133.299 1.00 29.07 ? 51  LYS A C   1 
ATOM   425  O O   . LYS A 1 51  ? 36.420 59.340 133.501 1.00 30.33 ? 51  LYS A O   1 
ATOM   426  C CB  . LYS A 1 51  ? 34.977 61.264 135.117 1.00 37.37 ? 51  LYS A CB  1 
ATOM   427  C CG  . LYS A 1 51  ? 33.779 61.319 134.168 1.00 46.45 ? 51  LYS A CG  1 
ATOM   428  C CD  . LYS A 1 51  ? 32.441 61.280 134.909 1.00 48.42 ? 51  LYS A CD  1 
ATOM   429  C CE  . LYS A 1 51  ? 32.155 62.607 135.609 1.00 52.17 ? 51  LYS A CE  1 
ATOM   430  N NZ  . LYS A 1 51  ? 30.793 62.679 136.220 1.00 50.76 ? 51  LYS A NZ  1 
ATOM   431  N N   . ASP A 1 52  ? 36.795 61.042 132.102 1.00 27.90 ? 52  ASP A N   1 
ATOM   432  C CA  . ASP A 1 52  ? 36.939 60.149 130.957 1.00 29.29 ? 52  ASP A CA  1 
ATOM   433  C C   . ASP A 1 52  ? 38.293 60.263 130.271 1.00 26.07 ? 52  ASP A C   1 
ATOM   434  O O   . ASP A 1 52  ? 38.862 61.352 130.177 1.00 23.62 ? 52  ASP A O   1 
ATOM   435  C CB  . ASP A 1 52  ? 35.820 60.432 129.949 1.00 30.57 ? 52  ASP A CB  1 
ATOM   436  C CG  . ASP A 1 52  ? 34.437 60.179 130.526 1.00 33.13 ? 52  ASP A CG  1 
ATOM   437  O OD1 . ASP A 1 52  ? 33.956 59.021 130.470 1.00 32.45 ? 52  ASP A OD1 1 
ATOM   438  O OD2 . ASP A 1 52  ? 33.837 61.143 131.054 1.00 35.10 ? 52  ASP A OD2 1 
ATOM   439  N N   . VAL A 1 53  ? 38.809 59.127 129.812 1.00 26.60 ? 53  VAL A N   1 
ATOM   440  C CA  . VAL A 1 53  ? 40.091 59.112 129.124 1.00 26.41 ? 53  VAL A CA  1 
ATOM   441  C C   . VAL A 1 53  ? 39.936 59.920 127.853 1.00 24.38 ? 53  VAL A C   1 
ATOM   442  O O   . VAL A 1 53  ? 38.981 59.736 127.098 1.00 24.19 ? 53  VAL A O   1 
ATOM   443  C CB  . VAL A 1 53  ? 40.541 57.672 128.761 1.00 29.01 ? 53  VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 53  ? 41.856 57.713 127.990 1.00 24.90 ? 53  VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 53  ? 40.726 56.855 130.019 1.00 34.58 ? 53  VAL A CG2 1 
ATOM   446  N N   . GLN A 1 54  ? 40.864 60.839 127.634 1.00 23.77 ? 54  GLN A N   1 
ATOM   447  C CA  . GLN A 1 54  ? 40.845 61.685 126.454 1.00 21.94 ? 54  GLN A CA  1 
ATOM   448  C C   . GLN A 1 54  ? 41.756 61.127 125.357 1.00 23.35 ? 54  GLN A C   1 
ATOM   449  O O   . GLN A 1 54  ? 41.432 61.204 124.168 1.00 23.06 ? 54  GLN A O   1 
ATOM   450  C CB  . GLN A 1 54  ? 41.290 63.103 126.834 1.00 26.91 ? 54  GLN A CB  1 
ATOM   451  C CG  . GLN A 1 54  ? 41.466 64.048 125.660 1.00 25.50 ? 54  GLN A CG  1 
ATOM   452  C CD  . GLN A 1 54  ? 40.201 64.232 124.851 1.00 30.13 ? 54  GLN A CD  1 
ATOM   453  O OE1 . GLN A 1 54  ? 39.093 63.986 125.333 1.00 32.32 ? 54  GLN A OE1 1 
ATOM   454  N NE2 . GLN A 1 54  ? 40.357 64.680 123.619 1.00 27.94 ? 54  GLN A NE2 1 
ATOM   455  N N   . SER A 1 55  ? 42.892 60.559 125.747 1.00 21.71 ? 55  SER A N   1 
ATOM   456  C CA  . SER A 1 55  ? 43.819 60.014 124.758 1.00 21.79 ? 55  SER A CA  1 
ATOM   457  C C   . SER A 1 55  ? 44.971 59.280 125.432 1.00 24.21 ? 55  SER A C   1 
ATOM   458  O O   . SER A 1 55  ? 45.271 59.531 126.607 1.00 23.21 ? 55  SER A O   1 
ATOM   459  C CB  . SER A 1 55  ? 44.360 61.166 123.902 1.00 23.33 ? 55  SER A CB  1 
ATOM   460  O OG  . SER A 1 55  ? 45.016 60.709 122.738 1.00 22.91 ? 55  SER A OG  1 
ATOM   461  N N   . THR A 1 56  ? 45.590 58.347 124.709 1.00 21.30 ? 56  THR A N   1 
ATOM   462  C CA  . THR A 1 56  ? 46.743 57.626 125.238 1.00 23.29 ? 56  THR A CA  1 
ATOM   463  C C   . THR A 1 56  ? 47.837 57.710 124.185 1.00 24.29 ? 56  THR A C   1 
ATOM   464  O O   . THR A 1 56  ? 47.585 57.682 122.968 1.00 22.18 ? 56  THR A O   1 
ATOM   465  C CB  . THR A 1 56  ? 46.484 56.124 125.569 1.00 22.23 ? 56  THR A CB  1 
ATOM   466  O OG1 . THR A 1 56  ? 46.685 55.326 124.398 1.00 27.35 ? 56  THR A OG1 1 
ATOM   467  C CG2 . THR A 1 56  ? 45.073 55.917 126.118 1.00 25.59 ? 56  THR A CG2 1 
ATOM   468  N N   . GLU A 1 57  ? 49.055 57.836 124.678 1.00 24.57 ? 57  GLU A N   1 
ATOM   469  C CA  . GLU A 1 57  ? 50.237 57.987 123.846 1.00 23.94 ? 57  GLU A CA  1 
ATOM   470  C C   . GLU A 1 57  ? 50.442 56.909 122.783 1.00 21.58 ? 57  GLU A C   1 
ATOM   471  O O   . GLU A 1 57  ? 50.672 57.223 121.605 1.00 21.39 ? 57  GLU A O   1 
ATOM   472  C CB  . GLU A 1 57  ? 51.472 58.059 124.761 1.00 26.07 ? 57  GLU A CB  1 
ATOM   473  C CG  . GLU A 1 57  ? 52.801 58.274 124.046 1.00 27.82 ? 57  GLU A CG  1 
ATOM   474  C CD  . GLU A 1 57  ? 54.006 57.963 124.937 1.00 30.51 ? 57  GLU A CD  1 
ATOM   475  O OE1 . GLU A 1 57  ? 53.840 57.758 126.163 1.00 27.14 ? 57  GLU A OE1 1 
ATOM   476  O OE2 . GLU A 1 57  ? 55.128 57.926 124.401 1.00 28.24 ? 57  GLU A OE2 1 
ATOM   477  N N   . ARG A 1 58  ? 50.355 55.643 123.187 1.00 20.91 ? 58  ARG A N   1 
ATOM   478  C CA  . ARG A 1 58  ? 50.618 54.561 122.250 1.00 23.71 ? 58  ARG A CA  1 
ATOM   479  C C   . ARG A 1 58  ? 49.484 54.121 121.324 1.00 23.91 ? 58  ARG A C   1 
ATOM   480  O O   . ARG A 1 58  ? 49.715 53.305 120.441 1.00 25.89 ? 58  ARG A O   1 
ATOM   481  C CB  . ARG A 1 58  ? 51.222 53.351 122.998 1.00 25.12 ? 58  ARG A CB  1 
ATOM   482  C CG  . ARG A 1 58  ? 52.631 53.656 123.603 1.00 27.81 ? 58  ARG A CG  1 
ATOM   483  C CD  . ARG A 1 58  ? 53.177 52.559 124.543 1.00 30.49 ? 58  ARG A CD  1 
ATOM   484  N NE  . ARG A 1 58  ? 54.314 53.066 125.326 1.00 37.23 ? 58  ARG A NE  1 
ATOM   485  C CZ  . ARG A 1 58  ? 54.744 52.554 126.480 1.00 37.62 ? 58  ARG A CZ  1 
ATOM   486  N NH1 . ARG A 1 58  ? 54.146 51.498 127.015 1.00 35.34 ? 58  ARG A NH1 1 
ATOM   487  N NH2 . ARG A 1 58  ? 55.761 53.124 127.122 1.00 41.12 ? 58  ARG A NH2 1 
ATOM   488  N N   . ASP A 1 59  ? 48.271 54.633 121.505 1.00 24.54 ? 59  ASP A N   1 
ATOM   489  C CA  . ASP A 1 59  ? 47.202 54.267 120.573 1.00 23.95 ? 59  ASP A CA  1 
ATOM   490  C C   . ASP A 1 59  ? 46.591 55.482 119.887 1.00 21.46 ? 59  ASP A C   1 
ATOM   491  O O   . ASP A 1 59  ? 45.729 55.332 119.015 1.00 20.73 ? 59  ASP A O   1 
ATOM   492  C CB  . ASP A 1 59  ? 46.084 53.458 121.258 1.00 22.19 ? 59  ASP A CB  1 
ATOM   493  C CG  . ASP A 1 59  ? 44.985 54.336 121.842 1.00 26.53 ? 59  ASP A CG  1 
ATOM   494  O OD1 . ASP A 1 59  ? 43.816 53.896 121.838 1.00 26.26 ? 59  ASP A OD1 1 
ATOM   495  O OD2 . ASP A 1 59  ? 45.284 55.455 122.316 1.00 28.26 ? 59  ASP A OD2 1 
ATOM   496  N N   . GLU A 1 60  ? 47.024 56.689 120.253 1.00 19.51 ? 60  GLU A N   1 
ATOM   497  C CA  . GLU A 1 60  ? 46.426 57.867 119.628 1.00 21.39 ? 60  GLU A CA  1 
ATOM   498  C C   . GLU A 1 60  ? 46.563 57.913 118.102 1.00 19.81 ? 60  GLU A C   1 
ATOM   499  O O   . GLU A 1 60  ? 45.721 58.506 117.430 1.00 20.58 ? 60  GLU A O   1 
ATOM   500  C CB  . GLU A 1 60  ? 46.968 59.168 120.252 1.00 20.72 ? 60  GLU A CB  1 
ATOM   501  C CG  . GLU A 1 60  ? 48.458 59.380 120.137 1.00 20.26 ? 60  GLU A CG  1 
ATOM   502  C CD  . GLU A 1 60  ? 48.877 60.106 118.872 1.00 24.97 ? 60  GLU A CD  1 
ATOM   503  O OE1 . GLU A 1 60  ? 48.016 60.401 118.009 1.00 22.00 ? 60  GLU A OE1 1 
ATOM   504  O OE2 . GLU A 1 60  ? 50.090 60.384 118.747 1.00 22.69 ? 60  GLU A OE2 1 
ATOM   505  N N   . TYR A 1 61  ? 47.594 57.291 117.538 1.00 19.71 ? 61  TYR A N   1 
ATOM   506  C CA  . TYR A 1 61  ? 47.725 57.340 116.084 1.00 20.47 ? 61  TYR A CA  1 
ATOM   507  C C   . TYR A 1 61  ? 46.507 56.691 115.423 1.00 17.18 ? 61  TYR A C   1 
ATOM   508  O O   . TYR A 1 61  ? 46.058 57.141 114.382 1.00 17.11 ? 61  TYR A O   1 
ATOM   509  C CB  . TYR A 1 61  ? 49.022 56.661 115.595 1.00 21.49 ? 61  TYR A CB  1 
ATOM   510  C CG  . TYR A 1 61  ? 49.035 55.143 115.668 1.00 24.85 ? 61  TYR A CG  1 
ATOM   511  C CD1 . TYR A 1 61  ? 49.230 54.488 116.880 1.00 22.23 ? 61  TYR A CD1 1 
ATOM   512  C CD2 . TYR A 1 61  ? 48.865 54.364 114.515 1.00 22.97 ? 61  TYR A CD2 1 
ATOM   513  C CE1 . TYR A 1 61  ? 49.260 53.100 116.954 1.00 25.79 ? 61  TYR A CE1 1 
ATOM   514  C CE2 . TYR A 1 61  ? 48.887 52.969 114.572 1.00 22.80 ? 61  TYR A CE2 1 
ATOM   515  C CZ  . TYR A 1 61  ? 49.085 52.349 115.801 1.00 26.17 ? 61  TYR A CZ  1 
ATOM   516  O OH  . TYR A 1 61  ? 49.089 50.986 115.892 1.00 24.70 ? 61  TYR A OH  1 
ATOM   517  N N   . ILE A 1 62  ? 45.967 55.644 116.045 1.00 20.52 ? 62  ILE A N   1 
ATOM   518  C CA  . ILE A 1 62  ? 44.787 54.948 115.521 1.00 18.85 ? 62  ILE A CA  1 
ATOM   519  C C   . ILE A 1 62  ? 43.578 55.887 115.517 1.00 21.85 ? 62  ILE A C   1 
ATOM   520  O O   . ILE A 1 62  ? 42.885 56.042 114.510 1.00 17.23 ? 62  ILE A O   1 
ATOM   521  C CB  . ILE A 1 62  ? 44.448 53.720 116.386 1.00 20.38 ? 62  ILE A CB  1 
ATOM   522  C CG1 . ILE A 1 62  ? 45.574 52.684 116.269 1.00 19.03 ? 62  ILE A CG1 1 
ATOM   523  C CG2 . ILE A 1 62  ? 43.085 53.137 115.962 1.00 18.98 ? 62  ILE A CG2 1 
ATOM   524  C CD1 . ILE A 1 62  ? 45.469 51.507 117.260 1.00 16.67 ? 62  ILE A CD1 1 
ATOM   525  N N   . TYR A 1 63  ? 43.332 56.517 116.658 1.00 19.89 ? 63  TYR A N   1 
ATOM   526  C CA  . TYR A 1 63  ? 42.218 57.434 116.766 1.00 18.43 ? 63  TYR A CA  1 
ATOM   527  C C   . TYR A 1 63  ? 42.358 58.618 115.827 1.00 20.01 ? 63  TYR A C   1 
ATOM   528  O O   . TYR A 1 63  ? 41.409 58.992 115.151 1.00 20.52 ? 63  TYR A O   1 
ATOM   529  C CB  . TYR A 1 63  ? 42.089 57.963 118.197 1.00 18.45 ? 63  TYR A CB  1 
ATOM   530  C CG  . TYR A 1 63  ? 41.046 59.060 118.329 1.00 18.85 ? 63  TYR A CG  1 
ATOM   531  C CD1 . TYR A 1 63  ? 41.389 60.412 118.197 1.00 19.06 ? 63  TYR A CD1 1 
ATOM   532  C CD2 . TYR A 1 63  ? 39.710 58.740 118.557 1.00 20.90 ? 63  TYR A CD2 1 
ATOM   533  C CE1 . TYR A 1 63  ? 40.407 61.423 118.290 1.00 22.04 ? 63  TYR A CE1 1 
ATOM   534  C CE2 . TYR A 1 63  ? 38.732 59.733 118.656 1.00 23.18 ? 63  TYR A CE2 1 
ATOM   535  C CZ  . TYR A 1 63  ? 39.081 61.066 118.524 1.00 21.96 ? 63  TYR A CZ  1 
ATOM   536  O OH  . TYR A 1 63  ? 38.091 62.026 118.662 1.00 22.70 ? 63  TYR A OH  1 
ATOM   537  N N   . HIS A 1 64  ? 43.540 59.224 115.793 1.00 21.00 ? 64  HIS A N   1 
ATOM   538  C CA  . HIS A 1 64  ? 43.716 60.388 114.943 1.00 19.29 ? 64  HIS A CA  1 
ATOM   539  C C   . HIS A 1 64  ? 43.740 60.075 113.452 1.00 19.66 ? 64  HIS A C   1 
ATOM   540  O O   . HIS A 1 64  ? 43.250 60.866 112.660 1.00 18.37 ? 64  HIS A O   1 
ATOM   541  C CB  . HIS A 1 64  ? 44.948 61.176 115.407 1.00 15.31 ? 64  HIS A CB  1 
ATOM   542  C CG  . HIS A 1 64  ? 44.792 61.734 116.790 1.00 16.72 ? 64  HIS A CG  1 
ATOM   543  N ND1 . HIS A 1 64  ? 43.899 62.742 117.087 1.00 20.68 ? 64  HIS A ND1 1 
ATOM   544  C CD2 . HIS A 1 64  ? 45.331 61.351 117.972 1.00 12.25 ? 64  HIS A CD2 1 
ATOM   545  C CE1 . HIS A 1 64  ? 43.889 62.950 118.393 1.00 12.51 ? 64  HIS A CE1 1 
ATOM   546  N NE2 . HIS A 1 64  ? 44.747 62.117 118.952 1.00 18.20 ? 64  HIS A NE2 1 
ATOM   547  N N   . GLU A 1 65  ? 44.297 58.934 113.053 1.00 16.59 ? 65  GLU A N   1 
ATOM   548  C CA  . GLU A 1 65  ? 44.264 58.591 111.631 1.00 20.25 ? 65  GLU A CA  1 
ATOM   549  C C   . GLU A 1 65  ? 42.805 58.331 111.233 1.00 20.50 ? 65  GLU A C   1 
ATOM   550  O O   . GLU A 1 65  ? 42.351 58.768 110.177 1.00 20.63 ? 65  GLU A O   1 
ATOM   551  C CB  . GLU A 1 65  ? 45.100 57.341 111.339 1.00 18.87 ? 65  GLU A CB  1 
ATOM   552  C CG  . GLU A 1 65  ? 46.590 57.595 111.255 1.00 20.72 ? 65  GLU A CG  1 
ATOM   553  C CD  . GLU A 1 65  ? 47.367 56.362 110.824 1.00 18.64 ? 65  GLU A CD  1 
ATOM   554  O OE1 . GLU A 1 65  ? 46.767 55.431 110.250 1.00 21.53 ? 65  GLU A OE1 1 
ATOM   555  O OE2 . GLU A 1 65  ? 48.584 56.331 111.050 1.00 19.95 ? 65  GLU A OE2 1 
ATOM   556  N N   . THR A 1 66  ? 42.073 57.636 112.104 1.00 20.85 ? 66  THR A N   1 
ATOM   557  C CA  . THR A 1 66  ? 40.667 57.298 111.865 1.00 18.95 ? 66  THR A CA  1 
ATOM   558  C C   . THR A 1 66  ? 39.798 58.562 111.788 1.00 20.04 ? 66  THR A C   1 
ATOM   559  O O   . THR A 1 66  ? 38.900 58.676 110.957 1.00 20.24 ? 66  THR A O   1 
ATOM   560  C CB  . THR A 1 66  ? 40.134 56.375 113.005 1.00 19.85 ? 66  THR A CB  1 
ATOM   561  O OG1 . THR A 1 66  ? 40.831 55.118 112.964 1.00 18.71 ? 66  THR A OG1 1 
ATOM   562  C CG2 . THR A 1 66  ? 38.614 56.143 112.872 1.00 17.02 ? 66  THR A CG2 1 
ATOM   563  N N   . LEU A 1 67  ? 40.080 59.510 112.666 1.00 18.92 ? 67  LEU A N   1 
ATOM   564  C CA  . LEU A 1 67  ? 39.337 60.756 112.721 1.00 19.87 ? 67  LEU A CA  1 
ATOM   565  C C   . LEU A 1 67  ? 39.571 61.695 111.546 1.00 20.22 ? 67  LEU A C   1 
ATOM   566  O O   . LEU A 1 67  ? 38.634 62.313 111.040 1.00 21.48 ? 67  LEU A O   1 
ATOM   567  C CB  . LEU A 1 67  ? 39.710 61.513 114.004 1.00 23.26 ? 67  LEU A CB  1 
ATOM   568  C CG  . LEU A 1 67  ? 39.194 62.957 114.071 1.00 22.50 ? 67  LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 67  ? 37.683 62.946 114.271 1.00 22.19 ? 67  LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 67  ? 39.892 63.692 115.223 1.00 22.79 ? 67  LEU A CD2 1 
ATOM   571  N N   . VAL A 1 68  ? 40.826 61.801 111.122 1.00 19.29 ? 68  VAL A N   1 
ATOM   572  C CA  . VAL A 1 68  ? 41.207 62.739 110.069 1.00 20.33 ? 68  VAL A CA  1 
ATOM   573  C C   . VAL A 1 68  ? 41.227 62.332 108.599 1.00 22.84 ? 68  VAL A C   1 
ATOM   574  O O   . VAL A 1 68  ? 40.634 63.001 107.743 1.00 20.72 ? 68  VAL A O   1 
ATOM   575  C CB  . VAL A 1 68  ? 42.600 63.342 110.410 1.00 22.03 ? 68  VAL A CB  1 
ATOM   576  C CG1 . VAL A 1 68  ? 43.151 64.152 109.243 1.00 21.78 ? 68  VAL A CG1 1 
ATOM   577  C CG2 . VAL A 1 68  ? 42.482 64.221 111.643 1.00 22.22 ? 68  VAL A CG2 1 
ATOM   578  N N   . HIS A 1 69  ? 41.900 61.236 108.300 1.00 17.84 ? 69  HIS A N   1 
ATOM   579  C CA  . HIS A 1 69  ? 42.055 60.840 106.916 1.00 22.07 ? 69  HIS A CA  1 
ATOM   580  C C   . HIS A 1 69  ? 40.855 60.439 106.081 1.00 18.41 ? 69  HIS A C   1 
ATOM   581  O O   . HIS A 1 69  ? 40.861 60.673 104.870 1.00 21.80 ? 69  HIS A O   1 
ATOM   582  C CB  . HIS A 1 69  ? 43.177 59.809 106.842 1.00 21.33 ? 69  HIS A CB  1 
ATOM   583  C CG  . HIS A 1 69  ? 44.443 60.301 107.471 1.00 23.23 ? 69  HIS A CG  1 
ATOM   584  N ND1 . HIS A 1 69  ? 45.055 61.474 107.077 1.00 23.72 ? 69  HIS A ND1 1 
ATOM   585  C CD2 . HIS A 1 69  ? 45.190 59.810 108.486 1.00 18.97 ? 69  HIS A CD2 1 
ATOM   586  C CE1 . HIS A 1 69  ? 46.127 61.682 107.819 1.00 24.21 ? 69  HIS A CE1 1 
ATOM   587  N NE2 . HIS A 1 69  ? 46.233 60.687 108.683 1.00 23.46 ? 69  HIS A NE2 1 
ATOM   588  N N   . PRO A 1 70  ? 39.808 59.844 106.685 1.00 21.13 ? 70  PRO A N   1 
ATOM   589  C CA  . PRO A 1 70  ? 38.713 59.520 105.771 1.00 21.10 ? 70  PRO A CA  1 
ATOM   590  C C   . PRO A 1 70  ? 38.164 60.798 105.106 1.00 23.25 ? 70  PRO A C   1 
ATOM   591  O O   . PRO A 1 70  ? 37.949 60.828 103.895 1.00 22.81 ? 70  PRO A O   1 
ATOM   592  C CB  . PRO A 1 70  ? 37.697 58.824 106.685 1.00 21.27 ? 70  PRO A CB  1 
ATOM   593  C CG  . PRO A 1 70  ? 38.584 58.111 107.661 1.00 19.75 ? 70  PRO A CG  1 
ATOM   594  C CD  . PRO A 1 70  ? 39.605 59.200 107.995 1.00 19.23 ? 70  PRO A CD  1 
ATOM   595  N N   . ALA A 1 71  ? 37.961 61.856 105.888 1.00 22.51 ? 71  ALA A N   1 
ATOM   596  C CA  . ALA A 1 71  ? 37.453 63.116 105.326 1.00 25.81 ? 71  ALA A CA  1 
ATOM   597  C C   . ALA A 1 71  ? 38.478 63.775 104.404 1.00 25.08 ? 71  ALA A C   1 
ATOM   598  O O   . ALA A 1 71  ? 38.130 64.283 103.335 1.00 24.75 ? 71  ALA A O   1 
ATOM   599  C CB  . ALA A 1 71  ? 37.089 64.092 106.440 1.00 19.01 ? 71  ALA A CB  1 
ATOM   600  N N   . MET A 1 72  ? 39.738 63.771 104.824 1.00 25.09 ? 72  MET A N   1 
ATOM   601  C CA  . MET A 1 72  ? 40.791 64.390 104.029 1.00 27.43 ? 72  MET A CA  1 
ATOM   602  C C   . MET A 1 72  ? 41.012 63.663 102.711 1.00 29.89 ? 72  MET A C   1 
ATOM   603  O O   . MET A 1 72  ? 41.159 64.296 101.667 1.00 33.17 ? 72  MET A O   1 
ATOM   604  C CB  . MET A 1 72  ? 42.102 64.445 104.819 1.00 26.23 ? 72  MET A CB  1 
ATOM   605  C CG  . MET A 1 72  ? 42.071 65.354 106.045 1.00 27.18 ? 72  MET A CG  1 
ATOM   606  S SD  . MET A 1 72  ? 41.934 67.136 105.684 1.00 27.85 ? 72  MET A SD  1 
ATOM   607  C CE  . MET A 1 72  ? 43.609 67.449 104.999 1.00 28.71 ? 72  MET A CE  1 
ATOM   608  N N   . LEU A 1 73  ? 41.024 62.336 102.758 1.00 28.82 ? 73  LEU A N   1 
ATOM   609  C CA  . LEU A 1 73  ? 41.238 61.534 101.566 1.00 27.49 ? 73  LEU A CA  1 
ATOM   610  C C   . LEU A 1 73  ? 40.049 61.511 100.618 1.00 27.43 ? 73  LEU A C   1 
ATOM   611  O O   . LEU A 1 73  ? 40.229 61.357 99.414  1.00 25.95 ? 73  LEU A O   1 
ATOM   612  C CB  . LEU A 1 73  ? 41.614 60.100 101.947 1.00 26.41 ? 73  LEU A CB  1 
ATOM   613  C CG  . LEU A 1 73  ? 43.034 59.921 102.481 1.00 26.93 ? 73  LEU A CG  1 
ATOM   614  C CD1 . LEU A 1 73  ? 43.230 58.513 103.035 1.00 22.32 ? 73  LEU A CD1 1 
ATOM   615  C CD2 . LEU A 1 73  ? 44.015 60.202 101.336 1.00 28.18 ? 73  LEU A CD2 1 
ATOM   616  N N   . THR A 1 74  ? 38.838 61.653 101.147 1.00 26.89 ? 74  THR A N   1 
ATOM   617  C CA  . THR A 1 74  ? 37.669 61.642 100.280 1.00 29.75 ? 74  THR A CA  1 
ATOM   618  C C   . THR A 1 74  ? 37.523 62.984 99.547  1.00 30.58 ? 74  THR A C   1 
ATOM   619  O O   . THR A 1 74  ? 36.765 63.102 98.579  1.00 30.74 ? 74  THR A O   1 
ATOM   620  C CB  . THR A 1 74  ? 36.372 61.314 101.069 1.00 30.52 ? 74  THR A CB  1 
ATOM   621  O OG1 . THR A 1 74  ? 35.303 61.099 100.142 1.00 38.30 ? 74  THR A OG1 1 
ATOM   622  C CG2 . THR A 1 74  ? 35.993 62.451 102.003 1.00 29.04 ? 74  THR A CG2 1 
ATOM   623  N N   . HIS A 1 75  ? 38.256 63.996 100.002 1.00 30.03 ? 75  HIS A N   1 
ATOM   624  C CA  . HIS A 1 75  ? 38.221 65.303 99.348  1.00 30.05 ? 75  HIS A CA  1 
ATOM   625  C C   . HIS A 1 75  ? 39.347 65.306 98.311  1.00 31.47 ? 75  HIS A C   1 
ATOM   626  O O   . HIS A 1 75  ? 40.511 65.098 98.650  1.00 30.38 ? 75  HIS A O   1 
ATOM   627  C CB  . HIS A 1 75  ? 38.443 66.424 100.364 1.00 29.36 ? 75  HIS A CB  1 
ATOM   628  C CG  . HIS A 1 75  ? 38.171 67.791 99.820  1.00 34.07 ? 75  HIS A CG  1 
ATOM   629  N ND1 . HIS A 1 75  ? 38.973 68.391 98.870  1.00 36.11 ? 75  HIS A ND1 1 
ATOM   630  C CD2 . HIS A 1 75  ? 37.165 68.664 100.069 1.00 34.37 ? 75  HIS A CD2 1 
ATOM   631  C CE1 . HIS A 1 75  ? 38.472 69.574 98.559  1.00 38.66 ? 75  HIS A CE1 1 
ATOM   632  N NE2 . HIS A 1 75  ? 37.375 69.764 99.273  1.00 35.43 ? 75  HIS A NE2 1 
ATOM   633  N N   . PRO A 1 76  ? 39.014 65.551 97.034  1.00 34.19 ? 76  PRO A N   1 
ATOM   634  C CA  . PRO A 1 76  ? 40.028 65.565 95.971  1.00 36.39 ? 76  PRO A CA  1 
ATOM   635  C C   . PRO A 1 76  ? 41.243 66.487 96.173  1.00 36.96 ? 76  PRO A C   1 
ATOM   636  O O   . PRO A 1 76  ? 42.344 66.167 95.724  1.00 37.60 ? 76  PRO A O   1 
ATOM   637  C CB  . PRO A 1 76  ? 39.213 65.918 94.723  1.00 38.13 ? 76  PRO A CB  1 
ATOM   638  C CG  . PRO A 1 76  ? 38.112 66.771 95.268  1.00 38.98 ? 76  PRO A CG  1 
ATOM   639  C CD  . PRO A 1 76  ? 37.714 66.033 96.529  1.00 36.57 ? 76  PRO A CD  1 
ATOM   640  N N   . GLU A 1 77  ? 41.062 67.618 96.847  1.00 36.30 ? 77  GLU A N   1 
ATOM   641  C CA  . GLU A 1 77  ? 42.180 68.537 97.059  1.00 38.82 ? 77  GLU A CA  1 
ATOM   642  C C   . GLU A 1 77  ? 41.909 69.518 98.201  1.00 39.05 ? 77  GLU A C   1 
ATOM   643  O O   . GLU A 1 77  ? 41.568 70.680 97.971  1.00 39.13 ? 77  GLU A O   1 
ATOM   644  C CB  . GLU A 1 77  ? 42.480 69.324 95.768  1.00 41.69 ? 77  GLU A CB  1 
ATOM   645  C CG  . GLU A 1 77  ? 43.673 70.278 95.889  1.00 44.19 ? 77  GLU A CG  1 
ATOM   646  C CD  . GLU A 1 77  ? 43.963 71.074 94.617  1.00 48.18 ? 77  GLU A CD  1 
ATOM   647  O OE1 . GLU A 1 77  ? 45.006 71.766 94.586  1.00 48.87 ? 77  GLU A OE1 1 
ATOM   648  O OE2 . GLU A 1 77  ? 43.160 71.017 93.659  1.00 44.21 ? 77  GLU A OE2 1 
ATOM   649  N N   . PRO A 1 78  ? 42.059 69.063 99.456  1.00 37.47 ? 78  PRO A N   1 
ATOM   650  C CA  . PRO A 1 78  ? 41.807 69.977 100.571 1.00 37.34 ? 78  PRO A CA  1 
ATOM   651  C C   . PRO A 1 78  ? 42.953 70.976 100.752 1.00 36.75 ? 78  PRO A C   1 
ATOM   652  O O   . PRO A 1 78  ? 44.099 70.572 100.934 1.00 35.48 ? 78  PRO A O   1 
ATOM   653  C CB  . PRO A 1 78  ? 41.672 69.027 101.761 1.00 36.75 ? 78  PRO A CB  1 
ATOM   654  C CG  . PRO A 1 78  ? 42.674 67.947 101.414 1.00 37.61 ? 78  PRO A CG  1 
ATOM   655  C CD  . PRO A 1 78  ? 42.390 67.709 99.942  1.00 35.21 ? 78  PRO A CD  1 
ATOM   656  N N   . LYS A 1 79  ? 42.640 72.271 100.701 1.00 36.53 ? 79  LYS A N   1 
ATOM   657  C CA  . LYS A 1 79  ? 43.658 73.310 100.875 1.00 38.29 ? 79  LYS A CA  1 
ATOM   658  C C   . LYS A 1 79  ? 43.494 74.049 102.199 1.00 38.30 ? 79  LYS A C   1 
ATOM   659  O O   . LYS A 1 79  ? 44.479 74.478 102.802 1.00 39.06 ? 79  LYS A O   1 
ATOM   660  C CB  . LYS A 1 79  ? 43.597 74.328 99.731  1.00 42.01 ? 79  LYS A CB  1 
ATOM   661  C CG  . LYS A 1 79  ? 43.847 73.748 98.342  1.00 44.40 ? 79  LYS A CG  1 
ATOM   662  C CD  . LYS A 1 79  ? 43.797 74.849 97.288  1.00 47.40 ? 79  LYS A CD  1 
ATOM   663  C CE  . LYS A 1 79  ? 43.794 74.273 95.882  1.00 50.01 ? 79  LYS A CE  1 
ATOM   664  N NZ  . LYS A 1 79  ? 43.711 75.348 94.851  1.00 52.95 ? 79  LYS A NZ  1 
ATOM   665  N N   . ARG A 1 80  ? 42.250 74.208 102.642 1.00 37.29 ? 80  ARG A N   1 
ATOM   666  C CA  . ARG A 1 80  ? 41.964 74.904 103.898 1.00 38.23 ? 80  ARG A CA  1 
ATOM   667  C C   . ARG A 1 80  ? 41.166 74.010 104.838 1.00 34.82 ? 80  ARG A C   1 
ATOM   668  O O   . ARG A 1 80  ? 40.081 73.547 104.502 1.00 31.74 ? 80  ARG A O   1 
ATOM   669  C CB  . ARG A 1 80  ? 41.190 76.197 103.618 1.00 42.33 ? 80  ARG A CB  1 
ATOM   670  C CG  . ARG A 1 80  ? 41.973 77.167 102.753 1.00 51.35 ? 80  ARG A CG  1 
ATOM   671  C CD  . ARG A 1 80  ? 41.145 78.346 102.269 1.00 58.21 ? 80  ARG A CD  1 
ATOM   672  N NE  . ARG A 1 80  ? 41.881 79.121 101.268 1.00 65.24 ? 80  ARG A NE  1 
ATOM   673  C CZ  . ARG A 1 80  ? 42.312 78.631 100.105 1.00 68.32 ? 80  ARG A CZ  1 
ATOM   674  N NH1 . ARG A 1 80  ? 42.081 77.363 99.783  1.00 69.91 ? 80  ARG A NH1 1 
ATOM   675  N NH2 . ARG A 1 80  ? 42.981 79.407 99.262  1.00 70.59 ? 80  ARG A NH2 1 
ATOM   676  N N   . VAL A 1 81  ? 41.704 73.777 106.027 1.00 35.23 ? 81  VAL A N   1 
ATOM   677  C CA  . VAL A 1 81  ? 41.038 72.911 106.986 1.00 33.30 ? 81  VAL A CA  1 
ATOM   678  C C   . VAL A 1 81  ? 40.795 73.578 108.327 1.00 34.17 ? 81  VAL A C   1 
ATOM   679  O O   . VAL A 1 81  ? 41.616 74.372 108.802 1.00 34.80 ? 81  VAL A O   1 
ATOM   680  C CB  . VAL A 1 81  ? 41.859 71.625 107.210 1.00 35.17 ? 81  VAL A CB  1 
ATOM   681  C CG1 . VAL A 1 81  ? 41.168 70.721 108.245 1.00 32.84 ? 81  VAL A CG1 1 
ATOM   682  C CG2 . VAL A 1 81  ? 42.048 70.902 105.884 1.00 31.79 ? 81  VAL A CG2 1 
ATOM   683  N N   . LEU A 1 82  ? 39.652 73.246 108.926 1.00 29.36 ? 82  LEU A N   1 
ATOM   684  C CA  . LEU A 1 82  ? 39.263 73.765 110.228 1.00 28.72 ? 82  LEU A CA  1 
ATOM   685  C C   . LEU A 1 82  ? 39.131 72.608 111.215 1.00 27.83 ? 82  LEU A C   1 
ATOM   686  O O   . LEU A 1 82  ? 38.423 71.641 110.957 1.00 28.86 ? 82  LEU A O   1 
ATOM   687  C CB  . LEU A 1 82  ? 37.916 74.502 110.144 1.00 30.68 ? 82  LEU A CB  1 
ATOM   688  C CG  . LEU A 1 82  ? 37.368 74.961 111.502 1.00 34.00 ? 82  LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 82  ? 38.345 75.956 112.149 1.00 36.06 ? 82  LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 82  ? 35.988 75.582 111.332 1.00 36.57 ? 82  LEU A CD2 1 
ATOM   691  N N   . ILE A 1 83  ? 39.825 72.707 112.338 1.00 26.61 ? 83  ILE A N   1 
ATOM   692  C CA  . ILE A 1 83  ? 39.745 71.684 113.363 1.00 28.97 ? 83  ILE A CA  1 
ATOM   693  C C   . ILE A 1 83  ? 39.039 72.312 114.555 1.00 30.02 ? 83  ILE A C   1 
ATOM   694  O O   . ILE A 1 83  ? 39.444 73.369 115.040 1.00 31.30 ? 83  ILE A O   1 
ATOM   695  C CB  . ILE A 1 83  ? 41.146 71.204 113.811 1.00 25.40 ? 83  ILE A CB  1 
ATOM   696  C CG1 . ILE A 1 83  ? 41.868 70.547 112.633 1.00 28.79 ? 83  ILE A CG1 1 
ATOM   697  C CG2 . ILE A 1 83  ? 41.009 70.226 114.979 1.00 26.68 ? 83  ILE A CG2 1 
ATOM   698  C CD1 . ILE A 1 83  ? 43.361 70.328 112.874 1.00 28.27 ? 83  ILE A CD1 1 
ATOM   699  N N   . VAL A 1 84  ? 37.958 71.683 114.999 1.00 30.14 ? 84  VAL A N   1 
ATOM   700  C CA  . VAL A 1 84  ? 37.213 72.166 116.158 1.00 29.27 ? 84  VAL A CA  1 
ATOM   701  C C   . VAL A 1 84  ? 37.523 71.148 117.233 1.00 29.62 ? 84  VAL A C   1 
ATOM   702  O O   . VAL A 1 84  ? 37.087 70.002 117.142 1.00 29.01 ? 84  VAL A O   1 
ATOM   703  C CB  . VAL A 1 84  ? 35.690 72.178 115.881 1.00 31.60 ? 84  VAL A CB  1 
ATOM   704  C CG1 . VAL A 1 84  ? 34.924 72.494 117.162 1.00 30.12 ? 84  VAL A CG1 1 
ATOM   705  C CG2 . VAL A 1 84  ? 35.367 73.199 114.797 1.00 32.50 ? 84  VAL A CG2 1 
ATOM   706  N N   . GLY A 1 85  ? 38.273 71.561 118.248 1.00 27.58 ? 85  GLY A N   1 
ATOM   707  C CA  . GLY A 1 85  ? 38.655 70.638 119.298 1.00 28.53 ? 85  GLY A CA  1 
ATOM   708  C C   . GLY A 1 85  ? 40.063 70.137 119.012 1.00 32.55 ? 85  GLY A C   1 
ATOM   709  O O   . GLY A 1 85  ? 40.906 70.894 118.512 1.00 34.15 ? 85  GLY A O   1 
ATOM   710  N N   . GLY A 1 86  ? 40.323 68.869 119.318 1.00 32.96 ? 86  GLY A N   1 
ATOM   711  C CA  . GLY A 1 86  ? 41.642 68.296 119.081 1.00 34.19 ? 86  GLY A CA  1 
ATOM   712  C C   . GLY A 1 86  ? 42.772 69.041 119.771 1.00 35.36 ? 86  GLY A C   1 
ATOM   713  O O   . GLY A 1 86  ? 43.810 69.317 119.163 1.00 36.85 ? 86  GLY A O   1 
ATOM   714  N N   . GLY A 1 87  ? 42.581 69.335 121.054 1.00 32.78 ? 87  GLY A N   1 
ATOM   715  C CA  . GLY A 1 87  ? 43.572 70.075 121.814 1.00 31.08 ? 87  GLY A CA  1 
ATOM   716  C C   . GLY A 1 87  ? 44.964 69.498 122.006 1.00 31.40 ? 87  GLY A C   1 
ATOM   717  O O   . GLY A 1 87  ? 45.885 70.253 122.310 1.00 32.77 ? 87  GLY A O   1 
ATOM   718  N N   . GLU A 1 88  ? 45.139 68.189 121.839 1.00 30.84 ? 88  GLU A N   1 
ATOM   719  C CA  . GLU A 1 88  ? 46.460 67.578 122.012 1.00 30.04 ? 88  GLU A CA  1 
ATOM   720  C C   . GLU A 1 88  ? 47.444 67.979 120.906 1.00 29.97 ? 88  GLU A C   1 
ATOM   721  O O   . GLU A 1 88  ? 48.672 67.919 121.088 1.00 27.50 ? 88  GLU A O   1 
ATOM   722  C CB  . GLU A 1 88  ? 46.358 66.052 122.028 1.00 26.88 ? 88  GLU A CB  1 
ATOM   723  C CG  . GLU A 1 88  ? 45.371 65.464 123.022 1.00 33.33 ? 88  GLU A CG  1 
ATOM   724  C CD  . GLU A 1 88  ? 43.926 65.485 122.530 1.00 33.35 ? 88  GLU A CD  1 
ATOM   725  O OE1 . GLU A 1 88  ? 43.087 64.829 123.180 1.00 38.51 ? 88  GLU A OE1 1 
ATOM   726  O OE2 . GLU A 1 88  ? 43.619 66.144 121.508 1.00 30.62 ? 88  GLU A OE2 1 
ATOM   727  N N   . GLY A 1 89  ? 46.908 68.356 119.752 1.00 27.27 ? 89  GLY A N   1 
ATOM   728  C CA  . GLY A 1 89  ? 47.758 68.731 118.641 1.00 25.88 ? 89  GLY A CA  1 
ATOM   729  C C   . GLY A 1 89  ? 47.975 67.625 117.608 1.00 27.17 ? 89  GLY A C   1 
ATOM   730  O O   . GLY A 1 89  ? 48.578 67.869 116.556 1.00 23.86 ? 89  GLY A O   1 
ATOM   731  N N   . ALA A 1 90  ? 47.488 66.416 117.892 1.00 24.18 ? 90  ALA A N   1 
ATOM   732  C CA  . ALA A 1 90  ? 47.653 65.288 116.965 1.00 22.03 ? 90  ALA A CA  1 
ATOM   733  C C   . ALA A 1 90  ? 46.685 65.337 115.774 1.00 22.21 ? 90  ALA A C   1 
ATOM   734  O O   . ALA A 1 90  ? 47.016 64.862 114.682 1.00 25.08 ? 90  ALA A O   1 
ATOM   735  C CB  . ALA A 1 90  ? 47.507 63.963 117.724 1.00 21.43 ? 90  ALA A CB  1 
ATOM   736  N N   . THR A 1 91  ? 45.501 65.915 115.970 1.00 21.17 ? 91  THR A N   1 
ATOM   737  C CA  . THR A 1 91  ? 44.526 66.053 114.889 1.00 22.12 ? 91  THR A CA  1 
ATOM   738  C C   . THR A 1 91  ? 45.146 66.977 113.840 1.00 24.00 ? 91  THR A C   1 
ATOM   739  O O   . THR A 1 91  ? 45.065 66.724 112.635 1.00 22.19 ? 91  THR A O   1 
ATOM   740  C CB  . THR A 1 91  ? 43.200 66.666 115.402 1.00 21.25 ? 91  THR A CB  1 
ATOM   741  O OG1 . THR A 1 91  ? 42.666 65.824 116.425 1.00 25.11 ? 91  THR A OG1 1 
ATOM   742  C CG2 . THR A 1 91  ? 42.178 66.791 114.278 1.00 19.92 ? 91  THR A CG2 1 
ATOM   743  N N   . LEU A 1 92  ? 45.783 68.041 114.315 1.00 25.67 ? 92  LEU A N   1 
ATOM   744  C CA  . LEU A 1 92  ? 46.458 69.000 113.429 1.00 25.53 ? 92  LEU A CA  1 
ATOM   745  C C   . LEU A 1 92  ? 47.621 68.285 112.718 1.00 22.43 ? 92  LEU A C   1 
ATOM   746  O O   . LEU A 1 92  ? 47.845 68.456 111.517 1.00 24.80 ? 92  LEU A O   1 
ATOM   747  C CB  . LEU A 1 92  ? 46.983 70.184 114.261 1.00 23.28 ? 92  LEU A CB  1 
ATOM   748  C CG  . LEU A 1 92  ? 47.832 71.253 113.559 1.00 25.18 ? 92  LEU A CG  1 
ATOM   749  C CD1 . LEU A 1 92  ? 47.043 71.894 112.422 1.00 23.69 ? 92  LEU A CD1 1 
ATOM   750  C CD2 . LEU A 1 92  ? 48.267 72.302 114.580 1.00 23.65 ? 92  LEU A CD2 1 
ATOM   751  N N   . ARG A 1 93  ? 48.360 67.489 113.478 1.00 24.99 ? 93  ARG A N   1 
ATOM   752  C CA  . ARG A 1 93  ? 49.483 66.719 112.944 1.00 25.50 ? 93  ARG A CA  1 
ATOM   753  C C   . ARG A 1 93  ? 49.057 65.878 111.731 1.00 27.03 ? 93  ARG A C   1 
ATOM   754  O O   . ARG A 1 93  ? 49.714 65.896 110.689 1.00 21.81 ? 93  ARG A O   1 
ATOM   755  C CB  . ARG A 1 93  ? 50.027 65.796 114.035 1.00 25.17 ? 93  ARG A CB  1 
ATOM   756  C CG  . ARG A 1 93  ? 51.255 64.973 113.651 1.00 25.46 ? 93  ARG A CG  1 
ATOM   757  C CD  . ARG A 1 93  ? 51.478 63.898 114.709 1.00 25.36 ? 93  ARG A CD  1 
ATOM   758  N NE  . ARG A 1 93  ? 50.456 62.857 114.617 1.00 23.22 ? 93  ARG A NE  1 
ATOM   759  C CZ  . ARG A 1 93  ? 50.009 62.144 115.645 1.00 19.46 ? 93  ARG A CZ  1 
ATOM   760  N NH1 . ARG A 1 93  ? 49.086 61.211 115.446 1.00 18.47 ? 93  ARG A NH1 1 
ATOM   761  N NH2 . ARG A 1 93  ? 50.465 62.373 116.873 1.00 19.01 ? 93  ARG A NH2 1 
ATOM   762  N N   . GLU A 1 94  ? 47.957 65.138 111.859 1.00 25.05 ? 94  GLU A N   1 
ATOM   763  C CA  . GLU A 1 94  ? 47.500 64.302 110.752 1.00 25.22 ? 94  GLU A CA  1 
ATOM   764  C C   . GLU A 1 94  ? 46.990 65.135 109.582 1.00 26.06 ? 94  GLU A C   1 
ATOM   765  O O   . GLU A 1 94  ? 47.237 64.793 108.424 1.00 23.84 ? 94  GLU A O   1 
ATOM   766  C CB  . GLU A 1 94  ? 46.409 63.324 111.217 1.00 22.72 ? 94  GLU A CB  1 
ATOM   767  C CG  . GLU A 1 94  ? 46.887 62.306 112.251 1.00 22.73 ? 94  GLU A CG  1 
ATOM   768  C CD  . GLU A 1 94  ? 48.059 61.458 111.768 1.00 27.07 ? 94  GLU A CD  1 
ATOM   769  O OE1 . GLU A 1 94  ? 48.023 60.980 110.617 1.00 26.54 ? 94  GLU A OE1 1 
ATOM   770  O OE2 . GLU A 1 94  ? 49.017 61.261 112.548 1.00 30.21 ? 94  GLU A OE2 1 
ATOM   771  N N   . VAL A 1 95  ? 46.281 66.222 109.883 1.00 22.10 ? 95  VAL A N   1 
ATOM   772  C CA  . VAL A 1 95  ? 45.757 67.096 108.837 1.00 24.72 ? 95  VAL A CA  1 
ATOM   773  C C   . VAL A 1 95  ? 46.908 67.667 108.004 1.00 24.55 ? 95  VAL A C   1 
ATOM   774  O O   . VAL A 1 95  ? 46.851 67.679 106.779 1.00 24.78 ? 95  VAL A O   1 
ATOM   775  C CB  . VAL A 1 95  ? 44.950 68.280 109.441 1.00 25.09 ? 95  VAL A CB  1 
ATOM   776  C CG1 . VAL A 1 95  ? 44.795 69.392 108.412 1.00 23.49 ? 95  VAL A CG1 1 
ATOM   777  C CG2 . VAL A 1 95  ? 43.575 67.802 109.899 1.00 22.87 ? 95  VAL A CG2 1 
ATOM   778  N N   . LEU A 1 96  ? 47.956 68.120 108.686 1.00 25.24 ? 96  LEU A N   1 
ATOM   779  C CA  . LEU A 1 96  ? 49.113 68.714 108.025 1.00 27.52 ? 96  LEU A CA  1 
ATOM   780  C C   . LEU A 1 96  ? 49.911 67.777 107.106 1.00 31.14 ? 96  LEU A C   1 
ATOM   781  O O   . LEU A 1 96  ? 50.753 68.250 106.339 1.00 32.43 ? 96  LEU A O   1 
ATOM   782  C CB  . LEU A 1 96  ? 50.043 69.336 109.075 1.00 27.81 ? 96  LEU A CB  1 
ATOM   783  C CG  . LEU A 1 96  ? 49.481 70.569 109.806 1.00 28.32 ? 96  LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 96  ? 50.384 70.939 110.957 1.00 28.57 ? 96  LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 96  ? 49.342 71.736 108.845 1.00 29.03 ? 96  LEU A CD2 1 
ATOM   786  N N   . LYS A 1 97  ? 49.654 66.468 107.170 1.00 28.86 ? 97  LYS A N   1 
ATOM   787  C CA  . LYS A 1 97  ? 50.362 65.503 106.310 1.00 30.01 ? 97  LYS A CA  1 
ATOM   788  C C   . LYS A 1 97  ? 49.908 65.564 104.851 1.00 28.56 ? 97  LYS A C   1 
ATOM   789  O O   . LYS A 1 97  ? 50.599 65.080 103.957 1.00 25.71 ? 97  LYS A O   1 
ATOM   790  C CB  . LYS A 1 97  ? 50.156 64.066 106.796 1.00 31.19 ? 97  LYS A CB  1 
ATOM   791  C CG  . LYS A 1 97  ? 50.864 63.690 108.079 1.00 32.10 ? 97  LYS A CG  1 
ATOM   792  C CD  . LYS A 1 97  ? 50.569 62.223 108.366 1.00 34.08 ? 97  LYS A CD  1 
ATOM   793  C CE  . LYS A 1 97  ? 51.019 61.800 109.733 1.00 30.96 ? 97  LYS A CE  1 
ATOM   794  N NZ  . LYS A 1 97  ? 50.654 60.369 109.958 1.00 31.36 ? 97  LYS A NZ  1 
ATOM   795  N N   . HIS A 1 98  ? 48.726 66.119 104.611 1.00 26.64 ? 98  HIS A N   1 
ATOM   796  C CA  . HIS A 1 98  ? 48.228 66.226 103.256 1.00 29.24 ? 98  HIS A CA  1 
ATOM   797  C C   . HIS A 1 98  ? 48.935 67.438 102.639 1.00 30.88 ? 98  HIS A C   1 
ATOM   798  O O   . HIS A 1 98  ? 48.778 68.572 103.103 1.00 27.12 ? 98  HIS A O   1 
ATOM   799  C CB  . HIS A 1 98  ? 46.702 66.365 103.290 1.00 27.14 ? 98  HIS A CB  1 
ATOM   800  C CG  . HIS A 1 98  ? 46.016 65.140 103.827 1.00 28.45 ? 98  HIS A CG  1 
ATOM   801  N ND1 . HIS A 1 98  ? 45.477 64.169 103.009 1.00 23.53 ? 98  HIS A ND1 1 
ATOM   802  C CD2 . HIS A 1 98  ? 45.871 64.684 105.095 1.00 26.27 ? 98  HIS A CD2 1 
ATOM   803  C CE1 . HIS A 1 98  ? 45.033 63.169 103.748 1.00 28.71 ? 98  HIS A CE1 1 
ATOM   804  N NE2 . HIS A 1 98  ? 45.260 63.454 105.018 1.00 27.05 ? 98  HIS A NE2 1 
ATOM   805  N N   . PRO A 1 99  ? 49.760 67.200 101.602 1.00 33.91 ? 99  PRO A N   1 
ATOM   806  C CA  . PRO A 1 99  ? 50.511 68.265 100.925 1.00 33.94 ? 99  PRO A CA  1 
ATOM   807  C C   . PRO A 1 99  ? 49.689 69.410 100.333 1.00 35.91 ? 99  PRO A C   1 
ATOM   808  O O   . PRO A 1 99  ? 50.207 70.508 100.143 1.00 36.10 ? 99  PRO A O   1 
ATOM   809  C CB  . PRO A 1 99  ? 51.317 67.502 99.871  1.00 35.93 ? 99  PRO A CB  1 
ATOM   810  C CG  . PRO A 1 99  ? 50.433 66.323 99.557  1.00 37.96 ? 99  PRO A CG  1 
ATOM   811  C CD  . PRO A 1 99  ? 49.988 65.902 100.943 1.00 34.50 ? 99  PRO A CD  1 
ATOM   812  N N   . THR A 1 100 ? 48.416 69.174 100.045 1.00 35.92 ? 100 THR A N   1 
ATOM   813  C CA  . THR A 1 100 ? 47.589 70.239 99.487  1.00 37.27 ? 100 THR A CA  1 
ATOM   814  C C   . THR A 1 100 ? 47.128 71.231 100.548 1.00 36.95 ? 100 THR A C   1 
ATOM   815  O O   . THR A 1 100 ? 46.566 72.284 100.229 1.00 36.44 ? 100 THR A O   1 
ATOM   816  C CB  . THR A 1 100 ? 46.354 69.678 98.778  1.00 38.75 ? 100 THR A CB  1 
ATOM   817  O OG1 . THR A 1 100 ? 45.645 68.807 99.668  1.00 41.27 ? 100 THR A OG1 1 
ATOM   818  C CG2 . THR A 1 100 ? 46.766 68.917 97.527  1.00 39.11 ? 100 THR A CG2 1 
ATOM   819  N N   . VAL A 1 101 ? 47.368 70.903 101.811 1.00 35.25 ? 101 VAL A N   1 
ATOM   820  C CA  . VAL A 1 101 ? 46.965 71.786 102.893 1.00 33.46 ? 101 VAL A CA  1 
ATOM   821  C C   . VAL A 1 101 ? 47.846 73.028 102.943 1.00 34.91 ? 101 VAL A C   1 
ATOM   822  O O   . VAL A 1 101 ? 49.062 72.939 103.103 1.00 35.60 ? 101 VAL A O   1 
ATOM   823  C CB  . VAL A 1 101 ? 47.019 71.073 104.260 1.00 32.64 ? 101 VAL A CB  1 
ATOM   824  C CG1 . VAL A 1 101 ? 46.689 72.062 105.382 1.00 33.15 ? 101 VAL A CG1 1 
ATOM   825  C CG2 . VAL A 1 101 ? 46.029 69.921 104.271 1.00 32.34 ? 101 VAL A CG2 1 
ATOM   826  N N   . GLU A 1 102 ? 47.205 74.185 102.814 1.00 35.28 ? 102 GLU A N   1 
ATOM   827  C CA  . GLU A 1 102 ? 47.888 75.470 102.839 1.00 35.44 ? 102 GLU A CA  1 
ATOM   828  C C   . GLU A 1 102 ? 47.634 76.172 104.167 1.00 35.54 ? 102 GLU A C   1 
ATOM   829  O O   . GLU A 1 102 ? 48.462 76.939 104.650 1.00 34.04 ? 102 GLU A O   1 
ATOM   830  C CB  . GLU A 1 102 ? 47.379 76.336 101.692 1.00 37.71 ? 102 GLU A CB  1 
ATOM   831  C CG  . GLU A 1 102 ? 47.738 75.815 100.311 1.00 41.02 ? 102 GLU A CG  1 
ATOM   832  C CD  . GLU A 1 102 ? 47.139 76.664 99.205  1.00 44.35 ? 102 GLU A CD  1 
ATOM   833  O OE1 . GLU A 1 102 ? 47.099 77.901 99.369  1.00 45.70 ? 102 GLU A OE1 1 
ATOM   834  O OE2 . GLU A 1 102 ? 46.716 76.101 98.172  1.00 48.37 ? 102 GLU A OE2 1 
ATOM   835  N N   . LYS A 1 103 ? 46.476 75.909 104.760 1.00 35.90 ? 103 LYS A N   1 
ATOM   836  C CA  . LYS A 1 103 ? 46.146 76.527 106.028 1.00 35.48 ? 103 LYS A CA  1 
ATOM   837  C C   . LYS A 1 103 ? 45.272 75.609 106.860 1.00 35.51 ? 103 LYS A C   1 
ATOM   838  O O   . LYS A 1 103 ? 44.308 75.030 106.366 1.00 36.57 ? 103 LYS A O   1 
ATOM   839  C CB  . LYS A 1 103 ? 45.423 77.859 105.795 1.00 41.27 ? 103 LYS A CB  1 
ATOM   840  C CG  . LYS A 1 103 ? 45.143 78.643 107.063 1.00 42.57 ? 103 LYS A CG  1 
ATOM   841  C CD  . LYS A 1 103 ? 44.471 79.970 106.748 1.00 47.76 ? 103 LYS A CD  1 
ATOM   842  C CE  . LYS A 1 103 ? 44.222 80.768 108.018 1.00 47.85 ? 103 LYS A CE  1 
ATOM   843  N NZ  . LYS A 1 103 ? 43.430 82.012 107.765 1.00 51.27 ? 103 LYS A NZ  1 
ATOM   844  N N   . ALA A 1 104 ? 45.623 75.481 108.131 1.00 36.12 ? 104 ALA A N   1 
ATOM   845  C CA  . ALA A 1 104 ? 44.872 74.648 109.046 1.00 35.48 ? 104 ALA A CA  1 
ATOM   846  C C   . ALA A 1 104 ? 44.640 75.435 110.328 1.00 36.35 ? 104 ALA A C   1 
ATOM   847  O O   . ALA A 1 104 ? 45.574 75.708 111.084 1.00 36.99 ? 104 ALA A O   1 
ATOM   848  C CB  . ALA A 1 104 ? 45.639 73.360 109.333 1.00 33.81 ? 104 ALA A CB  1 
ATOM   849  N N   . VAL A 1 105 ? 43.387 75.819 110.548 1.00 37.89 ? 105 VAL A N   1 
ATOM   850  C CA  . VAL A 1 105 ? 42.996 76.573 111.734 1.00 36.19 ? 105 VAL A CA  1 
ATOM   851  C C   . VAL A 1 105 ? 42.394 75.638 112.776 1.00 35.55 ? 105 VAL A C   1 
ATOM   852  O O   . VAL A 1 105 ? 41.477 74.871 112.485 1.00 36.95 ? 105 VAL A O   1 
ATOM   853  C CB  . VAL A 1 105 ? 41.936 77.647 111.402 1.00 33.66 ? 105 VAL A CB  1 
ATOM   854  C CG1 . VAL A 1 105 ? 41.536 78.384 112.676 1.00 32.95 ? 105 VAL A CG1 1 
ATOM   855  C CG2 . VAL A 1 105 ? 42.472 78.610 110.364 1.00 35.87 ? 105 VAL A CG2 1 
ATOM   856  N N   . MET A 1 106 ? 42.914 75.719 113.992 1.00 34.35 ? 106 MET A N   1 
ATOM   857  C CA  . MET A 1 106 ? 42.448 74.898 115.101 1.00 34.89 ? 106 MET A CA  1 
ATOM   858  C C   . MET A 1 106 ? 41.813 75.824 116.142 1.00 36.47 ? 106 MET A C   1 
ATOM   859  O O   . MET A 1 106 ? 42.456 76.763 116.619 1.00 33.81 ? 106 MET A O   1 
ATOM   860  C CB  . MET A 1 106 ? 43.633 74.144 115.707 1.00 32.65 ? 106 MET A CB  1 
ATOM   861  C CG  . MET A 1 106 ? 43.305 73.306 116.915 1.00 32.84 ? 106 MET A CG  1 
ATOM   862  S SD  . MET A 1 106 ? 44.769 72.446 117.471 1.00 34.66 ? 106 MET A SD  1 
ATOM   863  C CE  . MET A 1 106 ? 44.434 72.322 119.240 1.00 33.25 ? 106 MET A CE  1 
ATOM   864  N N   . VAL A 1 107 ? 40.545 75.569 116.467 1.00 35.52 ? 107 VAL A N   1 
ATOM   865  C CA  . VAL A 1 107 ? 39.811 76.374 117.445 1.00 35.90 ? 107 VAL A CA  1 
ATOM   866  C C   . VAL A 1 107 ? 39.478 75.549 118.685 1.00 38.07 ? 107 VAL A C   1 
ATOM   867  O O   . VAL A 1 107 ? 38.773 74.546 118.587 1.00 37.20 ? 107 VAL A O   1 
ATOM   868  C CB  . VAL A 1 107 ? 38.478 76.899 116.856 1.00 36.96 ? 107 VAL A CB  1 
ATOM   869  C CG1 . VAL A 1 107 ? 37.777 77.795 117.869 1.00 39.01 ? 107 VAL A CG1 1 
ATOM   870  C CG2 . VAL A 1 107 ? 38.730 77.640 115.557 1.00 37.30 ? 107 VAL A CG2 1 
ATOM   871  N N   . ASP A 1 108 ? 39.991 75.964 119.842 1.00 37.10 ? 108 ASP A N   1 
ATOM   872  C CA  . ASP A 1 108 ? 39.723 75.263 121.090 1.00 38.78 ? 108 ASP A CA  1 
ATOM   873  C C   . ASP A 1 108 ? 39.461 76.243 122.234 1.00 40.10 ? 108 ASP A C   1 
ATOM   874  O O   . ASP A 1 108 ? 40.127 77.268 122.360 1.00 38.26 ? 108 ASP A O   1 
ATOM   875  C CB  . ASP A 1 108 ? 40.882 74.341 121.456 1.00 41.43 ? 108 ASP A CB  1 
ATOM   876  C CG  . ASP A 1 108 ? 40.527 73.398 122.583 1.00 46.97 ? 108 ASP A CG  1 
ATOM   877  O OD1 . ASP A 1 108 ? 40.869 73.692 123.751 1.00 47.83 ? 108 ASP A OD1 1 
ATOM   878  O OD2 . ASP A 1 108 ? 39.881 72.363 122.299 1.00 52.47 ? 108 ASP A OD2 1 
ATOM   879  N N   . ILE A 1 109 ? 38.495 75.900 123.076 1.00 39.20 ? 109 ILE A N   1 
ATOM   880  C CA  . ILE A 1 109 ? 38.088 76.740 124.196 1.00 39.35 ? 109 ILE A CA  1 
ATOM   881  C C   . ILE A 1 109 ? 39.084 76.839 125.361 1.00 38.93 ? 109 ILE A C   1 
ATOM   882  O O   . ILE A 1 109 ? 39.209 77.891 125.987 1.00 39.94 ? 109 ILE A O   1 
ATOM   883  C CB  . ILE A 1 109 ? 36.721 76.229 124.771 1.00 41.02 ? 109 ILE A CB  1 
ATOM   884  C CG1 . ILE A 1 109 ? 36.075 77.286 125.669 1.00 40.71 ? 109 ILE A CG1 1 
ATOM   885  C CG2 . ILE A 1 109 ? 36.938 74.950 125.581 1.00 38.41 ? 109 ILE A CG2 1 
ATOM   886  C CD1 . ILE A 1 109 ? 35.542 78.489 124.920 1.00 42.49 ? 109 ILE A CD1 1 
ATOM   887  N N   . ASP A 1 110 ? 39.793 75.753 125.641 1.00 35.02 ? 110 ASP A N   1 
ATOM   888  C CA  . ASP A 1 110 ? 40.702 75.705 126.780 1.00 36.78 ? 110 ASP A CA  1 
ATOM   889  C C   . ASP A 1 110 ? 42.187 75.909 126.454 1.00 37.27 ? 110 ASP A C   1 
ATOM   890  O O   . ASP A 1 110 ? 42.922 74.955 126.175 1.00 35.63 ? 110 ASP A O   1 
ATOM   891  C CB  . ASP A 1 110 ? 40.476 74.371 127.502 1.00 34.76 ? 110 ASP A CB  1 
ATOM   892  C CG  . ASP A 1 110 ? 41.048 74.342 128.898 1.00 36.66 ? 110 ASP A CG  1 
ATOM   893  O OD1 . ASP A 1 110 ? 40.695 73.403 129.653 1.00 37.69 ? 110 ASP A OD1 1 
ATOM   894  O OD2 . ASP A 1 110 ? 41.853 75.231 129.245 1.00 38.03 ? 110 ASP A OD2 1 
ATOM   895  N N   . GLY A 1 111 ? 42.622 77.165 126.509 1.00 34.93 ? 111 GLY A N   1 
ATOM   896  C CA  . GLY A 1 111 ? 44.009 77.479 126.226 1.00 33.63 ? 111 GLY A CA  1 
ATOM   897  C C   . GLY A 1 111 ? 44.946 76.867 127.243 1.00 34.73 ? 111 GLY A C   1 
ATOM   898  O O   . GLY A 1 111 ? 46.053 76.447 126.907 1.00 35.12 ? 111 GLY A O   1 
ATOM   899  N N   . GLU A 1 112 ? 44.519 76.816 128.497 1.00 35.41 ? 112 GLU A N   1 
ATOM   900  C CA  . GLU A 1 112 ? 45.369 76.237 129.522 1.00 38.58 ? 112 GLU A CA  1 
ATOM   901  C C   . GLU A 1 112 ? 45.615 74.753 129.237 1.00 36.68 ? 112 GLU A C   1 
ATOM   902  O O   . GLU A 1 112 ? 46.720 74.250 129.441 1.00 39.02 ? 112 GLU A O   1 
ATOM   903  C CB  . GLU A 1 112 ? 44.741 76.418 130.906 1.00 39.78 ? 112 GLU A CB  1 
ATOM   904  C CG  . GLU A 1 112 ? 45.613 75.916 132.046 1.00 45.89 ? 112 GLU A CG  1 
ATOM   905  C CD  . GLU A 1 112 ? 45.084 76.319 133.415 1.00 48.28 ? 112 GLU A CD  1 
ATOM   906  O OE1 . GLU A 1 112 ? 45.604 75.805 134.429 1.00 47.95 ? 112 GLU A OE1 1 
ATOM   907  O OE2 . GLU A 1 112 ? 44.153 77.150 133.477 1.00 50.82 ? 112 GLU A OE2 1 
ATOM   908  N N   . LEU A 1 113 ? 44.587 74.055 128.763 1.00 34.58 ? 113 LEU A N   1 
ATOM   909  C CA  . LEU A 1 113 ? 44.731 72.636 128.454 1.00 32.67 ? 113 LEU A CA  1 
ATOM   910  C C   . LEU A 1 113 ? 45.719 72.442 127.299 1.00 29.86 ? 113 LEU A C   1 
ATOM   911  O O   . LEU A 1 113 ? 46.572 71.546 127.339 1.00 29.85 ? 113 LEU A O   1 
ATOM   912  C CB  . LEU A 1 113 ? 43.377 72.017 128.085 1.00 33.30 ? 113 LEU A CB  1 
ATOM   913  C CG  . LEU A 1 113 ? 43.465 70.517 127.767 1.00 33.54 ? 113 LEU A CG  1 
ATOM   914  C CD1 . LEU A 1 113 ? 43.964 69.761 128.998 1.00 37.09 ? 113 LEU A CD1 1 
ATOM   915  C CD2 . LEU A 1 113 ? 42.102 69.994 127.337 1.00 39.29 ? 113 LEU A CD2 1 
ATOM   916  N N   . VAL A 1 114 ? 45.587 73.274 126.273 1.00 28.10 ? 114 VAL A N   1 
ATOM   917  C CA  . VAL A 1 114 ? 46.473 73.214 125.114 1.00 33.48 ? 114 VAL A CA  1 
ATOM   918  C C   . VAL A 1 114 ? 47.916 73.379 125.595 1.00 36.48 ? 114 VAL A C   1 
ATOM   919  O O   . VAL A 1 114 ? 48.830 72.725 125.090 1.00 37.73 ? 114 VAL A O   1 
ATOM   920  C CB  . VAL A 1 114 ? 46.155 74.345 124.101 1.00 33.85 ? 114 VAL A CB  1 
ATOM   921  C CG1 . VAL A 1 114 ? 47.214 74.385 123.000 1.00 33.07 ? 114 VAL A CG1 1 
ATOM   922  C CG2 . VAL A 1 114 ? 44.783 74.137 123.494 1.00 33.33 ? 114 VAL A CG2 1 
ATOM   923  N N   . GLU A 1 115 ? 48.113 74.258 126.574 1.00 35.97 ? 115 GLU A N   1 
ATOM   924  C CA  . GLU A 1 115 ? 49.439 74.498 127.129 1.00 36.03 ? 115 GLU A CA  1 
ATOM   925  C C   . GLU A 1 115 ? 49.969 73.247 127.823 1.00 36.64 ? 115 GLU A C   1 
ATOM   926  O O   . GLU A 1 115 ? 51.171 72.950 127.766 1.00 32.67 ? 115 GLU A O   1 
ATOM   927  C CB  . GLU A 1 115 ? 49.398 75.668 128.118 1.00 38.44 ? 115 GLU A CB  1 
ATOM   928  C CG  . GLU A 1 115 ? 49.442 77.034 127.455 1.00 41.51 ? 115 GLU A CG  1 
ATOM   929  C CD  . GLU A 1 115 ? 50.672 77.208 126.583 1.00 42.39 ? 115 GLU A CD  1 
ATOM   930  O OE1 . GLU A 1 115 ? 51.748 76.701 126.972 1.00 42.55 ? 115 GLU A OE1 1 
ATOM   931  O OE2 . GLU A 1 115 ? 50.569 77.857 125.520 1.00 44.20 ? 115 GLU A OE2 1 
ATOM   932  N N   . VAL A 1 116 ? 49.071 72.526 128.491 1.00 31.63 ? 116 VAL A N   1 
ATOM   933  C CA  . VAL A 1 116 ? 49.448 71.287 129.157 1.00 31.16 ? 116 VAL A CA  1 
ATOM   934  C C   . VAL A 1 116 ? 49.972 70.298 128.103 1.00 30.62 ? 116 VAL A C   1 
ATOM   935  O O   . VAL A 1 116 ? 50.971 69.602 128.326 1.00 30.36 ? 116 VAL A O   1 
ATOM   936  C CB  . VAL A 1 116 ? 48.231 70.646 129.883 1.00 31.71 ? 116 VAL A CB  1 
ATOM   937  C CG1 . VAL A 1 116 ? 48.569 69.224 130.311 1.00 31.26 ? 116 VAL A CG1 1 
ATOM   938  C CG2 . VAL A 1 116 ? 47.851 71.483 131.108 1.00 30.64 ? 116 VAL A CG2 1 
ATOM   939  N N   . ALA A 1 117 ? 49.290 70.246 126.961 1.00 30.14 ? 117 ALA A N   1 
ATOM   940  C CA  . ALA A 1 117 ? 49.661 69.339 125.873 1.00 30.94 ? 117 ALA A CA  1 
ATOM   941  C C   . ALA A 1 117 ? 51.009 69.729 125.289 1.00 30.24 ? 117 ALA A C   1 
ATOM   942  O O   . ALA A 1 117 ? 51.871 68.875 125.066 1.00 30.31 ? 117 ALA A O   1 
ATOM   943  C CB  . ALA A 1 117 ? 48.589 69.363 124.768 1.00 27.83 ? 117 ALA A CB  1 
ATOM   944  N N   . LYS A 1 118 ? 51.175 71.025 125.042 1.00 31.34 ? 118 LYS A N   1 
ATOM   945  C CA  . LYS A 1 118 ? 52.416 71.552 124.492 1.00 32.23 ? 118 LYS A CA  1 
ATOM   946  C C   . LYS A 1 118 ? 53.607 71.207 125.355 1.00 33.01 ? 118 LYS A C   1 
ATOM   947  O O   . LYS A 1 118 ? 54.638 70.776 124.840 1.00 33.91 ? 118 LYS A O   1 
ATOM   948  C CB  . LYS A 1 118 ? 52.327 73.064 124.323 1.00 29.17 ? 118 LYS A CB  1 
ATOM   949  C CG  . LYS A 1 118 ? 51.510 73.468 123.122 1.00 29.24 ? 118 LYS A CG  1 
ATOM   950  C CD  . LYS A 1 118 ? 51.539 74.951 122.902 1.00 27.29 ? 118 LYS A CD  1 
ATOM   951  C CE  . LYS A 1 118 ? 50.782 75.305 121.648 1.00 26.83 ? 118 LYS A CE  1 
ATOM   952  N NZ  . LYS A 1 118 ? 50.889 76.741 121.330 1.00 28.43 ? 118 LYS A NZ  1 
ATOM   953  N N   . ARG A 1 119 ? 53.461 71.362 126.668 1.00 32.76 ? 119 ARG A N   1 
ATOM   954  C CA  . ARG A 1 119 ? 54.560 71.077 127.570 1.00 32.60 ? 119 ARG A CA  1 
ATOM   955  C C   . ARG A 1 119 ? 54.747 69.620 127.976 1.00 32.83 ? 119 ARG A C   1 
ATOM   956  O O   . ARG A 1 119 ? 55.879 69.185 128.191 1.00 31.11 ? 119 ARG A O   1 
ATOM   957  C CB  . ARG A 1 119 ? 54.445 71.917 128.854 1.00 39.28 ? 119 ARG A CB  1 
ATOM   958  C CG  . ARG A 1 119 ? 55.747 71.916 129.678 1.00 48.41 ? 119 ARG A CG  1 
ATOM   959  C CD  . ARG A 1 119 ? 55.544 71.660 131.174 1.00 53.81 ? 119 ARG A CD  1 
ATOM   960  N NE  . ARG A 1 119 ? 55.301 72.873 131.957 1.00 60.98 ? 119 ARG A NE  1 
ATOM   961  C CZ  . ARG A 1 119 ? 55.121 72.893 133.279 1.00 62.71 ? 119 ARG A CZ  1 
ATOM   962  N NH1 . ARG A 1 119 ? 55.157 71.767 133.984 1.00 63.24 ? 119 ARG A NH1 1 
ATOM   963  N NH2 . ARG A 1 119 ? 54.903 74.042 133.902 1.00 63.53 ? 119 ARG A NH2 1 
ATOM   964  N N   . HIS A 1 120 ? 53.661 68.860 128.091 1.00 28.78 ? 120 HIS A N   1 
ATOM   965  C CA  . HIS A 1 120 ? 53.786 67.480 128.546 1.00 27.94 ? 120 HIS A CA  1 
ATOM   966  C C   . HIS A 1 120 ? 53.391 66.403 127.554 1.00 25.38 ? 120 HIS A C   1 
ATOM   967  O O   . HIS A 1 120 ? 53.533 65.222 127.848 1.00 26.28 ? 120 HIS A O   1 
ATOM   968  C CB  . HIS A 1 120 ? 52.961 67.281 129.826 1.00 30.73 ? 120 HIS A CB  1 
ATOM   969  C CG  . HIS A 1 120 ? 53.344 68.196 130.948 1.00 34.35 ? 120 HIS A CG  1 
ATOM   970  N ND1 . HIS A 1 120 ? 54.410 67.943 131.787 1.00 35.02 ? 120 HIS A ND1 1 
ATOM   971  C CD2 . HIS A 1 120 ? 52.793 69.356 131.378 1.00 32.99 ? 120 HIS A CD2 1 
ATOM   972  C CE1 . HIS A 1 120 ? 54.495 68.906 132.688 1.00 33.60 ? 120 HIS A CE1 1 
ATOM   973  N NE2 . HIS A 1 120 ? 53.525 69.775 132.463 1.00 33.92 ? 120 HIS A NE2 1 
ATOM   974  N N   . MET A 1 121 ? 52.910 66.798 126.387 1.00 26.50 ? 121 MET A N   1 
ATOM   975  C CA  . MET A 1 121 ? 52.487 65.822 125.390 1.00 28.13 ? 121 MET A CA  1 
ATOM   976  C C   . MET A 1 121 ? 53.126 66.017 124.014 1.00 28.70 ? 121 MET A C   1 
ATOM   977  O O   . MET A 1 121 ? 52.434 66.067 122.994 1.00 25.42 ? 121 MET A O   1 
ATOM   978  C CB  . MET A 1 121 ? 50.957 65.856 125.283 1.00 26.52 ? 121 MET A CB  1 
ATOM   979  C CG  . MET A 1 121 ? 50.272 65.485 126.594 1.00 24.05 ? 121 MET A CG  1 
ATOM   980  S SD  . MET A 1 121 ? 48.492 65.774 126.611 1.00 29.06 ? 121 MET A SD  1 
ATOM   981  C CE  . MET A 1 121 ? 47.951 64.413 125.509 1.00 23.07 ? 121 MET A CE  1 
ATOM   982  N N   . PRO A 1 122 ? 54.466 66.127 123.970 1.00 26.81 ? 122 PRO A N   1 
ATOM   983  C CA  . PRO A 1 122 ? 55.167 66.310 122.694 1.00 25.99 ? 122 PRO A CA  1 
ATOM   984  C C   . PRO A 1 122 ? 54.975 65.113 121.741 1.00 26.53 ? 122 PRO A C   1 
ATOM   985  O O   . PRO A 1 122 ? 55.130 65.238 120.518 1.00 24.97 ? 122 PRO A O   1 
ATOM   986  C CB  . PRO A 1 122 ? 56.618 66.477 123.127 1.00 24.80 ? 122 PRO A CB  1 
ATOM   987  C CG  . PRO A 1 122 ? 56.694 65.623 124.364 1.00 25.57 ? 122 PRO A CG  1 
ATOM   988  C CD  . PRO A 1 122 ? 55.426 66.015 125.084 1.00 26.14 ? 122 PRO A CD  1 
ATOM   989  N N   . GLU A 1 123 ? 54.655 63.955 122.315 1.00 26.08 ? 123 GLU A N   1 
ATOM   990  C CA  . GLU A 1 123 ? 54.432 62.744 121.535 1.00 26.53 ? 123 GLU A CA  1 
ATOM   991  C C   . GLU A 1 123 ? 53.217 62.923 120.634 1.00 25.33 ? 123 GLU A C   1 
ATOM   992  O O   . GLU A 1 123 ? 53.126 62.309 119.575 1.00 27.89 ? 123 GLU A O   1 
ATOM   993  C CB  . GLU A 1 123 ? 54.217 61.547 122.462 1.00 27.47 ? 123 GLU A CB  1 
ATOM   994  C CG  . GLU A 1 123 ? 55.376 61.280 123.417 1.00 28.51 ? 123 GLU A CG  1 
ATOM   995  C CD  . GLU A 1 123 ? 55.310 62.093 124.707 1.00 28.08 ? 123 GLU A CD  1 
ATOM   996  O OE1 . GLU A 1 123 ? 56.147 61.837 125.601 1.00 31.16 ? 123 GLU A OE1 1 
ATOM   997  O OE2 . GLU A 1 123 ? 54.433 62.974 124.834 1.00 23.89 ? 123 GLU A OE2 1 
ATOM   998  N N   . TRP A 1 124 ? 52.279 63.758 121.073 1.00 27.41 ? 124 TRP A N   1 
ATOM   999  C CA  . TRP A 1 124 ? 51.073 64.054 120.307 1.00 24.26 ? 124 TRP A CA  1 
ATOM   1000 C C   . TRP A 1 124 ? 51.283 65.117 119.226 1.00 27.56 ? 124 TRP A C   1 
ATOM   1001 O O   . TRP A 1 124 ? 51.130 64.837 118.032 1.00 25.67 ? 124 TRP A O   1 
ATOM   1002 C CB  . TRP A 1 124 ? 49.946 64.536 121.224 1.00 24.57 ? 124 TRP A CB  1 
ATOM   1003 C CG  . TRP A 1 124 ? 49.158 63.459 121.907 1.00 23.65 ? 124 TRP A CG  1 
ATOM   1004 C CD1 . TRP A 1 124 ? 47.901 63.023 121.579 1.00 20.42 ? 124 TRP A CD1 1 
ATOM   1005 C CD2 . TRP A 1 124 ? 49.544 62.730 123.075 1.00 23.89 ? 124 TRP A CD2 1 
ATOM   1006 N NE1 . TRP A 1 124 ? 47.485 62.069 122.479 1.00 24.20 ? 124 TRP A NE1 1 
ATOM   1007 C CE2 . TRP A 1 124 ? 48.471 61.873 123.408 1.00 21.92 ? 124 TRP A CE2 1 
ATOM   1008 C CE3 . TRP A 1 124 ? 50.694 62.723 123.879 1.00 23.81 ? 124 TRP A CE3 1 
ATOM   1009 C CZ2 . TRP A 1 124 ? 48.509 61.021 124.513 1.00 18.99 ? 124 TRP A CZ2 1 
ATOM   1010 C CZ3 . TRP A 1 124 ? 50.736 61.877 124.974 1.00 25.16 ? 124 TRP A CZ3 1 
ATOM   1011 C CH2 . TRP A 1 124 ? 49.644 61.035 125.283 1.00 25.64 ? 124 TRP A CH2 1 
ATOM   1012 N N   . HIS A 1 125 ? 51.629 66.339 119.624 1.00 24.01 ? 125 HIS A N   1 
ATOM   1013 C CA  . HIS A 1 125 ? 51.780 67.395 118.620 1.00 24.41 ? 125 HIS A CA  1 
ATOM   1014 C C   . HIS A 1 125 ? 52.968 67.244 117.677 1.00 22.71 ? 125 HIS A C   1 
ATOM   1015 O O   . HIS A 1 125 ? 52.883 67.629 116.503 1.00 24.00 ? 125 HIS A O   1 
ATOM   1016 C CB  . HIS A 1 125 ? 51.764 68.789 119.283 1.00 27.89 ? 125 HIS A CB  1 
ATOM   1017 C CG  . HIS A 1 125 ? 52.842 69.005 120.303 1.00 28.02 ? 125 HIS A CG  1 
ATOM   1018 N ND1 . HIS A 1 125 ? 54.147 69.290 119.961 1.00 32.53 ? 125 HIS A ND1 1 
ATOM   1019 C CD2 . HIS A 1 125 ? 52.803 68.991 121.657 1.00 30.77 ? 125 HIS A CD2 1 
ATOM   1020 C CE1 . HIS A 1 125 ? 54.866 69.440 121.061 1.00 33.17 ? 125 HIS A CE1 1 
ATOM   1021 N NE2 . HIS A 1 125 ? 54.074 69.263 122.104 1.00 32.23 ? 125 HIS A NE2 1 
ATOM   1022 N N   . GLN A 1 126 ? 54.052 66.650 118.170 1.00 25.37 ? 126 GLN A N   1 
ATOM   1023 C CA  . GLN A 1 126 ? 55.254 66.428 117.368 1.00 26.31 ? 126 GLN A CA  1 
ATOM   1024 C C   . GLN A 1 126 ? 55.617 67.654 116.545 1.00 29.82 ? 126 GLN A C   1 
ATOM   1025 O O   . GLN A 1 126 ? 55.980 67.552 115.365 1.00 31.83 ? 126 GLN A O   1 
ATOM   1026 C CB  . GLN A 1 126 ? 55.061 65.203 116.460 1.00 24.99 ? 126 GLN A CB  1 
ATOM   1027 C CG  . GLN A 1 126 ? 54.863 63.915 117.247 1.00 24.13 ? 126 GLN A CG  1 
ATOM   1028 C CD  . GLN A 1 126 ? 54.534 62.698 116.382 1.00 29.11 ? 126 GLN A CD  1 
ATOM   1029 O OE1 . GLN A 1 126 ? 53.956 61.722 116.865 1.00 28.62 ? 126 GLN A OE1 1 
ATOM   1030 N NE2 . GLN A 1 126 ? 54.908 62.748 115.115 1.00 25.53 ? 126 GLN A NE2 1 
ATOM   1031 N N   . GLY A 1 127 ? 55.504 68.819 117.177 1.00 30.32 ? 127 GLY A N   1 
ATOM   1032 C CA  . GLY A 1 127 ? 55.838 70.071 116.514 1.00 32.71 ? 127 GLY A CA  1 
ATOM   1033 C C   . GLY A 1 127 ? 54.811 70.644 115.547 1.00 33.36 ? 127 GLY A C   1 
ATOM   1034 O O   . GLY A 1 127 ? 55.078 71.642 114.873 1.00 34.39 ? 127 GLY A O   1 
ATOM   1035 N N   . ALA A 1 128 ? 53.632 70.040 115.480 1.00 31.27 ? 128 ALA A N   1 
ATOM   1036 C CA  . ALA A 1 128 ? 52.595 70.510 114.564 1.00 30.90 ? 128 ALA A CA  1 
ATOM   1037 C C   . ALA A 1 128 ? 52.141 71.948 114.807 1.00 31.61 ? 128 ALA A C   1 
ATOM   1038 O O   . ALA A 1 128 ? 51.780 72.646 113.864 1.00 33.84 ? 128 ALA A O   1 
ATOM   1039 C CB  . ALA A 1 128 ? 51.381 69.572 114.618 1.00 29.60 ? 128 ALA A CB  1 
ATOM   1040 N N   . PHE A 1 129 ? 52.143 72.394 116.062 1.00 34.28 ? 129 PHE A N   1 
ATOM   1041 C CA  . PHE A 1 129 ? 51.707 73.763 116.358 1.00 35.52 ? 129 PHE A CA  1 
ATOM   1042 C C   . PHE A 1 129 ? 52.658 74.786 115.731 1.00 38.24 ? 129 PHE A C   1 
ATOM   1043 O O   . PHE A 1 129 ? 52.254 75.902 115.402 1.00 39.13 ? 129 PHE A O   1 
ATOM   1044 C CB  . PHE A 1 129 ? 51.629 74.001 117.872 1.00 34.03 ? 129 PHE A CB  1 
ATOM   1045 C CG  . PHE A 1 129 ? 50.463 73.309 118.548 1.00 34.25 ? 129 PHE A CG  1 
ATOM   1046 C CD1 . PHE A 1 129 ? 50.669 72.220 119.386 1.00 35.15 ? 129 PHE A CD1 1 
ATOM   1047 C CD2 . PHE A 1 129 ? 49.158 73.763 118.354 1.00 33.39 ? 129 PHE A CD2 1 
ATOM   1048 C CE1 . PHE A 1 129 ? 49.590 71.592 120.027 1.00 35.52 ? 129 PHE A CE1 1 
ATOM   1049 C CE2 . PHE A 1 129 ? 48.079 73.145 118.988 1.00 31.14 ? 129 PHE A CE2 1 
ATOM   1050 C CZ  . PHE A 1 129 ? 48.293 72.061 119.824 1.00 31.29 ? 129 PHE A CZ  1 
ATOM   1051 N N   . ASP A 1 130 ? 53.919 74.402 115.564 1.00 37.84 ? 130 ASP A N   1 
ATOM   1052 C CA  . ASP A 1 130 ? 54.911 75.302 114.978 1.00 38.41 ? 130 ASP A CA  1 
ATOM   1053 C C   . ASP A 1 130 ? 54.986 75.235 113.466 1.00 38.98 ? 130 ASP A C   1 
ATOM   1054 O O   . ASP A 1 130 ? 55.934 75.742 112.869 1.00 41.53 ? 130 ASP A O   1 
ATOM   1055 C CB  . ASP A 1 130 ? 56.299 75.023 115.548 1.00 40.25 ? 130 ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 130 ? 56.396 75.344 117.014 1.00 40.27 ? 130 ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 130 ? 55.951 76.440 117.405 1.00 42.99 ? 130 ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 130 ? 56.922 74.506 117.772 1.00 44.25 ? 130 ASP A OD2 1 
ATOM   1059 N N   . ASP A 1 131 ? 54.006 74.599 112.838 1.00 37.18 ? 131 ASP A N   1 
ATOM   1060 C CA  . ASP A 1 131 ? 53.994 74.522 111.386 1.00 36.25 ? 131 ASP A CA  1 
ATOM   1061 C C   . ASP A 1 131 ? 53.468 75.866 110.874 1.00 36.33 ? 131 ASP A C   1 
ATOM   1062 O O   . ASP A 1 131 ? 52.452 76.354 111.349 1.00 36.93 ? 131 ASP A O   1 
ATOM   1063 C CB  . ASP A 1 131 ? 53.076 73.391 110.926 1.00 36.27 ? 131 ASP A CB  1 
ATOM   1064 C CG  . ASP A 1 131 ? 53.081 73.207 109.418 1.00 36.25 ? 131 ASP A CG  1 
ATOM   1065 O OD1 . ASP A 1 131 ? 52.782 74.176 108.695 1.00 38.12 ? 131 ASP A OD1 1 
ATOM   1066 O OD2 . ASP A 1 131 ? 53.375 72.087 108.953 1.00 36.52 ? 131 ASP A OD2 1 
ATOM   1067 N N   . PRO A 1 132 ? 54.156 76.481 109.897 1.00 37.75 ? 132 PRO A N   1 
ATOM   1068 C CA  . PRO A 1 132 ? 53.712 77.774 109.359 1.00 38.25 ? 132 PRO A CA  1 
ATOM   1069 C C   . PRO A 1 132 ? 52.265 77.790 108.853 1.00 37.45 ? 132 PRO A C   1 
ATOM   1070 O O   . PRO A 1 132 ? 51.624 78.840 108.813 1.00 37.24 ? 132 PRO A O   1 
ATOM   1071 C CB  . PRO A 1 132 ? 54.724 78.050 108.242 1.00 38.89 ? 132 PRO A CB  1 
ATOM   1072 C CG  . PRO A 1 132 ? 55.146 76.671 107.813 1.00 38.82 ? 132 PRO A CG  1 
ATOM   1073 C CD  . PRO A 1 132 ? 55.303 75.962 109.133 1.00 37.39 ? 132 PRO A CD  1 
ATOM   1074 N N   . ARG A 1 133 ? 51.754 76.623 108.476 1.00 37.21 ? 133 ARG A N   1 
ATOM   1075 C CA  . ARG A 1 133 ? 50.387 76.508 107.972 1.00 36.90 ? 133 ARG A CA  1 
ATOM   1076 C C   . ARG A 1 133 ? 49.347 76.393 109.087 1.00 38.78 ? 133 ARG A C   1 
ATOM   1077 O O   . ARG A 1 133 ? 48.144 76.451 108.831 1.00 39.98 ? 133 ARG A O   1 
ATOM   1078 C CB  . ARG A 1 133 ? 50.266 75.283 107.068 1.00 36.83 ? 133 ARG A CB  1 
ATOM   1079 C CG  . ARG A 1 133 ? 51.064 75.355 105.782 1.00 35.19 ? 133 ARG A CG  1 
ATOM   1080 C CD  . ARG A 1 133 ? 51.035 74.008 105.098 1.00 37.43 ? 133 ARG A CD  1 
ATOM   1081 N NE  . ARG A 1 133 ? 51.711 72.998 105.908 1.00 31.69 ? 133 ARG A NE  1 
ATOM   1082 C CZ  . ARG A 1 133 ? 51.561 71.689 105.748 1.00 33.26 ? 133 ARG A CZ  1 
ATOM   1083 N NH1 . ARG A 1 133 ? 50.748 71.224 104.809 1.00 34.47 ? 133 ARG A NH1 1 
ATOM   1084 N NH2 . ARG A 1 133 ? 52.233 70.846 106.521 1.00 34.13 ? 133 ARG A NH2 1 
ATOM   1085 N N   . ALA A 1 134 ? 49.811 76.244 110.320 1.00 36.47 ? 134 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 134 ? 48.914 76.079 111.455 1.00 37.29 ? 134 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 134 ? 48.576 77.381 112.177 1.00 36.49 ? 134 ALA A C   1 
ATOM   1088 O O   . ALA A 1 134 ? 49.438 78.233 112.387 1.00 36.42 ? 134 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 134 ? 49.520 75.077 112.434 1.00 34.31 ? 134 ALA A CB  1 
ATOM   1090 N N   . VAL A 1 135 ? 47.311 77.525 112.554 1.00 35.61 ? 135 VAL A N   1 
ATOM   1091 C CA  . VAL A 1 135 ? 46.846 78.709 113.267 1.00 35.64 ? 135 VAL A CA  1 
ATOM   1092 C C   . VAL A 1 135 ? 45.971 78.294 114.443 1.00 37.59 ? 135 VAL A C   1 
ATOM   1093 O O   . VAL A 1 135 ? 44.864 77.777 114.262 1.00 38.90 ? 135 VAL A O   1 
ATOM   1094 C CB  . VAL A 1 135 ? 46.022 79.626 112.347 1.00 38.01 ? 135 VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 135 ? 45.593 80.881 113.108 1.00 35.90 ? 135 VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 135 ? 46.831 79.986 111.116 1.00 38.42 ? 135 VAL A CG2 1 
ATOM   1097 N N   . LEU A 1 136 ? 46.473 78.520 115.649 1.00 36.46 ? 136 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 136 ? 45.744 78.177 116.857 1.00 35.47 ? 136 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 136 ? 44.899 79.358 117.314 1.00 39.41 ? 136 LEU A C   1 
ATOM   1100 O O   . LEU A 1 136 ? 45.389 80.492 117.396 1.00 38.08 ? 136 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 136 ? 46.713 77.783 117.971 1.00 32.38 ? 136 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 136 ? 46.057 77.563 119.335 1.00 30.77 ? 136 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 136 ? 45.121 76.345 119.262 1.00 32.05 ? 136 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 136 ? 47.119 77.356 120.398 1.00 32.91 ? 136 LEU A CD2 1 
ATOM   1105 N N   . VAL A 1 137 ? 43.632 79.077 117.604 1.00 38.77 ? 137 VAL A N   1 
ATOM   1106 C CA  . VAL A 1 137 ? 42.676 80.081 118.064 1.00 38.50 ? 137 VAL A CA  1 
ATOM   1107 C C   . VAL A 1 137 ? 41.977 79.569 119.319 1.00 40.40 ? 137 VAL A C   1 
ATOM   1108 O O   . VAL A 1 137 ? 41.296 78.539 119.285 1.00 38.07 ? 137 VAL A O   1 
ATOM   1109 C CB  . VAL A 1 137 ? 41.607 80.368 116.985 1.00 40.10 ? 137 VAL A CB  1 
ATOM   1110 C CG1 . VAL A 1 137 ? 40.559 81.344 117.527 1.00 39.49 ? 137 VAL A CG1 1 
ATOM   1111 C CG2 . VAL A 1 137 ? 42.268 80.932 115.744 1.00 36.34 ? 137 VAL A CG2 1 
ATOM   1112 N N   . ILE A 1 138 ? 42.156 80.272 120.432 1.00 39.51 ? 138 ILE A N   1 
ATOM   1113 C CA  . ILE A 1 138 ? 41.524 79.850 121.668 1.00 41.76 ? 138 ILE A CA  1 
ATOM   1114 C C   . ILE A 1 138 ? 40.209 80.590 121.797 1.00 44.17 ? 138 ILE A C   1 
ATOM   1115 O O   . ILE A 1 138 ? 40.185 81.785 122.091 1.00 45.47 ? 138 ILE A O   1 
ATOM   1116 C CB  . ILE A 1 138 ? 42.415 80.143 122.888 1.00 40.55 ? 138 ILE A CB  1 
ATOM   1117 C CG1 . ILE A 1 138 ? 43.741 79.384 122.750 1.00 41.59 ? 138 ILE A CG1 1 
ATOM   1118 C CG2 . ILE A 1 138 ? 41.699 79.724 124.173 1.00 40.71 ? 138 ILE A CG2 1 
ATOM   1119 C CD1 . ILE A 1 138 ? 43.576 77.874 122.535 1.00 38.74 ? 138 ILE A CD1 1 
ATOM   1120 N N   . ASP A 1 139 ? 39.112 79.876 121.558 1.00 44.07 ? 139 ASP A N   1 
ATOM   1121 C CA  . ASP A 1 139 ? 37.790 80.483 121.626 1.00 43.86 ? 139 ASP A CA  1 
ATOM   1122 C C   . ASP A 1 139 ? 36.683 79.433 121.520 1.00 43.88 ? 139 ASP A C   1 
ATOM   1123 O O   . ASP A 1 139 ? 36.950 78.249 121.294 1.00 39.90 ? 139 ASP A O   1 
ATOM   1124 C CB  . ASP A 1 139 ? 37.648 81.492 120.483 1.00 45.10 ? 139 ASP A CB  1 
ATOM   1125 C CG  . ASP A 1 139 ? 36.448 82.411 120.650 1.00 47.52 ? 139 ASP A CG  1 
ATOM   1126 O OD1 . ASP A 1 139 ? 36.173 83.188 119.713 1.00 47.49 ? 139 ASP A OD1 1 
ATOM   1127 O OD2 . ASP A 1 139 ? 35.787 82.364 121.712 1.00 48.24 ? 139 ASP A OD2 1 
ATOM   1128 N N   . ASP A 1 140 ? 35.444 79.882 121.701 1.00 45.23 ? 140 ASP A N   1 
ATOM   1129 C CA  . ASP A 1 140 ? 34.270 79.024 121.589 1.00 44.81 ? 140 ASP A CA  1 
ATOM   1130 C C   . ASP A 1 140 ? 34.041 78.810 120.103 1.00 44.48 ? 140 ASP A C   1 
ATOM   1131 O O   . ASP A 1 140 ? 33.940 79.772 119.338 1.00 43.97 ? 140 ASP A O   1 
ATOM   1132 C CB  . ASP A 1 140 ? 33.042 79.707 122.205 1.00 47.65 ? 140 ASP A CB  1 
ATOM   1133 C CG  . ASP A 1 140 ? 31.733 79.187 121.628 1.00 49.53 ? 140 ASP A CG  1 
ATOM   1134 O OD1 . ASP A 1 140 ? 31.447 77.979 121.763 1.00 51.66 ? 140 ASP A OD1 1 
ATOM   1135 O OD2 . ASP A 1 140 ? 30.990 79.990 121.030 1.00 52.41 ? 140 ASP A OD2 1 
ATOM   1136 N N   . ALA A 1 141 ? 33.960 77.550 119.698 1.00 43.74 ? 141 ALA A N   1 
ATOM   1137 C CA  . ALA A 1 141 ? 33.757 77.209 118.298 1.00 42.76 ? 141 ALA A CA  1 
ATOM   1138 C C   . ALA A 1 141 ? 32.624 77.993 117.642 1.00 41.21 ? 141 ALA A C   1 
ATOM   1139 O O   . ALA A 1 141 ? 32.823 78.601 116.592 1.00 40.94 ? 141 ALA A O   1 
ATOM   1140 C CB  . ALA A 1 141 ? 33.502 75.714 118.162 1.00 43.88 ? 141 ALA A CB  1 
ATOM   1141 N N   . ARG A 1 142 ? 31.442 77.988 118.253 1.00 40.02 ? 142 ARG A N   1 
ATOM   1142 C CA  . ARG A 1 142 ? 30.309 78.703 117.673 1.00 41.61 ? 142 ARG A CA  1 
ATOM   1143 C C   . ARG A 1 142 ? 30.575 80.197 117.586 1.00 43.09 ? 142 ARG A C   1 
ATOM   1144 O O   . ARG A 1 142 ? 30.318 80.824 116.558 1.00 41.91 ? 142 ARG A O   1 
ATOM   1145 C CB  . ARG A 1 142 ? 29.030 78.455 118.478 1.00 40.62 ? 142 ARG A CB  1 
ATOM   1146 C CG  . ARG A 1 142 ? 28.570 77.020 118.441 1.00 41.08 ? 142 ARG A CG  1 
ATOM   1147 C CD  . ARG A 1 142 ? 27.097 76.867 118.795 1.00 41.26 ? 142 ARG A CD  1 
ATOM   1148 N NE  . ARG A 1 142 ? 26.207 77.549 117.855 1.00 40.29 ? 142 ARG A NE  1 
ATOM   1149 C CZ  . ARG A 1 142 ? 24.906 77.289 117.737 1.00 40.86 ? 142 ARG A CZ  1 
ATOM   1150 N NH1 . ARG A 1 142 ? 24.163 77.961 116.866 1.00 41.78 ? 142 ARG A NH1 1 
ATOM   1151 N NH2 . ARG A 1 142 ? 24.349 76.344 118.483 1.00 37.67 ? 142 ARG A NH2 1 
ATOM   1152 N N   . ALA A 1 143 ? 31.094 80.764 118.669 1.00 44.79 ? 143 ALA A N   1 
ATOM   1153 C CA  . ALA A 1 143 ? 31.403 82.187 118.696 1.00 46.87 ? 143 ALA A CA  1 
ATOM   1154 C C   . ALA A 1 143 ? 32.341 82.508 117.535 1.00 47.12 ? 143 ALA A C   1 
ATOM   1155 O O   . ALA A 1 143 ? 32.090 83.429 116.756 1.00 46.78 ? 143 ALA A O   1 
ATOM   1156 C CB  . ALA A 1 143 ? 32.054 82.553 120.019 1.00 47.45 ? 143 ALA A CB  1 
ATOM   1157 N N   . TYR A 1 144 ? 33.414 81.731 117.412 1.00 47.77 ? 144 TYR A N   1 
ATOM   1158 C CA  . TYR A 1 144 ? 34.378 81.940 116.337 1.00 47.59 ? 144 TYR A CA  1 
ATOM   1159 C C   . TYR A 1 144 ? 33.718 81.829 114.974 1.00 46.87 ? 144 TYR A C   1 
ATOM   1160 O O   . TYR A 1 144 ? 33.903 82.691 114.113 1.00 46.67 ? 144 TYR A O   1 
ATOM   1161 C CB  . TYR A 1 144 ? 35.530 80.928 116.432 1.00 48.92 ? 144 TYR A CB  1 
ATOM   1162 C CG  . TYR A 1 144 ? 36.426 80.909 115.205 1.00 49.45 ? 144 TYR A CG  1 
ATOM   1163 C CD1 . TYR A 1 144 ? 36.087 80.158 114.080 1.00 49.87 ? 144 TYR A CD1 1 
ATOM   1164 C CD2 . TYR A 1 144 ? 37.584 81.685 115.150 1.00 51.96 ? 144 TYR A CD2 1 
ATOM   1165 C CE1 . TYR A 1 144 ? 36.876 80.182 112.931 1.00 54.23 ? 144 TYR A CE1 1 
ATOM   1166 C CE2 . TYR A 1 144 ? 38.379 81.719 114.005 1.00 52.97 ? 144 TYR A CE2 1 
ATOM   1167 C CZ  . TYR A 1 144 ? 38.020 80.967 112.900 1.00 54.61 ? 144 TYR A CZ  1 
ATOM   1168 O OH  . TYR A 1 144 ? 38.793 81.008 111.759 1.00 56.39 ? 144 TYR A OH  1 
ATOM   1169 N N   . LEU A 1 145 ? 32.950 80.761 114.779 1.00 46.81 ? 145 LEU A N   1 
ATOM   1170 C CA  . LEU A 1 145 ? 32.273 80.535 113.510 1.00 48.07 ? 145 LEU A CA  1 
ATOM   1171 C C   . LEU A 1 145 ? 31.250 81.617 113.192 1.00 49.25 ? 145 LEU A C   1 
ATOM   1172 O O   . LEU A 1 145 ? 31.103 82.012 112.038 1.00 48.31 ? 145 LEU A O   1 
ATOM   1173 C CB  . LEU A 1 145 ? 31.597 79.158 113.509 1.00 48.31 ? 145 LEU A CB  1 
ATOM   1174 C CG  . LEU A 1 145 ? 32.543 77.956 113.387 1.00 47.89 ? 145 LEU A CG  1 
ATOM   1175 C CD1 . LEU A 1 145 ? 31.751 76.664 113.450 1.00 47.82 ? 145 LEU A CD1 1 
ATOM   1176 C CD2 . LEU A 1 145 ? 33.307 78.043 112.074 1.00 44.54 ? 145 LEU A CD2 1 
ATOM   1177 N N   . GLU A 1 146 ? 30.545 82.092 114.214 1.00 52.36 ? 146 GLU A N   1 
ATOM   1178 C CA  . GLU A 1 146 ? 29.543 83.140 114.029 1.00 57.22 ? 146 GLU A CA  1 
ATOM   1179 C C   . GLU A 1 146 ? 30.178 84.457 113.586 1.00 58.02 ? 146 GLU A C   1 
ATOM   1180 O O   . GLU A 1 146 ? 29.608 85.190 112.776 1.00 57.38 ? 146 GLU A O   1 
ATOM   1181 C CB  . GLU A 1 146 ? 28.761 83.365 115.327 1.00 60.14 ? 146 GLU A CB  1 
ATOM   1182 C CG  . GLU A 1 146 ? 27.728 82.291 115.646 1.00 66.09 ? 146 GLU A CG  1 
ATOM   1183 C CD  . GLU A 1 146 ? 26.573 82.268 114.654 1.00 68.95 ? 146 GLU A CD  1 
ATOM   1184 O OE1 . GLU A 1 146 ? 25.878 83.294 114.514 1.00 71.51 ? 146 GLU A OE1 1 
ATOM   1185 O OE2 . GLU A 1 146 ? 26.353 81.221 114.013 1.00 73.19 ? 146 GLU A OE2 1 
ATOM   1186 N N   . ARG A 1 147 ? 31.360 84.751 114.118 1.00 59.72 ? 147 ARG A N   1 
ATOM   1187 C CA  . ARG A 1 147 ? 32.064 85.981 113.778 1.00 61.42 ? 147 ARG A CA  1 
ATOM   1188 C C   . ARG A 1 147 ? 32.796 85.880 112.447 1.00 62.06 ? 147 ARG A C   1 
ATOM   1189 O O   . ARG A 1 147 ? 32.584 86.697 111.553 1.00 63.76 ? 147 ARG A O   1 
ATOM   1190 C CB  . ARG A 1 147 ? 33.063 86.342 114.877 1.00 62.92 ? 147 ARG A CB  1 
ATOM   1191 C CG  . ARG A 1 147 ? 33.870 87.587 114.572 1.00 66.20 ? 147 ARG A CG  1 
ATOM   1192 C CD  . ARG A 1 147 ? 34.841 87.942 115.693 1.00 69.56 ? 147 ARG A CD  1 
ATOM   1193 N NE  . ARG A 1 147 ? 35.755 86.849 116.019 1.00 71.89 ? 147 ARG A NE  1 
ATOM   1194 C CZ  . ARG A 1 147 ? 35.478 85.873 116.879 1.00 72.71 ? 147 ARG A CZ  1 
ATOM   1195 N NH1 . ARG A 1 147 ? 36.369 84.919 117.110 1.00 73.07 ? 147 ARG A NH1 1 
ATOM   1196 N NH2 . ARG A 1 147 ? 34.314 85.859 117.519 1.00 72.77 ? 147 ARG A NH2 1 
ATOM   1197 N N   . THR A 1 148 ? 33.659 84.878 112.320 1.00 62.36 ? 148 THR A N   1 
ATOM   1198 C CA  . THR A 1 148 ? 34.427 84.675 111.096 1.00 62.12 ? 148 THR A CA  1 
ATOM   1199 C C   . THR A 1 148 ? 33.528 84.416 109.892 1.00 61.26 ? 148 THR A C   1 
ATOM   1200 O O   . THR A 1 148 ? 32.339 84.148 110.036 1.00 60.23 ? 148 THR A O   1 
ATOM   1201 C CB  . THR A 1 148 ? 35.388 83.476 111.229 1.00 62.18 ? 148 THR A CB  1 
ATOM   1202 O OG1 . THR A 1 148 ? 36.225 83.401 110.068 1.00 66.18 ? 148 THR A OG1 1 
ATOM   1203 C CG2 . THR A 1 148 ? 34.602 82.178 111.350 1.00 62.75 ? 148 THR A CG2 1 
ATOM   1204 N N   . GLU A 1 149 ? 34.111 84.496 108.702 1.00 61.42 ? 149 GLU A N   1 
ATOM   1205 C CA  . GLU A 1 149 ? 33.371 84.248 107.477 1.00 62.12 ? 149 GLU A CA  1 
ATOM   1206 C C   . GLU A 1 149 ? 34.235 83.501 106.469 1.00 60.31 ? 149 GLU A C   1 
ATOM   1207 O O   . GLU A 1 149 ? 33.834 83.289 105.328 1.00 59.09 ? 149 GLU A O   1 
ATOM   1208 C CB  . GLU A 1 149 ? 32.862 85.562 106.878 1.00 65.50 ? 149 GLU A CB  1 
ATOM   1209 C CG  . GLU A 1 149 ? 33.893 86.675 106.808 1.00 69.85 ? 149 GLU A CG  1 
ATOM   1210 C CD  . GLU A 1 149 ? 33.350 87.917 106.119 1.00 72.98 ? 149 GLU A CD  1 
ATOM   1211 O OE1 . GLU A 1 149 ? 33.219 87.903 104.875 1.00 72.98 ? 149 GLU A OE1 1 
ATOM   1212 O OE2 . GLU A 1 149 ? 33.041 88.904 106.825 1.00 74.39 ? 149 GLU A OE2 1 
ATOM   1213 N N   . GLU A 1 150 ? 35.429 83.106 106.895 1.00 59.49 ? 150 GLU A N   1 
ATOM   1214 C CA  . GLU A 1 150 ? 36.320 82.351 106.025 1.00 59.21 ? 150 GLU A CA  1 
ATOM   1215 C C   . GLU A 1 150 ? 35.700 80.965 105.872 1.00 55.94 ? 150 GLU A C   1 
ATOM   1216 O O   . GLU A 1 150 ? 35.058 80.471 106.796 1.00 56.19 ? 150 GLU A O   1 
ATOM   1217 C CB  . GLU A 1 150 ? 37.711 82.230 106.657 1.00 62.23 ? 150 GLU A CB  1 
ATOM   1218 C CG  . GLU A 1 150 ? 38.683 81.379 105.845 1.00 66.94 ? 150 GLU A CG  1 
ATOM   1219 C CD  . GLU A 1 150 ? 40.047 81.232 106.503 1.00 69.05 ? 150 GLU A CD  1 
ATOM   1220 O OE1 . GLU A 1 150 ? 40.888 80.484 105.956 1.00 70.22 ? 150 GLU A OE1 1 
ATOM   1221 O OE2 . GLU A 1 150 ? 40.279 81.863 107.559 1.00 69.79 ? 150 GLU A OE2 1 
ATOM   1222 N N   . ARG A 1 151 ? 35.879 80.343 104.712 1.00 54.53 ? 151 ARG A N   1 
ATOM   1223 C CA  . ARG A 1 151 ? 35.325 79.012 104.475 1.00 51.60 ? 151 ARG A CA  1 
ATOM   1224 C C   . ARG A 1 151 ? 36.421 77.947 104.354 1.00 48.64 ? 151 ARG A C   1 
ATOM   1225 O O   . ARG A 1 151 ? 37.597 78.269 104.148 1.00 45.03 ? 151 ARG A O   1 
ATOM   1226 C CB  . ARG A 1 151 ? 34.437 79.034 103.230 1.00 52.71 ? 151 ARG A CB  1 
ATOM   1227 C CG  . ARG A 1 151 ? 33.228 79.957 103.379 1.00 57.98 ? 151 ARG A CG  1 
ATOM   1228 C CD  . ARG A 1 151 ? 32.228 79.768 102.254 1.00 61.76 ? 151 ARG A CD  1 
ATOM   1229 N NE  . ARG A 1 151 ? 32.830 80.021 100.949 1.00 68.08 ? 151 ARG A NE  1 
ATOM   1230 C CZ  . ARG A 1 151 ? 32.224 79.786 99.789  1.00 70.60 ? 151 ARG A CZ  1 
ATOM   1231 N NH1 . ARG A 1 151 ? 32.849 80.046 98.647  1.00 72.13 ? 151 ARG A NH1 1 
ATOM   1232 N NH2 . ARG A 1 151 ? 30.995 79.288 99.769  1.00 72.38 ? 151 ARG A NH2 1 
ATOM   1233 N N   . TYR A 1 152 ? 36.036 76.679 104.480 1.00 43.78 ? 152 TYR A N   1 
ATOM   1234 C CA  . TYR A 1 152 ? 37.009 75.592 104.433 1.00 39.10 ? 152 TYR A CA  1 
ATOM   1235 C C   . TYR A 1 152 ? 36.627 74.429 103.527 1.00 34.33 ? 152 TYR A C   1 
ATOM   1236 O O   . TYR A 1 152 ? 35.457 74.225 103.230 1.00 33.39 ? 152 TYR A O   1 
ATOM   1237 C CB  . TYR A 1 152 ? 37.238 75.064 105.848 1.00 39.68 ? 152 TYR A CB  1 
ATOM   1238 C CG  . TYR A 1 152 ? 37.525 76.150 106.861 1.00 42.72 ? 152 TYR A CG  1 
ATOM   1239 C CD1 . TYR A 1 152 ? 36.489 76.809 107.526 1.00 42.77 ? 152 TYR A CD1 1 
ATOM   1240 C CD2 . TYR A 1 152 ? 38.835 76.542 107.133 1.00 40.93 ? 152 TYR A CD2 1 
ATOM   1241 C CE1 . TYR A 1 152 ? 36.756 77.833 108.438 1.00 44.71 ? 152 TYR A CE1 1 
ATOM   1242 C CE2 . TYR A 1 152 ? 39.110 77.561 108.039 1.00 44.34 ? 152 TYR A CE2 1 
ATOM   1243 C CZ  . TYR A 1 152 ? 38.070 78.202 108.690 1.00 46.19 ? 152 TYR A CZ  1 
ATOM   1244 O OH  . TYR A 1 152 ? 38.355 79.198 109.600 1.00 49.21 ? 152 TYR A OH  1 
ATOM   1245 N N   . ASP A 1 153 ? 37.630 73.668 103.099 1.00 31.32 ? 153 ASP A N   1 
ATOM   1246 C CA  . ASP A 1 153 ? 37.415 72.493 102.247 1.00 29.77 ? 153 ASP A CA  1 
ATOM   1247 C C   . ASP A 1 153 ? 36.998 71.306 103.116 1.00 28.76 ? 153 ASP A C   1 
ATOM   1248 O O   . ASP A 1 153 ? 36.166 70.485 102.722 1.00 27.62 ? 153 ASP A O   1 
ATOM   1249 C CB  . ASP A 1 153 ? 38.701 72.126 101.516 1.00 29.68 ? 153 ASP A CB  1 
ATOM   1250 C CG  . ASP A 1 153 ? 39.162 73.212 100.568 1.00 33.23 ? 153 ASP A CG  1 
ATOM   1251 O OD1 . ASP A 1 153 ? 40.297 73.707 100.733 1.00 35.47 ? 153 ASP A OD1 1 
ATOM   1252 O OD2 . ASP A 1 153 ? 38.383 73.558 99.661  1.00 33.55 ? 153 ASP A OD2 1 
ATOM   1253 N N   . VAL A 1 154 ? 37.605 71.235 104.298 1.00 28.69 ? 154 VAL A N   1 
ATOM   1254 C CA  . VAL A 1 154 ? 37.338 70.175 105.256 1.00 28.23 ? 154 VAL A CA  1 
ATOM   1255 C C   . VAL A 1 154 ? 37.264 70.741 106.662 1.00 28.87 ? 154 VAL A C   1 
ATOM   1256 O O   . VAL A 1 154 ? 38.045 71.619 107.033 1.00 29.85 ? 154 VAL A O   1 
ATOM   1257 C CB  . VAL A 1 154 ? 38.454 69.100 105.233 1.00 27.05 ? 154 VAL A CB  1 
ATOM   1258 C CG1 . VAL A 1 154 ? 38.262 68.112 106.390 1.00 29.07 ? 154 VAL A CG1 1 
ATOM   1259 C CG2 . VAL A 1 154 ? 38.431 68.364 103.914 1.00 24.67 ? 154 VAL A CG2 1 
ATOM   1260 N N   . VAL A 1 155 ? 36.298 70.247 107.427 1.00 25.67 ? 155 VAL A N   1 
ATOM   1261 C CA  . VAL A 1 155 ? 36.134 70.636 108.813 1.00 25.96 ? 155 VAL A CA  1 
ATOM   1262 C C   . VAL A 1 155 ? 36.153 69.321 109.575 1.00 26.07 ? 155 VAL A C   1 
ATOM   1263 O O   . VAL A 1 155 ? 35.440 68.375 109.213 1.00 27.33 ? 155 VAL A O   1 
ATOM   1264 C CB  . VAL A 1 155 ? 34.783 71.339 109.093 1.00 22.90 ? 155 VAL A CB  1 
ATOM   1265 C CG1 . VAL A 1 155 ? 34.604 71.511 110.596 1.00 23.84 ? 155 VAL A CG1 1 
ATOM   1266 C CG2 . VAL A 1 155 ? 34.743 72.708 108.413 1.00 24.29 ? 155 VAL A CG2 1 
ATOM   1267 N N   . ILE A 1 156 ? 36.992 69.260 110.599 1.00 24.48 ? 156 ILE A N   1 
ATOM   1268 C CA  . ILE A 1 156 ? 37.108 68.080 111.441 1.00 25.32 ? 156 ILE A CA  1 
ATOM   1269 C C   . ILE A 1 156 ? 36.624 68.467 112.825 1.00 26.22 ? 156 ILE A C   1 
ATOM   1270 O O   . ILE A 1 156 ? 37.178 69.383 113.438 1.00 25.54 ? 156 ILE A O   1 
ATOM   1271 C CB  . ILE A 1 156 ? 38.574 67.602 111.582 1.00 24.80 ? 156 ILE A CB  1 
ATOM   1272 C CG1 . ILE A 1 156 ? 39.121 67.146 110.226 1.00 23.86 ? 156 ILE A CG1 1 
ATOM   1273 C CG2 . ILE A 1 156 ? 38.658 66.482 112.629 1.00 22.67 ? 156 ILE A CG2 1 
ATOM   1274 C CD1 . ILE A 1 156 ? 38.322 66.062 109.563 1.00 23.61 ? 156 ILE A CD1 1 
ATOM   1275 N N   . ILE A 1 157 ? 35.591 67.785 113.314 1.00 25.15 ? 157 ILE A N   1 
ATOM   1276 C CA  . ILE A 1 157 ? 35.078 68.060 114.655 1.00 25.31 ? 157 ILE A CA  1 
ATOM   1277 C C   . ILE A 1 157 ? 35.578 66.954 115.583 1.00 25.76 ? 157 ILE A C   1 
ATOM   1278 O O   . ILE A 1 157 ? 35.240 65.779 115.416 1.00 24.09 ? 157 ILE A O   1 
ATOM   1279 C CB  . ILE A 1 157 ? 33.538 68.114 114.671 1.00 25.75 ? 157 ILE A CB  1 
ATOM   1280 C CG1 . ILE A 1 157 ? 33.063 69.193 113.688 1.00 28.78 ? 157 ILE A CG1 1 
ATOM   1281 C CG2 . ILE A 1 157 ? 33.039 68.395 116.104 1.00 21.21 ? 157 ILE A CG2 1 
ATOM   1282 C CD1 . ILE A 1 157 ? 31.557 69.268 113.530 1.00 35.79 ? 157 ILE A CD1 1 
ATOM   1283 N N   . ASP A 1 158 ? 36.399 67.348 116.547 1.00 23.87 ? 158 ASP A N   1 
ATOM   1284 C CA  . ASP A 1 158 ? 37.004 66.430 117.500 1.00 27.25 ? 158 ASP A CA  1 
ATOM   1285 C C   . ASP A 1 158 ? 36.618 66.897 118.896 1.00 29.78 ? 158 ASP A C   1 
ATOM   1286 O O   . ASP A 1 158 ? 37.434 67.477 119.611 1.00 30.20 ? 158 ASP A O   1 
ATOM   1287 C CB  . ASP A 1 158 ? 38.526 66.473 117.308 1.00 28.76 ? 158 ASP A CB  1 
ATOM   1288 C CG  . ASP A 1 158 ? 39.266 65.433 118.125 1.00 27.77 ? 158 ASP A CG  1 
ATOM   1289 O OD1 . ASP A 1 158 ? 40.519 65.497 118.143 1.00 28.64 ? 158 ASP A OD1 1 
ATOM   1290 O OD2 . ASP A 1 158 ? 38.615 64.558 118.734 1.00 21.15 ? 158 ASP A OD2 1 
ATOM   1291 N N   . LEU A 1 159 ? 35.363 66.654 119.267 1.00 33.12 ? 159 LEU A N   1 
ATOM   1292 C CA  . LEU A 1 159 ? 34.833 67.058 120.568 1.00 34.09 ? 159 LEU A CA  1 
ATOM   1293 C C   . LEU A 1 159 ? 34.427 65.875 121.427 1.00 38.76 ? 159 LEU A C   1 
ATOM   1294 O O   . LEU A 1 159 ? 34.478 64.728 120.991 1.00 40.63 ? 159 LEU A O   1 
ATOM   1295 C CB  . LEU A 1 159 ? 33.616 67.969 120.368 1.00 33.22 ? 159 LEU A CB  1 
ATOM   1296 C CG  . LEU A 1 159 ? 33.901 69.275 119.619 1.00 33.75 ? 159 LEU A CG  1 
ATOM   1297 C CD1 . LEU A 1 159 ? 32.603 69.970 119.216 1.00 32.98 ? 159 LEU A CD1 1 
ATOM   1298 C CD2 . LEU A 1 159 ? 34.749 70.169 120.512 1.00 30.14 ? 159 LEU A CD2 1 
ATOM   1299 N N   . THR A 1 160 ? 34.023 66.164 122.659 1.00 41.39 ? 160 THR A N   1 
ATOM   1300 C CA  . THR A 1 160 ? 33.581 65.130 123.581 1.00 44.40 ? 160 THR A CA  1 
ATOM   1301 C C   . THR A 1 160 ? 32.057 65.086 123.625 1.00 44.52 ? 160 THR A C   1 
ATOM   1302 O O   . THR A 1 160 ? 31.393 66.108 123.450 1.00 42.85 ? 160 THR A O   1 
ATOM   1303 C CB  . THR A 1 160 ? 34.106 65.383 125.008 1.00 45.70 ? 160 THR A CB  1 
ATOM   1304 O OG1 . THR A 1 160 ? 33.475 64.470 125.914 1.00 51.09 ? 160 THR A OG1 1 
ATOM   1305 C CG2 . THR A 1 160 ? 33.814 66.810 125.444 1.00 46.60 ? 160 THR A CG2 1 
ATOM   1306 N N   . ASP A 1 161 ? 31.517 63.892 123.855 1.00 44.92 ? 161 ASP A N   1 
ATOM   1307 C CA  . ASP A 1 161 ? 30.075 63.669 123.926 1.00 45.10 ? 161 ASP A CA  1 
ATOM   1308 C C   . ASP A 1 161 ? 29.385 64.625 124.894 1.00 44.12 ? 161 ASP A C   1 
ATOM   1309 O O   . ASP A 1 161 ? 29.949 64.998 125.914 1.00 42.93 ? 161 ASP A O   1 
ATOM   1310 C CB  . ASP A 1 161 ? 29.796 62.232 124.366 1.00 49.23 ? 161 ASP A CB  1 
ATOM   1311 C CG  . ASP A 1 161 ? 30.323 61.204 123.380 1.00 53.88 ? 161 ASP A CG  1 
ATOM   1312 O OD1 . ASP A 1 161 ? 31.423 61.409 122.821 1.00 59.39 ? 161 ASP A OD1 1 
ATOM   1313 O OD2 . ASP A 1 161 ? 29.641 60.179 123.178 1.00 56.51 ? 161 ASP A OD2 1 
ATOM   1314 N N   . PRO A 1 162 ? 28.150 65.041 124.574 1.00 43.91 ? 162 PRO A N   1 
ATOM   1315 C CA  . PRO A 1 162 ? 27.410 65.952 125.446 1.00 46.52 ? 162 PRO A CA  1 
ATOM   1316 C C   . PRO A 1 162 ? 26.715 65.171 126.559 1.00 49.13 ? 162 PRO A C   1 
ATOM   1317 O O   . PRO A 1 162 ? 25.491 65.010 126.563 1.00 49.03 ? 162 PRO A O   1 
ATOM   1318 C CB  . PRO A 1 162 ? 26.428 66.617 124.488 1.00 45.74 ? 162 PRO A CB  1 
ATOM   1319 C CG  . PRO A 1 162 ? 26.101 65.504 123.551 1.00 44.96 ? 162 PRO A CG  1 
ATOM   1320 C CD  . PRO A 1 162 ? 27.458 64.874 123.284 1.00 44.26 ? 162 PRO A CD  1 
ATOM   1321 N N   . VAL A 1 163 ? 27.514 64.666 127.492 1.00 50.27 ? 163 VAL A N   1 
ATOM   1322 C CA  . VAL A 1 163 ? 26.991 63.910 128.619 1.00 51.41 ? 163 VAL A CA  1 
ATOM   1323 C C   . VAL A 1 163 ? 26.856 64.865 129.791 1.00 52.10 ? 163 VAL A C   1 
ATOM   1324 O O   . VAL A 1 163 ? 27.834 65.482 130.214 1.00 52.11 ? 163 VAL A O   1 
ATOM   1325 C CB  . VAL A 1 163 ? 27.940 62.757 129.019 1.00 52.50 ? 163 VAL A CB  1 
ATOM   1326 C CG1 . VAL A 1 163 ? 27.416 62.062 130.265 1.00 50.93 ? 163 VAL A CG1 1 
ATOM   1327 C CG2 . VAL A 1 163 ? 28.071 61.767 127.870 1.00 51.60 ? 163 VAL A CG2 1 
ATOM   1328 N N   . GLY A 1 164 ? 25.640 64.985 130.310 1.00 52.67 ? 164 GLY A N   1 
ATOM   1329 C CA  . GLY A 1 164 ? 25.400 65.882 131.423 1.00 52.93 ? 164 GLY A CA  1 
ATOM   1330 C C   . GLY A 1 164 ? 24.546 67.042 130.962 1.00 53.80 ? 164 GLY A C   1 
ATOM   1331 O O   . GLY A 1 164 ? 24.869 67.710 129.979 1.00 52.25 ? 164 GLY A O   1 
ATOM   1332 N N   . GLU A 1 165 ? 23.452 67.283 131.676 1.00 55.49 ? 165 GLU A N   1 
ATOM   1333 C CA  . GLU A 1 165 ? 22.527 68.356 131.334 1.00 56.53 ? 165 GLU A CA  1 
ATOM   1334 C C   . GLU A 1 165 ? 23.145 69.756 131.333 1.00 56.22 ? 165 GLU A C   1 
ATOM   1335 O O   . GLU A 1 165 ? 22.830 70.577 130.469 1.00 54.27 ? 165 GLU A O   1 
ATOM   1336 C CB  . GLU A 1 165 ? 21.320 68.301 132.280 1.00 57.61 ? 165 GLU A CB  1 
ATOM   1337 C CG  . GLU A 1 165 ? 20.297 69.412 132.082 1.00 59.69 ? 165 GLU A CG  1 
ATOM   1338 C CD  . GLU A 1 165 ? 18.962 69.094 132.735 1.00 61.04 ? 165 GLU A CD  1 
ATOM   1339 O OE1 . GLU A 1 165 ? 18.959 68.563 133.867 1.00 61.18 ? 165 GLU A OE1 1 
ATOM   1340 O OE2 . GLU A 1 165 ? 17.914 69.382 132.120 1.00 60.63 ? 165 GLU A OE2 1 
ATOM   1341 N N   . ASP A 1 166 ? 24.031 70.033 132.283 1.00 58.42 ? 166 ASP A N   1 
ATOM   1342 C CA  . ASP A 1 166 ? 24.652 71.352 132.355 1.00 60.96 ? 166 ASP A CA  1 
ATOM   1343 C C   . ASP A 1 166 ? 25.897 71.500 131.483 1.00 60.86 ? 166 ASP A C   1 
ATOM   1344 O O   . ASP A 1 166 ? 26.490 72.577 131.418 1.00 62.71 ? 166 ASP A O   1 
ATOM   1345 C CB  . ASP A 1 166 ? 24.978 71.702 133.811 1.00 63.77 ? 166 ASP A CB  1 
ATOM   1346 C CG  . ASP A 1 166 ? 25.577 70.537 134.571 1.00 67.35 ? 166 ASP A CG  1 
ATOM   1347 O OD1 . ASP A 1 166 ? 26.690 70.097 134.210 1.00 70.27 ? 166 ASP A OD1 1 
ATOM   1348 O OD2 . ASP A 1 166 ? 24.932 70.057 135.528 1.00 68.62 ? 166 ASP A OD2 1 
ATOM   1349 N N   . ASN A 1 167 ? 26.281 70.419 130.808 1.00 58.62 ? 167 ASN A N   1 
ATOM   1350 C CA  . ASN A 1 167 ? 27.452 70.430 129.933 1.00 55.48 ? 167 ASN A CA  1 
ATOM   1351 C C   . ASN A 1 167 ? 27.227 71.362 128.735 1.00 53.54 ? 167 ASN A C   1 
ATOM   1352 O O   . ASN A 1 167 ? 26.288 71.177 127.960 1.00 53.82 ? 167 ASN A O   1 
ATOM   1353 C CB  . ASN A 1 167 ? 27.733 69.014 129.432 1.00 54.54 ? 167 ASN A CB  1 
ATOM   1354 C CG  . ASN A 1 167 ? 29.035 68.913 128.665 1.00 54.44 ? 167 ASN A CG  1 
ATOM   1355 O OD1 . ASN A 1 167 ? 29.528 69.903 128.115 1.00 54.04 ? 167 ASN A OD1 1 
ATOM   1356 N ND2 . ASN A 1 167 ? 29.593 67.706 128.608 1.00 51.78 ? 167 ASN A ND2 1 
ATOM   1357 N N   . PRO A 1 168 ? 28.094 72.374 128.565 1.00 52.28 ? 168 PRO A N   1 
ATOM   1358 C CA  . PRO A 1 168 ? 27.964 73.319 127.451 1.00 49.00 ? 168 PRO A CA  1 
ATOM   1359 C C   . PRO A 1 168 ? 28.229 72.679 126.090 1.00 45.97 ? 168 PRO A C   1 
ATOM   1360 O O   . PRO A 1 168 ? 27.987 73.292 125.052 1.00 44.83 ? 168 PRO A O   1 
ATOM   1361 C CB  . PRO A 1 168 ? 28.986 74.396 127.797 1.00 49.87 ? 168 PRO A CB  1 
ATOM   1362 C CG  . PRO A 1 168 ? 30.069 73.604 128.462 1.00 52.25 ? 168 PRO A CG  1 
ATOM   1363 C CD  . PRO A 1 168 ? 29.285 72.685 129.377 1.00 52.56 ? 168 PRO A CD  1 
ATOM   1364 N N   . ALA A 1 169 ? 28.724 71.446 126.099 1.00 44.97 ? 169 ALA A N   1 
ATOM   1365 C CA  . ALA A 1 169 ? 29.007 70.727 124.857 1.00 43.61 ? 169 ALA A CA  1 
ATOM   1366 C C   . ALA A 1 169 ? 27.714 70.517 124.075 1.00 43.34 ? 169 ALA A C   1 
ATOM   1367 O O   . ALA A 1 169 ? 27.735 70.348 122.855 1.00 41.79 ? 169 ALA A O   1 
ATOM   1368 C CB  . ALA A 1 169 ? 29.653 69.383 125.166 1.00 43.71 ? 169 ALA A CB  1 
ATOM   1369 N N   . ARG A 1 170 ? 26.593 70.525 124.792 1.00 41.10 ? 170 ARG A N   1 
ATOM   1370 C CA  . ARG A 1 170 ? 25.279 70.340 124.186 1.00 39.54 ? 170 ARG A CA  1 
ATOM   1371 C C   . ARG A 1 170 ? 25.060 71.277 123.009 1.00 39.14 ? 170 ARG A C   1 
ATOM   1372 O O   . ARG A 1 170 ? 24.498 70.878 121.984 1.00 34.93 ? 170 ARG A O   1 
ATOM   1373 C CB  . ARG A 1 170 ? 24.173 70.576 125.224 1.00 38.58 ? 170 ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 170 ? 24.124 69.544 126.340 1.00 37.64 ? 170 ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 170 ? 23.079 69.923 127.386 1.00 41.16 ? 170 ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 170 ? 21.724 69.997 126.839 1.00 40.58 ? 170 ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 170 ? 20.660 70.422 127.519 1.00 41.84 ? 170 ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 170 ? 19.469 70.450 126.936 1.00 38.84 ? 170 ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 170 ? 20.783 70.828 128.777 1.00 39.39 ? 170 ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 171 ? 25.507 72.522 123.152 1.00 36.92 ? 171 LEU A N   1 
ATOM   1381 C CA  . LEU A 1 171 ? 25.329 73.513 122.095 1.00 37.04 ? 171 LEU A CA  1 
ATOM   1382 C C   . LEU A 1 171 ? 26.193 73.273 120.860 1.00 37.63 ? 171 LEU A C   1 
ATOM   1383 O O   . LEU A 1 171 ? 26.014 73.940 119.838 1.00 37.81 ? 171 LEU A O   1 
ATOM   1384 C CB  . LEU A 1 171 ? 25.591 74.920 122.646 1.00 39.44 ? 171 LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 171 ? 24.679 75.367 123.795 1.00 43.69 ? 171 LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 171 ? 25.002 76.808 124.182 1.00 42.89 ? 171 LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 171 ? 23.212 75.250 123.372 1.00 42.82 ? 171 LEU A CD2 1 
ATOM   1388 N N   . LEU A 1 172 ? 27.130 72.330 120.947 1.00 35.51 ? 172 LEU A N   1 
ATOM   1389 C CA  . LEU A 1 172 ? 28.004 72.030 119.810 1.00 35.64 ? 172 LEU A CA  1 
ATOM   1390 C C   . LEU A 1 172 ? 27.540 70.761 119.098 1.00 33.06 ? 172 LEU A C   1 
ATOM   1391 O O   . LEU A 1 172 ? 28.189 70.275 118.172 1.00 32.29 ? 172 LEU A O   1 
ATOM   1392 C CB  . LEU A 1 172 ? 29.451 71.869 120.289 1.00 37.11 ? 172 LEU A CB  1 
ATOM   1393 C CG  . LEU A 1 172 ? 30.060 73.112 120.954 1.00 41.91 ? 172 LEU A CG  1 
ATOM   1394 C CD1 . LEU A 1 172 ? 31.376 72.762 121.617 1.00 42.82 ? 172 LEU A CD1 1 
ATOM   1395 C CD2 . LEU A 1 172 ? 30.252 74.205 119.919 1.00 39.21 ? 172 LEU A CD2 1 
ATOM   1396 N N   . TYR A 1 173 ? 26.402 70.235 119.532 1.00 32.85 ? 173 TYR A N   1 
ATOM   1397 C CA  . TYR A 1 173 ? 25.853 69.021 118.944 1.00 32.12 ? 173 TYR A CA  1 
ATOM   1398 C C   . TYR A 1 173 ? 24.423 69.198 118.442 1.00 32.22 ? 173 TYR A C   1 
ATOM   1399 O O   . TYR A 1 173 ? 23.677 68.224 118.304 1.00 29.00 ? 173 TYR A O   1 
ATOM   1400 C CB  . TYR A 1 173 ? 25.906 67.879 119.964 1.00 32.13 ? 173 TYR A CB  1 
ATOM   1401 C CG  . TYR A 1 173 ? 27.273 67.248 120.119 1.00 32.36 ? 173 TYR A CG  1 
ATOM   1402 C CD1 . TYR A 1 173 ? 28.275 67.865 120.872 1.00 31.74 ? 173 TYR A CD1 1 
ATOM   1403 C CD2 . TYR A 1 173 ? 27.566 66.034 119.500 1.00 32.73 ? 173 TYR A CD2 1 
ATOM   1404 C CE1 . TYR A 1 173 ? 29.541 67.283 121.002 1.00 31.23 ? 173 TYR A CE1 1 
ATOM   1405 C CE2 . TYR A 1 173 ? 28.823 65.443 119.619 1.00 29.78 ? 173 TYR A CE2 1 
ATOM   1406 C CZ  . TYR A 1 173 ? 29.805 66.070 120.369 1.00 31.85 ? 173 TYR A CZ  1 
ATOM   1407 O OH  . TYR A 1 173 ? 31.044 65.481 120.472 1.00 30.30 ? 173 TYR A OH  1 
ATOM   1408 N N   . THR A 1 174 ? 24.040 70.439 118.157 1.00 31.11 ? 174 THR A N   1 
ATOM   1409 C CA  . THR A 1 174 ? 22.691 70.708 117.669 1.00 30.37 ? 174 THR A CA  1 
ATOM   1410 C C   . THR A 1 174 ? 22.677 70.809 116.158 1.00 26.93 ? 174 THR A C   1 
ATOM   1411 O O   . THR A 1 174 ? 23.713 71.034 115.532 1.00 26.33 ? 174 THR A O   1 
ATOM   1412 C CB  . THR A 1 174 ? 22.130 72.039 118.219 1.00 30.91 ? 174 THR A CB  1 
ATOM   1413 O OG1 . THR A 1 174 ? 22.913 73.125 117.712 1.00 27.76 ? 174 THR A OG1 1 
ATOM   1414 C CG2 . THR A 1 174 ? 22.154 72.048 119.735 1.00 27.09 ? 174 THR A CG2 1 
ATOM   1415 N N   . VAL A 1 175 ? 21.501 70.659 115.559 1.00 26.43 ? 175 VAL A N   1 
ATOM   1416 C CA  . VAL A 1 175 ? 21.420 70.767 114.108 1.00 25.96 ? 175 VAL A CA  1 
ATOM   1417 C C   . VAL A 1 175 ? 21.868 72.163 113.659 1.00 29.65 ? 175 VAL A C   1 
ATOM   1418 O O   . VAL A 1 175 ? 22.430 72.324 112.566 1.00 28.39 ? 175 VAL A O   1 
ATOM   1419 C CB  . VAL A 1 175 ? 19.991 70.450 113.580 1.00 26.49 ? 175 VAL A CB  1 
ATOM   1420 C CG1 . VAL A 1 175 ? 18.971 71.456 114.113 1.00 31.60 ? 175 VAL A CG1 1 
ATOM   1421 C CG2 . VAL A 1 175 ? 20.000 70.461 112.069 1.00 26.33 ? 175 VAL A CG2 1 
ATOM   1422 N N   . GLU A 1 176 ? 21.642 73.179 114.499 1.00 30.64 ? 176 GLU A N   1 
ATOM   1423 C CA  . GLU A 1 176 ? 22.073 74.535 114.133 1.00 30.70 ? 176 GLU A CA  1 
ATOM   1424 C C   . GLU A 1 176 ? 23.594 74.616 114.055 1.00 28.16 ? 176 GLU A C   1 
ATOM   1425 O O   . GLU A 1 176 ? 24.140 75.270 113.171 1.00 30.55 ? 176 GLU A O   1 
ATOM   1426 C CB  . GLU A 1 176 ? 21.568 75.587 115.132 1.00 29.56 ? 176 GLU A CB  1 
ATOM   1427 C CG  . GLU A 1 176 ? 20.079 75.888 115.028 1.00 34.88 ? 176 GLU A CG  1 
ATOM   1428 C CD  . GLU A 1 176 ? 19.215 74.837 115.709 1.00 34.64 ? 176 GLU A CD  1 
ATOM   1429 O OE1 . GLU A 1 176 ? 17.976 74.917 115.588 1.00 39.20 ? 176 GLU A OE1 1 
ATOM   1430 O OE2 . GLU A 1 176 ? 19.771 73.942 116.375 1.00 34.63 ? 176 GLU A OE2 1 
ATOM   1431 N N   . PHE A 1 177 ? 24.281 73.971 114.989 1.00 30.40 ? 177 PHE A N   1 
ATOM   1432 C CA  . PHE A 1 177 ? 25.738 73.989 114.965 1.00 33.64 ? 177 PHE A CA  1 
ATOM   1433 C C   . PHE A 1 177 ? 26.256 73.393 113.657 1.00 33.45 ? 177 PHE A C   1 
ATOM   1434 O O   . PHE A 1 177 ? 27.141 73.964 113.004 1.00 33.03 ? 177 PHE A O   1 
ATOM   1435 C CB  . PHE A 1 177 ? 26.315 73.209 116.147 1.00 34.22 ? 177 PHE A CB  1 
ATOM   1436 C CG  . PHE A 1 177 ? 27.819 73.146 116.144 1.00 41.09 ? 177 PHE A CG  1 
ATOM   1437 C CD1 . PHE A 1 177 ? 28.482 71.956 115.862 1.00 41.26 ? 177 PHE A CD1 1 
ATOM   1438 C CD2 . PHE A 1 177 ? 28.573 74.291 116.374 1.00 40.30 ? 177 PHE A CD2 1 
ATOM   1439 C CE1 . PHE A 1 177 ? 29.876 71.910 115.807 1.00 43.47 ? 177 PHE A CE1 1 
ATOM   1440 C CE2 . PHE A 1 177 ? 29.964 74.254 116.319 1.00 41.98 ? 177 PHE A CE2 1 
ATOM   1441 C CZ  . PHE A 1 177 ? 30.616 73.062 116.036 1.00 41.47 ? 177 PHE A CZ  1 
ATOM   1442 N N   . TYR A 1 178 ? 25.700 72.249 113.264 1.00 32.45 ? 178 TYR A N   1 
ATOM   1443 C CA  . TYR A 1 178 ? 26.140 71.599 112.036 1.00 31.84 ? 178 TYR A CA  1 
ATOM   1444 C C   . TYR A 1 178 ? 25.829 72.445 110.810 1.00 31.37 ? 178 TYR A C   1 
ATOM   1445 O O   . TYR A 1 178 ? 26.556 72.405 109.819 1.00 32.26 ? 178 TYR A O   1 
ATOM   1446 C CB  . TYR A 1 178 ? 25.529 70.199 111.924 1.00 28.97 ? 178 TYR A CB  1 
ATOM   1447 C CG  . TYR A 1 178 ? 25.977 69.287 113.051 1.00 26.95 ? 178 TYR A CG  1 
ATOM   1448 C CD1 . TYR A 1 178 ? 25.042 68.669 113.892 1.00 27.34 ? 178 TYR A CD1 1 
ATOM   1449 C CD2 . TYR A 1 178 ? 27.334 69.111 113.332 1.00 25.00 ? 178 TYR A CD2 1 
ATOM   1450 C CE1 . TYR A 1 178 ? 25.450 67.907 114.996 1.00 26.09 ? 178 TYR A CE1 1 
ATOM   1451 C CE2 . TYR A 1 178 ? 27.755 68.350 114.432 1.00 24.81 ? 178 TYR A CE2 1 
ATOM   1452 C CZ  . TYR A 1 178 ? 26.802 67.754 115.263 1.00 24.41 ? 178 TYR A CZ  1 
ATOM   1453 O OH  . TYR A 1 178 ? 27.203 67.027 116.361 1.00 25.83 ? 178 TYR A OH  1 
ATOM   1454 N N   . ARG A 1 179 ? 24.754 73.221 110.875 1.00 32.79 ? 179 ARG A N   1 
ATOM   1455 C CA  . ARG A 1 179 ? 24.402 74.099 109.762 1.00 31.62 ? 179 ARG A CA  1 
ATOM   1456 C C   . ARG A 1 179 ? 25.385 75.266 109.715 1.00 28.20 ? 179 ARG A C   1 
ATOM   1457 O O   . ARG A 1 179 ? 25.756 75.728 108.645 1.00 33.70 ? 179 ARG A O   1 
ATOM   1458 C CB  . ARG A 1 179 ? 22.970 74.614 109.923 1.00 36.11 ? 179 ARG A CB  1 
ATOM   1459 C CG  . ARG A 1 179 ? 21.948 73.690 109.322 1.00 33.68 ? 179 ARG A CG  1 
ATOM   1460 C CD  . ARG A 1 179 ? 20.532 74.084 109.700 1.00 38.10 ? 179 ARG A CD  1 
ATOM   1461 N NE  . ARG A 1 179 ? 19.586 73.116 109.161 1.00 35.07 ? 179 ARG A NE  1 
ATOM   1462 C CZ  . ARG A 1 179 ? 18.401 72.837 109.692 1.00 37.88 ? 179 ARG A CZ  1 
ATOM   1463 N NH1 . ARG A 1 179 ? 17.616 71.929 109.116 1.00 33.85 ? 179 ARG A NH1 1 
ATOM   1464 N NH2 . ARG A 1 179 ? 18.001 73.454 110.796 1.00 36.15 ? 179 ARG A NH2 1 
ATOM   1465 N N   . LEU A 1 180 ? 25.795 75.734 110.887 1.00 30.60 ? 180 LEU A N   1 
ATOM   1466 C CA  . LEU A 1 180 ? 26.771 76.816 111.001 1.00 31.85 ? 180 LEU A CA  1 
ATOM   1467 C C   . LEU A 1 180 ? 28.082 76.319 110.388 1.00 34.85 ? 180 LEU A C   1 
ATOM   1468 O O   . LEU A 1 180 ? 28.755 77.048 109.650 1.00 33.72 ? 180 LEU A O   1 
ATOM   1469 C CB  . LEU A 1 180 ? 26.997 77.166 112.473 1.00 34.18 ? 180 LEU A CB  1 
ATOM   1470 C CG  . LEU A 1 180 ? 28.139 78.134 112.796 1.00 35.91 ? 180 LEU A CG  1 
ATOM   1471 C CD1 . LEU A 1 180 ? 27.952 79.438 112.024 1.00 39.40 ? 180 LEU A CD1 1 
ATOM   1472 C CD2 . LEU A 1 180 ? 28.166 78.394 114.294 1.00 37.73 ? 180 LEU A CD2 1 
ATOM   1473 N N   . VAL A 1 181 ? 28.436 75.070 110.697 1.00 31.57 ? 181 VAL A N   1 
ATOM   1474 C CA  . VAL A 1 181 ? 29.651 74.462 110.155 1.00 31.88 ? 181 VAL A CA  1 
ATOM   1475 C C   . VAL A 1 181 ? 29.539 74.375 108.637 1.00 31.49 ? 181 VAL A C   1 
ATOM   1476 O O   . VAL A 1 181 ? 30.448 74.773 107.910 1.00 33.34 ? 181 VAL A O   1 
ATOM   1477 C CB  . VAL A 1 181 ? 29.875 73.022 110.702 1.00 29.64 ? 181 VAL A CB  1 
ATOM   1478 C CG1 . VAL A 1 181 ? 31.026 72.349 109.948 1.00 30.36 ? 181 VAL A CG1 1 
ATOM   1479 C CG2 . VAL A 1 181 ? 30.169 73.056 112.195 1.00 29.77 ? 181 VAL A CG2 1 
ATOM   1480 N N   . LYS A 1 182 ? 28.414 73.855 108.163 1.00 34.64 ? 182 LYS A N   1 
ATOM   1481 C CA  . LYS A 1 182 ? 28.198 73.703 106.734 1.00 36.16 ? 182 LYS A CA  1 
ATOM   1482 C C   . LYS A 1 182 ? 28.284 75.038 106.004 1.00 39.51 ? 182 LYS A C   1 
ATOM   1483 O O   . LYS A 1 182 ? 28.699 75.092 104.841 1.00 36.90 ? 182 LYS A O   1 
ATOM   1484 C CB  . LYS A 1 182 ? 26.834 73.079 106.454 1.00 37.08 ? 182 LYS A CB  1 
ATOM   1485 C CG  . LYS A 1 182 ? 26.732 72.515 105.042 1.00 39.83 ? 182 LYS A CG  1 
ATOM   1486 C CD  . LYS A 1 182 ? 25.422 72.869 104.353 1.00 42.59 ? 182 LYS A CD  1 
ATOM   1487 C CE  . LYS A 1 182 ? 24.228 72.257 105.039 1.00 41.90 ? 182 LYS A CE  1 
ATOM   1488 N NZ  . LYS A 1 182 ? 23.018 72.328 104.177 1.00 36.17 ? 182 LYS A NZ  1 
ATOM   1489 N N   . ALA A 1 183 ? 27.872 76.103 106.686 1.00 39.28 ? 183 ALA A N   1 
ATOM   1490 C CA  . ALA A 1 183 ? 27.905 77.442 106.106 1.00 42.36 ? 183 ALA A CA  1 
ATOM   1491 C C   . ALA A 1 183 ? 29.347 77.847 105.832 1.00 43.22 ? 183 ALA A C   1 
ATOM   1492 O O   . ALA A 1 183 ? 29.618 78.615 104.907 1.00 42.62 ? 183 ALA A O   1 
ATOM   1493 C CB  . ALA A 1 183 ? 27.249 78.449 107.052 1.00 41.25 ? 183 ALA A CB  1 
ATOM   1494 N N   . HIS A 1 184 ? 30.270 77.327 106.636 1.00 42.68 ? 184 HIS A N   1 
ATOM   1495 C CA  . HIS A 1 184 ? 31.678 77.648 106.462 1.00 43.05 ? 184 HIS A CA  1 
ATOM   1496 C C   . HIS A 1 184 ? 32.434 76.656 105.595 1.00 43.27 ? 184 HIS A C   1 
ATOM   1497 O O   . HIS A 1 184 ? 33.652 76.535 105.698 1.00 44.42 ? 184 HIS A O   1 
ATOM   1498 C CB  . HIS A 1 184 ? 32.358 77.781 107.820 1.00 44.28 ? 184 HIS A CB  1 
ATOM   1499 C CG  . HIS A 1 184 ? 31.936 79.000 108.577 1.00 48.83 ? 184 HIS A CG  1 
ATOM   1500 N ND1 . HIS A 1 184 ? 30.668 79.149 109.096 1.00 49.12 ? 184 HIS A ND1 1 
ATOM   1501 C CD2 . HIS A 1 184 ? 32.594 80.151 108.852 1.00 50.08 ? 184 HIS A CD2 1 
ATOM   1502 C CE1 . HIS A 1 184 ? 30.563 80.340 109.659 1.00 51.40 ? 184 HIS A CE1 1 
ATOM   1503 N NE2 . HIS A 1 184 ? 31.718 80.968 109.525 1.00 52.32 ? 184 HIS A NE2 1 
ATOM   1504 N N   . LEU A 1 185 ? 31.709 75.951 104.735 1.00 41.39 ? 185 LEU A N   1 
ATOM   1505 C CA  . LEU A 1 185 ? 32.329 74.985 103.842 1.00 41.42 ? 185 LEU A CA  1 
ATOM   1506 C C   . LEU A 1 185 ? 32.311 75.462 102.396 1.00 43.01 ? 185 LEU A C   1 
ATOM   1507 O O   . LEU A 1 185 ? 31.310 76.002 101.919 1.00 43.05 ? 185 LEU A O   1 
ATOM   1508 C CB  . LEU A 1 185 ? 31.611 73.638 103.923 1.00 40.18 ? 185 LEU A CB  1 
ATOM   1509 C CG  . LEU A 1 185 ? 32.012 72.676 105.039 1.00 37.45 ? 185 LEU A CG  1 
ATOM   1510 C CD1 . LEU A 1 185 ? 31.143 71.427 104.953 1.00 37.84 ? 185 LEU A CD1 1 
ATOM   1511 C CD2 . LEU A 1 185 ? 33.488 72.317 104.901 1.00 33.11 ? 185 LEU A CD2 1 
ATOM   1512 N N   . ASN A 1 186 ? 33.424 75.269 101.702 1.00 43.56 ? 186 ASN A N   1 
ATOM   1513 C CA  . ASN A 1 186 ? 33.505 75.647 100.297 1.00 43.73 ? 186 ASN A CA  1 
ATOM   1514 C C   . ASN A 1 186 ? 32.673 74.628 99.532  1.00 43.33 ? 186 ASN A C   1 
ATOM   1515 O O   . ASN A 1 186 ? 32.322 73.576 100.069 1.00 42.97 ? 186 ASN A O   1 
ATOM   1516 C CB  . ASN A 1 186 ? 34.955 75.577 99.810  1.00 43.94 ? 186 ASN A CB  1 
ATOM   1517 C CG  . ASN A 1 186 ? 35.809 76.704 100.353 1.00 46.25 ? 186 ASN A CG  1 
ATOM   1518 O OD1 . ASN A 1 186 ? 37.021 76.550 100.521 1.00 48.97 ? 186 ASN A OD1 1 
ATOM   1519 N ND2 . ASN A 1 186 ? 35.189 77.850 100.614 1.00 42.36 ? 186 ASN A ND2 1 
ATOM   1520 N N   . PRO A 1 187 ? 32.316 74.933 98.278  1.00 44.25 ? 187 PRO A N   1 
ATOM   1521 C CA  . PRO A 1 187 ? 31.527 73.937 97.551  1.00 44.01 ? 187 PRO A CA  1 
ATOM   1522 C C   . PRO A 1 187 ? 32.398 72.692 97.417  1.00 42.54 ? 187 PRO A C   1 
ATOM   1523 O O   . PRO A 1 187 ? 33.605 72.798 97.188  1.00 44.10 ? 187 PRO A O   1 
ATOM   1524 C CB  . PRO A 1 187 ? 31.259 74.619 96.210  1.00 44.99 ? 187 PRO A CB  1 
ATOM   1525 C CG  . PRO A 1 187 ? 32.446 75.549 96.054  1.00 46.34 ? 187 PRO A CG  1 
ATOM   1526 C CD  . PRO A 1 187 ? 32.570 76.121 97.447  1.00 44.64 ? 187 PRO A CD  1 
ATOM   1527 N N   . GLY A 1 188 ? 31.795 71.521 97.578  1.00 39.71 ? 188 GLY A N   1 
ATOM   1528 C CA  . GLY A 1 188 ? 32.561 70.291 97.491  1.00 37.14 ? 188 GLY A CA  1 
ATOM   1529 C C   . GLY A 1 188 ? 33.239 69.967 98.815  1.00 35.50 ? 188 GLY A C   1 
ATOM   1530 O O   . GLY A 1 188 ? 34.041 69.038 98.899  1.00 34.31 ? 188 GLY A O   1 
ATOM   1531 N N   . GLY A 1 189 ? 32.905 70.732 99.852  1.00 32.47 ? 189 GLY A N   1 
ATOM   1532 C CA  . GLY A 1 189 ? 33.496 70.524 101.160 1.00 32.40 ? 189 GLY A CA  1 
ATOM   1533 C C   . GLY A 1 189 ? 32.948 69.330 101.916 1.00 32.21 ? 189 GLY A C   1 
ATOM   1534 O O   . GLY A 1 189 ? 31.806 68.918 101.717 1.00 30.43 ? 189 GLY A O   1 
ATOM   1535 N N   . VAL A 1 190 ? 33.773 68.768 102.793 1.00 34.90 ? 190 VAL A N   1 
ATOM   1536 C CA  . VAL A 1 190 ? 33.362 67.619 103.586 1.00 34.32 ? 190 VAL A CA  1 
ATOM   1537 C C   . VAL A 1 190 ? 33.680 67.832 105.055 1.00 32.95 ? 190 VAL A C   1 
ATOM   1538 O O   . VAL A 1 190 ? 34.653 68.508 105.408 1.00 31.93 ? 190 VAL A O   1 
ATOM   1539 C CB  . VAL A 1 190 ? 34.060 66.319 103.111 1.00 37.65 ? 190 VAL A CB  1 
ATOM   1540 C CG1 . VAL A 1 190 ? 33.682 66.024 101.669 1.00 37.96 ? 190 VAL A CG1 1 
ATOM   1541 C CG2 . VAL A 1 190 ? 35.564 66.457 103.247 1.00 38.89 ? 190 VAL A CG2 1 
ATOM   1542 N N   . MET A 1 191 ? 32.848 67.249 105.908 1.00 28.38 ? 191 MET A N   1 
ATOM   1543 C CA  . MET A 1 191 ? 33.038 67.355 107.340 1.00 29.54 ? 191 MET A CA  1 
ATOM   1544 C C   . MET A 1 191 ? 33.252 65.954 107.931 1.00 27.06 ? 191 MET A C   1 
ATOM   1545 O O   . MET A 1 191 ? 32.543 65.002 107.577 1.00 26.95 ? 191 MET A O   1 
ATOM   1546 C CB  . MET A 1 191 ? 31.812 68.033 107.964 1.00 29.85 ? 191 MET A CB  1 
ATOM   1547 C CG  . MET A 1 191 ? 31.926 68.310 109.443 1.00 36.80 ? 191 MET A CG  1 
ATOM   1548 S SD  . MET A 1 191 ? 31.385 66.900 110.409 1.00 50.69 ? 191 MET A SD  1 
ATOM   1549 C CE  . MET A 1 191 ? 29.577 67.292 110.553 1.00 41.02 ? 191 MET A CE  1 
ATOM   1550 N N   . GLY A 1 192 ? 34.239 65.832 108.815 1.00 26.89 ? 192 GLY A N   1 
ATOM   1551 C CA  . GLY A 1 192 ? 34.522 64.554 109.451 1.00 25.10 ? 192 GLY A CA  1 
ATOM   1552 C C   . GLY A 1 192 ? 34.469 64.753 110.952 1.00 24.06 ? 192 GLY A C   1 
ATOM   1553 O O   . GLY A 1 192 ? 34.895 65.795 111.432 1.00 23.41 ? 192 GLY A O   1 
ATOM   1554 N N   . MET A 1 193 ? 33.971 63.767 111.697 1.00 22.58 ? 193 MET A N   1 
ATOM   1555 C CA  . MET A 1 193 ? 33.872 63.912 113.144 1.00 22.56 ? 193 MET A CA  1 
ATOM   1556 C C   . MET A 1 193 ? 33.817 62.610 113.949 1.00 20.28 ? 193 MET A C   1 
ATOM   1557 O O   . MET A 1 193 ? 33.436 61.562 113.428 1.00 20.53 ? 193 MET A O   1 
ATOM   1558 C CB  . MET A 1 193 ? 32.619 64.722 113.487 1.00 23.96 ? 193 MET A CB  1 
ATOM   1559 C CG  . MET A 1 193 ? 31.316 63.962 113.245 1.00 24.50 ? 193 MET A CG  1 
ATOM   1560 S SD  . MET A 1 193 ? 29.831 64.947 113.600 1.00 26.24 ? 193 MET A SD  1 
ATOM   1561 C CE  . MET A 1 193 ? 29.956 65.146 115.350 1.00 18.57 ? 193 MET A CE  1 
ATOM   1562 N N   . GLN A 1 194 ? 34.200 62.697 115.222 1.00 21.94 ? 194 GLN A N   1 
ATOM   1563 C CA  . GLN A 1 194 ? 34.115 61.556 116.129 1.00 24.53 ? 194 GLN A CA  1 
ATOM   1564 C C   . GLN A 1 194 ? 32.675 61.740 116.566 1.00 26.43 ? 194 GLN A C   1 
ATOM   1565 O O   . GLN A 1 194 ? 32.245 62.862 116.856 1.00 26.50 ? 194 GLN A O   1 
ATOM   1566 C CB  . GLN A 1 194 ? 35.092 61.683 117.311 1.00 25.25 ? 194 GLN A CB  1 
ATOM   1567 C CG  . GLN A 1 194 ? 34.651 62.566 118.467 1.00 39.03 ? 194 GLN A CG  1 
ATOM   1568 C CD  . GLN A 1 194 ? 33.932 61.802 119.583 1.00 40.91 ? 194 GLN A CD  1 
ATOM   1569 O OE1 . GLN A 1 194 ? 33.630 62.365 120.632 1.00 50.05 ? 194 GLN A OE1 1 
ATOM   1570 N NE2 . GLN A 1 194 ? 33.654 60.530 119.356 1.00 40.33 ? 194 GLN A NE2 1 
ATOM   1571 N N   . THR A 1 195 ? 31.929 60.647 116.600 1.00 27.86 ? 195 THR A N   1 
ATOM   1572 C CA  . THR A 1 195 ? 30.510 60.713 116.896 1.00 30.21 ? 195 THR A CA  1 
ATOM   1573 C C   . THR A 1 195 ? 30.037 59.852 118.045 1.00 28.36 ? 195 THR A C   1 
ATOM   1574 O O   . THR A 1 195 ? 28.960 59.267 117.976 1.00 30.61 ? 195 THR A O   1 
ATOM   1575 C CB  . THR A 1 195 ? 29.727 60.311 115.649 1.00 35.80 ? 195 THR A CB  1 
ATOM   1576 O OG1 . THR A 1 195 ? 30.236 61.031 114.521 1.00 45.51 ? 195 THR A OG1 1 
ATOM   1577 C CG2 . THR A 1 195 ? 28.259 60.604 115.820 1.00 43.78 ? 195 THR A CG2 1 
ATOM   1578 N N   . GLY A 1 196 ? 30.843 59.761 119.089 1.00 24.33 ? 196 GLY A N   1 
ATOM   1579 C CA  . GLY A 1 196 ? 30.453 58.984 120.246 1.00 26.61 ? 196 GLY A CA  1 
ATOM   1580 C C   . GLY A 1 196 ? 30.759 57.499 120.224 1.00 28.37 ? 196 GLY A C   1 
ATOM   1581 O O   . GLY A 1 196 ? 30.897 56.868 119.169 1.00 26.22 ? 196 GLY A O   1 
ATOM   1582 N N   . MET A 1 197 ? 30.861 56.937 121.420 1.00 28.90 ? 197 MET A N   1 
ATOM   1583 C CA  . MET A 1 197 ? 31.130 55.519 121.570 1.00 27.56 ? 197 MET A CA  1 
ATOM   1584 C C   . MET A 1 197 ? 29.897 54.762 121.089 1.00 26.34 ? 197 MET A C   1 
ATOM   1585 O O   . MET A 1 197 ? 28.791 55.310 121.035 1.00 23.09 ? 197 MET A O   1 
ATOM   1586 C CB  . MET A 1 197 ? 31.375 55.173 123.040 1.00 35.31 ? 197 MET A CB  1 
ATOM   1587 C CG  . MET A 1 197 ? 30.089 54.948 123.835 1.00 40.75 ? 197 MET A CG  1 
ATOM   1588 S SD  . MET A 1 197 ? 30.376 54.317 125.503 1.00 49.05 ? 197 MET A SD  1 
ATOM   1589 C CE  . MET A 1 197 ? 30.400 55.838 126.386 1.00 45.66 ? 197 MET A CE  1 
ATOM   1590 N N   . ILE A 1 198 ? 30.100 53.504 120.732 1.00 26.42 ? 198 ILE A N   1 
ATOM   1591 C CA  . ILE A 1 198 ? 29.005 52.655 120.288 1.00 29.54 ? 198 ILE A CA  1 
ATOM   1592 C C   . ILE A 1 198 ? 28.926 51.528 121.308 1.00 28.52 ? 198 ILE A C   1 
ATOM   1593 O O   . ILE A 1 198 ? 29.915 50.846 121.563 1.00 31.93 ? 198 ILE A O   1 
ATOM   1594 C CB  . ILE A 1 198 ? 29.279 52.065 118.893 1.00 28.59 ? 198 ILE A CB  1 
ATOM   1595 C CG1 . ILE A 1 198 ? 29.275 53.187 117.851 1.00 27.11 ? 198 ILE A CG1 1 
ATOM   1596 C CG2 . ILE A 1 198 ? 28.222 51.022 118.545 1.00 24.98 ? 198 ILE A CG2 1 
ATOM   1597 C CD1 . ILE A 1 198 ? 29.774 52.744 116.496 1.00 29.91 ? 198 ILE A CD1 1 
ATOM   1598 N N   . LEU A 1 199 ? 27.753 51.352 121.893 1.00 29.11 ? 199 LEU A N   1 
ATOM   1599 C CA  . LEU A 1 199 ? 27.535 50.321 122.893 1.00 35.12 ? 199 LEU A CA  1 
ATOM   1600 C C   . LEU A 1 199 ? 26.043 50.035 122.960 1.00 39.94 ? 199 LEU A C   1 
ATOM   1601 O O   . LEU A 1 199 ? 25.261 50.869 123.434 1.00 43.03 ? 199 LEU A O   1 
ATOM   1602 C CB  . LEU A 1 199 ? 28.022 50.805 124.265 1.00 35.10 ? 199 LEU A CB  1 
ATOM   1603 C CG  . LEU A 1 199 ? 28.229 49.756 125.358 1.00 33.08 ? 199 LEU A CG  1 
ATOM   1604 C CD1 . LEU A 1 199 ? 29.470 48.944 125.046 1.00 34.32 ? 199 LEU A CD1 1 
ATOM   1605 C CD2 . LEU A 1 199 ? 28.406 50.448 126.696 1.00 34.80 ? 199 LEU A CD2 1 
ATOM   1606 N N   . LEU A 1 200 ? 25.671 48.854 122.476 1.00 42.33 ? 200 LEU A N   1 
ATOM   1607 C CA  . LEU A 1 200 ? 24.290 48.373 122.446 1.00 46.00 ? 200 LEU A CA  1 
ATOM   1608 C C   . LEU A 1 200 ? 23.252 49.476 122.260 1.00 45.11 ? 200 LEU A C   1 
ATOM   1609 O O   . LEU A 1 200 ? 22.270 49.525 123.035 1.00 44.13 ? 200 LEU A O   1 
ATOM   1610 C CB  . LEU A 1 200 ? 23.991 47.577 123.723 1.00 47.91 ? 200 LEU A CB  1 
ATOM   1611 C CG  . LEU A 1 200 ? 24.968 46.435 124.059 1.00 50.68 ? 200 LEU A CG  1 
ATOM   1612 C CD1 . LEU A 1 200 ? 24.418 45.635 125.242 1.00 52.50 ? 200 LEU A CD1 1 
ATOM   1613 C CD2 . LEU A 1 200 ? 25.164 45.527 122.846 1.00 52.33 ? 200 LEU A CD2 1 
ATOM   1614 N N   . ARG A 1 204 ? 22.614 55.582 122.922 1.00 29.58 ? 204 ARG A N   1 
ATOM   1615 C CA  . ARG A 1 204 ? 22.116 56.102 121.613 1.00 31.99 ? 204 ARG A CA  1 
ATOM   1616 C C   . ARG A 1 204 ? 22.845 57.363 121.159 1.00 28.77 ? 204 ARG A C   1 
ATOM   1617 O O   . ARG A 1 204 ? 22.386 58.055 120.254 1.00 30.03 ? 204 ARG A O   1 
ATOM   1618 C CB  . ARG A 1 204 ? 20.613 56.406 121.696 1.00 36.53 ? 204 ARG A CB  1 
ATOM   1619 C CG  . ARG A 1 204 ? 19.693 55.223 121.392 1.00 38.74 ? 204 ARG A CG  1 
ATOM   1620 C CD  . ARG A 1 204 ? 18.257 55.536 121.821 1.00 42.78 ? 204 ARG A CD  1 
ATOM   1621 N NE  . ARG A 1 204 ? 17.716 56.745 121.197 1.00 40.71 ? 204 ARG A NE  1 
ATOM   1622 C CZ  . ARG A 1 204 ? 16.932 57.624 121.821 1.00 42.29 ? 204 ARG A CZ  1 
ATOM   1623 N NH1 . ARG A 1 204 ? 16.593 57.437 123.092 1.00 41.15 ? 204 ARG A NH1 1 
ATOM   1624 N NH2 . ARG A 1 204 ? 16.484 58.694 121.178 1.00 35.24 ? 204 ARG A NH2 1 
ATOM   1625 N N   . VAL A 1 205 ? 23.979 57.671 121.777 1.00 28.89 ? 205 VAL A N   1 
ATOM   1626 C CA  . VAL A 1 205 ? 24.709 58.868 121.387 1.00 26.73 ? 205 VAL A CA  1 
ATOM   1627 C C   . VAL A 1 205 ? 25.064 58.886 119.910 1.00 23.44 ? 205 VAL A C   1 
ATOM   1628 O O   . VAL A 1 205 ? 24.758 59.847 119.199 1.00 22.70 ? 205 VAL A O   1 
ATOM   1629 C CB  . VAL A 1 205 ? 26.006 59.028 122.183 1.00 29.43 ? 205 VAL A CB  1 
ATOM   1630 C CG1 . VAL A 1 205 ? 26.741 60.276 121.721 1.00 29.22 ? 205 VAL A CG1 1 
ATOM   1631 C CG2 . VAL A 1 205 ? 25.693 59.116 123.653 1.00 31.16 ? 205 VAL A CG2 1 
ATOM   1632 N N   . HIS A 1 206 ? 25.713 57.835 119.429 1.00 22.38 ? 206 HIS A N   1 
ATOM   1633 C CA  . HIS A 1 206 ? 26.087 57.839 118.028 1.00 19.17 ? 206 HIS A CA  1 
ATOM   1634 C C   . HIS A 1 206 ? 24.885 57.932 117.082 1.00 21.21 ? 206 HIS A C   1 
ATOM   1635 O O   . HIS A 1 206 ? 24.889 58.722 116.146 1.00 21.64 ? 206 HIS A O   1 
ATOM   1636 C CB  . HIS A 1 206 ? 26.947 56.620 117.675 1.00 20.90 ? 206 HIS A CB  1 
ATOM   1637 C CG  . HIS A 1 206 ? 27.354 56.590 116.236 1.00 21.88 ? 206 HIS A CG  1 
ATOM   1638 N ND1 . HIS A 1 206 ? 28.142 57.570 115.670 1.00 19.28 ? 206 HIS A ND1 1 
ATOM   1639 C CD2 . HIS A 1 206 ? 26.994 55.768 115.223 1.00 21.02 ? 206 HIS A CD2 1 
ATOM   1640 C CE1 . HIS A 1 206 ? 28.242 57.360 114.369 1.00 23.57 ? 206 HIS A CE1 1 
ATOM   1641 N NE2 . HIS A 1 206 ? 27.552 56.274 114.070 1.00 23.55 ? 206 HIS A NE2 1 
ATOM   1642 N N   . PRO A 1 207 ? 23.832 57.139 117.318 1.00 21.58 ? 207 PRO A N   1 
ATOM   1643 C CA  . PRO A 1 207 ? 22.690 57.238 116.405 1.00 21.15 ? 207 PRO A CA  1 
ATOM   1644 C C   . PRO A 1 207 ? 22.026 58.612 116.440 1.00 23.53 ? 207 PRO A C   1 
ATOM   1645 O O   . PRO A 1 207 ? 21.561 59.108 115.418 1.00 22.55 ? 207 PRO A O   1 
ATOM   1646 C CB  . PRO A 1 207 ? 21.762 56.131 116.893 1.00 22.00 ? 207 PRO A CB  1 
ATOM   1647 C CG  . PRO A 1 207 ? 22.740 55.100 117.386 1.00 22.49 ? 207 PRO A CG  1 
ATOM   1648 C CD  . PRO A 1 207 ? 23.711 55.951 118.177 1.00 20.47 ? 207 PRO A CD  1 
ATOM   1649 N N   . VAL A 1 208 ? 21.997 59.237 117.613 1.00 22.58 ? 208 VAL A N   1 
ATOM   1650 C CA  . VAL A 1 208 ? 21.379 60.549 117.721 1.00 23.95 ? 208 VAL A CA  1 
ATOM   1651 C C   . VAL A 1 208 ? 22.221 61.579 116.980 1.00 22.07 ? 208 VAL A C   1 
ATOM   1652 O O   . VAL A 1 208 ? 21.691 62.417 116.248 1.00 24.94 ? 208 VAL A O   1 
ATOM   1653 C CB  . VAL A 1 208 ? 21.187 60.963 119.203 1.00 28.02 ? 208 VAL A CB  1 
ATOM   1654 C CG1 . VAL A 1 208 ? 20.749 62.412 119.293 1.00 29.24 ? 208 VAL A CG1 1 
ATOM   1655 C CG2 . VAL A 1 208 ? 20.127 60.072 119.848 1.00 30.97 ? 208 VAL A CG2 1 
ATOM   1656 N N   . VAL A 1 209 ? 23.536 61.512 117.135 1.00 21.86 ? 209 VAL A N   1 
ATOM   1657 C CA  . VAL A 1 209 ? 24.381 62.468 116.425 1.00 22.98 ? 209 VAL A CA  1 
ATOM   1658 C C   . VAL A 1 209 ? 24.228 62.268 114.922 1.00 22.78 ? 209 VAL A C   1 
ATOM   1659 O O   . VAL A 1 209 ? 24.117 63.243 114.177 1.00 25.20 ? 209 VAL A O   1 
ATOM   1660 C CB  . VAL A 1 209 ? 25.848 62.322 116.815 1.00 24.75 ? 209 VAL A CB  1 
ATOM   1661 C CG1 . VAL A 1 209 ? 26.708 63.288 115.998 1.00 26.44 ? 209 VAL A CG1 1 
ATOM   1662 C CG2 . VAL A 1 209 ? 26.007 62.588 118.292 1.00 23.98 ? 209 VAL A CG2 1 
ATOM   1663 N N   . HIS A 1 210 ? 24.219 61.011 114.474 1.00 21.21 ? 210 HIS A N   1 
ATOM   1664 C CA  . HIS A 1 210 ? 24.052 60.724 113.048 1.00 22.19 ? 210 HIS A CA  1 
ATOM   1665 C C   . HIS A 1 210 ? 22.741 61.338 112.543 1.00 23.21 ? 210 HIS A C   1 
ATOM   1666 O O   . HIS A 1 210 ? 22.709 62.012 111.516 1.00 23.79 ? 210 HIS A O   1 
ATOM   1667 C CB  . HIS A 1 210 ? 24.011 59.211 112.786 1.00 24.63 ? 210 HIS A CB  1 
ATOM   1668 C CG  . HIS A 1 210 ? 23.875 58.855 111.337 1.00 28.87 ? 210 HIS A CG  1 
ATOM   1669 N ND1 . HIS A 1 210 ? 24.912 58.331 110.596 1.00 30.62 ? 210 HIS A ND1 1 
ATOM   1670 C CD2 . HIS A 1 210 ? 22.833 58.988 110.480 1.00 31.88 ? 210 HIS A CD2 1 
ATOM   1671 C CE1 . HIS A 1 210 ? 24.516 58.155 109.348 1.00 30.79 ? 210 HIS A CE1 1 
ATOM   1672 N NE2 . HIS A 1 210 ? 23.259 58.546 109.251 1.00 30.62 ? 210 HIS A NE2 1 
ATOM   1673 N N   . ARG A 1 211 ? 21.656 61.099 113.265 1.00 24.56 ? 211 ARG A N   1 
ATOM   1674 C CA  . ARG A 1 211 ? 20.362 61.640 112.861 1.00 25.04 ? 211 ARG A CA  1 
ATOM   1675 C C   . ARG A 1 211 ? 20.365 63.176 112.845 1.00 24.24 ? 211 ARG A C   1 
ATOM   1676 O O   . ARG A 1 211 ? 19.838 63.794 111.923 1.00 27.42 ? 211 ARG A O   1 
ATOM   1677 C CB  . ARG A 1 211 ? 19.268 61.114 113.795 1.00 24.55 ? 211 ARG A CB  1 
ATOM   1678 C CG  . ARG A 1 211 ? 17.877 61.682 113.516 1.00 24.70 ? 211 ARG A CG  1 
ATOM   1679 C CD  . ARG A 1 211 ? 17.326 61.239 112.173 1.00 28.99 ? 211 ARG A CD  1 
ATOM   1680 N NE  . ARG A 1 211 ? 16.070 61.927 111.867 1.00 29.63 ? 211 ARG A NE  1 
ATOM   1681 C CZ  . ARG A 1 211 ? 15.986 63.146 111.336 1.00 33.53 ? 211 ARG A CZ  1 
ATOM   1682 N NH1 . ARG A 1 211 ? 14.793 63.682 111.106 1.00 34.56 ? 211 ARG A NH1 1 
ATOM   1683 N NH2 . ARG A 1 211 ? 17.084 63.826 111.018 1.00 29.39 ? 211 ARG A NH2 1 
ATOM   1684 N N   . THR A 1 212 ? 20.968 63.789 113.855 1.00 24.21 ? 212 THR A N   1 
ATOM   1685 C CA  . THR A 1 212 ? 21.029 65.245 113.938 1.00 25.64 ? 212 THR A CA  1 
ATOM   1686 C C   . THR A 1 212 ? 21.832 65.842 112.780 1.00 25.51 ? 212 THR A C   1 
ATOM   1687 O O   . THR A 1 212 ? 21.417 66.820 112.161 1.00 26.38 ? 212 THR A O   1 
ATOM   1688 C CB  . THR A 1 212 ? 21.648 65.680 115.274 1.00 25.27 ? 212 THR A CB  1 
ATOM   1689 O OG1 . THR A 1 212 ? 20.833 65.192 116.344 1.00 25.47 ? 212 THR A OG1 1 
ATOM   1690 C CG2 . THR A 1 212 ? 21.753 67.207 115.364 1.00 26.18 ? 212 THR A CG2 1 
ATOM   1691 N N   . VAL A 1 213 ? 22.980 65.244 112.482 1.00 23.35 ? 213 VAL A N   1 
ATOM   1692 C CA  . VAL A 1 213 ? 23.815 65.725 111.392 1.00 23.60 ? 213 VAL A CA  1 
ATOM   1693 C C   . VAL A 1 213 ? 23.077 65.598 110.052 1.00 25.54 ? 213 VAL A C   1 
ATOM   1694 O O   . VAL A 1 213 ? 23.196 66.460 109.179 1.00 26.41 ? 213 VAL A O   1 
ATOM   1695 C CB  . VAL A 1 213 ? 25.149 64.936 111.351 1.00 25.30 ? 213 VAL A CB  1 
ATOM   1696 C CG1 . VAL A 1 213 ? 25.931 65.281 110.094 1.00 23.00 ? 213 VAL A CG1 1 
ATOM   1697 C CG2 . VAL A 1 213 ? 25.980 65.274 112.599 1.00 22.31 ? 213 VAL A CG2 1 
ATOM   1698 N N   . ARG A 1 214 ? 22.298 64.529 109.912 1.00 26.09 ? 214 ARG A N   1 
ATOM   1699 C CA  . ARG A 1 214 ? 21.535 64.262 108.694 1.00 28.63 ? 214 ARG A CA  1 
ATOM   1700 C C   . ARG A 1 214 ? 20.431 65.303 108.493 1.00 29.94 ? 214 ARG A C   1 
ATOM   1701 O O   . ARG A 1 214 ? 19.879 65.438 107.403 1.00 31.06 ? 214 ARG A O   1 
ATOM   1702 C CB  . ARG A 1 214 ? 20.914 62.862 108.765 1.00 32.64 ? 214 ARG A CB  1 
ATOM   1703 C CG  . ARG A 1 214 ? 20.124 62.453 107.534 1.00 34.25 ? 214 ARG A CG  1 
ATOM   1704 C CD  . ARG A 1 214 ? 21.022 62.264 106.320 1.00 42.32 ? 214 ARG A CD  1 
ATOM   1705 N NE  . ARG A 1 214 ? 20.269 61.939 105.108 1.00 44.98 ? 214 ARG A NE  1 
ATOM   1706 C CZ  . ARG A 1 214 ? 19.471 62.789 104.461 1.00 49.85 ? 214 ARG A CZ  1 
ATOM   1707 N NH1 . ARG A 1 214 ? 19.314 64.033 104.900 1.00 47.65 ? 214 ARG A NH1 1 
ATOM   1708 N NH2 . ARG A 1 214 ? 18.823 62.394 103.372 1.00 49.46 ? 214 ARG A NH2 1 
ATOM   1709 N N   . GLU A 1 215 ? 20.102 66.029 109.553 1.00 29.72 ? 215 GLU A N   1 
ATOM   1710 C CA  . GLU A 1 215 ? 19.082 67.056 109.460 1.00 32.81 ? 215 GLU A CA  1 
ATOM   1711 C C   . GLU A 1 215 ? 19.738 68.312 108.899 1.00 34.05 ? 215 GLU A C   1 
ATOM   1712 O O   . GLU A 1 215 ? 19.059 69.290 108.592 1.00 35.57 ? 215 GLU A O   1 
ATOM   1713 C CB  . GLU A 1 215 ? 18.494 67.341 110.842 1.00 30.73 ? 215 GLU A CB  1 
ATOM   1714 C CG  . GLU A 1 215 ? 17.253 68.209 110.820 1.00 35.02 ? 215 GLU A CG  1 
ATOM   1715 C CD  . GLU A 1 215 ? 16.061 67.512 110.179 1.00 34.65 ? 215 GLU A CD  1 
ATOM   1716 O OE1 . GLU A 1 215 ? 15.030 68.183 109.973 1.00 39.42 ? 215 GLU A OE1 1 
ATOM   1717 O OE2 . GLU A 1 215 ? 16.154 66.297 109.893 1.00 32.34 ? 215 GLU A OE2 1 
ATOM   1718 N N   . ALA A 1 216 ? 21.063 68.264 108.748 1.00 34.85 ? 216 ALA A N   1 
ATOM   1719 C CA  . ALA A 1 216 ? 21.837 69.394 108.242 1.00 34.89 ? 216 ALA A CA  1 
ATOM   1720 C C   . ALA A 1 216 ? 22.595 69.134 106.937 1.00 35.79 ? 216 ALA A C   1 
ATOM   1721 O O   . ALA A 1 216 ? 22.892 70.070 106.199 1.00 36.63 ? 216 ALA A O   1 
ATOM   1722 C CB  . ALA A 1 216 ? 22.816 69.860 109.317 1.00 35.62 ? 216 ALA A CB  1 
ATOM   1723 N N   . PHE A 1 217 ? 22.921 67.871 106.661 1.00 34.67 ? 217 PHE A N   1 
ATOM   1724 C CA  . PHE A 1 217 ? 23.660 67.500 105.447 1.00 32.84 ? 217 PHE A CA  1 
ATOM   1725 C C   . PHE A 1 217 ? 22.892 66.460 104.629 1.00 32.13 ? 217 PHE A C   1 
ATOM   1726 O O   . PHE A 1 217 ? 22.189 65.621 105.187 1.00 32.20 ? 217 PHE A O   1 
ATOM   1727 C CB  . PHE A 1 217 ? 25.035 66.909 105.809 1.00 30.22 ? 217 PHE A CB  1 
ATOM   1728 C CG  . PHE A 1 217 ? 26.071 67.932 106.202 1.00 29.72 ? 217 PHE A CG  1 
ATOM   1729 C CD1 . PHE A 1 217 ? 26.965 68.428 105.260 1.00 28.96 ? 217 PHE A CD1 1 
ATOM   1730 C CD2 . PHE A 1 217 ? 26.179 68.369 107.521 1.00 28.24 ? 217 PHE A CD2 1 
ATOM   1731 C CE1 . PHE A 1 217 ? 27.958 69.341 105.626 1.00 30.18 ? 217 PHE A CE1 1 
ATOM   1732 C CE2 . PHE A 1 217 ? 27.164 69.279 107.898 1.00 31.74 ? 217 PHE A CE2 1 
ATOM   1733 C CZ  . PHE A 1 217 ? 28.058 69.764 106.946 1.00 28.50 ? 217 PHE A CZ  1 
ATOM   1734 N N   . ARG A 1 218 ? 23.055 66.509 103.309 1.00 31.36 ? 218 ARG A N   1 
ATOM   1735 C CA  . ARG A 1 218 ? 22.395 65.578 102.394 1.00 33.34 ? 218 ARG A CA  1 
ATOM   1736 C C   . ARG A 1 218 ? 22.951 64.153 102.553 1.00 32.48 ? 218 ARG A C   1 
ATOM   1737 O O   . ARG A 1 218 ? 22.194 63.178 102.609 1.00 29.78 ? 218 ARG A O   1 
ATOM   1738 C CB  . ARG A 1 218 ? 22.605 66.034 100.941 1.00 37.06 ? 218 ARG A CB  1 
ATOM   1739 C CG  . ARG A 1 218 ? 21.634 65.450 99.918  1.00 39.02 ? 218 ARG A CG  1 
ATOM   1740 C CD  . ARG A 1 218 ? 21.553 63.937 99.991  1.00 49.06 ? 218 ARG A CD  1 
ATOM   1741 N NE  . ARG A 1 218 ? 20.460 63.377 99.192  1.00 51.48 ? 218 ARG A NE  1 
ATOM   1742 C CZ  . ARG A 1 218 ? 20.019 62.126 99.307  1.00 54.28 ? 218 ARG A CZ  1 
ATOM   1743 N NH1 . ARG A 1 218 ? 20.574 61.305 100.190 1.00 57.10 ? 218 ARG A NH1 1 
ATOM   1744 N NH2 . ARG A 1 218 ? 19.024 61.693 98.541  1.00 56.25 ? 218 ARG A NH2 1 
ATOM   1745 N N   . TYR A 1 219 ? 24.273 64.042 102.608 1.00 28.68 ? 219 TYR A N   1 
ATOM   1746 C CA  . TYR A 1 219 ? 24.920 62.743 102.740 1.00 29.48 ? 219 TYR A CA  1 
ATOM   1747 C C   . TYR A 1 219 ? 25.634 62.602 104.069 1.00 27.06 ? 219 TYR A C   1 
ATOM   1748 O O   . TYR A 1 219 ? 26.542 63.373 104.382 1.00 27.90 ? 219 TYR A O   1 
ATOM   1749 C CB  . TYR A 1 219 ? 25.921 62.535 101.614 1.00 29.52 ? 219 TYR A CB  1 
ATOM   1750 C CG  . TYR A 1 219 ? 25.310 62.655 100.247 1.00 36.57 ? 219 TYR A CG  1 
ATOM   1751 C CD1 . TYR A 1 219 ? 25.478 63.814 99.486  1.00 38.30 ? 219 TYR A CD1 1 
ATOM   1752 C CD2 . TYR A 1 219 ? 24.543 61.618 99.719  1.00 38.12 ? 219 TYR A CD2 1 
ATOM   1753 C CE1 . TYR A 1 219 ? 24.893 63.937 98.227  1.00 41.73 ? 219 TYR A CE1 1 
ATOM   1754 C CE2 . TYR A 1 219 ? 23.955 61.728 98.465  1.00 42.74 ? 219 TYR A CE2 1 
ATOM   1755 C CZ  . TYR A 1 219 ? 24.134 62.887 97.725  1.00 42.41 ? 219 TYR A CZ  1 
ATOM   1756 O OH  . TYR A 1 219 ? 23.562 62.980 96.480  1.00 47.39 ? 219 TYR A OH  1 
ATOM   1757 N N   . VAL A 1 220 ? 25.213 61.614 104.849 1.00 25.74 ? 220 VAL A N   1 
ATOM   1758 C CA  . VAL A 1 220 ? 25.816 61.364 106.146 1.00 22.74 ? 220 VAL A CA  1 
ATOM   1759 C C   . VAL A 1 220 ? 26.155 59.885 106.193 1.00 25.43 ? 220 VAL A C   1 
ATOM   1760 O O   . VAL A 1 220 ? 25.296 59.032 106.004 1.00 27.30 ? 220 VAL A O   1 
ATOM   1761 C CB  . VAL A 1 220 ? 24.850 61.737 107.277 1.00 27.07 ? 220 VAL A CB  1 
ATOM   1762 C CG1 . VAL A 1 220 ? 25.505 61.483 108.643 1.00 22.31 ? 220 VAL A CG1 1 
ATOM   1763 C CG2 . VAL A 1 220 ? 24.452 63.199 107.134 1.00 24.26 ? 220 VAL A CG2 1 
ATOM   1764 N N   . ARG A 1 221 ? 27.423 59.587 106.431 1.00 26.31 ? 221 ARG A N   1 
ATOM   1765 C CA  . ARG A 1 221 ? 27.888 58.206 106.447 1.00 26.35 ? 221 ARG A CA  1 
ATOM   1766 C C   . ARG A 1 221 ? 28.656 57.851 107.710 1.00 24.04 ? 221 ARG A C   1 
ATOM   1767 O O   . ARG A 1 221 ? 29.744 58.364 107.944 1.00 21.09 ? 221 ARG A O   1 
ATOM   1768 C CB  . ARG A 1 221 ? 28.787 57.968 105.231 1.00 30.14 ? 221 ARG A CB  1 
ATOM   1769 C CG  . ARG A 1 221 ? 28.107 57.362 104.005 1.00 38.20 ? 221 ARG A CG  1 
ATOM   1770 C CD  . ARG A 1 221 ? 26.784 57.996 103.692 1.00 43.60 ? 221 ARG A CD  1 
ATOM   1771 N NE  . ARG A 1 221 ? 26.258 57.565 102.401 1.00 47.10 ? 221 ARG A NE  1 
ATOM   1772 C CZ  . ARG A 1 221 ? 25.008 57.781 102.002 1.00 49.88 ? 221 ARG A CZ  1 
ATOM   1773 N NH1 . ARG A 1 221 ? 24.607 57.364 100.809 1.00 49.32 ? 221 ARG A NH1 1 
ATOM   1774 N NH2 . ARG A 1 221 ? 24.150 58.399 102.808 1.00 50.66 ? 221 ARG A NH2 1 
ATOM   1775 N N   . SER A 1 222 ? 28.083 56.963 108.514 1.00 21.02 ? 222 SER A N   1 
ATOM   1776 C CA  . SER A 1 222 ? 28.727 56.519 109.732 1.00 20.98 ? 222 SER A CA  1 
ATOM   1777 C C   . SER A 1 222 ? 29.841 55.519 109.449 1.00 20.10 ? 222 SER A C   1 
ATOM   1778 O O   . SER A 1 222 ? 29.753 54.723 108.520 1.00 20.57 ? 222 SER A O   1 
ATOM   1779 C CB  . SER A 1 222 ? 27.708 55.844 110.656 1.00 22.22 ? 222 SER A CB  1 
ATOM   1780 O OG  . SER A 1 222 ? 27.005 56.802 111.438 1.00 30.12 ? 222 SER A OG  1 
ATOM   1781 N N   . TYR A 1 223 ? 30.903 55.582 110.240 1.00 19.44 ? 223 TYR A N   1 
ATOM   1782 C CA  . TYR A 1 223 ? 31.971 54.594 110.140 1.00 19.31 ? 223 TYR A CA  1 
ATOM   1783 C C   . TYR A 1 223 ? 32.449 54.359 111.568 1.00 19.30 ? 223 TYR A C   1 
ATOM   1784 O O   . TYR A 1 223 ? 32.256 55.205 112.437 1.00 19.51 ? 223 TYR A O   1 
ATOM   1785 C CB  . TYR A 1 223 ? 33.113 55.018 109.191 1.00 20.16 ? 223 TYR A CB  1 
ATOM   1786 C CG  . TYR A 1 223 ? 33.938 56.233 109.552 1.00 21.78 ? 223 TYR A CG  1 
ATOM   1787 C CD1 . TYR A 1 223 ? 33.498 57.523 109.245 1.00 21.27 ? 223 TYR A CD1 1 
ATOM   1788 C CD2 . TYR A 1 223 ? 35.213 56.085 110.107 1.00 18.71 ? 223 TYR A CD2 1 
ATOM   1789 C CE1 . TYR A 1 223 ? 34.323 58.645 109.474 1.00 21.53 ? 223 TYR A CE1 1 
ATOM   1790 C CE2 . TYR A 1 223 ? 36.037 57.184 110.339 1.00 17.14 ? 223 TYR A CE2 1 
ATOM   1791 C CZ  . TYR A 1 223 ? 35.589 58.462 110.021 1.00 20.98 ? 223 TYR A CZ  1 
ATOM   1792 O OH  . TYR A 1 223 ? 36.409 59.537 110.284 1.00 16.55 ? 223 TYR A OH  1 
ATOM   1793 N N   . LYS A 1 224 ? 33.043 53.204 111.831 1.00 18.79 ? 224 LYS A N   1 
ATOM   1794 C CA  . LYS A 1 224 ? 33.484 52.919 113.194 1.00 20.11 ? 224 LYS A CA  1 
ATOM   1795 C C   . LYS A 1 224 ? 34.838 52.256 113.244 1.00 18.85 ? 224 LYS A C   1 
ATOM   1796 O O   . LYS A 1 224 ? 35.322 51.722 112.244 1.00 17.48 ? 224 LYS A O   1 
ATOM   1797 C CB  . LYS A 1 224 ? 32.471 52.013 113.895 1.00 20.51 ? 224 LYS A CB  1 
ATOM   1798 C CG  . LYS A 1 224 ? 32.276 50.673 113.204 1.00 24.08 ? 224 LYS A CG  1 
ATOM   1799 C CD  . LYS A 1 224 ? 31.276 49.815 113.956 1.00 29.61 ? 224 LYS A CD  1 
ATOM   1800 C CE  . LYS A 1 224 ? 31.226 48.390 113.399 1.00 38.64 ? 224 LYS A CE  1 
ATOM   1801 N NZ  . LYS A 1 224 ? 32.556 47.691 113.438 1.00 34.54 ? 224 LYS A NZ  1 
ATOM   1802 N N   . ASN A 1 225 ? 35.441 52.294 114.421 1.00 17.04 ? 225 ASN A N   1 
ATOM   1803 C CA  . ASN A 1 225 ? 36.745 51.674 114.624 1.00 16.98 ? 225 ASN A CA  1 
ATOM   1804 C C   . ASN A 1 225 ? 36.930 51.498 116.117 1.00 19.76 ? 225 ASN A C   1 
ATOM   1805 O O   . ASN A 1 225 ? 36.498 52.335 116.910 1.00 17.22 ? 225 ASN A O   1 
ATOM   1806 C CB  . ASN A 1 225 ? 37.876 52.553 114.064 1.00 14.55 ? 225 ASN A CB  1 
ATOM   1807 C CG  . ASN A 1 225 ? 39.155 51.754 113.776 1.00 19.00 ? 225 ASN A CG  1 
ATOM   1808 O OD1 . ASN A 1 225 ? 39.138 50.526 113.752 1.00 19.24 ? 225 ASN A OD1 1 
ATOM   1809 N ND2 . ASN A 1 225 ? 40.251 52.450 113.546 1.00 18.13 ? 225 ASN A ND2 1 
ATOM   1810 N N   . HIS A 1 226 ? 37.554 50.387 116.487 1.00 18.85 ? 226 HIS A N   1 
ATOM   1811 C CA  . HIS A 1 226 ? 37.846 50.086 117.876 1.00 21.21 ? 226 HIS A CA  1 
ATOM   1812 C C   . HIS A 1 226 ? 39.069 50.907 118.281 1.00 20.22 ? 226 HIS A C   1 
ATOM   1813 O O   . HIS A 1 226 ? 40.064 50.905 117.570 1.00 20.64 ? 226 HIS A O   1 
ATOM   1814 C CB  . HIS A 1 226 ? 38.144 48.589 118.017 1.00 22.91 ? 226 HIS A CB  1 
ATOM   1815 C CG  . HIS A 1 226 ? 38.874 48.236 119.276 1.00 28.45 ? 226 HIS A CG  1 
ATOM   1816 N ND1 . HIS A 1 226 ? 40.223 47.950 119.302 1.00 35.23 ? 226 HIS A ND1 1 
ATOM   1817 C CD2 . HIS A 1 226 ? 38.447 48.145 120.553 1.00 26.40 ? 226 HIS A CD2 1 
ATOM   1818 C CE1 . HIS A 1 226 ? 40.593 47.695 120.544 1.00 29.21 ? 226 HIS A CE1 1 
ATOM   1819 N NE2 . HIS A 1 226 ? 39.531 47.807 121.322 1.00 31.31 ? 226 HIS A NE2 1 
ATOM   1820 N N   . ILE A 1 227 ? 38.989 51.625 119.402 1.00 18.47 ? 227 ILE A N   1 
ATOM   1821 C CA  . ILE A 1 227 ? 40.124 52.431 119.872 1.00 17.75 ? 227 ILE A CA  1 
ATOM   1822 C C   . ILE A 1 227 ? 40.657 51.710 121.115 1.00 17.16 ? 227 ILE A C   1 
ATOM   1823 O O   . ILE A 1 227 ? 40.064 51.790 122.201 1.00 16.82 ? 227 ILE A O   1 
ATOM   1824 C CB  . ILE A 1 227 ? 39.679 53.868 120.233 1.00 19.43 ? 227 ILE A CB  1 
ATOM   1825 C CG1 . ILE A 1 227 ? 38.817 54.453 119.113 1.00 17.47 ? 227 ILE A CG1 1 
ATOM   1826 C CG2 . ILE A 1 227 ? 40.903 54.749 120.453 1.00 19.20 ? 227 ILE A CG2 1 
ATOM   1827 C CD1 . ILE A 1 227 ? 39.507 54.515 117.704 1.00 16.80 ? 227 ILE A CD1 1 
ATOM   1828 N N   . PRO A 1 228 ? 41.780 50.992 120.964 1.00 17.88 ? 228 PRO A N   1 
ATOM   1829 C CA  . PRO A 1 228 ? 42.446 50.208 122.008 1.00 19.04 ? 228 PRO A CA  1 
ATOM   1830 C C   . PRO A 1 228 ? 42.497 50.845 123.384 1.00 17.61 ? 228 PRO A C   1 
ATOM   1831 O O   . PRO A 1 228 ? 42.059 50.246 124.365 1.00 15.81 ? 228 PRO A O   1 
ATOM   1832 C CB  . PRO A 1 228 ? 43.845 49.976 121.430 1.00 20.13 ? 228 PRO A CB  1 
ATOM   1833 C CG  . PRO A 1 228 ? 43.610 49.989 119.956 1.00 18.17 ? 228 PRO A CG  1 
ATOM   1834 C CD  . PRO A 1 228 ? 42.693 51.176 119.818 1.00 18.78 ? 228 PRO A CD  1 
ATOM   1835 N N   . GLY A 1 229 ? 43.042 52.054 123.434 1.00 17.00 ? 229 GLY A N   1 
ATOM   1836 C CA  . GLY A 1 229 ? 43.189 52.765 124.685 1.00 20.58 ? 229 GLY A CA  1 
ATOM   1837 C C   . GLY A 1 229 ? 41.894 53.171 125.370 1.00 22.18 ? 229 GLY A C   1 
ATOM   1838 O O   . GLY A 1 229 ? 41.911 53.480 126.566 1.00 19.78 ? 229 GLY A O   1 
ATOM   1839 N N   . PHE A 1 230 ? 40.789 53.202 124.626 1.00 19.62 ? 230 PHE A N   1 
ATOM   1840 C CA  . PHE A 1 230 ? 39.482 53.559 125.209 1.00 20.26 ? 230 PHE A CA  1 
ATOM   1841 C C   . PHE A 1 230 ? 38.696 52.306 125.588 1.00 17.94 ? 230 PHE A C   1 
ATOM   1842 O O   . PHE A 1 230 ? 37.721 52.391 126.331 1.00 19.85 ? 230 PHE A O   1 
ATOM   1843 C CB  . PHE A 1 230 ? 38.591 54.337 124.228 1.00 17.79 ? 230 PHE A CB  1 
ATOM   1844 C CG  . PHE A 1 230 ? 39.136 55.677 123.790 1.00 21.35 ? 230 PHE A CG  1 
ATOM   1845 C CD1 . PHE A 1 230 ? 40.079 56.360 124.549 1.00 21.93 ? 230 PHE A CD1 1 
ATOM   1846 C CD2 . PHE A 1 230 ? 38.669 56.266 122.616 1.00 23.99 ? 230 PHE A CD2 1 
ATOM   1847 C CE1 . PHE A 1 230 ? 40.556 57.616 124.150 1.00 24.63 ? 230 PHE A CE1 1 
ATOM   1848 C CE2 . PHE A 1 230 ? 39.132 57.518 122.198 1.00 22.28 ? 230 PHE A CE2 1 
ATOM   1849 C CZ  . PHE A 1 230 ? 40.083 58.199 122.973 1.00 22.95 ? 230 PHE A CZ  1 
ATOM   1850 N N   . PHE A 1 231 ? 39.129 51.158 125.076 1.00 18.22 ? 231 PHE A N   1 
ATOM   1851 C CA  . PHE A 1 231 ? 38.443 49.882 125.293 1.00 17.82 ? 231 PHE A CA  1 
ATOM   1852 C C   . PHE A 1 231 ? 37.015 50.024 124.781 1.00 19.17 ? 231 PHE A C   1 
ATOM   1853 O O   . PHE A 1 231 ? 36.073 49.469 125.340 1.00 17.93 ? 231 PHE A O   1 
ATOM   1854 C CB  . PHE A 1 231 ? 38.444 49.512 126.773 1.00 15.96 ? 231 PHE A CB  1 
ATOM   1855 C CG  . PHE A 1 231 ? 39.810 49.183 127.290 1.00 17.09 ? 231 PHE A CG  1 
ATOM   1856 C CD1 . PHE A 1 231 ? 40.671 50.197 127.700 1.00 16.51 ? 231 PHE A CD1 1 
ATOM   1857 C CD2 . PHE A 1 231 ? 40.266 47.870 127.299 1.00 19.03 ? 231 PHE A CD2 1 
ATOM   1858 C CE1 . PHE A 1 231 ? 41.969 49.905 128.111 1.00 16.42 ? 231 PHE A CE1 1 
ATOM   1859 C CE2 . PHE A 1 231 ? 41.572 47.571 127.709 1.00 14.60 ? 231 PHE A CE2 1 
ATOM   1860 C CZ  . PHE A 1 231 ? 42.418 48.599 128.116 1.00 10.81 ? 231 PHE A CZ  1 
ATOM   1861 N N   . LEU A 1 232 ? 36.869 50.760 123.686 1.00 18.76 ? 232 LEU A N   1 
ATOM   1862 C CA  . LEU A 1 232 ? 35.548 51.022 123.138 1.00 20.39 ? 232 LEU A CA  1 
ATOM   1863 C C   . LEU A 1 232 ? 35.525 51.082 121.621 1.00 25.11 ? 232 LEU A C   1 
ATOM   1864 O O   . LEU A 1 232 ? 36.509 51.452 120.973 1.00 22.80 ? 232 LEU A O   1 
ATOM   1865 C CB  . LEU A 1 232 ? 35.043 52.368 123.653 1.00 22.93 ? 232 LEU A CB  1 
ATOM   1866 C CG  . LEU A 1 232 ? 34.097 52.652 124.825 1.00 28.48 ? 232 LEU A CG  1 
ATOM   1867 C CD1 . LEU A 1 232 ? 33.805 51.439 125.673 1.00 26.95 ? 232 LEU A CD1 1 
ATOM   1868 C CD2 . LEU A 1 232 ? 34.695 53.783 125.624 1.00 27.25 ? 232 LEU A CD2 1 
ATOM   1869 N N   . ASN A 1 233 ? 34.368 50.748 121.067 1.00 21.68 ? 233 ASN A N   1 
ATOM   1870 C CA  . ASN A 1 233 ? 34.156 50.826 119.644 1.00 23.65 ? 233 ASN A CA  1 
ATOM   1871 C C   . ASN A 1 233 ? 33.655 52.261 119.474 1.00 21.27 ? 233 ASN A C   1 
ATOM   1872 O O   . ASN A 1 233 ? 32.705 52.661 120.134 1.00 26.38 ? 233 ASN A O   1 
ATOM   1873 C CB  . ASN A 1 233 ? 33.055 49.838 119.239 1.00 30.12 ? 233 ASN A CB  1 
ATOM   1874 C CG  . ASN A 1 233 ? 33.099 49.483 117.770 1.00 37.18 ? 233 ASN A CG  1 
ATOM   1875 O OD1 . ASN A 1 233 ? 33.852 50.078 116.997 1.00 39.32 ? 233 ASN A OD1 1 
ATOM   1876 N ND2 . ASN A 1 233 ? 32.288 48.504 117.373 1.00 36.67 ? 233 ASN A ND2 1 
ATOM   1877 N N   . PHE A 1 234 ? 34.294 53.054 118.620 1.00 20.87 ? 234 PHE A N   1 
ATOM   1878 C CA  . PHE A 1 234 ? 33.832 54.417 118.438 1.00 20.04 ? 234 PHE A CA  1 
ATOM   1879 C C   . PHE A 1 234 ? 33.199 54.652 117.082 1.00 18.79 ? 234 PHE A C   1 
ATOM   1880 O O   . PHE A 1 234 ? 33.605 54.063 116.089 1.00 19.63 ? 234 PHE A O   1 
ATOM   1881 C CB  . PHE A 1 234 ? 34.983 55.412 118.646 1.00 21.57 ? 234 PHE A CB  1 
ATOM   1882 C CG  . PHE A 1 234 ? 34.897 56.149 119.942 1.00 22.15 ? 234 PHE A CG  1 
ATOM   1883 C CD1 . PHE A 1 234 ? 34.428 57.465 119.983 1.00 28.88 ? 234 PHE A CD1 1 
ATOM   1884 C CD2 . PHE A 1 234 ? 35.205 55.505 121.137 1.00 21.18 ? 234 PHE A CD2 1 
ATOM   1885 C CE1 . PHE A 1 234 ? 34.264 58.126 121.197 1.00 30.54 ? 234 PHE A CE1 1 
ATOM   1886 C CE2 . PHE A 1 234 ? 35.044 56.156 122.354 1.00 25.92 ? 234 PHE A CE2 1 
ATOM   1887 C CZ  . PHE A 1 234 ? 34.575 57.463 122.387 1.00 29.50 ? 234 PHE A CZ  1 
ATOM   1888 N N   . GLY A 1 235 ? 32.190 55.513 117.068 1.00 18.45 ? 235 GLY A N   1 
ATOM   1889 C CA  . GLY A 1 235 ? 31.510 55.869 115.843 1.00 18.46 ? 235 GLY A CA  1 
ATOM   1890 C C   . GLY A 1 235 ? 32.076 57.191 115.350 1.00 20.58 ? 235 GLY A C   1 
ATOM   1891 O O   . GLY A 1 235 ? 32.503 58.028 116.137 1.00 19.69 ? 235 GLY A O   1 
ATOM   1892 N N   . PHE A 1 236 ? 32.091 57.359 114.037 1.00 19.53 ? 236 PHE A N   1 
ATOM   1893 C CA  . PHE A 1 236 ? 32.587 58.568 113.385 1.00 19.24 ? 236 PHE A CA  1 
ATOM   1894 C C   . PHE A 1 236 ? 31.647 58.734 112.202 1.00 19.32 ? 236 PHE A C   1 
ATOM   1895 O O   . PHE A 1 236 ? 30.840 57.850 111.916 1.00 22.55 ? 236 PHE A O   1 
ATOM   1896 C CB  . PHE A 1 236 ? 33.996 58.349 112.826 1.00 16.91 ? 236 PHE A CB  1 
ATOM   1897 C CG  . PHE A 1 236 ? 35.037 58.089 113.868 1.00 16.59 ? 236 PHE A CG  1 
ATOM   1898 C CD1 . PHE A 1 236 ? 35.871 59.112 114.304 1.00 18.01 ? 236 PHE A CD1 1 
ATOM   1899 C CD2 . PHE A 1 236 ? 35.192 56.819 114.407 1.00 18.50 ? 236 PHE A CD2 1 
ATOM   1900 C CE1 . PHE A 1 236 ? 36.848 58.869 115.259 1.00 19.52 ? 236 PHE A CE1 1 
ATOM   1901 C CE2 . PHE A 1 236 ? 36.164 56.564 115.361 1.00 18.38 ? 236 PHE A CE2 1 
ATOM   1902 C CZ  . PHE A 1 236 ? 36.997 57.593 115.789 1.00 19.57 ? 236 PHE A CZ  1 
ATOM   1903 N N   . LEU A 1 237 ? 31.733 59.859 111.520 1.00 23.02 ? 237 LEU A N   1 
ATOM   1904 C CA  . LEU A 1 237 ? 30.906 60.028 110.335 1.00 23.86 ? 237 LEU A CA  1 
ATOM   1905 C C   . LEU A 1 237 ? 31.486 61.076 109.418 1.00 23.68 ? 237 LEU A C   1 
ATOM   1906 O O   . LEU A 1 237 ? 32.275 61.922 109.835 1.00 22.18 ? 237 LEU A O   1 
ATOM   1907 C CB  . LEU A 1 237 ? 29.460 60.377 110.702 1.00 26.36 ? 237 LEU A CB  1 
ATOM   1908 C CG  . LEU A 1 237 ? 29.088 61.653 111.449 1.00 24.29 ? 237 LEU A CG  1 
ATOM   1909 C CD1 . LEU A 1 237 ? 29.135 62.829 110.488 1.00 26.60 ? 237 LEU A CD1 1 
ATOM   1910 C CD2 . LEU A 1 237 ? 27.661 61.517 112.014 1.00 28.25 ? 237 LEU A CD2 1 
ATOM   1911 N N   . LEU A 1 238 ? 31.094 60.981 108.158 1.00 22.01 ? 238 LEU A N   1 
ATOM   1912 C CA  . LEU A 1 238 ? 31.511 61.905 107.119 1.00 24.71 ? 238 LEU A CA  1 
ATOM   1913 C C   . LEU A 1 238 ? 30.190 62.504 106.660 1.00 25.95 ? 238 LEU A C   1 
ATOM   1914 O O   . LEU A 1 238 ? 29.181 61.798 106.591 1.00 24.24 ? 238 LEU A O   1 
ATOM   1915 C CB  . LEU A 1 238 ? 32.172 61.133 105.970 1.00 23.99 ? 238 LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 238 ? 33.648 61.399 105.651 1.00 32.69 ? 238 LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 238 ? 34.469 61.511 106.919 1.00 24.13 ? 238 LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 238 ? 34.171 60.291 104.731 1.00 25.68 ? 238 LEU A CD2 1 
ATOM   1919 N N   . ALA A 1 239 ? 30.198 63.796 106.359 1.00 24.51 ? 239 ALA A N   1 
ATOM   1920 C CA  . ALA A 1 239 ? 28.998 64.487 105.916 1.00 27.55 ? 239 ALA A CA  1 
ATOM   1921 C C   . ALA A 1 239 ? 29.314 65.518 104.839 1.00 27.47 ? 239 ALA A C   1 
ATOM   1922 O O   . ALA A 1 239 ? 30.292 66.269 104.932 1.00 26.54 ? 239 ALA A O   1 
ATOM   1923 C CB  . ALA A 1 239 ? 28.337 65.173 107.092 1.00 26.07 ? 239 ALA A CB  1 
ATOM   1924 N N   . SER A 1 240 ? 28.470 65.563 103.823 1.00 28.87 ? 240 SER A N   1 
ATOM   1925 C CA  . SER A 1 240 ? 28.664 66.524 102.750 1.00 33.15 ? 240 SER A CA  1 
ATOM   1926 C C   . SER A 1 240 ? 27.350 66.722 102.025 1.00 33.80 ? 240 SER A C   1 
ATOM   1927 O O   . SER A 1 240 ? 26.453 65.884 102.123 1.00 31.64 ? 240 SER A O   1 
ATOM   1928 C CB  . SER A 1 240 ? 29.721 66.020 101.766 1.00 32.24 ? 240 SER A CB  1 
ATOM   1929 O OG  . SER A 1 240 ? 30.004 67.001 100.788 1.00 34.79 ? 240 SER A OG  1 
ATOM   1930 N N   . ASP A 1 241 ? 27.237 67.850 101.329 1.00 36.80 ? 241 ASP A N   1 
ATOM   1931 C CA  . ASP A 1 241 ? 26.054 68.164 100.540 1.00 39.85 ? 241 ASP A CA  1 
ATOM   1932 C C   . ASP A 1 241 ? 26.442 68.017 99.069  1.00 41.09 ? 241 ASP A C   1 
ATOM   1933 O O   . ASP A 1 241 ? 25.598 67.773 98.212  1.00 43.32 ? 241 ASP A O   1 
ATOM   1934 C CB  . ASP A 1 241 ? 25.591 69.605 100.797 1.00 40.90 ? 241 ASP A CB  1 
ATOM   1935 C CG  . ASP A 1 241 ? 24.372 69.685 101.707 1.00 42.74 ? 241 ASP A CG  1 
ATOM   1936 O OD1 . ASP A 1 241 ? 23.819 70.797 101.872 1.00 42.27 ? 241 ASP A OD1 1 
ATOM   1937 O OD2 . ASP A 1 241 ? 23.964 68.643 102.258 1.00 43.04 ? 241 ASP A OD2 1 
ATOM   1938 N N   . ALA A 1 242 ? 27.736 68.156 98.790  1.00 43.51 ? 242 ALA A N   1 
ATOM   1939 C CA  . ALA A 1 242 ? 28.257 68.081 97.427  1.00 43.15 ? 242 ALA A CA  1 
ATOM   1940 C C   . ALA A 1 242 ? 28.366 66.687 96.817  1.00 45.23 ? 242 ALA A C   1 
ATOM   1941 O O   . ALA A 1 242 ? 28.304 66.542 95.592  1.00 45.43 ? 242 ALA A O   1 
ATOM   1942 C CB  . ALA A 1 242 ? 29.610 68.771 97.363  1.00 43.93 ? 242 ALA A CB  1 
ATOM   1943 N N   . PHE A 1 243 ? 28.546 65.666 97.652  1.00 43.38 ? 243 PHE A N   1 
ATOM   1944 C CA  . PHE A 1 243 ? 28.662 64.294 97.156  1.00 43.49 ? 243 PHE A CA  1 
ATOM   1945 C C   . PHE A 1 243 ? 28.626 63.290 98.300  1.00 41.48 ? 243 PHE A C   1 
ATOM   1946 O O   . PHE A 1 243 ? 28.768 63.658 99.463  1.00 40.72 ? 243 PHE A O   1 
ATOM   1947 C CB  . PHE A 1 243 ? 29.968 64.104 96.380  1.00 43.51 ? 243 PHE A CB  1 
ATOM   1948 C CG  . PHE A 1 243 ? 31.199 64.235 97.231  1.00 47.17 ? 243 PHE A CG  1 
ATOM   1949 C CD1 . PHE A 1 243 ? 31.706 65.485 97.559  1.00 45.42 ? 243 PHE A CD1 1 
ATOM   1950 C CD2 . PHE A 1 243 ? 31.842 63.102 97.721  1.00 47.48 ? 243 PHE A CD2 1 
ATOM   1951 C CE1 . PHE A 1 243 ? 32.837 65.607 98.363  1.00 46.80 ? 243 PHE A CE1 1 
ATOM   1952 C CE2 . PHE A 1 243 ? 32.974 63.213 98.527  1.00 48.11 ? 243 PHE A CE2 1 
ATOM   1953 C CZ  . PHE A 1 243 ? 33.471 64.470 98.847  1.00 46.76 ? 243 PHE A CZ  1 
ATOM   1954 N N   . ASP A 1 244 ? 28.430 62.023 97.957  1.00 38.66 ? 244 ASP A N   1 
ATOM   1955 C CA  . ASP A 1 244 ? 28.385 60.954 98.942  1.00 35.96 ? 244 ASP A CA  1 
ATOM   1956 C C   . ASP A 1 244 ? 29.832 60.602 99.286  1.00 35.84 ? 244 ASP A C   1 
ATOM   1957 O O   . ASP A 1 244 ? 30.528 59.947 98.508  1.00 34.97 ? 244 ASP A O   1 
ATOM   1958 C CB  . ASP A 1 244 ? 27.662 59.737 98.358  1.00 35.27 ? 244 ASP A CB  1 
ATOM   1959 C CG  . ASP A 1 244 ? 27.634 58.562 99.312  1.00 34.59 ? 244 ASP A CG  1 
ATOM   1960 O OD1 . ASP A 1 244 ? 28.306 58.627 100.361 1.00 34.61 ? 244 ASP A OD1 1 
ATOM   1961 O OD2 . ASP A 1 244 ? 26.945 57.569 99.011  1.00 30.39 ? 244 ASP A OD2 1 
ATOM   1962 N N   . PRO A 1 245 ? 30.296 61.018 100.471 1.00 35.86 ? 245 PRO A N   1 
ATOM   1963 C CA  . PRO A 1 245 ? 31.666 60.760 100.921 1.00 36.69 ? 245 PRO A CA  1 
ATOM   1964 C C   . PRO A 1 245 ? 32.079 59.296 101.023 1.00 35.62 ? 245 PRO A C   1 
ATOM   1965 O O   . PRO A 1 245 ? 33.274 58.993 101.053 1.00 36.88 ? 245 PRO A O   1 
ATOM   1966 C CB  . PRO A 1 245 ? 31.716 61.477 102.264 1.00 36.75 ? 245 PRO A CB  1 
ATOM   1967 C CG  . PRO A 1 245 ? 30.335 61.262 102.775 1.00 35.98 ? 245 PRO A CG  1 
ATOM   1968 C CD  . PRO A 1 245 ? 29.491 61.579 101.570 1.00 35.47 ? 245 PRO A CD  1 
ATOM   1969 N N   . ALA A 1 246 ? 31.109 58.389 101.079 1.00 34.54 ? 246 ALA A N   1 
ATOM   1970 C CA  . ALA A 1 246 ? 31.427 56.967 101.185 1.00 35.94 ? 246 ALA A CA  1 
ATOM   1971 C C   . ALA A 1 246 ? 31.209 56.169 99.900  1.00 37.96 ? 246 ALA A C   1 
ATOM   1972 O O   . ALA A 1 246 ? 31.233 54.937 99.918  1.00 35.12 ? 246 ALA A O   1 
ATOM   1973 C CB  . ALA A 1 246 ? 30.629 56.341 102.316 1.00 37.79 ? 246 ALA A CB  1 
ATOM   1974 N N   . ALA A 1 247 ? 30.985 56.860 98.788  1.00 37.91 ? 247 ALA A N   1 
ATOM   1975 C CA  . ALA A 1 247 ? 30.802 56.169 97.514  1.00 38.14 ? 247 ALA A CA  1 
ATOM   1976 C C   . ALA A 1 247 ? 32.196 56.052 96.903  1.00 36.84 ? 247 ALA A C   1 
ATOM   1977 O O   . ALA A 1 247 ? 32.555 56.800 95.996  1.00 39.19 ? 247 ALA A O   1 
ATOM   1978 C CB  . ALA A 1 247 ? 29.874 56.973 96.599  1.00 38.57 ? 247 ALA A CB  1 
ATOM   1979 N N   . PHE A 1 248 ? 32.975 55.107 97.419  1.00 35.32 ? 248 PHE A N   1 
ATOM   1980 C CA  . PHE A 1 248 ? 34.347 54.892 96.978  1.00 35.01 ? 248 PHE A CA  1 
ATOM   1981 C C   . PHE A 1 248 ? 34.487 54.262 95.603  1.00 36.24 ? 248 PHE A C   1 
ATOM   1982 O O   . PHE A 1 248 ? 33.963 53.173 95.345  1.00 39.12 ? 248 PHE A O   1 
ATOM   1983 C CB  . PHE A 1 248 ? 35.087 54.022 97.989  1.00 31.93 ? 248 PHE A CB  1 
ATOM   1984 C CG  . PHE A 1 248 ? 35.044 54.557 99.382  1.00 30.36 ? 248 PHE A CG  1 
ATOM   1985 C CD1 . PHE A 1 248 ? 34.309 53.904 100.365 1.00 30.02 ? 248 PHE A CD1 1 
ATOM   1986 C CD2 . PHE A 1 248 ? 35.718 55.719 99.708  1.00 30.85 ? 248 PHE A CD2 1 
ATOM   1987 C CE1 . PHE A 1 248 ? 34.249 54.413 101.668 1.00 29.00 ? 248 PHE A CE1 1 
ATOM   1988 C CE2 . PHE A 1 248 ? 35.665 56.238 101.004 1.00 34.30 ? 248 PHE A CE2 1 
ATOM   1989 C CZ  . PHE A 1 248 ? 34.926 55.578 101.986 1.00 27.70 ? 248 PHE A CZ  1 
ATOM   1990 N N   . SER A 1 249 ? 35.192 54.954 94.718  1.00 37.52 ? 249 SER A N   1 
ATOM   1991 C CA  . SER A 1 249 ? 35.422 54.436 93.376  1.00 40.11 ? 249 SER A CA  1 
ATOM   1992 C C   . SER A 1 249 ? 36.703 53.606 93.436  1.00 39.69 ? 249 SER A C   1 
ATOM   1993 O O   . SER A 1 249 ? 37.675 53.985 94.100  1.00 36.51 ? 249 SER A O   1 
ATOM   1994 C CB  . SER A 1 249 ? 35.562 55.586 92.374  1.00 43.93 ? 249 SER A CB  1 
ATOM   1995 O OG  . SER A 1 249 ? 34.371 56.357 92.330  1.00 45.19 ? 249 SER A OG  1 
ATOM   1996 N N   . GLU A 1 250 ? 36.688 52.467 92.753  1.00 39.88 ? 250 GLU A N   1 
ATOM   1997 C CA  . GLU A 1 250 ? 37.825 51.555 92.734  1.00 41.25 ? 250 GLU A CA  1 
ATOM   1998 C C   . GLU A 1 250 ? 39.164 52.274 92.556  1.00 40.32 ? 250 GLU A C   1 
ATOM   1999 O O   . GLU A 1 250 ? 39.310 53.121 91.679  1.00 39.71 ? 250 GLU A O   1 
ATOM   2000 C CB  . GLU A 1 250 ? 37.618 50.508 91.628  1.00 43.81 ? 250 GLU A CB  1 
ATOM   2001 C CG  . GLU A 1 250 ? 38.610 49.348 91.633  1.00 50.80 ? 250 GLU A CG  1 
ATOM   2002 C CD  . GLU A 1 250 ? 38.183 48.199 90.712  1.00 55.87 ? 250 GLU A CD  1 
ATOM   2003 O OE1 . GLU A 1 250 ? 38.000 48.428 89.495  1.00 58.96 ? 250 GLU A OE1 1 
ATOM   2004 O OE2 . GLU A 1 250 ? 38.030 47.060 91.206  1.00 57.88 ? 250 GLU A OE2 1 
ATOM   2005 N N   . GLY A 1 251 ? 40.115 51.949 93.433  1.00 38.58 ? 251 GLY A N   1 
ATOM   2006 C CA  . GLY A 1 251 ? 41.454 52.516 93.383  1.00 34.08 ? 251 GLY A CA  1 
ATOM   2007 C C   . GLY A 1 251 ? 41.698 53.972 93.749  1.00 31.34 ? 251 GLY A C   1 
ATOM   2008 O O   . GLY A 1 251 ? 42.852 54.376 93.902  1.00 30.13 ? 251 GLY A O   1 
ATOM   2009 N N   . VAL A 1 252 ? 40.639 54.761 93.900  1.00 31.20 ? 252 VAL A N   1 
ATOM   2010 C CA  . VAL A 1 252 ? 40.785 56.188 94.206  1.00 29.08 ? 252 VAL A CA  1 
ATOM   2011 C C   . VAL A 1 252 ? 41.445 56.535 95.535  1.00 30.31 ? 252 VAL A C   1 
ATOM   2012 O O   . VAL A 1 252 ? 42.364 57.359 95.580  1.00 29.73 ? 252 VAL A O   1 
ATOM   2013 C CB  . VAL A 1 252 ? 39.415 56.905 94.132  1.00 32.42 ? 252 VAL A CB  1 
ATOM   2014 C CG1 . VAL A 1 252 ? 39.570 58.383 94.449  1.00 28.25 ? 252 VAL A CG1 1 
ATOM   2015 C CG2 . VAL A 1 252 ? 38.823 56.729 92.741  1.00 32.54 ? 252 VAL A CG2 1 
ATOM   2016 N N   . ILE A 1 253 ? 40.990 55.925 96.626  1.00 29.35 ? 253 ILE A N   1 
ATOM   2017 C CA  . ILE A 1 253 ? 41.584 56.239 97.920  1.00 28.40 ? 253 ILE A CA  1 
ATOM   2018 C C   . ILE A 1 253 ? 43.054 55.842 97.928  1.00 26.62 ? 253 ILE A C   1 
ATOM   2019 O O   . ILE A 1 253 ? 43.907 56.599 98.394  1.00 25.24 ? 253 ILE A O   1 
ATOM   2020 C CB  . ILE A 1 253 ? 40.835 55.527 99.075  1.00 28.01 ? 253 ILE A CB  1 
ATOM   2021 C CG1 . ILE A 1 253 ? 39.394 56.058 99.158  1.00 26.51 ? 253 ILE A CG1 1 
ATOM   2022 C CG2 . ILE A 1 253 ? 41.581 55.743 100.399 1.00 28.23 ? 253 ILE A CG2 1 
ATOM   2023 C CD1 . ILE A 1 253 ? 39.289 57.562 99.391  1.00 23.67 ? 253 ILE A CD1 1 
ATOM   2024 N N   . GLU A 1 254 ? 43.342 54.654 97.396  1.00 30.58 ? 254 GLU A N   1 
ATOM   2025 C CA  . GLU A 1 254 ? 44.708 54.139 97.324  1.00 30.22 ? 254 GLU A CA  1 
ATOM   2026 C C   . GLU A 1 254 ? 45.616 55.090 96.545  1.00 31.31 ? 254 GLU A C   1 
ATOM   2027 O O   . GLU A 1 254 ? 46.732 55.382 96.967  1.00 32.32 ? 254 GLU A O   1 
ATOM   2028 C CB  . GLU A 1 254 ? 44.716 52.764 96.651  1.00 33.80 ? 254 GLU A CB  1 
ATOM   2029 C CG  . GLU A 1 254 ? 46.110 52.214 96.369  1.00 37.74 ? 254 GLU A CG  1 
ATOM   2030 C CD  . GLU A 1 254 ? 46.856 51.805 97.625  1.00 44.72 ? 254 GLU A CD  1 
ATOM   2031 O OE1 . GLU A 1 254 ? 48.103 51.935 97.640  1.00 48.26 ? 254 GLU A OE1 1 
ATOM   2032 O OE2 . GLU A 1 254 ? 46.205 51.342 98.592  1.00 44.85 ? 254 GLU A OE2 1 
ATOM   2033 N N   . ALA A 1 255 ? 45.131 55.571 95.407  1.00 30.85 ? 255 ALA A N   1 
ATOM   2034 C CA  . ALA A 1 255 ? 45.908 56.481 94.571  1.00 32.36 ? 255 ALA A CA  1 
ATOM   2035 C C   . ALA A 1 255 ? 46.251 57.769 95.323  1.00 29.64 ? 255 ALA A C   1 
ATOM   2036 O O   . ALA A 1 255 ? 47.371 58.266 95.242  1.00 31.44 ? 255 ALA A O   1 
ATOM   2037 C CB  . ALA A 1 255 ? 45.126 56.806 93.279  1.00 29.11 ? 255 ALA A CB  1 
ATOM   2038 N N   . ARG A 1 256 ? 45.290 58.296 96.073  1.00 30.33 ? 256 ARG A N   1 
ATOM   2039 C CA  . ARG A 1 256 ? 45.510 59.532 96.815  1.00 28.73 ? 256 ARG A CA  1 
ATOM   2040 C C   . ARG A 1 256 ? 46.525 59.382 97.949  1.00 30.19 ? 256 ARG A C   1 
ATOM   2041 O O   . ARG A 1 256 ? 47.363 60.261 98.176  1.00 27.54 ? 256 ARG A O   1 
ATOM   2042 C CB  . ARG A 1 256 ? 44.169 60.043 97.328  1.00 31.16 ? 256 ARG A CB  1 
ATOM   2043 C CG  . ARG A 1 256 ? 43.214 60.364 96.190  1.00 28.23 ? 256 ARG A CG  1 
ATOM   2044 C CD  . ARG A 1 256 ? 41.853 60.808 96.669  1.00 32.73 ? 256 ARG A CD  1 
ATOM   2045 N NE  . ARG A 1 256 ? 41.059 61.367 95.573  1.00 34.98 ? 256 ARG A NE  1 
ATOM   2046 C CZ  . ARG A 1 256 ? 39.779 61.710 95.670  1.00 39.07 ? 256 ARG A CZ  1 
ATOM   2047 N NH1 . ARG A 1 256 ? 39.127 61.554 96.822  1.00 30.71 ? 256 ARG A NH1 1 
ATOM   2048 N NH2 . ARG A 1 256 ? 39.145 62.203 94.610  1.00 34.34 ? 256 ARG A NH2 1 
ATOM   2049 N N   . ILE A 1 257 ? 46.465 58.257 98.652  1.00 31.44 ? 257 ILE A N   1 
ATOM   2050 C CA  . ILE A 1 257 ? 47.404 58.012 99.732  1.00 31.62 ? 257 ILE A CA  1 
ATOM   2051 C C   . ILE A 1 257 ? 48.823 58.040 99.153  1.00 34.01 ? 257 ILE A C   1 
ATOM   2052 O O   . ILE A 1 257 ? 49.710 58.712 99.687  1.00 30.72 ? 257 ILE A O   1 
ATOM   2053 C CB  . ILE A 1 257 ? 47.136 56.643 100.395 1.00 31.25 ? 257 ILE A CB  1 
ATOM   2054 C CG1 . ILE A 1 257 ? 45.747 56.653 101.054 1.00 29.92 ? 257 ILE A CG1 1 
ATOM   2055 C CG2 . ILE A 1 257 ? 48.235 56.335 101.416 1.00 33.10 ? 257 ILE A CG2 1 
ATOM   2056 C CD1 . ILE A 1 257 ? 45.315 55.307 101.630 1.00 22.04 ? 257 ILE A CD1 1 
ATOM   2057 N N   . ARG A 1 258 ? 49.025 57.321 98.051  1.00 36.76 ? 258 ARG A N   1 
ATOM   2058 C CA  . ARG A 1 258 ? 50.335 57.264 97.401  1.00 41.20 ? 258 ARG A CA  1 
ATOM   2059 C C   . ARG A 1 258 ? 50.762 58.631 96.883  1.00 41.29 ? 258 ARG A C   1 
ATOM   2060 O O   . ARG A 1 258 ? 51.883 59.071 97.113  1.00 42.07 ? 258 ARG A O   1 
ATOM   2061 C CB  . ARG A 1 258 ? 50.315 56.257 96.245  1.00 46.15 ? 258 ARG A CB  1 
ATOM   2062 C CG  . ARG A 1 258 ? 50.307 54.808 96.708  1.00 54.10 ? 258 ARG A CG  1 
ATOM   2063 C CD  . ARG A 1 258 ? 50.213 53.842 95.547  1.00 58.98 ? 258 ARG A CD  1 
ATOM   2064 N NE  . ARG A 1 258 ? 49.026 54.103 94.737  1.00 66.91 ? 258 ARG A NE  1 
ATOM   2065 C CZ  . ARG A 1 258 ? 48.580 53.291 93.784  1.00 69.83 ? 258 ARG A CZ  1 
ATOM   2066 N NH1 . ARG A 1 258 ? 49.225 52.160 93.523  1.00 71.80 ? 258 ARG A NH1 1 
ATOM   2067 N NH2 . ARG A 1 258 ? 47.492 53.610 93.092  1.00 69.77 ? 258 ARG A NH2 1 
ATOM   2068 N N   . GLU A 1 259 ? 49.853 59.301 96.192  1.00 40.53 ? 259 GLU A N   1 
ATOM   2069 C CA  . GLU A 1 259 ? 50.130 60.620 95.647  1.00 42.23 ? 259 GLU A CA  1 
ATOM   2070 C C   . GLU A 1 259 ? 50.498 61.654 96.718  1.00 40.69 ? 259 GLU A C   1 
ATOM   2071 O O   . GLU A 1 259 ? 51.362 62.502 96.499  1.00 38.54 ? 259 GLU A O   1 
ATOM   2072 C CB  . GLU A 1 259 ? 48.913 61.090 94.865  1.00 47.24 ? 259 GLU A CB  1 
ATOM   2073 C CG  . GLU A 1 259 ? 48.997 62.499 94.355  1.00 55.68 ? 259 GLU A CG  1 
ATOM   2074 C CD  . GLU A 1 259 ? 47.860 62.807 93.410  1.00 60.66 ? 259 GLU A CD  1 
ATOM   2075 O OE1 . GLU A 1 259 ? 46.698 62.467 93.744  1.00 61.82 ? 259 GLU A OE1 1 
ATOM   2076 O OE2 . GLU A 1 259 ? 48.128 63.387 92.336  1.00 64.61 ? 259 GLU A OE2 1 
ATOM   2077 N N   . ARG A 1 260 ? 49.850 61.578 97.879  1.00 37.19 ? 260 ARG A N   1 
ATOM   2078 C CA  . ARG A 1 260 ? 50.111 62.525 98.960  1.00 33.65 ? 260 ARG A CA  1 
ATOM   2079 C C   . ARG A 1 260 ? 51.212 62.052 99.896  1.00 33.06 ? 260 ARG A C   1 
ATOM   2080 O O   . ARG A 1 260 ? 51.512 62.705 100.899 1.00 33.58 ? 260 ARG A O   1 
ATOM   2081 C CB  . ARG A 1 260 ? 48.816 62.779 99.749  1.00 33.89 ? 260 ARG A CB  1 
ATOM   2082 C CG  . ARG A 1 260 ? 47.652 63.201 98.856  1.00 32.67 ? 260 ARG A CG  1 
ATOM   2083 C CD  . ARG A 1 260 ? 46.400 63.569 99.640  1.00 33.05 ? 260 ARG A CD  1 
ATOM   2084 N NE  . ARG A 1 260 ? 45.244 63.710 98.756  1.00 30.35 ? 260 ARG A NE  1 
ATOM   2085 C CZ  . ARG A 1 260 ? 44.010 63.989 99.166  1.00 30.98 ? 260 ARG A CZ  1 
ATOM   2086 N NH1 . ARG A 1 260 ? 43.762 64.167 100.460 1.00 30.04 ? 260 ARG A NH1 1 
ATOM   2087 N NH2 . ARG A 1 260 ? 43.018 64.071 98.283  1.00 31.46 ? 260 ARG A NH2 1 
ATOM   2088 N N   . ASN A 1 261 ? 51.809 60.911 99.564  1.00 36.24 ? 261 ASN A N   1 
ATOM   2089 C CA  . ASN A 1 261 ? 52.882 60.329 100.364 1.00 36.87 ? 261 ASN A CA  1 
ATOM   2090 C C   . ASN A 1 261 ? 52.576 60.342 101.866 1.00 33.85 ? 261 ASN A C   1 
ATOM   2091 O O   . ASN A 1 261 ? 53.444 60.661 102.682 1.00 34.15 ? 261 ASN A O   1 
ATOM   2092 C CB  . ASN A 1 261 ? 54.196 61.080 100.092 1.00 41.35 ? 261 ASN A CB  1 
ATOM   2093 C CG  . ASN A 1 261 ? 54.639 60.982 98.637  1.00 46.03 ? 261 ASN A CG  1 
ATOM   2094 O OD1 . ASN A 1 261 ? 55.428 61.796 98.161  1.00 48.24 ? 261 ASN A OD1 1 
ATOM   2095 N ND2 . ASN A 1 261 ? 54.137 59.977 97.930  1.00 49.13 ? 261 ASN A ND2 1 
ATOM   2096 N N   . LEU A 1 262 ? 51.344 60.007 102.238 1.00 35.64 ? 262 LEU A N   1 
ATOM   2097 C CA  . LEU A 1 262 ? 50.970 59.976 103.652 1.00 34.34 ? 262 LEU A CA  1 
ATOM   2098 C C   . LEU A 1 262 ? 51.644 58.814 104.357 1.00 36.82 ? 262 LEU A C   1 
ATOM   2099 O O   . LEU A 1 262 ? 51.630 57.689 103.852 1.00 39.64 ? 262 LEU A O   1 
ATOM   2100 C CB  . LEU A 1 262 ? 49.462 59.782 103.833 1.00 38.57 ? 262 LEU A CB  1 
ATOM   2101 C CG  . LEU A 1 262 ? 48.442 60.842 103.444 1.00 38.42 ? 262 LEU A CG  1 
ATOM   2102 C CD1 . LEU A 1 262 ? 47.047 60.331 103.815 1.00 35.06 ? 262 LEU A CD1 1 
ATOM   2103 C CD2 . LEU A 1 262 ? 48.755 62.144 104.156 1.00 32.41 ? 262 LEU A CD2 1 
ATOM   2104 N N   . ALA A 1 263 ? 52.199 59.079 105.537 1.00 35.57 ? 263 ALA A N   1 
ATOM   2105 C CA  . ALA A 1 263 ? 52.852 58.044 106.332 1.00 35.72 ? 263 ALA A CA  1 
ATOM   2106 C C   . ALA A 1 263 ? 51.840 57.501 107.346 1.00 35.94 ? 263 ALA A C   1 
ATOM   2107 O O   . ALA A 1 263 ? 51.788 57.959 108.483 1.00 41.77 ? 263 ALA A O   1 
ATOM   2108 C CB  . ALA A 1 263 ? 54.055 58.626 107.059 1.00 33.07 ? 263 ALA A CB  1 
ATOM   2109 N N   . LEU A 1 264 ? 51.035 56.533 106.928 1.00 32.43 ? 264 LEU A N   1 
ATOM   2110 C CA  . LEU A 1 264 ? 50.025 55.944 107.798 1.00 27.75 ? 264 LEU A CA  1 
ATOM   2111 C C   . LEU A 1 264 ? 50.577 54.741 108.549 1.00 27.53 ? 264 LEU A C   1 
ATOM   2112 O O   . LEU A 1 264 ? 51.332 53.951 107.992 1.00 25.01 ? 264 LEU A O   1 
ATOM   2113 C CB  . LEU A 1 264 ? 48.826 55.504 106.966 1.00 28.67 ? 264 LEU A CB  1 
ATOM   2114 C CG  . LEU A 1 264 ? 48.201 56.588 106.086 1.00 29.99 ? 264 LEU A CG  1 
ATOM   2115 C CD1 . LEU A 1 264 ? 47.156 55.970 105.144 1.00 29.01 ? 264 LEU A CD1 1 
ATOM   2116 C CD2 . LEU A 1 264 ? 47.579 57.647 106.975 1.00 29.37 ? 264 LEU A CD2 1 
ATOM   2117 N N   . ARG A 1 265 ? 50.193 54.606 109.814 1.00 24.22 ? 265 ARG A N   1 
ATOM   2118 C CA  . ARG A 1 265 ? 50.631 53.479 110.639 1.00 24.80 ? 265 ARG A CA  1 
ATOM   2119 C C   . ARG A 1 265 ? 49.471 52.521 110.927 1.00 24.73 ? 265 ARG A C   1 
ATOM   2120 O O   . ARG A 1 265 ? 49.680 51.343 111.204 1.00 22.85 ? 265 ARG A O   1 
ATOM   2121 C CB  . ARG A 1 265 ? 51.214 53.992 111.952 1.00 22.44 ? 265 ARG A CB  1 
ATOM   2122 C CG  . ARG A 1 265 ? 52.535 54.739 111.778 1.00 25.69 ? 265 ARG A CG  1 
ATOM   2123 C CD  . ARG A 1 265 ? 52.967 55.398 113.079 1.00 27.53 ? 265 ARG A CD  1 
ATOM   2124 N NE  . ARG A 1 265 ? 53.079 54.427 114.161 1.00 34.15 ? 265 ARG A NE  1 
ATOM   2125 C CZ  . ARG A 1 265 ? 52.988 54.737 115.450 1.00 33.14 ? 265 ARG A CZ  1 
ATOM   2126 N NH1 . ARG A 1 265 ? 52.778 55.998 115.815 1.00 31.07 ? 265 ARG A NH1 1 
ATOM   2127 N NH2 . ARG A 1 265 ? 53.115 53.787 116.372 1.00 30.87 ? 265 ARG A NH2 1 
ATOM   2128 N N   . HIS A 1 266 ? 48.244 53.027 110.863 1.00 23.04 ? 266 HIS A N   1 
ATOM   2129 C CA  . HIS A 1 266 ? 47.076 52.183 111.123 1.00 23.07 ? 266 HIS A CA  1 
ATOM   2130 C C   . HIS A 1 266 ? 46.244 51.933 109.860 1.00 21.37 ? 266 HIS A C   1 
ATOM   2131 O O   . HIS A 1 266 ? 45.996 50.787 109.480 1.00 23.95 ? 266 HIS A O   1 
ATOM   2132 C CB  . HIS A 1 266 ? 46.187 52.823 112.209 1.00 22.70 ? 266 HIS A CB  1 
ATOM   2133 C CG  . HIS A 1 266 ? 44.974 52.005 112.563 1.00 20.18 ? 266 HIS A CG  1 
ATOM   2134 N ND1 . HIS A 1 266 ? 45.055 50.786 113.204 1.00 16.72 ? 266 HIS A ND1 1 
ATOM   2135 C CD2 . HIS A 1 266 ? 43.656 52.226 112.348 1.00 18.76 ? 266 HIS A CD2 1 
ATOM   2136 C CE1 . HIS A 1 266 ? 43.839 50.292 113.366 1.00 16.06 ? 266 HIS A CE1 1 
ATOM   2137 N NE2 . HIS A 1 266 ? 42.971 51.147 112.858 1.00 16.48 ? 266 HIS A NE2 1 
ATOM   2138 N N   . LEU A 1 267 ? 45.827 53.002 109.188 1.00 23.59 ? 267 LEU A N   1 
ATOM   2139 C CA  . LEU A 1 267 ? 44.981 52.838 108.008 1.00 21.33 ? 267 LEU A CA  1 
ATOM   2140 C C   . LEU A 1 267 ? 45.665 52.356 106.732 1.00 23.91 ? 267 LEU A C   1 
ATOM   2141 O O   . LEU A 1 267 ? 46.867 52.536 106.556 1.00 23.82 ? 267 LEU A O   1 
ATOM   2142 C CB  . LEU A 1 267 ? 44.244 54.149 107.677 1.00 21.55 ? 267 LEU A CB  1 
ATOM   2143 C CG  . LEU A 1 267 ? 43.253 54.765 108.681 1.00 19.39 ? 267 LEU A CG  1 
ATOM   2144 C CD1 . LEU A 1 267 ? 42.633 55.998 108.069 1.00 19.50 ? 267 LEU A CD1 1 
ATOM   2145 C CD2 . LEU A 1 267 ? 42.162 53.770 109.066 1.00 16.85 ? 267 LEU A CD2 1 
ATOM   2146 N N   . THR A 1 268 ? 44.860 51.723 105.871 1.00 23.89 ? 268 THR A N   1 
ATOM   2147 C CA  . THR A 1 268 ? 45.262 51.273 104.528 1.00 22.95 ? 268 THR A CA  1 
ATOM   2148 C C   . THR A 1 268 ? 44.012 51.668 103.746 1.00 23.13 ? 268 THR A C   1 
ATOM   2149 O O   . THR A 1 268 ? 42.960 51.912 104.352 1.00 21.30 ? 268 THR A O   1 
ATOM   2150 C CB  . THR A 1 268 ? 45.443 49.737 104.393 1.00 22.82 ? 268 THR A CB  1 
ATOM   2151 O OG1 . THR A 1 268 ? 44.178 49.084 104.565 1.00 21.56 ? 268 THR A OG1 1 
ATOM   2152 C CG2 . THR A 1 268 ? 46.456 49.212 105.421 1.00 26.67 ? 268 THR A CG2 1 
ATOM   2153 N N   . ALA A 1 269 ? 44.092 51.739 102.420 1.00 23.98 ? 269 ALA A N   1 
ATOM   2154 C CA  . ALA A 1 269 ? 42.910 52.111 101.645 1.00 23.71 ? 269 ALA A CA  1 
ATOM   2155 C C   . ALA A 1 269 ? 41.765 51.128 101.881 1.00 21.85 ? 269 ALA A C   1 
ATOM   2156 O O   . ALA A 1 269 ? 40.628 51.525 102.126 1.00 23.70 ? 269 ALA A O   1 
ATOM   2157 C CB  . ALA A 1 269 ? 43.243 52.182 100.159 1.00 21.66 ? 269 ALA A CB  1 
ATOM   2158 N N   . PRO A 1 270 ? 42.049 49.825 101.803 1.00 24.82 ? 270 PRO A N   1 
ATOM   2159 C CA  . PRO A 1 270 ? 40.963 48.874 102.028 1.00 22.40 ? 270 PRO A CA  1 
ATOM   2160 C C   . PRO A 1 270 ? 40.401 48.910 103.457 1.00 22.62 ? 270 PRO A C   1 
ATOM   2161 O O   . PRO A 1 270 ? 39.198 48.794 103.651 1.00 19.12 ? 270 PRO A O   1 
ATOM   2162 C CB  . PRO A 1 270 ? 41.590 47.528 101.646 1.00 25.72 ? 270 PRO A CB  1 
ATOM   2163 C CG  . PRO A 1 270 ? 43.034 47.736 101.846 1.00 27.90 ? 270 PRO A CG  1 
ATOM   2164 C CD  . PRO A 1 270 ? 43.292 49.138 101.402 1.00 24.78 ? 270 PRO A CD  1 
ATOM   2165 N N   . TYR A 1 271 ? 41.257 49.095 104.455 1.00 22.74 ? 271 TYR A N   1 
ATOM   2166 C CA  . TYR A 1 271 ? 40.757 49.138 105.827 1.00 19.49 ? 271 TYR A CA  1 
ATOM   2167 C C   . TYR A 1 271 ? 39.905 50.383 106.067 1.00 21.90 ? 271 TYR A C   1 
ATOM   2168 O O   . TYR A 1 271 ? 38.910 50.332 106.788 1.00 21.01 ? 271 TYR A O   1 
ATOM   2169 C CB  . TYR A 1 271 ? 41.910 49.089 106.834 1.00 18.20 ? 271 TYR A CB  1 
ATOM   2170 C CG  . TYR A 1 271 ? 41.420 48.950 108.260 1.00 22.21 ? 271 TYR A CG  1 
ATOM   2171 C CD1 . TYR A 1 271 ? 41.220 50.072 109.078 1.00 22.83 ? 271 TYR A CD1 1 
ATOM   2172 C CD2 . TYR A 1 271 ? 41.085 47.696 108.768 1.00 21.35 ? 271 TYR A CD2 1 
ATOM   2173 C CE1 . TYR A 1 271 ? 40.688 49.934 110.376 1.00 20.21 ? 271 TYR A CE1 1 
ATOM   2174 C CE2 . TYR A 1 271 ? 40.560 47.552 110.036 1.00 23.98 ? 271 TYR A CE2 1 
ATOM   2175 C CZ  . TYR A 1 271 ? 40.363 48.667 110.838 1.00 23.06 ? 271 TYR A CZ  1 
ATOM   2176 O OH  . TYR A 1 271 ? 39.849 48.474 112.100 1.00 22.84 ? 271 TYR A OH  1 
ATOM   2177 N N   . LEU A 1 272 ? 40.285 51.499 105.453 1.00 21.23 ? 272 LEU A N   1 
ATOM   2178 C CA  . LEU A 1 272 ? 39.528 52.730 105.611 1.00 23.60 ? 272 LEU A CA  1 
ATOM   2179 C C   . LEU A 1 272 ? 38.101 52.535 105.094 1.00 22.44 ? 272 LEU A C   1 
ATOM   2180 O O   . LEU A 1 272 ? 37.119 52.884 105.762 1.00 19.87 ? 272 LEU A O   1 
ATOM   2181 C CB  . LEU A 1 272 ? 40.226 53.869 104.856 1.00 24.64 ? 272 LEU A CB  1 
ATOM   2182 C CG  . LEU A 1 272 ? 39.679 55.297 104.997 1.00 24.39 ? 272 LEU A CG  1 
ATOM   2183 C CD1 . LEU A 1 272 ? 40.743 56.301 104.514 1.00 24.51 ? 272 LEU A CD1 1 
ATOM   2184 C CD2 . LEU A 1 272 ? 38.390 55.445 104.194 1.00 26.06 ? 272 LEU A CD2 1 
ATOM   2185 N N   . GLU A 1 273 ? 37.991 51.965 103.902 1.00 20.27 ? 273 GLU A N   1 
ATOM   2186 C CA  . GLU A 1 273 ? 36.695 51.726 103.297 1.00 21.05 ? 273 GLU A CA  1 
ATOM   2187 C C   . GLU A 1 273 ? 35.898 50.696 104.072 1.00 18.63 ? 273 GLU A C   1 
ATOM   2188 O O   . GLU A 1 273 ? 34.679 50.770 104.124 1.00 18.21 ? 273 GLU A O   1 
ATOM   2189 C CB  . GLU A 1 273 ? 36.873 51.301 101.828 1.00 23.93 ? 273 GLU A CB  1 
ATOM   2190 C CG  . GLU A 1 273 ? 37.338 52.461 100.950 1.00 25.26 ? 273 GLU A CG  1 
ATOM   2191 C CD  . GLU A 1 273 ? 37.501 52.089 99.484  1.00 29.77 ? 273 GLU A CD  1 
ATOM   2192 O OE1 . GLU A 1 273 ? 36.667 51.319 98.952  1.00 27.76 ? 273 GLU A OE1 1 
ATOM   2193 O OE2 . GLU A 1 273 ? 38.462 52.591 98.865  1.00 26.02 ? 273 GLU A OE2 1 
ATOM   2194 N N   . ALA A 1 274 ? 36.585 49.744 104.694 1.00 17.46 ? 274 ALA A N   1 
ATOM   2195 C CA  . ALA A 1 274 ? 35.894 48.721 105.470 1.00 17.90 ? 274 ALA A CA  1 
ATOM   2196 C C   . ALA A 1 274 ? 35.257 49.301 106.733 1.00 17.87 ? 274 ALA A C   1 
ATOM   2197 O O   . ALA A 1 274 ? 34.297 48.735 107.262 1.00 20.61 ? 274 ALA A O   1 
ATOM   2198 C CB  . ALA A 1 274 ? 36.859 47.598 105.847 1.00 21.51 ? 274 ALA A CB  1 
ATOM   2199 N N   . MET A 1 275 ? 35.785 50.417 107.227 1.00 18.18 ? 275 MET A N   1 
ATOM   2200 C CA  . MET A 1 275 ? 35.212 51.031 108.429 1.00 20.49 ? 275 MET A CA  1 
ATOM   2201 C C   . MET A 1 275 ? 33.763 51.447 108.199 1.00 21.25 ? 275 MET A C   1 
ATOM   2202 O O   . MET A 1 275 ? 32.985 51.561 109.153 1.00 21.74 ? 275 MET A O   1 
ATOM   2203 C CB  . MET A 1 275 ? 36.027 52.260 108.864 1.00 21.45 ? 275 MET A CB  1 
ATOM   2204 C CG  . MET A 1 275 ? 37.440 51.928 109.331 1.00 21.66 ? 275 MET A CG  1 
ATOM   2205 S SD  . MET A 1 275 ? 38.250 53.290 110.205 1.00 19.89 ? 275 MET A SD  1 
ATOM   2206 C CE  . MET A 1 275 ? 38.484 54.490 108.867 1.00 21.30 ? 275 MET A CE  1 
ATOM   2207 N N   . PHE A 1 276 ? 33.401 51.651 106.932 1.00 19.60 ? 276 PHE A N   1 
ATOM   2208 C CA  . PHE A 1 276 ? 32.050 52.071 106.565 1.00 20.03 ? 276 PHE A CA  1 
ATOM   2209 C C   . PHE A 1 276 ? 31.079 50.903 106.403 1.00 20.91 ? 276 PHE A C   1 
ATOM   2210 O O   . PHE A 1 276 ? 29.895 51.114 106.163 1.00 20.36 ? 276 PHE A O   1 
ATOM   2211 C CB  . PHE A 1 276 ? 32.093 52.900 105.268 1.00 18.84 ? 276 PHE A CB  1 
ATOM   2212 C CG  . PHE A 1 276 ? 32.764 54.222 105.437 1.00 21.18 ? 276 PHE A CG  1 
ATOM   2213 C CD1 . PHE A 1 276 ? 32.012 55.380 105.669 1.00 20.43 ? 276 PHE A CD1 1 
ATOM   2214 C CD2 . PHE A 1 276 ? 34.143 54.306 105.465 1.00 18.20 ? 276 PHE A CD2 1 
ATOM   2215 C CE1 . PHE A 1 276 ? 32.633 56.588 105.928 1.00 21.10 ? 276 PHE A CE1 1 
ATOM   2216 C CE2 . PHE A 1 276 ? 34.776 55.514 105.726 1.00 20.50 ? 276 PHE A CE2 1 
ATOM   2217 C CZ  . PHE A 1 276 ? 34.025 56.654 105.959 1.00 21.44 ? 276 PHE A CZ  1 
ATOM   2218 N N   . VAL A 1 277 ? 31.583 49.677 106.529 1.00 21.24 ? 277 VAL A N   1 
ATOM   2219 C CA  . VAL A 1 277 ? 30.735 48.497 106.424 1.00 21.25 ? 277 VAL A CA  1 
ATOM   2220 C C   . VAL A 1 277 ? 30.242 48.196 107.835 1.00 23.37 ? 277 VAL A C   1 
ATOM   2221 O O   . VAL A 1 277 ? 31.013 47.765 108.716 1.00 22.92 ? 277 VAL A O   1 
ATOM   2222 C CB  . VAL A 1 277 ? 31.514 47.300 105.855 1.00 21.10 ? 277 VAL A CB  1 
ATOM   2223 C CG1 . VAL A 1 277 ? 30.567 46.104 105.691 1.00 20.88 ? 277 VAL A CG1 1 
ATOM   2224 C CG2 . VAL A 1 277 ? 32.145 47.695 104.504 1.00 20.76 ? 277 VAL A CG2 1 
ATOM   2225 N N   . LEU A 1 278 ? 28.952 48.428 108.047 1.00 19.76 ? 278 LEU A N   1 
ATOM   2226 C CA  . LEU A 1 278 ? 28.351 48.273 109.362 1.00 21.46 ? 278 LEU A CA  1 
ATOM   2227 C C   . LEU A 1 278 ? 27.559 46.999 109.598 1.00 20.13 ? 278 LEU A C   1 
ATOM   2228 O O   . LEU A 1 278 ? 26.951 46.451 108.691 1.00 19.82 ? 278 LEU A O   1 
ATOM   2229 C CB  . LEU A 1 278 ? 27.446 49.481 109.648 1.00 23.14 ? 278 LEU A CB  1 
ATOM   2230 C CG  . LEU A 1 278 ? 28.084 50.786 110.139 1.00 29.37 ? 278 LEU A CG  1 
ATOM   2231 C CD1 . LEU A 1 278 ? 29.471 50.948 109.609 1.00 26.35 ? 278 LEU A CD1 1 
ATOM   2232 C CD2 . LEU A 1 278 ? 27.195 51.964 109.760 1.00 24.45 ? 278 LEU A CD2 1 
ATOM   2233 N N   . PRO A 1 279 ? 27.546 46.526 110.850 1.00 20.12 ? 279 PRO A N   1 
ATOM   2234 C CA  . PRO A 1 279 ? 26.810 45.312 111.185 1.00 17.60 ? 279 PRO A CA  1 
ATOM   2235 C C   . PRO A 1 279 ? 25.309 45.576 111.209 1.00 20.33 ? 279 PRO A C   1 
ATOM   2236 O O   . PRO A 1 279 ? 24.868 46.726 111.295 1.00 21.18 ? 279 PRO A O   1 
ATOM   2237 C CB  . PRO A 1 279 ? 27.363 44.934 112.557 1.00 19.45 ? 279 PRO A CB  1 
ATOM   2238 C CG  . PRO A 1 279 ? 27.719 46.276 113.160 1.00 20.35 ? 279 PRO A CG  1 
ATOM   2239 C CD  . PRO A 1 279 ? 28.333 47.019 111.998 1.00 18.94 ? 279 PRO A CD  1 
ATOM   2240 N N   . LYS A 1 280 ? 24.537 44.498 111.149 1.00 22.90 ? 280 LYS A N   1 
ATOM   2241 C CA  . LYS A 1 280 ? 23.082 44.585 111.131 1.00 24.46 ? 280 LYS A CA  1 
ATOM   2242 C C   . LYS A 1 280 ? 22.472 45.312 112.319 1.00 23.54 ? 280 LYS A C   1 
ATOM   2243 O O   . LYS A 1 280 ? 21.540 46.098 112.142 1.00 20.42 ? 280 LYS A O   1 
ATOM   2244 C CB  . LYS A 1 280 ? 22.472 43.185 111.032 1.00 22.70 ? 280 LYS A CB  1 
ATOM   2245 C CG  . LYS A 1 280 ? 20.947 43.201 110.963 1.00 26.34 ? 280 LYS A CG  1 
ATOM   2246 C CD  . LYS A 1 280 ? 20.380 41.806 110.875 1.00 27.35 ? 280 LYS A CD  1 
ATOM   2247 C CE  . LYS A 1 280 ? 18.855 41.849 110.844 1.00 30.40 ? 280 LYS A CE  1 
ATOM   2248 N NZ  . LYS A 1 280 ? 18.274 40.494 110.655 1.00 40.22 ? 280 LYS A NZ  1 
ATOM   2249 N N   . ASP A 1 281 ? 22.990 45.062 113.524 1.00 19.71 ? 281 ASP A N   1 
ATOM   2250 C CA  . ASP A 1 281 ? 22.431 45.712 114.701 1.00 18.88 ? 281 ASP A CA  1 
ATOM   2251 C C   . ASP A 1 281 ? 22.682 47.221 114.739 1.00 18.79 ? 281 ASP A C   1 
ATOM   2252 O O   . ASP A 1 281 ? 21.803 47.975 115.151 1.00 18.41 ? 281 ASP A O   1 
ATOM   2253 C CB  . ASP A 1 281 ? 22.930 45.030 115.997 1.00 18.15 ? 281 ASP A CB  1 
ATOM   2254 C CG  . ASP A 1 281 ? 24.410 44.666 115.958 1.00 20.50 ? 281 ASP A CG  1 
ATOM   2255 O OD1 . ASP A 1 281 ? 25.132 45.125 115.052 1.00 19.08 ? 281 ASP A OD1 1 
ATOM   2256 O OD2 . ASP A 1 281 ? 24.854 43.922 116.860 1.00 24.82 ? 281 ASP A OD2 1 
ATOM   2257 N N   . LEU A 1 282 ? 23.865 47.664 114.305 1.00 19.65 ? 282 LEU A N   1 
ATOM   2258 C CA  . LEU A 1 282 ? 24.189 49.093 114.275 1.00 19.57 ? 282 LEU A CA  1 
ATOM   2259 C C   . LEU A 1 282 ? 23.329 49.800 113.224 1.00 21.20 ? 282 LEU A C   1 
ATOM   2260 O O   . LEU A 1 282 ? 22.835 50.909 113.453 1.00 19.86 ? 282 LEU A O   1 
ATOM   2261 C CB  . LEU A 1 282 ? 25.659 49.328 113.900 1.00 20.55 ? 282 LEU A CB  1 
ATOM   2262 C CG  . LEU A 1 282 ? 26.444 50.478 114.558 1.00 30.30 ? 282 LEU A CG  1 
ATOM   2263 C CD1 . LEU A 1 282 ? 27.646 50.801 113.694 1.00 26.97 ? 282 LEU A CD1 1 
ATOM   2264 C CD2 . LEU A 1 282 ? 25.590 51.720 114.773 1.00 28.16 ? 282 LEU A CD2 1 
ATOM   2265 N N   . LEU A 1 283 ? 23.201 49.173 112.057 1.00 21.74 ? 283 LEU A N   1 
ATOM   2266 C CA  . LEU A 1 283 ? 22.393 49.731 110.967 1.00 21.94 ? 283 LEU A CA  1 
ATOM   2267 C C   . LEU A 1 283 ? 20.946 49.946 111.440 1.00 20.66 ? 283 LEU A C   1 
ATOM   2268 O O   . LEU A 1 283 ? 20.321 50.971 111.147 1.00 20.79 ? 283 LEU A O   1 
ATOM   2269 C CB  . LEU A 1 283 ? 22.431 48.788 109.748 1.00 20.98 ? 283 LEU A CB  1 
ATOM   2270 C CG  . LEU A 1 283 ? 23.730 48.859 108.934 1.00 21.96 ? 283 LEU A CG  1 
ATOM   2271 C CD1 . LEU A 1 283 ? 23.789 47.751 107.868 1.00 17.57 ? 283 LEU A CD1 1 
ATOM   2272 C CD2 . LEU A 1 283 ? 23.817 50.249 108.287 1.00 20.66 ? 283 LEU A CD2 1 
ATOM   2273 N N   . GLU A 1 284 ? 20.416 48.985 112.183 1.00 22.62 ? 284 GLU A N   1 
ATOM   2274 C CA  . GLU A 1 284 ? 19.058 49.121 112.694 1.00 24.11 ? 284 GLU A CA  1 
ATOM   2275 C C   . GLU A 1 284 ? 18.966 50.282 113.688 1.00 23.58 ? 284 GLU A C   1 
ATOM   2276 O O   . GLU A 1 284 ? 18.032 51.065 113.642 1.00 22.59 ? 284 GLU A O   1 
ATOM   2277 C CB  . GLU A 1 284 ? 18.611 47.829 113.373 1.00 25.23 ? 284 GLU A CB  1 
ATOM   2278 C CG  . GLU A 1 284 ? 18.220 46.725 112.414 1.00 31.44 ? 284 GLU A CG  1 
ATOM   2279 C CD  . GLU A 1 284 ? 18.046 45.389 113.114 1.00 38.56 ? 284 GLU A CD  1 
ATOM   2280 O OE1 . GLU A 1 284 ? 17.423 44.485 112.519 1.00 40.26 ? 284 GLU A OE1 1 
ATOM   2281 O OE2 . GLU A 1 284 ? 18.545 45.236 114.254 1.00 39.32 ? 284 GLU A OE2 1 
ATOM   2282 N N   . ALA A 1 285 ? 19.938 50.392 114.586 1.00 22.28 ? 285 ALA A N   1 
ATOM   2283 C CA  . ALA A 1 285 ? 19.917 51.472 115.566 1.00 21.79 ? 285 ALA A CA  1 
ATOM   2284 C C   . ALA A 1 285 ? 19.937 52.829 114.865 1.00 21.42 ? 285 ALA A C   1 
ATOM   2285 O O   . ALA A 1 285 ? 19.201 53.748 115.235 1.00 21.27 ? 285 ALA A O   1 
ATOM   2286 C CB  . ALA A 1 285 ? 21.119 51.357 116.511 1.00 20.80 ? 285 ALA A CB  1 
ATOM   2287 N N   . LEU A 1 286 ? 20.783 52.953 113.850 1.00 20.27 ? 286 LEU A N   1 
ATOM   2288 C CA  . LEU A 1 286 ? 20.892 54.205 113.113 1.00 22.68 ? 286 LEU A CA  1 
ATOM   2289 C C   . LEU A 1 286 ? 19.562 54.481 112.414 1.00 25.56 ? 286 LEU A C   1 
ATOM   2290 O O   . LEU A 1 286 ? 19.018 55.583 112.489 1.00 24.36 ? 286 LEU A O   1 
ATOM   2291 C CB  . LEU A 1 286 ? 22.020 54.119 112.068 1.00 21.43 ? 286 LEU A CB  1 
ATOM   2292 C CG  . LEU A 1 286 ? 23.457 54.088 112.621 1.00 24.14 ? 286 LEU A CG  1 
ATOM   2293 C CD1 . LEU A 1 286 ? 24.461 53.718 111.530 1.00 23.06 ? 286 LEU A CD1 1 
ATOM   2294 C CD2 . LEU A 1 286 ? 23.786 55.448 113.211 1.00 22.92 ? 286 LEU A CD2 1 
ATOM   2295 N N   . GLU A 1 287 ? 19.038 53.450 111.762 1.00 27.95 ? 287 GLU A N   1 
ATOM   2296 C CA  . GLU A 1 287 ? 17.789 53.552 111.013 1.00 32.01 ? 287 GLU A CA  1 
ATOM   2297 C C   . GLU A 1 287 ? 16.579 53.973 111.834 1.00 30.89 ? 287 GLU A C   1 
ATOM   2298 O O   . GLU A 1 287 ? 15.766 54.786 111.382 1.00 32.22 ? 287 GLU A O   1 
ATOM   2299 C CB  . GLU A 1 287 ? 17.476 52.219 110.333 1.00 37.51 ? 287 GLU A CB  1 
ATOM   2300 C CG  . GLU A 1 287 ? 16.199 52.248 109.499 1.00 48.40 ? 287 GLU A CG  1 
ATOM   2301 C CD  . GLU A 1 287 ? 16.421 52.865 108.137 1.00 55.38 ? 287 GLU A CD  1 
ATOM   2302 O OE1 . GLU A 1 287 ? 16.940 52.149 107.247 1.00 60.06 ? 287 GLU A OE1 1 
ATOM   2303 O OE2 . GLU A 1 287 ? 16.093 54.064 107.958 1.00 58.29 ? 287 GLU A OE2 1 
ATOM   2304 N N   . LYS A 1 288 ? 16.454 53.423 113.035 1.00 28.84 ? 288 LYS A N   1 
ATOM   2305 C CA  . LYS A 1 288 ? 15.311 53.729 113.882 1.00 29.83 ? 288 LYS A CA  1 
ATOM   2306 C C   . LYS A 1 288 ? 15.409 55.011 114.697 1.00 28.06 ? 288 LYS A C   1 
ATOM   2307 O O   . LYS A 1 288 ? 14.398 55.481 115.218 1.00 25.77 ? 288 LYS A O   1 
ATOM   2308 C CB  . LYS A 1 288 ? 15.037 52.568 114.845 1.00 35.51 ? 288 LYS A CB  1 
ATOM   2309 C CG  . LYS A 1 288 ? 16.168 52.295 115.820 1.00 42.09 ? 288 LYS A CG  1 
ATOM   2310 C CD  . LYS A 1 288 ? 15.675 51.630 117.107 1.00 49.63 ? 288 LYS A CD  1 
ATOM   2311 C CE  . LYS A 1 288 ? 15.030 50.271 116.861 1.00 53.02 ? 288 LYS A CE  1 
ATOM   2312 N NZ  . LYS A 1 288 ? 14.497 49.684 118.132 1.00 54.41 ? 288 LYS A NZ  1 
ATOM   2313 N N   . GLU A 1 289 ? 16.606 55.581 114.817 1.00 24.26 ? 289 GLU A N   1 
ATOM   2314 C CA  . GLU A 1 289 ? 16.762 56.796 115.618 1.00 23.93 ? 289 GLU A CA  1 
ATOM   2315 C C   . GLU A 1 289 ? 15.907 57.949 115.098 1.00 22.86 ? 289 GLU A C   1 
ATOM   2316 O O   . GLU A 1 289 ? 15.931 58.260 113.919 1.00 21.86 ? 289 GLU A O   1 
ATOM   2317 C CB  . GLU A 1 289 ? 18.221 57.239 115.668 1.00 24.07 ? 289 GLU A CB  1 
ATOM   2318 C CG  . GLU A 1 289 ? 18.434 58.413 116.615 1.00 25.70 ? 289 GLU A CG  1 
ATOM   2319 C CD  . GLU A 1 289 ? 17.944 58.108 118.021 1.00 26.37 ? 289 GLU A CD  1 
ATOM   2320 O OE1 . GLU A 1 289 ? 17.083 58.857 118.534 1.00 21.85 ? 289 GLU A OE1 1 
ATOM   2321 O OE2 . GLU A 1 289 ? 18.417 57.114 118.609 1.00 27.01 ? 289 GLU A OE2 1 
ATOM   2322 N N   . THR A 1 290 ? 15.185 58.602 116.000 1.00 23.12 ? 290 THR A N   1 
ATOM   2323 C CA  . THR A 1 290 ? 14.304 59.702 115.622 1.00 26.22 ? 290 THR A CA  1 
ATOM   2324 C C   . THR A 1 290 ? 14.679 61.056 116.249 1.00 27.21 ? 290 THR A C   1 
ATOM   2325 O O   . THR A 1 290 ? 14.182 62.091 115.824 1.00 25.70 ? 290 THR A O   1 
ATOM   2326 C CB  . THR A 1 290 ? 12.854 59.391 116.050 1.00 24.83 ? 290 THR A CB  1 
ATOM   2327 O OG1 . THR A 1 290 ? 12.802 59.331 117.475 1.00 29.68 ? 290 THR A OG1 1 
ATOM   2328 C CG2 . THR A 1 290 ? 12.395 58.037 115.509 1.00 26.31 ? 290 THR A CG2 1 
ATOM   2329 N N   . MET A 1 291 ? 15.551 61.057 117.252 1.00 25.63 ? 291 MET A N   1 
ATOM   2330 C CA  . MET A 1 291 ? 15.898 62.310 117.911 1.00 26.97 ? 291 MET A CA  1 
ATOM   2331 C C   . MET A 1 291 ? 16.851 63.209 117.148 1.00 26.70 ? 291 MET A C   1 
ATOM   2332 O O   . MET A 1 291 ? 17.880 62.760 116.644 1.00 25.04 ? 291 MET A O   1 
ATOM   2333 C CB  . MET A 1 291 ? 16.472 62.046 119.307 1.00 26.22 ? 291 MET A CB  1 
ATOM   2334 C CG  . MET A 1 291 ? 16.837 63.324 120.054 1.00 27.16 ? 291 MET A CG  1 
ATOM   2335 S SD  . MET A 1 291 ? 17.478 62.989 121.686 1.00 33.49 ? 291 MET A SD  1 
ATOM   2336 C CE  . MET A 1 291 ? 15.982 62.402 122.514 1.00 31.68 ? 291 MET A CE  1 
ATOM   2337 N N   . VAL A 1 292 ? 16.486 64.488 117.077 1.00 25.42 ? 292 VAL A N   1 
ATOM   2338 C CA  . VAL A 1 292 ? 17.291 65.515 116.419 1.00 26.84 ? 292 VAL A CA  1 
ATOM   2339 C C   . VAL A 1 292 ? 17.588 66.587 117.467 1.00 28.63 ? 292 VAL A C   1 
ATOM   2340 O O   . VAL A 1 292 ? 16.666 67.190 118.025 1.00 26.23 ? 292 VAL A O   1 
ATOM   2341 C CB  . VAL A 1 292 ? 16.540 66.190 115.235 1.00 24.72 ? 292 VAL A CB  1 
ATOM   2342 C CG1 . VAL A 1 292 ? 17.343 67.406 114.725 1.00 26.08 ? 292 VAL A CG1 1 
ATOM   2343 C CG2 . VAL A 1 292 ? 16.327 65.195 114.102 1.00 27.90 ? 292 VAL A CG2 1 
ATOM   2344 N N   . SER A 1 293 ? 18.868 66.809 117.752 1.00 28.83 ? 293 SER A N   1 
ATOM   2345 C CA  . SER A 1 293 ? 19.259 67.823 118.732 1.00 28.96 ? 293 SER A CA  1 
ATOM   2346 C C   . SER A 1 293 ? 19.099 69.214 118.120 1.00 28.70 ? 293 SER A C   1 
ATOM   2347 O O   . SER A 1 293 ? 19.509 69.443 116.978 1.00 30.47 ? 293 SER A O   1 
ATOM   2348 C CB  . SER A 1 293 ? 20.708 67.626 119.155 1.00 29.21 ? 293 SER A CB  1 
ATOM   2349 O OG  . SER A 1 293 ? 21.021 68.509 120.218 1.00 32.64 ? 293 SER A OG  1 
ATOM   2350 N N   . THR A 1 294 ? 18.514 70.140 118.881 1.00 29.06 ? 294 THR A N   1 
ATOM   2351 C CA  . THR A 1 294 ? 18.277 71.508 118.403 1.00 30.95 ? 294 THR A CA  1 
ATOM   2352 C C   . THR A 1 294 ? 18.701 72.553 119.436 1.00 28.75 ? 294 THR A C   1 
ATOM   2353 O O   . THR A 1 294 ? 18.795 72.264 120.629 1.00 31.39 ? 294 THR A O   1 
ATOM   2354 C CB  . THR A 1 294 ? 16.769 71.750 118.114 1.00 29.97 ? 294 THR A CB  1 
ATOM   2355 O OG1 . THR A 1 294 ? 16.039 71.695 119.348 1.00 31.57 ? 294 THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 294 ? 16.221 70.693 117.161 1.00 30.67 ? 294 THR A CG2 1 
ATOM   2357 N N   . ASP A 1 295 ? 18.964 73.772 118.982 1.00 30.79 ? 295 ASP A N   1 
ATOM   2358 C CA  . ASP A 1 295 ? 19.333 74.820 119.927 1.00 31.83 ? 295 ASP A CA  1 
ATOM   2359 C C   . ASP A 1 295 ? 18.208 74.976 120.948 1.00 30.77 ? 295 ASP A C   1 
ATOM   2360 O O   . ASP A 1 295 ? 18.461 75.184 122.134 1.00 34.36 ? 295 ASP A O   1 
ATOM   2361 C CB  . ASP A 1 295 ? 19.572 76.136 119.195 1.00 32.52 ? 295 ASP A CB  1 
ATOM   2362 C CG  . ASP A 1 295 ? 20.969 76.227 118.612 1.00 36.12 ? 295 ASP A CG  1 
ATOM   2363 O OD1 . ASP A 1 295 ? 21.236 77.176 117.839 1.00 35.62 ? 295 ASP A OD1 1 
ATOM   2364 O OD2 . ASP A 1 295 ? 21.802 75.344 118.937 1.00 37.30 ? 295 ASP A OD2 1 
ATOM   2365 N N   . GLN A 1 296 ? 16.969 74.835 120.487 1.00 33.03 ? 296 GLN A N   1 
ATOM   2366 C CA  . GLN A 1 296 ? 15.797 74.947 121.360 1.00 36.22 ? 296 GLN A CA  1 
ATOM   2367 C C   . GLN A 1 296 ? 15.805 73.863 122.429 1.00 36.98 ? 296 GLN A C   1 
ATOM   2368 O O   . GLN A 1 296 ? 15.596 74.130 123.621 1.00 34.80 ? 296 GLN A O   1 
ATOM   2369 C CB  . GLN A 1 296 ? 14.510 74.829 120.535 1.00 39.40 ? 296 GLN A CB  1 
ATOM   2370 C CG  . GLN A 1 296 ? 13.242 74.656 121.370 1.00 43.92 ? 296 GLN A CG  1 
ATOM   2371 C CD  . GLN A 1 296 ? 12.851 75.915 122.119 1.00 49.81 ? 296 GLN A CD  1 
ATOM   2372 O OE1 . GLN A 1 296 ? 12.495 75.868 123.301 1.00 50.63 ? 296 GLN A OE1 1 
ATOM   2373 N NE2 . GLN A 1 296 ? 12.905 77.052 121.429 1.00 50.67 ? 296 GLN A NE2 1 
ATOM   2374 N N   . ASN A 1 297 ? 16.036 72.632 121.990 1.00 36.14 ? 297 ASN A N   1 
ATOM   2375 C CA  . ASN A 1 297 ? 16.068 71.492 122.894 1.00 36.18 ? 297 ASN A CA  1 
ATOM   2376 C C   . ASN A 1 297 ? 17.310 70.658 122.623 1.00 37.29 ? 297 ASN A C   1 
ATOM   2377 O O   . ASN A 1 297 ? 17.243 69.639 121.934 1.00 36.45 ? 297 ASN A O   1 
ATOM   2378 C CB  . ASN A 1 297 ? 14.821 70.623 122.699 1.00 34.97 ? 297 ASN A CB  1 
ATOM   2379 C CG  . ASN A 1 297 ? 13.541 71.386 122.940 1.00 35.08 ? 297 ASN A CG  1 
ATOM   2380 O OD1 . ASN A 1 297 ? 13.232 71.755 124.071 1.00 36.74 ? 297 ASN A OD1 1 
ATOM   2381 N ND2 . ASN A 1 297 ? 12.792 71.639 121.872 1.00 33.26 ? 297 ASN A ND2 1 
ATOM   2382 N N   . PRO A 1 298 ? 18.465 71.096 123.146 1.00 36.40 ? 298 PRO A N   1 
ATOM   2383 C CA  . PRO A 1 298 ? 19.714 70.361 122.945 1.00 36.57 ? 298 PRO A CA  1 
ATOM   2384 C C   . PRO A 1 298 ? 19.725 69.010 123.648 1.00 34.05 ? 298 PRO A C   1 
ATOM   2385 O O   . PRO A 1 298 ? 19.368 68.884 124.817 1.00 35.67 ? 298 PRO A O   1 
ATOM   2386 C CB  . PRO A 1 298 ? 20.784 71.326 123.471 1.00 35.72 ? 298 PRO A CB  1 
ATOM   2387 C CG  . PRO A 1 298 ? 20.046 72.165 124.456 1.00 41.44 ? 298 PRO A CG  1 
ATOM   2388 C CD  . PRO A 1 298 ? 18.710 72.392 123.801 1.00 38.16 ? 298 PRO A CD  1 
ATOM   2389 N N   . PHE A 1 299 ? 20.123 67.985 122.916 1.00 33.56 ? 299 PHE A N   1 
ATOM   2390 C CA  . PHE A 1 299 ? 20.172 66.657 123.487 1.00 33.89 ? 299 PHE A CA  1 
ATOM   2391 C C   . PHE A 1 299 ? 21.441 66.489 124.316 1.00 34.20 ? 299 PHE A C   1 
ATOM   2392 O O   . PHE A 1 299 ? 22.452 67.155 124.085 1.00 34.76 ? 299 PHE A O   1 
ATOM   2393 C CB  . PHE A 1 299 ? 20.109 65.622 122.363 1.00 35.49 ? 299 PHE A CB  1 
ATOM   2394 C CG  . PHE A 1 299 ? 21.260 64.676 122.345 1.00 36.71 ? 299 PHE A CG  1 
ATOM   2395 C CD1 . PHE A 1 299 ? 21.200 63.476 123.045 1.00 37.74 ? 299 PHE A CD1 1 
ATOM   2396 C CD2 . PHE A 1 299 ? 22.408 64.980 121.621 1.00 39.06 ? 299 PHE A CD2 1 
ATOM   2397 C CE1 . PHE A 1 299 ? 22.268 62.586 123.023 1.00 42.02 ? 299 PHE A CE1 1 
ATOM   2398 C CE2 . PHE A 1 299 ? 23.485 64.099 121.589 1.00 39.59 ? 299 PHE A CE2 1 
ATOM   2399 C CZ  . PHE A 1 299 ? 23.416 62.899 122.291 1.00 38.33 ? 299 PHE A CZ  1 
ATOM   2400 N N   . TYR A 1 300 ? 21.355 65.626 125.313 1.00 32.59 ? 300 TYR A N   1 
ATOM   2401 C CA  . TYR A 1 300 ? 22.484 65.313 126.165 1.00 35.83 ? 300 TYR A CA  1 
ATOM   2402 C C   . TYR A 1 300 ? 22.235 63.897 126.630 1.00 36.12 ? 300 TYR A C   1 
ATOM   2403 O O   . TYR A 1 300 ? 21.133 63.372 126.472 1.00 34.05 ? 300 TYR A O   1 
ATOM   2404 C CB  . TYR A 1 300 ? 22.571 66.252 127.375 1.00 35.70 ? 300 TYR A CB  1 
ATOM   2405 C CG  . TYR A 1 300 ? 21.423 66.140 128.354 1.00 38.91 ? 300 TYR A CG  1 
ATOM   2406 C CD1 . TYR A 1 300 ? 20.203 66.776 128.108 1.00 38.15 ? 300 TYR A CD1 1 
ATOM   2407 C CD2 . TYR A 1 300 ? 21.552 65.395 129.526 1.00 38.33 ? 300 TYR A CD2 1 
ATOM   2408 C CE1 . TYR A 1 300 ? 19.144 66.676 129.007 1.00 41.85 ? 300 TYR A CE1 1 
ATOM   2409 C CE2 . TYR A 1 300 ? 20.499 65.284 130.431 1.00 41.67 ? 300 TYR A CE2 1 
ATOM   2410 C CZ  . TYR A 1 300 ? 19.296 65.928 130.168 1.00 43.57 ? 300 TYR A CZ  1 
ATOM   2411 O OH  . TYR A 1 300 ? 18.247 65.818 131.057 1.00 44.77 ? 300 TYR A OH  1 
ATOM   2412 N N   . VAL A 1 301 ? 23.261 63.274 127.188 1.00 40.30 ? 301 VAL A N   1 
ATOM   2413 C CA  . VAL A 1 301 ? 23.129 61.914 127.676 1.00 45.15 ? 301 VAL A CA  1 
ATOM   2414 C C   . VAL A 1 301 ? 23.088 61.984 129.182 1.00 46.18 ? 301 VAL A C   1 
ATOM   2415 O O   . VAL A 1 301 ? 23.806 62.777 129.783 1.00 45.33 ? 301 VAL A O   1 
ATOM   2416 C CB  . VAL A 1 301 ? 24.321 61.050 127.258 1.00 46.48 ? 301 VAL A CB  1 
ATOM   2417 C CG1 . VAL A 1 301 ? 24.065 59.604 127.643 1.00 47.92 ? 301 VAL A CG1 1 
ATOM   2418 C CG2 . VAL A 1 301 ? 24.555 61.186 125.773 1.00 48.19 ? 301 VAL A CG2 1 
ATOM   2419 N N   . THR A 1 302 ? 22.240 61.160 129.785 1.00 49.25 ? 302 THR A N   1 
ATOM   2420 C CA  . THR A 1 302 ? 22.104 61.130 131.233 1.00 53.51 ? 302 THR A CA  1 
ATOM   2421 C C   . THR A 1 302 ? 23.228 60.303 131.843 1.00 58.09 ? 302 THR A C   1 
ATOM   2422 O O   . THR A 1 302 ? 23.907 59.549 131.147 1.00 56.31 ? 302 THR A O   1 
ATOM   2423 C CB  . THR A 1 302 ? 20.765 60.503 131.648 1.00 53.39 ? 302 THR A CB  1 
ATOM   2424 O OG1 . THR A 1 302 ? 20.741 59.125 131.248 1.00 51.72 ? 302 THR A OG1 1 
ATOM   2425 C CG2 . THR A 1 302 ? 19.601 61.250 130.992 1.00 53.47 ? 302 THR A CG2 1 
ATOM   2426 N N   . PRO A 1 303 ? 23.437 60.428 133.160 1.00 62.84 ? 303 PRO A N   1 
ATOM   2427 C CA  . PRO A 1 303 ? 24.507 59.646 133.779 1.00 67.14 ? 303 PRO A CA  1 
ATOM   2428 C C   . PRO A 1 303 ? 24.304 58.160 133.512 1.00 69.88 ? 303 PRO A C   1 
ATOM   2429 O O   . PRO A 1 303 ? 25.261 57.388 133.502 1.00 72.07 ? 303 PRO A O   1 
ATOM   2430 C CB  . PRO A 1 303 ? 24.377 59.998 135.260 1.00 68.42 ? 303 PRO A CB  1 
ATOM   2431 C CG  . PRO A 1 303 ? 22.898 60.256 135.414 1.00 67.79 ? 303 PRO A CG  1 
ATOM   2432 C CD  . PRO A 1 303 ? 22.615 61.096 134.185 1.00 66.01 ? 303 PRO A CD  1 
ATOM   2433 N N   . GLU A 1 304 ? 23.052 57.770 133.283 1.00 71.64 ? 304 GLU A N   1 
ATOM   2434 C CA  . GLU A 1 304 ? 22.723 56.375 133.016 1.00 72.72 ? 304 GLU A CA  1 
ATOM   2435 C C   . GLU A 1 304 ? 22.842 56.050 131.530 1.00 72.41 ? 304 GLU A C   1 
ATOM   2436 O O   . GLU A 1 304 ? 22.477 54.959 131.094 1.00 73.11 ? 304 GLU A O   1 
ATOM   2437 C CB  . GLU A 1 304 ? 21.308 56.059 133.509 1.00 73.88 ? 304 GLU A CB  1 
ATOM   2438 C CG  . GLU A 1 304 ? 21.069 56.444 134.961 1.00 77.42 ? 304 GLU A CG  1 
ATOM   2439 C CD  . GLU A 1 304 ? 22.104 55.854 135.906 1.00 80.16 ? 304 GLU A CD  1 
ATOM   2440 O OE1 . GLU A 1 304 ? 22.128 54.615 136.079 1.00 80.91 ? 304 GLU A OE1 1 
ATOM   2441 O OE2 . GLU A 1 304 ? 22.902 56.633 136.475 1.00 82.00 ? 304 GLU A OE2 1 
ATOM   2442 N N   . GLY A 1 305 ? 23.347 57.005 130.757 1.00 72.53 ? 305 GLY A N   1 
ATOM   2443 C CA  . GLY A 1 305 ? 23.525 56.793 129.330 1.00 72.57 ? 305 GLY A CA  1 
ATOM   2444 C C   . GLY A 1 305 ? 22.285 56.881 128.457 1.00 72.25 ? 305 GLY A C   1 
ATOM   2445 O O   . GLY A 1 305 ? 22.245 56.282 127.382 1.00 72.70 ? 305 GLY A O   1 
ATOM   2446 N N   . GLU A 1 306 ? 21.278 57.630 128.895 1.00 71.73 ? 306 GLU A N   1 
ATOM   2447 C CA  . GLU A 1 306 ? 20.045 57.773 128.124 1.00 70.88 ? 306 GLU A CA  1 
ATOM   2448 C C   . GLU A 1 306 ? 20.011 59.066 127.312 1.00 67.82 ? 306 GLU A C   1 
ATOM   2449 O O   . GLU A 1 306 ? 20.606 60.072 127.698 1.00 67.27 ? 306 GLU A O   1 
ATOM   2450 C CB  . GLU A 1 306 ? 18.837 57.723 129.060 1.00 73.42 ? 306 GLU A CB  1 
ATOM   2451 C CG  . GLU A 1 306 ? 18.760 56.448 129.885 1.00 78.95 ? 306 GLU A CG  1 
ATOM   2452 C CD  . GLU A 1 306 ? 17.641 56.481 130.905 1.00 81.54 ? 306 GLU A CD  1 
ATOM   2453 O OE1 . GLU A 1 306 ? 16.465 56.584 130.493 1.00 84.12 ? 306 GLU A OE1 1 
ATOM   2454 O OE2 . GLU A 1 306 ? 17.936 56.406 132.119 1.00 81.79 ? 306 GLU A OE2 1 
ATOM   2455 N N   . ALA A 1 307 ? 19.310 59.027 126.182 1.00 64.68 ? 307 ALA A N   1 
ATOM   2456 C CA  . ALA A 1 307 ? 19.187 60.192 125.312 1.00 61.41 ? 307 ALA A CA  1 
ATOM   2457 C C   . ALA A 1 307 ? 18.075 61.112 125.811 1.00 59.72 ? 307 ALA A C   1 
ATOM   2458 O O   . ALA A 1 307 ? 16.906 60.716 125.883 1.00 58.26 ? 307 ALA A O   1 
ATOM   2459 C CB  . ALA A 1 307 ? 18.900 59.748 123.886 1.00 61.48 ? 307 ALA A CB  1 
ATOM   2460 N N   . ARG A 1 308 ? 18.451 62.339 126.157 1.00 57.22 ? 308 ARG A N   1 
ATOM   2461 C CA  . ARG A 1 308 ? 17.508 63.334 126.661 1.00 55.69 ? 308 ARG A CA  1 
ATOM   2462 C C   . ARG A 1 308 ? 17.533 64.588 125.796 1.00 52.56 ? 308 ARG A C   1 
ATOM   2463 O O   . ARG A 1 308 ? 18.505 64.850 125.090 1.00 52.31 ? 308 ARG A O   1 
ATOM   2464 C CB  . ARG A 1 308 ? 17.864 63.709 128.098 1.00 57.65 ? 308 ARG A CB  1 
ATOM   2465 C CG  . ARG A 1 308 ? 16.821 63.344 129.128 1.00 61.98 ? 308 ARG A CG  1 
ATOM   2466 C CD  . ARG A 1 308 ? 16.559 61.855 129.153 1.00 66.15 ? 308 ARG A CD  1 
ATOM   2467 N NE  . ARG A 1 308 ? 15.989 61.436 130.430 1.00 69.37 ? 308 ARG A NE  1 
ATOM   2468 C CZ  . ARG A 1 308 ? 15.678 60.180 130.735 1.00 71.44 ? 308 ARG A CZ  1 
ATOM   2469 N NH1 . ARG A 1 308 ? 15.168 59.892 131.927 1.00 71.49 ? 308 ARG A NH1 1 
ATOM   2470 N NH2 . ARG A 1 308 ? 15.871 59.212 129.847 1.00 72.28 ? 308 ARG A NH2 1 
ATOM   2471 N N   . GLN A 1 309 ? 16.467 65.373 125.875 1.00 48.82 ? 309 GLN A N   1 
ATOM   2472 C CA  . GLN A 1 309 ? 16.368 66.588 125.089 1.00 46.78 ? 309 GLN A CA  1 
ATOM   2473 C C   . GLN A 1 309 ? 15.429 67.617 125.722 1.00 48.81 ? 309 GLN A C   1 
ATOM   2474 O O   . GLN A 1 309 ? 14.256 67.335 125.960 1.00 47.99 ? 309 GLN A O   1 
ATOM   2475 C CB  . GLN A 1 309 ? 15.895 66.209 123.692 1.00 43.93 ? 309 GLN A CB  1 
ATOM   2476 C CG  . GLN A 1 309 ? 15.495 67.345 122.819 1.00 42.43 ? 309 GLN A CG  1 
ATOM   2477 C CD  . GLN A 1 309 ? 15.342 66.909 121.387 1.00 34.57 ? 309 GLN A CD  1 
ATOM   2478 O OE1 . GLN A 1 309 ? 14.657 65.934 121.089 1.00 34.39 ? 309 GLN A OE1 1 
ATOM   2479 N NE2 . GLN A 1 309 ? 15.985 67.628 120.488 1.00 40.09 ? 309 GLN A NE2 1 
ATOM   2480 N N   . ALA A 1 310 ? 15.962 68.809 125.992 1.00 50.78 ? 310 ALA A N   1 
ATOM   2481 C CA  . ALA A 1 310 ? 15.200 69.911 126.596 1.00 52.97 ? 310 ALA A CA  1 
ATOM   2482 C C   . ALA A 1 310 ? 16.010 71.206 126.481 1.00 54.36 ? 310 ALA A C   1 
ATOM   2483 O O   . ALA A 1 310 ? 17.199 71.168 126.177 1.00 54.80 ? 310 ALA A O   1 
ATOM   2484 C CB  . ALA A 1 310 ? 14.908 69.605 128.064 1.00 51.73 ? 310 ALA A CB  1 
ATOM   2485 N N   . PRO A 1 311 ? 15.383 72.370 126.729 1.00 57.33 ? 311 PRO A N   1 
ATOM   2486 C CA  . PRO A 1 311 ? 16.119 73.639 126.629 1.00 57.82 ? 311 PRO A CA  1 
ATOM   2487 C C   . PRO A 1 311 ? 17.361 73.732 127.519 1.00 57.41 ? 311 PRO A C   1 
ATOM   2488 O O   . PRO A 1 311 ? 17.359 73.270 128.658 1.00 57.28 ? 311 PRO A O   1 
ATOM   2489 C CB  . PRO A 1 311 ? 15.055 74.686 126.973 1.00 59.15 ? 311 PRO A CB  1 
ATOM   2490 C CG  . PRO A 1 311 ? 14.093 73.929 127.842 1.00 59.32 ? 311 PRO A CG  1 
ATOM   2491 C CD  . PRO A 1 311 ? 13.989 72.606 127.140 1.00 58.01 ? 311 PRO A CD  1 
ATOM   2492 N N   . TYR A 1 312 ? 18.425 74.322 126.979 1.00 58.50 ? 312 TYR A N   1 
ATOM   2493 C CA  . TYR A 1 312 ? 19.684 74.471 127.707 1.00 59.27 ? 312 TYR A CA  1 
ATOM   2494 C C   . TYR A 1 312 ? 19.604 75.583 128.757 1.00 59.00 ? 312 TYR A C   1 
ATOM   2495 O O   . TYR A 1 312 ? 19.920 75.317 129.937 1.00 58.40 ? 312 TYR A O   1 
ATOM   2496 C CB  . TYR A 1 312 ? 20.828 74.777 126.730 1.00 60.75 ? 312 TYR A CB  1 
ATOM   2497 C CG  . TYR A 1 312 ? 22.199 74.814 127.379 1.00 61.95 ? 312 TYR A CG  1 
ATOM   2498 C CD1 . TYR A 1 312 ? 23.246 75.532 126.804 1.00 63.12 ? 312 TYR A CD1 1 
ATOM   2499 C CD2 . TYR A 1 312 ? 22.450 74.129 128.568 1.00 63.38 ? 312 TYR A CD2 1 
ATOM   2500 C CE1 . TYR A 1 312 ? 24.508 75.570 127.398 1.00 63.32 ? 312 TYR A CE1 1 
ATOM   2501 C CE2 . TYR A 1 312 ? 23.706 74.160 129.169 1.00 64.22 ? 312 TYR A CE2 1 
ATOM   2502 C CZ  . TYR A 1 312 ? 24.728 74.881 128.581 1.00 63.44 ? 312 TYR A CZ  1 
ATOM   2503 O OH  . TYR A 1 312 ? 25.965 74.909 129.182 1.00 63.82 ? 312 TYR A OH  1 
ATOM   2504 N N   . MET B 1 1   ? 30.860 56.682 140.080 1.00 69.45 ? 1   MET B N   1 
ATOM   2505 C CA  . MET B 1 1   ? 30.986 55.420 140.866 1.00 68.40 ? 1   MET B CA  1 
ATOM   2506 C C   . MET B 1 1   ? 30.022 55.397 142.044 1.00 65.86 ? 1   MET B C   1 
ATOM   2507 O O   . MET B 1 1   ? 29.667 56.443 142.588 1.00 66.97 ? 1   MET B O   1 
ATOM   2508 C CB  . MET B 1 1   ? 32.419 55.269 141.386 1.00 70.43 ? 1   MET B CB  1 
ATOM   2509 C CG  . MET B 1 1   ? 33.302 54.356 140.548 1.00 70.79 ? 1   MET B CG  1 
ATOM   2510 S SD  . MET B 1 1   ? 32.829 52.622 140.692 1.00 71.18 ? 1   MET B SD  1 
ATOM   2511 C CE  . MET B 1 1   ? 33.548 52.204 142.260 1.00 69.86 ? 1   MET B CE  1 
ATOM   2512 N N   . ASP B 1 2   ? 29.596 54.201 142.434 1.00 61.94 ? 2   ASP B N   1 
ATOM   2513 C CA  . ASP B 1 2   ? 28.689 54.052 143.566 1.00 58.72 ? 2   ASP B CA  1 
ATOM   2514 C C   . ASP B 1 2   ? 29.174 52.937 144.475 1.00 54.73 ? 2   ASP B C   1 
ATOM   2515 O O   . ASP B 1 2   ? 30.123 52.222 144.155 1.00 56.98 ? 2   ASP B O   1 
ATOM   2516 C CB  . ASP B 1 2   ? 27.267 53.711 143.100 1.00 62.40 ? 2   ASP B CB  1 
ATOM   2517 C CG  . ASP B 1 2   ? 26.625 54.823 142.288 1.00 65.97 ? 2   ASP B CG  1 
ATOM   2518 O OD1 . ASP B 1 2   ? 26.659 55.994 142.732 1.00 67.12 ? 2   ASP B OD1 1 
ATOM   2519 O OD2 . ASP B 1 2   ? 26.073 54.520 141.206 1.00 67.42 ? 2   ASP B OD2 1 
ATOM   2520 N N   . TYR B 1 3   ? 28.519 52.799 145.618 1.00 46.06 ? 3   TYR B N   1 
ATOM   2521 C CA  . TYR B 1 3   ? 28.856 51.741 146.553 1.00 42.62 ? 3   TYR B CA  1 
ATOM   2522 C C   . TYR B 1 3   ? 27.955 50.561 146.178 1.00 39.13 ? 3   TYR B C   1 
ATOM   2523 O O   . TYR B 1 3   ? 26.971 50.746 145.463 1.00 39.53 ? 3   TYR B O   1 
ATOM   2524 C CB  . TYR B 1 3   ? 28.607 52.225 147.988 1.00 37.68 ? 3   TYR B CB  1 
ATOM   2525 C CG  . TYR B 1 3   ? 29.490 53.411 148.343 1.00 37.94 ? 3   TYR B CG  1 
ATOM   2526 C CD1 . TYR B 1 3   ? 30.879 53.271 148.397 1.00 37.64 ? 3   TYR B CD1 1 
ATOM   2527 C CD2 . TYR B 1 3   ? 28.947 54.681 148.573 1.00 36.28 ? 3   TYR B CD2 1 
ATOM   2528 C CE1 . TYR B 1 3   ? 31.709 54.356 148.667 1.00 35.53 ? 3   TYR B CE1 1 
ATOM   2529 C CE2 . TYR B 1 3   ? 29.775 55.782 148.846 1.00 35.50 ? 3   TYR B CE2 1 
ATOM   2530 C CZ  . TYR B 1 3   ? 31.154 55.602 148.889 1.00 35.83 ? 3   TYR B CZ  1 
ATOM   2531 O OH  . TYR B 1 3   ? 31.991 56.659 149.145 1.00 38.89 ? 3   TYR B OH  1 
ATOM   2532 N N   . GLY B 1 4   ? 28.299 49.355 146.627 1.00 35.45 ? 4   GLY B N   1 
ATOM   2533 C CA  . GLY B 1 4   ? 27.492 48.191 146.297 1.00 26.28 ? 4   GLY B CA  1 
ATOM   2534 C C   . GLY B 1 4   ? 28.362 47.012 145.917 1.00 24.99 ? 4   GLY B C   1 
ATOM   2535 O O   . GLY B 1 4   ? 29.566 47.011 146.194 1.00 25.25 ? 4   GLY B O   1 
ATOM   2536 N N   . MET B 1 5   ? 27.772 46.010 145.271 1.00 22.07 ? 5   MET B N   1 
ATOM   2537 C CA  . MET B 1 5   ? 28.533 44.823 144.877 1.00 21.01 ? 5   MET B CA  1 
ATOM   2538 C C   . MET B 1 5   ? 29.129 45.007 143.500 1.00 22.37 ? 5   MET B C   1 
ATOM   2539 O O   . MET B 1 5   ? 28.464 45.496 142.583 1.00 21.65 ? 5   MET B O   1 
ATOM   2540 C CB  . MET B 1 5   ? 27.642 43.572 144.852 1.00 22.12 ? 5   MET B CB  1 
ATOM   2541 C CG  . MET B 1 5   ? 26.957 43.242 146.162 1.00 23.47 ? 5   MET B CG  1 
ATOM   2542 S SD  . MET B 1 5   ? 26.052 41.677 146.049 1.00 29.51 ? 5   MET B SD  1 
ATOM   2543 C CE  . MET B 1 5   ? 24.863 42.066 144.765 1.00 22.16 ? 5   MET B CE  1 
ATOM   2544 N N   . TYR B 1 6   ? 30.381 44.594 143.358 1.00 20.13 ? 6   TYR B N   1 
ATOM   2545 C CA  . TYR B 1 6   ? 31.076 44.711 142.089 1.00 21.16 ? 6   TYR B CA  1 
ATOM   2546 C C   . TYR B 1 6   ? 31.983 43.528 141.881 1.00 22.24 ? 6   TYR B C   1 
ATOM   2547 O O   . TYR B 1 6   ? 32.386 42.851 142.833 1.00 21.10 ? 6   TYR B O   1 
ATOM   2548 C CB  . TYR B 1 6   ? 31.958 45.967 142.044 1.00 21.55 ? 6   TYR B CB  1 
ATOM   2549 C CG  . TYR B 1 6   ? 31.199 47.264 142.041 1.00 22.19 ? 6   TYR B CG  1 
ATOM   2550 C CD1 . TYR B 1 6   ? 30.686 47.794 143.220 1.00 23.71 ? 6   TYR B CD1 1 
ATOM   2551 C CD2 . TYR B 1 6   ? 30.962 47.947 140.847 1.00 20.06 ? 6   TYR B CD2 1 
ATOM   2552 C CE1 . TYR B 1 6   ? 29.948 48.976 143.214 1.00 25.27 ? 6   TYR B CE1 1 
ATOM   2553 C CE2 . TYR B 1 6   ? 30.229 49.125 140.828 1.00 23.82 ? 6   TYR B CE2 1 
ATOM   2554 C CZ  . TYR B 1 6   ? 29.725 49.635 142.009 1.00 27.36 ? 6   TYR B CZ  1 
ATOM   2555 O OH  . TYR B 1 6   ? 29.000 50.798 141.990 1.00 32.36 ? 6   TYR B OH  1 
ATOM   2556 N N   . PHE B 1 7   ? 32.300 43.273 140.623 1.00 20.29 ? 7   PHE B N   1 
ATOM   2557 C CA  . PHE B 1 7   ? 33.225 42.214 140.317 1.00 20.17 ? 7   PHE B CA  1 
ATOM   2558 C C   . PHE B 1 7   ? 34.478 42.883 139.758 1.00 18.88 ? 7   PHE B C   1 
ATOM   2559 O O   . PHE B 1 7   ? 34.380 43.752 138.893 1.00 18.35 ? 7   PHE B O   1 
ATOM   2560 C CB  . PHE B 1 7   ? 32.658 41.250 139.276 1.00 20.24 ? 7   PHE B CB  1 
ATOM   2561 C CG  . PHE B 1 7   ? 33.476 39.999 139.143 1.00 23.31 ? 7   PHE B CG  1 
ATOM   2562 C CD1 . PHE B 1 7   ? 34.725 40.032 138.517 1.00 22.14 ? 7   PHE B CD1 1 
ATOM   2563 C CD2 . PHE B 1 7   ? 33.066 38.823 139.759 1.00 22.95 ? 7   PHE B CD2 1 
ATOM   2564 C CE1 . PHE B 1 7   ? 35.554 38.912 138.519 1.00 24.20 ? 7   PHE B CE1 1 
ATOM   2565 C CE2 . PHE B 1 7   ? 33.898 37.693 139.763 1.00 23.65 ? 7   PHE B CE2 1 
ATOM   2566 C CZ  . PHE B 1 7   ? 35.136 37.742 139.147 1.00 22.13 ? 7   PHE B CZ  1 
ATOM   2567 N N   . PHE B 1 8   ? 35.650 42.524 140.276 1.00 20.66 ? 8   PHE B N   1 
ATOM   2568 C CA  . PHE B 1 8   ? 36.892 43.088 139.746 1.00 19.90 ? 8   PHE B CA  1 
ATOM   2569 C C   . PHE B 1 8   ? 37.392 42.091 138.701 1.00 18.91 ? 8   PHE B C   1 
ATOM   2570 O O   . PHE B 1 8   ? 37.875 41.011 139.049 1.00 23.66 ? 8   PHE B O   1 
ATOM   2571 C CB  . PHE B 1 8   ? 37.953 43.284 140.851 1.00 22.53 ? 8   PHE B CB  1 
ATOM   2572 C CG  . PHE B 1 8   ? 37.858 44.614 141.558 1.00 24.68 ? 8   PHE B CG  1 
ATOM   2573 C CD1 . PHE B 1 8   ? 36.802 44.889 142.417 1.00 28.05 ? 8   PHE B CD1 1 
ATOM   2574 C CD2 . PHE B 1 8   ? 38.828 45.594 141.362 1.00 32.53 ? 8   PHE B CD2 1 
ATOM   2575 C CE1 . PHE B 1 8   ? 36.709 46.117 143.076 1.00 29.76 ? 8   PHE B CE1 1 
ATOM   2576 C CE2 . PHE B 1 8   ? 38.743 46.832 142.018 1.00 29.08 ? 8   PHE B CE2 1 
ATOM   2577 C CZ  . PHE B 1 8   ? 37.680 47.087 142.875 1.00 30.50 ? 8   PHE B CZ  1 
ATOM   2578 N N   . GLU B 1 9   ? 37.260 42.455 137.427 1.00 19.19 ? 9   GLU B N   1 
ATOM   2579 C CA  . GLU B 1 9   ? 37.667 41.601 136.309 1.00 20.96 ? 9   GLU B CA  1 
ATOM   2580 C C   . GLU B 1 9   ? 39.049 41.926 135.759 1.00 24.01 ? 9   GLU B C   1 
ATOM   2581 O O   . GLU B 1 9   ? 39.361 43.082 135.467 1.00 23.03 ? 9   GLU B O   1 
ATOM   2582 C CB  . GLU B 1 9   ? 36.691 41.730 135.125 1.00 24.72 ? 9   GLU B CB  1 
ATOM   2583 C CG  . GLU B 1 9   ? 37.011 40.734 133.989 1.00 29.10 ? 9   GLU B CG  1 
ATOM   2584 C CD  . GLU B 1 9   ? 36.630 41.210 132.584 1.00 28.75 ? 9   GLU B CD  1 
ATOM   2585 O OE1 . GLU B 1 9   ? 35.869 42.188 132.441 1.00 26.84 ? 9   GLU B OE1 1 
ATOM   2586 O OE2 . GLU B 1 9   ? 37.100 40.579 131.616 1.00 28.37 ? 9   GLU B OE2 1 
ATOM   2587 N N   . HIS B 1 10  ? 39.871 40.898 135.607 1.00 23.62 ? 10  HIS B N   1 
ATOM   2588 C CA  . HIS B 1 10  ? 41.192 41.064 135.026 1.00 27.27 ? 10  HIS B CA  1 
ATOM   2589 C C   . HIS B 1 10  ? 41.009 41.391 133.544 1.00 28.19 ? 10  HIS B C   1 
ATOM   2590 O O   . HIS B 1 10  ? 40.170 40.781 132.872 1.00 26.63 ? 10  HIS B O   1 
ATOM   2591 C CB  . HIS B 1 10  ? 42.001 39.754 135.121 1.00 27.96 ? 10  HIS B CB  1 
ATOM   2592 C CG  . HIS B 1 10  ? 43.112 39.660 134.114 1.00 31.22 ? 10  HIS B CG  1 
ATOM   2593 N ND1 . HIS B 1 10  ? 44.341 40.261 134.294 1.00 34.66 ? 10  HIS B ND1 1 
ATOM   2594 C CD2 . HIS B 1 10  ? 43.161 39.069 132.895 1.00 28.03 ? 10  HIS B CD2 1 
ATOM   2595 C CE1 . HIS B 1 10  ? 45.100 40.044 133.232 1.00 25.69 ? 10  HIS B CE1 1 
ATOM   2596 N NE2 . HIS B 1 10  ? 44.405 39.324 132.369 1.00 34.81 ? 10  HIS B NE2 1 
ATOM   2597 N N   . VAL B 1 11  ? 41.772 42.357 133.042 1.00 25.04 ? 11  VAL B N   1 
ATOM   2598 C CA  . VAL B 1 11  ? 41.736 42.686 131.619 1.00 25.24 ? 11  VAL B CA  1 
ATOM   2599 C C   . VAL B 1 11  ? 43.202 42.616 131.176 1.00 28.05 ? 11  VAL B C   1 
ATOM   2600 O O   . VAL B 1 11  ? 43.562 41.827 130.302 1.00 26.70 ? 11  VAL B O   1 
ATOM   2601 C CB  . VAL B 1 11  ? 41.163 44.093 131.335 1.00 25.17 ? 11  VAL B CB  1 
ATOM   2602 C CG1 . VAL B 1 11  ? 41.201 44.352 129.822 1.00 26.01 ? 11  VAL B CG1 1 
ATOM   2603 C CG2 . VAL B 1 11  ? 39.717 44.190 131.810 1.00 20.64 ? 11  VAL B CG2 1 
ATOM   2604 N N   . THR B 1 12  ? 44.043 43.439 131.798 1.00 25.55 ? 12  THR B N   1 
ATOM   2605 C CA  . THR B 1 12  ? 45.479 43.447 131.527 1.00 27.12 ? 12  THR B CA  1 
ATOM   2606 C C   . THR B 1 12  ? 46.179 43.730 132.848 1.00 30.64 ? 12  THR B C   1 
ATOM   2607 O O   . THR B 1 12  ? 45.533 43.991 133.872 1.00 29.63 ? 12  THR B O   1 
ATOM   2608 C CB  . THR B 1 12  ? 45.917 44.564 130.552 1.00 27.42 ? 12  THR B CB  1 
ATOM   2609 O OG1 . THR B 1 12  ? 46.042 45.805 131.268 1.00 28.27 ? 12  THR B OG1 1 
ATOM   2610 C CG2 . THR B 1 12  ? 44.920 44.710 129.402 1.00 25.61 ? 12  THR B CG2 1 
ATOM   2611 N N   . PRO B 1 13  ? 47.512 43.670 132.854 1.00 30.59 ? 13  PRO B N   1 
ATOM   2612 C CA  . PRO B 1 13  ? 48.163 43.955 134.131 1.00 31.01 ? 13  PRO B CA  1 
ATOM   2613 C C   . PRO B 1 13  ? 48.018 45.419 134.554 1.00 29.74 ? 13  PRO B C   1 
ATOM   2614 O O   . PRO B 1 13  ? 48.241 45.754 135.715 1.00 29.31 ? 13  PRO B O   1 
ATOM   2615 C CB  . PRO B 1 13  ? 49.622 43.551 133.880 1.00 32.44 ? 13  PRO B CB  1 
ATOM   2616 C CG  . PRO B 1 13  ? 49.766 43.622 132.361 1.00 33.40 ? 13  PRO B CG  1 
ATOM   2617 C CD  . PRO B 1 13  ? 48.454 43.073 131.888 1.00 31.63 ? 13  PRO B CD  1 
ATOM   2618 N N   . TYR B 1 14  ? 47.603 46.283 133.630 1.00 26.38 ? 14  TYR B N   1 
ATOM   2619 C CA  . TYR B 1 14  ? 47.492 47.708 133.939 1.00 22.91 ? 14  TYR B CA  1 
ATOM   2620 C C   . TYR B 1 14  ? 46.085 48.277 133.865 1.00 23.08 ? 14  TYR B C   1 
ATOM   2621 O O   . TYR B 1 14  ? 45.874 49.455 134.157 1.00 22.25 ? 14  TYR B O   1 
ATOM   2622 C CB  . TYR B 1 14  ? 48.416 48.496 133.007 1.00 26.31 ? 14  TYR B CB  1 
ATOM   2623 C CG  . TYR B 1 14  ? 49.740 47.794 132.800 1.00 27.29 ? 14  TYR B CG  1 
ATOM   2624 C CD1 . TYR B 1 14  ? 50.075 47.254 131.563 1.00 27.71 ? 14  TYR B CD1 1 
ATOM   2625 C CD2 . TYR B 1 14  ? 50.626 47.610 133.864 1.00 31.43 ? 14  TYR B CD2 1 
ATOM   2626 C CE1 . TYR B 1 14  ? 51.270 46.533 131.382 1.00 33.52 ? 14  TYR B CE1 1 
ATOM   2627 C CE2 . TYR B 1 14  ? 51.820 46.893 133.698 1.00 33.76 ? 14  TYR B CE2 1 
ATOM   2628 C CZ  . TYR B 1 14  ? 52.132 46.357 132.454 1.00 35.72 ? 14  TYR B CZ  1 
ATOM   2629 O OH  . TYR B 1 14  ? 53.300 45.647 132.285 1.00 38.88 ? 14  TYR B OH  1 
ATOM   2630 N N   . GLU B 1 15  ? 45.129 47.443 133.472 1.00 20.35 ? 15  GLU B N   1 
ATOM   2631 C CA  . GLU B 1 15  ? 43.751 47.872 133.370 1.00 22.00 ? 15  GLU B CA  1 
ATOM   2632 C C   . GLU B 1 15  ? 42.833 46.786 133.908 1.00 20.61 ? 15  GLU B C   1 
ATOM   2633 O O   . GLU B 1 15  ? 42.923 45.624 133.504 1.00 20.98 ? 15  GLU B O   1 
ATOM   2634 C CB  . GLU B 1 15  ? 43.374 48.171 131.916 1.00 22.23 ? 15  GLU B CB  1 
ATOM   2635 C CG  . GLU B 1 15  ? 43.974 49.446 131.323 1.00 21.51 ? 15  GLU B CG  1 
ATOM   2636 C CD  . GLU B 1 15  ? 45.330 49.226 130.679 1.00 23.46 ? 15  GLU B CD  1 
ATOM   2637 O OE1 . GLU B 1 15  ? 45.608 48.092 130.230 1.00 24.30 ? 15  GLU B OE1 1 
ATOM   2638 O OE2 . GLU B 1 15  ? 46.110 50.199 130.601 1.00 22.99 ? 15  GLU B OE2 1 
ATOM   2639 N N   . THR B 1 16  ? 41.961 47.182 134.828 1.00 19.49 ? 16  THR B N   1 
ATOM   2640 C CA  . THR B 1 16  ? 40.994 46.277 135.442 1.00 20.47 ? 16  THR B CA  1 
ATOM   2641 C C   . THR B 1 16  ? 39.585 46.833 135.245 1.00 20.92 ? 16  THR B C   1 
ATOM   2642 O O   . THR B 1 16  ? 39.360 48.046 135.339 1.00 19.19 ? 16  THR B O   1 
ATOM   2643 C CB  . THR B 1 16  ? 41.280 46.120 136.947 1.00 21.18 ? 16  THR B CB  1 
ATOM   2644 O OG1 . THR B 1 16  ? 42.581 45.537 137.120 1.00 22.31 ? 16  THR B OG1 1 
ATOM   2645 C CG2 . THR B 1 16  ? 40.245 45.229 137.603 1.00 18.12 ? 16  THR B CG2 1 
ATOM   2646 N N   . LEU B 1 17  ? 38.639 45.948 134.962 1.00 20.69 ? 17  LEU B N   1 
ATOM   2647 C CA  . LEU B 1 17  ? 37.256 46.362 134.741 1.00 24.06 ? 17  LEU B CA  1 
ATOM   2648 C C   . LEU B 1 17  ? 36.461 46.052 136.009 1.00 21.21 ? 17  LEU B C   1 
ATOM   2649 O O   . LEU B 1 17  ? 36.473 44.919 136.485 1.00 21.42 ? 17  LEU B O   1 
ATOM   2650 C CB  . LEU B 1 17  ? 36.696 45.591 133.539 1.00 24.99 ? 17  LEU B CB  1 
ATOM   2651 C CG  . LEU B 1 17  ? 35.759 46.230 132.510 1.00 30.89 ? 17  LEU B CG  1 
ATOM   2652 C CD1 . LEU B 1 17  ? 36.019 47.715 132.351 1.00 29.96 ? 17  LEU B CD1 1 
ATOM   2653 C CD2 . LEU B 1 17  ? 35.970 45.500 131.173 1.00 27.94 ? 17  LEU B CD2 1 
ATOM   2654 N N   . VAL B 1 18  ? 35.799 47.067 136.561 1.00 18.92 ? 18  VAL B N   1 
ATOM   2655 C CA  . VAL B 1 18  ? 35.004 46.907 137.773 1.00 18.50 ? 18  VAL B CA  1 
ATOM   2656 C C   . VAL B 1 18  ? 33.542 46.986 137.330 1.00 19.87 ? 18  VAL B C   1 
ATOM   2657 O O   . VAL B 1 18  ? 33.044 48.051 136.950 1.00 18.28 ? 18  VAL B O   1 
ATOM   2658 C CB  . VAL B 1 18  ? 35.367 48.017 138.808 1.00 23.31 ? 18  VAL B CB  1 
ATOM   2659 C CG1 . VAL B 1 18  ? 34.541 47.854 140.075 1.00 22.43 ? 18  VAL B CG1 1 
ATOM   2660 C CG2 . VAL B 1 18  ? 36.870 47.926 139.161 1.00 19.80 ? 18  VAL B CG2 1 
ATOM   2661 N N   . ARG B 1 19  ? 32.871 45.841 137.367 1.00 18.05 ? 19  ARG B N   1 
ATOM   2662 C CA  . ARG B 1 19  ? 31.491 45.720 136.906 1.00 19.60 ? 19  ARG B CA  1 
ATOM   2663 C C   . ARG B 1 19  ? 30.495 45.591 138.045 1.00 19.90 ? 19  ARG B C   1 
ATOM   2664 O O   . ARG B 1 19  ? 30.633 44.720 138.900 1.00 19.45 ? 19  ARG B O   1 
ATOM   2665 C CB  . ARG B 1 19  ? 31.350 44.494 135.999 1.00 19.99 ? 19  ARG B CB  1 
ATOM   2666 C CG  . ARG B 1 19  ? 32.341 44.423 134.842 1.00 24.50 ? 19  ARG B CG  1 
ATOM   2667 C CD  . ARG B 1 19  ? 32.110 43.110 134.077 1.00 26.43 ? 19  ARG B CD  1 
ATOM   2668 N NE  . ARG B 1 19  ? 33.044 42.915 132.978 1.00 32.13 ? 19  ARG B NE  1 
ATOM   2669 C CZ  . ARG B 1 19  ? 32.711 42.974 131.694 1.00 22.40 ? 19  ARG B CZ  1 
ATOM   2670 N NH1 . ARG B 1 19  ? 31.457 43.231 131.342 1.00 22.06 ? 19  ARG B NH1 1 
ATOM   2671 N NH2 . ARG B 1 19  ? 33.636 42.753 130.767 1.00 27.33 ? 19  ARG B NH2 1 
ATOM   2672 N N   . ARG B 1 20  ? 29.475 46.444 138.025 1.00 18.62 ? 20  ARG B N   1 
ATOM   2673 C CA  . ARG B 1 20  ? 28.462 46.446 139.065 1.00 21.12 ? 20  ARG B CA  1 
ATOM   2674 C C   . ARG B 1 20  ? 27.614 45.190 138.981 1.00 21.81 ? 20  ARG B C   1 
ATOM   2675 O O   . ARG B 1 20  ? 27.154 44.813 137.904 1.00 21.36 ? 20  ARG B O   1 
ATOM   2676 C CB  . ARG B 1 20  ? 27.558 47.679 138.915 1.00 23.81 ? 20  ARG B CB  1 
ATOM   2677 C CG  . ARG B 1 20  ? 26.579 47.849 140.072 1.00 27.30 ? 20  ARG B CG  1 
ATOM   2678 C CD  . ARG B 1 20  ? 25.719 49.084 139.914 1.00 36.73 ? 20  ARG B CD  1 
ATOM   2679 N NE  . ARG B 1 20  ? 24.857 49.281 141.077 1.00 45.71 ? 20  ARG B NE  1 
ATOM   2680 C CZ  . ARG B 1 20  ? 25.301 49.531 142.307 1.00 46.10 ? 20  ARG B CZ  1 
ATOM   2681 N NH1 . ARG B 1 20  ? 26.601 49.620 142.539 1.00 49.90 ? 20  ARG B NH1 1 
ATOM   2682 N NH2 . ARG B 1 20  ? 24.445 49.690 143.308 1.00 48.48 ? 20  ARG B NH2 1 
ATOM   2683 N N   . MET B 1 21  ? 27.421 44.529 140.116 1.00 23.73 ? 21  MET B N   1 
ATOM   2684 C CA  . MET B 1 21  ? 26.600 43.340 140.145 1.00 24.11 ? 21  MET B CA  1 
ATOM   2685 C C   . MET B 1 21  ? 25.284 43.702 140.810 1.00 27.89 ? 21  MET B C   1 
ATOM   2686 O O   . MET B 1 21  ? 25.263 44.194 141.939 1.00 26.17 ? 21  MET B O   1 
ATOM   2687 C CB  . MET B 1 21  ? 27.286 42.214 140.919 1.00 23.99 ? 21  MET B CB  1 
ATOM   2688 C CG  . MET B 1 21  ? 28.664 41.846 140.383 1.00 24.54 ? 21  MET B CG  1 
ATOM   2689 S SD  . MET B 1 21  ? 29.306 40.351 141.162 1.00 26.72 ? 21  MET B SD  1 
ATOM   2690 C CE  . MET B 1 21  ? 29.160 40.758 142.921 1.00 28.45 ? 21  MET B CE  1 
ATOM   2691 N N   . GLU B 1 22  ? 24.190 43.465 140.097 1.00 28.02 ? 22  GLU B N   1 
ATOM   2692 C CA  . GLU B 1 22  ? 22.859 43.750 140.608 1.00 32.31 ? 22  GLU B CA  1 
ATOM   2693 C C   . GLU B 1 22  ? 22.475 42.666 141.619 1.00 31.93 ? 22  GLU B C   1 
ATOM   2694 O O   . GLU B 1 22  ? 21.867 42.952 142.649 1.00 32.20 ? 22  GLU B O   1 
ATOM   2695 C CB  . GLU B 1 22  ? 21.860 43.809 139.444 1.00 32.83 ? 22  GLU B CB  1 
ATOM   2696 C CG  . GLU B 1 22  ? 21.087 45.121 139.377 1.00 44.02 ? 22  GLU B CG  1 
ATOM   2697 C CD  . GLU B 1 22  ? 21.977 46.367 139.374 1.00 45.35 ? 22  GLU B CD  1 
ATOM   2698 O OE1 . GLU B 1 22  ? 21.452 47.456 139.679 1.00 48.35 ? 22  GLU B OE1 1 
ATOM   2699 O OE2 . GLU B 1 22  ? 23.185 46.274 139.062 1.00 47.51 ? 22  GLU B OE2 1 
ATOM   2700 N N   . ARG B 1 23  ? 22.843 41.425 141.320 1.00 27.31 ? 23  ARG B N   1 
ATOM   2701 C CA  . ARG B 1 23  ? 22.593 40.298 142.209 1.00 30.09 ? 23  ARG B CA  1 
ATOM   2702 C C   . ARG B 1 23  ? 23.394 39.120 141.666 1.00 28.59 ? 23  ARG B C   1 
ATOM   2703 O O   . ARG B 1 23  ? 23.673 39.058 140.463 1.00 29.78 ? 23  ARG B O   1 
ATOM   2704 C CB  . ARG B 1 23  ? 21.096 39.954 142.272 1.00 35.59 ? 23  ARG B CB  1 
ATOM   2705 C CG  . ARG B 1 23  ? 20.567 39.138 141.111 1.00 42.94 ? 23  ARG B CG  1 
ATOM   2706 C CD  . ARG B 1 23  ? 19.059 38.888 141.258 1.00 50.43 ? 23  ARG B CD  1 
ATOM   2707 N NE  . ARG B 1 23  ? 18.531 38.053 140.178 1.00 55.79 ? 23  ARG B NE  1 
ATOM   2708 C CZ  . ARG B 1 23  ? 18.666 36.729 140.115 1.00 58.30 ? 23  ARG B CZ  1 
ATOM   2709 N NH1 . ARG B 1 23  ? 19.309 36.078 141.077 1.00 56.75 ? 23  ARG B NH1 1 
ATOM   2710 N NH2 . ARG B 1 23  ? 18.169 36.057 139.083 1.00 60.17 ? 23  ARG B NH2 1 
ATOM   2711 N N   . VAL B 1 24  ? 23.786 38.205 142.544 1.00 23.06 ? 24  VAL B N   1 
ATOM   2712 C CA  . VAL B 1 24  ? 24.578 37.054 142.130 1.00 24.51 ? 24  VAL B CA  1 
ATOM   2713 C C   . VAL B 1 24  ? 23.676 35.848 141.938 1.00 29.43 ? 24  VAL B C   1 
ATOM   2714 O O   . VAL B 1 24  ? 22.922 35.474 142.841 1.00 26.43 ? 24  VAL B O   1 
ATOM   2715 C CB  . VAL B 1 24  ? 25.676 36.717 143.167 1.00 26.18 ? 24  VAL B CB  1 
ATOM   2716 C CG1 . VAL B 1 24  ? 26.517 35.529 142.689 1.00 26.24 ? 24  VAL B CG1 1 
ATOM   2717 C CG2 . VAL B 1 24  ? 26.572 37.941 143.385 1.00 28.57 ? 24  VAL B CG2 1 
ATOM   2718 N N   . ILE B 1 25  ? 23.756 35.252 140.749 1.00 24.85 ? 25  ILE B N   1 
ATOM   2719 C CA  . ILE B 1 25  ? 22.945 34.090 140.413 1.00 29.72 ? 25  ILE B CA  1 
ATOM   2720 C C   . ILE B 1 25  ? 23.594 32.805 140.912 1.00 30.00 ? 25  ILE B C   1 
ATOM   2721 O O   . ILE B 1 25  ? 22.958 31.997 141.583 1.00 32.44 ? 25  ILE B O   1 
ATOM   2722 C CB  . ILE B 1 25  ? 22.729 34.011 138.884 1.00 26.25 ? 25  ILE B CB  1 
ATOM   2723 C CG1 . ILE B 1 25  ? 21.955 35.247 138.424 1.00 30.72 ? 25  ILE B CG1 1 
ATOM   2724 C CG2 . ILE B 1 25  ? 21.969 32.742 138.522 1.00 30.65 ? 25  ILE B CG2 1 
ATOM   2725 C CD1 . ILE B 1 25  ? 21.755 35.330 136.909 1.00 35.24 ? 25  ILE B CD1 1 
ATOM   2726 N N   . ALA B 1 26  ? 24.863 32.621 140.587 1.00 29.19 ? 26  ALA B N   1 
ATOM   2727 C CA  . ALA B 1 26  ? 25.586 31.435 141.010 1.00 29.26 ? 26  ALA B CA  1 
ATOM   2728 C C   . ALA B 1 26  ? 27.063 31.733 141.018 1.00 30.08 ? 26  ALA B C   1 
ATOM   2729 O O   . ALA B 1 26  ? 27.535 32.594 140.277 1.00 28.69 ? 26  ALA B O   1 
ATOM   2730 C CB  . ALA B 1 26  ? 25.304 30.279 140.065 1.00 25.69 ? 26  ALA B CB  1 
ATOM   2731 N N   . SER B 1 27  ? 27.785 31.029 141.878 1.00 29.87 ? 27  SER B N   1 
ATOM   2732 C CA  . SER B 1 27  ? 29.229 31.177 141.980 1.00 32.29 ? 27  SER B CA  1 
ATOM   2733 C C   . SER B 1 27  ? 29.722 29.853 142.530 1.00 32.65 ? 27  SER B C   1 
ATOM   2734 O O   . SER B 1 27  ? 28.988 29.158 143.229 1.00 34.90 ? 27  SER B O   1 
ATOM   2735 C CB  . SER B 1 27  ? 29.611 32.341 142.914 1.00 33.96 ? 27  SER B CB  1 
ATOM   2736 O OG  . SER B 1 27  ? 29.210 32.120 144.258 1.00 35.94 ? 27  SER B OG  1 
ATOM   2737 N N   . GLY B 1 28  ? 30.944 29.478 142.188 1.00 34.10 ? 28  GLY B N   1 
ATOM   2738 C CA  . GLY B 1 28  ? 31.454 28.217 142.676 1.00 33.52 ? 28  GLY B CA  1 
ATOM   2739 C C   . GLY B 1 28  ? 32.811 27.889 142.112 1.00 36.05 ? 28  GLY B C   1 
ATOM   2740 O O   . GLY B 1 28  ? 33.509 28.749 141.577 1.00 35.53 ? 28  GLY B O   1 
ATOM   2741 N N   . LYS B 1 29  ? 33.183 26.625 142.221 1.00 36.16 ? 29  LYS B N   1 
ATOM   2742 C CA  . LYS B 1 29  ? 34.473 26.188 141.737 1.00 36.83 ? 29  LYS B CA  1 
ATOM   2743 C C   . LYS B 1 29  ? 34.409 24.744 141.289 1.00 36.77 ? 29  LYS B C   1 
ATOM   2744 O O   . LYS B 1 29  ? 34.066 23.867 142.067 1.00 36.38 ? 29  LYS B O   1 
ATOM   2745 C CB  . LYS B 1 29  ? 35.507 26.336 142.853 1.00 40.28 ? 29  LYS B CB  1 
ATOM   2746 C CG  . LYS B 1 29  ? 36.777 25.537 142.648 1.00 44.95 ? 29  LYS B CG  1 
ATOM   2747 C CD  . LYS B 1 29  ? 37.640 25.579 143.899 1.00 50.17 ? 29  LYS B CD  1 
ATOM   2748 C CE  . LYS B 1 29  ? 38.693 24.479 143.889 1.00 52.56 ? 29  LYS B CE  1 
ATOM   2749 N NZ  . LYS B 1 29  ? 39.319 24.288 145.234 1.00 52.28 ? 29  LYS B NZ  1 
ATOM   2750 N N   . THR B 1 30  ? 34.732 24.501 140.026 1.00 36.61 ? 30  THR B N   1 
ATOM   2751 C CA  . THR B 1 30  ? 34.740 23.140 139.507 1.00 35.48 ? 30  THR B CA  1 
ATOM   2752 C C   . THR B 1 30  ? 36.187 22.719 139.696 1.00 37.20 ? 30  THR B C   1 
ATOM   2753 O O   . THR B 1 30  ? 37.015 23.518 140.123 1.00 37.72 ? 30  THR B O   1 
ATOM   2754 C CB  . THR B 1 30  ? 34.419 23.097 137.999 1.00 31.99 ? 30  THR B CB  1 
ATOM   2755 O OG1 . THR B 1 30  ? 35.553 23.567 137.264 1.00 27.99 ? 30  THR B OG1 1 
ATOM   2756 C CG2 . THR B 1 30  ? 33.218 23.977 137.682 1.00 33.11 ? 30  THR B CG2 1 
ATOM   2757 N N   . PRO B 1 31  ? 36.519 21.463 139.388 1.00 38.76 ? 31  PRO B N   1 
ATOM   2758 C CA  . PRO B 1 31  ? 37.922 21.091 139.578 1.00 38.51 ? 31  PRO B CA  1 
ATOM   2759 C C   . PRO B 1 31  ? 38.865 21.775 138.591 1.00 40.00 ? 31  PRO B C   1 
ATOM   2760 O O   . PRO B 1 31  ? 40.090 21.677 138.720 1.00 40.45 ? 31  PRO B O   1 
ATOM   2761 C CB  . PRO B 1 31  ? 37.896 19.571 139.415 1.00 39.88 ? 31  PRO B CB  1 
ATOM   2762 C CG  . PRO B 1 31  ? 36.727 19.342 138.515 1.00 41.18 ? 31  PRO B CG  1 
ATOM   2763 C CD  . PRO B 1 31  ? 35.699 20.286 139.065 1.00 39.39 ? 31  PRO B CD  1 
ATOM   2764 N N   . PHE B 1 32  ? 38.300 22.484 137.616 1.00 36.75 ? 32  PHE B N   1 
ATOM   2765 C CA  . PHE B 1 32  ? 39.121 23.155 136.609 1.00 36.53 ? 32  PHE B CA  1 
ATOM   2766 C C   . PHE B 1 32  ? 39.206 24.673 136.726 1.00 34.73 ? 32  PHE B C   1 
ATOM   2767 O O   . PHE B 1 32  ? 40.249 25.258 136.437 1.00 36.47 ? 32  PHE B O   1 
ATOM   2768 C CB  . PHE B 1 32  ? 38.617 22.800 135.204 1.00 38.41 ? 32  PHE B CB  1 
ATOM   2769 C CG  . PHE B 1 32  ? 38.598 21.326 134.920 1.00 37.81 ? 32  PHE B CG  1 
ATOM   2770 C CD1 . PHE B 1 32  ? 39.751 20.669 134.506 1.00 38.86 ? 32  PHE B CD1 1 
ATOM   2771 C CD2 . PHE B 1 32  ? 37.428 20.589 135.090 1.00 37.61 ? 32  PHE B CD2 1 
ATOM   2772 C CE1 . PHE B 1 32  ? 39.738 19.291 134.264 1.00 37.92 ? 32  PHE B CE1 1 
ATOM   2773 C CE2 . PHE B 1 32  ? 37.404 19.215 134.852 1.00 38.40 ? 32  PHE B CE2 1 
ATOM   2774 C CZ  . PHE B 1 32  ? 38.560 18.568 134.440 1.00 38.58 ? 32  PHE B CZ  1 
ATOM   2775 N N   . GLN B 1 33  ? 38.125 25.318 137.149 1.00 33.23 ? 33  GLN B N   1 
ATOM   2776 C CA  . GLN B 1 33  ? 38.127 26.777 137.231 1.00 32.85 ? 33  GLN B CA  1 
ATOM   2777 C C   . GLN B 1 33  ? 37.065 27.308 138.175 1.00 31.08 ? 33  GLN B C   1 
ATOM   2778 O O   . GLN B 1 33  ? 36.163 26.572 138.574 1.00 34.73 ? 33  GLN B O   1 
ATOM   2779 C CB  . GLN B 1 33  ? 37.875 27.340 135.832 1.00 32.04 ? 33  GLN B CB  1 
ATOM   2780 C CG  . GLN B 1 33  ? 36.579 26.812 135.228 1.00 29.09 ? 33  GLN B CG  1 
ATOM   2781 C CD  . GLN B 1 33  ? 36.548 26.883 133.710 1.00 35.78 ? 33  GLN B CD  1 
ATOM   2782 O OE1 . GLN B 1 33  ? 35.867 26.086 133.057 1.00 36.85 ? 33  GLN B OE1 1 
ATOM   2783 N NE2 . GLN B 1 33  ? 37.273 27.836 133.141 1.00 28.28 ? 33  GLN B NE2 1 
ATOM   2784 N N   . ASP B 1 34  ? 37.178 28.583 138.543 1.00 32.84 ? 34  ASP B N   1 
ATOM   2785 C CA  . ASP B 1 34  ? 36.168 29.213 139.404 1.00 31.86 ? 34  ASP B CA  1 
ATOM   2786 C C   . ASP B 1 34  ? 35.162 29.851 138.444 1.00 30.63 ? 34  ASP B C   1 
ATOM   2787 O O   . ASP B 1 34  ? 35.540 30.273 137.354 1.00 25.63 ? 34  ASP B O   1 
ATOM   2788 C CB  . ASP B 1 34  ? 36.759 30.329 140.272 1.00 32.25 ? 34  ASP B CB  1 
ATOM   2789 C CG  . ASP B 1 34  ? 37.858 29.845 141.192 1.00 35.98 ? 34  ASP B CG  1 
ATOM   2790 O OD1 . ASP B 1 34  ? 37.721 28.747 141.765 1.00 38.74 ? 34  ASP B OD1 1 
ATOM   2791 O OD2 . ASP B 1 34  ? 38.855 30.581 141.346 1.00 38.96 ? 34  ASP B OD2 1 
ATOM   2792 N N   . TYR B 1 35  ? 33.898 29.935 138.845 1.00 28.54 ? 35  TYR B N   1 
ATOM   2793 C CA  . TYR B 1 35  ? 32.901 30.540 137.980 1.00 27.28 ? 35  TYR B CA  1 
ATOM   2794 C C   . TYR B 1 35  ? 32.002 31.467 138.788 1.00 29.07 ? 35  TYR B C   1 
ATOM   2795 O O   . TYR B 1 35  ? 31.763 31.245 139.976 1.00 29.92 ? 35  TYR B O   1 
ATOM   2796 C CB  . TYR B 1 35  ? 32.081 29.449 137.273 1.00 27.70 ? 35  TYR B CB  1 
ATOM   2797 C CG  . TYR B 1 35  ? 31.188 28.642 138.188 1.00 30.41 ? 35  TYR B CG  1 
ATOM   2798 C CD1 . TYR B 1 35  ? 29.931 29.115 138.557 1.00 31.72 ? 35  TYR B CD1 1 
ATOM   2799 C CD2 . TYR B 1 35  ? 31.612 27.423 138.708 1.00 30.43 ? 35  TYR B CD2 1 
ATOM   2800 C CE1 . TYR B 1 35  ? 29.117 28.394 139.424 1.00 32.57 ? 35  TYR B CE1 1 
ATOM   2801 C CE2 . TYR B 1 35  ? 30.807 26.693 139.576 1.00 34.34 ? 35  TYR B CE2 1 
ATOM   2802 C CZ  . TYR B 1 35  ? 29.561 27.187 139.930 1.00 34.09 ? 35  TYR B CZ  1 
ATOM   2803 O OH  . TYR B 1 35  ? 28.760 26.477 140.790 1.00 32.46 ? 35  TYR B OH  1 
ATOM   2804 N N   . PHE B 1 36  ? 31.532 32.525 138.142 1.00 24.44 ? 36  PHE B N   1 
ATOM   2805 C CA  . PHE B 1 36  ? 30.646 33.492 138.776 1.00 22.75 ? 36  PHE B CA  1 
ATOM   2806 C C   . PHE B 1 36  ? 29.643 33.924 137.721 1.00 23.09 ? 36  PHE B C   1 
ATOM   2807 O O   . PHE B 1 36  ? 30.027 34.279 136.608 1.00 24.22 ? 36  PHE B O   1 
ATOM   2808 C CB  . PHE B 1 36  ? 31.418 34.740 139.236 1.00 23.46 ? 36  PHE B CB  1 
ATOM   2809 C CG  . PHE B 1 36  ? 32.617 34.444 140.097 1.00 24.77 ? 36  PHE B CG  1 
ATOM   2810 C CD1 . PHE B 1 36  ? 32.514 34.445 141.485 1.00 25.06 ? 36  PHE B CD1 1 
ATOM   2811 C CD2 . PHE B 1 36  ? 33.850 34.170 139.518 1.00 26.58 ? 36  PHE B CD2 1 
ATOM   2812 C CE1 . PHE B 1 36  ? 33.631 34.177 142.284 1.00 26.31 ? 36  PHE B CE1 1 
ATOM   2813 C CE2 . PHE B 1 36  ? 34.977 33.899 140.312 1.00 25.72 ? 36  PHE B CE2 1 
ATOM   2814 C CZ  . PHE B 1 36  ? 34.860 33.905 141.693 1.00 30.99 ? 36  PHE B CZ  1 
ATOM   2815 N N   . LEU B 1 37  ? 28.361 33.893 138.060 1.00 23.26 ? 37  LEU B N   1 
ATOM   2816 C CA  . LEU B 1 37  ? 27.319 34.322 137.125 1.00 25.12 ? 37  LEU B CA  1 
ATOM   2817 C C   . LEU B 1 37  ? 26.489 35.377 137.853 1.00 25.40 ? 37  LEU B C   1 
ATOM   2818 O O   . LEU B 1 37  ? 25.908 35.087 138.901 1.00 28.90 ? 37  LEU B O   1 
ATOM   2819 C CB  . LEU B 1 37  ? 26.427 33.134 136.735 1.00 23.26 ? 37  LEU B CB  1 
ATOM   2820 C CG  . LEU B 1 37  ? 25.333 33.412 135.703 1.00 25.32 ? 37  LEU B CG  1 
ATOM   2821 C CD1 . LEU B 1 37  ? 25.959 33.724 134.346 1.00 21.76 ? 37  LEU B CD1 1 
ATOM   2822 C CD2 . LEU B 1 37  ? 24.413 32.203 135.588 1.00 24.07 ? 37  LEU B CD2 1 
ATOM   2823 N N   . PHE B 1 38  ? 26.442 36.596 137.323 1.00 25.21 ? 38  PHE B N   1 
ATOM   2824 C CA  . PHE B 1 38  ? 25.675 37.646 137.981 1.00 25.48 ? 38  PHE B CA  1 
ATOM   2825 C C   . PHE B 1 38  ? 24.883 38.512 137.017 1.00 25.20 ? 38  PHE B C   1 
ATOM   2826 O O   . PHE B 1 38  ? 25.133 38.548 135.811 1.00 24.60 ? 38  PHE B O   1 
ATOM   2827 C CB  . PHE B 1 38  ? 26.581 38.541 138.868 1.00 22.99 ? 38  PHE B CB  1 
ATOM   2828 C CG  . PHE B 1 38  ? 27.628 39.313 138.105 1.00 20.23 ? 38  PHE B CG  1 
ATOM   2829 C CD1 . PHE B 1 38  ? 28.890 38.779 137.893 1.00 20.86 ? 38  PHE B CD1 1 
ATOM   2830 C CD2 . PHE B 1 38  ? 27.329 40.555 137.556 1.00 19.30 ? 38  PHE B CD2 1 
ATOM   2831 C CE1 . PHE B 1 38  ? 29.848 39.474 137.133 1.00 19.48 ? 38  PHE B CE1 1 
ATOM   2832 C CE2 . PHE B 1 38  ? 28.274 41.253 136.801 1.00 22.37 ? 38  PHE B CE2 1 
ATOM   2833 C CZ  . PHE B 1 38  ? 29.535 40.709 136.590 1.00 20.13 ? 38  PHE B CZ  1 
ATOM   2834 N N   . GLU B 1 39  ? 23.906 39.208 137.570 1.00 26.57 ? 39  GLU B N   1 
ATOM   2835 C CA  . GLU B 1 39  ? 23.069 40.081 136.786 1.00 26.31 ? 39  GLU B CA  1 
ATOM   2836 C C   . GLU B 1 39  ? 23.683 41.476 136.748 1.00 26.40 ? 39  GLU B C   1 
ATOM   2837 O O   . GLU B 1 39  ? 23.983 42.052 137.796 1.00 24.39 ? 39  GLU B O   1 
ATOM   2838 C CB  . GLU B 1 39  ? 21.681 40.146 137.425 1.00 31.53 ? 39  GLU B CB  1 
ATOM   2839 C CG  . GLU B 1 39  ? 20.633 40.791 136.557 1.00 40.71 ? 39  GLU B CG  1 
ATOM   2840 C CD  . GLU B 1 39  ? 20.417 40.024 135.262 1.00 43.56 ? 39  GLU B CD  1 
ATOM   2841 O OE1 . GLU B 1 39  ? 20.156 38.800 135.322 1.00 47.92 ? 39  GLU B OE1 1 
ATOM   2842 O OE2 . GLU B 1 39  ? 20.503 40.650 134.188 1.00 46.57 ? 39  GLU B OE2 1 
ATOM   2843 N N   . SER B 1 40  ? 23.876 42.011 135.547 1.00 25.90 ? 40  SER B N   1 
ATOM   2844 C CA  . SER B 1 40  ? 24.408 43.360 135.377 1.00 27.83 ? 40  SER B CA  1 
ATOM   2845 C C   . SER B 1 40  ? 23.308 44.147 134.661 1.00 28.57 ? 40  SER B C   1 
ATOM   2846 O O   . SER B 1 40  ? 22.580 43.591 133.849 1.00 25.66 ? 40  SER B O   1 
ATOM   2847 C CB  . SER B 1 40  ? 25.683 43.351 134.520 1.00 31.85 ? 40  SER B CB  1 
ATOM   2848 O OG  . SER B 1 40  ? 25.387 43.145 133.142 1.00 29.81 ? 40  SER B OG  1 
ATOM   2849 N N   . LYS B 1 41  ? 23.177 45.432 134.959 1.00 29.96 ? 41  LYS B N   1 
ATOM   2850 C CA  . LYS B 1 41  ? 22.141 46.235 134.325 1.00 28.52 ? 41  LYS B CA  1 
ATOM   2851 C C   . LYS B 1 41  ? 22.390 46.508 132.859 1.00 31.21 ? 41  LYS B C   1 
ATOM   2852 O O   . LYS B 1 41  ? 21.448 46.639 132.085 1.00 31.82 ? 41  LYS B O   1 
ATOM   2853 C CB  . LYS B 1 41  ? 21.955 47.563 135.058 1.00 31.20 ? 41  LYS B CB  1 
ATOM   2854 C CG  . LYS B 1 41  ? 21.062 47.451 136.272 1.00 38.48 ? 41  LYS B CG  1 
ATOM   2855 C CD  . LYS B 1 41  ? 20.239 48.713 136.454 1.00 42.97 ? 41  LYS B CD  1 
ATOM   2856 C CE  . LYS B 1 41  ? 19.341 48.618 137.673 1.00 47.01 ? 41  LYS B CE  1 
ATOM   2857 N NZ  . LYS B 1 41  ? 18.374 49.759 137.732 1.00 48.29 ? 41  LYS B NZ  1 
ATOM   2858 N N   . GLY B 1 42  ? 23.657 46.589 132.472 1.00 29.37 ? 42  GLY B N   1 
ATOM   2859 C CA  . GLY B 1 42  ? 23.962 46.853 131.081 1.00 31.93 ? 42  GLY B CA  1 
ATOM   2860 C C   . GLY B 1 42  ? 23.954 45.633 130.173 1.00 31.47 ? 42  GLY B C   1 
ATOM   2861 O O   . GLY B 1 42  ? 23.297 45.628 129.133 1.00 32.88 ? 42  GLY B O   1 
ATOM   2862 N N   . PHE B 1 43  ? 24.660 44.582 130.565 1.00 28.62 ? 43  PHE B N   1 
ATOM   2863 C CA  . PHE B 1 43  ? 24.747 43.400 129.719 1.00 26.07 ? 43  PHE B CA  1 
ATOM   2864 C C   . PHE B 1 43  ? 23.953 42.168 130.133 1.00 26.67 ? 43  PHE B C   1 
ATOM   2865 O O   . PHE B 1 43  ? 24.130 41.097 129.551 1.00 25.32 ? 43  PHE B O   1 
ATOM   2866 C CB  . PHE B 1 43  ? 26.214 43.020 129.569 1.00 22.68 ? 43  PHE B CB  1 
ATOM   2867 C CG  . PHE B 1 43  ? 27.022 44.039 128.820 1.00 23.11 ? 43  PHE B CG  1 
ATOM   2868 C CD1 . PHE B 1 43  ? 26.934 44.130 127.439 1.00 22.08 ? 43  PHE B CD1 1 
ATOM   2869 C CD2 . PHE B 1 43  ? 27.851 44.918 129.498 1.00 22.52 ? 43  PHE B CD2 1 
ATOM   2870 C CE1 . PHE B 1 43  ? 27.663 45.086 126.738 1.00 21.14 ? 43  PHE B CE1 1 
ATOM   2871 C CE2 . PHE B 1 43  ? 28.589 45.884 128.808 1.00 26.64 ? 43  PHE B CE2 1 
ATOM   2872 C CZ  . PHE B 1 43  ? 28.491 45.966 127.424 1.00 24.05 ? 43  PHE B CZ  1 
ATOM   2873 N N   . GLY B 1 44  ? 23.071 42.314 131.116 1.00 23.37 ? 44  GLY B N   1 
ATOM   2874 C CA  . GLY B 1 44  ? 22.314 41.165 131.571 1.00 22.81 ? 44  GLY B CA  1 
ATOM   2875 C C   . GLY B 1 44  ? 23.232 40.221 132.322 1.00 24.36 ? 44  GLY B C   1 
ATOM   2876 O O   . GLY B 1 44  ? 24.187 40.666 132.970 1.00 24.30 ? 44  GLY B O   1 
ATOM   2877 N N   . LYS B 1 45  ? 22.963 38.919 132.247 1.00 21.19 ? 45  LYS B N   1 
ATOM   2878 C CA  . LYS B 1 45  ? 23.791 37.952 132.946 1.00 22.81 ? 45  LYS B CA  1 
ATOM   2879 C C   . LYS B 1 45  ? 25.211 37.977 132.411 1.00 24.76 ? 45  LYS B C   1 
ATOM   2880 O O   . LYS B 1 45  ? 25.432 38.087 131.201 1.00 22.35 ? 45  LYS B O   1 
ATOM   2881 C CB  . LYS B 1 45  ? 23.246 36.534 132.797 1.00 22.14 ? 45  LYS B CB  1 
ATOM   2882 C CG  . LYS B 1 45  ? 21.932 36.257 133.516 1.00 28.26 ? 45  LYS B CG  1 
ATOM   2883 C CD  . LYS B 1 45  ? 21.559 34.796 133.323 1.00 26.46 ? 45  LYS B CD  1 
ATOM   2884 C CE  . LYS B 1 45  ? 20.176 34.477 133.843 1.00 32.12 ? 45  LYS B CE  1 
ATOM   2885 N NZ  . LYS B 1 45  ? 19.867 33.045 133.559 1.00 28.45 ? 45  LYS B NZ  1 
ATOM   2886 N N   . VAL B 1 46  ? 26.170 37.891 133.326 1.00 21.87 ? 46  VAL B N   1 
ATOM   2887 C CA  . VAL B 1 46  ? 27.581 37.878 132.958 1.00 20.70 ? 46  VAL B CA  1 
ATOM   2888 C C   . VAL B 1 46  ? 28.212 36.658 133.590 1.00 22.87 ? 46  VAL B C   1 
ATOM   2889 O O   . VAL B 1 46  ? 27.994 36.377 134.772 1.00 25.90 ? 46  VAL B O   1 
ATOM   2890 C CB  . VAL B 1 46  ? 28.325 39.129 133.469 1.00 20.52 ? 46  VAL B CB  1 
ATOM   2891 C CG1 . VAL B 1 46  ? 29.821 39.002 133.169 1.00 16.35 ? 46  VAL B CG1 1 
ATOM   2892 C CG2 . VAL B 1 46  ? 27.748 40.373 132.827 1.00 20.55 ? 46  VAL B CG2 1 
ATOM   2893 N N   . LEU B 1 47  ? 28.977 35.918 132.796 1.00 22.96 ? 47  LEU B N   1 
ATOM   2894 C CA  . LEU B 1 47  ? 29.651 34.738 133.304 1.00 22.68 ? 47  LEU B CA  1 
ATOM   2895 C C   . LEU B 1 47  ? 31.136 35.051 133.330 1.00 23.31 ? 47  LEU B C   1 
ATOM   2896 O O   . LEU B 1 47  ? 31.717 35.483 132.330 1.00 19.31 ? 47  LEU B O   1 
ATOM   2897 C CB  . LEU B 1 47  ? 29.385 33.537 132.387 1.00 22.64 ? 47  LEU B CB  1 
ATOM   2898 C CG  . LEU B 1 47  ? 29.787 32.076 132.656 1.00 27.10 ? 47  LEU B CG  1 
ATOM   2899 C CD1 . LEU B 1 47  ? 30.969 31.722 131.822 1.00 28.42 ? 47  LEU B CD1 1 
ATOM   2900 C CD2 . LEU B 1 47  ? 30.027 31.807 134.124 1.00 19.67 ? 47  LEU B CD2 1 
ATOM   2901 N N   . ILE B 1 48  ? 31.734 34.842 134.490 1.00 21.24 ? 48  ILE B N   1 
ATOM   2902 C CA  . ILE B 1 48  ? 33.155 35.063 134.678 1.00 24.01 ? 48  ILE B CA  1 
ATOM   2903 C C   . ILE B 1 48  ? 33.754 33.686 134.916 1.00 24.60 ? 48  ILE B C   1 
ATOM   2904 O O   . ILE B 1 48  ? 33.193 32.889 135.665 1.00 27.75 ? 48  ILE B O   1 
ATOM   2905 C CB  . ILE B 1 48  ? 33.442 35.889 135.963 1.00 24.83 ? 48  ILE B CB  1 
ATOM   2906 C CG1 . ILE B 1 48  ? 32.705 37.234 135.926 1.00 25.03 ? 48  ILE B CG1 1 
ATOM   2907 C CG2 . ILE B 1 48  ? 34.937 36.007 136.173 1.00 26.06 ? 48  ILE B CG2 1 
ATOM   2908 C CD1 . ILE B 1 48  ? 33.250 38.264 134.965 1.00 23.92 ? 48  ILE B CD1 1 
ATOM   2909 N N   . LEU B 1 49  ? 34.884 33.400 134.284 1.00 23.53 ? 49  LEU B N   1 
ATOM   2910 C CA  . LEU B 1 49  ? 35.567 32.134 134.512 1.00 24.34 ? 49  LEU B CA  1 
ATOM   2911 C C   . LEU B 1 49  ? 36.915 32.526 135.132 1.00 27.23 ? 49  LEU B C   1 
ATOM   2912 O O   . LEU B 1 49  ? 37.729 33.190 134.499 1.00 26.48 ? 49  LEU B O   1 
ATOM   2913 C CB  . LEU B 1 49  ? 35.751 31.396 133.184 1.00 28.96 ? 49  LEU B CB  1 
ATOM   2914 C CG  . LEU B 1 49  ? 34.952 30.103 132.960 1.00 30.95 ? 49  LEU B CG  1 
ATOM   2915 C CD1 . LEU B 1 49  ? 33.637 30.109 133.727 1.00 23.17 ? 49  LEU B CD1 1 
ATOM   2916 C CD2 . LEU B 1 49  ? 34.733 29.910 131.473 1.00 27.22 ? 49  LEU B CD2 1 
ATOM   2917 N N   . ASP B 1 50  ? 37.132 32.138 136.382 1.00 30.19 ? 50  ASP B N   1 
ATOM   2918 C CA  . ASP B 1 50  ? 38.355 32.485 137.091 1.00 28.73 ? 50  ASP B CA  1 
ATOM   2919 C C   . ASP B 1 50  ? 38.394 33.995 137.283 1.00 28.73 ? 50  ASP B C   1 
ATOM   2920 O O   . ASP B 1 50  ? 37.666 34.521 138.115 1.00 29.33 ? 50  ASP B O   1 
ATOM   2921 C CB  . ASP B 1 50  ? 39.586 31.993 136.325 1.00 32.34 ? 50  ASP B CB  1 
ATOM   2922 C CG  . ASP B 1 50  ? 39.902 30.539 136.617 1.00 35.11 ? 50  ASP B CG  1 
ATOM   2923 O OD1 . ASP B 1 50  ? 40.617 29.909 135.810 1.00 34.84 ? 50  ASP B OD1 1 
ATOM   2924 O OD2 . ASP B 1 50  ? 39.439 30.034 137.666 1.00 35.38 ? 50  ASP B OD2 1 
ATOM   2925 N N   . LYS B 1 51  ? 39.211 34.703 136.515 1.00 27.17 ? 51  LYS B N   1 
ATOM   2926 C CA  . LYS B 1 51  ? 39.277 36.150 136.685 1.00 31.62 ? 51  LYS B CA  1 
ATOM   2927 C C   . LYS B 1 51  ? 38.907 36.964 135.450 1.00 29.47 ? 51  LYS B C   1 
ATOM   2928 O O   . LYS B 1 51  ? 39.011 38.191 135.458 1.00 29.08 ? 51  LYS B O   1 
ATOM   2929 C CB  . LYS B 1 51  ? 40.674 36.553 137.180 1.00 35.26 ? 51  LYS B CB  1 
ATOM   2930 C CG  . LYS B 1 51  ? 41.818 36.130 136.270 1.00 42.26 ? 51  LYS B CG  1 
ATOM   2931 C CD  . LYS B 1 51  ? 43.174 36.248 136.964 1.00 45.00 ? 51  LYS B CD  1 
ATOM   2932 C CE  . LYS B 1 51  ? 43.281 35.270 138.134 1.00 48.81 ? 51  LYS B CE  1 
ATOM   2933 N NZ  . LYS B 1 51  ? 44.646 35.234 138.742 1.00 48.84 ? 51  LYS B NZ  1 
ATOM   2934 N N   . ASP B 1 52  ? 38.440 36.290 134.402 1.00 27.88 ? 52  ASP B N   1 
ATOM   2935 C CA  . ASP B 1 52  ? 38.081 36.981 133.164 1.00 27.80 ? 52  ASP B CA  1 
ATOM   2936 C C   . ASP B 1 52  ? 36.644 36.714 132.716 1.00 26.11 ? 52  ASP B C   1 
ATOM   2937 O O   . ASP B 1 52  ? 36.135 35.597 132.845 1.00 25.24 ? 52  ASP B O   1 
ATOM   2938 C CB  . ASP B 1 52  ? 39.054 36.570 132.050 1.00 28.77 ? 52  ASP B CB  1 
ATOM   2939 C CG  . ASP B 1 52  ? 40.464 37.114 132.272 1.00 31.63 ? 52  ASP B CG  1 
ATOM   2940 O OD1 . ASP B 1 52  ? 40.801 38.162 131.691 1.00 32.89 ? 52  ASP B OD1 1 
ATOM   2941 O OD2 . ASP B 1 52  ? 41.235 36.502 133.035 1.00 34.27 ? 52  ASP B OD2 1 
ATOM   2942 N N   . VAL B 1 53  ? 35.985 37.752 132.207 1.00 24.53 ? 53  VAL B N   1 
ATOM   2943 C CA  . VAL B 1 53  ? 34.625 37.603 131.717 1.00 25.11 ? 53  VAL B CA  1 
ATOM   2944 C C   . VAL B 1 53  ? 34.668 36.576 130.580 1.00 25.02 ? 53  VAL B C   1 
ATOM   2945 O O   . VAL B 1 53  ? 35.564 36.606 129.736 1.00 22.57 ? 53  VAL B O   1 
ATOM   2946 C CB  . VAL B 1 53  ? 34.059 38.939 131.182 1.00 24.59 ? 53  VAL B CB  1 
ATOM   2947 C CG1 . VAL B 1 53  ? 34.950 39.482 130.076 1.00 30.33 ? 53  VAL B CG1 1 
ATOM   2948 C CG2 . VAL B 1 53  ? 32.646 38.729 130.663 1.00 25.05 ? 53  VAL B CG2 1 
ATOM   2949 N N   . GLN B 1 54  ? 33.710 35.658 130.578 1.00 23.19 ? 54  GLN B N   1 
ATOM   2950 C CA  . GLN B 1 54  ? 33.656 34.620 129.562 1.00 20.75 ? 54  GLN B CA  1 
ATOM   2951 C C   . GLN B 1 54  ? 32.564 34.941 128.552 1.00 21.38 ? 54  GLN B C   1 
ATOM   2952 O O   . GLN B 1 54  ? 32.733 34.729 127.347 1.00 18.47 ? 54  GLN B O   1 
ATOM   2953 C CB  . GLN B 1 54  ? 33.395 33.266 130.236 1.00 24.89 ? 54  GLN B CB  1 
ATOM   2954 C CG  . GLN B 1 54  ? 33.119 32.088 129.299 1.00 24.26 ? 54  GLN B CG  1 
ATOM   2955 C CD  . GLN B 1 54  ? 34.224 31.849 128.286 1.00 28.24 ? 54  GLN B CD  1 
ATOM   2956 O OE1 . GLN B 1 54  ? 35.397 32.151 128.535 1.00 25.27 ? 54  GLN B OE1 1 
ATOM   2957 N NE2 . GLN B 1 54  ? 33.856 31.285 127.137 1.00 24.31 ? 54  GLN B NE2 1 
ATOM   2958 N N   . SER B 1 55  ? 31.448 35.468 129.040 1.00 16.77 ? 55  SER B N   1 
ATOM   2959 C CA  . SER B 1 55  ? 30.353 35.805 128.154 1.00 20.20 ? 55  SER B CA  1 
ATOM   2960 C C   . SER B 1 55  ? 29.361 36.754 128.815 1.00 21.14 ? 55  SER B C   1 
ATOM   2961 O O   . SER B 1 55  ? 29.314 36.891 130.038 1.00 21.02 ? 55  SER B O   1 
ATOM   2962 C CB  . SER B 1 55  ? 29.642 34.520 127.692 1.00 18.81 ? 55  SER B CB  1 
ATOM   2963 O OG  . SER B 1 55  ? 28.884 34.743 126.507 1.00 19.27 ? 55  SER B OG  1 
ATOM   2964 N N   . THR B 1 56  ? 28.566 37.407 127.980 1.00 19.12 ? 56  THR B N   1 
ATOM   2965 C CA  . THR B 1 56  ? 27.568 38.366 128.415 1.00 20.73 ? 56  THR B CA  1 
ATOM   2966 C C   . THR B 1 56  ? 26.252 37.994 127.735 1.00 22.60 ? 56  THR B C   1 
ATOM   2967 O O   . THR B 1 56  ? 26.232 37.663 126.550 1.00 18.14 ? 56  THR B O   1 
ATOM   2968 C CB  . THR B 1 56  ? 28.046 39.771 127.994 1.00 25.88 ? 56  THR B CB  1 
ATOM   2969 O OG1 . THR B 1 56  ? 28.826 40.334 129.053 1.00 26.68 ? 56  THR B OG1 1 
ATOM   2970 C CG2 . THR B 1 56  ? 26.912 40.663 127.569 1.00 15.69 ? 56  THR B CG2 1 
ATOM   2971 N N   . GLU B 1 57  ? 25.158 38.040 128.487 1.00 20.61 ? 57  GLU B N   1 
ATOM   2972 C CA  . GLU B 1 57  ? 23.860 37.688 127.937 1.00 23.32 ? 57  GLU B CA  1 
ATOM   2973 C C   . GLU B 1 57  ? 23.425 38.585 126.785 1.00 24.20 ? 57  GLU B C   1 
ATOM   2974 O O   . GLU B 1 57  ? 22.956 38.097 125.762 1.00 22.32 ? 57  GLU B O   1 
ATOM   2975 C CB  . GLU B 1 57  ? 22.796 37.733 129.035 1.00 23.01 ? 57  GLU B CB  1 
ATOM   2976 C CG  . GLU B 1 57  ? 21.375 37.591 128.528 1.00 23.65 ? 57  GLU B CG  1 
ATOM   2977 C CD  . GLU B 1 57  ? 20.349 37.774 129.632 1.00 26.50 ? 57  GLU B CD  1 
ATOM   2978 O OE1 . GLU B 1 57  ? 20.740 38.136 130.758 1.00 23.20 ? 57  GLU B OE1 1 
ATOM   2979 O OE2 . GLU B 1 57  ? 19.155 37.554 129.371 1.00 23.01 ? 57  GLU B OE2 1 
ATOM   2980 N N   . ARG B 1 58  ? 23.584 39.897 126.947 1.00 23.96 ? 58  ARG B N   1 
ATOM   2981 C CA  . ARG B 1 58  ? 23.148 40.831 125.917 1.00 24.15 ? 58  ARG B CA  1 
ATOM   2982 C C   . ARG B 1 58  ? 24.051 41.007 124.700 1.00 23.68 ? 58  ARG B C   1 
ATOM   2983 O O   . ARG B 1 58  ? 23.614 41.576 123.705 1.00 20.10 ? 58  ARG B O   1 
ATOM   2984 C CB  . ARG B 1 58  ? 22.857 42.198 126.538 1.00 29.16 ? 58  ARG B CB  1 
ATOM   2985 C CG  . ARG B 1 58  ? 21.627 42.196 127.458 1.00 36.48 ? 58  ARG B CG  1 
ATOM   2986 C CD  . ARG B 1 58  ? 21.297 43.609 127.911 1.00 44.21 ? 58  ARG B CD  1 
ATOM   2987 N NE  . ARG B 1 58  ? 21.096 44.489 126.758 1.00 55.82 ? 58  ARG B NE  1 
ATOM   2988 C CZ  . ARG B 1 58  ? 21.024 45.818 126.818 1.00 59.66 ? 58  ARG B CZ  1 
ATOM   2989 N NH1 . ARG B 1 58  ? 20.839 46.524 125.707 1.00 61.05 ? 58  ARG B NH1 1 
ATOM   2990 N NH2 . ARG B 1 58  ? 21.142 46.445 127.984 1.00 61.64 ? 58  ARG B NH2 1 
ATOM   2991 N N   . ASP B 1 59  ? 25.293 40.536 124.766 1.00 18.84 ? 59  ASP B N   1 
ATOM   2992 C CA  . ASP B 1 59  ? 26.171 40.665 123.600 1.00 20.07 ? 59  ASP B CA  1 
ATOM   2993 C C   . ASP B 1 59  ? 26.740 39.341 123.085 1.00 16.61 ? 59  ASP B C   1 
ATOM   2994 O O   . ASP B 1 59  ? 27.490 39.343 122.116 1.00 18.06 ? 59  ASP B O   1 
ATOM   2995 C CB  . ASP B 1 59  ? 27.337 41.631 123.888 1.00 17.89 ? 59  ASP B CB  1 
ATOM   2996 C CG  . ASP B 1 59  ? 28.561 40.934 124.439 1.00 21.04 ? 59  ASP B CG  1 
ATOM   2997 O OD1 . ASP B 1 59  ? 29.675 41.455 124.206 1.00 22.29 ? 59  ASP B OD1 1 
ATOM   2998 O OD2 . ASP B 1 59  ? 28.426 39.877 125.105 1.00 21.73 ? 59  ASP B OD2 1 
ATOM   2999 N N   . GLU B 1 60  ? 26.393 38.216 123.713 1.00 18.20 ? 60  GLU B N   1 
ATOM   3000 C CA  . GLU B 1 60  ? 26.956 36.937 123.276 1.00 18.47 ? 60  GLU B CA  1 
ATOM   3001 C C   . GLU B 1 60  ? 26.601 36.600 121.831 1.00 17.83 ? 60  GLU B C   1 
ATOM   3002 O O   . GLU B 1 60  ? 27.370 35.927 121.143 1.00 16.08 ? 60  GLU B O   1 
ATOM   3003 C CB  . GLU B 1 60  ? 26.551 35.795 124.241 1.00 19.67 ? 60  GLU B CB  1 
ATOM   3004 C CG  . GLU B 1 60  ? 25.057 35.543 124.390 1.00 20.51 ? 60  GLU B CG  1 
ATOM   3005 C CD  . GLU B 1 60  ? 24.523 34.602 123.321 1.00 19.52 ? 60  GLU B CD  1 
ATOM   3006 O OE1 . GLU B 1 60  ? 25.282 34.245 122.394 1.00 18.00 ? 60  GLU B OE1 1 
ATOM   3007 O OE2 . GLU B 1 60  ? 23.340 34.226 123.412 1.00 21.17 ? 60  GLU B OE2 1 
ATOM   3008 N N   . TYR B 1 61  ? 25.464 37.098 121.351 1.00 17.80 ? 61  TYR B N   1 
ATOM   3009 C CA  . TYR B 1 61  ? 25.080 36.824 119.971 1.00 19.39 ? 61  TYR B CA  1 
ATOM   3010 C C   . TYR B 1 61  ? 26.140 37.350 119.007 1.00 19.53 ? 61  TYR B C   1 
ATOM   3011 O O   . TYR B 1 61  ? 26.398 36.733 117.965 1.00 17.28 ? 61  TYR B O   1 
ATOM   3012 C CB  . TYR B 1 61  ? 23.708 37.439 119.638 1.00 16.59 ? 61  TYR B CB  1 
ATOM   3013 C CG  . TYR B 1 61  ? 23.697 38.941 119.430 1.00 21.34 ? 61  TYR B CG  1 
ATOM   3014 C CD1 . TYR B 1 61  ? 23.561 39.814 120.511 1.00 18.70 ? 61  TYR B CD1 1 
ATOM   3015 C CD2 . TYR B 1 61  ? 23.784 39.488 118.144 1.00 19.43 ? 61  TYR B CD2 1 
ATOM   3016 C CE1 . TYR B 1 61  ? 23.502 41.180 120.327 1.00 20.03 ? 61  TYR B CE1 1 
ATOM   3017 C CE2 . TYR B 1 61  ? 23.730 40.865 117.942 1.00 19.62 ? 61  TYR B CE2 1 
ATOM   3018 C CZ  . TYR B 1 61  ? 23.586 41.705 119.044 1.00 20.82 ? 61  TYR B CZ  1 
ATOM   3019 O OH  . TYR B 1 61  ? 23.536 43.062 118.873 1.00 22.01 ? 61  TYR B OH  1 
ATOM   3020 N N   . ILE B 1 62  ? 26.766 38.481 119.355 1.00 17.13 ? 62  ILE B N   1 
ATOM   3021 C CA  . ILE B 1 62  ? 27.813 39.062 118.510 1.00 18.49 ? 62  ILE B CA  1 
ATOM   3022 C C   . ILE B 1 62  ? 29.042 38.148 118.489 1.00 17.80 ? 62  ILE B C   1 
ATOM   3023 O O   . ILE B 1 62  ? 29.617 37.850 117.436 1.00 17.82 ? 62  ILE B O   1 
ATOM   3024 C CB  . ILE B 1 62  ? 28.257 40.457 119.040 1.00 19.84 ? 62  ILE B CB  1 
ATOM   3025 C CG1 . ILE B 1 62  ? 27.122 41.467 118.838 1.00 18.05 ? 62  ILE B CG1 1 
ATOM   3026 C CG2 . ILE B 1 62  ? 29.546 40.897 118.326 1.00 16.92 ? 62  ILE B CG2 1 
ATOM   3027 C CD1 . ILE B 1 62  ? 27.261 42.782 119.644 1.00 18.04 ? 62  ILE B CD1 1 
ATOM   3028 N N   . TYR B 1 63  ? 29.443 37.701 119.666 1.00 17.38 ? 63  TYR B N   1 
ATOM   3029 C CA  . TYR B 1 63  ? 30.604 36.830 119.763 1.00 16.19 ? 63  TYR B CA  1 
ATOM   3030 C C   . TYR B 1 63  ? 30.379 35.490 119.063 1.00 15.81 ? 63  TYR B C   1 
ATOM   3031 O O   . TYR B 1 63  ? 31.213 35.049 118.277 1.00 19.00 ? 63  TYR B O   1 
ATOM   3032 C CB  . TYR B 1 63  ? 30.947 36.583 121.238 1.00 14.06 ? 63  TYR B CB  1 
ATOM   3033 C CG  . TYR B 1 63  ? 32.039 35.557 121.429 1.00 19.49 ? 63  TYR B CG  1 
ATOM   3034 C CD1 . TYR B 1 63  ? 31.748 34.189 121.477 1.00 21.07 ? 63  TYR B CD1 1 
ATOM   3035 C CD2 . TYR B 1 63  ? 33.378 35.951 121.474 1.00 20.41 ? 63  TYR B CD2 1 
ATOM   3036 C CE1 . TYR B 1 63  ? 32.778 33.234 121.562 1.00 21.38 ? 63  TYR B CE1 1 
ATOM   3037 C CE2 . TYR B 1 63  ? 34.398 35.023 121.547 1.00 23.57 ? 63  TYR B CE2 1 
ATOM   3038 C CZ  . TYR B 1 63  ? 34.099 33.668 121.592 1.00 22.25 ? 63  TYR B CZ  1 
ATOM   3039 O OH  . TYR B 1 63  ? 35.140 32.778 121.658 1.00 22.71 ? 63  TYR B OH  1 
ATOM   3040 N N   . HIS B 1 64  ? 29.254 34.839 119.351 1.00 16.40 ? 64  HIS B N   1 
ATOM   3041 C CA  . HIS B 1 64  ? 28.994 33.531 118.760 1.00 19.35 ? 64  HIS B CA  1 
ATOM   3042 C C   . HIS B 1 64  ? 28.758 33.567 117.246 1.00 20.11 ? 64  HIS B C   1 
ATOM   3043 O O   . HIS B 1 64  ? 29.195 32.657 116.541 1.00 20.20 ? 64  HIS B O   1 
ATOM   3044 C CB  . HIS B 1 64  ? 27.858 32.850 119.536 1.00 17.10 ? 64  HIS B CB  1 
ATOM   3045 C CG  . HIS B 1 64  ? 28.222 32.580 120.965 1.00 15.20 ? 64  HIS B CG  1 
ATOM   3046 N ND1 . HIS B 1 64  ? 29.191 31.664 121.322 1.00 23.32 ? 64  HIS B ND1 1 
ATOM   3047 C CD2 . HIS B 1 64  ? 27.841 33.186 122.114 1.00 11.77 ? 64  HIS B CD2 1 
ATOM   3048 C CE1 . HIS B 1 64  ? 29.391 31.719 122.628 1.00 14.15 ? 64  HIS B CE1 1 
ATOM   3049 N NE2 . HIS B 1 64  ? 28.583 32.635 123.131 1.00 19.73 ? 64  HIS B NE2 1 
ATOM   3050 N N   . GLU B 1 65  ? 28.100 34.609 116.738 1.00 17.90 ? 65  GLU B N   1 
ATOM   3051 C CA  . GLU B 1 65  ? 27.894 34.715 115.290 1.00 18.37 ? 65  GLU B CA  1 
ATOM   3052 C C   . GLU B 1 65  ? 29.257 34.887 114.612 1.00 20.70 ? 65  GLU B C   1 
ATOM   3053 O O   . GLU B 1 65  ? 29.548 34.245 113.597 1.00 21.81 ? 65  GLU B O   1 
ATOM   3054 C CB  . GLU B 1 65  ? 26.980 35.907 114.932 1.00 16.79 ? 65  GLU B CB  1 
ATOM   3055 C CG  . GLU B 1 65  ? 25.490 35.630 115.152 1.00 18.85 ? 65  GLU B CG  1 
ATOM   3056 C CD  . GLU B 1 65  ? 24.581 36.771 114.697 1.00 17.94 ? 65  GLU B CD  1 
ATOM   3057 O OE1 . GLU B 1 65  ? 25.011 37.589 113.861 1.00 20.40 ? 65  GLU B OE1 1 
ATOM   3058 O OE2 . GLU B 1 65  ? 23.427 36.832 115.162 1.00 20.30 ? 65  GLU B OE2 1 
ATOM   3059 N N   . THR B 1 66  ? 30.087 35.757 115.186 1.00 17.88 ? 66  THR B N   1 
ATOM   3060 C CA  . THR B 1 66  ? 31.431 36.038 114.675 1.00 18.14 ? 66  THR B CA  1 
ATOM   3061 C C   . THR B 1 66  ? 32.304 34.768 114.673 1.00 16.57 ? 66  THR B C   1 
ATOM   3062 O O   . THR B 1 66  ? 33.027 34.481 113.713 1.00 18.64 ? 66  THR B O   1 
ATOM   3063 C CB  . THR B 1 66  ? 32.121 37.121 115.568 1.00 18.35 ? 66  THR B CB  1 
ATOM   3064 O OG1 . THR B 1 66  ? 31.365 38.342 115.512 1.00 21.54 ? 66  THR B OG1 1 
ATOM   3065 C CG2 . THR B 1 66  ? 33.550 37.393 115.105 1.00 15.64 ? 66  THR B CG2 1 
ATOM   3066 N N   . LEU B 1 67  ? 32.234 34.016 115.765 1.00 15.94 ? 67  LEU B N   1 
ATOM   3067 C CA  . LEU B 1 67  ? 33.010 32.781 115.926 1.00 19.67 ? 67  LEU B CA  1 
ATOM   3068 C C   . LEU B 1 67  ? 32.640 31.652 114.966 1.00 20.11 ? 67  LEU B C   1 
ATOM   3069 O O   . LEU B 1 67  ? 33.501 31.010 114.359 1.00 19.22 ? 67  LEU B O   1 
ATOM   3070 C CB  . LEU B 1 67  ? 32.825 32.231 117.349 1.00 14.17 ? 67  LEU B CB  1 
ATOM   3071 C CG  . LEU B 1 67  ? 33.378 30.827 117.649 1.00 20.00 ? 67  LEU B CG  1 
ATOM   3072 C CD1 . LEU B 1 67  ? 34.905 30.846 117.683 1.00 18.55 ? 67  LEU B CD1 1 
ATOM   3073 C CD2 . LEU B 1 67  ? 32.824 30.355 119.002 1.00 18.22 ? 67  LEU B CD2 1 
ATOM   3074 N N   . VAL B 1 68  ? 31.341 31.428 114.844 1.00 18.23 ? 68  VAL B N   1 
ATOM   3075 C CA  . VAL B 1 68  ? 30.808 30.323 114.063 1.00 20.55 ? 68  VAL B CA  1 
ATOM   3076 C C   . VAL B 1 68  ? 30.530 30.465 112.577 1.00 22.71 ? 68  VAL B C   1 
ATOM   3077 O O   . VAL B 1 68  ? 30.990 29.641 111.769 1.00 19.87 ? 68  VAL B O   1 
ATOM   3078 C CB  . VAL B 1 68  ? 29.497 29.818 114.728 1.00 21.01 ? 68  VAL B CB  1 
ATOM   3079 C CG1 . VAL B 1 68  ? 28.878 28.652 113.923 1.00 20.69 ? 68  VAL B CG1 1 
ATOM   3080 C CG2 . VAL B 1 68  ? 29.791 29.376 116.145 1.00 21.67 ? 68  VAL B CG2 1 
ATOM   3081 N N   . HIS B 1 69  ? 29.787 31.499 112.208 1.00 20.53 ? 69  HIS B N   1 
ATOM   3082 C CA  . HIS B 1 69  ? 29.375 31.630 110.824 1.00 21.64 ? 69  HIS B CA  1 
ATOM   3083 C C   . HIS B 1 69  ? 30.386 31.816 109.718 1.00 19.65 ? 69  HIS B C   1 
ATOM   3084 O O   . HIS B 1 69  ? 30.153 31.350 108.601 1.00 22.59 ? 69  HIS B O   1 
ATOM   3085 C CB  . HIS B 1 69  ? 28.235 32.651 110.746 1.00 18.27 ? 69  HIS B CB  1 
ATOM   3086 C CG  . HIS B 1 69  ? 27.083 32.274 111.616 1.00 22.12 ? 69  HIS B CG  1 
ATOM   3087 N ND1 . HIS B 1 69  ? 26.559 30.998 111.623 1.00 21.98 ? 69  HIS B ND1 1 
ATOM   3088 C CD2 . HIS B 1 69  ? 26.437 32.952 112.595 1.00 20.16 ? 69  HIS B CD2 1 
ATOM   3089 C CE1 . HIS B 1 69  ? 25.648 30.903 112.575 1.00 22.89 ? 69  HIS B CE1 1 
ATOM   3090 N NE2 . HIS B 1 69  ? 25.558 32.075 113.182 1.00 23.31 ? 69  HIS B NE2 1 
ATOM   3091 N N   . PRO B 1 70  ? 31.516 32.492 109.984 1.00 20.88 ? 70  PRO B N   1 
ATOM   3092 C CA  . PRO B 1 70  ? 32.445 32.614 108.856 1.00 19.33 ? 70  PRO B CA  1 
ATOM   3093 C C   . PRO B 1 70  ? 32.893 31.229 108.372 1.00 20.27 ? 70  PRO B C   1 
ATOM   3094 O O   . PRO B 1 70  ? 32.879 30.950 107.172 1.00 20.56 ? 70  PRO B O   1 
ATOM   3095 C CB  . PRO B 1 70  ? 33.593 33.438 109.441 1.00 18.20 ? 70  PRO B CB  1 
ATOM   3096 C CG  . PRO B 1 70  ? 32.868 34.321 110.444 1.00 19.59 ? 70  PRO B CG  1 
ATOM   3097 C CD  . PRO B 1 70  ? 31.953 33.324 111.122 1.00 18.42 ? 70  PRO B CD  1 
ATOM   3098 N N   . ALA B 1 71  ? 33.278 30.353 109.298 1.00 20.93 ? 71  ALA B N   1 
ATOM   3099 C CA  . ALA B 1 71  ? 33.713 29.010 108.898 1.00 24.32 ? 71  ALA B CA  1 
ATOM   3100 C C   . ALA B 1 71  ? 32.549 28.219 108.299 1.00 25.09 ? 71  ALA B C   1 
ATOM   3101 O O   . ALA B 1 71  ? 32.690 27.616 107.230 1.00 27.28 ? 71  ALA B O   1 
ATOM   3102 C CB  . ALA B 1 71  ? 34.308 28.243 110.100 1.00 19.69 ? 71  ALA B CB  1 
ATOM   3103 N N   . MET B 1 72  ? 31.404 28.225 108.978 1.00 23.76 ? 72  MET B N   1 
ATOM   3104 C CA  . MET B 1 72  ? 30.229 27.491 108.502 1.00 25.05 ? 72  MET B CA  1 
ATOM   3105 C C   . MET B 1 72  ? 29.737 27.966 107.136 1.00 28.12 ? 72  MET B C   1 
ATOM   3106 O O   . MET B 1 72  ? 29.304 27.154 106.306 1.00 29.54 ? 72  MET B O   1 
ATOM   3107 C CB  . MET B 1 72  ? 29.079 27.591 109.508 1.00 20.71 ? 72  MET B CB  1 
ATOM   3108 C CG  . MET B 1 72  ? 29.334 26.888 110.837 1.00 25.70 ? 72  MET B CG  1 
ATOM   3109 S SD  . MET B 1 72  ? 29.531 25.101 110.662 1.00 25.72 ? 72  MET B SD  1 
ATOM   3110 C CE  . MET B 1 72  ? 27.782 24.615 110.411 1.00 22.56 ? 72  MET B CE  1 
ATOM   3111 N N   . LEU B 1 73  ? 29.799 29.273 106.900 1.00 24.43 ? 73  LEU B N   1 
ATOM   3112 C CA  . LEU B 1 73  ? 29.350 29.830 105.631 1.00 23.60 ? 73  LEU B CA  1 
ATOM   3113 C C   . LEU B 1 73  ? 30.374 29.689 104.512 1.00 24.58 ? 73  LEU B C   1 
ATOM   3114 O O   . LEU B 1 73  ? 29.999 29.673 103.343 1.00 23.79 ? 73  LEU B O   1 
ATOM   3115 C CB  . LEU B 1 73  ? 28.943 31.310 105.791 1.00 22.52 ? 73  LEU B CB  1 
ATOM   3116 C CG  . LEU B 1 73  ? 27.654 31.543 106.587 1.00 23.38 ? 73  LEU B CG  1 
ATOM   3117 C CD1 . LEU B 1 73  ? 27.410 33.037 106.812 1.00 19.41 ? 73  LEU B CD1 1 
ATOM   3118 C CD2 . LEU B 1 73  ? 26.484 30.900 105.853 1.00 22.07 ? 73  LEU B CD2 1 
ATOM   3119 N N   . THR B 1 74  ? 31.661 29.586 104.840 1.00 26.51 ? 74  THR B N   1 
ATOM   3120 C CA  . THR B 1 74  ? 32.653 29.438 103.775 1.00 28.05 ? 74  THR B CA  1 
ATOM   3121 C C   . THR B 1 74  ? 32.637 28.004 103.254 1.00 29.75 ? 74  THR B C   1 
ATOM   3122 O O   . THR B 1 74  ? 33.176 27.714 102.182 1.00 26.77 ? 74  THR B O   1 
ATOM   3123 C CB  . THR B 1 74  ? 34.079 29.760 104.240 1.00 30.84 ? 74  THR B CB  1 
ATOM   3124 O OG1 . THR B 1 74  ? 34.408 28.968 105.387 1.00 34.73 ? 74  THR B OG1 1 
ATOM   3125 C CG2 . THR B 1 74  ? 34.205 31.225 104.568 1.00 34.52 ? 74  THR B CG2 1 
ATOM   3126 N N   . HIS B 1 75  ? 32.037 27.103 104.027 1.00 28.74 ? 75  HIS B N   1 
ATOM   3127 C CA  . HIS B 1 75  ? 31.941 25.713 103.608 1.00 30.57 ? 75  HIS B CA  1 
ATOM   3128 C C   . HIS B 1 75  ? 30.661 25.566 102.803 1.00 27.87 ? 75  HIS B C   1 
ATOM   3129 O O   . HIS B 1 75  ? 29.591 25.966 103.248 1.00 31.49 ? 75  HIS B O   1 
ATOM   3130 C CB  . HIS B 1 75  ? 31.906 24.766 104.804 1.00 28.95 ? 75  HIS B CB  1 
ATOM   3131 C CG  . HIS B 1 75  ? 32.114 23.334 104.429 1.00 29.61 ? 75  HIS B CG  1 
ATOM   3132 N ND1 . HIS B 1 75  ? 31.124 22.565 103.853 1.00 30.52 ? 75  HIS B ND1 1 
ATOM   3133 C CD2 . HIS B 1 75  ? 33.211 22.542 104.503 1.00 32.45 ? 75  HIS B CD2 1 
ATOM   3134 C CE1 . HIS B 1 75  ? 31.602 21.361 103.591 1.00 32.25 ? 75  HIS B CE1 1 
ATOM   3135 N NE2 . HIS B 1 75  ? 32.866 21.321 103.974 1.00 31.79 ? 75  HIS B NE2 1 
ATOM   3136 N N   . PRO B 1 76  ? 30.756 24.975 101.607 1.00 28.21 ? 76  PRO B N   1 
ATOM   3137 C CA  . PRO B 1 76  ? 29.575 24.804 100.760 1.00 29.46 ? 76  PRO B CA  1 
ATOM   3138 C C   . PRO B 1 76  ? 28.451 23.963 101.354 1.00 29.90 ? 76  PRO B C   1 
ATOM   3139 O O   . PRO B 1 76  ? 27.285 24.214 101.080 1.00 30.40 ? 76  PRO B O   1 
ATOM   3140 C CB  . PRO B 1 76  ? 30.156 24.204 99.475  1.00 30.04 ? 76  PRO B CB  1 
ATOM   3141 C CG  . PRO B 1 76  ? 31.319 23.409 99.972  1.00 32.41 ? 76  PRO B CG  1 
ATOM   3142 C CD  . PRO B 1 76  ? 31.941 24.335 101.007 1.00 26.71 ? 76  PRO B CD  1 
ATOM   3143 N N   . GLU B 1 77  ? 28.793 22.984 102.182 1.00 32.06 ? 77  GLU B N   1 
ATOM   3144 C CA  . GLU B 1 77  ? 27.776 22.112 102.768 1.00 32.68 ? 77  GLU B CA  1 
ATOM   3145 C C   . GLU B 1 77  ? 28.324 21.389 103.994 1.00 31.94 ? 77  GLU B C   1 
ATOM   3146 O O   . GLU B 1 77  ? 28.704 20.224 103.933 1.00 30.69 ? 77  GLU B O   1 
ATOM   3147 C CB  . GLU B 1 77  ? 27.296 21.103 101.703 1.00 35.11 ? 77  GLU B CB  1 
ATOM   3148 C CG  . GLU B 1 77  ? 26.278 20.073 102.198 1.00 36.97 ? 77  GLU B CG  1 
ATOM   3149 C CD  . GLU B 1 77  ? 25.632 19.269 101.066 1.00 40.86 ? 77  GLU B CD  1 
ATOM   3150 O OE1 . GLU B 1 77  ? 26.342 18.884 100.111 1.00 38.87 ? 77  GLU B OE1 1 
ATOM   3151 O OE2 . GLU B 1 77  ? 24.412 19.013 101.140 1.00 41.29 ? 77  GLU B OE2 1 
ATOM   3152 N N   . PRO B 1 78  ? 28.375 22.085 105.137 1.00 31.27 ? 78  PRO B N   1 
ATOM   3153 C CA  . PRO B 1 78  ? 28.888 21.484 106.374 1.00 28.34 ? 78  PRO B CA  1 
ATOM   3154 C C   . PRO B 1 78  ? 27.907 20.479 106.992 1.00 28.85 ? 78  PRO B C   1 
ATOM   3155 O O   . PRO B 1 78  ? 26.826 20.855 107.442 1.00 26.93 ? 78  PRO B O   1 
ATOM   3156 C CB  . PRO B 1 78  ? 29.133 22.702 107.260 1.00 30.47 ? 78  PRO B CB  1 
ATOM   3157 C CG  . PRO B 1 78  ? 28.019 23.636 106.846 1.00 30.75 ? 78  PRO B CG  1 
ATOM   3158 C CD  . PRO B 1 78  ? 28.004 23.500 105.331 1.00 27.69 ? 78  PRO B CD  1 
ATOM   3159 N N   . LYS B 1 79  ? 28.292 19.201 107.015 1.00 28.16 ? 79  LYS B N   1 
ATOM   3160 C CA  . LYS B 1 79  ? 27.427 18.148 107.559 1.00 29.25 ? 79  LYS B CA  1 
ATOM   3161 C C   . LYS B 1 79  ? 27.882 17.632 108.926 1.00 26.34 ? 79  LYS B C   1 
ATOM   3162 O O   . LYS B 1 79  ? 27.071 17.353 109.793 1.00 26.05 ? 79  LYS B O   1 
ATOM   3163 C CB  . LYS B 1 79  ? 27.341 16.971 106.573 1.00 30.30 ? 79  LYS B CB  1 
ATOM   3164 C CG  . LYS B 1 79  ? 26.663 17.304 105.241 1.00 31.46 ? 79  LYS B CG  1 
ATOM   3165 C CD  . LYS B 1 79  ? 26.616 16.068 104.340 1.00 33.01 ? 79  LYS B CD  1 
ATOM   3166 C CE  . LYS B 1 79  ? 25.955 16.361 102.999 1.00 34.56 ? 79  LYS B CE  1 
ATOM   3167 N NZ  . LYS B 1 79  ? 25.885 15.124 102.162 1.00 40.97 ? 79  LYS B NZ  1 
ATOM   3168 N N   . ARG B 1 80  ? 29.190 17.497 109.111 1.00 30.56 ? 80  ARG B N   1 
ATOM   3169 C CA  . ARG B 1 80  ? 29.724 17.028 110.380 1.00 30.13 ? 80  ARG B CA  1 
ATOM   3170 C C   . ARG B 1 80  ? 30.550 18.169 110.963 1.00 28.68 ? 80  ARG B C   1 
ATOM   3171 O O   . ARG B 1 80  ? 31.415 18.718 110.287 1.00 26.15 ? 80  ARG B O   1 
ATOM   3172 C CB  . ARG B 1 80  ? 30.611 15.792 110.168 1.00 34.48 ? 80  ARG B CB  1 
ATOM   3173 C CG  . ARG B 1 80  ? 30.063 14.514 110.784 1.00 43.66 ? 80  ARG B CG  1 
ATOM   3174 C CD  . ARG B 1 80  ? 28.850 14.010 110.033 1.00 46.98 ? 80  ARG B CD  1 
ATOM   3175 N NE  . ARG B 1 80  ? 29.178 13.739 108.636 1.00 53.93 ? 80  ARG B NE  1 
ATOM   3176 C CZ  . ARG B 1 80  ? 28.297 13.359 107.714 1.00 54.16 ? 80  ARG B CZ  1 
ATOM   3177 N NH1 . ARG B 1 80  ? 27.020 13.199 108.039 1.00 54.55 ? 80  ARG B NH1 1 
ATOM   3178 N NH2 . ARG B 1 80  ? 28.692 13.146 106.462 1.00 50.72 ? 80  ARG B NH2 1 
ATOM   3179 N N   . VAL B 1 81  ? 30.282 18.520 112.216 1.00 26.67 ? 81  VAL B N   1 
ATOM   3180 C CA  . VAL B 1 81  ? 31.003 19.621 112.856 1.00 25.98 ? 81  VAL B CA  1 
ATOM   3181 C C   . VAL B 1 81  ? 31.515 19.231 114.229 1.00 25.11 ? 81  VAL B C   1 
ATOM   3182 O O   . VAL B 1 81  ? 30.834 18.515 114.973 1.00 25.57 ? 81  VAL B O   1 
ATOM   3183 C CB  . VAL B 1 81  ? 30.093 20.871 113.031 1.00 25.63 ? 81  VAL B CB  1 
ATOM   3184 C CG1 . VAL B 1 81  ? 30.905 22.041 113.658 1.00 24.99 ? 81  VAL B CG1 1 
ATOM   3185 C CG2 . VAL B 1 81  ? 29.495 21.281 111.695 1.00 23.88 ? 81  VAL B CG2 1 
ATOM   3186 N N   . LEU B 1 82  ? 32.726 19.681 114.548 1.00 21.99 ? 82  LEU B N   1 
ATOM   3187 C CA  . LEU B 1 82  ? 33.316 19.426 115.860 1.00 23.40 ? 82  LEU B CA  1 
ATOM   3188 C C   . LEU B 1 82  ? 33.505 20.771 116.568 1.00 24.56 ? 82  LEU B C   1 
ATOM   3189 O O   . LEU B 1 82  ? 33.994 21.733 115.972 1.00 23.49 ? 82  LEU B O   1 
ATOM   3190 C CB  . LEU B 1 82  ? 34.677 18.735 115.742 1.00 25.40 ? 82  LEU B CB  1 
ATOM   3191 C CG  . LEU B 1 82  ? 35.440 18.602 117.071 1.00 26.83 ? 82  LEU B CG  1 
ATOM   3192 C CD1 . LEU B 1 82  ? 34.654 17.711 118.036 1.00 27.95 ? 82  LEU B CD1 1 
ATOM   3193 C CD2 . LEU B 1 82  ? 36.821 18.027 116.830 1.00 27.34 ? 82  LEU B CD2 1 
ATOM   3194 N N   . ILE B 1 83  ? 33.102 20.834 117.831 1.00 27.36 ? 83  ILE B N   1 
ATOM   3195 C CA  . ILE B 1 83  ? 33.250 22.043 118.630 1.00 25.93 ? 83  ILE B CA  1 
ATOM   3196 C C   . ILE B 1 83  ? 34.148 21.743 119.827 1.00 24.82 ? 83  ILE B C   1 
ATOM   3197 O O   . ILE B 1 83  ? 33.840 20.860 120.618 1.00 24.11 ? 83  ILE B O   1 
ATOM   3198 C CB  . ILE B 1 83  ? 31.901 22.524 119.185 1.00 24.16 ? 83  ILE B CB  1 
ATOM   3199 C CG1 . ILE B 1 83  ? 30.986 22.960 118.046 1.00 22.89 ? 83  ILE B CG1 1 
ATOM   3200 C CG2 . ILE B 1 83  ? 32.135 23.669 120.171 1.00 26.75 ? 83  ILE B CG2 1 
ATOM   3201 C CD1 . ILE B 1 83  ? 29.541 23.175 118.470 1.00 24.49 ? 83  ILE B CD1 1 
ATOM   3202 N N   . VAL B 1 84  ? 35.256 22.470 119.955 1.00 22.34 ? 84  VAL B N   1 
ATOM   3203 C CA  . VAL B 1 84  ? 36.141 22.278 121.093 1.00 24.75 ? 84  VAL B CA  1 
ATOM   3204 C C   . VAL B 1 84  ? 35.943 23.469 122.033 1.00 26.53 ? 84  VAL B C   1 
ATOM   3205 O O   . VAL B 1 84  ? 36.325 24.594 121.711 1.00 27.46 ? 84  VAL B O   1 
ATOM   3206 C CB  . VAL B 1 84  ? 37.609 22.205 120.652 1.00 25.56 ? 84  VAL B CB  1 
ATOM   3207 C CG1 . VAL B 1 84  ? 38.505 22.014 121.869 1.00 23.48 ? 84  VAL B CG1 1 
ATOM   3208 C CG2 . VAL B 1 84  ? 37.782 21.056 119.653 1.00 26.32 ? 84  VAL B CG2 1 
ATOM   3209 N N   . GLY B 1 85  ? 35.348 23.215 123.193 1.00 26.92 ? 85  GLY B N   1 
ATOM   3210 C CA  . GLY B 1 85  ? 35.086 24.288 124.139 1.00 25.29 ? 85  GLY B CA  1 
ATOM   3211 C C   . GLY B 1 85  ? 33.639 24.724 123.984 1.00 26.35 ? 85  GLY B C   1 
ATOM   3212 O O   . GLY B 1 85  ? 32.767 23.881 123.718 1.00 23.30 ? 85  GLY B O   1 
ATOM   3213 N N   . GLY B 1 86  ? 33.385 26.027 124.136 1.00 23.90 ? 86  GLY B N   1 
ATOM   3214 C CA  . GLY B 1 86  ? 32.036 26.558 124.014 1.00 25.98 ? 86  GLY B CA  1 
ATOM   3215 C C   . GLY B 1 86  ? 31.069 26.008 125.053 1.00 27.43 ? 86  GLY B C   1 
ATOM   3216 O O   . GLY B 1 86  ? 29.905 25.717 124.755 1.00 25.00 ? 86  GLY B O   1 
ATOM   3217 N N   . GLY B 1 87  ? 31.551 25.885 126.284 1.00 25.19 ? 87  GLY B N   1 
ATOM   3218 C CA  . GLY B 1 87  ? 30.740 25.333 127.363 1.00 24.38 ? 87  GLY B CA  1 
ATOM   3219 C C   . GLY B 1 87  ? 29.364 25.921 127.619 1.00 27.49 ? 87  GLY B C   1 
ATOM   3220 O O   . GLY B 1 87  ? 28.506 25.242 128.184 1.00 25.31 ? 87  GLY B O   1 
ATOM   3221 N N   . GLU B 1 88  ? 29.141 27.171 127.218 1.00 25.82 ? 88  GLU B N   1 
ATOM   3222 C CA  . GLU B 1 88  ? 27.847 27.802 127.429 1.00 24.06 ? 88  GLU B CA  1 
ATOM   3223 C C   . GLU B 1 88  ? 26.754 27.166 126.564 1.00 24.05 ? 88  GLU B C   1 
ATOM   3224 O O   . GLU B 1 88  ? 25.574 27.190 126.930 1.00 23.58 ? 88  GLU B O   1 
ATOM   3225 C CB  . GLU B 1 88  ? 27.918 29.303 127.110 1.00 23.43 ? 88  GLU B CB  1 
ATOM   3226 C CG  . GLU B 1 88  ? 29.025 30.077 127.826 1.00 23.78 ? 88  GLU B CG  1 
ATOM   3227 C CD  . GLU B 1 88  ? 30.287 30.204 126.986 1.00 28.67 ? 88  GLU B CD  1 
ATOM   3228 O OE1 . GLU B 1 88  ? 31.042 31.178 127.195 1.00 29.79 ? 88  GLU B OE1 1 
ATOM   3229 O OE2 . GLU B 1 88  ? 30.533 29.328 126.125 1.00 23.39 ? 88  GLU B OE2 1 
ATOM   3230 N N   . GLY B 1 89  ? 27.147 26.616 125.416 1.00 23.78 ? 89  GLY B N   1 
ATOM   3231 C CA  . GLY B 1 89  ? 26.181 26.002 124.514 1.00 23.83 ? 89  GLY B CA  1 
ATOM   3232 C C   . GLY B 1 89  ? 25.707 26.910 123.383 1.00 23.72 ? 89  GLY B C   1 
ATOM   3233 O O   . GLY B 1 89  ? 24.934 26.494 122.514 1.00 21.85 ? 89  GLY B O   1 
ATOM   3234 N N   . ALA B 1 90  ? 26.171 28.157 123.375 1.00 20.96 ? 90  ALA B N   1 
ATOM   3235 C CA  . ALA B 1 90  ? 25.755 29.096 122.341 1.00 21.61 ? 90  ALA B CA  1 
ATOM   3236 C C   . ALA B 1 90  ? 26.512 28.854 121.048 1.00 20.27 ? 90  ALA B C   1 
ATOM   3237 O O   . ALA B 1 90  ? 26.016 29.171 119.978 1.00 23.27 ? 90  ALA B O   1 
ATOM   3238 C CB  . ALA B 1 90  ? 25.955 30.554 122.812 1.00 16.75 ? 90  ALA B CB  1 
ATOM   3239 N N   . THR B 1 91  ? 27.718 28.303 121.150 1.00 19.18 ? 91  THR B N   1 
ATOM   3240 C CA  . THR B 1 91  ? 28.506 28.004 119.960 1.00 22.27 ? 91  THR B CA  1 
ATOM   3241 C C   . THR B 1 91  ? 27.776 26.877 119.223 1.00 23.24 ? 91  THR B C   1 
ATOM   3242 O O   . THR B 1 91  ? 27.599 26.922 118.001 1.00 24.07 ? 91  THR B O   1 
ATOM   3243 C CB  . THR B 1 91  ? 29.931 27.571 120.353 1.00 22.51 ? 91  THR B CB  1 
ATOM   3244 O OG1 . THR B 1 91  ? 30.570 28.659 121.038 1.00 24.13 ? 91  THR B OG1 1 
ATOM   3245 C CG2 . THR B 1 91  ? 30.762 27.203 119.116 1.00 13.62 ? 91  THR B CG2 1 
ATOM   3246 N N   . LEU B 1 92  ? 27.342 25.876 119.982 1.00 22.21 ? 92  LEU B N   1 
ATOM   3247 C CA  . LEU B 1 92  ? 26.608 24.742 119.421 1.00 23.74 ? 92  LEU B CA  1 
ATOM   3248 C C   . LEU B 1 92  ? 25.320 25.286 118.808 1.00 22.94 ? 92  LEU B C   1 
ATOM   3249 O O   . LEU B 1 92  ? 24.931 24.917 117.702 1.00 25.26 ? 92  LEU B O   1 
ATOM   3250 C CB  . LEU B 1 92  ? 26.289 23.733 120.531 1.00 22.27 ? 92  LEU B CB  1 
ATOM   3251 C CG  . LEU B 1 92  ? 25.445 22.502 120.199 1.00 27.06 ? 92  LEU B CG  1 
ATOM   3252 C CD1 . LEU B 1 92  ? 26.096 21.708 119.067 1.00 26.91 ? 92  LEU B CD1 1 
ATOM   3253 C CD2 . LEU B 1 92  ? 25.323 21.635 121.449 1.00 25.99 ? 92  LEU B CD2 1 
ATOM   3254 N N   . ARG B 1 93  ? 24.664 26.173 119.542 1.00 24.60 ? 93  ARG B N   1 
ATOM   3255 C CA  . ARG B 1 93  ? 23.439 26.797 119.071 1.00 23.19 ? 93  ARG B CA  1 
ATOM   3256 C C   . ARG B 1 93  ? 23.640 27.393 117.673 1.00 25.66 ? 93  ARG B C   1 
ATOM   3257 O O   . ARG B 1 93  ? 22.862 27.119 116.762 1.00 23.95 ? 93  ARG B O   1 
ATOM   3258 C CB  . ARG B 1 93  ? 23.026 27.905 120.031 1.00 24.03 ? 93  ARG B CB  1 
ATOM   3259 C CG  . ARG B 1 93  ? 21.724 28.603 119.695 1.00 21.25 ? 93  ARG B CG  1 
ATOM   3260 C CD  . ARG B 1 93  ? 21.586 29.869 120.547 1.00 22.18 ? 93  ARG B CD  1 
ATOM   3261 N NE  . ARG B 1 93  ? 22.481 30.936 120.091 1.00 21.08 ? 93  ARG B NE  1 
ATOM   3262 C CZ  . ARG B 1 93  ? 22.933 31.916 120.869 1.00 23.34 ? 93  ARG B CZ  1 
ATOM   3263 N NH1 . ARG B 1 93  ? 23.734 32.852 120.369 1.00 20.11 ? 93  ARG B NH1 1 
ATOM   3264 N NH2 . ARG B 1 93  ? 22.608 31.947 122.156 1.00 19.26 ? 93  ARG B NH2 1 
ATOM   3265 N N   . GLU B 1 94  ? 24.673 28.217 117.497 1.00 22.13 ? 94  GLU B N   1 
ATOM   3266 C CA  . GLU B 1 94  ? 24.893 28.811 116.191 1.00 22.67 ? 94  GLU B CA  1 
ATOM   3267 C C   . GLU B 1 94  ? 25.247 27.766 115.124 1.00 22.13 ? 94  GLU B C   1 
ATOM   3268 O O   . GLU B 1 94  ? 24.856 27.900 113.970 1.00 22.78 ? 94  GLU B O   1 
ATOM   3269 C CB  . GLU B 1 94  ? 25.982 29.892 116.257 1.00 21.71 ? 94  GLU B CB  1 
ATOM   3270 C CG  . GLU B 1 94  ? 25.596 31.125 117.075 1.00 21.05 ? 94  GLU B CG  1 
ATOM   3271 C CD  . GLU B 1 94  ? 24.280 31.755 116.628 1.00 22.60 ? 94  GLU B CD  1 
ATOM   3272 O OE1 . GLU B 1 94  ? 24.129 32.054 115.427 1.00 24.61 ? 94  GLU B OE1 1 
ATOM   3273 O OE2 . GLU B 1 94  ? 23.397 31.962 117.487 1.00 29.73 ? 94  GLU B OE2 1 
ATOM   3274 N N   . VAL B 1 95  ? 25.999 26.739 115.503 1.00 20.44 ? 95  VAL B N   1 
ATOM   3275 C CA  . VAL B 1 95  ? 26.358 25.698 114.550 1.00 23.74 ? 95  VAL B CA  1 
ATOM   3276 C C   . VAL B 1 95  ? 25.099 24.990 114.046 1.00 22.64 ? 95  VAL B C   1 
ATOM   3277 O O   . VAL B 1 95  ? 24.953 24.745 112.844 1.00 22.31 ? 95  VAL B O   1 
ATOM   3278 C CB  . VAL B 1 95  ? 27.308 24.659 115.196 1.00 25.11 ? 95  VAL B CB  1 
ATOM   3279 C CG1 . VAL B 1 95  ? 27.281 23.339 114.405 1.00 24.75 ? 95  VAL B CG1 1 
ATOM   3280 C CG2 . VAL B 1 95  ? 28.730 25.226 115.233 1.00 24.24 ? 95  VAL B CG2 1 
ATOM   3281 N N   . LEU B 1 96  ? 24.200 24.686 114.982 1.00 23.36 ? 96  LEU B N   1 
ATOM   3282 C CA  . LEU B 1 96  ? 22.940 23.996 114.704 1.00 27.93 ? 96  LEU B CA  1 
ATOM   3283 C C   . LEU B 1 96  ? 21.963 24.791 113.846 1.00 30.71 ? 96  LEU B C   1 
ATOM   3284 O O   . LEU B 1 96  ? 20.976 24.230 113.362 1.00 29.05 ? 96  LEU B O   1 
ATOM   3285 C CB  . LEU B 1 96  ? 22.255 23.609 116.026 1.00 27.75 ? 96  LEU B CB  1 
ATOM   3286 C CG  . LEU B 1 96  ? 22.292 22.168 116.558 1.00 32.44 ? 96  LEU B CG  1 
ATOM   3287 C CD1 . LEU B 1 96  ? 23.340 21.325 115.837 1.00 30.41 ? 96  LEU B CD1 1 
ATOM   3288 C CD2 . LEU B 1 96  ? 22.547 22.199 118.058 1.00 30.76 ? 96  LEU B CD2 1 
ATOM   3289 N N   . LYS B 1 97  ? 22.213 26.087 113.658 1.00 28.67 ? 97  LYS B N   1 
ATOM   3290 C CA  . LYS B 1 97  ? 21.309 26.892 112.831 1.00 30.51 ? 97  LYS B CA  1 
ATOM   3291 C C   . LYS B 1 97  ? 21.458 26.517 111.369 1.00 29.71 ? 97  LYS B C   1 
ATOM   3292 O O   . LYS B 1 97  ? 20.588 26.807 110.553 1.00 31.38 ? 97  LYS B O   1 
ATOM   3293 C CB  . LYS B 1 97  ? 21.586 28.392 112.976 1.00 31.58 ? 97  LYS B CB  1 
ATOM   3294 C CG  . LYS B 1 97  ? 20.974 29.062 114.200 1.00 28.64 ? 97  LYS B CG  1 
ATOM   3295 C CD  . LYS B 1 97  ? 21.363 30.532 114.201 1.00 30.82 ? 97  LYS B CD  1 
ATOM   3296 C CE  . LYS B 1 97  ? 20.854 31.274 115.418 1.00 31.08 ? 97  LYS B CE  1 
ATOM   3297 N NZ  . LYS B 1 97  ? 21.411 32.665 115.410 1.00 32.33 ? 97  LYS B NZ  1 
ATOM   3298 N N   . HIS B 1 98  ? 22.571 25.881 111.031 1.00 30.64 ? 98  HIS B N   1 
ATOM   3299 C CA  . HIS B 1 98  ? 22.808 25.480 109.653 1.00 30.26 ? 98  HIS B CA  1 
ATOM   3300 C C   . HIS B 1 98  ? 22.102 24.141 109.393 1.00 33.24 ? 98  HIS B C   1 
ATOM   3301 O O   . HIS B 1 98  ? 22.525 23.095 109.886 1.00 30.19 ? 98  HIS B O   1 
ATOM   3302 C CB  . HIS B 1 98  ? 24.313 25.377 109.412 1.00 29.24 ? 98  HIS B CB  1 
ATOM   3303 C CG  . HIS B 1 98  ? 25.017 26.703 109.431 1.00 32.85 ? 98  HIS B CG  1 
ATOM   3304 N ND1 . HIS B 1 98  ? 25.313 27.408 108.283 1.00 33.33 ? 98  HIS B ND1 1 
ATOM   3305 C CD2 . HIS B 1 98  ? 25.433 27.477 110.464 1.00 29.59 ? 98  HIS B CD2 1 
ATOM   3306 C CE1 . HIS B 1 98  ? 25.878 28.558 108.606 1.00 32.10 ? 98  HIS B CE1 1 
ATOM   3307 N NE2 . HIS B 1 98  ? 25.961 28.625 109.923 1.00 32.39 ? 98  HIS B NE2 1 
ATOM   3308 N N   . PRO B 1 99  ? 21.003 24.165 108.617 1.00 35.33 ? 99  PRO B N   1 
ATOM   3309 C CA  . PRO B 1 99  ? 20.246 22.947 108.307 1.00 36.33 ? 99  PRO B CA  1 
ATOM   3310 C C   . PRO B 1 99  ? 21.018 21.815 107.624 1.00 33.96 ? 99  PRO B C   1 
ATOM   3311 O O   . PRO B 1 99  ? 20.545 20.686 107.594 1.00 33.73 ? 99  PRO B O   1 
ATOM   3312 C CB  . PRO B 1 99  ? 19.073 23.471 107.468 1.00 35.52 ? 99  PRO B CB  1 
ATOM   3313 C CG  . PRO B 1 99  ? 19.654 24.675 106.794 1.00 38.18 ? 99  PRO B CG  1 
ATOM   3314 C CD  . PRO B 1 99  ? 20.428 25.328 107.917 1.00 37.03 ? 99  PRO B CD  1 
ATOM   3315 N N   . THR B 1 100 ? 22.197 22.098 107.079 1.00 33.73 ? 100 THR B N   1 
ATOM   3316 C CA  . THR B 1 100 ? 22.974 21.036 106.446 1.00 31.83 ? 100 THR B CA  1 
ATOM   3317 C C   . THR B 1 100 ? 23.635 20.166 107.501 1.00 32.62 ? 100 THR B C   1 
ATOM   3318 O O   . THR B 1 100 ? 24.063 19.050 107.219 1.00 30.48 ? 100 THR B O   1 
ATOM   3319 C CB  . THR B 1 100 ? 24.085 21.580 105.525 1.00 35.93 ? 100 THR B CB  1 
ATOM   3320 O OG1 . THR B 1 100 ? 24.892 22.529 106.239 1.00 32.32 ? 100 THR B OG1 1 
ATOM   3321 C CG2 . THR B 1 100 ? 23.480 22.225 104.289 1.00 37.20 ? 100 THR B CG2 1 
ATOM   3322 N N   . VAL B 1 101 ? 23.716 20.676 108.726 1.00 28.10 ? 101 VAL B N   1 
ATOM   3323 C CA  . VAL B 1 101 ? 24.351 19.921 109.798 1.00 28.76 ? 101 VAL B CA  1 
ATOM   3324 C C   . VAL B 1 101 ? 23.573 18.657 110.170 1.00 28.47 ? 101 VAL B C   1 
ATOM   3325 O O   . VAL B 1 101 ? 22.379 18.710 110.438 1.00 27.71 ? 101 VAL B O   1 
ATOM   3326 C CB  . VAL B 1 101 ? 24.544 20.804 111.057 1.00 28.30 ? 101 VAL B CB  1 
ATOM   3327 C CG1 . VAL B 1 101 ? 25.135 19.979 112.201 1.00 30.20 ? 101 VAL B CG1 1 
ATOM   3328 C CG2 . VAL B 1 101 ? 25.463 21.978 110.717 1.00 25.69 ? 101 VAL B CG2 1 
ATOM   3329 N N   . GLU B 1 102 ? 24.272 17.525 110.176 1.00 28.35 ? 102 GLU B N   1 
ATOM   3330 C CA  . GLU B 1 102 ? 23.670 16.242 110.526 1.00 30.86 ? 102 GLU B CA  1 
ATOM   3331 C C   . GLU B 1 102 ? 24.214 15.819 111.882 1.00 30.68 ? 102 GLU B C   1 
ATOM   3332 O O   . GLU B 1 102 ? 23.545 15.122 112.647 1.00 32.03 ? 102 GLU B O   1 
ATOM   3333 C CB  . GLU B 1 102 ? 23.999 15.194 109.453 1.00 31.30 ? 102 GLU B CB  1 
ATOM   3334 C CG  . GLU B 1 102 ? 23.594 15.639 108.059 1.00 34.67 ? 102 GLU B CG  1 
ATOM   3335 C CD  . GLU B 1 102 ? 23.840 14.583 106.991 1.00 39.47 ? 102 GLU B CD  1 
ATOM   3336 O OE1 . GLU B 1 102 ? 24.738 13.737 107.176 1.00 40.44 ? 102 GLU B OE1 1 
ATOM   3337 O OE2 . GLU B 1 102 ? 23.141 14.620 105.957 1.00 41.15 ? 102 GLU B OE2 1 
ATOM   3338 N N   . LYS B 1 103 ? 25.441 16.232 112.176 1.00 30.62 ? 103 LYS B N   1 
ATOM   3339 C CA  . LYS B 1 103 ? 26.028 15.920 113.470 1.00 32.03 ? 103 LYS B CA  1 
ATOM   3340 C C   . LYS B 1 103 ? 27.000 16.991 113.954 1.00 30.43 ? 103 LYS B C   1 
ATOM   3341 O O   . LYS B 1 103 ? 27.831 17.499 113.195 1.00 31.51 ? 103 LYS B O   1 
ATOM   3342 C CB  . LYS B 1 103 ? 26.738 14.557 113.465 1.00 33.31 ? 103 LYS B CB  1 
ATOM   3343 C CG  . LYS B 1 103 ? 27.264 14.209 114.866 1.00 36.79 ? 103 LYS B CG  1 
ATOM   3344 C CD  . LYS B 1 103 ? 27.562 12.736 115.072 1.00 39.88 ? 103 LYS B CD  1 
ATOM   3345 C CE  . LYS B 1 103 ? 28.695 12.258 114.202 1.00 40.33 ? 103 LYS B CE  1 
ATOM   3346 N NZ  . LYS B 1 103 ? 29.163 10.930 114.684 1.00 45.09 ? 103 LYS B NZ  1 
ATOM   3347 N N   . ALA B 1 104 ? 26.876 17.331 115.229 1.00 28.27 ? 104 ALA B N   1 
ATOM   3348 C CA  . ALA B 1 104 ? 27.739 18.326 115.851 1.00 30.08 ? 104 ALA B CA  1 
ATOM   3349 C C   . ALA B 1 104 ? 28.249 17.754 117.166 1.00 27.64 ? 104 ALA B C   1 
ATOM   3350 O O   . ALA B 1 104 ? 27.494 17.588 118.117 1.00 28.79 ? 104 ALA B O   1 
ATOM   3351 C CB  . ALA B 1 104 ? 26.963 19.641 116.095 1.00 27.12 ? 104 ALA B CB  1 
ATOM   3352 N N   . VAL B 1 105 ? 29.532 17.415 117.189 1.00 27.60 ? 105 VAL B N   1 
ATOM   3353 C CA  . VAL B 1 105 ? 30.158 16.882 118.383 1.00 28.56 ? 105 VAL B CA  1 
ATOM   3354 C C   . VAL B 1 105 ? 30.838 18.026 119.133 1.00 26.69 ? 105 VAL B C   1 
ATOM   3355 O O   . VAL B 1 105 ? 31.617 18.791 118.560 1.00 26.82 ? 105 VAL B O   1 
ATOM   3356 C CB  . VAL B 1 105 ? 31.238 15.817 118.044 1.00 27.87 ? 105 VAL B CB  1 
ATOM   3357 C CG1 . VAL B 1 105 ? 31.870 15.302 119.323 1.00 27.54 ? 105 VAL B CG1 1 
ATOM   3358 C CG2 . VAL B 1 105 ? 30.621 14.666 117.257 1.00 28.26 ? 105 VAL B CG2 1 
ATOM   3359 N N   . MET B 1 106 ? 30.529 18.140 120.415 1.00 26.85 ? 106 MET B N   1 
ATOM   3360 C CA  . MET B 1 106 ? 31.124 19.162 121.265 1.00 29.25 ? 106 MET B CA  1 
ATOM   3361 C C   . MET B 1 106 ? 31.905 18.465 122.376 1.00 28.14 ? 106 MET B C   1 
ATOM   3362 O O   . MET B 1 106 ? 31.362 17.637 123.108 1.00 29.52 ? 106 MET B O   1 
ATOM   3363 C CB  . MET B 1 106 ? 30.028 20.041 121.863 1.00 28.40 ? 106 MET B CB  1 
ATOM   3364 C CG  . MET B 1 106 ? 30.512 21.047 122.896 1.00 27.18 ? 106 MET B CG  1 
ATOM   3365 S SD  . MET B 1 106 ? 29.122 21.974 123.615 1.00 25.87 ? 106 MET B SD  1 
ATOM   3366 C CE  . MET B 1 106 ? 29.834 22.507 125.179 1.00 24.36 ? 106 MET B CE  1 
ATOM   3367 N N   . VAL B 1 107 ? 33.188 18.780 122.482 1.00 27.75 ? 107 VAL B N   1 
ATOM   3368 C CA  . VAL B 1 107 ? 34.019 18.193 123.520 1.00 30.23 ? 107 VAL B CA  1 
ATOM   3369 C C   . VAL B 1 107 ? 34.607 19.309 124.370 1.00 30.41 ? 107 VAL B C   1 
ATOM   3370 O O   . VAL B 1 107 ? 35.226 20.239 123.848 1.00 31.66 ? 107 VAL B O   1 
ATOM   3371 C CB  . VAL B 1 107 ? 35.167 17.328 122.924 1.00 30.27 ? 107 VAL B CB  1 
ATOM   3372 C CG1 . VAL B 1 107 ? 36.070 18.171 122.029 1.00 30.05 ? 107 VAL B CG1 1 
ATOM   3373 C CG2 . VAL B 1 107 ? 35.980 16.706 124.050 1.00 28.12 ? 107 VAL B CG2 1 
ATOM   3374 N N   . ASP B 1 108 ? 34.381 19.220 125.675 1.00 30.89 ? 108 ASP B N   1 
ATOM   3375 C CA  . ASP B 1 108 ? 34.875 20.205 126.627 1.00 33.30 ? 108 ASP B CA  1 
ATOM   3376 C C   . ASP B 1 108 ? 35.241 19.454 127.905 1.00 34.19 ? 108 ASP B C   1 
ATOM   3377 O O   . ASP B 1 108 ? 34.535 18.528 128.322 1.00 33.81 ? 108 ASP B O   1 
ATOM   3378 C CB  . ASP B 1 108 ? 33.801 21.256 126.922 1.00 36.03 ? 108 ASP B CB  1 
ATOM   3379 C CG  . ASP B 1 108 ? 34.379 22.529 127.525 1.00 41.27 ? 108 ASP B CG  1 
ATOM   3380 O OD1 . ASP B 1 108 ? 33.596 23.345 128.049 1.00 44.44 ? 108 ASP B OD1 1 
ATOM   3381 O OD2 . ASP B 1 108 ? 35.613 22.722 127.461 1.00 41.88 ? 108 ASP B OD2 1 
ATOM   3382 N N   . ILE B 1 109 ? 36.340 19.865 128.524 1.00 32.59 ? 109 ILE B N   1 
ATOM   3383 C CA  . ILE B 1 109 ? 36.849 19.218 129.728 1.00 32.66 ? 109 ILE B CA  1 
ATOM   3384 C C   . ILE B 1 109 ? 36.043 19.424 131.018 1.00 31.28 ? 109 ILE B C   1 
ATOM   3385 O O   . ILE B 1 109 ? 36.006 18.537 131.868 1.00 29.08 ? 109 ILE B O   1 
ATOM   3386 C CB  . ILE B 1 109 ? 38.315 19.668 129.996 1.00 33.13 ? 109 ILE B CB  1 
ATOM   3387 C CG1 . ILE B 1 109 ? 38.991 18.745 131.016 1.00 38.93 ? 109 ILE B CG1 1 
ATOM   3388 C CG2 . ILE B 1 109 ? 38.336 21.086 130.544 1.00 34.55 ? 109 ILE B CG2 1 
ATOM   3389 C CD1 . ILE B 1 109 ? 39.404 17.397 130.462 1.00 42.96 ? 109 ILE B CD1 1 
ATOM   3390 N N   . ASP B 1 110 ? 35.388 20.571 131.160 1.00 30.28 ? 110 ASP B N   1 
ATOM   3391 C CA  . ASP B 1 110 ? 34.663 20.883 132.393 1.00 30.28 ? 110 ASP B CA  1 
ATOM   3392 C C   . ASP B 1 110 ? 33.166 20.603 132.394 1.00 31.90 ? 110 ASP B C   1 
ATOM   3393 O O   . ASP B 1 110 ? 32.362 21.488 132.114 1.00 31.87 ? 110 ASP B O   1 
ATOM   3394 C CB  . ASP B 1 110 ? 34.912 22.350 132.753 1.00 29.33 ? 110 ASP B CB  1 
ATOM   3395 C CG  . ASP B 1 110 ? 34.548 22.676 134.193 1.00 29.52 ? 110 ASP B CG  1 
ATOM   3396 O OD1 . ASP B 1 110 ? 35.048 23.707 134.699 1.00 25.43 ? 110 ASP B OD1 1 
ATOM   3397 O OD2 . ASP B 1 110 ? 33.758 21.922 134.815 1.00 28.80 ? 110 ASP B OD2 1 
ATOM   3398 N N   . GLY B 1 111 ? 32.804 19.368 132.745 1.00 34.92 ? 111 GLY B N   1 
ATOM   3399 C CA  . GLY B 1 111 ? 31.406 18.962 132.781 1.00 33.17 ? 111 GLY B CA  1 
ATOM   3400 C C   . GLY B 1 111 ? 30.551 19.711 133.786 1.00 30.93 ? 111 GLY B C   1 
ATOM   3401 O O   . GLY B 1 111 ? 29.370 19.955 133.543 1.00 30.54 ? 111 GLY B O   1 
ATOM   3402 N N   . GLU B 1 112 ? 31.131 20.064 134.928 1.00 32.00 ? 112 GLU B N   1 
ATOM   3403 C CA  . GLU B 1 112 ? 30.376 20.803 135.925 1.00 32.18 ? 112 GLU B CA  1 
ATOM   3404 C C   . GLU B 1 112 ? 29.989 22.173 135.367 1.00 31.53 ? 112 GLU B C   1 
ATOM   3405 O O   . GLU B 1 112 ? 28.866 22.636 135.564 1.00 31.75 ? 112 GLU B O   1 
ATOM   3406 C CB  . GLU B 1 112 ? 31.190 20.975 137.207 1.00 34.20 ? 112 GLU B CB  1 
ATOM   3407 C CG  . GLU B 1 112 ? 31.610 19.661 137.844 1.00 43.54 ? 112 GLU B CG  1 
ATOM   3408 C CD  . GLU B 1 112 ? 31.931 19.799 139.327 1.00 47.46 ? 112 GLU B CD  1 
ATOM   3409 O OE1 . GLU B 1 112 ? 32.774 20.648 139.696 1.00 42.91 ? 112 GLU B OE1 1 
ATOM   3410 O OE2 . GLU B 1 112 ? 31.331 19.046 140.123 1.00 53.00 ? 112 GLU B OE2 1 
ATOM   3411 N N   . LEU B 1 113 ? 30.919 22.819 134.669 1.00 29.84 ? 113 LEU B N   1 
ATOM   3412 C CA  . LEU B 1 113 ? 30.635 24.137 134.101 1.00 30.40 ? 113 LEU B CA  1 
ATOM   3413 C C   . LEU B 1 113 ? 29.484 24.011 133.116 1.00 29.85 ? 113 LEU B C   1 
ATOM   3414 O O   . LEU B 1 113 ? 28.550 24.816 133.120 1.00 27.27 ? 113 LEU B O   1 
ATOM   3415 C CB  . LEU B 1 113 ? 31.882 24.694 133.406 1.00 31.98 ? 113 LEU B CB  1 
ATOM   3416 C CG  . LEU B 1 113 ? 31.835 26.105 132.816 1.00 34.71 ? 113 LEU B CG  1 
ATOM   3417 C CD1 . LEU B 1 113 ? 31.126 26.071 131.482 1.00 40.30 ? 113 LEU B CD1 1 
ATOM   3418 C CD2 . LEU B 1 113 ? 31.163 27.057 133.781 1.00 33.00 ? 113 LEU B CD2 1 
ATOM   3419 N N   . VAL B 1 114 ? 29.540 22.990 132.271 1.00 29.63 ? 114 VAL B N   1 
ATOM   3420 C CA  . VAL B 1 114 ? 28.467 22.786 131.314 1.00 28.46 ? 114 VAL B CA  1 
ATOM   3421 C C   . VAL B 1 114 ? 27.143 22.670 132.064 1.00 28.51 ? 114 VAL B C   1 
ATOM   3422 O O   . VAL B 1 114 ? 26.117 23.196 131.626 1.00 31.23 ? 114 VAL B O   1 
ATOM   3423 C CB  . VAL B 1 114 ? 28.711 21.526 130.483 1.00 29.10 ? 114 VAL B CB  1 
ATOM   3424 C CG1 . VAL B 1 114 ? 27.433 21.104 129.800 1.00 24.56 ? 114 VAL B CG1 1 
ATOM   3425 C CG2 . VAL B 1 114 ? 29.797 21.803 129.450 1.00 27.54 ? 114 VAL B CG2 1 
ATOM   3426 N N   . GLU B 1 115 ? 27.168 21.989 133.204 1.00 30.19 ? 115 GLU B N   1 
ATOM   3427 C CA  . GLU B 1 115 ? 25.963 21.842 134.013 1.00 31.16 ? 115 GLU B CA  1 
ATOM   3428 C C   . GLU B 1 115 ? 25.451 23.198 134.514 1.00 29.68 ? 115 GLU B C   1 
ATOM   3429 O O   . GLU B 1 115 ? 24.240 23.421 134.576 1.00 28.89 ? 115 GLU B O   1 
ATOM   3430 C CB  . GLU B 1 115 ? 26.230 20.906 135.191 1.00 36.22 ? 115 GLU B CB  1 
ATOM   3431 C CG  . GLU B 1 115 ? 26.288 19.424 134.813 1.00 38.78 ? 115 GLU B CG  1 
ATOM   3432 C CD  . GLU B 1 115 ? 24.971 18.915 134.246 1.00 43.26 ? 115 GLU B CD  1 
ATOM   3433 O OE1 . GLU B 1 115 ? 23.914 19.455 134.631 1.00 44.55 ? 115 GLU B OE1 1 
ATOM   3434 O OE2 . GLU B 1 115 ? 24.988 17.969 133.425 1.00 46.43 ? 115 GLU B OE2 1 
ATOM   3435 N N   . VAL B 1 116 ? 26.361 24.104 134.868 1.00 27.14 ? 116 VAL B N   1 
ATOM   3436 C CA  . VAL B 1 116 ? 25.947 25.437 135.319 1.00 24.98 ? 116 VAL B CA  1 
ATOM   3437 C C   . VAL B 1 116 ? 25.229 26.143 134.164 1.00 26.21 ? 116 VAL B C   1 
ATOM   3438 O O   . VAL B 1 116 ? 24.204 26.803 134.364 1.00 24.68 ? 116 VAL B O   1 
ATOM   3439 C CB  . VAL B 1 116 ? 27.160 26.300 135.765 1.00 25.39 ? 116 VAL B CB  1 
ATOM   3440 C CG1 . VAL B 1 116 ? 26.715 27.746 136.040 1.00 22.13 ? 116 VAL B CG1 1 
ATOM   3441 C CG2 . VAL B 1 116 ? 27.778 25.710 137.038 1.00 26.56 ? 116 VAL B CG2 1 
ATOM   3442 N N   . ALA B 1 117 ? 25.763 25.998 132.953 1.00 26.21 ? 117 ALA B N   1 
ATOM   3443 C CA  . ALA B 1 117 ? 25.158 26.624 131.771 1.00 24.85 ? 117 ALA B CA  1 
ATOM   3444 C C   . ALA B 1 117 ? 23.760 26.050 131.539 1.00 25.73 ? 117 ALA B C   1 
ATOM   3445 O O   . ALA B 1 117 ? 22.783 26.789 131.384 1.00 24.06 ? 117 ALA B O   1 
ATOM   3446 C CB  . ALA B 1 117 ? 26.029 26.376 130.548 1.00 27.17 ? 117 ALA B CB  1 
ATOM   3447 N N   . LYS B 1 118 ? 23.676 24.724 131.516 1.00 26.88 ? 118 LYS B N   1 
ATOM   3448 C CA  . LYS B 1 118 ? 22.406 24.057 131.313 1.00 29.88 ? 118 LYS B CA  1 
ATOM   3449 C C   . LYS B 1 118 ? 21.361 24.601 132.284 1.00 31.07 ? 118 LYS B C   1 
ATOM   3450 O O   . LYS B 1 118 ? 20.263 24.952 131.870 1.00 31.57 ? 118 LYS B O   1 
ATOM   3451 C CB  . LYS B 1 118 ? 22.563 22.540 131.492 1.00 31.72 ? 118 LYS B CB  1 
ATOM   3452 C CG  . LYS B 1 118 ? 23.343 21.863 130.362 1.00 32.09 ? 118 LYS B CG  1 
ATOM   3453 C CD  . LYS B 1 118 ? 23.282 20.342 130.468 1.00 34.22 ? 118 LYS B CD  1 
ATOM   3454 C CE  . LYS B 1 118 ? 23.776 19.682 129.180 1.00 33.00 ? 118 LYS B CE  1 
ATOM   3455 N NZ  . LYS B 1 118 ? 23.726 18.190 129.233 1.00 34.20 ? 118 LYS B NZ  1 
ATOM   3456 N N   . ARG B 1 119 ? 21.717 24.710 133.563 1.00 30.65 ? 119 ARG B N   1 
ATOM   3457 C CA  . ARG B 1 119 ? 20.774 25.204 134.567 1.00 33.41 ? 119 ARG B CA  1 
ATOM   3458 C C   . ARG B 1 119 ? 20.522 26.711 134.631 1.00 32.62 ? 119 ARG B C   1 
ATOM   3459 O O   . ARG B 1 119 ? 19.374 27.143 134.747 1.00 32.16 ? 119 ARG B O   1 
ATOM   3460 C CB  . ARG B 1 119 ? 21.189 24.743 135.969 1.00 36.51 ? 119 ARG B CB  1 
ATOM   3461 C CG  . ARG B 1 119 ? 20.262 25.272 137.070 1.00 45.03 ? 119 ARG B CG  1 
ATOM   3462 C CD  . ARG B 1 119 ? 20.715 24.860 138.464 1.00 53.22 ? 119 ARG B CD  1 
ATOM   3463 N NE  . ARG B 1 119 ? 19.864 25.432 139.509 1.00 60.01 ? 119 ARG B NE  1 
ATOM   3464 C CZ  . ARG B 1 119 ? 20.164 25.426 140.807 1.00 63.53 ? 119 ARG B CZ  1 
ATOM   3465 N NH1 . ARG B 1 119 ? 21.299 24.875 141.224 1.00 63.76 ? 119 ARG B NH1 1 
ATOM   3466 N NH2 . ARG B 1 119 ? 19.333 25.973 141.691 1.00 62.57 ? 119 ARG B NH2 1 
ATOM   3467 N N   . HIS B 1 120 ? 21.580 27.512 134.546 1.00 29.01 ? 120 HIS B N   1 
ATOM   3468 C CA  . HIS B 1 120 ? 21.430 28.958 134.673 1.00 28.99 ? 120 HIS B CA  1 
ATOM   3469 C C   . HIS B 1 120 ? 21.624 29.818 133.435 1.00 28.51 ? 120 HIS B C   1 
ATOM   3470 O O   . HIS B 1 120 ? 21.470 31.037 133.506 1.00 27.00 ? 120 HIS B O   1 
ATOM   3471 C CB  . HIS B 1 120 ? 22.394 29.465 135.745 1.00 30.12 ? 120 HIS B CB  1 
ATOM   3472 C CG  . HIS B 1 120 ? 22.198 28.830 137.084 1.00 31.44 ? 120 HIS B CG  1 
ATOM   3473 N ND1 . HIS B 1 120 ? 21.115 29.112 137.888 1.00 30.67 ? 120 HIS B ND1 1 
ATOM   3474 C CD2 . HIS B 1 120 ? 22.962 27.948 137.773 1.00 33.11 ? 120 HIS B CD2 1 
ATOM   3475 C CE1 . HIS B 1 120 ? 21.222 28.435 139.018 1.00 35.24 ? 120 HIS B CE1 1 
ATOM   3476 N NE2 . HIS B 1 120 ? 22.334 27.721 138.975 1.00 33.17 ? 120 HIS B NE2 1 
ATOM   3477 N N   . MET B 1 121 ? 21.957 29.210 132.307 1.00 26.59 ? 121 MET B N   1 
ATOM   3478 C CA  . MET B 1 121 ? 22.207 30.002 131.112 1.00 25.89 ? 121 MET B CA  1 
ATOM   3479 C C   . MET B 1 121 ? 21.418 29.559 129.871 1.00 25.03 ? 121 MET B C   1 
ATOM   3480 O O   . MET B 1 121 ? 21.983 29.418 128.780 1.00 24.61 ? 121 MET B O   1 
ATOM   3481 C CB  . MET B 1 121 ? 23.719 29.984 130.836 1.00 22.45 ? 121 MET B CB  1 
ATOM   3482 C CG  . MET B 1 121 ? 24.550 30.535 132.016 1.00 20.46 ? 121 MET B CG  1 
ATOM   3483 S SD  . MET B 1 121 ? 26.341 30.387 131.795 1.00 24.34 ? 121 MET B SD  1 
ATOM   3484 C CE  . MET B 1 121 ? 26.570 31.437 130.380 1.00 20.00 ? 121 MET B CE  1 
ATOM   3485 N N   . PRO B 1 122 ? 20.103 29.345 130.024 1.00 25.72 ? 122 PRO B N   1 
ATOM   3486 C CA  . PRO B 1 122 ? 19.283 28.922 128.882 1.00 26.62 ? 122 PRO B CA  1 
ATOM   3487 C C   . PRO B 1 122 ? 19.315 29.946 127.753 1.00 24.03 ? 122 PRO B C   1 
ATOM   3488 O O   . PRO B 1 122 ? 19.105 29.597 126.586 1.00 23.34 ? 122 PRO B O   1 
ATOM   3489 C CB  . PRO B 1 122 ? 17.893 28.768 129.491 1.00 27.68 ? 122 PRO B CB  1 
ATOM   3490 C CG  . PRO B 1 122 ? 17.893 29.783 130.595 1.00 27.12 ? 122 PRO B CG  1 
ATOM   3491 C CD  . PRO B 1 122 ? 19.263 29.574 131.214 1.00 26.71 ? 122 PRO B CD  1 
ATOM   3492 N N   . GLU B 1 123 ? 19.586 31.203 128.111 1.00 22.46 ? 123 GLU B N   1 
ATOM   3493 C CA  . GLU B 1 123 ? 19.667 32.292 127.135 1.00 23.50 ? 123 GLU B CA  1 
ATOM   3494 C C   . GLU B 1 123 ? 20.762 31.990 126.112 1.00 21.37 ? 123 GLU B C   1 
ATOM   3495 O O   . GLU B 1 123 ? 20.707 32.436 124.972 1.00 21.14 ? 123 GLU B O   1 
ATOM   3496 C CB  . GLU B 1 123 ? 19.974 33.628 127.832 1.00 24.98 ? 123 GLU B CB  1 
ATOM   3497 C CG  . GLU B 1 123 ? 18.917 34.089 128.846 1.00 22.54 ? 123 GLU B CG  1 
ATOM   3498 C CD  . GLU B 1 123 ? 19.153 33.542 130.231 1.00 28.54 ? 123 GLU B CD  1 
ATOM   3499 O OE1 . GLU B 1 123 ? 18.394 33.926 131.146 1.00 27.89 ? 123 GLU B OE1 1 
ATOM   3500 O OE2 . GLU B 1 123 ? 20.097 32.734 130.413 1.00 27.40 ? 123 GLU B OE2 1 
ATOM   3501 N N   . TRP B 1 124 ? 21.758 31.228 126.539 1.00 21.19 ? 124 TRP B N   1 
ATOM   3502 C CA  . TRP B 1 124 ? 22.863 30.844 125.671 1.00 22.09 ? 124 TRP B CA  1 
ATOM   3503 C C   . TRP B 1 124 ? 22.544 29.555 124.895 1.00 22.75 ? 124 TRP B C   1 
ATOM   3504 O O   . TRP B 1 124 ? 22.417 29.574 123.672 1.00 24.51 ? 124 TRP B O   1 
ATOM   3505 C CB  . TRP B 1 124 ? 24.136 30.617 126.501 1.00 24.34 ? 124 TRP B CB  1 
ATOM   3506 C CG  . TRP B 1 124 ? 24.936 31.866 126.848 1.00 23.22 ? 124 TRP B CG  1 
ATOM   3507 C CD1 . TRP B 1 124 ? 26.105 32.277 126.266 1.00 22.55 ? 124 TRP B CD1 1 
ATOM   3508 C CD2 . TRP B 1 124 ? 24.664 32.803 127.901 1.00 23.09 ? 124 TRP B CD2 1 
ATOM   3509 N NE1 . TRP B 1 124 ? 26.583 33.406 126.899 1.00 20.15 ? 124 TRP B NE1 1 
ATOM   3510 C CE2 . TRP B 1 124 ? 25.718 33.750 127.904 1.00 21.37 ? 124 TRP B CE2 1 
ATOM   3511 C CE3 . TRP B 1 124 ? 23.635 32.933 128.844 1.00 22.93 ? 124 TRP B CE3 1 
ATOM   3512 C CZ2 . TRP B 1 124 ? 25.773 34.813 128.819 1.00 20.87 ? 124 TRP B CZ2 1 
ATOM   3513 C CZ3 . TRP B 1 124 ? 23.689 33.992 129.757 1.00 22.49 ? 124 TRP B CZ3 1 
ATOM   3514 C CH2 . TRP B 1 124 ? 24.755 34.918 129.737 1.00 24.42 ? 124 TRP B CH2 1 
ATOM   3515 N N   . HIS B 1 125 ? 22.395 28.440 125.601 1.00 21.81 ? 125 HIS B N   1 
ATOM   3516 C CA  . HIS B 1 125 ? 22.160 27.181 124.901 1.00 23.74 ? 125 HIS B CA  1 
ATOM   3517 C C   . HIS B 1 125 ? 20.844 27.117 124.122 1.00 24.00 ? 125 HIS B C   1 
ATOM   3518 O O   . HIS B 1 125 ? 20.799 26.558 123.025 1.00 24.57 ? 125 HIS B O   1 
ATOM   3519 C CB  . HIS B 1 125 ? 22.339 25.966 125.852 1.00 23.57 ? 125 HIS B CB  1 
ATOM   3520 C CG  . HIS B 1 125 ? 21.392 25.916 127.017 1.00 24.78 ? 125 HIS B CG  1 
ATOM   3521 N ND1 . HIS B 1 125 ? 20.078 25.511 126.902 1.00 25.64 ? 125 HIS B ND1 1 
ATOM   3522 C CD2 . HIS B 1 125 ? 21.592 26.161 128.337 1.00 29.77 ? 125 HIS B CD2 1 
ATOM   3523 C CE1 . HIS B 1 125 ? 19.510 25.506 128.097 1.00 24.40 ? 125 HIS B CE1 1 
ATOM   3524 N NE2 . HIS B 1 125 ? 20.408 25.897 128.986 1.00 29.00 ? 125 HIS B NE2 1 
ATOM   3525 N N   . GLN B 1 126 ? 19.804 27.742 124.652 1.00 23.16 ? 126 GLN B N   1 
ATOM   3526 C CA  . GLN B 1 126 ? 18.498 27.741 124.001 1.00 27.94 ? 126 GLN B CA  1 
ATOM   3527 C C   . GLN B 1 126 ? 18.120 26.337 123.521 1.00 29.40 ? 126 GLN B C   1 
ATOM   3528 O O   . GLN B 1 126 ? 17.553 26.160 122.447 1.00 33.68 ? 126 GLN B O   1 
ATOM   3529 C CB  . GLN B 1 126 ? 18.484 28.757 122.847 1.00 27.69 ? 126 GLN B CB  1 
ATOM   3530 C CG  . GLN B 1 126 ? 18.802 30.164 123.357 1.00 32.00 ? 126 GLN B CG  1 
ATOM   3531 C CD  . GLN B 1 126 ? 18.728 31.265 122.309 1.00 39.51 ? 126 GLN B CD  1 
ATOM   3532 O OE1 . GLN B 1 126 ? 19.313 32.340 122.492 1.00 39.48 ? 126 GLN B OE1 1 
ATOM   3533 N NE2 . GLN B 1 126 ? 17.995 31.020 121.225 1.00 39.02 ? 126 GLN B NE2 1 
ATOM   3534 N N   . GLY B 1 127 ? 18.451 25.341 124.338 1.00 29.02 ? 127 GLY B N   1 
ATOM   3535 C CA  . GLY B 1 127 ? 18.118 23.962 124.019 1.00 32.00 ? 127 GLY B CA  1 
ATOM   3536 C C   . GLY B 1 127 ? 19.067 23.200 123.113 1.00 29.32 ? 127 GLY B C   1 
ATOM   3537 O O   . GLY B 1 127 ? 18.848 22.026 122.851 1.00 29.82 ? 127 GLY B O   1 
ATOM   3538 N N   . ALA B 1 128 ? 20.126 23.845 122.646 1.00 28.33 ? 128 ALA B N   1 
ATOM   3539 C CA  . ALA B 1 128 ? 21.080 23.187 121.756 1.00 28.94 ? 128 ALA B CA  1 
ATOM   3540 C C   . ALA B 1 128 ? 21.617 21.840 122.246 1.00 30.15 ? 128 ALA B C   1 
ATOM   3541 O O   . ALA B 1 128 ? 21.820 20.929 121.438 1.00 30.76 ? 128 ALA B O   1 
ATOM   3542 C CB  . ALA B 1 128 ? 22.257 24.131 121.450 1.00 26.44 ? 128 ALA B CB  1 
ATOM   3543 N N   . PHE B 1 129 ? 21.862 21.703 123.548 1.00 29.87 ? 129 PHE B N   1 
ATOM   3544 C CA  . PHE B 1 129 ? 22.401 20.443 124.065 1.00 29.94 ? 129 PHE B CA  1 
ATOM   3545 C C   . PHE B 1 129 ? 21.443 19.272 123.802 1.00 31.86 ? 129 PHE B C   1 
ATOM   3546 O O   . PHE B 1 129 ? 21.877 18.128 123.643 1.00 30.84 ? 129 PHE B O   1 
ATOM   3547 C CB  . PHE B 1 129 ? 22.685 20.534 125.576 1.00 27.14 ? 129 PHE B CB  1 
ATOM   3548 C CG  . PHE B 1 129 ? 23.869 21.406 125.933 1.00 24.60 ? 129 PHE B CG  1 
ATOM   3549 C CD1 . PHE B 1 129 ? 23.690 22.584 126.655 1.00 26.74 ? 129 PHE B CD1 1 
ATOM   3550 C CD2 . PHE B 1 129 ? 25.161 21.039 125.554 1.00 28.27 ? 129 PHE B CD2 1 
ATOM   3551 C CE1 . PHE B 1 129 ? 24.785 23.391 126.998 1.00 26.84 ? 129 PHE B CE1 1 
ATOM   3552 C CE2 . PHE B 1 129 ? 26.261 21.833 125.889 1.00 26.41 ? 129 PHE B CE2 1 
ATOM   3553 C CZ  . PHE B 1 129 ? 26.071 23.012 126.613 1.00 29.76 ? 129 PHE B CZ  1 
ATOM   3554 N N   . ASP B 1 130 ? 20.149 19.564 123.747 1.00 31.80 ? 130 ASP B N   1 
ATOM   3555 C CA  . ASP B 1 130 ? 19.149 18.528 123.517 1.00 35.95 ? 130 ASP B CA  1 
ATOM   3556 C C   . ASP B 1 130 ? 18.790 18.333 122.049 1.00 35.34 ? 130 ASP B C   1 
ATOM   3557 O O   . ASP B 1 130 ? 17.855 17.603 121.726 1.00 36.13 ? 130 ASP B O   1 
ATOM   3558 C CB  . ASP B 1 130 ? 17.882 18.815 124.329 1.00 33.05 ? 130 ASP B CB  1 
ATOM   3559 C CG  . ASP B 1 130 ? 18.151 18.865 125.822 1.00 38.71 ? 130 ASP B CG  1 
ATOM   3560 O OD1 . ASP B 1 130 ? 18.955 18.046 126.317 1.00 41.29 ? 130 ASP B OD1 1 
ATOM   3561 O OD2 . ASP B 1 130 ? 17.555 19.712 126.508 1.00 42.59 ? 130 ASP B OD2 1 
ATOM   3562 N N   . ASP B 1 131 ? 19.526 18.979 121.152 1.00 33.06 ? 131 ASP B N   1 
ATOM   3563 C CA  . ASP B 1 131 ? 19.247 18.800 119.733 1.00 31.53 ? 131 ASP B CA  1 
ATOM   3564 C C   . ASP B 1 131 ? 19.615 17.351 119.402 1.00 31.14 ? 131 ASP B C   1 
ATOM   3565 O O   . ASP B 1 131 ? 20.676 16.868 119.806 1.00 27.69 ? 131 ASP B O   1 
ATOM   3566 C CB  . ASP B 1 131 ? 20.088 19.766 118.897 1.00 29.48 ? 131 ASP B CB  1 
ATOM   3567 C CG  . ASP B 1 131 ? 19.703 19.759 117.423 1.00 29.70 ? 131 ASP B CG  1 
ATOM   3568 O OD1 . ASP B 1 131 ? 19.911 18.730 116.736 1.00 28.61 ? 131 ASP B OD1 1 
ATOM   3569 O OD2 . ASP B 1 131 ? 19.196 20.793 116.946 1.00 31.09 ? 131 ASP B OD2 1 
ATOM   3570 N N   . PRO B 1 132 ? 18.751 16.642 118.655 1.00 31.02 ? 132 PRO B N   1 
ATOM   3571 C CA  . PRO B 1 132 ? 19.089 15.249 118.334 1.00 31.37 ? 132 PRO B CA  1 
ATOM   3572 C C   . PRO B 1 132 ? 20.428 15.109 117.607 1.00 31.56 ? 132 PRO B C   1 
ATOM   3573 O O   . PRO B 1 132 ? 21.083 14.081 117.712 1.00 32.58 ? 132 PRO B O   1 
ATOM   3574 C CB  . PRO B 1 132 ? 17.895 14.783 117.491 1.00 33.19 ? 132 PRO B CB  1 
ATOM   3575 C CG  . PRO B 1 132 ? 17.417 16.042 116.832 1.00 29.82 ? 132 PRO B CG  1 
ATOM   3576 C CD  . PRO B 1 132 ? 17.561 17.098 117.911 1.00 28.93 ? 132 PRO B CD  1 
ATOM   3577 N N   . ARG B 1 133 ? 20.843 16.152 116.893 1.00 30.79 ? 133 ARG B N   1 
ATOM   3578 C CA  . ARG B 1 133 ? 22.109 16.123 116.162 1.00 30.98 ? 133 ARG B CA  1 
ATOM   3579 C C   . ARG B 1 133 ? 23.334 16.412 117.034 1.00 31.81 ? 133 ARG B C   1 
ATOM   3580 O O   . ARG B 1 133 ? 24.472 16.209 116.600 1.00 32.32 ? 133 ARG B O   1 
ATOM   3581 C CB  . ARG B 1 133 ? 22.082 17.141 115.019 1.00 30.85 ? 133 ARG B CB  1 
ATOM   3582 C CG  . ARG B 1 133 ? 20.996 16.911 113.996 1.00 29.71 ? 133 ARG B CG  1 
ATOM   3583 C CD  . ARG B 1 133 ? 20.881 18.119 113.096 1.00 28.81 ? 133 ARG B CD  1 
ATOM   3584 N NE  . ARG B 1 133 ? 20.359 19.272 113.827 1.00 28.74 ? 133 ARG B NE  1 
ATOM   3585 C CZ  . ARG B 1 133 ? 20.245 20.494 113.313 1.00 28.17 ? 133 ARG B CZ  1 
ATOM   3586 N NH1 . ARG B 1 133 ? 20.623 20.725 112.063 1.00 28.38 ? 133 ARG B NH1 1 
ATOM   3587 N NH2 . ARG B 1 133 ? 19.734 21.481 114.044 1.00 24.93 ? 133 ARG B NH2 1 
ATOM   3588 N N   . ALA B 1 134 ? 23.110 16.874 118.258 1.00 30.16 ? 134 ALA B N   1 
ATOM   3589 C CA  . ALA B 1 134 ? 24.218 17.210 119.150 1.00 31.47 ? 134 ALA B CA  1 
ATOM   3590 C C   . ALA B 1 134 ? 24.709 16.068 120.028 1.00 33.19 ? 134 ALA B C   1 
ATOM   3591 O O   . ALA B 1 134 ? 23.918 15.362 120.653 1.00 33.55 ? 134 ALA B O   1 
ATOM   3592 C CB  . ALA B 1 134 ? 23.828 18.391 120.036 1.00 29.24 ? 134 ALA B CB  1 
ATOM   3593 N N   . VAL B 1 135 ? 26.029 15.911 120.082 1.00 31.41 ? 135 VAL B N   1 
ATOM   3594 C CA  . VAL B 1 135 ? 26.658 14.890 120.913 1.00 33.19 ? 135 VAL B CA  1 
ATOM   3595 C C   . VAL B 1 135 ? 27.633 15.605 121.858 1.00 30.67 ? 135 VAL B C   1 
ATOM   3596 O O   . VAL B 1 135 ? 28.593 16.219 121.409 1.00 30.31 ? 135 VAL B O   1 
ATOM   3597 C CB  . VAL B 1 135 ? 27.448 13.885 120.057 1.00 32.08 ? 135 VAL B CB  1 
ATOM   3598 C CG1 . VAL B 1 135 ? 28.065 12.814 120.956 1.00 32.37 ? 135 VAL B CG1 1 
ATOM   3599 C CG2 . VAL B 1 135 ? 26.539 13.278 118.994 1.00 31.86 ? 135 VAL B CG2 1 
ATOM   3600 N N   . LEU B 1 136 ? 27.378 15.531 123.157 1.00 30.19 ? 136 LEU B N   1 
ATOM   3601 C CA  . LEU B 1 136 ? 28.235 16.187 124.136 1.00 28.76 ? 136 LEU B CA  1 
ATOM   3602 C C   . LEU B 1 136 ? 29.273 15.237 124.712 1.00 32.55 ? 136 LEU B C   1 
ATOM   3603 O O   . LEU B 1 136 ? 28.934 14.190 125.246 1.00 34.03 ? 136 LEU B O   1 
ATOM   3604 C CB  . LEU B 1 136 ? 27.391 16.761 125.283 1.00 28.43 ? 136 LEU B CB  1 
ATOM   3605 C CG  . LEU B 1 136 ? 28.144 17.418 126.452 1.00 31.74 ? 136 LEU B CG  1 
ATOM   3606 C CD1 . LEU B 1 136 ? 29.015 18.564 125.941 1.00 30.61 ? 136 LEU B CD1 1 
ATOM   3607 C CD2 . LEU B 1 136 ? 27.149 17.930 127.482 1.00 30.92 ? 136 LEU B CD2 1 
ATOM   3608 N N   . VAL B 1 137 ? 30.543 15.604 124.608 1.00 31.31 ? 137 VAL B N   1 
ATOM   3609 C CA  . VAL B 1 137 ? 31.600 14.772 125.159 1.00 31.49 ? 137 VAL B CA  1 
ATOM   3610 C C   . VAL B 1 137 ? 32.415 15.570 126.179 1.00 32.80 ? 137 VAL B C   1 
ATOM   3611 O O   . VAL B 1 137 ? 32.994 16.615 125.845 1.00 27.23 ? 137 VAL B O   1 
ATOM   3612 C CB  . VAL B 1 137 ? 32.544 14.259 124.052 1.00 33.60 ? 137 VAL B CB  1 
ATOM   3613 C CG1 . VAL B 1 137 ? 33.691 13.483 124.674 1.00 35.33 ? 137 VAL B CG1 1 
ATOM   3614 C CG2 . VAL B 1 137 ? 31.769 13.384 123.071 1.00 33.13 ? 137 VAL B CG2 1 
ATOM   3615 N N   . ILE B 1 138 ? 32.431 15.089 127.421 1.00 30.65 ? 138 ILE B N   1 
ATOM   3616 C CA  . ILE B 1 138 ? 33.198 15.733 128.486 1.00 34.55 ? 138 ILE B CA  1 
ATOM   3617 C C   . ILE B 1 138 ? 34.523 14.994 128.519 1.00 37.09 ? 138 ILE B C   1 
ATOM   3618 O O   . ILE B 1 138 ? 34.594 13.856 128.984 1.00 37.27 ? 138 ILE B O   1 
ATOM   3619 C CB  . ILE B 1 138 ? 32.510 15.596 129.870 1.00 35.03 ? 138 ILE B CB  1 
ATOM   3620 C CG1 . ILE B 1 138 ? 31.240 16.447 129.920 1.00 36.49 ? 138 ILE B CG1 1 
ATOM   3621 C CG2 . ILE B 1 138 ? 33.460 16.032 130.968 1.00 35.97 ? 138 ILE B CG2 1 
ATOM   3622 C CD1 . ILE B 1 138 ? 30.095 15.867 129.152 1.00 40.13 ? 138 ILE B CD1 1 
ATOM   3623 N N   . ASP B 1 139 ? 35.579 15.643 128.041 1.00 37.16 ? 139 ASP B N   1 
ATOM   3624 C CA  . ASP B 1 139 ? 36.876 14.989 127.983 1.00 36.34 ? 139 ASP B CA  1 
ATOM   3625 C C   . ASP B 1 139 ? 37.901 15.954 127.400 1.00 36.97 ? 139 ASP B C   1 
ATOM   3626 O O   . ASP B 1 139 ? 37.551 17.037 126.928 1.00 34.74 ? 139 ASP B O   1 
ATOM   3627 C CB  . ASP B 1 139 ? 36.748 13.760 127.071 1.00 37.53 ? 139 ASP B CB  1 
ATOM   3628 C CG  . ASP B 1 139 ? 37.972 12.860 127.098 1.00 38.04 ? 139 ASP B CG  1 
ATOM   3629 O OD1 . ASP B 1 139 ? 38.056 11.975 126.223 1.00 42.17 ? 139 ASP B OD1 1 
ATOM   3630 O OD2 . ASP B 1 139 ? 38.836 13.023 127.980 1.00 38.10 ? 139 ASP B OD2 1 
ATOM   3631 N N   . ASP B 1 140 ? 39.169 15.564 127.450 1.00 40.02 ? 140 ASP B N   1 
ATOM   3632 C CA  . ASP B 1 140 ? 40.234 16.372 126.878 1.00 39.31 ? 140 ASP B CA  1 
ATOM   3633 C C   . ASP B 1 140 ? 40.057 16.181 125.380 1.00 40.28 ? 140 ASP B C   1 
ATOM   3634 O O   . ASP B 1 140 ? 40.113 15.053 124.886 1.00 39.74 ? 140 ASP B O   1 
ATOM   3635 C CB  . ASP B 1 140 ? 41.602 15.842 127.312 1.00 43.46 ? 140 ASP B CB  1 
ATOM   3636 C CG  . ASP B 1 140 ? 42.746 16.449 126.514 1.00 46.89 ? 140 ASP B CG  1 
ATOM   3637 O OD1 . ASP B 1 140 ? 43.023 17.657 126.677 1.00 48.54 ? 140 ASP B OD1 1 
ATOM   3638 O OD2 . ASP B 1 140 ? 43.367 15.711 125.720 1.00 49.26 ? 140 ASP B OD2 1 
ATOM   3639 N N   . ALA B 1 141 ? 39.836 17.276 124.657 1.00 38.29 ? 141 ALA B N   1 
ATOM   3640 C CA  . ALA B 1 141 ? 39.629 17.197 123.216 1.00 38.32 ? 141 ALA B CA  1 
ATOM   3641 C C   . ALA B 1 141 ? 40.785 16.511 122.503 1.00 37.15 ? 141 ALA B C   1 
ATOM   3642 O O   . ALA B 1 141 ? 40.612 15.933 121.432 1.00 35.82 ? 141 ALA B O   1 
ATOM   3643 C CB  . ALA B 1 141 ? 39.421 18.595 122.639 1.00 40.39 ? 141 ALA B CB  1 
ATOM   3644 N N   . ARG B 1 142 ? 41.968 16.573 123.092 1.00 36.39 ? 142 ARG B N   1 
ATOM   3645 C CA  . ARG B 1 142 ? 43.119 15.954 122.458 1.00 38.53 ? 142 ARG B CA  1 
ATOM   3646 C C   . ARG B 1 142 ? 43.095 14.436 122.620 1.00 38.00 ? 142 ARG B C   1 
ATOM   3647 O O   . ARG B 1 142 ? 43.374 13.701 121.672 1.00 35.55 ? 142 ARG B O   1 
ATOM   3648 C CB  . ARG B 1 142 ? 44.411 16.549 123.018 1.00 39.45 ? 142 ARG B CB  1 
ATOM   3649 C CG  . ARG B 1 142 ? 45.616 16.168 122.206 1.00 39.41 ? 142 ARG B CG  1 
ATOM   3650 C CD  . ARG B 1 142 ? 46.744 17.168 122.341 1.00 37.58 ? 142 ARG B CD  1 
ATOM   3651 N NE  . ARG B 1 142 ? 47.864 16.723 121.525 1.00 38.07 ? 142 ARG B NE  1 
ATOM   3652 C CZ  . ARG B 1 142 ? 49.021 17.360 121.406 1.00 40.16 ? 142 ARG B CZ  1 
ATOM   3653 N NH1 . ARG B 1 142 ? 49.238 18.503 122.053 1.00 31.44 ? 142 ARG B NH1 1 
ATOM   3654 N NH2 . ARG B 1 142 ? 49.966 16.835 120.637 1.00 40.21 ? 142 ARG B NH2 1 
ATOM   3655 N N   . ALA B 1 143 ? 42.747 13.969 123.814 1.00 40.83 ? 143 ALA B N   1 
ATOM   3656 C CA  . ALA B 1 143 ? 42.662 12.535 124.062 1.00 42.30 ? 143 ALA B CA  1 
ATOM   3657 C C   . ALA B 1 143 ? 41.509 11.983 123.233 1.00 43.13 ? 143 ALA B C   1 
ATOM   3658 O O   . ALA B 1 143 ? 41.589 10.880 122.687 1.00 43.72 ? 143 ALA B O   1 
ATOM   3659 C CB  . ALA B 1 143 ? 42.418 12.265 125.537 1.00 43.61 ? 143 ALA B CB  1 
ATOM   3660 N N   . TYR B 1 144 ? 40.438 12.761 123.127 1.00 41.94 ? 144 TYR B N   1 
ATOM   3661 C CA  . TYR B 1 144 ? 39.284 12.326 122.359 1.00 41.99 ? 144 TYR B CA  1 
ATOM   3662 C C   . TYR B 1 144 ? 39.595 12.157 120.868 1.00 42.53 ? 144 TYR B C   1 
ATOM   3663 O O   . TYR B 1 144 ? 39.214 11.153 120.267 1.00 43.56 ? 144 TYR B O   1 
ATOM   3664 C CB  . TYR B 1 144 ? 38.119 13.299 122.562 1.00 41.84 ? 144 TYR B CB  1 
ATOM   3665 C CG  . TYR B 1 144 ? 36.956 13.051 121.631 1.00 44.41 ? 144 TYR B CG  1 
ATOM   3666 C CD1 . TYR B 1 144 ? 36.904 13.655 120.377 1.00 44.17 ? 144 TYR B CD1 1 
ATOM   3667 C CD2 . TYR B 1 144 ? 35.923 12.185 121.987 1.00 44.57 ? 144 TYR B CD2 1 
ATOM   3668 C CE1 . TYR B 1 144 ? 35.857 13.406 119.498 1.00 46.24 ? 144 TYR B CE1 1 
ATOM   3669 C CE2 . TYR B 1 144 ? 34.866 11.925 121.108 1.00 46.89 ? 144 TYR B CE2 1 
ATOM   3670 C CZ  . TYR B 1 144 ? 34.843 12.541 119.867 1.00 44.55 ? 144 TYR B CZ  1 
ATOM   3671 O OH  . TYR B 1 144 ? 33.817 12.298 118.987 1.00 48.42 ? 144 TYR B OH  1 
ATOM   3672 N N   . LEU B 1 145 ? 40.296 13.116 120.272 1.00 41.56 ? 145 LEU B N   1 
ATOM   3673 C CA  . LEU B 1 145 ? 40.630 13.033 118.846 1.00 43.31 ? 145 LEU B CA  1 
ATOM   3674 C C   . LEU B 1 145 ? 41.643 11.937 118.490 1.00 46.38 ? 145 LEU B C   1 
ATOM   3675 O O   . LEU B 1 145 ? 41.585 11.355 117.403 1.00 43.99 ? 145 LEU B O   1 
ATOM   3676 C CB  . LEU B 1 145 ? 41.158 14.380 118.344 1.00 38.12 ? 145 LEU B CB  1 
ATOM   3677 C CG  . LEU B 1 145 ? 40.125 15.503 118.226 1.00 37.97 ? 145 LEU B CG  1 
ATOM   3678 C CD1 . LEU B 1 145 ? 40.823 16.805 117.854 1.00 34.20 ? 145 LEU B CD1 1 
ATOM   3679 C CD2 . LEU B 1 145 ? 39.073 15.126 117.186 1.00 35.55 ? 145 LEU B CD2 1 
ATOM   3680 N N   . GLU B 1 146 ? 42.579 11.667 119.394 1.00 49.66 ? 146 GLU B N   1 
ATOM   3681 C CA  . GLU B 1 146 ? 43.579 10.640 119.137 1.00 53.83 ? 146 GLU B CA  1 
ATOM   3682 C C   . GLU B 1 146 ? 42.928 9.275  119.282 1.00 56.05 ? 146 GLU B C   1 
ATOM   3683 O O   . GLU B 1 146 ? 43.325 8.313  118.626 1.00 55.23 ? 146 GLU B O   1 
ATOM   3684 C CB  . GLU B 1 146 ? 44.741 10.772 120.119 1.00 55.40 ? 146 GLU B CB  1 
ATOM   3685 C CG  . GLU B 1 146 ? 45.488 12.085 119.991 1.00 60.23 ? 146 GLU B CG  1 
ATOM   3686 C CD  . GLU B 1 146 ? 46.675 12.181 120.925 1.00 64.78 ? 146 GLU B CD  1 
ATOM   3687 O OE1 . GLU B 1 146 ? 47.337 13.245 120.943 1.00 66.88 ? 146 GLU B OE1 1 
ATOM   3688 O OE2 . GLU B 1 146 ? 46.949 11.193 121.639 1.00 68.47 ? 146 GLU B OE2 1 
ATOM   3689 N N   . ARG B 1 147 ? 41.911 9.217  120.137 1.00 57.70 ? 147 ARG B N   1 
ATOM   3690 C CA  . ARG B 1 147 ? 41.172 7.993  120.414 1.00 59.70 ? 147 ARG B CA  1 
ATOM   3691 C C   . ARG B 1 147 ? 40.005 7.796  119.445 1.00 59.64 ? 147 ARG B C   1 
ATOM   3692 O O   . ARG B 1 147 ? 39.170 6.915  119.642 1.00 59.83 ? 147 ARG B O   1 
ATOM   3693 C CB  . ARG B 1 147 ? 40.669 8.033  121.865 1.00 63.07 ? 147 ARG B CB  1 
ATOM   3694 C CG  . ARG B 1 147 ? 39.900 6.807  122.339 1.00 66.91 ? 147 ARG B CG  1 
ATOM   3695 C CD  . ARG B 1 147 ? 38.423 7.126  122.542 1.00 69.16 ? 147 ARG B CD  1 
ATOM   3696 N NE  . ARG B 1 147 ? 38.224 8.227  123.484 1.00 70.12 ? 147 ARG B NE  1 
ATOM   3697 C CZ  . ARG B 1 147 ? 37.035 8.727  123.810 1.00 70.21 ? 147 ARG B CZ  1 
ATOM   3698 N NH1 . ARG B 1 147 ? 35.930 8.227  123.272 1.00 69.03 ? 147 ARG B NH1 1 
ATOM   3699 N NH2 . ARG B 1 147 ? 36.951 9.733  124.671 1.00 71.89 ? 147 ARG B NH2 1 
ATOM   3700 N N   . THR B 1 148 ? 39.947 8.617  118.399 1.00 59.61 ? 148 THR B N   1 
ATOM   3701 C CA  . THR B 1 148 ? 38.878 8.504  117.408 1.00 59.01 ? 148 THR B CA  1 
ATOM   3702 C C   . THR B 1 148 ? 39.361 8.790  115.992 1.00 57.61 ? 148 THR B C   1 
ATOM   3703 O O   . THR B 1 148 ? 40.398 9.422  115.789 1.00 56.90 ? 148 THR B O   1 
ATOM   3704 C CB  . THR B 1 148 ? 37.701 9.458  117.718 1.00 60.87 ? 148 THR B CB  1 
ATOM   3705 O OG1 . THR B 1 148 ? 36.688 9.306  116.715 1.00 62.52 ? 148 THR B OG1 1 
ATOM   3706 C CG2 . THR B 1 148 ? 38.163 10.900 117.722 1.00 60.46 ? 148 THR B CG2 1 
ATOM   3707 N N   . GLU B 1 149 ? 38.596 8.321  115.013 1.00 57.39 ? 149 GLU B N   1 
ATOM   3708 C CA  . GLU B 1 149 ? 38.946 8.519  113.615 1.00 57.78 ? 149 GLU B CA  1 
ATOM   3709 C C   . GLU B 1 149 ? 37.788 9.102  112.808 1.00 55.87 ? 149 GLU B C   1 
ATOM   3710 O O   . GLU B 1 149 ? 37.722 8.936  111.590 1.00 56.81 ? 149 GLU B O   1 
ATOM   3711 C CB  . GLU B 1 149 ? 39.413 7.194  113.005 1.00 61.68 ? 149 GLU B CB  1 
ATOM   3712 C CG  . GLU B 1 149 ? 38.435 6.037  113.185 1.00 67.45 ? 149 GLU B CG  1 
ATOM   3713 C CD  . GLU B 1 149 ? 39.079 4.675  112.947 1.00 70.25 ? 149 GLU B CD  1 
ATOM   3714 O OE1 . GLU B 1 149 ? 39.602 4.436  111.835 1.00 71.47 ? 149 GLU B OE1 1 
ATOM   3715 O OE2 . GLU B 1 149 ? 39.061 3.842  113.881 1.00 71.48 ? 149 GLU B OE2 1 
ATOM   3716 N N   . GLU B 1 150 ? 36.874 9.783  113.492 1.00 52.75 ? 150 GLU B N   1 
ATOM   3717 C CA  . GLU B 1 150 ? 35.737 10.409 112.822 1.00 50.78 ? 150 GLU B CA  1 
ATOM   3718 C C   . GLU B 1 150 ? 36.268 11.660 112.118 1.00 47.01 ? 150 GLU B C   1 
ATOM   3719 O O   . GLU B 1 150 ? 37.250 12.254 112.561 1.00 44.69 ? 150 GLU B O   1 
ATOM   3720 C CB  . GLU B 1 150 ? 34.668 10.804 113.844 1.00 54.40 ? 150 GLU B CB  1 
ATOM   3721 C CG  . GLU B 1 150 ? 33.326 11.168 113.225 1.00 60.40 ? 150 GLU B CG  1 
ATOM   3722 C CD  . GLU B 1 150 ? 32.365 11.809 114.218 1.00 63.83 ? 150 GLU B CD  1 
ATOM   3723 O OE1 . GLU B 1 150 ? 32.209 11.276 115.339 1.00 63.48 ? 150 GLU B OE1 1 
ATOM   3724 O OE2 . GLU B 1 150 ? 31.756 12.846 113.870 1.00 67.22 ? 150 GLU B OE2 1 
ATOM   3725 N N   . ARG B 1 151 ? 35.621 12.059 111.029 1.00 44.60 ? 151 ARG B N   1 
ATOM   3726 C CA  . ARG B 1 151 ? 36.050 13.234 110.272 1.00 43.56 ? 151 ARG B CA  1 
ATOM   3727 C C   . ARG B 1 151 ? 35.007 14.358 110.278 1.00 39.90 ? 151 ARG B C   1 
ATOM   3728 O O   . ARG B 1 151 ? 33.804 14.110 110.378 1.00 36.59 ? 151 ARG B O   1 
ATOM   3729 C CB  . ARG B 1 151 ? 36.366 12.825 108.829 1.00 45.76 ? 151 ARG B CB  1 
ATOM   3730 C CG  . ARG B 1 151 ? 37.526 11.846 108.700 1.00 50.50 ? 151 ARG B CG  1 
ATOM   3731 C CD  . ARG B 1 151 ? 38.861 12.544 108.879 1.00 53.88 ? 151 ARG B CD  1 
ATOM   3732 N NE  . ARG B 1 151 ? 39.986 11.611 108.892 1.00 61.33 ? 151 ARG B NE  1 
ATOM   3733 C CZ  . ARG B 1 151 ? 40.276 10.794 109.904 1.00 64.13 ? 151 ARG B CZ  1 
ATOM   3734 N NH1 . ARG B 1 151 ? 39.525 10.789 110.998 1.00 65.09 ? 151 ARG B NH1 1 
ATOM   3735 N NH2 . ARG B 1 151 ? 41.322 9.981  109.825 1.00 65.37 ? 151 ARG B NH2 1 
ATOM   3736 N N   . TYR B 1 152 ? 35.469 15.601 110.163 1.00 37.18 ? 152 TYR B N   1 
ATOM   3737 C CA  . TYR B 1 152 ? 34.546 16.728 110.167 1.00 33.77 ? 152 TYR B CA  1 
ATOM   3738 C C   . TYR B 1 152 ? 34.760 17.665 109.001 1.00 29.93 ? 152 TYR B C   1 
ATOM   3739 O O   . TYR B 1 152 ? 35.847 17.718 108.428 1.00 32.69 ? 152 TYR B O   1 
ATOM   3740 C CB  . TYR B 1 152 ? 34.683 17.510 111.474 1.00 33.78 ? 152 TYR B CB  1 
ATOM   3741 C CG  . TYR B 1 152 ? 34.711 16.619 112.678 1.00 35.48 ? 152 TYR B CG  1 
ATOM   3742 C CD1 . TYR B 1 152 ? 35.921 16.169 113.205 1.00 37.58 ? 152 TYR B CD1 1 
ATOM   3743 C CD2 . TYR B 1 152 ? 33.530 16.197 113.281 1.00 34.32 ? 152 TYR B CD2 1 
ATOM   3744 C CE1 . TYR B 1 152 ? 35.956 15.320 114.304 1.00 38.46 ? 152 TYR B CE1 1 
ATOM   3745 C CE2 . TYR B 1 152 ? 33.551 15.348 114.380 1.00 38.39 ? 152 TYR B CE2 1 
ATOM   3746 C CZ  . TYR B 1 152 ? 34.766 14.914 114.887 1.00 39.73 ? 152 TYR B CZ  1 
ATOM   3747 O OH  . TYR B 1 152 ? 34.792 14.081 115.982 1.00 46.31 ? 152 TYR B OH  1 
ATOM   3748 N N   . ASP B 1 153 ? 33.707 18.395 108.648 1.00 26.36 ? 153 ASP B N   1 
ATOM   3749 C CA  . ASP B 1 153 ? 33.764 19.372 107.568 1.00 27.09 ? 153 ASP B CA  1 
ATOM   3750 C C   . ASP B 1 153 ? 34.217 20.721 108.142 1.00 27.56 ? 153 ASP B C   1 
ATOM   3751 O O   . ASP B 1 153 ? 34.921 21.489 107.488 1.00 27.27 ? 153 ASP B O   1 
ATOM   3752 C CB  . ASP B 1 153 ? 32.381 19.540 106.938 1.00 27.45 ? 153 ASP B CB  1 
ATOM   3753 C CG  . ASP B 1 153 ? 31.893 18.269 106.270 1.00 31.65 ? 153 ASP B CG  1 
ATOM   3754 O OD1 . ASP B 1 153 ? 30.778 17.813 106.592 1.00 27.08 ? 153 ASP B OD1 1 
ATOM   3755 O OD2 . ASP B 1 153 ? 32.647 17.733 105.432 1.00 29.36 ? 153 ASP B OD2 1 
ATOM   3756 N N   . VAL B 1 154 ? 33.789 20.992 109.370 1.00 27.35 ? 154 VAL B N   1 
ATOM   3757 C CA  . VAL B 1 154 ? 34.113 22.234 110.063 1.00 25.53 ? 154 VAL B CA  1 
ATOM   3758 C C   . VAL B 1 154 ? 34.453 21.947 111.521 1.00 24.71 ? 154 VAL B C   1 
ATOM   3759 O O   . VAL B 1 154 ? 33.806 21.136 112.167 1.00 24.11 ? 154 VAL B O   1 
ATOM   3760 C CB  . VAL B 1 154 ? 32.905 23.219 110.041 1.00 25.05 ? 154 VAL B CB  1 
ATOM   3761 C CG1 . VAL B 1 154 ? 33.167 24.420 110.988 1.00 22.56 ? 154 VAL B CG1 1 
ATOM   3762 C CG2 . VAL B 1 154 ? 32.649 23.701 108.609 1.00 25.59 ? 154 VAL B CG2 1 
ATOM   3763 N N   . VAL B 1 155 ? 35.479 22.615 112.030 1.00 24.56 ? 155 VAL B N   1 
ATOM   3764 C CA  . VAL B 1 155 ? 35.868 22.456 113.425 1.00 21.01 ? 155 VAL B CA  1 
ATOM   3765 C C   . VAL B 1 155 ? 35.914 23.860 114.013 1.00 22.86 ? 155 VAL B C   1 
ATOM   3766 O O   . VAL B 1 155 ? 36.567 24.735 113.453 1.00 25.06 ? 155 VAL B O   1 
ATOM   3767 C CB  . VAL B 1 155 ? 37.268 21.830 113.571 1.00 18.98 ? 155 VAL B CB  1 
ATOM   3768 C CG1 . VAL B 1 155 ? 37.750 21.986 115.008 1.00 20.67 ? 155 VAL B CG1 1 
ATOM   3769 C CG2 . VAL B 1 155 ? 37.241 20.322 113.176 1.00 17.97 ? 155 VAL B CG2 1 
ATOM   3770 N N   . ILE B 1 156 ? 35.224 24.072 115.130 1.00 23.52 ? 156 ILE B N   1 
ATOM   3771 C CA  . ILE B 1 156 ? 35.236 25.375 115.785 1.00 22.82 ? 156 ILE B CA  1 
ATOM   3772 C C   . ILE B 1 156 ? 35.960 25.243 117.131 1.00 22.13 ? 156 ILE B C   1 
ATOM   3773 O O   . ILE B 1 156 ? 35.631 24.379 117.934 1.00 18.82 ? 156 ILE B O   1 
ATOM   3774 C CB  . ILE B 1 156 ? 33.810 25.909 116.076 1.00 23.45 ? 156 ILE B CB  1 
ATOM   3775 C CG1 . ILE B 1 156 ? 32.971 25.963 114.792 1.00 19.78 ? 156 ILE B CG1 1 
ATOM   3776 C CG2 . ILE B 1 156 ? 33.923 27.318 116.726 1.00 21.34 ? 156 ILE B CG2 1 
ATOM   3777 C CD1 . ILE B 1 156 ? 33.465 26.953 113.755 1.00 23.83 ? 156 ILE B CD1 1 
ATOM   3778 N N   . ILE B 1 157 ? 36.952 26.092 117.376 1.00 21.73 ? 157 ILE B N   1 
ATOM   3779 C CA  . ILE B 1 157 ? 37.671 26.037 118.643 1.00 21.32 ? 157 ILE B CA  1 
ATOM   3780 C C   . ILE B 1 157 ? 37.271 27.278 119.435 1.00 23.85 ? 157 ILE B C   1 
ATOM   3781 O O   . ILE B 1 157 ? 37.532 28.401 119.016 1.00 24.01 ? 157 ILE B O   1 
ATOM   3782 C CB  . ILE B 1 157 ? 39.191 25.981 118.406 1.00 24.38 ? 157 ILE B CB  1 
ATOM   3783 C CG1 . ILE B 1 157 ? 39.526 24.727 117.578 1.00 25.81 ? 157 ILE B CG1 1 
ATOM   3784 C CG2 . ILE B 1 157 ? 39.937 25.911 119.735 1.00 22.61 ? 157 ILE B CG2 1 
ATOM   3785 C CD1 . ILE B 1 157 ? 41.005 24.601 117.256 1.00 29.25 ? 157 ILE B CD1 1 
ATOM   3786 N N   . ASP B 1 158 ? 36.619 27.051 120.571 1.00 24.25 ? 158 ASP B N   1 
ATOM   3787 C CA  . ASP B 1 158 ? 36.114 28.117 121.419 1.00 22.72 ? 158 ASP B CA  1 
ATOM   3788 C C   . ASP B 1 158 ? 36.631 27.939 122.839 1.00 23.59 ? 158 ASP B C   1 
ATOM   3789 O O   . ASP B 1 158 ? 35.887 27.514 123.717 1.00 23.90 ? 158 ASP B O   1 
ATOM   3790 C CB  . ASP B 1 158 ? 34.580 28.061 121.421 1.00 21.91 ? 158 ASP B CB  1 
ATOM   3791 C CG  . ASP B 1 158 ? 33.947 29.241 122.143 1.00 23.36 ? 158 ASP B CG  1 
ATOM   3792 O OD1 . ASP B 1 158 ? 32.732 29.173 122.418 1.00 20.44 ? 158 ASP B OD1 1 
ATOM   3793 O OD2 . ASP B 1 158 ? 34.652 30.241 122.415 1.00 18.85 ? 158 ASP B OD2 1 
ATOM   3794 N N   . LEU B 1 159 ? 37.896 28.284 123.054 1.00 22.65 ? 159 LEU B N   1 
ATOM   3795 C CA  . LEU B 1 159 ? 38.551 28.140 124.358 1.00 27.07 ? 159 LEU B CA  1 
ATOM   3796 C C   . LEU B 1 159 ? 39.110 29.461 124.893 1.00 29.16 ? 159 LEU B C   1 
ATOM   3797 O O   . LEU B 1 159 ? 39.354 30.401 124.136 1.00 30.99 ? 159 LEU B O   1 
ATOM   3798 C CB  . LEU B 1 159 ? 39.716 27.151 124.235 1.00 25.30 ? 159 LEU B CB  1 
ATOM   3799 C CG  . LEU B 1 159 ? 39.422 25.728 123.739 1.00 26.45 ? 159 LEU B CG  1 
ATOM   3800 C CD1 . LEU B 1 159 ? 40.729 25.037 123.355 1.00 25.80 ? 159 LEU B CD1 1 
ATOM   3801 C CD2 . LEU B 1 159 ? 38.700 24.947 124.825 1.00 24.85 ? 159 LEU B CD2 1 
ATOM   3802 N N   . THR B 1 160 ? 39.346 29.530 126.197 1.00 32.64 ? 160 THR B N   1 
ATOM   3803 C CA  . THR B 1 160 ? 39.919 30.748 126.753 1.00 35.78 ? 160 THR B CA  1 
ATOM   3804 C C   . THR B 1 160 ? 41.432 30.663 126.532 1.00 36.00 ? 160 THR B C   1 
ATOM   3805 O O   . THR B 1 160 ? 41.942 29.603 126.181 1.00 33.02 ? 160 THR B O   1 
ATOM   3806 C CB  . THR B 1 160 ? 39.633 30.867 128.258 1.00 39.67 ? 160 THR B CB  1 
ATOM   3807 O OG1 . THR B 1 160 ? 40.110 32.134 128.731 1.00 45.84 ? 160 THR B OG1 1 
ATOM   3808 C CG2 . THR B 1 160 ? 40.328 29.748 129.023 1.00 33.89 ? 160 THR B CG2 1 
ATOM   3809 N N   . ASP B 1 161 ? 42.148 31.769 126.715 1.00 37.74 ? 161 ASP B N   1 
ATOM   3810 C CA  . ASP B 1 161 ? 43.603 31.755 126.541 1.00 42.08 ? 161 ASP B CA  1 
ATOM   3811 C C   . ASP B 1 161 ? 44.244 30.845 127.592 1.00 40.10 ? 161 ASP B C   1 
ATOM   3812 O O   . ASP B 1 161 ? 43.731 30.715 128.707 1.00 41.77 ? 161 ASP B O   1 
ATOM   3813 C CB  . ASP B 1 161 ? 44.188 33.163 126.684 1.00 44.89 ? 161 ASP B CB  1 
ATOM   3814 C CG  . ASP B 1 161 ? 43.975 34.015 125.448 1.00 53.84 ? 161 ASP B CG  1 
ATOM   3815 O OD1 . ASP B 1 161 ? 44.490 35.158 125.416 1.00 57.67 ? 161 ASP B OD1 1 
ATOM   3816 O OD2 . ASP B 1 161 ? 43.298 33.547 124.506 1.00 57.00 ? 161 ASP B OD2 1 
ATOM   3817 N N   . PRO B 1 162 ? 45.367 30.187 127.246 1.00 36.41 ? 162 PRO B N   1 
ATOM   3818 C CA  . PRO B 1 162 ? 46.006 29.312 128.230 1.00 34.26 ? 162 PRO B CA  1 
ATOM   3819 C C   . PRO B 1 162 ? 46.888 30.142 129.164 1.00 33.75 ? 162 PRO B C   1 
ATOM   3820 O O   . PRO B 1 162 ? 48.073 30.351 128.898 1.00 33.68 ? 162 PRO B O   1 
ATOM   3821 C CB  . PRO B 1 162 ? 46.808 28.350 127.360 1.00 33.01 ? 162 PRO B CB  1 
ATOM   3822 C CG  . PRO B 1 162 ? 47.271 29.239 126.242 1.00 31.31 ? 162 PRO B CG  1 
ATOM   3823 C CD  . PRO B 1 162 ? 46.013 30.056 125.925 1.00 35.72 ? 162 PRO B CD  1 
ATOM   3824 N N   . VAL B 1 163 ? 46.296 30.626 130.249 1.00 33.60 ? 163 VAL B N   1 
ATOM   3825 C CA  . VAL B 1 163 ? 47.022 31.442 131.214 1.00 33.52 ? 163 VAL B CA  1 
ATOM   3826 C C   . VAL B 1 163 ? 47.721 30.582 132.249 1.00 35.05 ? 163 VAL B C   1 
ATOM   3827 O O   . VAL B 1 163 ? 47.115 29.685 132.835 1.00 33.70 ? 163 VAL B O   1 
ATOM   3828 C CB  . VAL B 1 163 ? 46.076 32.402 131.959 1.00 36.12 ? 163 VAL B CB  1 
ATOM   3829 C CG1 . VAL B 1 163 ? 46.833 33.114 133.080 1.00 36.57 ? 163 VAL B CG1 1 
ATOM   3830 C CG2 . VAL B 1 163 ? 45.497 33.417 130.980 1.00 35.50 ? 163 VAL B CG2 1 
ATOM   3831 N N   . GLY B 1 164 ? 49.004 30.851 132.467 1.00 37.23 ? 164 GLY B N   1 
ATOM   3832 C CA  . GLY B 1 164 ? 49.746 30.091 133.460 1.00 40.05 ? 164 GLY B CA  1 
ATOM   3833 C C   . GLY B 1 164 ? 50.532 28.923 132.909 1.00 40.91 ? 164 GLY B C   1 
ATOM   3834 O O   . GLY B 1 164 ? 50.039 28.145 132.095 1.00 40.64 ? 164 GLY B O   1 
ATOM   3835 N N   . GLU B 1 165 ? 51.766 28.796 133.373 1.00 42.09 ? 165 GLU B N   1 
ATOM   3836 C CA  . GLU B 1 165 ? 52.648 27.726 132.937 1.00 45.18 ? 165 GLU B CA  1 
ATOM   3837 C C   . GLU B 1 165 ? 52.115 26.335 133.275 1.00 44.75 ? 165 GLU B C   1 
ATOM   3838 O O   . GLU B 1 165 ? 52.239 25.406 132.485 1.00 46.15 ? 165 GLU B O   1 
ATOM   3839 C CB  . GLU B 1 165 ? 54.027 27.929 133.566 1.00 46.67 ? 165 GLU B CB  1 
ATOM   3840 C CG  . GLU B 1 165 ? 55.034 26.846 133.250 1.00 53.33 ? 165 GLU B CG  1 
ATOM   3841 C CD  . GLU B 1 165 ? 56.435 27.235 133.680 1.00 54.61 ? 165 GLU B CD  1 
ATOM   3842 O OE1 . GLU B 1 165 ? 56.601 27.676 134.839 1.00 57.92 ? 165 GLU B OE1 1 
ATOM   3843 O OE2 . GLU B 1 165 ? 57.367 27.097 132.860 1.00 56.73 ? 165 GLU B OE2 1 
ATOM   3844 N N   . ASP B 1 166 ? 51.508 26.195 134.444 1.00 44.57 ? 166 ASP B N   1 
ATOM   3845 C CA  . ASP B 1 166 ? 50.992 24.902 134.869 1.00 48.62 ? 166 ASP B CA  1 
ATOM   3846 C C   . ASP B 1 166 ? 49.633 24.564 134.251 1.00 47.27 ? 166 ASP B C   1 
ATOM   3847 O O   . ASP B 1 166 ? 49.034 23.547 134.590 1.00 49.59 ? 166 ASP B O   1 
ATOM   3848 C CB  . ASP B 1 166 ? 50.885 24.869 136.399 1.00 53.78 ? 166 ASP B CB  1 
ATOM   3849 C CG  . ASP B 1 166 ? 50.700 23.461 136.947 1.00 59.93 ? 166 ASP B CG  1 
ATOM   3850 O OD1 . ASP B 1 166 ? 51.658 22.659 136.863 1.00 64.58 ? 166 ASP B OD1 1 
ATOM   3851 O OD2 . ASP B 1 166 ? 49.600 23.153 137.460 1.00 61.76 ? 166 ASP B OD2 1 
ATOM   3852 N N   . ASN B 1 167 ? 49.150 25.406 133.343 1.00 44.93 ? 167 ASN B N   1 
ATOM   3853 C CA  . ASN B 1 167 ? 47.850 25.176 132.712 1.00 42.87 ? 167 ASN B CA  1 
ATOM   3854 C C   . ASN B 1 167 ? 47.902 24.087 131.642 1.00 43.12 ? 167 ASN B C   1 
ATOM   3855 O O   . ASN B 1 167 ? 48.492 24.278 130.578 1.00 40.31 ? 167 ASN B O   1 
ATOM   3856 C CB  . ASN B 1 167 ? 47.335 26.464 132.075 1.00 42.05 ? 167 ASN B CB  1 
ATOM   3857 C CG  . ASN B 1 167 ? 45.862 26.393 131.728 1.00 41.64 ? 167 ASN B CG  1 
ATOM   3858 O OD1 . ASN B 1 167 ? 45.317 25.314 131.483 1.00 39.72 ? 167 ASN B OD1 1 
ATOM   3859 N ND2 . ASN B 1 167 ? 45.210 27.547 131.698 1.00 41.48 ? 167 ASN B ND2 1 
ATOM   3860 N N   . PRO B 1 168 ? 47.272 22.933 131.906 1.00 42.83 ? 168 PRO B N   1 
ATOM   3861 C CA  . PRO B 1 168 ? 47.266 21.833 130.936 1.00 43.68 ? 168 PRO B CA  1 
ATOM   3862 C C   . PRO B 1 168 ? 46.603 22.174 129.595 1.00 42.47 ? 168 PRO B C   1 
ATOM   3863 O O   . PRO B 1 168 ? 46.787 21.459 128.611 1.00 40.70 ? 168 PRO B O   1 
ATOM   3864 C CB  . PRO B 1 168 ? 46.544 20.709 131.687 1.00 43.90 ? 168 PRO B CB  1 
ATOM   3865 C CG  . PRO B 1 168 ? 45.661 21.446 132.650 1.00 45.39 ? 168 PRO B CG  1 
ATOM   3866 C CD  . PRO B 1 168 ? 46.559 22.553 133.138 1.00 45.73 ? 168 PRO B CD  1 
ATOM   3867 N N   . ALA B 1 169 ? 45.838 23.263 129.553 1.00 40.35 ? 169 ALA B N   1 
ATOM   3868 C CA  . ALA B 1 169 ? 45.179 23.668 128.310 1.00 38.62 ? 169 ALA B CA  1 
ATOM   3869 C C   . ALA B 1 169 ? 46.203 24.165 127.285 1.00 36.39 ? 169 ALA B C   1 
ATOM   3870 O O   . ALA B 1 169 ? 45.878 24.337 126.109 1.00 36.28 ? 169 ALA B O   1 
ATOM   3871 C CB  . ALA B 1 169 ? 44.146 24.752 128.587 1.00 41.73 ? 169 ALA B CB  1 
ATOM   3872 N N   . ARG B 1 170 ? 47.432 24.405 127.737 1.00 33.33 ? 170 ARG B N   1 
ATOM   3873 C CA  . ARG B 1 170 ? 48.511 24.855 126.850 1.00 32.79 ? 170 ARG B CA  1 
ATOM   3874 C C   . ARG B 1 170 ? 48.665 23.862 125.705 1.00 32.29 ? 170 ARG B C   1 
ATOM   3875 O O   . ARG B 1 170 ? 49.066 24.221 124.589 1.00 31.93 ? 170 ARG B O   1 
ATOM   3876 C CB  . ARG B 1 170 ? 49.842 24.908 127.597 1.00 33.81 ? 170 ARG B CB  1 
ATOM   3877 C CG  . ARG B 1 170 ? 49.931 25.920 128.710 1.00 36.64 ? 170 ARG B CG  1 
ATOM   3878 C CD  . ARG B 1 170 ? 51.167 25.635 129.563 1.00 37.96 ? 170 ARG B CD  1 
ATOM   3879 N NE  . ARG B 1 170 ? 52.409 25.811 128.818 1.00 40.43 ? 170 ARG B NE  1 
ATOM   3880 C CZ  . ARG B 1 170 ? 53.605 25.411 129.242 1.00 42.60 ? 170 ARG B CZ  1 
ATOM   3881 N NH1 . ARG B 1 170 ? 54.683 25.622 128.493 1.00 38.79 ? 170 ARG B NH1 1 
ATOM   3882 N NH2 . ARG B 1 170 ? 53.725 24.788 130.409 1.00 42.58 ? 170 ARG B NH2 1 
ATOM   3883 N N   . LEU B 1 171 ? 48.352 22.604 125.992 1.00 29.20 ? 171 LEU B N   1 
ATOM   3884 C CA  . LEU B 1 171 ? 48.467 21.553 125.004 1.00 30.62 ? 171 LEU B CA  1 
ATOM   3885 C C   . LEU B 1 171 ? 47.355 21.608 123.962 1.00 30.65 ? 171 LEU B C   1 
ATOM   3886 O O   . LEU B 1 171 ? 47.351 20.819 123.024 1.00 29.79 ? 171 LEU B O   1 
ATOM   3887 C CB  . LEU B 1 171 ? 48.490 20.183 125.690 1.00 31.39 ? 171 LEU B CB  1 
ATOM   3888 C CG  . LEU B 1 171 ? 49.713 19.963 126.583 1.00 34.79 ? 171 LEU B CG  1 
ATOM   3889 C CD1 . LEU B 1 171 ? 49.686 18.562 127.184 1.00 35.41 ? 171 LEU B CD1 1 
ATOM   3890 C CD2 . LEU B 1 171 ? 50.969 20.166 125.767 1.00 33.40 ? 171 LEU B CD2 1 
ATOM   3891 N N   . LEU B 1 172 ? 46.414 22.536 124.127 1.00 29.82 ? 172 LEU B N   1 
ATOM   3892 C CA  . LEU B 1 172 ? 45.333 22.679 123.152 1.00 27.72 ? 172 LEU B CA  1 
ATOM   3893 C C   . LEU B 1 172 ? 45.629 23.879 122.246 1.00 27.05 ? 172 LEU B C   1 
ATOM   3894 O O   . LEU B 1 172 ? 44.787 24.304 121.455 1.00 28.70 ? 172 LEU B O   1 
ATOM   3895 C CB  . LEU B 1 172 ? 43.976 22.845 123.853 1.00 30.27 ? 172 LEU B CB  1 
ATOM   3896 C CG  . LEU B 1 172 ? 43.432 21.629 124.626 1.00 31.44 ? 172 LEU B CG  1 
ATOM   3897 C CD1 . LEU B 1 172 ? 42.037 21.919 125.192 1.00 32.17 ? 172 LEU B CD1 1 
ATOM   3898 C CD2 . LEU B 1 172 ? 43.369 20.433 123.697 1.00 32.81 ? 172 LEU B CD2 1 
ATOM   3899 N N   . TYR B 1 173 ? 46.836 24.421 122.369 1.00 27.35 ? 173 TYR B N   1 
ATOM   3900 C CA  . TYR B 1 173 ? 47.257 25.553 121.550 1.00 25.77 ? 173 TYR B CA  1 
ATOM   3901 C C   . TYR B 1 173 ? 48.606 25.321 120.884 1.00 26.92 ? 173 TYR B C   1 
ATOM   3902 O O   . TYR B 1 173 ? 49.279 26.279 120.507 1.00 27.04 ? 173 TYR B O   1 
ATOM   3903 C CB  . TYR B 1 173 ? 47.349 26.831 122.383 1.00 27.80 ? 173 TYR B CB  1 
ATOM   3904 C CG  . TYR B 1 173 ? 46.028 27.502 122.649 1.00 30.46 ? 173 TYR B CG  1 
ATOM   3905 C CD1 . TYR B 1 173 ? 45.190 27.063 123.674 1.00 30.94 ? 173 TYR B CD1 1 
ATOM   3906 C CD2 . TYR B 1 173 ? 45.624 28.593 121.885 1.00 28.50 ? 173 TYR B CD2 1 
ATOM   3907 C CE1 . TYR B 1 173 ? 43.982 27.702 123.934 1.00 29.95 ? 173 TYR B CE1 1 
ATOM   3908 C CE2 . TYR B 1 173 ? 44.426 29.238 122.136 1.00 31.56 ? 173 TYR B CE2 1 
ATOM   3909 C CZ  . TYR B 1 173 ? 43.610 28.791 123.159 1.00 29.17 ? 173 TYR B CZ  1 
ATOM   3910 O OH  . TYR B 1 173 ? 42.428 29.445 123.399 1.00 26.00 ? 173 TYR B OH  1 
ATOM   3911 N N   . THR B 1 174 ? 49.006 24.059 120.738 1.00 27.26 ? 174 THR B N   1 
ATOM   3912 C CA  . THR B 1 174 ? 50.289 23.741 120.102 1.00 25.43 ? 174 THR B CA  1 
ATOM   3913 C C   . THR B 1 174 ? 50.078 23.353 118.640 1.00 25.46 ? 174 THR B C   1 
ATOM   3914 O O   . THR B 1 174 ? 48.972 23.020 118.241 1.00 22.71 ? 174 THR B O   1 
ATOM   3915 C CB  . THR B 1 174 ? 50.966 22.548 120.778 1.00 26.37 ? 174 THR B CB  1 
ATOM   3916 O OG1 . THR B 1 174 ? 50.099 21.412 120.679 1.00 26.00 ? 174 THR B OG1 1 
ATOM   3917 C CG2 . THR B 1 174 ? 51.265 22.849 122.255 1.00 26.28 ? 174 THR B CG2 1 
ATOM   3918 N N   . VAL B 1 175 ? 51.144 23.360 117.847 1.00 27.09 ? 175 VAL B N   1 
ATOM   3919 C CA  . VAL B 1 175 ? 51.004 22.987 116.444 1.00 29.29 ? 175 VAL B CA  1 
ATOM   3920 C C   . VAL B 1 175 ? 50.551 21.538 116.265 1.00 28.20 ? 175 VAL B C   1 
ATOM   3921 O O   . VAL B 1 175 ? 49.816 21.236 115.330 1.00 26.63 ? 175 VAL B O   1 
ATOM   3922 C CB  . VAL B 1 175 ? 52.309 23.182 115.667 1.00 31.11 ? 175 VAL B CB  1 
ATOM   3923 C CG1 . VAL B 1 175 ? 52.081 22.899 114.182 1.00 33.56 ? 175 VAL B CG1 1 
ATOM   3924 C CG2 . VAL B 1 175 ? 52.799 24.590 115.848 1.00 36.84 ? 175 VAL B CG2 1 
ATOM   3925 N N   . GLU B 1 176 ? 50.980 20.630 117.140 1.00 29.42 ? 176 GLU B N   1 
ATOM   3926 C CA  . GLU B 1 176 ? 50.527 19.261 116.964 1.00 31.36 ? 176 GLU B CA  1 
ATOM   3927 C C   . GLU B 1 176 ? 49.038 19.135 117.292 1.00 30.51 ? 176 GLU B C   1 
ATOM   3928 O O   . GLU B 1 176 ? 48.364 18.248 116.767 1.00 28.10 ? 176 GLU B O   1 
ATOM   3929 C CB  . GLU B 1 176 ? 51.368 18.254 117.771 1.00 32.95 ? 176 GLU B CB  1 
ATOM   3930 C CG  . GLU B 1 176 ? 52.103 18.814 118.946 1.00 37.22 ? 176 GLU B CG  1 
ATOM   3931 C CD  . GLU B 1 176 ? 53.339 19.617 118.576 1.00 38.08 ? 176 GLU B CD  1 
ATOM   3932 O OE1 . GLU B 1 176 ? 53.468 20.746 119.081 1.00 35.79 ? 176 GLU B OE1 1 
ATOM   3933 O OE2 . GLU B 1 176 ? 54.191 19.124 117.807 1.00 35.25 ? 176 GLU B OE2 1 
ATOM   3934 N N   . PHE B 1 177 ? 48.506 20.021 118.133 1.00 29.30 ? 177 PHE B N   1 
ATOM   3935 C CA  . PHE B 1 177 ? 47.078 19.947 118.404 1.00 30.59 ? 177 PHE B CA  1 
ATOM   3936 C C   . PHE B 1 177 ? 46.337 20.331 117.120 1.00 29.61 ? 177 PHE B C   1 
ATOM   3937 O O   . PHE B 1 177 ? 45.413 19.636 116.691 1.00 31.35 ? 177 PHE B O   1 
ATOM   3938 C CB  . PHE B 1 177 ? 46.640 20.884 119.538 1.00 31.56 ? 177 PHE B CB  1 
ATOM   3939 C CG  . PHE B 1 177 ? 45.137 20.951 119.704 1.00 32.18 ? 177 PHE B CG  1 
ATOM   3940 C CD1 . PHE B 1 177 ? 44.424 22.083 119.317 1.00 33.29 ? 177 PHE B CD1 1 
ATOM   3941 C CD2 . PHE B 1 177 ? 44.431 19.849 120.178 1.00 32.64 ? 177 PHE B CD2 1 
ATOM   3942 C CE1 . PHE B 1 177 ? 43.021 22.117 119.398 1.00 31.88 ? 177 PHE B CE1 1 
ATOM   3943 C CE2 . PHE B 1 177 ? 43.033 19.870 120.264 1.00 35.91 ? 177 PHE B CE2 1 
ATOM   3944 C CZ  . PHE B 1 177 ? 42.327 21.007 119.872 1.00 32.03 ? 177 PHE B CZ  1 
ATOM   3945 N N   . TYR B 1 178 ? 46.751 21.431 116.497 1.00 29.13 ? 178 TYR B N   1 
ATOM   3946 C CA  . TYR B 1 178 ? 46.104 21.867 115.261 1.00 29.11 ? 178 TYR B CA  1 
ATOM   3947 C C   . TYR B 1 178 ? 46.308 20.845 114.131 1.00 29.70 ? 178 TYR B C   1 
ATOM   3948 O O   . TYR B 1 178 ? 45.453 20.699 113.250 1.00 26.00 ? 178 TYR B O   1 
ATOM   3949 C CB  . TYR B 1 178 ? 46.636 23.243 114.835 1.00 27.96 ? 178 TYR B CB  1 
ATOM   3950 C CG  . TYR B 1 178 ? 46.371 24.338 115.857 1.00 30.54 ? 178 TYR B CG  1 
ATOM   3951 C CD1 . TYR B 1 178 ? 47.417 25.131 116.350 1.00 25.88 ? 178 TYR B CD1 1 
ATOM   3952 C CD2 . TYR B 1 178 ? 45.092 24.538 116.379 1.00 25.10 ? 178 TYR B CD2 1 
ATOM   3953 C CE1 . TYR B 1 178 ? 47.197 26.082 117.336 1.00 26.01 ? 178 TYR B CE1 1 
ATOM   3954 C CE2 . TYR B 1 178 ? 44.862 25.498 117.376 1.00 27.39 ? 178 TYR B CE2 1 
ATOM   3955 C CZ  . TYR B 1 178 ? 45.918 26.260 117.850 1.00 26.46 ? 178 TYR B CZ  1 
ATOM   3956 O OH  . TYR B 1 178 ? 45.709 27.179 118.865 1.00 26.91 ? 178 TYR B OH  1 
ATOM   3957 N N   . ARG B 1 179 ? 47.443 20.146 114.147 1.00 29.12 ? 179 ARG B N   1 
ATOM   3958 C CA  . ARG B 1 179 ? 47.708 19.139 113.118 1.00 31.19 ? 179 ARG B CA  1 
ATOM   3959 C C   . ARG B 1 179 ? 46.758 17.972 113.334 1.00 28.89 ? 179 ARG B C   1 
ATOM   3960 O O   . ARG B 1 179 ? 46.247 17.389 112.381 1.00 31.23 ? 179 ARG B O   1 
ATOM   3961 C CB  . ARG B 1 179 ? 49.166 18.670 113.180 1.00 33.14 ? 179 ARG B CB  1 
ATOM   3962 C CG  . ARG B 1 179 ? 50.110 19.586 112.416 1.00 34.35 ? 179 ARG B CG  1 
ATOM   3963 C CD  . ARG B 1 179 ? 51.567 19.303 112.742 1.00 35.71 ? 179 ARG B CD  1 
ATOM   3964 N NE  . ARG B 1 179 ? 52.458 20.226 112.043 1.00 34.53 ? 179 ARG B NE  1 
ATOM   3965 C CZ  . ARG B 1 179 ? 53.742 20.392 112.344 1.00 37.01 ? 179 ARG B CZ  1 
ATOM   3966 N NH1 . ARG B 1 179 ? 54.479 21.255 111.657 1.00 39.32 ? 179 ARG B NH1 1 
ATOM   3967 N NH2 . ARG B 1 179 ? 54.286 19.698 113.336 1.00 37.52 ? 179 ARG B NH2 1 
ATOM   3968 N N   . LEU B 1 180 ? 46.516 17.658 114.602 1.00 29.42 ? 180 LEU B N   1 
ATOM   3969 C CA  . LEU B 1 180 ? 45.601 16.591 114.986 1.00 29.47 ? 180 LEU B CA  1 
ATOM   3970 C C   . LEU B 1 180 ? 44.216 16.965 114.500 1.00 31.39 ? 180 LEU B C   1 
ATOM   3971 O O   . LEU B 1 180 ? 43.485 16.127 113.960 1.00 30.84 ? 180 LEU B O   1 
ATOM   3972 C CB  . LEU B 1 180 ? 45.582 16.436 116.501 1.00 30.49 ? 180 LEU B CB  1 
ATOM   3973 C CG  . LEU B 1 180 ? 44.515 15.517 117.094 1.00 31.33 ? 180 LEU B CG  1 
ATOM   3974 C CD1 . LEU B 1 180 ? 44.718 14.077 116.593 1.00 37.51 ? 180 LEU B CD1 1 
ATOM   3975 C CD2 . LEU B 1 180 ? 44.610 15.579 118.610 1.00 32.84 ? 180 LEU B CD2 1 
ATOM   3976 N N   . VAL B 1 181 ? 43.854 18.230 114.703 1.00 30.42 ? 181 VAL B N   1 
ATOM   3977 C CA  . VAL B 1 181 ? 42.556 18.722 114.251 1.00 29.64 ? 181 VAL B CA  1 
ATOM   3978 C C   . VAL B 1 181 ? 42.485 18.631 112.730 1.00 28.39 ? 181 VAL B C   1 
ATOM   3979 O O   . VAL B 1 181 ? 41.482 18.180 112.173 1.00 29.60 ? 181 VAL B O   1 
ATOM   3980 C CB  . VAL B 1 181 ? 42.313 20.205 114.669 1.00 28.64 ? 181 VAL B CB  1 
ATOM   3981 C CG1 . VAL B 1 181 ? 41.107 20.781 113.917 1.00 28.49 ? 181 VAL B CG1 1 
ATOM   3982 C CG2 . VAL B 1 181 ? 42.075 20.291 116.156 1.00 25.41 ? 181 VAL B CG2 1 
ATOM   3983 N N   . LYS B 1 182 ? 43.548 19.049 112.054 1.00 26.44 ? 182 LYS B N   1 
ATOM   3984 C CA  . LYS B 1 182 ? 43.537 19.007 110.604 1.00 28.56 ? 182 LYS B CA  1 
ATOM   3985 C C   . LYS B 1 182 ? 43.421 17.565 110.100 1.00 32.52 ? 182 LYS B C   1 
ATOM   3986 O O   . LYS B 1 182 ? 42.844 17.315 109.037 1.00 31.17 ? 182 LYS B O   1 
ATOM   3987 C CB  . LYS B 1 182 ? 44.799 19.647 110.029 1.00 30.92 ? 182 LYS B CB  1 
ATOM   3988 C CG  . LYS B 1 182 ? 44.756 19.712 108.517 1.00 33.53 ? 182 LYS B CG  1 
ATOM   3989 C CD  . LYS B 1 182 ? 46.066 19.293 107.877 1.00 37.48 ? 182 LYS B CD  1 
ATOM   3990 C CE  . LYS B 1 182 ? 47.040 20.442 107.827 1.00 39.71 ? 182 LYS B CE  1 
ATOM   3991 N NZ  . LYS B 1 182 ? 48.290 20.097 107.101 1.00 34.65 ? 182 LYS B NZ  1 
ATOM   3992 N N   . ALA B 1 183 ? 43.958 16.626 110.874 1.00 30.49 ? 183 ALA B N   1 
ATOM   3993 C CA  . ALA B 1 183 ? 43.921 15.214 110.509 1.00 34.28 ? 183 ALA B CA  1 
ATOM   3994 C C   . ALA B 1 183 ? 42.504 14.656 110.598 1.00 34.50 ? 183 ALA B C   1 
ATOM   3995 O O   . ALA B 1 183 ? 42.232 13.563 110.113 1.00 31.28 ? 183 ALA B O   1 
ATOM   3996 C CB  . ALA B 1 183 ? 44.861 14.406 111.412 1.00 33.08 ? 183 ALA B CB  1 
ATOM   3997 N N   . HIS B 1 184 ? 41.599 15.402 111.224 1.00 33.59 ? 184 HIS B N   1 
ATOM   3998 C CA  . HIS B 1 184 ? 40.224 14.944 111.338 1.00 33.41 ? 184 HIS B CA  1 
ATOM   3999 C C   . HIS B 1 184 ? 39.276 15.737 110.451 1.00 34.18 ? 184 HIS B C   1 
ATOM   4000 O O   . HIS B 1 184 ? 38.054 15.646 110.595 1.00 34.97 ? 184 HIS B O   1 
ATOM   4001 C CB  . HIS B 1 184 ? 39.748 15.002 112.789 1.00 35.09 ? 184 HIS B CB  1 
ATOM   4002 C CG  . HIS B 1 184 ? 40.306 13.911 113.648 1.00 37.34 ? 184 HIS B CG  1 
ATOM   4003 N ND1 . HIS B 1 184 ? 41.633 13.856 114.017 1.00 38.86 ? 184 HIS B ND1 1 
ATOM   4004 C CD2 . HIS B 1 184 ? 39.718 12.821 114.196 1.00 38.02 ? 184 HIS B CD2 1 
ATOM   4005 C CE1 . HIS B 1 184 ? 41.837 12.779 114.755 1.00 38.08 ? 184 HIS B CE1 1 
ATOM   4006 N NE2 . HIS B 1 184 ? 40.691 12.134 114.879 1.00 35.13 ? 184 HIS B NE2 1 
ATOM   4007 N N   . LEU B 1 185 ? 39.841 16.513 109.534 1.00 32.05 ? 185 LEU B N   1 
ATOM   4008 C CA  . LEU B 1 185 ? 39.032 17.302 108.611 1.00 35.92 ? 185 LEU B CA  1 
ATOM   4009 C C   . LEU B 1 185 ? 38.874 16.587 107.276 1.00 37.87 ? 185 LEU B C   1 
ATOM   4010 O O   . LEU B 1 185 ? 39.829 16.002 106.769 1.00 38.72 ? 185 LEU B O   1 
ATOM   4011 C CB  . LEU B 1 185 ? 39.684 18.659 108.342 1.00 34.72 ? 185 LEU B CB  1 
ATOM   4012 C CG  . LEU B 1 185 ? 39.531 19.750 109.400 1.00 35.29 ? 185 LEU B CG  1 
ATOM   4013 C CD1 . LEU B 1 185 ? 40.379 20.961 108.991 1.00 35.03 ? 185 LEU B CD1 1 
ATOM   4014 C CD2 . LEU B 1 185 ? 38.059 20.137 109.521 1.00 30.13 ? 185 LEU B CD2 1 
ATOM   4015 N N   . ASN B 1 186 ? 37.668 16.633 106.717 1.00 38.63 ? 186 ASN B N   1 
ATOM   4016 C CA  . ASN B 1 186 ? 37.404 16.036 105.416 1.00 37.68 ? 186 ASN B CA  1 
ATOM   4017 C C   . ASN B 1 186 ? 38.188 16.880 104.407 1.00 41.37 ? 186 ASN B C   1 
ATOM   4018 O O   . ASN B 1 186 ? 38.673 17.964 104.747 1.00 40.04 ? 186 ASN B O   1 
ATOM   4019 C CB  . ASN B 1 186 ? 35.903 16.082 105.114 1.00 36.54 ? 186 ASN B CB  1 
ATOM   4020 C CG  . ASN B 1 186 ? 35.146 14.930 105.749 1.00 40.55 ? 186 ASN B CG  1 
ATOM   4021 O OD1 . ASN B 1 186 ? 33.959 15.052 106.094 1.00 36.83 ? 186 ASN B OD1 1 
ATOM   4022 N ND2 . ASN B 1 186 ? 35.824 13.791 105.895 1.00 36.15 ? 186 ASN B ND2 1 
ATOM   4023 N N   . PRO B 1 187 ? 38.319 16.404 103.155 1.00 43.05 ? 187 PRO B N   1 
ATOM   4024 C CA  . PRO B 1 187 ? 39.060 17.133 102.117 1.00 44.05 ? 187 PRO B CA  1 
ATOM   4025 C C   . PRO B 1 187 ? 38.895 18.659 102.020 1.00 44.27 ? 187 PRO B C   1 
ATOM   4026 O O   . PRO B 1 187 ? 39.895 19.385 102.000 1.00 47.76 ? 187 PRO B O   1 
ATOM   4027 C CB  . PRO B 1 187 ? 38.673 16.397 100.823 1.00 45.27 ? 187 PRO B CB  1 
ATOM   4028 C CG  . PRO B 1 187 ? 37.443 15.590 101.199 1.00 45.65 ? 187 PRO B CG  1 
ATOM   4029 C CD  . PRO B 1 187 ? 37.734 15.173 102.602 1.00 43.25 ? 187 PRO B CD  1 
ATOM   4030 N N   . GLY B 1 188 ? 37.662 19.149 101.948 1.00 39.97 ? 188 GLY B N   1 
ATOM   4031 C CA  . GLY B 1 188 ? 37.463 20.590 101.869 1.00 34.08 ? 188 GLY B CA  1 
ATOM   4032 C C   . GLY B 1 188 ? 37.115 21.199 103.223 1.00 31.67 ? 188 GLY B C   1 
ATOM   4033 O O   . GLY B 1 188 ? 36.356 22.159 103.313 1.00 30.73 ? 188 GLY B O   1 
ATOM   4034 N N   . GLY B 1 189 ? 37.690 20.647 104.282 1.00 28.47 ? 189 GLY B N   1 
ATOM   4035 C CA  . GLY B 1 189 ? 37.400 21.134 105.617 1.00 27.78 ? 189 GLY B CA  1 
ATOM   4036 C C   . GLY B 1 189 ? 37.984 22.487 105.968 1.00 27.92 ? 189 GLY B C   1 
ATOM   4037 O O   . GLY B 1 189 ? 38.941 22.955 105.347 1.00 26.97 ? 189 GLY B O   1 
ATOM   4038 N N   . VAL B 1 190 ? 37.409 23.116 106.987 1.00 27.87 ? 190 VAL B N   1 
ATOM   4039 C CA  . VAL B 1 190 ? 37.880 24.421 107.427 1.00 25.30 ? 190 VAL B CA  1 
ATOM   4040 C C   . VAL B 1 190 ? 37.767 24.524 108.939 1.00 25.81 ? 190 VAL B C   1 
ATOM   4041 O O   . VAL B 1 190 ? 36.809 24.035 109.528 1.00 24.74 ? 190 VAL B O   1 
ATOM   4042 C CB  . VAL B 1 190 ? 37.047 25.567 106.782 1.00 28.67 ? 190 VAL B CB  1 
ATOM   4043 C CG1 . VAL B 1 190 ? 35.583 25.395 107.109 1.00 28.45 ? 190 VAL B CG1 1 
ATOM   4044 C CG2 . VAL B 1 190 ? 37.535 26.934 107.286 1.00 25.88 ? 190 VAL B CG2 1 
ATOM   4045 N N   . MET B 1 191 ? 38.755 25.153 109.559 1.00 22.59 ? 191 MET B N   1 
ATOM   4046 C CA  . MET B 1 191 ? 38.732 25.337 110.999 1.00 24.62 ? 191 MET B CA  1 
ATOM   4047 C C   . MET B 1 191 ? 38.532 26.818 111.272 1.00 24.46 ? 191 MET B C   1 
ATOM   4048 O O   . MET B 1 191 ? 39.136 27.662 110.600 1.00 23.49 ? 191 MET B O   1 
ATOM   4049 C CB  . MET B 1 191 ? 40.048 24.872 111.635 1.00 22.62 ? 191 MET B CB  1 
ATOM   4050 C CG  . MET B 1 191 ? 40.118 25.071 113.147 1.00 28.57 ? 191 MET B CG  1 
ATOM   4051 S SD  . MET B 1 191 ? 41.677 24.480 113.859 1.00 37.31 ? 191 MET B SD  1 
ATOM   4052 C CE  . MET B 1 191 ? 42.758 25.956 113.592 1.00 29.30 ? 191 MET B CE  1 
ATOM   4053 N N   . GLY B 1 192 ? 37.658 27.122 112.232 1.00 23.09 ? 192 GLY B N   1 
ATOM   4054 C CA  . GLY B 1 192 ? 37.413 28.503 112.611 1.00 21.54 ? 192 GLY B CA  1 
ATOM   4055 C C   . GLY B 1 192 ? 37.623 28.545 114.118 1.00 24.94 ? 192 GLY B C   1 
ATOM   4056 O O   . GLY B 1 192 ? 37.301 27.563 114.790 1.00 23.93 ? 192 GLY B O   1 
ATOM   4057 N N   . MET B 1 193 ? 38.153 29.647 114.653 1.00 22.25 ? 193 MET B N   1 
ATOM   4058 C CA  . MET B 1 193 ? 38.392 29.740 116.094 1.00 20.03 ? 193 MET B CA  1 
ATOM   4059 C C   . MET B 1 193 ? 38.533 31.166 116.624 1.00 20.34 ? 193 MET B C   1 
ATOM   4060 O O   . MET B 1 193 ? 38.825 32.094 115.870 1.00 19.88 ? 193 MET B O   1 
ATOM   4061 C CB  . MET B 1 193 ? 39.678 28.982 116.458 1.00 17.50 ? 193 MET B CB  1 
ATOM   4062 C CG  . MET B 1 193 ? 40.948 29.685 115.959 1.00 23.91 ? 193 MET B CG  1 
ATOM   4063 S SD  . MET B 1 193 ? 42.509 28.786 116.180 1.00 25.50 ? 193 MET B SD  1 
ATOM   4064 C CE  . MET B 1 193 ? 42.675 28.819 117.948 1.00 22.21 ? 193 MET B CE  1 
ATOM   4065 N N   . GLN B 1 194 ? 38.302 31.330 117.930 1.00 16.78 ? 194 GLN B N   1 
ATOM   4066 C CA  . GLN B 1 194 ? 38.517 32.619 118.579 1.00 20.70 ? 194 GLN B CA  1 
ATOM   4067 C C   . GLN B 1 194 ? 40.018 32.541 118.854 1.00 22.16 ? 194 GLN B C   1 
ATOM   4068 O O   . GLN B 1 194 ? 40.520 31.521 119.343 1.00 23.54 ? 194 GLN B O   1 
ATOM   4069 C CB  . GLN B 1 194 ? 37.719 32.722 119.881 1.00 24.20 ? 194 GLN B CB  1 
ATOM   4070 C CG  . GLN B 1 194 ? 38.056 33.945 120.713 1.00 23.83 ? 194 GLN B CG  1 
ATOM   4071 C CD  . GLN B 1 194 ? 38.823 33.575 121.968 1.00 25.76 ? 194 GLN B CD  1 
ATOM   4072 O OE1 . GLN B 1 194 ? 38.244 33.080 122.944 1.00 28.40 ? 194 GLN B OE1 1 
ATOM   4073 N NE2 . GLN B 1 194 ? 40.128 33.794 121.947 1.00 20.44 ? 194 GLN B NE2 1 
ATOM   4074 N N   . THR B 1 195 ? 40.750 33.595 118.528 1.00 23.51 ? 195 THR B N   1 
ATOM   4075 C CA  . THR B 1 195 ? 42.188 33.539 118.695 1.00 26.49 ? 195 THR B CA  1 
ATOM   4076 C C   . THR B 1 195 ? 42.833 34.584 119.581 1.00 25.31 ? 195 THR B C   1 
ATOM   4077 O O   . THR B 1 195 ? 43.923 35.070 119.274 1.00 26.72 ? 195 THR B O   1 
ATOM   4078 C CB  . THR B 1 195 ? 42.887 33.580 117.333 1.00 30.42 ? 195 THR B CB  1 
ATOM   4079 O OG1 . THR B 1 195 ? 42.641 34.845 116.713 1.00 46.73 ? 195 THR B OG1 1 
ATOM   4080 C CG2 . THR B 1 195 ? 42.345 32.500 116.435 1.00 36.32 ? 195 THR B CG2 1 
ATOM   4081 N N   . GLY B 1 196 ? 42.164 34.927 120.674 1.00 24.72 ? 196 GLY B N   1 
ATOM   4082 C CA  . GLY B 1 196 ? 42.736 35.872 121.610 1.00 25.69 ? 196 GLY B CA  1 
ATOM   4083 C C   . GLY B 1 196 ? 42.483 37.334 121.348 1.00 25.12 ? 196 GLY B C   1 
ATOM   4084 O O   . GLY B 1 196 ? 42.235 37.757 120.218 1.00 22.40 ? 196 GLY B O   1 
ATOM   4085 N N   . MET B 1 197 ? 42.560 38.117 122.413 1.00 25.53 ? 197 MET B N   1 
ATOM   4086 C CA  . MET B 1 197 ? 42.343 39.540 122.293 1.00 24.48 ? 197 MET B CA  1 
ATOM   4087 C C   . MET B 1 197 ? 43.502 40.155 121.519 1.00 23.17 ? 197 MET B C   1 
ATOM   4088 O O   . MET B 1 197 ? 44.617 39.636 121.493 1.00 24.41 ? 197 MET B O   1 
ATOM   4089 C CB  . MET B 1 197 ? 42.246 40.207 123.678 1.00 29.86 ? 197 MET B CB  1 
ATOM   4090 C CG  . MET B 1 197 ? 43.563 40.758 124.192 1.00 34.43 ? 197 MET B CG  1 
ATOM   4091 S SD  . MET B 1 197 ? 43.478 41.772 125.689 1.00 32.60 ? 197 MET B SD  1 
ATOM   4092 C CE  . MET B 1 197 ? 43.190 40.513 126.894 1.00 33.98 ? 197 MET B CE  1 
ATOM   4093 N N   . ILE B 1 198 ? 43.213 41.274 120.891 1.00 20.49 ? 198 ILE B N   1 
ATOM   4094 C CA  . ILE B 1 198 ? 44.203 42.020 120.147 1.00 22.97 ? 198 ILE B CA  1 
ATOM   4095 C C   . ILE B 1 198 ? 44.432 43.310 120.924 1.00 24.79 ? 198 ILE B C   1 
ATOM   4096 O O   . ILE B 1 198 ? 43.504 44.108 121.108 1.00 26.47 ? 198 ILE B O   1 
ATOM   4097 C CB  . ILE B 1 198 ? 43.683 42.371 118.762 1.00 22.48 ? 198 ILE B CB  1 
ATOM   4098 C CG1 . ILE B 1 198 ? 43.461 41.077 117.967 1.00 22.04 ? 198 ILE B CG1 1 
ATOM   4099 C CG2 . ILE B 1 198 ? 44.649 43.337 118.088 1.00 23.51 ? 198 ILE B CG2 1 
ATOM   4100 C CD1 . ILE B 1 198 ? 42.587 41.242 116.732 1.00 24.51 ? 198 ILE B CD1 1 
ATOM   4101 N N   . LEU B 1 199 ? 45.657 43.484 121.399 1.00 24.25 ? 199 LEU B N   1 
ATOM   4102 C CA  . LEU B 1 199 ? 46.065 44.669 122.151 1.00 26.27 ? 199 LEU B CA  1 
ATOM   4103 C C   . LEU B 1 199 ? 47.581 44.665 121.978 1.00 29.19 ? 199 LEU B C   1 
ATOM   4104 O O   . LEU B 1 199 ? 48.347 44.357 122.899 1.00 31.31 ? 199 LEU B O   1 
ATOM   4105 C CB  . LEU B 1 199 ? 45.678 44.533 123.629 1.00 23.83 ? 199 LEU B CB  1 
ATOM   4106 C CG  . LEU B 1 199 ? 45.721 45.831 124.436 1.00 26.08 ? 199 LEU B CG  1 
ATOM   4107 C CD1 . LEU B 1 199 ? 44.811 46.861 123.784 1.00 22.78 ? 199 LEU B CD1 1 
ATOM   4108 C CD2 . LEU B 1 199 ? 45.288 45.573 125.882 1.00 22.51 ? 199 LEU B CD2 1 
ATOM   4109 N N   . LEU B 1 200 ? 47.979 45.006 120.759 1.00 31.28 ? 200 LEU B N   1 
ATOM   4110 C CA  . LEU B 1 200 ? 49.364 45.024 120.306 1.00 31.39 ? 200 LEU B CA  1 
ATOM   4111 C C   . LEU B 1 200 ? 50.397 45.710 121.194 1.00 31.64 ? 200 LEU B C   1 
ATOM   4112 O O   . LEU B 1 200 ? 51.571 45.343 121.176 1.00 30.37 ? 200 LEU B O   1 
ATOM   4113 C CB  . LEU B 1 200 ? 49.408 45.622 118.900 1.00 31.10 ? 200 LEU B CB  1 
ATOM   4114 C CG  . LEU B 1 200 ? 48.534 44.877 117.881 1.00 33.08 ? 200 LEU B CG  1 
ATOM   4115 C CD1 . LEU B 1 200 ? 48.740 45.466 116.491 1.00 31.41 ? 200 LEU B CD1 1 
ATOM   4116 C CD2 . LEU B 1 200 ? 48.895 43.391 117.887 1.00 31.91 ? 200 LEU B CD2 1 
ATOM   4117 N N   . THR B 1 201 ? 49.967 46.708 121.951 1.00 29.53 ? 201 THR B N   1 
ATOM   4118 C CA  . THR B 1 201 ? 50.871 47.429 122.850 1.00 31.93 ? 201 THR B CA  1 
ATOM   4119 C C   . THR B 1 201 ? 51.182 46.628 124.109 1.00 32.67 ? 201 THR B C   1 
ATOM   4120 O O   . THR B 1 201 ? 52.210 46.840 124.755 1.00 38.49 ? 201 THR B O   1 
ATOM   4121 C CB  . THR B 1 201 ? 50.240 48.740 123.316 1.00 31.17 ? 201 THR B CB  1 
ATOM   4122 O OG1 . THR B 1 201 ? 48.948 48.461 123.863 1.00 31.62 ? 201 THR B OG1 1 
ATOM   4123 C CG2 . THR B 1 201 ? 50.094 49.712 122.170 1.00 31.47 ? 201 THR B CG2 1 
ATOM   4124 N N   . HIS B 1 202 ? 50.287 45.712 124.457 1.00 28.32 ? 202 HIS B N   1 
ATOM   4125 C CA  . HIS B 1 202 ? 50.425 44.920 125.673 1.00 31.78 ? 202 HIS B CA  1 
ATOM   4126 C C   . HIS B 1 202 ? 50.997 43.517 125.483 1.00 33.95 ? 202 HIS B C   1 
ATOM   4127 O O   . HIS B 1 202 ? 51.796 43.046 126.298 1.00 34.69 ? 202 HIS B O   1 
ATOM   4128 C CB  . HIS B 1 202 ? 49.058 44.805 126.350 1.00 28.41 ? 202 HIS B CB  1 
ATOM   4129 C CG  . HIS B 1 202 ? 48.559 46.085 126.950 1.00 28.82 ? 202 HIS B CG  1 
ATOM   4130 N ND1 . HIS B 1 202 ? 48.526 47.277 126.256 1.00 27.72 ? 202 HIS B ND1 1 
ATOM   4131 C CD2 . HIS B 1 202 ? 48.042 46.350 128.176 1.00 25.33 ? 202 HIS B CD2 1 
ATOM   4132 C CE1 . HIS B 1 202 ? 48.012 48.220 127.028 1.00 27.78 ? 202 HIS B CE1 1 
ATOM   4133 N NE2 . HIS B 1 202 ? 47.709 47.683 128.197 1.00 25.14 ? 202 HIS B NE2 1 
ATOM   4134 N N   . HIS B 1 203 ? 50.587 42.853 124.406 1.00 35.48 ? 203 HIS B N   1 
ATOM   4135 C CA  . HIS B 1 203 ? 51.028 41.489 124.142 1.00 38.20 ? 203 HIS B CA  1 
ATOM   4136 C C   . HIS B 1 203 ? 50.681 41.073 122.714 1.00 37.68 ? 203 HIS B C   1 
ATOM   4137 O O   . HIS B 1 203 ? 49.972 41.791 122.000 1.00 37.86 ? 203 HIS B O   1 
ATOM   4138 C CB  . HIS B 1 203 ? 50.335 40.551 125.122 1.00 36.94 ? 203 HIS B CB  1 
ATOM   4139 C CG  . HIS B 1 203 ? 48.842 40.578 125.014 1.00 40.52 ? 203 HIS B CG  1 
ATOM   4140 N ND1 . HIS B 1 203 ? 48.159 39.939 124.002 1.00 40.49 ? 203 HIS B ND1 1 
ATOM   4141 C CD2 . HIS B 1 203 ? 47.903 41.197 125.769 1.00 40.76 ? 203 HIS B CD2 1 
ATOM   4142 C CE1 . HIS B 1 203 ? 46.864 40.161 124.137 1.00 40.26 ? 203 HIS B CE1 1 
ATOM   4143 N NE2 . HIS B 1 203 ? 46.682 40.922 125.201 1.00 42.49 ? 203 HIS B NE2 1 
ATOM   4144 N N   . ARG B 1 204 ? 51.169 39.905 122.306 1.00 34.88 ? 204 ARG B N   1 
ATOM   4145 C CA  . ARG B 1 204 ? 50.916 39.422 120.954 1.00 36.60 ? 204 ARG B CA  1 
ATOM   4146 C C   . ARG B 1 204 ? 50.297 38.032 120.948 1.00 32.97 ? 204 ARG B C   1 
ATOM   4147 O O   . ARG B 1 204 ? 50.665 37.174 120.143 1.00 30.22 ? 204 ARG B O   1 
ATOM   4148 C CB  . ARG B 1 204 ? 52.218 39.412 120.140 1.00 39.37 ? 204 ARG B CB  1 
ATOM   4149 C CG  . ARG B 1 204 ? 53.378 40.117 120.808 1.00 46.12 ? 204 ARG B CG  1 
ATOM   4150 C CD  . ARG B 1 204 ? 54.137 39.166 121.735 1.00 50.48 ? 204 ARG B CD  1 
ATOM   4151 N NE  . ARG B 1 204 ? 55.021 38.282 120.979 1.00 54.22 ? 204 ARG B NE  1 
ATOM   4152 C CZ  . ARG B 1 204 ? 55.773 37.327 121.518 1.00 55.23 ? 204 ARG B CZ  1 
ATOM   4153 N NH1 . ARG B 1 204 ? 56.551 36.577 120.740 1.00 51.18 ? 204 ARG B NH1 1 
ATOM   4154 N NH2 . ARG B 1 204 ? 55.741 37.116 122.829 1.00 53.28 ? 204 ARG B NH2 1 
ATOM   4155 N N   . VAL B 1 205 ? 49.345 37.811 121.843 1.00 30.25 ? 205 VAL B N   1 
ATOM   4156 C CA  . VAL B 1 205 ? 48.698 36.512 121.909 1.00 29.08 ? 205 VAL B CA  1 
ATOM   4157 C C   . VAL B 1 205 ? 48.071 36.139 120.572 1.00 24.89 ? 205 VAL B C   1 
ATOM   4158 O O   . VAL B 1 205 ? 48.331 35.065 120.040 1.00 26.98 ? 205 VAL B O   1 
ATOM   4159 C CB  . VAL B 1 205 ? 47.618 36.478 123.004 1.00 30.16 ? 205 VAL B CB  1 
ATOM   4160 C CG1 . VAL B 1 205 ? 46.851 35.175 122.934 1.00 28.92 ? 205 VAL B CG1 1 
ATOM   4161 C CG2 . VAL B 1 205 ? 48.271 36.621 124.373 1.00 32.29 ? 205 VAL B CG2 1 
ATOM   4162 N N   . HIS B 1 206 ? 47.256 37.027 120.018 1.00 22.58 ? 206 HIS B N   1 
ATOM   4163 C CA  . HIS B 1 206 ? 46.616 36.721 118.753 1.00 22.40 ? 206 HIS B CA  1 
ATOM   4164 C C   . HIS B 1 206 ? 47.643 36.389 117.671 1.00 21.14 ? 206 HIS B C   1 
ATOM   4165 O O   . HIS B 1 206 ? 47.500 35.411 116.961 1.00 22.18 ? 206 HIS B O   1 
ATOM   4166 C CB  . HIS B 1 206 ? 45.725 37.879 118.294 1.00 19.98 ? 206 HIS B CB  1 
ATOM   4167 C CG  . HIS B 1 206 ? 45.126 37.659 116.942 1.00 21.92 ? 206 HIS B CG  1 
ATOM   4168 N ND1 . HIS B 1 206 ? 44.318 36.580 116.657 1.00 20.62 ? 206 HIS B ND1 1 
ATOM   4169 C CD2 . HIS B 1 206 ? 45.251 38.354 115.787 1.00 21.22 ? 206 HIS B CD2 1 
ATOM   4170 C CE1 . HIS B 1 206 ? 43.971 36.621 115.382 1.00 22.14 ? 206 HIS B CE1 1 
ATOM   4171 N NE2 . HIS B 1 206 ? 44.526 37.687 114.833 1.00 21.44 ? 206 HIS B NE2 1 
ATOM   4172 N N   . PRO B 1 207 ? 48.692 37.215 117.525 1.00 25.31 ? 207 PRO B N   1 
ATOM   4173 C CA  . PRO B 1 207 ? 49.630 36.827 116.472 1.00 25.74 ? 207 PRO B CA  1 
ATOM   4174 C C   . PRO B 1 207 ? 50.368 35.519 116.741 1.00 23.58 ? 207 PRO B C   1 
ATOM   4175 O O   . PRO B 1 207 ? 50.783 34.850 115.810 1.00 26.22 ? 207 PRO B O   1 
ATOM   4176 C CB  . PRO B 1 207 ? 50.566 38.042 116.339 1.00 26.39 ? 207 PRO B CB  1 
ATOM   4177 C CG  . PRO B 1 207 ? 50.253 38.919 117.503 1.00 29.60 ? 207 PRO B CG  1 
ATOM   4178 C CD  . PRO B 1 207 ? 48.836 38.634 117.880 1.00 21.85 ? 207 PRO B CD  1 
ATOM   4179 N N   . VAL B 1 208 ? 50.509 35.140 118.006 1.00 25.58 ? 208 VAL B N   1 
ATOM   4180 C CA  . VAL B 1 208 ? 51.195 33.896 118.324 1.00 23.07 ? 208 VAL B CA  1 
ATOM   4181 C C   . VAL B 1 208 ? 50.298 32.715 117.981 1.00 25.37 ? 208 VAL B C   1 
ATOM   4182 O O   . VAL B 1 208 ? 50.777 31.687 117.486 1.00 21.43 ? 208 VAL B O   1 
ATOM   4183 C CB  . VAL B 1 208 ? 51.622 33.851 119.812 1.00 21.86 ? 208 VAL B CB  1 
ATOM   4184 C CG1 . VAL B 1 208 ? 52.063 32.444 120.200 1.00 24.59 ? 208 VAL B CG1 1 
ATOM   4185 C CG2 . VAL B 1 208 ? 52.776 34.826 120.029 1.00 25.73 ? 208 VAL B CG2 1 
ATOM   4186 N N   . VAL B 1 209 ? 48.996 32.861 118.224 1.00 21.22 ? 209 VAL B N   1 
ATOM   4187 C CA  . VAL B 1 209 ? 48.061 31.797 117.891 1.00 23.11 ? 209 VAL B CA  1 
ATOM   4188 C C   . VAL B 1 209 ? 47.999 31.657 116.358 1.00 26.22 ? 209 VAL B C   1 
ATOM   4189 O O   . VAL B 1 209 ? 48.012 30.552 115.816 1.00 21.97 ? 209 VAL B O   1 
ATOM   4190 C CB  . VAL B 1 209 ? 46.641 32.094 118.425 1.00 25.63 ? 209 VAL B CB  1 
ATOM   4191 C CG1 . VAL B 1 209 ? 45.661 31.045 117.900 1.00 25.09 ? 209 VAL B CG1 1 
ATOM   4192 C CG2 . VAL B 1 209 ? 46.650 32.093 119.966 1.00 25.52 ? 209 VAL B CG2 1 
ATOM   4193 N N   . HIS B 1 210 ? 47.922 32.786 115.664 1.00 24.34 ? 210 HIS B N   1 
ATOM   4194 C CA  . HIS B 1 210 ? 47.869 32.777 114.204 1.00 23.98 ? 210 HIS B CA  1 
ATOM   4195 C C   . HIS B 1 210 ? 49.147 32.137 113.609 1.00 23.48 ? 210 HIS B C   1 
ATOM   4196 O O   . HIS B 1 210 ? 49.069 31.317 112.684 1.00 24.41 ? 210 HIS B O   1 
ATOM   4197 C CB  . HIS B 1 210 ? 47.709 34.216 113.720 1.00 20.78 ? 210 HIS B CB  1 
ATOM   4198 C CG  . HIS B 1 210 ? 47.732 34.382 112.233 1.00 25.05 ? 210 HIS B CG  1 
ATOM   4199 N ND1 . HIS B 1 210 ? 46.584 34.488 111.475 1.00 27.91 ? 210 HIS B ND1 1 
ATOM   4200 C CD2 . HIS B 1 210 ? 48.766 34.509 111.369 1.00 27.73 ? 210 HIS B CD2 1 
ATOM   4201 C CE1 . HIS B 1 210 ? 46.910 34.677 110.210 1.00 30.84 ? 210 HIS B CE1 1 
ATOM   4202 N NE2 . HIS B 1 210 ? 48.228 34.692 110.118 1.00 32.04 ? 210 HIS B NE2 1 
ATOM   4203 N N   . ARG B 1 211 ? 50.308 32.524 114.135 1.00 24.47 ? 211 ARG B N   1 
ATOM   4204 C CA  . ARG B 1 211 ? 51.594 31.996 113.655 1.00 25.27 ? 211 ARG B CA  1 
ATOM   4205 C C   . ARG B 1 211 ? 51.690 30.490 113.901 1.00 26.46 ? 211 ARG B C   1 
ATOM   4206 O O   . ARG B 1 211 ? 52.239 29.751 113.087 1.00 27.74 ? 211 ARG B O   1 
ATOM   4207 C CB  . ARG B 1 211 ? 52.769 32.684 114.358 1.00 27.33 ? 211 ARG B CB  1 
ATOM   4208 C CG  . ARG B 1 211 ? 54.155 32.127 113.944 1.00 28.41 ? 211 ARG B CG  1 
ATOM   4209 C CD  . ARG B 1 211 ? 54.489 32.462 112.491 1.00 31.65 ? 211 ARG B CD  1 
ATOM   4210 N NE  . ARG B 1 211 ? 55.706 31.795 112.021 1.00 34.37 ? 211 ARG B NE  1 
ATOM   4211 C CZ  . ARG B 1 211 ? 55.772 30.527 111.615 1.00 36.23 ? 211 ARG B CZ  1 
ATOM   4212 N NH1 . ARG B 1 211 ? 56.932 30.025 111.209 1.00 36.78 ? 211 ARG B NH1 1 
ATOM   4213 N NH2 . ARG B 1 211 ? 54.687 29.755 111.606 1.00 31.81 ? 211 ARG B NH2 1 
ATOM   4214 N N   . THR B 1 212 ? 51.166 30.048 115.035 1.00 23.23 ? 212 THR B N   1 
ATOM   4215 C CA  . THR B 1 212 ? 51.176 28.633 115.373 1.00 25.58 ? 212 THR B CA  1 
ATOM   4216 C C   . THR B 1 212 ? 50.260 27.857 114.419 1.00 26.82 ? 212 THR B C   1 
ATOM   4217 O O   . THR B 1 212 ? 50.626 26.786 113.927 1.00 25.82 ? 212 THR B O   1 
ATOM   4218 C CB  . THR B 1 212 ? 50.719 28.426 116.832 1.00 23.64 ? 212 THR B CB  1 
ATOM   4219 O OG1 . THR B 1 212 ? 51.622 29.116 117.708 1.00 19.90 ? 212 THR B OG1 1 
ATOM   4220 C CG2 . THR B 1 212 ? 50.707 26.937 117.190 1.00 23.30 ? 212 THR B CG2 1 
ATOM   4221 N N   . VAL B 1 213 ? 49.081 28.406 114.137 1.00 23.29 ? 213 VAL B N   1 
ATOM   4222 C CA  . VAL B 1 213 ? 48.139 27.745 113.238 1.00 24.98 ? 213 VAL B CA  1 
ATOM   4223 C C   . VAL B 1 213 ? 48.691 27.692 111.810 1.00 26.39 ? 213 VAL B C   1 
ATOM   4224 O O   . VAL B 1 213 ? 48.453 26.721 111.076 1.00 27.34 ? 213 VAL B O   1 
ATOM   4225 C CB  . VAL B 1 213 ? 46.765 28.462 113.242 1.00 26.38 ? 213 VAL B CB  1 
ATOM   4226 C CG1 . VAL B 1 213 ? 45.818 27.817 112.222 1.00 24.72 ? 213 VAL B CG1 1 
ATOM   4227 C CG2 . VAL B 1 213 ? 46.159 28.390 114.639 1.00 21.17 ? 213 VAL B CG2 1 
ATOM   4228 N N   . ARG B 1 214 ? 49.438 28.722 111.420 1.00 26.19 ? 214 ARG B N   1 
ATOM   4229 C CA  . ARG B 1 214 ? 50.030 28.768 110.076 1.00 30.37 ? 214 ARG B CA  1 
ATOM   4230 C C   . ARG B 1 214 ? 51.036 27.640 109.875 1.00 29.75 ? 214 ARG B C   1 
ATOM   4231 O O   . ARG B 1 214 ? 51.310 27.239 108.748 1.00 27.04 ? 214 ARG B O   1 
ATOM   4232 C CB  . ARG B 1 214 ? 50.758 30.088 109.821 1.00 32.07 ? 214 ARG B CB  1 
ATOM   4233 C CG  . ARG B 1 214 ? 49.860 31.307 109.728 1.00 45.86 ? 214 ARG B CG  1 
ATOM   4234 C CD  . ARG B 1 214 ? 50.447 32.372 108.801 1.00 52.47 ? 214 ARG B CD  1 
ATOM   4235 N NE  . ARG B 1 214 ? 49.823 32.359 107.473 1.00 61.26 ? 214 ARG B NE  1 
ATOM   4236 C CZ  . ARG B 1 214 ? 49.928 31.368 106.584 1.00 63.86 ? 214 ARG B CZ  1 
ATOM   4237 N NH1 . ARG B 1 214 ? 50.643 30.279 106.860 1.00 63.00 ? 214 ARG B NH1 1 
ATOM   4238 N NH2 . ARG B 1 214 ? 49.304 31.465 105.413 1.00 61.76 ? 214 ARG B NH2 1 
ATOM   4239 N N   . GLU B 1 215 ? 51.583 27.141 110.978 1.00 30.98 ? 215 GLU B N   1 
ATOM   4240 C CA  . GLU B 1 215 ? 52.573 26.075 110.935 1.00 33.03 ? 215 GLU B CA  1 
ATOM   4241 C C   . GLU B 1 215 ? 51.902 24.723 110.726 1.00 35.98 ? 215 GLU B C   1 
ATOM   4242 O O   . GLU B 1 215 ? 52.573 23.718 110.492 1.00 40.82 ? 215 GLU B O   1 
ATOM   4243 C CB  . GLU B 1 215 ? 53.371 26.083 112.236 1.00 33.51 ? 215 GLU B CB  1 
ATOM   4244 C CG  . GLU B 1 215 ? 54.702 25.378 112.183 1.00 40.69 ? 215 GLU B CG  1 
ATOM   4245 C CD  . GLU B 1 215 ? 55.652 25.968 111.148 1.00 42.08 ? 215 GLU B CD  1 
ATOM   4246 O OE1 . GLU B 1 215 ? 55.570 27.181 110.866 1.00 42.19 ? 215 GLU B OE1 1 
ATOM   4247 O OE2 . GLU B 1 215 ? 56.498 25.211 110.629 1.00 44.08 ? 215 GLU B OE2 1 
ATOM   4248 N N   . ALA B 1 216 ? 50.575 24.700 110.801 1.00 36.25 ? 216 ALA B N   1 
ATOM   4249 C CA  . ALA B 1 216 ? 49.828 23.462 110.606 1.00 35.17 ? 216 ALA B CA  1 
ATOM   4250 C C   . ALA B 1 216 ? 48.868 23.532 109.429 1.00 35.70 ? 216 ALA B C   1 
ATOM   4251 O O   . ALA B 1 216 ? 48.420 22.503 108.939 1.00 37.84 ? 216 ALA B O   1 
ATOM   4252 C CB  . ALA B 1 216 ? 49.059 23.107 111.871 1.00 34.82 ? 216 ALA B CB  1 
ATOM   4253 N N   . PHE B 1 217 ? 48.534 24.739 108.982 1.00 33.76 ? 217 PHE B N   1 
ATOM   4254 C CA  . PHE B 1 217 ? 47.615 24.893 107.860 1.00 32.68 ? 217 PHE B CA  1 
ATOM   4255 C C   . PHE B 1 217 ? 48.208 25.728 106.736 1.00 33.69 ? 217 PHE B C   1 
ATOM   4256 O O   . PHE B 1 217 ? 48.913 26.704 106.975 1.00 31.63 ? 217 PHE B O   1 
ATOM   4257 C CB  . PHE B 1 217 ? 46.304 25.535 108.318 1.00 32.33 ? 217 PHE B CB  1 
ATOM   4258 C CG  . PHE B 1 217 ? 45.385 24.598 109.049 1.00 29.36 ? 217 PHE B CG  1 
ATOM   4259 C CD1 . PHE B 1 217 ? 44.441 23.847 108.357 1.00 28.92 ? 217 PHE B CD1 1 
ATOM   4260 C CD2 . PHE B 1 217 ? 45.446 24.487 110.436 1.00 30.50 ? 217 PHE B CD2 1 
ATOM   4261 C CE1 . PHE B 1 217 ? 43.557 22.995 109.035 1.00 29.50 ? 217 PHE B CE1 1 
ATOM   4262 C CE2 . PHE B 1 217 ? 44.572 23.643 111.125 1.00 28.18 ? 217 PHE B CE2 1 
ATOM   4263 C CZ  . PHE B 1 217 ? 43.624 22.896 110.425 1.00 26.91 ? 217 PHE B CZ  1 
ATOM   4264 N N   . ARG B 1 218 ? 47.899 25.336 105.504 1.00 34.32 ? 218 ARG B N   1 
ATOM   4265 C CA  . ARG B 1 218 ? 48.389 26.032 104.320 1.00 37.13 ? 218 ARG B CA  1 
ATOM   4266 C C   . ARG B 1 218 ? 47.912 27.485 104.311 1.00 33.05 ? 218 ARG B C   1 
ATOM   4267 O O   . ARG B 1 218 ? 48.714 28.417 104.255 1.00 33.33 ? 218 ARG B O   1 
ATOM   4268 C CB  . ARG B 1 218 ? 47.881 25.325 103.055 1.00 41.14 ? 218 ARG B CB  1 
ATOM   4269 C CG  . ARG B 1 218 ? 48.747 25.509 101.816 1.00 51.19 ? 218 ARG B CG  1 
ATOM   4270 C CD  . ARG B 1 218 ? 49.031 26.966 101.483 1.00 59.15 ? 218 ARG B CD  1 
ATOM   4271 N NE  . ARG B 1 218 ? 49.748 27.100 100.214 1.00 66.54 ? 218 ARG B NE  1 
ATOM   4272 C CZ  . ARG B 1 218 ? 50.193 28.251 99.717  1.00 69.10 ? 218 ARG B CZ  1 
ATOM   4273 N NH1 . ARG B 1 218 ? 50.002 29.384 100.382 1.00 71.16 ? 218 ARG B NH1 1 
ATOM   4274 N NH2 . ARG B 1 218 ? 50.826 28.272 98.551  1.00 71.00 ? 218 ARG B NH2 1 
ATOM   4275 N N   . TYR B 1 219 ? 46.599 27.665 104.363 1.00 31.19 ? 219 TYR B N   1 
ATOM   4276 C CA  . TYR B 1 219 ? 46.011 28.998 104.340 1.00 31.26 ? 219 TYR B CA  1 
ATOM   4277 C C   . TYR B 1 219 ? 45.437 29.399 105.697 1.00 29.43 ? 219 TYR B C   1 
ATOM   4278 O O   . TYR B 1 219 ? 44.575 28.711 106.228 1.00 27.02 ? 219 TYR B O   1 
ATOM   4279 C CB  . TYR B 1 219 ? 44.897 29.057 103.293 1.00 35.28 ? 219 TYR B CB  1 
ATOM   4280 C CG  . TYR B 1 219 ? 45.331 28.588 101.927 1.00 44.14 ? 219 TYR B CG  1 
ATOM   4281 C CD1 . TYR B 1 219 ? 45.417 27.228 101.634 1.00 46.78 ? 219 TYR B CD1 1 
ATOM   4282 C CD2 . TYR B 1 219 ? 45.691 29.501 100.937 1.00 45.22 ? 219 TYR B CD2 1 
ATOM   4283 C CE1 . TYR B 1 219 ? 45.855 26.784 100.384 1.00 51.33 ? 219 TYR B CE1 1 
ATOM   4284 C CE2 . TYR B 1 219 ? 46.134 29.069 99.682  1.00 50.72 ? 219 TYR B CE2 1 
ATOM   4285 C CZ  . TYR B 1 219 ? 46.215 27.708 99.414  1.00 52.25 ? 219 TYR B CZ  1 
ATOM   4286 O OH  . TYR B 1 219 ? 46.677 27.270 98.189  1.00 54.42 ? 219 TYR B OH  1 
ATOM   4287 N N   . VAL B 1 220 ? 45.919 30.507 106.253 1.00 25.84 ? 220 VAL B N   1 
ATOM   4288 C CA  . VAL B 1 220 ? 45.409 30.988 107.533 1.00 26.44 ? 220 VAL B CA  1 
ATOM   4289 C C   . VAL B 1 220 ? 45.025 32.451 107.364 1.00 25.01 ? 220 VAL B C   1 
ATOM   4290 O O   . VAL B 1 220 ? 45.829 33.261 106.898 1.00 23.93 ? 220 VAL B O   1 
ATOM   4291 C CB  . VAL B 1 220 ? 46.461 30.856 108.648 1.00 27.78 ? 220 VAL B CB  1 
ATOM   4292 C CG1 . VAL B 1 220 ? 45.871 31.315 109.981 1.00 26.55 ? 220 VAL B CG1 1 
ATOM   4293 C CG2 . VAL B 1 220 ? 46.921 29.397 108.747 1.00 26.01 ? 220 VAL B CG2 1 
ATOM   4294 N N   . ARG B 1 221 ? 43.789 32.778 107.724 1.00 22.60 ? 221 ARG B N   1 
ATOM   4295 C CA  . ARG B 1 221 ? 43.304 34.144 107.596 1.00 20.98 ? 221 ARG B CA  1 
ATOM   4296 C C   . ARG B 1 221 ? 42.665 34.657 108.893 1.00 20.97 ? 221 ARG B C   1 
ATOM   4297 O O   . ARG B 1 221 ? 41.657 34.129 109.344 1.00 19.59 ? 221 ARG B O   1 
ATOM   4298 C CB  . ARG B 1 221 ? 42.272 34.234 106.469 1.00 19.74 ? 221 ARG B CB  1 
ATOM   4299 C CG  . ARG B 1 221 ? 42.820 34.028 105.060 1.00 23.85 ? 221 ARG B CG  1 
ATOM   4300 C CD  . ARG B 1 221 ? 43.814 35.122 104.704 1.00 26.78 ? 221 ARG B CD  1 
ATOM   4301 N NE  . ARG B 1 221 ? 44.127 35.085 103.281 1.00 32.74 ? 221 ARG B NE  1 
ATOM   4302 C CZ  . ARG B 1 221 ? 44.960 35.922 102.672 1.00 34.05 ? 221 ARG B CZ  1 
ATOM   4303 N NH1 . ARG B 1 221 ? 45.577 36.876 103.363 1.00 29.79 ? 221 ARG B NH1 1 
ATOM   4304 N NH2 . ARG B 1 221 ? 45.167 35.804 101.364 1.00 35.42 ? 221 ARG B NH2 1 
ATOM   4305 N N   . SER B 1 222 ? 43.269 35.686 109.474 1.00 22.61 ? 222 SER B N   1 
ATOM   4306 C CA  . SER B 1 222 ? 42.759 36.319 110.684 1.00 21.08 ? 222 SER B CA  1 
ATOM   4307 C C   . SER B 1 222 ? 41.585 37.254 110.358 1.00 19.58 ? 222 SER B C   1 
ATOM   4308 O O   . SER B 1 222 ? 41.503 37.831 109.273 1.00 19.08 ? 222 SER B O   1 
ATOM   4309 C CB  . SER B 1 222 ? 43.853 37.181 111.346 1.00 23.39 ? 222 SER B CB  1 
ATOM   4310 O OG  . SER B 1 222 ? 44.817 36.399 112.025 1.00 33.10 ? 222 SER B OG  1 
ATOM   4311 N N   . TYR B 1 223 ? 40.684 37.396 111.315 1.00 18.80 ? 223 TYR B N   1 
ATOM   4312 C CA  . TYR B 1 223 ? 39.581 38.339 111.200 1.00 21.10 ? 223 TYR B CA  1 
ATOM   4313 C C   . TYR B 1 223 ? 39.327 38.825 112.616 1.00 20.19 ? 223 TYR B C   1 
ATOM   4314 O O   . TYR B 1 223 ? 39.741 38.184 113.597 1.00 19.05 ? 223 TYR B O   1 
ATOM   4315 C CB  . TYR B 1 223 ? 38.314 37.749 110.540 1.00 21.61 ? 223 TYR B CB  1 
ATOM   4316 C CG  . TYR B 1 223 ? 37.601 36.614 111.227 1.00 20.83 ? 223 TYR B CG  1 
ATOM   4317 C CD1 . TYR B 1 223 ? 38.029 35.295 111.066 1.00 17.60 ? 223 TYR B CD1 1 
ATOM   4318 C CD2 . TYR B 1 223 ? 36.419 36.843 111.942 1.00 17.85 ? 223 TYR B CD2 1 
ATOM   4319 C CE1 . TYR B 1 223 ? 37.289 34.222 111.591 1.00 17.38 ? 223 TYR B CE1 1 
ATOM   4320 C CE2 . TYR B 1 223 ? 35.675 35.782 112.468 1.00 19.13 ? 223 TYR B CE2 1 
ATOM   4321 C CZ  . TYR B 1 223 ? 36.116 34.477 112.284 1.00 21.16 ? 223 TYR B CZ  1 
ATOM   4322 O OH  . TYR B 1 223 ? 35.368 33.427 112.777 1.00 16.71 ? 223 TYR B OH  1 
ATOM   4323 N N   . LYS B 1 224 ? 38.706 39.984 112.737 1.00 16.42 ? 224 LYS B N   1 
ATOM   4324 C CA  . LYS B 1 224 ? 38.499 40.527 114.064 1.00 18.35 ? 224 LYS B CA  1 
ATOM   4325 C C   . LYS B 1 224 ? 37.145 41.179 114.197 1.00 18.17 ? 224 LYS B C   1 
ATOM   4326 O O   . LYS B 1 224 ? 36.484 41.476 113.201 1.00 16.87 ? 224 LYS B O   1 
ATOM   4327 C CB  . LYS B 1 224 ? 39.604 41.548 114.362 1.00 20.55 ? 224 LYS B CB  1 
ATOM   4328 C CG  . LYS B 1 224 ? 39.644 42.707 113.368 1.00 28.03 ? 224 LYS B CG  1 
ATOM   4329 C CD  . LYS B 1 224 ? 40.726 43.722 113.729 1.00 30.77 ? 224 LYS B CD  1 
ATOM   4330 C CE  . LYS B 1 224 ? 40.618 44.972 112.862 1.00 33.97 ? 224 LYS B CE  1 
ATOM   4331 N NZ  . LYS B 1 224 ? 39.309 45.690 113.072 1.00 29.20 ? 224 LYS B NZ  1 
ATOM   4332 N N   . ASN B 1 225 ? 36.734 41.391 115.442 1.00 18.49 ? 225 ASN B N   1 
ATOM   4333 C CA  . ASN B 1 225 ? 35.470 42.045 115.727 1.00 15.24 ? 225 ASN B CA  1 
ATOM   4334 C C   . ASN B 1 225 ? 35.550 42.538 117.176 1.00 18.28 ? 225 ASN B C   1 
ATOM   4335 O O   . ASN B 1 225 ? 36.183 41.899 118.020 1.00 18.62 ? 225 ASN B O   1 
ATOM   4336 C CB  . ASN B 1 225 ? 34.291 41.070 115.566 1.00 14.68 ? 225 ASN B CB  1 
ATOM   4337 C CG  . ASN B 1 225 ? 32.961 41.792 115.296 1.00 19.83 ? 225 ASN B CG  1 
ATOM   4338 O OD1 . ASN B 1 225 ? 31.890 41.183 115.286 1.00 23.75 ? 225 ASN B OD1 1 
ATOM   4339 N ND2 . ASN B 1 225 ? 33.036 43.093 115.072 1.00 16.62 ? 225 ASN B ND2 1 
ATOM   4340 N N   . HIS B 1 226 ? 34.944 43.691 117.445 1.00 19.08 ? 226 HIS B N   1 
ATOM   4341 C CA  . HIS B 1 226 ? 34.921 44.246 118.793 1.00 20.43 ? 226 HIS B CA  1 
ATOM   4342 C C   . HIS B 1 226 ? 33.768 43.572 119.539 1.00 18.70 ? 226 HIS B C   1 
ATOM   4343 O O   . HIS B 1 226 ? 32.651 43.492 119.025 1.00 20.94 ? 226 HIS B O   1 
ATOM   4344 C CB  . HIS B 1 226 ? 34.703 45.772 118.771 1.00 23.45 ? 226 HIS B CB  1 
ATOM   4345 C CG  . HIS B 1 226 ? 34.782 46.403 120.134 1.00 29.36 ? 226 HIS B CG  1 
ATOM   4346 N ND1 . HIS B 1 226 ? 33.670 46.631 120.919 1.00 32.12 ? 226 HIS B ND1 1 
ATOM   4347 C CD2 . HIS B 1 226 ? 35.849 46.758 120.887 1.00 31.46 ? 226 HIS B CD2 1 
ATOM   4348 C CE1 . HIS B 1 226 ? 34.051 47.096 122.096 1.00 30.43 ? 226 HIS B CE1 1 
ATOM   4349 N NE2 . HIS B 1 226 ? 35.369 47.182 122.105 1.00 34.03 ? 226 HIS B NE2 1 
ATOM   4350 N N   . ILE B 1 227 ? 34.059 43.042 120.722 1.00 20.28 ? 227 ILE B N   1 
ATOM   4351 C CA  . ILE B 1 227 ? 33.042 42.371 121.530 1.00 20.53 ? 227 ILE B CA  1 
ATOM   4352 C C   . ILE B 1 227 ? 32.662 43.351 122.655 1.00 19.23 ? 227 ILE B C   1 
ATOM   4353 O O   . ILE B 1 227 ? 33.370 43.472 123.653 1.00 20.56 ? 227 ILE B O   1 
ATOM   4354 C CB  . ILE B 1 227 ? 33.596 41.040 122.113 1.00 18.90 ? 227 ILE B CB  1 
ATOM   4355 C CG1 . ILE B 1 227 ? 34.283 40.212 121.000 1.00 14.75 ? 227 ILE B CG1 1 
ATOM   4356 C CG2 . ILE B 1 227 ? 32.462 40.255 122.752 1.00 16.89 ? 227 ILE B CG2 1 
ATOM   4357 C CD1 . ILE B 1 227 ? 33.357 39.796 119.846 1.00 16.08 ? 227 ILE B CD1 1 
ATOM   4358 N N   . PRO B 1 228 ? 31.535 44.064 122.489 1.00 21.16 ? 228 PRO B N   1 
ATOM   4359 C CA  . PRO B 1 228 ? 30.993 45.068 123.420 1.00 21.16 ? 228 PRO B CA  1 
ATOM   4360 C C   . PRO B 1 228 ? 31.143 44.759 124.908 1.00 21.70 ? 228 PRO B C   1 
ATOM   4361 O O   . PRO B 1 228 ? 31.693 45.563 125.679 1.00 22.07 ? 228 PRO B O   1 
ATOM   4362 C CB  . PRO B 1 228 ? 29.520 45.160 123.016 1.00 21.80 ? 228 PRO B CB  1 
ATOM   4363 C CG  . PRO B 1 228 ? 29.543 44.842 121.567 1.00 20.67 ? 228 PRO B CG  1 
ATOM   4364 C CD  . PRO B 1 228 ? 30.521 43.696 121.482 1.00 18.18 ? 228 PRO B CD  1 
ATOM   4365 N N   . GLY B 1 229 ? 30.623 43.606 125.307 1.00 19.26 ? 229 GLY B N   1 
ATOM   4366 C CA  . GLY B 1 229 ? 30.683 43.202 126.705 1.00 19.32 ? 229 GLY B CA  1 
ATOM   4367 C C   . GLY B 1 229 ? 32.071 42.897 127.232 1.00 19.31 ? 229 GLY B C   1 
ATOM   4368 O O   . GLY B 1 229 ? 32.269 42.844 128.462 1.00 18.97 ? 229 GLY B O   1 
ATOM   4369 N N   . PHE B 1 230 ? 33.023 42.666 126.327 1.00 18.37 ? 230 PHE B N   1 
ATOM   4370 C CA  . PHE B 1 230 ? 34.408 42.394 126.738 1.00 18.31 ? 230 PHE B CA  1 
ATOM   4371 C C   . PHE B 1 230 ? 35.226 43.685 126.748 1.00 16.79 ? 230 PHE B C   1 
ATOM   4372 O O   . PHE B 1 230 ? 36.294 43.731 127.366 1.00 17.32 ? 230 PHE B O   1 
ATOM   4373 C CB  . PHE B 1 230 ? 35.143 41.441 125.777 1.00 20.25 ? 230 PHE B CB  1 
ATOM   4374 C CG  . PHE B 1 230 ? 34.631 40.023 125.766 1.00 20.64 ? 230 PHE B CG  1 
ATOM   4375 C CD1 . PHE B 1 230 ? 33.772 39.550 126.749 1.00 22.55 ? 230 PHE B CD1 1 
ATOM   4376 C CD2 . PHE B 1 230 ? 35.071 39.144 124.779 1.00 22.60 ? 230 PHE B CD2 1 
ATOM   4377 C CE1 . PHE B 1 230 ? 33.356 38.207 126.749 1.00 23.66 ? 230 PHE B CE1 1 
ATOM   4378 C CE2 . PHE B 1 230 ? 34.662 37.799 124.768 1.00 23.09 ? 230 PHE B CE2 1 
ATOM   4379 C CZ  . PHE B 1 230 ? 33.802 37.338 125.759 1.00 24.72 ? 230 PHE B CZ  1 
ATOM   4380 N N   . PHE B 1 231 ? 34.726 44.718 126.069 1.00 15.85 ? 231 PHE B N   1 
ATOM   4381 C CA  . PHE B 1 231 ? 35.432 45.996 125.959 1.00 18.40 ? 231 PHE B CA  1 
ATOM   4382 C C   . PHE B 1 231 ? 36.798 45.726 125.325 1.00 20.04 ? 231 PHE B C   1 
ATOM   4383 O O   . PHE B 1 231 ? 37.784 46.415 125.597 1.00 18.96 ? 231 PHE B O   1 
ATOM   4384 C CB  . PHE B 1 231 ? 35.600 46.661 127.343 1.00 16.85 ? 231 PHE B CB  1 
ATOM   4385 C CG  . PHE B 1 231 ? 34.293 47.092 127.964 1.00 16.17 ? 231 PHE B CG  1 
ATOM   4386 C CD1 . PHE B 1 231 ? 33.510 46.184 128.691 1.00 17.36 ? 231 PHE B CD1 1 
ATOM   4387 C CD2 . PHE B 1 231 ? 33.809 48.374 127.761 1.00 16.58 ? 231 PHE B CD2 1 
ATOM   4388 C CE1 . PHE B 1 231 ? 32.249 46.571 129.198 1.00 17.01 ? 231 PHE B CE1 1 
ATOM   4389 C CE2 . PHE B 1 231 ? 32.551 48.775 128.262 1.00 16.97 ? 231 PHE B CE2 1 
ATOM   4390 C CZ  . PHE B 1 231 ? 31.774 47.869 128.979 1.00 16.39 ? 231 PHE B CZ  1 
ATOM   4391 N N   . LEU B 1 232 ? 36.830 44.736 124.441 1.00 20.10 ? 232 LEU B N   1 
ATOM   4392 C CA  . LEU B 1 232 ? 38.064 44.329 123.761 1.00 19.88 ? 232 LEU B CA  1 
ATOM   4393 C C   . LEU B 1 232 ? 37.814 43.946 122.319 1.00 22.33 ? 232 LEU B C   1 
ATOM   4394 O O   . LEU B 1 232 ? 36.754 43.419 121.972 1.00 18.52 ? 232 LEU B O   1 
ATOM   4395 C CB  . LEU B 1 232 ? 38.665 43.099 124.444 1.00 24.43 ? 232 LEU B CB  1 
ATOM   4396 C CG  . LEU B 1 232 ? 39.646 43.157 125.617 1.00 26.16 ? 232 LEU B CG  1 
ATOM   4397 C CD1 . LEU B 1 232 ? 39.661 44.509 126.242 1.00 30.37 ? 232 LEU B CD1 1 
ATOM   4398 C CD2 . LEU B 1 232 ? 39.278 42.077 126.613 1.00 23.29 ? 232 LEU B CD2 1 
ATOM   4399 N N   . ASN B 1 233 ? 38.815 44.200 121.490 1.00 23.06 ? 233 ASN B N   1 
ATOM   4400 C CA  . ASN B 1 233 ? 38.788 43.842 120.084 1.00 23.50 ? 233 ASN B CA  1 
ATOM   4401 C C   . ASN B 1 233 ? 39.290 42.392 120.121 1.00 22.35 ? 233 ASN B C   1 
ATOM   4402 O O   . ASN B 1 233 ? 40.322 42.129 120.726 1.00 22.47 ? 233 ASN B O   1 
ATOM   4403 C CB  . ASN B 1 233 ? 39.804 44.698 119.325 1.00 24.39 ? 233 ASN B CB  1 
ATOM   4404 C CG  . ASN B 1 233 ? 39.476 44.841 117.867 1.00 33.85 ? 233 ASN B CG  1 
ATOM   4405 O OD1 . ASN B 1 233 ? 40.280 45.359 117.087 1.00 37.37 ? 233 ASN B OD1 1 
ATOM   4406 N ND2 . ASN B 1 233 ? 38.286 44.401 117.483 1.00 31.43 ? 233 ASN B ND2 1 
ATOM   4407 N N   . PHE B 1 234 ? 38.575 41.453 119.507 1.00 17.69 ? 234 PHE B N   1 
ATOM   4408 C CA  . PHE B 1 234 ? 39.049 40.071 119.528 1.00 19.55 ? 234 PHE B CA  1 
ATOM   4409 C C   . PHE B 1 234 ? 39.468 39.555 118.173 1.00 19.28 ? 234 PHE B C   1 
ATOM   4410 O O   . PHE B 1 234 ? 38.887 39.909 117.154 1.00 18.21 ? 234 PHE B O   1 
ATOM   4411 C CB  . PHE B 1 234 ? 37.989 39.129 120.111 1.00 17.44 ? 234 PHE B CB  1 
ATOM   4412 C CG  . PHE B 1 234 ? 38.288 38.697 121.516 1.00 22.45 ? 234 PHE B CG  1 
ATOM   4413 C CD1 . PHE B 1 234 ? 38.759 37.407 121.784 1.00 23.86 ? 234 PHE B CD1 1 
ATOM   4414 C CD2 . PHE B 1 234 ? 38.151 39.598 122.572 1.00 21.18 ? 234 PHE B CD2 1 
ATOM   4415 C CE1 . PHE B 1 234 ? 39.094 37.026 123.088 1.00 26.04 ? 234 PHE B CE1 1 
ATOM   4416 C CE2 . PHE B 1 234 ? 38.483 39.226 123.884 1.00 25.35 ? 234 PHE B CE2 1 
ATOM   4417 C CZ  . PHE B 1 234 ? 38.956 37.935 124.137 1.00 24.36 ? 234 PHE B CZ  1 
ATOM   4418 N N   . GLY B 1 235 ? 40.496 38.718 118.182 1.00 19.42 ? 235 GLY B N   1 
ATOM   4419 C CA  . GLY B 1 235 ? 40.970 38.124 116.956 1.00 18.27 ? 235 GLY B CA  1 
ATOM   4420 C C   . GLY B 1 235 ? 40.361 36.743 116.824 1.00 18.49 ? 235 GLY B C   1 
ATOM   4421 O O   . GLY B 1 235 ? 40.071 36.068 117.817 1.00 17.29 ? 235 GLY B O   1 
ATOM   4422 N N   . PHE B 1 236 ? 40.165 36.333 115.580 1.00 18.34 ? 236 PHE B N   1 
ATOM   4423 C CA  . PHE B 1 236 ? 39.608 35.032 115.245 1.00 18.62 ? 236 PHE B CA  1 
ATOM   4424 C C   . PHE B 1 236 ? 40.374 34.628 113.993 1.00 17.59 ? 236 PHE B C   1 
ATOM   4425 O O   . PHE B 1 236 ? 41.141 35.421 113.449 1.00 16.76 ? 236 PHE B O   1 
ATOM   4426 C CB  . PHE B 1 236 ? 38.126 35.160 114.880 1.00 17.18 ? 236 PHE B CB  1 
ATOM   4427 C CG  . PHE B 1 236 ? 37.248 35.621 116.019 1.00 18.65 ? 236 PHE B CG  1 
ATOM   4428 C CD1 . PHE B 1 236 ? 36.563 34.698 116.804 1.00 21.37 ? 236 PHE B CD1 1 
ATOM   4429 C CD2 . PHE B 1 236 ? 37.106 36.976 116.298 1.00 17.58 ? 236 PHE B CD2 1 
ATOM   4430 C CE1 . PHE B 1 236 ? 35.736 35.116 117.859 1.00 21.66 ? 236 PHE B CE1 1 
ATOM   4431 C CE2 . PHE B 1 236 ? 36.287 37.411 117.350 1.00 17.22 ? 236 PHE B CE2 1 
ATOM   4432 C CZ  . PHE B 1 236 ? 35.599 36.474 118.130 1.00 19.75 ? 236 PHE B CZ  1 
ATOM   4433 N N   . LEU B 1 237 ? 40.180 33.399 113.536 1.00 19.29 ? 237 LEU B N   1 
ATOM   4434 C CA  . LEU B 1 237 ? 40.826 33.009 112.298 1.00 18.66 ? 237 LEU B CA  1 
ATOM   4435 C C   . LEU B 1 237 ? 40.155 31.832 111.650 1.00 20.52 ? 237 LEU B C   1 
ATOM   4436 O O   . LEU B 1 237 ? 39.432 31.077 112.306 1.00 19.50 ? 237 LEU B O   1 
ATOM   4437 C CB  . LEU B 1 237 ? 42.327 32.748 112.517 1.00 23.08 ? 237 LEU B CB  1 
ATOM   4438 C CG  . LEU B 1 237 ? 43.072 31.427 112.763 1.00 27.63 ? 237 LEU B CG  1 
ATOM   4439 C CD1 . LEU B 1 237 ? 44.076 31.693 113.862 1.00 24.62 ? 237 LEU B CD1 1 
ATOM   4440 C CD2 . LEU B 1 237 ? 42.175 30.281 113.125 1.00 29.88 ? 237 LEU B CD2 1 
ATOM   4441 N N   . LEU B 1 238 ? 40.354 31.731 110.336 1.00 19.29 ? 238 LEU B N   1 
ATOM   4442 C CA  . LEU B 1 238 ? 39.840 30.625 109.533 1.00 22.32 ? 238 LEU B CA  1 
ATOM   4443 C C   . LEU B 1 238 ? 41.090 29.930 108.979 1.00 23.40 ? 238 LEU B C   1 
ATOM   4444 O O   . LEU B 1 238 ? 42.072 30.596 108.608 1.00 23.73 ? 238 LEU B O   1 
ATOM   4445 C CB  . LEU B 1 238 ? 38.969 31.163 108.387 1.00 24.59 ? 238 LEU B CB  1 
ATOM   4446 C CG  . LEU B 1 238 ? 37.470 30.844 108.420 1.00 30.16 ? 238 LEU B CG  1 
ATOM   4447 C CD1 . LEU B 1 238 ? 36.912 30.955 109.817 1.00 26.01 ? 238 LEU B CD1 1 
ATOM   4448 C CD2 . LEU B 1 238 ? 36.743 31.768 107.452 1.00 24.66 ? 238 LEU B CD2 1 
ATOM   4449 N N   . ALA B 1 239 ? 41.078 28.602 108.941 1.00 22.43 ? 239 ALA B N   1 
ATOM   4450 C CA  . ALA B 1 239 ? 42.242 27.871 108.446 1.00 26.18 ? 239 ALA B CA  1 
ATOM   4451 C C   . ALA B 1 239 ? 41.830 26.686 107.592 1.00 29.36 ? 239 ALA B C   1 
ATOM   4452 O O   . ALA B 1 239 ? 40.853 25.997 107.892 1.00 25.27 ? 239 ALA B O   1 
ATOM   4453 C CB  . ALA B 1 239 ? 43.094 27.390 109.607 1.00 26.01 ? 239 ALA B CB  1 
ATOM   4454 N N   . SER B 1 240 ? 42.599 26.442 106.535 1.00 31.81 ? 240 SER B N   1 
ATOM   4455 C CA  . SER B 1 240 ? 42.297 25.342 105.638 1.00 35.11 ? 240 SER B CA  1 
ATOM   4456 C C   . SER B 1 240 ? 43.479 25.021 104.744 1.00 36.64 ? 240 SER B C   1 
ATOM   4457 O O   . SER B 1 240 ? 44.350 25.865 104.497 1.00 31.39 ? 240 SER B O   1 
ATOM   4458 C CB  . SER B 1 240 ? 41.079 25.695 104.774 1.00 38.77 ? 240 SER B CB  1 
ATOM   4459 O OG  . SER B 1 240 ? 40.691 24.612 103.944 1.00 41.21 ? 240 SER B OG  1 
ATOM   4460 N N   . ASP B 1 241 ? 43.507 23.779 104.276 1.00 40.91 ? 241 ASP B N   1 
ATOM   4461 C CA  . ASP B 1 241 ? 44.549 23.323 103.375 1.00 41.78 ? 241 ASP B CA  1 
ATOM   4462 C C   . ASP B 1 241 ? 43.962 23.327 101.976 1.00 40.84 ? 241 ASP B C   1 
ATOM   4463 O O   . ASP B 1 241 ? 44.677 23.462 100.992 1.00 41.80 ? 241 ASP B O   1 
ATOM   4464 C CB  . ASP B 1 241 ? 44.987 21.903 103.733 1.00 43.36 ? 241 ASP B CB  1 
ATOM   4465 C CG  . ASP B 1 241 ? 46.193 21.879 104.643 1.00 46.08 ? 241 ASP B CG  1 
ATOM   4466 O OD1 . ASP B 1 241 ? 46.711 20.776 104.920 1.00 51.03 ? 241 ASP B OD1 1 
ATOM   4467 O OD2 . ASP B 1 241 ? 46.629 22.961 105.081 1.00 50.14 ? 241 ASP B OD2 1 
ATOM   4468 N N   . ALA B 1 242 ? 42.642 23.197 101.907 1.00 43.42 ? 242 ALA B N   1 
ATOM   4469 C CA  . ALA B 1 242 ? 41.927 23.139 100.636 1.00 46.48 ? 242 ALA B CA  1 
ATOM   4470 C C   . ALA B 1 242 ? 41.739 24.459 99.886  1.00 48.93 ? 242 ALA B C   1 
ATOM   4471 O O   . ALA B 1 242 ? 41.617 24.464 98.660  1.00 49.95 ? 242 ALA B O   1 
ATOM   4472 C CB  . ALA B 1 242 ? 40.562 22.472 100.852 1.00 45.65 ? 242 ALA B CB  1 
ATOM   4473 N N   . PHE B 1 243 ? 41.714 25.575 100.605 1.00 49.11 ? 243 PHE B N   1 
ATOM   4474 C CA  . PHE B 1 243 ? 41.511 26.865 99.956  1.00 46.30 ? 243 PHE B CA  1 
ATOM   4475 C C   . PHE B 1 243 ? 41.828 28.045 100.872 1.00 43.34 ? 243 PHE B C   1 
ATOM   4476 O O   . PHE B 1 243 ? 41.997 27.877 102.078 1.00 39.40 ? 243 PHE B O   1 
ATOM   4477 C CB  . PHE B 1 243 ? 40.059 26.977 99.486  1.00 47.81 ? 243 PHE B CB  1 
ATOM   4478 C CG  . PHE B 1 243 ? 39.046 26.773 100.584 1.00 54.28 ? 243 PHE B CG  1 
ATOM   4479 C CD1 . PHE B 1 243 ? 38.845 25.510 101.145 1.00 56.13 ? 243 PHE B CD1 1 
ATOM   4480 C CD2 . PHE B 1 243 ? 38.292 27.844 101.061 1.00 56.04 ? 243 PHE B CD2 1 
ATOM   4481 C CE1 . PHE B 1 243 ? 37.910 25.316 102.161 1.00 55.44 ? 243 PHE B CE1 1 
ATOM   4482 C CE2 . PHE B 1 243 ? 37.353 27.663 102.078 1.00 57.12 ? 243 PHE B CE2 1 
ATOM   4483 C CZ  . PHE B 1 243 ? 37.162 26.396 102.629 1.00 58.95 ? 243 PHE B CZ  1 
ATOM   4484 N N   . ASP B 1 244 ? 41.923 29.232 100.278 1.00 39.60 ? 244 ASP B N   1 
ATOM   4485 C CA  . ASP B 1 244 ? 42.179 30.454 101.029 1.00 36.79 ? 244 ASP B CA  1 
ATOM   4486 C C   . ASP B 1 244 ? 40.811 30.829 101.574 1.00 34.99 ? 244 ASP B C   1 
ATOM   4487 O O   . ASP B 1 244 ? 39.967 31.355 100.854 1.00 38.00 ? 244 ASP B O   1 
ATOM   4488 C CB  . ASP B 1 244 ? 42.704 31.555 100.109 1.00 31.94 ? 244 ASP B CB  1 
ATOM   4489 C CG  . ASP B 1 244 ? 42.842 32.895 100.816 1.00 33.19 ? 244 ASP B CG  1 
ATOM   4490 O OD1 . ASP B 1 244 ? 42.538 32.990 102.026 1.00 27.22 ? 244 ASP B OD1 1 
ATOM   4491 O OD2 . ASP B 1 244 ? 43.254 33.864 100.153 1.00 33.82 ? 244 ASP B OD2 1 
ATOM   4492 N N   . PRO B 1 245 ? 40.574 30.562 102.863 1.00 34.69 ? 245 PRO B N   1 
ATOM   4493 C CA  . PRO B 1 245 ? 39.289 30.864 103.498 1.00 32.90 ? 245 PRO B CA  1 
ATOM   4494 C C   . PRO B 1 245 ? 38.753 32.281 103.328 1.00 29.53 ? 245 PRO B C   1 
ATOM   4495 O O   . PRO B 1 245 ? 37.566 32.512 103.515 1.00 30.57 ? 245 PRO B O   1 
ATOM   4496 C CB  . PRO B 1 245 ? 39.532 30.481 104.963 1.00 32.71 ? 245 PRO B CB  1 
ATOM   4497 C CG  . PRO B 1 245 ? 40.993 30.739 105.131 1.00 34.82 ? 245 PRO B CG  1 
ATOM   4498 C CD  . PRO B 1 245 ? 41.577 30.169 103.865 1.00 31.64 ? 245 PRO B CD  1 
ATOM   4499 N N   . ALA B 1 246 ? 39.602 33.235 102.966 1.00 28.59 ? 246 ALA B N   1 
ATOM   4500 C CA  . ALA B 1 246 ? 39.116 34.601 102.785 1.00 32.64 ? 246 ALA B CA  1 
ATOM   4501 C C   . ALA B 1 246 ? 38.938 34.991 101.316 1.00 32.78 ? 246 ALA B C   1 
ATOM   4502 O O   . ALA B 1 246 ? 38.652 36.144 101.007 1.00 32.05 ? 246 ALA B O   1 
ATOM   4503 C CB  . ALA B 1 246 ? 40.045 35.592 103.484 1.00 33.19 ? 246 ALA B CB  1 
ATOM   4504 N N   . ALA B 1 247 ? 39.111 34.033 100.411 1.00 33.69 ? 247 ALA B N   1 
ATOM   4505 C CA  . ALA B 1 247 ? 38.949 34.308 98.980  1.00 39.15 ? 247 ALA B CA  1 
ATOM   4506 C C   . ALA B 1 247 ? 37.463 34.180 98.644  1.00 39.03 ? 247 ALA B C   1 
ATOM   4507 O O   . ALA B 1 247 ? 37.053 33.292 97.910  1.00 40.96 ? 247 ALA B O   1 
ATOM   4508 C CB  . ALA B 1 247 ? 39.775 33.316 98.158  1.00 37.22 ? 247 ALA B CB  1 
ATOM   4509 N N   . PHE B 1 248 ? 36.673 35.097 99.188  1.00 40.67 ? 248 PHE B N   1 
ATOM   4510 C CA  . PHE B 1 248 ? 35.228 35.108 99.020  1.00 42.36 ? 248 PHE B CA  1 
ATOM   4511 C C   . PHE B 1 248 ? 34.669 35.493 97.682  1.00 44.32 ? 248 PHE B C   1 
ATOM   4512 O O   . PHE B 1 248 ? 35.251 35.355 96.610  1.00 47.55 ? 248 PHE B O   1 
ATOM   4513 C CB  . PHE B 1 248 ? 34.564 36.102 99.982  1.00 43.71 ? 248 PHE B CB  1 
ATOM   4514 C CG  . PHE B 1 248 ? 34.856 35.869 101.416 1.00 41.84 ? 248 PHE B CG  1 
ATOM   4515 C CD1 . PHE B 1 248 ? 35.247 36.933 102.222 1.00 39.36 ? 248 PHE B CD1 1 
ATOM   4516 C CD2 . PHE B 1 248 ? 34.731 34.609 101.973 1.00 41.04 ? 248 PHE B CD2 1 
ATOM   4517 C CE1 . PHE B 1 248 ? 35.511 36.746 103.560 1.00 34.09 ? 248 PHE B CE1 1 
ATOM   4518 C CE2 . PHE B 1 248 ? 34.994 34.415 103.320 1.00 42.54 ? 248 PHE B CE2 1 
ATOM   4519 C CZ  . PHE B 1 248 ? 35.385 35.494 104.112 1.00 36.30 ? 248 PHE B CZ  1 
ATOM   4520 N N   . SER B 1 249 ? 33.485 36.040 97.867  1.00 45.65 ? 249 SER B N   1 
ATOM   4521 C CA  . SER B 1 249 ? 32.584 36.607 96.910  1.00 46.46 ? 249 SER B CA  1 
ATOM   4522 C C   . SER B 1 249 ? 31.469 36.973 97.893  1.00 46.85 ? 249 SER B C   1 
ATOM   4523 O O   . SER B 1 249 ? 30.944 36.094 98.600  1.00 47.00 ? 249 SER B O   1 
ATOM   4524 C CB  . SER B 1 249 ? 32.072 35.572 95.925  1.00 43.72 ? 249 SER B CB  1 
ATOM   4525 O OG  . SER B 1 249 ? 30.979 36.132 95.238  1.00 40.04 ? 249 SER B OG  1 
ATOM   4526 N N   . GLU B 1 250 ? 31.156 38.262 97.997  1.00 43.22 ? 250 GLU B N   1 
ATOM   4527 C CA  . GLU B 1 250 ? 30.085 38.694 98.885  1.00 40.54 ? 250 GLU B CA  1 
ATOM   4528 C C   . GLU B 1 250 ? 28.795 38.002 98.427  1.00 38.21 ? 250 GLU B C   1 
ATOM   4529 O O   . GLU B 1 250 ? 27.947 37.620 99.255  1.00 35.96 ? 250 GLU B O   1 
ATOM   4530 C CB  . GLU B 1 250 ? 29.927 40.216 98.825  1.00 44.41 ? 250 GLU B CB  1 
ATOM   4531 C CG  . GLU B 1 250 ? 28.748 40.742 99.624  1.00 47.59 ? 250 GLU B CG  1 
ATOM   4532 C CD  . GLU B 1 250 ? 28.585 42.247 99.506  1.00 52.04 ? 250 GLU B CD  1 
ATOM   4533 O OE1 . GLU B 1 250 ? 27.492 42.752 99.848  1.00 54.72 ? 250 GLU B OE1 1 
ATOM   4534 O OE2 . GLU B 1 250 ? 29.546 42.927 99.081  1.00 52.99 ? 250 GLU B OE2 1 
ATOM   4535 N N   . GLY B 1 251 ? 28.672 37.814 97.107  1.00 35.32 ? 251 GLY B N   1 
ATOM   4536 C CA  . GLY B 1 251 ? 27.499 37.162 96.531  1.00 27.93 ? 251 GLY B CA  1 
ATOM   4537 C C   . GLY B 1 251 ? 27.220 35.746 97.019  1.00 24.73 ? 251 GLY B C   1 
ATOM   4538 O O   . GLY B 1 251 ? 26.085 35.396 97.330  1.00 25.80 ? 251 GLY B O   1 
ATOM   4539 N N   . VAL B 1 252 ? 28.255 34.921 97.101  1.00 25.93 ? 252 VAL B N   1 
ATOM   4540 C CA  . VAL B 1 252 ? 28.085 33.539 97.541  1.00 27.29 ? 252 VAL B CA  1 
ATOM   4541 C C   . VAL B 1 252 ? 27.704 33.427 99.013  1.00 28.28 ? 252 VAL B C   1 
ATOM   4542 O O   . VAL B 1 252 ? 26.864 32.615 99.398  1.00 25.86 ? 252 VAL B O   1 
ATOM   4543 C CB  . VAL B 1 252 ? 29.374 32.730 97.279  1.00 28.45 ? 252 VAL B CB  1 
ATOM   4544 C CG1 . VAL B 1 252 ? 29.275 31.348 97.921  1.00 31.38 ? 252 VAL B CG1 1 
ATOM   4545 C CG2 . VAL B 1 252 ? 29.589 32.595 95.764  1.00 29.45 ? 252 VAL B CG2 1 
ATOM   4546 N N   . ILE B 1 253 ? 28.334 34.233 99.851  1.00 28.42 ? 253 ILE B N   1 
ATOM   4547 C CA  . ILE B 1 253 ? 27.999 34.174 101.260 1.00 26.77 ? 253 ILE B CA  1 
ATOM   4548 C C   . ILE B 1 253 ? 26.551 34.616 101.453 1.00 26.28 ? 253 ILE B C   1 
ATOM   4549 O O   . ILE B 1 253 ? 25.809 33.997 102.205 1.00 26.27 ? 253 ILE B O   1 
ATOM   4550 C CB  . ILE B 1 253 ? 28.967 35.034 102.068 1.00 28.02 ? 253 ILE B CB  1 
ATOM   4551 C CG1 . ILE B 1 253 ? 30.297 34.275 102.169 1.00 29.01 ? 253 ILE B CG1 1 
ATOM   4552 C CG2 . ILE B 1 253 ? 28.385 35.341 103.455 1.00 24.20 ? 253 ILE B CG2 1 
ATOM   4553 C CD1 . ILE B 1 253 ? 31.438 35.090 102.665 1.00 36.21 ? 253 ILE B CD1 1 
ATOM   4554 N N   . GLU B 1 254 ? 26.149 35.665 100.741 1.00 26.55 ? 254 GLU B N   1 
ATOM   4555 C CA  . GLU B 1 254 ? 24.786 36.177 100.837 1.00 29.81 ? 254 GLU B CA  1 
ATOM   4556 C C   . GLU B 1 254 ? 23.792 35.077 100.474 1.00 30.63 ? 254 GLU B C   1 
ATOM   4557 O O   . GLU B 1 254 ? 22.804 34.854 101.175 1.00 28.35 ? 254 GLU B O   1 
ATOM   4558 C CB  . GLU B 1 254 ? 24.609 37.372 99.891  1.00 30.02 ? 254 GLU B CB  1 
ATOM   4559 C CG  . GLU B 1 254 ? 23.186 37.899 99.818  1.00 38.19 ? 254 GLU B CG  1 
ATOM   4560 C CD  . GLU B 1 254 ? 22.714 38.472 101.139 1.00 43.33 ? 254 GLU B CD  1 
ATOM   4561 O OE1 . GLU B 1 254 ? 21.496 38.676 101.299 1.00 46.39 ? 254 GLU B OE1 1 
ATOM   4562 O OE2 . GLU B 1 254 ? 23.558 38.726 102.022 1.00 44.50 ? 254 GLU B OE2 1 
ATOM   4563 N N   . ALA B 1 255 ? 24.070 34.380 99.377  1.00 32.44 ? 255 ALA B N   1 
ATOM   4564 C CA  . ALA B 1 255 ? 23.201 33.303 98.908  1.00 32.09 ? 255 ALA B CA  1 
ATOM   4565 C C   . ALA B 1 255 ? 23.115 32.150 99.896  1.00 32.29 ? 255 ALA B C   1 
ATOM   4566 O O   . ALA B 1 255 ? 22.060 31.531 100.053 1.00 32.59 ? 255 ALA B O   1 
ATOM   4567 C CB  . ALA B 1 255 ? 23.689 32.792 97.544  1.00 33.83 ? 255 ALA B CB  1 
ATOM   4568 N N   . ARG B 1 256 ? 24.226 31.846 100.560 1.00 33.74 ? 256 ARG B N   1 
ATOM   4569 C CA  . ARG B 1 256 ? 24.228 30.759 101.527 1.00 31.72 ? 256 ARG B CA  1 
ATOM   4570 C C   . ARG B 1 256 ? 23.459 31.168 102.781 1.00 33.12 ? 256 ARG B C   1 
ATOM   4571 O O   . ARG B 1 256 ? 22.777 30.349 103.390 1.00 33.53 ? 256 ARG B O   1 
ATOM   4572 C CB  . ARG B 1 256 ? 25.667 30.348 101.852 1.00 31.81 ? 256 ARG B CB  1 
ATOM   4573 C CG  . ARG B 1 256 ? 26.359 29.674 100.661 1.00 30.88 ? 256 ARG B CG  1 
ATOM   4574 C CD  . ARG B 1 256 ? 27.817 29.363 100.935 1.00 33.86 ? 256 ARG B CD  1 
ATOM   4575 N NE  . ARG B 1 256 ? 28.463 28.688 99.812  1.00 34.00 ? 256 ARG B NE  1 
ATOM   4576 C CZ  . ARG B 1 256 ? 29.764 28.421 99.748  1.00 34.34 ? 256 ARG B CZ  1 
ATOM   4577 N NH1 . ARG B 1 256 ? 30.567 28.768 100.746 1.00 31.70 ? 256 ARG B NH1 1 
ATOM   4578 N NH2 . ARG B 1 256 ? 30.271 27.823 98.680  1.00 35.09 ? 256 ARG B NH2 1 
ATOM   4579 N N   . ILE B 1 257 ? 23.555 32.441 103.159 1.00 32.53 ? 257 ILE B N   1 
ATOM   4580 C CA  . ILE B 1 257 ? 22.814 32.920 104.322 1.00 30.77 ? 257 ILE B CA  1 
ATOM   4581 C C   . ILE B 1 257 ? 21.327 32.743 104.022 1.00 32.52 ? 257 ILE B C   1 
ATOM   4582 O O   . ILE B 1 257 ? 20.585 32.160 104.812 1.00 27.95 ? 257 ILE B O   1 
ATOM   4583 C CB  . ILE B 1 257 ? 23.094 34.420 104.611 1.00 27.45 ? 257 ILE B CB  1 
ATOM   4584 C CG1 . ILE B 1 257 ? 24.532 34.600 105.101 1.00 27.16 ? 257 ILE B CG1 1 
ATOM   4585 C CG2 . ILE B 1 257 ? 22.133 34.951 105.664 1.00 30.58 ? 257 ILE B CG2 1 
ATOM   4586 C CD1 . ILE B 1 257 ? 24.901 36.045 105.375 1.00 25.90 ? 257 ILE B CD1 1 
ATOM   4587 N N   . ARG B 1 258 ? 20.893 33.225 102.864 1.00 33.28 ? 258 ARG B N   1 
ATOM   4588 C CA  . ARG B 1 258 ? 19.482 33.119 102.502 1.00 37.16 ? 258 ARG B CA  1 
ATOM   4589 C C   . ARG B 1 258 ? 19.018 31.680 102.351 1.00 37.59 ? 258 ARG B C   1 
ATOM   4590 O O   . ARG B 1 258 ? 17.940 31.306 102.815 1.00 36.12 ? 258 ARG B O   1 
ATOM   4591 C CB  . ARG B 1 258 ? 19.217 33.895 101.211 1.00 39.36 ? 258 ARG B CB  1 
ATOM   4592 C CG  . ARG B 1 258 ? 19.415 35.392 101.377 1.00 45.72 ? 258 ARG B CG  1 
ATOM   4593 C CD  . ARG B 1 258 ? 19.214 36.130 100.074 1.00 52.23 ? 258 ARG B CD  1 
ATOM   4594 N NE  . ARG B 1 258 ? 19.465 37.561 100.216 1.00 56.39 ? 258 ARG B NE  1 
ATOM   4595 C CZ  . ARG B 1 258 ? 19.538 38.408 99.193  1.00 61.35 ? 258 ARG B CZ  1 
ATOM   4596 N NH1 . ARG B 1 258 ? 19.379 37.966 97.951  1.00 64.40 ? 258 ARG B NH1 1 
ATOM   4597 N NH2 . ARG B 1 258 ? 19.774 39.696 99.408  1.00 63.31 ? 258 ARG B NH2 1 
ATOM   4598 N N   . GLU B 1 259 ? 19.852 30.872 101.711 1.00 40.34 ? 259 GLU B N   1 
ATOM   4599 C CA  . GLU B 1 259 ? 19.558 29.469 101.471 1.00 42.09 ? 259 GLU B CA  1 
ATOM   4600 C C   . GLU B 1 259 ? 19.301 28.705 102.775 1.00 41.83 ? 259 GLU B C   1 
ATOM   4601 O O   . GLU B 1 259 ? 18.331 27.950 102.887 1.00 38.54 ? 259 GLU B O   1 
ATOM   4602 C CB  . GLU B 1 259 ? 20.737 28.845 100.713 1.00 46.48 ? 259 GLU B CB  1 
ATOM   4603 C CG  . GLU B 1 259 ? 20.378 27.746 99.737  1.00 53.54 ? 259 GLU B CG  1 
ATOM   4604 C CD  . GLU B 1 259 ? 19.925 26.473 100.419 1.00 58.91 ? 259 GLU B CD  1 
ATOM   4605 O OE1 . GLU B 1 259 ? 20.715 25.910 101.212 1.00 63.27 ? 259 GLU B OE1 1 
ATOM   4606 O OE2 . GLU B 1 259 ? 18.782 26.033 100.163 1.00 60.62 ? 259 GLU B OE2 1 
ATOM   4607 N N   . ARG B 1 260 ? 20.160 28.920 103.766 1.00 40.38 ? 260 ARG B N   1 
ATOM   4608 C CA  . ARG B 1 260 ? 20.049 28.215 105.039 1.00 39.51 ? 260 ARG B CA  1 
ATOM   4609 C C   . ARG B 1 260 ? 19.108 28.859 106.033 1.00 39.70 ? 260 ARG B C   1 
ATOM   4610 O O   . ARG B 1 260 ? 18.986 28.397 107.167 1.00 40.42 ? 260 ARG B O   1 
ATOM   4611 C CB  . ARG B 1 260 ? 21.436 28.067 105.660 1.00 38.35 ? 260 ARG B CB  1 
ATOM   4612 C CG  . ARG B 1 260 ? 22.454 27.560 104.653 1.00 36.19 ? 260 ARG B CG  1 
ATOM   4613 C CD  . ARG B 1 260 ? 23.841 27.414 105.229 1.00 33.97 ? 260 ARG B CD  1 
ATOM   4614 N NE  . ARG B 1 260 ? 24.794 27.076 104.179 1.00 32.33 ? 260 ARG B NE  1 
ATOM   4615 C CZ  . ARG B 1 260 ? 26.088 26.858 104.377 1.00 32.27 ? 260 ARG B CZ  1 
ATOM   4616 N NH1 . ARG B 1 260 ? 26.600 26.940 105.600 1.00 28.34 ? 260 ARG B NH1 1 
ATOM   4617 N NH2 . ARG B 1 260 ? 26.872 26.561 103.344 1.00 31.52 ? 260 ARG B NH2 1 
ATOM   4618 N N   . ASN B 1 261 ? 18.431 29.916 105.601 1.00 41.89 ? 261 ASN B N   1 
ATOM   4619 C CA  . ASN B 1 261 ? 17.499 30.625 106.466 1.00 43.22 ? 261 ASN B CA  1 
ATOM   4620 C C   . ASN B 1 261 ? 18.144 30.941 107.807 1.00 40.67 ? 261 ASN B C   1 
ATOM   4621 O O   . ASN B 1 261 ? 17.529 30.781 108.861 1.00 42.31 ? 261 ASN B O   1 
ATOM   4622 C CB  . ASN B 1 261 ? 16.237 29.789 106.676 1.00 45.88 ? 261 ASN B CB  1 
ATOM   4623 C CG  . ASN B 1 261 ? 15.274 29.898 105.514 1.00 52.46 ? 261 ASN B CG  1 
ATOM   4624 O OD1 . ASN B 1 261 ? 14.909 28.895 104.890 1.00 52.15 ? 261 ASN B OD1 1 
ATOM   4625 N ND2 . ASN B 1 261 ? 14.855 31.126 105.212 1.00 53.96 ? 261 ASN B ND2 1 
ATOM   4626 N N   . LEU B 1 262 ? 19.396 31.378 107.760 1.00 42.34 ? 262 LEU B N   1 
ATOM   4627 C CA  . LEU B 1 262 ? 20.119 31.723 108.974 1.00 41.30 ? 262 LEU B CA  1 
ATOM   4628 C C   . LEU B 1 262 ? 19.583 33.007 109.557 1.00 40.30 ? 262 LEU B C   1 
ATOM   4629 O O   . LEU B 1 262 ? 19.527 34.030 108.874 1.00 41.94 ? 262 LEU B O   1 
ATOM   4630 C CB  . LEU B 1 262 ? 21.605 31.932 108.702 1.00 43.08 ? 262 LEU B CB  1 
ATOM   4631 C CG  . LEU B 1 262 ? 22.568 30.762 108.610 1.00 44.33 ? 262 LEU B CG  1 
ATOM   4632 C CD1 . LEU B 1 262 ? 23.977 31.341 108.527 1.00 41.40 ? 262 LEU B CD1 1 
ATOM   4633 C CD2 . LEU B 1 262 ? 22.424 29.855 109.826 1.00 42.99 ? 262 LEU B CD2 1 
ATOM   4634 N N   . ALA B 1 263 ? 19.192 32.952 110.821 1.00 38.31 ? 263 ALA B N   1 
ATOM   4635 C CA  . ALA B 1 263 ? 18.701 34.133 111.494 1.00 36.61 ? 263 ALA B CA  1 
ATOM   4636 C C   . ALA B 1 263 ? 19.954 34.749 112.117 1.00 36.39 ? 263 ALA B C   1 
ATOM   4637 O O   . ALA B 1 263 ? 20.581 34.147 112.991 1.00 38.81 ? 263 ALA B O   1 
ATOM   4638 C CB  . ALA B 1 263 ? 17.696 33.745 112.563 1.00 34.67 ? 263 ALA B CB  1 
ATOM   4639 N N   . LEU B 1 264 ? 20.348 35.915 111.615 1.00 32.86 ? 264 LEU B N   1 
ATOM   4640 C CA  . LEU B 1 264 ? 21.522 36.625 112.116 1.00 28.55 ? 264 LEU B CA  1 
ATOM   4641 C C   . LEU B 1 264 ? 21.071 37.959 112.676 1.00 28.87 ? 264 LEU B C   1 
ATOM   4642 O O   . LEU B 1 264 ? 20.206 38.606 112.098 1.00 26.98 ? 264 LEU B O   1 
ATOM   4643 C CB  . LEU B 1 264 ? 22.529 36.874 110.991 1.00 23.05 ? 264 LEU B CB  1 
ATOM   4644 C CG  . LEU B 1 264 ? 23.162 35.640 110.343 1.00 21.15 ? 264 LEU B CG  1 
ATOM   4645 C CD1 . LEU B 1 264 ? 24.080 36.057 109.203 1.00 20.92 ? 264 LEU B CD1 1 
ATOM   4646 C CD2 . LEU B 1 264 ? 23.930 34.869 111.404 1.00 25.93 ? 264 LEU B CD2 1 
ATOM   4647 N N   . ARG B 1 265 ? 21.659 38.364 113.800 1.00 26.17 ? 265 ARG B N   1 
ATOM   4648 C CA  . ARG B 1 265 ? 21.313 39.635 114.427 1.00 23.34 ? 265 ARG B CA  1 
ATOM   4649 C C   . ARG B 1 265 ? 22.477 40.615 114.349 1.00 21.94 ? 265 ARG B C   1 
ATOM   4650 O O   . ARG B 1 265 ? 22.291 41.825 114.480 1.00 20.91 ? 265 ARG B O   1 
ATOM   4651 C CB  . ARG B 1 265 ? 20.922 39.407 115.882 1.00 24.40 ? 265 ARG B CB  1 
ATOM   4652 C CG  . ARG B 1 265 ? 19.699 38.520 116.057 1.00 29.79 ? 265 ARG B CG  1 
ATOM   4653 C CD  . ARG B 1 265 ? 19.531 38.174 117.519 1.00 33.10 ? 265 ARG B CD  1 
ATOM   4654 N NE  . ARG B 1 265 ? 19.664 39.383 118.321 1.00 36.26 ? 265 ARG B NE  1 
ATOM   4655 C CZ  . ARG B 1 265 ? 19.892 39.400 119.626 1.00 33.95 ? 265 ARG B CZ  1 
ATOM   4656 N NH1 . ARG B 1 265 ? 20.020 38.257 120.295 1.00 32.96 ? 265 ARG B NH1 1 
ATOM   4657 N NH2 . ARG B 1 265 ? 19.985 40.565 120.256 1.00 32.27 ? 265 ARG B NH2 1 
ATOM   4658 N N   . HIS B 1 266 ? 23.681 40.101 114.118 1.00 19.81 ? 266 HIS B N   1 
ATOM   4659 C CA  . HIS B 1 266 ? 24.848 40.977 114.029 1.00 21.71 ? 266 HIS B CA  1 
ATOM   4660 C C   . HIS B 1 266 ? 25.462 41.006 112.632 1.00 19.73 ? 266 HIS B C   1 
ATOM   4661 O O   . HIS B 1 266 ? 25.561 42.061 112.005 1.00 21.78 ? 266 HIS B O   1 
ATOM   4662 C CB  . HIS B 1 266 ? 25.910 40.542 115.053 1.00 15.59 ? 266 HIS B CB  1 
ATOM   4663 C CG  . HIS B 1 266 ? 27.135 41.407 115.054 1.00 22.08 ? 266 HIS B CG  1 
ATOM   4664 N ND1 . HIS B 1 266 ? 27.117 42.722 115.465 1.00 18.06 ? 266 HIS B ND1 1 
ATOM   4665 C CD2 . HIS B 1 266 ? 28.417 41.141 114.703 1.00 16.21 ? 266 HIS B CD2 1 
ATOM   4666 C CE1 . HIS B 1 266 ? 28.335 43.227 115.368 1.00 17.98 ? 266 HIS B CE1 1 
ATOM   4667 N NE2 . HIS B 1 266 ? 29.142 42.288 114.909 1.00 20.02 ? 266 HIS B NE2 1 
ATOM   4668 N N   . LEU B 1 267 ? 25.873 39.838 112.144 1.00 20.40 ? 267 LEU B N   1 
ATOM   4669 C CA  . LEU B 1 267 ? 26.502 39.741 110.830 1.00 20.10 ? 267 LEU B CA  1 
ATOM   4670 C C   . LEU B 1 267 ? 25.570 39.938 109.635 1.00 22.48 ? 267 LEU B C   1 
ATOM   4671 O O   . LEU B 1 267 ? 24.365 39.693 109.717 1.00 22.45 ? 267 LEU B O   1 
ATOM   4672 C CB  . LEU B 1 267 ? 27.157 38.368 110.652 1.00 20.74 ? 267 LEU B CB  1 
ATOM   4673 C CG  . LEU B 1 267 ? 28.285 37.967 111.602 1.00 21.49 ? 267 LEU B CG  1 
ATOM   4674 C CD1 . LEU B 1 267 ? 28.753 36.564 111.268 1.00 23.96 ? 267 LEU B CD1 1 
ATOM   4675 C CD2 . LEU B 1 267 ? 29.437 38.955 111.449 1.00 19.76 ? 267 LEU B CD2 1 
ATOM   4676 N N   . THR B 1 268 ? 26.171 40.385 108.538 1.00 23.92 ? 268 THR B N   1 
ATOM   4677 C CA  . THR B 1 268 ? 25.508 40.532 107.246 1.00 23.51 ? 268 THR B CA  1 
ATOM   4678 C C   . THR B 1 268 ? 26.604 39.969 106.354 1.00 22.73 ? 268 THR B C   1 
ATOM   4679 O O   . THR B 1 268 ? 27.739 39.833 106.800 1.00 23.05 ? 268 THR B O   1 
ATOM   4680 C CB  . THR B 1 268 ? 25.253 41.998 106.834 1.00 19.91 ? 268 THR B CB  1 
ATOM   4681 O OG1 . THR B 1 268 ? 26.499 42.672 106.675 1.00 24.73 ? 268 THR B OG1 1 
ATOM   4682 C CG2 . THR B 1 268 ? 24.383 42.716 107.867 1.00 18.49 ? 268 THR B CG2 1 
ATOM   4683 N N   . ALA B 1 269 ? 26.285 39.636 105.111 1.00 23.86 ? 269 ALA B N   1 
ATOM   4684 C CA  . ALA B 1 269 ? 27.298 39.104 104.213 1.00 23.70 ? 269 ALA B CA  1 
ATOM   4685 C C   . ALA B 1 269 ? 28.441 40.112 104.047 1.00 22.39 ? 269 ALA B C   1 
ATOM   4686 O O   . ALA B 1 269 ? 29.608 39.765 104.185 1.00 21.69 ? 269 ALA B O   1 
ATOM   4687 C CB  . ALA B 1 269 ? 26.672 38.758 102.837 1.00 25.22 ? 269 ALA B CB  1 
ATOM   4688 N N   . PRO B 1 270 ? 28.122 41.379 103.746 1.00 22.40 ? 270 PRO B N   1 
ATOM   4689 C CA  . PRO B 1 270 ? 29.241 42.310 103.596 1.00 21.58 ? 270 PRO B CA  1 
ATOM   4690 C C   . PRO B 1 270 ? 30.058 42.594 104.882 1.00 21.55 ? 270 PRO B C   1 
ATOM   4691 O O   . PRO B 1 270 ? 31.266 42.824 104.810 1.00 23.68 ? 270 PRO B O   1 
ATOM   4692 C CB  . PRO B 1 270 ? 28.581 43.556 103.002 1.00 21.67 ? 270 PRO B CB  1 
ATOM   4693 C CG  . PRO B 1 270 ? 27.192 43.474 103.439 1.00 22.07 ? 270 PRO B CG  1 
ATOM   4694 C CD  . PRO B 1 270 ? 26.845 42.017 103.385 1.00 21.26 ? 270 PRO B CD  1 
ATOM   4695 N N   . TYR B 1 271 ? 29.416 42.562 106.046 1.00 22.28 ? 271 TYR B N   1 
ATOM   4696 C CA  . TYR B 1 271 ? 30.149 42.824 107.289 1.00 20.82 ? 271 TYR B CA  1 
ATOM   4697 C C   . TYR B 1 271 ? 31.072 41.648 107.614 1.00 23.45 ? 271 TYR B C   1 
ATOM   4698 O O   . TYR B 1 271 ? 32.208 41.833 108.035 1.00 22.91 ? 271 TYR B O   1 
ATOM   4699 C CB  . TYR B 1 271 ? 29.193 43.064 108.446 1.00 18.35 ? 271 TYR B CB  1 
ATOM   4700 C CG  . TYR B 1 271 ? 29.934 43.486 109.701 1.00 18.72 ? 271 TYR B CG  1 
ATOM   4701 C CD1 . TYR B 1 271 ? 30.207 42.569 110.714 1.00 18.19 ? 271 TYR B CD1 1 
ATOM   4702 C CD2 . TYR B 1 271 ? 30.378 44.805 109.860 1.00 14.66 ? 271 TYR B CD2 1 
ATOM   4703 C CE1 . TYR B 1 271 ? 30.906 42.953 111.871 1.00 17.68 ? 271 TYR B CE1 1 
ATOM   4704 C CE2 . TYR B 1 271 ? 31.082 45.199 111.020 1.00 19.23 ? 271 TYR B CE2 1 
ATOM   4705 C CZ  . TYR B 1 271 ? 31.333 44.262 112.015 1.00 18.46 ? 271 TYR B CZ  1 
ATOM   4706 O OH  . TYR B 1 271 ? 31.983 44.635 113.172 1.00 25.04 ? 271 TYR B OH  1 
ATOM   4707 N N   . LEU B 1 272 ? 30.569 40.435 107.412 1.00 24.26 ? 272 LEU B N   1 
ATOM   4708 C CA  . LEU B 1 272 ? 31.357 39.235 107.634 1.00 21.46 ? 272 LEU B CA  1 
ATOM   4709 C C   . LEU B 1 272 ? 32.621 39.327 106.763 1.00 24.41 ? 272 LEU B C   1 
ATOM   4710 O O   . LEU B 1 272 ? 33.730 39.092 107.239 1.00 23.05 ? 272 LEU B O   1 
ATOM   4711 C CB  . LEU B 1 272 ? 30.511 38.000 107.267 1.00 21.56 ? 272 LEU B CB  1 
ATOM   4712 C CG  . LEU B 1 272 ? 31.123 36.613 107.461 1.00 24.81 ? 272 LEU B CG  1 
ATOM   4713 C CD1 . LEU B 1 272 ? 30.014 35.585 107.450 1.00 26.10 ? 272 LEU B CD1 1 
ATOM   4714 C CD2 . LEU B 1 272 ? 32.155 36.323 106.376 1.00 22.50 ? 272 LEU B CD2 1 
ATOM   4715 N N   . GLU B 1 273 ? 32.460 39.685 105.489 1.00 23.83 ? 273 GLU B N   1 
ATOM   4716 C CA  . GLU B 1 273 ? 33.608 39.818 104.594 1.00 24.83 ? 273 GLU B CA  1 
ATOM   4717 C C   . GLU B 1 273 ? 34.576 40.896 105.097 1.00 23.96 ? 273 GLU B C   1 
ATOM   4718 O O   . GLU B 1 273 ? 35.791 40.708 105.076 1.00 21.94 ? 273 GLU B O   1 
ATOM   4719 C CB  . GLU B 1 273 ? 33.168 40.175 103.154 1.00 26.40 ? 273 GLU B CB  1 
ATOM   4720 C CG  . GLU B 1 273 ? 34.343 40.671 102.266 1.00 34.65 ? 273 GLU B CG  1 
ATOM   4721 C CD  . GLU B 1 273 ? 33.963 40.995 100.812 1.00 40.17 ? 273 GLU B CD  1 
ATOM   4722 O OE1 . GLU B 1 273 ? 33.059 41.840 100.578 1.00 39.60 ? 273 GLU B OE1 1 
ATOM   4723 O OE2 . GLU B 1 273 ? 34.591 40.412 99.898  1.00 36.64 ? 273 GLU B OE2 1 
ATOM   4724 N N   . ALA B 1 274 ? 34.033 42.026 105.543 1.00 21.87 ? 274 ALA B N   1 
ATOM   4725 C CA  . ALA B 1 274 ? 34.863 43.124 106.039 1.00 19.36 ? 274 ALA B CA  1 
ATOM   4726 C C   . ALA B 1 274 ? 35.676 42.780 107.289 1.00 16.66 ? 274 ALA B C   1 
ATOM   4727 O O   . ALA B 1 274 ? 36.691 43.415 107.543 1.00 17.42 ? 274 ALA B O   1 
ATOM   4728 C CB  . ALA B 1 274 ? 33.987 44.378 106.304 1.00 16.04 ? 274 ALA B CB  1 
ATOM   4729 N N   . MET B 1 275 ? 35.250 41.791 108.074 1.00 18.63 ? 275 MET B N   1 
ATOM   4730 C CA  . MET B 1 275 ? 36.023 41.434 109.278 1.00 19.22 ? 275 MET B CA  1 
ATOM   4731 C C   . MET B 1 275 ? 37.425 40.953 108.909 1.00 19.93 ? 275 MET B C   1 
ATOM   4732 O O   . MET B 1 275 ? 38.345 40.978 109.733 1.00 16.28 ? 275 MET B O   1 
ATOM   4733 C CB  . MET B 1 275 ? 35.326 40.324 110.085 1.00 15.93 ? 275 MET B CB  1 
ATOM   4734 C CG  . MET B 1 275 ? 33.971 40.706 110.661 1.00 17.44 ? 275 MET B CG  1 
ATOM   4735 S SD  . MET B 1 275 ? 33.339 39.605 111.952 1.00 20.07 ? 275 MET B SD  1 
ATOM   4736 C CE  . MET B 1 275 ? 33.046 38.011 110.985 1.00 20.19 ? 275 MET B CE  1 
ATOM   4737 N N   . PHE B 1 276 ? 37.580 40.504 107.666 1.00 17.98 ? 276 PHE B N   1 
ATOM   4738 C CA  . PHE B 1 276 ? 38.861 39.985 107.189 1.00 17.37 ? 276 PHE B CA  1 
ATOM   4739 C C   . PHE B 1 276 ? 39.791 41.077 106.678 1.00 19.66 ? 276 PHE B C   1 
ATOM   4740 O O   . PHE B 1 276 ? 40.946 40.805 106.348 1.00 21.94 ? 276 PHE B O   1 
ATOM   4741 C CB  . PHE B 1 276 ? 38.619 38.928 106.104 1.00 18.18 ? 276 PHE B CB  1 
ATOM   4742 C CG  . PHE B 1 276 ? 38.043 37.659 106.641 1.00 12.93 ? 276 PHE B CG  1 
ATOM   4743 C CD1 . PHE B 1 276 ? 38.864 36.555 106.876 1.00 14.96 ? 276 PHE B CD1 1 
ATOM   4744 C CD2 . PHE B 1 276 ? 36.700 37.586 106.982 1.00 19.88 ? 276 PHE B CD2 1 
ATOM   4745 C CE1 . PHE B 1 276 ? 38.349 35.398 107.451 1.00 16.85 ? 276 PHE B CE1 1 
ATOM   4746 C CE2 . PHE B 1 276 ? 36.164 36.429 107.564 1.00 19.76 ? 276 PHE B CE2 1 
ATOM   4747 C CZ  . PHE B 1 276 ? 36.997 35.331 107.799 1.00 19.65 ? 276 PHE B CZ  1 
ATOM   4748 N N   . VAL B 1 277 ? 39.293 42.314 106.623 1.00 19.15 ? 277 VAL B N   1 
ATOM   4749 C CA  . VAL B 1 277 ? 40.129 43.439 106.190 1.00 18.57 ? 277 VAL B CA  1 
ATOM   4750 C C   . VAL B 1 277 ? 40.794 44.000 107.443 1.00 20.59 ? 277 VAL B C   1 
ATOM   4751 O O   . VAL B 1 277 ? 40.121 44.516 108.343 1.00 18.89 ? 277 VAL B O   1 
ATOM   4752 C CB  . VAL B 1 277 ? 39.292 44.530 105.521 1.00 19.39 ? 277 VAL B CB  1 
ATOM   4753 C CG1 . VAL B 1 277 ? 40.212 45.658 105.017 1.00 19.48 ? 277 VAL B CG1 1 
ATOM   4754 C CG2 . VAL B 1 277 ? 38.484 43.916 104.389 1.00 17.37 ? 277 VAL B CG2 1 
ATOM   4755 N N   . LEU B 1 278 ? 42.118 43.893 107.493 1.00 19.05 ? 278 LEU B N   1 
ATOM   4756 C CA  . LEU B 1 278 ? 42.891 44.308 108.656 1.00 20.76 ? 278 LEU B CA  1 
ATOM   4757 C C   . LEU B 1 278 ? 43.692 45.582 108.476 1.00 20.28 ? 278 LEU B C   1 
ATOM   4758 O O   . LEU B 1 278 ? 44.069 45.933 107.357 1.00 21.37 ? 278 LEU B O   1 
ATOM   4759 C CB  . LEU B 1 278 ? 43.846 43.171 109.049 1.00 19.94 ? 278 LEU B CB  1 
ATOM   4760 C CG  . LEU B 1 278 ? 43.321 41.897 109.737 1.00 28.80 ? 278 LEU B CG  1 
ATOM   4761 C CD1 . LEU B 1 278 ? 41.827 41.797 109.663 1.00 25.79 ? 278 LEU B CD1 1 
ATOM   4762 C CD2 . LEU B 1 278 ? 43.980 40.686 109.130 1.00 24.94 ? 278 LEU B CD2 1 
ATOM   4763 N N   . PRO B 1 279 ? 43.975 46.286 109.586 1.00 16.91 ? 279 PRO B N   1 
ATOM   4764 C CA  . PRO B 1 279 ? 44.752 47.528 109.496 1.00 20.25 ? 279 PRO B CA  1 
ATOM   4765 C C   . PRO B 1 279 ? 46.240 47.214 109.352 1.00 19.44 ? 279 PRO B C   1 
ATOM   4766 O O   . PRO B 1 279 ? 46.669 46.092 109.627 1.00 19.01 ? 279 PRO B O   1 
ATOM   4767 C CB  . PRO B 1 279 ? 44.422 48.247 110.807 1.00 18.37 ? 279 PRO B CB  1 
ATOM   4768 C CG  . PRO B 1 279 ? 44.216 47.122 111.768 1.00 18.57 ? 279 PRO B CG  1 
ATOM   4769 C CD  . PRO B 1 279 ? 43.439 46.090 110.947 1.00 18.99 ? 279 PRO B CD  1 
ATOM   4770 N N   . LYS B 1 280 ? 47.017 48.213 108.942 1.00 19.85 ? 280 LYS B N   1 
ATOM   4771 C CA  . LYS B 1 280 ? 48.454 48.051 108.723 1.00 21.49 ? 280 LYS B CA  1 
ATOM   4772 C C   . LYS B 1 280 ? 49.215 47.523 109.925 1.00 21.45 ? 280 LYS B C   1 
ATOM   4773 O O   . LYS B 1 280 ? 50.055 46.627 109.798 1.00 21.65 ? 280 LYS B O   1 
ATOM   4774 C CB  . LYS B 1 280 ? 49.090 49.379 108.299 1.00 21.41 ? 280 LYS B CB  1 
ATOM   4775 C CG  . LYS B 1 280 ? 50.588 49.265 108.055 1.00 27.90 ? 280 LYS B CG  1 
ATOM   4776 C CD  . LYS B 1 280 ? 51.219 50.588 107.671 1.00 33.58 ? 280 LYS B CD  1 
ATOM   4777 C CE  . LYS B 1 280 ? 50.679 51.103 106.357 1.00 39.22 ? 280 LYS B CE  1 
ATOM   4778 N NZ  . LYS B 1 280 ? 51.356 52.370 105.929 1.00 42.94 ? 280 LYS B NZ  1 
ATOM   4779 N N   . ASP B 1 281 ? 48.942 48.089 111.094 1.00 19.71 ? 281 ASP B N   1 
ATOM   4780 C CA  . ASP B 1 281 ? 49.651 47.644 112.283 1.00 21.62 ? 281 ASP B CA  1 
ATOM   4781 C C   . ASP B 1 281 ? 49.372 46.180 112.633 1.00 20.94 ? 281 ASP B C   1 
ATOM   4782 O O   . ASP B 1 281 ? 50.292 45.443 113.009 1.00 24.95 ? 281 ASP B O   1 
ATOM   4783 C CB  . ASP B 1 281 ? 49.359 48.571 113.483 1.00 20.33 ? 281 ASP B CB  1 
ATOM   4784 C CG  . ASP B 1 281 ? 47.873 48.954 113.620 1.00 26.67 ? 281 ASP B CG  1 
ATOM   4785 O OD1 . ASP B 1 281 ? 46.996 48.327 112.986 1.00 23.69 ? 281 ASP B OD1 1 
ATOM   4786 O OD2 . ASP B 1 281 ? 47.583 49.898 114.395 1.00 25.40 ? 281 ASP B OD2 1 
ATOM   4787 N N   . LEU B 1 282 ? 48.125 45.738 112.498 1.00 19.50 ? 282 LEU B N   1 
ATOM   4788 C CA  . LEU B 1 282 ? 47.823 44.348 112.824 1.00 20.13 ? 282 LEU B CA  1 
ATOM   4789 C C   . LEU B 1 282 ? 48.494 43.433 111.808 1.00 21.17 ? 282 LEU B C   1 
ATOM   4790 O O   . LEU B 1 282 ? 49.079 42.407 112.169 1.00 19.80 ? 282 LEU B O   1 
ATOM   4791 C CB  . LEU B 1 282 ? 46.317 44.090 112.842 1.00 18.44 ? 282 LEU B CB  1 
ATOM   4792 C CG  . LEU B 1 282 ? 45.897 42.654 113.192 1.00 21.68 ? 282 LEU B CG  1 
ATOM   4793 C CD1 . LEU B 1 282 ? 46.476 42.242 114.559 1.00 22.62 ? 282 LEU B CD1 1 
ATOM   4794 C CD2 . LEU B 1 282 ? 44.392 42.577 113.229 1.00 26.66 ? 282 LEU B CD2 1 
ATOM   4795 N N   . LEU B 1 283 ? 48.420 43.807 110.537 1.00 22.99 ? 283 LEU B N   1 
ATOM   4796 C CA  . LEU B 1 283 ? 49.057 43.009 109.487 1.00 22.13 ? 283 LEU B CA  1 
ATOM   4797 C C   . LEU B 1 283 ? 50.548 42.839 109.762 1.00 23.44 ? 283 LEU B C   1 
ATOM   4798 O O   . LEU B 1 283 ? 51.085 41.746 109.631 1.00 25.97 ? 283 LEU B O   1 
ATOM   4799 C CB  . LEU B 1 283 ? 48.851 43.671 108.122 1.00 22.66 ? 283 LEU B CB  1 
ATOM   4800 C CG  . LEU B 1 283 ? 47.411 43.528 107.623 1.00 22.75 ? 283 LEU B CG  1 
ATOM   4801 C CD1 . LEU B 1 283 ? 47.187 44.384 106.395 1.00 24.05 ? 283 LEU B CD1 1 
ATOM   4802 C CD2 . LEU B 1 283 ? 47.124 42.061 107.330 1.00 23.96 ? 283 LEU B CD2 1 
ATOM   4803 N N   . GLU B 1 284 ? 51.216 43.924 110.150 1.00 23.86 ? 284 GLU B N   1 
ATOM   4804 C CA  . GLU B 1 284 ? 52.635 43.850 110.441 1.00 24.42 ? 284 GLU B CA  1 
ATOM   4805 C C   . GLU B 1 284 ? 52.888 42.956 111.652 1.00 26.24 ? 284 GLU B C   1 
ATOM   4806 O O   . GLU B 1 284 ? 53.799 42.130 111.633 1.00 24.21 ? 284 GLU B O   1 
ATOM   4807 C CB  . GLU B 1 284 ? 53.209 45.258 110.656 1.00 31.37 ? 284 GLU B CB  1 
ATOM   4808 C CG  . GLU B 1 284 ? 53.295 46.056 109.347 1.00 37.15 ? 284 GLU B CG  1 
ATOM   4809 C CD  . GLU B 1 284 ? 53.869 47.460 109.506 1.00 43.42 ? 284 GLU B CD  1 
ATOM   4810 O OE1 . GLU B 1 284 ? 54.101 48.125 108.472 1.00 46.44 ? 284 GLU B OE1 1 
ATOM   4811 O OE2 . GLU B 1 284 ? 54.082 47.905 110.653 1.00 46.97 ? 284 GLU B OE2 1 
ATOM   4812 N N   . ALA B 1 285 ? 52.072 43.092 112.696 1.00 24.57 ? 285 ALA B N   1 
ATOM   4813 C CA  . ALA B 1 285 ? 52.244 42.255 113.879 1.00 24.23 ? 285 ALA B CA  1 
ATOM   4814 C C   . ALA B 1 285 ? 52.088 40.778 113.496 1.00 23.64 ? 285 ALA B C   1 
ATOM   4815 O O   . ALA B 1 285 ? 52.878 39.937 113.915 1.00 25.11 ? 285 ALA B O   1 
ATOM   4816 C CB  . ALA B 1 285 ? 51.228 42.640 114.964 1.00 21.32 ? 285 ALA B CB  1 
ATOM   4817 N N   . LEU B 1 286 ? 51.082 40.463 112.688 1.00 22.93 ? 286 LEU B N   1 
ATOM   4818 C CA  . LEU B 1 286 ? 50.885 39.087 112.256 1.00 24.37 ? 286 LEU B CA  1 
ATOM   4819 C C   . LEU B 1 286 ? 52.102 38.590 111.459 1.00 28.52 ? 286 LEU B C   1 
ATOM   4820 O O   . LEU B 1 286 ? 52.618 37.503 111.714 1.00 25.04 ? 286 LEU B O   1 
ATOM   4821 C CB  . LEU B 1 286 ? 49.628 38.965 111.380 1.00 26.17 ? 286 LEU B CB  1 
ATOM   4822 C CG  . LEU B 1 286 ? 48.259 39.111 112.056 1.00 27.17 ? 286 LEU B CG  1 
ATOM   4823 C CD1 . LEU B 1 286 ? 47.158 39.151 111.006 1.00 27.76 ? 286 LEU B CD1 1 
ATOM   4824 C CD2 . LEU B 1 286 ? 48.038 37.959 113.015 1.00 26.06 ? 286 LEU B CD2 1 
ATOM   4825 N N   . GLU B 1 287 ? 52.541 39.404 110.498 1.00 28.11 ? 287 GLU B N   1 
ATOM   4826 C CA  . GLU B 1 287 ? 53.670 39.086 109.623 1.00 34.16 ? 287 GLU B CA  1 
ATOM   4827 C C   . GLU B 1 287 ? 55.004 38.852 110.329 1.00 34.93 ? 287 GLU B C   1 
ATOM   4828 O O   . GLU B 1 287 ? 55.747 37.934 109.975 1.00 31.05 ? 287 GLU B O   1 
ATOM   4829 C CB  . GLU B 1 287 ? 53.888 40.212 108.591 1.00 39.45 ? 287 GLU B CB  1 
ATOM   4830 C CG  . GLU B 1 287 ? 52.760 40.444 107.581 1.00 51.26 ? 287 GLU B CG  1 
ATOM   4831 C CD  . GLU B 1 287 ? 53.016 41.664 106.678 1.00 57.48 ? 287 GLU B CD  1 
ATOM   4832 O OE1 . GLU B 1 287 ? 54.092 41.720 106.039 1.00 59.01 ? 287 GLU B OE1 1 
ATOM   4833 O OE2 . GLU B 1 287 ? 52.145 42.566 106.608 1.00 57.97 ? 287 GLU B OE2 1 
ATOM   4834 N N   . LYS B 1 288 ? 55.324 39.687 111.310 1.00 34.20 ? 288 LYS B N   1 
ATOM   4835 C CA  . LYS B 1 288 ? 56.606 39.553 111.983 1.00 34.41 ? 288 LYS B CA  1 
ATOM   4836 C C   . LYS B 1 288 ? 56.690 38.518 113.093 1.00 34.08 ? 288 LYS B C   1 
ATOM   4837 O O   . LYS B 1 288 ? 57.789 38.158 113.514 1.00 32.58 ? 288 LYS B O   1 
ATOM   4838 C CB  . LYS B 1 288 ? 57.062 40.906 112.529 1.00 38.94 ? 288 LYS B CB  1 
ATOM   4839 C CG  . LYS B 1 288 ? 56.454 41.298 113.862 1.00 42.18 ? 288 LYS B CG  1 
ATOM   4840 C CD  . LYS B 1 288 ? 57.472 42.057 114.725 1.00 49.69 ? 288 LYS B CD  1 
ATOM   4841 C CE  . LYS B 1 288 ? 58.081 43.253 113.983 1.00 54.87 ? 288 LYS B CE  1 
ATOM   4842 N NZ  . LYS B 1 288 ? 59.168 43.933 114.757 1.00 56.89 ? 288 LYS B NZ  1 
ATOM   4843 N N   . GLU B 1 289 ? 55.544 38.033 113.564 1.00 32.91 ? 289 GLU B N   1 
ATOM   4844 C CA  . GLU B 1 289 ? 55.529 37.055 114.653 1.00 29.76 ? 289 GLU B CA  1 
ATOM   4845 C C   . GLU B 1 289 ? 56.292 35.770 114.315 1.00 29.23 ? 289 GLU B C   1 
ATOM   4846 O O   . GLU B 1 289 ? 56.098 35.183 113.247 1.00 26.50 ? 289 GLU B O   1 
ATOM   4847 C CB  . GLU B 1 289 ? 54.087 36.713 115.030 1.00 28.59 ? 289 GLU B CB  1 
ATOM   4848 C CG  . GLU B 1 289 ? 53.967 35.882 116.301 1.00 28.64 ? 289 GLU B CG  1 
ATOM   4849 C CD  . GLU B 1 289 ? 54.730 36.490 117.454 1.00 28.83 ? 289 GLU B CD  1 
ATOM   4850 O OE1 . GLU B 1 289 ? 55.695 35.863 117.929 1.00 30.57 ? 289 GLU B OE1 1 
ATOM   4851 O OE2 . GLU B 1 289 ? 54.369 37.600 117.888 1.00 28.23 ? 289 GLU B OE2 1 
ATOM   4852 N N   . THR B 1 290 ? 57.158 35.338 115.228 1.00 27.42 ? 290 THR B N   1 
ATOM   4853 C CA  . THR B 1 290 ? 57.936 34.117 115.010 1.00 28.72 ? 290 THR B CA  1 
ATOM   4854 C C   . THR B 1 290 ? 57.621 32.987 115.989 1.00 29.53 ? 290 THR B C   1 
ATOM   4855 O O   . THR B 1 290 ? 58.015 31.844 115.754 1.00 32.59 ? 290 THR B O   1 
ATOM   4856 C CB  . THR B 1 290 ? 59.457 34.375 115.107 1.00 27.49 ? 290 THR B CB  1 
ATOM   4857 O OG1 . THR B 1 290 ? 59.772 34.881 116.407 1.00 26.33 ? 290 THR B OG1 1 
ATOM   4858 C CG2 . THR B 1 290 ? 59.908 35.353 114.045 1.00 29.09 ? 290 THR B CG2 1 
ATOM   4859 N N   . MET B 1 291 ? 56.916 33.284 117.081 1.00 26.39 ? 291 MET B N   1 
ATOM   4860 C CA  . MET B 1 291 ? 56.616 32.240 118.061 1.00 25.16 ? 291 MET B CA  1 
ATOM   4861 C C   . MET B 1 291 ? 55.639 31.166 117.575 1.00 26.12 ? 291 MET B C   1 
ATOM   4862 O O   . MET B 1 291 ? 54.536 31.463 117.118 1.00 27.89 ? 291 MET B O   1 
ATOM   4863 C CB  . MET B 1 291 ? 56.102 32.863 119.366 1.00 27.27 ? 291 MET B CB  1 
ATOM   4864 C CG  . MET B 1 291 ? 55.770 31.836 120.440 1.00 30.17 ? 291 MET B CG  1 
ATOM   4865 S SD  . MET B 1 291 ? 55.393 32.522 122.075 1.00 33.17 ? 291 MET B SD  1 
ATOM   4866 C CE  . MET B 1 291 ? 57.048 33.103 122.565 1.00 28.44 ? 291 MET B CE  1 
ATOM   4867 N N   . VAL B 1 292 ? 56.072 29.910 117.665 1.00 27.73 ? 292 VAL B N   1 
ATOM   4868 C CA  . VAL B 1 292 ? 55.258 28.766 117.272 1.00 26.53 ? 292 VAL B CA  1 
ATOM   4869 C C   . VAL B 1 292 ? 55.138 27.857 118.497 1.00 28.59 ? 292 VAL B C   1 
ATOM   4870 O O   . VAL B 1 292 ? 56.140 27.297 118.963 1.00 28.76 ? 292 VAL B O   1 
ATOM   4871 C CB  . VAL B 1 292 ? 55.911 27.948 116.111 1.00 27.66 ? 292 VAL B CB  1 
ATOM   4872 C CG1 . VAL B 1 292 ? 55.078 26.719 115.818 1.00 25.57 ? 292 VAL B CG1 1 
ATOM   4873 C CG2 . VAL B 1 292 ? 56.004 28.797 114.838 1.00 26.77 ? 292 VAL B CG2 1 
ATOM   4874 N N   . SER B 1 293 ? 53.925 27.718 119.022 1.00 23.25 ? 293 SER B N   1 
ATOM   4875 C CA  . SER B 1 293 ? 53.696 26.871 120.185 1.00 22.85 ? 293 SER B CA  1 
ATOM   4876 C C   . SER B 1 293 ? 53.770 25.410 119.763 1.00 26.30 ? 293 SER B C   1 
ATOM   4877 O O   . SER B 1 293 ? 53.139 25.007 118.783 1.00 25.06 ? 293 SER B O   1 
ATOM   4878 C CB  . SER B 1 293 ? 52.318 27.136 120.789 1.00 23.54 ? 293 SER B CB  1 
ATOM   4879 O OG  . SER B 1 293 ? 52.121 26.342 121.951 1.00 24.50 ? 293 SER B OG  1 
ATOM   4880 N N   . THR B 1 294 ? 54.530 24.622 120.522 1.00 26.53 ? 294 THR B N   1 
ATOM   4881 C CA  . THR B 1 294 ? 54.697 23.200 120.242 1.00 28.17 ? 294 THR B CA  1 
ATOM   4882 C C   . THR B 1 294 ? 54.614 22.410 121.541 1.00 28.05 ? 294 THR B C   1 
ATOM   4883 O O   . THR B 1 294 ? 54.794 22.966 122.626 1.00 23.41 ? 294 THR B O   1 
ATOM   4884 C CB  . THR B 1 294 ? 56.075 22.914 119.610 1.00 26.12 ? 294 THR B CB  1 
ATOM   4885 O OG1 . THR B 1 294 ? 57.105 23.234 120.554 1.00 25.40 ? 294 THR B OG1 1 
ATOM   4886 C CG2 . THR B 1 294 ? 56.273 23.756 118.351 1.00 22.35 ? 294 THR B CG2 1 
ATOM   4887 N N   . ASP B 1 295 ? 54.341 21.117 121.428 1.00 27.96 ? 295 ASP B N   1 
ATOM   4888 C CA  . ASP B 1 295 ? 54.268 20.260 122.609 1.00 31.68 ? 295 ASP B CA  1 
ATOM   4889 C C   . ASP B 1 295 ? 55.586 20.327 123.366 1.00 30.49 ? 295 ASP B C   1 
ATOM   4890 O O   . ASP B 1 295 ? 55.612 20.263 124.591 1.00 30.80 ? 295 ASP B O   1 
ATOM   4891 C CB  . ASP B 1 295 ? 53.992 18.810 122.207 1.00 33.95 ? 295 ASP B CB  1 
ATOM   4892 C CG  . ASP B 1 295 ? 52.577 18.597 121.741 1.00 35.66 ? 295 ASP B CG  1 
ATOM   4893 O OD1 . ASP B 1 295 ? 52.272 17.469 121.283 1.00 35.63 ? 295 ASP B OD1 1 
ATOM   4894 O OD2 . ASP B 1 295 ? 51.767 19.552 121.824 1.00 30.32 ? 295 ASP B OD2 1 
ATOM   4895 N N   . GLN B 1 296 ? 56.682 20.463 122.633 1.00 34.11 ? 296 GLN B N   1 
ATOM   4896 C CA  . GLN B 1 296 ? 57.991 20.552 123.263 1.00 38.07 ? 296 GLN B CA  1 
ATOM   4897 C C   . GLN B 1 296 ? 58.119 21.858 124.059 1.00 36.93 ? 296 GLN B C   1 
ATOM   4898 O O   . GLN B 1 296 ? 58.625 21.864 125.187 1.00 38.19 ? 296 GLN B O   1 
ATOM   4899 C CB  . GLN B 1 296 ? 59.089 20.485 122.204 1.00 41.84 ? 296 GLN B CB  1 
ATOM   4900 C CG  . GLN B 1 296 ? 60.493 20.519 122.780 1.00 47.31 ? 296 GLN B CG  1 
ATOM   4901 C CD  . GLN B 1 296 ? 61.064 19.136 123.048 1.00 51.07 ? 296 GLN B CD  1 
ATOM   4902 O OE1 . GLN B 1 296 ? 60.325 18.164 123.258 1.00 51.38 ? 296 GLN B OE1 1 
ATOM   4903 N NE2 . GLN B 1 296 ? 62.390 19.044 123.060 1.00 47.10 ? 296 GLN B NE2 1 
ATOM   4904 N N   . ASN B 1 297 ? 57.660 22.959 123.466 1.00 33.45 ? 297 ASN B N   1 
ATOM   4905 C CA  . ASN B 1 297 ? 57.717 24.279 124.102 1.00 29.70 ? 297 ASN B CA  1 
ATOM   4906 C C   . ASN B 1 297 ? 56.366 24.968 123.924 1.00 28.44 ? 297 ASN B C   1 
ATOM   4907 O O   . ASN B 1 297 ? 56.237 25.897 123.127 1.00 26.37 ? 297 ASN B O   1 
ATOM   4908 C CB  . ASN B 1 297 ? 58.796 25.136 123.440 1.00 32.98 ? 297 ASN B CB  1 
ATOM   4909 C CG  . ASN B 1 297 ? 60.178 24.535 123.566 1.00 33.92 ? 297 ASN B CG  1 
ATOM   4910 O OD1 . ASN B 1 297 ? 60.848 24.700 124.587 1.00 35.91 ? 297 ASN B OD1 1 
ATOM   4911 N ND2 . ASN B 1 297 ? 60.609 23.817 122.531 1.00 32.07 ? 297 ASN B ND2 1 
ATOM   4912 N N   . PRO B 1 298 ? 55.340 24.517 124.657 1.00 28.12 ? 298 PRO B N   1 
ATOM   4913 C CA  . PRO B 1 298 ? 54.024 25.143 124.513 1.00 29.90 ? 298 PRO B CA  1 
ATOM   4914 C C   . PRO B 1 298 ? 53.990 26.579 125.019 1.00 30.28 ? 298 PRO B C   1 
ATOM   4915 O O   . PRO B 1 298 ? 54.623 26.914 126.023 1.00 28.69 ? 298 PRO B O   1 
ATOM   4916 C CB  . PRO B 1 298 ? 53.110 24.208 125.308 1.00 31.25 ? 298 PRO B CB  1 
ATOM   4917 C CG  . PRO B 1 298 ? 54.015 23.673 126.362 1.00 32.77 ? 298 PRO B CG  1 
ATOM   4918 C CD  . PRO B 1 298 ? 55.292 23.398 125.615 1.00 29.18 ? 298 PRO B CD  1 
ATOM   4919 N N   . PHE B 1 299 ? 53.274 27.438 124.303 1.00 31.03 ? 299 PHE B N   1 
ATOM   4920 C CA  . PHE B 1 299 ? 53.173 28.825 124.734 1.00 31.09 ? 299 PHE B CA  1 
ATOM   4921 C C   . PHE B 1 299 ? 52.099 28.931 125.814 1.00 32.17 ? 299 PHE B C   1 
ATOM   4922 O O   . PHE B 1 299 ? 51.197 28.083 125.907 1.00 28.61 ? 299 PHE B O   1 
ATOM   4923 C CB  . PHE B 1 299 ? 52.850 29.727 123.530 1.00 31.29 ? 299 PHE B CB  1 
ATOM   4924 C CG  . PHE B 1 299 ? 51.445 30.291 123.525 1.00 31.88 ? 299 PHE B CG  1 
ATOM   4925 C CD1 . PHE B 1 299 ? 51.180 31.542 124.085 1.00 34.46 ? 299 PHE B CD1 1 
ATOM   4926 C CD2 . PHE B 1 299 ? 50.398 29.582 122.940 1.00 33.95 ? 299 PHE B CD2 1 
ATOM   4927 C CE1 . PHE B 1 299 ? 49.885 32.083 124.059 1.00 37.20 ? 299 PHE B CE1 1 
ATOM   4928 C CE2 . PHE B 1 299 ? 49.098 30.108 122.907 1.00 31.76 ? 299 PHE B CE2 1 
ATOM   4929 C CZ  . PHE B 1 299 ? 48.841 31.365 123.467 1.00 33.57 ? 299 PHE B CZ  1 
ATOM   4930 N N   . TYR B 1 300 ? 52.239 29.943 126.663 1.00 31.66 ? 300 TYR B N   1 
ATOM   4931 C CA  . TYR B 1 300 ? 51.261 30.207 127.711 1.00 32.98 ? 300 TYR B CA  1 
ATOM   4932 C C   . TYR B 1 300 ? 51.233 31.710 127.965 1.00 31.63 ? 300 TYR B C   1 
ATOM   4933 O O   . TYR B 1 300 ? 52.096 32.456 127.485 1.00 30.13 ? 300 TYR B O   1 
ATOM   4934 C CB  . TYR B 1 300 ? 51.581 29.445 129.010 1.00 33.26 ? 300 TYR B CB  1 
ATOM   4935 C CG  . TYR B 1 300 ? 52.867 29.857 129.681 1.00 39.48 ? 300 TYR B CG  1 
ATOM   4936 C CD1 . TYR B 1 300 ? 54.092 29.337 129.260 1.00 38.49 ? 300 TYR B CD1 1 
ATOM   4937 C CD2 . TYR B 1 300 ? 52.866 30.800 130.712 1.00 36.72 ? 300 TYR B CD2 1 
ATOM   4938 C CE1 . TYR B 1 300 ? 55.287 29.745 129.847 1.00 41.94 ? 300 TYR B CE1 1 
ATOM   4939 C CE2 . TYR B 1 300 ? 54.059 31.219 131.306 1.00 40.74 ? 300 TYR B CE2 1 
ATOM   4940 C CZ  . TYR B 1 300 ? 55.264 30.686 130.866 1.00 41.24 ? 300 TYR B CZ  1 
ATOM   4941 O OH  . TYR B 1 300 ? 56.445 31.091 131.438 1.00 46.81 ? 300 TYR B OH  1 
ATOM   4942 N N   . VAL B 1 301 ? 50.228 32.159 128.702 1.00 31.61 ? 301 VAL B N   1 
ATOM   4943 C CA  . VAL B 1 301 ? 50.106 33.577 128.992 1.00 30.03 ? 301 VAL B CA  1 
ATOM   4944 C C   . VAL B 1 301 ? 50.621 33.872 130.396 1.00 30.29 ? 301 VAL B C   1 
ATOM   4945 O O   . VAL B 1 301 ? 50.128 33.313 131.382 1.00 28.63 ? 301 VAL B O   1 
ATOM   4946 C CB  . VAL B 1 301 ? 48.632 34.029 128.839 1.00 30.60 ? 301 VAL B CB  1 
ATOM   4947 C CG1 . VAL B 1 301 ? 48.495 35.528 129.148 1.00 30.95 ? 301 VAL B CG1 1 
ATOM   4948 C CG2 . VAL B 1 301 ? 48.156 33.741 127.401 1.00 29.00 ? 301 VAL B CG2 1 
ATOM   4949 N N   . THR B 1 302 ? 51.622 34.743 130.476 1.00 29.86 ? 302 THR B N   1 
ATOM   4950 C CA  . THR B 1 302 ? 52.225 35.117 131.764 1.00 34.08 ? 302 THR B CA  1 
ATOM   4951 C C   . THR B 1 302 ? 51.323 36.058 132.561 1.00 37.33 ? 302 THR B C   1 
ATOM   4952 O O   . THR B 1 302 ? 50.404 36.676 132.014 1.00 34.93 ? 302 THR B O   1 
ATOM   4953 C CB  . THR B 1 302 ? 53.550 35.864 131.567 1.00 34.45 ? 302 THR B CB  1 
ATOM   4954 O OG1 . THR B 1 302 ? 53.269 37.194 131.107 1.00 34.36 ? 302 THR B OG1 1 
ATOM   4955 C CG2 . THR B 1 302 ? 54.432 35.146 130.536 1.00 31.77 ? 302 THR B CG2 1 
ATOM   4956 N N   . PRO B 1 303 ? 51.587 36.193 133.870 1.00 41.71 ? 303 PRO B N   1 
ATOM   4957 C CA  . PRO B 1 303 ? 50.756 37.091 134.674 1.00 42.04 ? 303 PRO B CA  1 
ATOM   4958 C C   . PRO B 1 303 ? 50.766 38.525 134.129 1.00 44.80 ? 303 PRO B C   1 
ATOM   4959 O O   . PRO B 1 303 ? 49.932 39.342 134.523 1.00 45.57 ? 303 PRO B O   1 
ATOM   4960 C CB  . PRO B 1 303 ? 51.353 36.960 136.082 1.00 44.06 ? 303 PRO B CB  1 
ATOM   4961 C CG  . PRO B 1 303 ? 52.753 36.448 135.842 1.00 44.18 ? 303 PRO B CG  1 
ATOM   4962 C CD  . PRO B 1 303 ? 52.574 35.490 134.708 1.00 42.44 ? 303 PRO B CD  1 
ATOM   4963 N N   . GLU B 1 304 ? 51.703 38.826 133.226 1.00 43.29 ? 304 GLU B N   1 
ATOM   4964 C CA  . GLU B 1 304 ? 51.765 40.153 132.609 1.00 45.33 ? 304 GLU B CA  1 
ATOM   4965 C C   . GLU B 1 304 ? 50.997 40.135 131.291 1.00 46.61 ? 304 GLU B C   1 
ATOM   4966 O O   . GLU B 1 304 ? 51.099 41.059 130.481 1.00 46.94 ? 304 GLU B O   1 
ATOM   4967 C CB  . GLU B 1 304 ? 53.211 40.593 132.353 1.00 46.85 ? 304 GLU B CB  1 
ATOM   4968 C CG  . GLU B 1 304 ? 53.976 40.914 133.621 1.00 49.33 ? 304 GLU B CG  1 
ATOM   4969 C CD  . GLU B 1 304 ? 54.229 39.682 134.471 1.00 50.80 ? 304 GLU B CD  1 
ATOM   4970 O OE1 . GLU B 1 304 ? 54.309 39.816 135.708 1.00 52.51 ? 304 GLU B OE1 1 
ATOM   4971 O OE2 . GLU B 1 304 ? 54.360 38.577 133.898 1.00 54.56 ? 304 GLU B OE2 1 
ATOM   4972 N N   . GLY B 1 305 ? 50.222 39.075 131.087 1.00 47.60 ? 305 GLY B N   1 
ATOM   4973 C CA  . GLY B 1 305 ? 49.431 38.957 129.875 1.00 47.77 ? 305 GLY B CA  1 
ATOM   4974 C C   . GLY B 1 305 ? 50.255 38.806 128.613 1.00 47.66 ? 305 GLY B C   1 
ATOM   4975 O O   . GLY B 1 305 ? 49.782 39.116 127.524 1.00 49.93 ? 305 GLY B O   1 
ATOM   4976 N N   . GLU B 1 306 ? 51.489 38.335 128.749 1.00 46.31 ? 306 GLU B N   1 
ATOM   4977 C CA  . GLU B 1 306 ? 52.359 38.140 127.594 1.00 45.65 ? 306 GLU B CA  1 
ATOM   4978 C C   . GLU B 1 306 ? 52.447 36.673 127.178 1.00 43.47 ? 306 GLU B C   1 
ATOM   4979 O O   . GLU B 1 306 ? 52.274 35.762 128.000 1.00 40.04 ? 306 GLU B O   1 
ATOM   4980 C CB  . GLU B 1 306 ? 53.759 38.676 127.889 1.00 46.86 ? 306 GLU B CB  1 
ATOM   4981 C CG  . GLU B 1 306 ? 53.937 40.137 127.527 1.00 53.31 ? 306 GLU B CG  1 
ATOM   4982 C CD  . GLU B 1 306 ? 55.164 40.756 128.169 1.00 56.11 ? 306 GLU B CD  1 
ATOM   4983 O OE1 . GLU B 1 306 ? 55.524 41.886 127.776 1.00 59.48 ? 306 GLU B OE1 1 
ATOM   4984 O OE2 . GLU B 1 306 ? 55.758 40.124 129.072 1.00 56.11 ? 306 GLU B OE2 1 
ATOM   4985 N N   . ALA B 1 307 ? 52.698 36.456 125.890 1.00 41.61 ? 307 ALA B N   1 
ATOM   4986 C CA  . ALA B 1 307 ? 52.829 35.110 125.353 1.00 39.44 ? 307 ALA B CA  1 
ATOM   4987 C C   . ALA B 1 307 ? 54.273 34.682 125.570 1.00 38.82 ? 307 ALA B C   1 
ATOM   4988 O O   . ALA B 1 307 ? 55.211 35.337 125.108 1.00 34.25 ? 307 ALA B O   1 
ATOM   4989 C CB  . ALA B 1 307 ? 52.491 35.097 123.873 1.00 38.71 ? 307 ALA B CB  1 
ATOM   4990 N N   . ARG B 1 308 ? 54.452 33.592 126.298 1.00 39.68 ? 308 ARG B N   1 
ATOM   4991 C CA  . ARG B 1 308 ? 55.794 33.101 126.563 1.00 39.45 ? 308 ARG B CA  1 
ATOM   4992 C C   . ARG B 1 308 ? 55.830 31.604 126.315 1.00 38.87 ? 308 ARG B C   1 
ATOM   4993 O O   . ARG B 1 308 ? 54.795 30.940 126.370 1.00 35.65 ? 308 ARG B O   1 
ATOM   4994 C CB  . ARG B 1 308 ? 56.190 33.401 128.013 1.00 44.43 ? 308 ARG B CB  1 
ATOM   4995 C CG  . ARG B 1 308 ? 57.685 33.276 128.283 1.00 49.22 ? 308 ARG B CG  1 
ATOM   4996 C CD  . ARG B 1 308 ? 58.052 33.711 129.699 1.00 54.43 ? 308 ARG B CD  1 
ATOM   4997 N NE  . ARG B 1 308 ? 59.487 33.971 129.832 1.00 61.24 ? 308 ARG B NE  1 
ATOM   4998 C CZ  . ARG B 1 308 ? 60.129 34.969 129.226 1.00 63.08 ? 308 ARG B CZ  1 
ATOM   4999 N NH1 . ARG B 1 308 ? 59.466 35.811 128.442 1.00 65.47 ? 308 ARG B NH1 1 
ATOM   5000 N NH2 . ARG B 1 308 ? 61.438 35.123 129.395 1.00 64.82 ? 308 ARG B NH2 1 
ATOM   5001 N N   . GLN B 1 309 ? 57.025 31.092 126.031 1.00 37.44 ? 309 GLN B N   1 
ATOM   5002 C CA  . GLN B 1 309 ? 57.244 29.670 125.785 1.00 39.28 ? 309 GLN B CA  1 
ATOM   5003 C C   . GLN B 1 309 ? 58.179 29.095 126.840 1.00 37.82 ? 309 GLN B C   1 
ATOM   5004 O O   . GLN B 1 309 ? 59.033 29.805 127.373 1.00 38.98 ? 309 GLN B O   1 
ATOM   5005 C CB  . GLN B 1 309 ? 57.905 29.444 124.424 1.00 39.58 ? 309 GLN B CB  1 
ATOM   5006 C CG  . GLN B 1 309 ? 56.980 29.481 123.242 1.00 42.18 ? 309 GLN B CG  1 
ATOM   5007 C CD  . GLN B 1 309 ? 57.688 29.061 121.962 1.00 38.24 ? 309 GLN B CD  1 
ATOM   5008 O OE1 . GLN B 1 309 ? 58.588 29.752 121.475 1.00 34.15 ? 309 GLN B OE1 1 
ATOM   5009 N NE2 . GLN B 1 309 ? 57.284 27.921 121.418 1.00 32.12 ? 309 GLN B NE2 1 
ATOM   5010 N N   . ALA B 1 310 ? 58.018 27.807 127.125 1.00 35.69 ? 310 ALA B N   1 
ATOM   5011 C CA  . ALA B 1 310 ? 58.872 27.110 128.083 1.00 36.86 ? 310 ALA B CA  1 
ATOM   5012 C C   . ALA B 1 310 ? 58.680 25.609 127.901 1.00 38.68 ? 310 ALA B C   1 
ATOM   5013 O O   . ALA B 1 310 ? 57.582 25.154 127.570 1.00 35.86 ? 310 ALA B O   1 
ATOM   5014 C CB  . ALA B 1 310 ? 58.524 27.514 129.506 1.00 37.35 ? 310 ALA B CB  1 
ATOM   5015 N N   . PRO B 1 311 ? 59.754 24.821 128.092 1.00 40.54 ? 311 PRO B N   1 
ATOM   5016 C CA  . PRO B 1 311 ? 59.645 23.370 127.938 1.00 44.83 ? 311 PRO B CA  1 
ATOM   5017 C C   . PRO B 1 311 ? 58.622 22.759 128.881 1.00 48.51 ? 311 PRO B C   1 
ATOM   5018 O O   . PRO B 1 311 ? 58.602 23.050 130.081 1.00 47.47 ? 311 PRO B O   1 
ATOM   5019 C CB  . PRO B 1 311 ? 61.076 22.877 128.193 1.00 43.33 ? 311 PRO B CB  1 
ATOM   5020 C CG  . PRO B 1 311 ? 61.702 23.975 128.991 1.00 45.43 ? 311 PRO B CG  1 
ATOM   5021 C CD  . PRO B 1 311 ? 61.150 25.214 128.343 1.00 41.11 ? 311 PRO B CD  1 
ATOM   5022 N N   . TYR B 1 312 ? 57.765 21.916 128.320 1.00 53.17 ? 312 TYR B N   1 
ATOM   5023 C CA  . TYR B 1 312 ? 56.720 21.264 129.088 1.00 59.96 ? 312 TYR B CA  1 
ATOM   5024 C C   . TYR B 1 312 ? 57.304 20.266 130.076 1.00 63.40 ? 312 TYR B C   1 
ATOM   5025 O O   . TYR B 1 312 ? 58.369 19.691 129.839 1.00 62.93 ? 312 TYR B O   1 
ATOM   5026 C CB  . TYR B 1 312 ? 55.750 20.537 128.153 1.00 62.47 ? 312 TYR B CB  1 
ATOM   5027 C CG  . TYR B 1 312 ? 54.462 20.116 128.824 1.00 64.66 ? 312 TYR B CG  1 
ATOM   5028 C CD1 . TYR B 1 312 ? 54.022 18.792 128.770 1.00 66.09 ? 312 TYR B CD1 1 
ATOM   5029 C CD2 . TYR B 1 312 ? 53.679 21.045 129.512 1.00 65.57 ? 312 TYR B CD2 1 
ATOM   5030 C CE1 . TYR B 1 312 ? 52.832 18.403 129.387 1.00 66.62 ? 312 TYR B CE1 1 
ATOM   5031 C CE2 . TYR B 1 312 ? 52.491 20.669 130.129 1.00 67.60 ? 312 TYR B CE2 1 
ATOM   5032 C CZ  . TYR B 1 312 ? 52.074 19.348 130.064 1.00 68.28 ? 312 TYR B CZ  1 
ATOM   5033 O OH  . TYR B 1 312 ? 50.897 18.980 130.680 1.00 70.48 ? 312 TYR B OH  1 
ATOM   5034 N N   . LYS B 1 313 ? 56.598 20.081 131.188 1.00 67.40 ? 313 LYS B N   1 
ATOM   5035 C CA  . LYS B 1 313 ? 56.995 19.140 132.229 1.00 71.83 ? 313 LYS B CA  1 
ATOM   5036 C C   . LYS B 1 313 ? 58.490 19.185 132.544 1.00 74.12 ? 313 LYS B C   1 
ATOM   5037 O O   . LYS B 1 313 ? 59.149 20.178 132.165 1.00 75.41 ? 313 LYS B O   1 
ATOM   5038 C CB  . LYS B 1 313 ? 56.584 17.721 131.818 1.00 72.23 ? 313 LYS B CB  1 
ATOM   5039 C CG  . LYS B 1 313 ? 56.491 16.735 132.971 1.00 73.53 ? 313 LYS B CG  1 
ATOM   5040 C CD  . LYS B 1 313 ? 55.608 17.273 134.095 1.00 75.26 ? 313 LYS B CD  1 
ATOM   5041 C CE  . LYS B 1 313 ? 54.248 17.736 133.579 1.00 75.95 ? 313 LYS B CE  1 
ATOM   5042 N NZ  . LYS B 1 313 ? 53.503 16.647 132.890 1.00 76.47 ? 313 LYS B NZ  1 
HETATM 5043 O O   . HOH C 2 .   ? 44.619 65.988 119.126 1.00 27.00 ? 315 HOH A O   1 
HETATM 5044 O O   . HOH C 2 .   ? 43.310 59.972 121.090 1.00 23.58 ? 316 HOH A O   1 
HETATM 5045 O O   . HOH C 2 .   ? 40.908 49.373 115.438 1.00 22.87 ? 317 HOH A O   1 
HETATM 5046 O O   . HOH C 2 .   ? 29.454 68.027 117.292 1.00 24.59 ? 318 HOH A O   1 
HETATM 5047 O O   . HOH C 2 .   ? 26.282 45.428 106.183 1.00 21.34 ? 319 HOH A O   1 
HETATM 5048 O O   . HOH C 2 .   ? 43.456 57.336 122.181 1.00 28.56 ? 320 HOH A O   1 
HETATM 5049 O O   . HOH C 2 .   ? 50.467 56.895 118.910 1.00 22.02 ? 321 HOH A O   1 
HETATM 5050 O O   . HOH C 2 .   ? 44.388 44.292 150.662 1.00 24.72 ? 322 HOH A O   1 
HETATM 5051 O O   . HOH C 2 .   ? 41.854 63.867 120.163 1.00 28.16 ? 323 HOH A O   1 
HETATM 5052 O O   . HOH C 2 .   ? 50.034 58.526 112.310 1.00 25.28 ? 324 HOH A O   1 
HETATM 5053 O O   . HOH C 2 .   ? 56.729 59.425 126.263 1.00 36.10 ? 325 HOH A O   1 
HETATM 5054 O O   . HOH C 2 .   ? 28.737 53.609 106.402 1.00 21.39 ? 326 HOH A O   1 
HETATM 5055 O O   . HOH C 2 .   ? 25.724 55.533 107.728 1.00 29.61 ? 327 HOH A O   1 
HETATM 5056 O O   . HOH C 2 .   ? 41.088 47.654 124.144 1.00 23.07 ? 328 HOH A O   1 
HETATM 5057 O O   . HOH C 2 .   ? 50.741 44.898 144.533 1.00 28.50 ? 329 HOH A O   1 
HETATM 5058 O O   . HOH C 2 .   ? 50.701 51.176 134.421 1.00 27.65 ? 330 HOH A O   1 
HETATM 5059 O O   . HOH C 2 .   ? 18.664 54.361 117.858 1.00 33.64 ? 331 HOH A O   1 
HETATM 5060 O O   . HOH C 2 .   ? 37.379 61.803 108.808 1.00 21.50 ? 332 HOH A O   1 
HETATM 5061 O O   . HOH C 2 .   ? 41.560 52.627 96.705  1.00 28.23 ? 333 HOH A O   1 
HETATM 5062 O O   . HOH C 2 .   ? 46.884 51.182 101.286 1.00 32.20 ? 334 HOH A O   1 
HETATM 5063 O O   . HOH C 2 .   ? 55.510 56.970 128.018 1.00 29.14 ? 335 HOH A O   1 
HETATM 5064 O O   . HOH C 2 .   ? 37.834 47.366 101.779 1.00 21.54 ? 336 HOH A O   1 
HETATM 5065 O O   . HOH C 2 .   ? 32.240 49.783 122.671 1.00 22.08 ? 337 HOH A O   1 
HETATM 5066 O O   . HOH C 2 .   ? 10.328 73.139 121.400 1.00 42.32 ? 338 HOH A O   1 
HETATM 5067 O O   . HOH C 2 .   ? 56.848 71.560 112.650 1.00 45.69 ? 339 HOH A O   1 
HETATM 5068 O O   . HOH C 2 .   ? 38.807 53.927 96.567  1.00 27.75 ? 340 HOH A O   1 
HETATM 5069 O O   . HOH C 2 .   ? 37.933 61.390 121.885 1.00 32.56 ? 341 HOH A O   1 
HETATM 5070 O O   . HOH C 2 .   ? 51.853 59.637 120.737 1.00 22.97 ? 342 HOH A O   1 
HETATM 5071 O O   . HOH C 2 .   ? 39.418 50.518 95.619  1.00 36.46 ? 343 HOH A O   1 
HETATM 5072 O O   . HOH C 2 .   ? 37.482 54.875 127.647 1.00 30.65 ? 344 HOH A O   1 
HETATM 5073 O O   . HOH C 2 .   ? 47.178 52.079 133.098 1.00 23.64 ? 345 HOH A O   1 
HETATM 5074 O O   . HOH C 2 .   ? 23.135 68.519 121.842 1.00 27.76 ? 346 HOH A O   1 
HETATM 5075 O O   . HOH C 2 .   ? 30.984 52.479 101.650 1.00 33.70 ? 347 HOH A O   1 
HETATM 5076 O O   . HOH C 2 .   ? 13.255 62.088 113.405 1.00 27.56 ? 348 HOH A O   1 
HETATM 5077 O O   . HOH C 2 .   ? 37.396 48.081 114.292 1.00 26.91 ? 349 HOH A O   1 
HETATM 5078 O O   . HOH C 2 .   ? 44.733 69.366 116.727 1.00 29.41 ? 350 HOH A O   1 
HETATM 5079 O O   . HOH C 2 .   ? 29.227 70.070 101.795 1.00 33.15 ? 351 HOH A O   1 
HETATM 5080 O O   . HOH C 2 .   ? 37.447 48.509 109.158 1.00 22.63 ? 352 HOH A O   1 
HETATM 5081 O O   . HOH C 2 .   ? 13.730 64.997 118.547 1.00 31.47 ? 353 HOH A O   1 
HETATM 5082 O O   . HOH C 2 .   ? 11.703 67.696 125.671 1.00 33.44 ? 354 HOH A O   1 
HETATM 5083 O O   . HOH C 2 .   ? 44.894 63.640 95.695  1.00 52.56 ? 355 HOH A O   1 
HETATM 5084 O O   . HOH C 2 .   ? 53.728 60.160 140.664 1.00 31.55 ? 356 HOH A O   1 
HETATM 5085 O O   . HOH C 2 .   ? 35.870 64.247 129.573 1.00 42.79 ? 357 HOH A O   1 
HETATM 5086 O O   . HOH C 2 .   ? 49.916 76.860 116.133 1.00 32.94 ? 358 HOH A O   1 
HETATM 5087 O O   . HOH C 2 .   ? 48.803 52.362 104.864 1.00 31.05 ? 359 HOH A O   1 
HETATM 5088 O O   . HOH C 2 .   ? 52.787 61.732 105.746 1.00 42.28 ? 360 HOH A O   1 
HETATM 5089 O O   . HOH C 2 .   ? 35.974 72.303 99.237  1.00 35.91 ? 361 HOH A O   1 
HETATM 5090 O O   . HOH C 2 .   ? 32.920 50.711 102.118 1.00 25.45 ? 362 HOH A O   1 
HETATM 5091 O O   . HOH C 2 .   ? 48.006 72.072 139.073 1.00 47.95 ? 363 HOH A O   1 
HETATM 5092 O O   . HOH C 2 .   ? 37.927 48.503 99.244  1.00 39.05 ? 364 HOH A O   1 
HETATM 5093 O O   . HOH C 2 .   ? 21.581 74.739 103.496 1.00 42.03 ? 365 HOH A O   1 
HETATM 5094 O O   . HOH C 2 .   ? 54.625 45.739 136.211 1.00 53.95 ? 366 HOH A O   1 
HETATM 5095 O O   . HOH C 2 .   ? 53.389 51.640 113.387 1.00 37.02 ? 367 HOH A O   1 
HETATM 5096 O O   . HOH C 2 .   ? 26.176 55.313 120.448 1.00 36.83 ? 368 HOH A O   1 
HETATM 5097 O O   . HOH C 2 .   ? 51.570 59.086 117.089 1.00 29.53 ? 369 HOH A O   1 
HETATM 5098 O O   . HOH C 2 .   ? 22.543 60.413 94.784  1.00 50.18 ? 370 HOH A O   1 
HETATM 5099 O O   . HOH C 2 .   ? 50.505 77.776 118.846 1.00 41.52 ? 371 HOH A O   1 
HETATM 5100 O O   . HOH C 2 .   ? 28.923 51.190 138.367 1.00 34.13 ? 372 HOH A O   1 
HETATM 5101 O O   . HOH C 2 .   ? 52.234 68.227 104.024 1.00 33.18 ? 373 HOH A O   1 
HETATM 5102 O O   . HOH C 2 .   ? 27.373 49.343 105.940 1.00 27.93 ? 374 HOH A O   1 
HETATM 5103 O O   . HOH C 2 .   ? 57.380 59.002 128.946 1.00 40.13 ? 375 HOH A O   1 
HETATM 5104 O O   . HOH C 2 .   ? 52.516 54.312 118.933 1.00 42.84 ? 376 HOH A O   1 
HETATM 5105 O O   . HOH C 2 .   ? 15.266 70.735 110.683 1.00 39.98 ? 377 HOH A O   1 
HETATM 5106 O O   . HOH C 2 .   ? 47.035 81.153 119.636 1.00 43.52 ? 378 HOH A O   1 
HETATM 5107 O O   . HOH C 2 .   ? 29.355 44.305 132.767 1.00 37.81 ? 379 HOH A O   1 
HETATM 5108 O O   . HOH C 2 .   ? 22.080 59.199 106.827 1.00 32.97 ? 380 HOH A O   1 
HETATM 5109 O O   . HOH C 2 .   ? 16.430 68.930 106.804 1.00 41.45 ? 381 HOH A O   1 
HETATM 5110 O O   . HOH C 2 .   ? 36.540 49.156 111.770 1.00 20.90 ? 382 HOH A O   1 
HETATM 5111 O O   . HOH C 2 .   ? 23.281 77.551 112.390 1.00 46.14 ? 383 HOH A O   1 
HETATM 5112 O O   . HOH C 2 .   ? 26.920 46.985 104.425 1.00 27.15 ? 384 HOH A O   1 
HETATM 5113 O O   . HOH C 2 .   ? 23.773 45.310 105.403 1.00 26.02 ? 385 HOH A O   1 
HETATM 5114 O O   . HOH C 2 .   ? 35.443 47.108 102.556 1.00 30.46 ? 386 HOH A O   1 
HETATM 5115 O O   . HOH C 2 .   ? 36.421 61.500 123.868 1.00 44.46 ? 387 HOH A O   1 
HETATM 5116 O O   . HOH C 2 .   ? 34.743 48.445 115.043 1.00 34.35 ? 388 HOH A O   1 
HETATM 5117 O O   . HOH C 2 .   ? 33.629 46.760 109.135 1.00 25.11 ? 389 HOH A O   1 
HETATM 5118 O O   . HOH C 2 .   ? 51.839 58.539 114.311 1.00 32.53 ? 390 HOH A O   1 
HETATM 5119 O O   . HOH C 2 .   ? 38.975 45.062 100.815 1.00 30.15 ? 391 HOH A O   1 
HETATM 5120 O O   . HOH C 2 .   ? 52.278 50.428 111.471 1.00 30.45 ? 392 HOH A O   1 
HETATM 5121 O O   . HOH C 2 .   ? 24.234 76.056 106.428 1.00 40.84 ? 393 HOH A O   1 
HETATM 5122 O O   . HOH C 2 .   ? 13.682 57.422 111.620 1.00 44.44 ? 394 HOH A O   1 
HETATM 5123 O O   . HOH C 2 .   ? 52.494 50.472 115.515 1.00 38.87 ? 395 HOH A O   1 
HETATM 5124 O O   . HOH C 2 .   ? 50.286 70.545 136.198 1.00 39.77 ? 396 HOH A O   1 
HETATM 5125 O O   . HOH C 2 .   ? 49.358 80.225 115.846 1.00 44.04 ? 397 HOH A O   1 
HETATM 5126 O O   . HOH C 2 .   ? 41.581 54.789 90.561  1.00 43.20 ? 398 HOH A O   1 
HETATM 5127 O O   . HOH C 2 .   ? 36.915 43.144 101.388 1.00 28.42 ? 399 HOH A O   1 
HETATM 5128 O O   . HOH C 2 .   ? 36.993 57.961 127.042 1.00 44.27 ? 400 HOH A O   1 
HETATM 5129 O O   . HOH C 2 .   ? 50.772 66.226 96.414  1.00 59.97 ? 401 HOH A O   1 
HETATM 5130 O O   . HOH C 2 .   ? 28.397 55.625 128.911 1.00 39.41 ? 402 HOH A O   1 
HETATM 5131 O O   . HOH C 2 .   ? 34.258 47.502 111.650 1.00 35.90 ? 403 HOH A O   1 
HETATM 5132 O O   . HOH C 2 .   ? 33.273 65.443 117.934 1.00 32.03 ? 404 HOH A O   1 
HETATM 5133 O O   . HOH C 2 .   ? 27.076 46.505 116.657 1.00 29.80 ? 405 HOH A O   1 
HETATM 5134 O O   . HOH C 2 .   ? 40.970 61.638 121.661 1.00 24.50 ? 406 HOH A O   1 
HETATM 5135 O O   . HOH C 2 .   ? 49.400 64.859 141.004 1.00 24.76 ? 407 HOH A O   1 
HETATM 5136 O O   . HOH C 2 .   ? 51.012 52.510 141.107 1.00 25.53 ? 408 HOH A O   1 
HETATM 5137 O O   . HOH C 2 .   ? 50.129 42.679 145.278 1.00 43.97 ? 409 HOH A O   1 
HETATM 5138 O O   . HOH C 2 .   ? 20.043 47.650 117.195 1.00 30.25 ? 410 HOH A O   1 
HETATM 5139 O O   . HOH C 2 .   ? 33.436 48.128 101.243 1.00 43.57 ? 411 HOH A O   1 
HETATM 5140 O O   . HOH C 2 .   ? 16.219 49.030 109.944 1.00 38.28 ? 412 HOH A O   1 
HETATM 5141 O O   . HOH C 2 .   ? 53.927 71.688 118.460 1.00 29.51 ? 413 HOH A O   1 
HETATM 5142 O O   . HOH C 2 .   ? 23.142 43.115 104.189 1.00 33.10 ? 414 HOH A O   1 
HETATM 5143 O O   . HOH C 2 .   ? 47.564 73.597 97.686  1.00 42.76 ? 415 HOH A O   1 
HETATM 5144 O O   . HOH C 2 .   ? 44.893 53.032 92.999  1.00 30.73 ? 416 HOH A O   1 
HETATM 5145 O O   . HOH C 2 .   ? 48.900 57.805 92.982  1.00 43.50 ? 417 HOH A O   1 
HETATM 5146 O O   . HOH C 2 .   ? 26.679 48.973 130.123 1.00 35.91 ? 418 HOH A O   1 
HETATM 5147 O O   . HOH C 2 .   ? 54.526 70.002 110.567 1.00 34.65 ? 419 HOH A O   1 
HETATM 5148 O O   . HOH C 2 .   ? 52.279 66.410 110.235 1.00 31.74 ? 420 HOH A O   1 
HETATM 5149 O O   . HOH C 2 .   ? 56.912 63.527 130.508 1.00 32.28 ? 421 HOH A O   1 
HETATM 5150 O O   . HOH C 2 .   ? 54.852 73.902 119.858 1.00 43.12 ? 422 HOH A O   1 
HETATM 5151 O O   . HOH C 2 .   ? 44.429 49.151 97.988  1.00 33.47 ? 423 HOH A O   1 
HETATM 5152 O O   . HOH C 2 .   ? 32.751 56.366 128.293 1.00 36.18 ? 424 HOH A O   1 
HETATM 5153 O O   . HOH C 2 .   ? 16.285 75.084 117.794 1.00 40.36 ? 425 HOH A O   1 
HETATM 5154 O O   . HOH C 2 .   ? 31.185 61.041 130.986 1.00 53.04 ? 426 HOH A O   1 
HETATM 5155 O O   . HOH C 2 .   ? 55.141 55.902 109.552 1.00 37.20 ? 427 HOH A O   1 
HETATM 5156 O O   . HOH C 2 .   ? 19.227 67.358 105.488 1.00 38.51 ? 428 HOH A O   1 
HETATM 5157 O O   . HOH C 2 .   ? 15.167 70.444 113.391 1.00 37.74 ? 429 HOH A O   1 
HETATM 5158 O O   . HOH C 2 .   ? 21.010 74.957 105.878 1.00 49.53 ? 430 HOH A O   1 
HETATM 5159 O O   . HOH C 2 .   ? 55.378 66.781 112.910 1.00 31.74 ? 431 HOH A O   1 
HETATM 5160 O O   . HOH C 2 .   ? 54.622 57.959 110.997 1.00 40.03 ? 432 HOH A O   1 
HETATM 5161 O O   . HOH C 2 .   ? 53.739 52.726 140.708 1.00 33.40 ? 433 HOH A O   1 
HETATM 5162 O O   . HOH C 2 .   ? 52.200 65.508 139.710 1.00 45.83 ? 434 HOH A O   1 
HETATM 5163 O O   . HOH C 2 .   ? 36.745 73.284 122.407 1.00 38.32 ? 435 HOH A O   1 
HETATM 5164 O O   . HOH C 2 .   ? 31.792 76.716 127.603 1.00 47.73 ? 436 HOH A O   1 
HETATM 5165 O O   . HOH C 2 .   ? 22.568 60.502 104.121 1.00 37.71 ? 437 HOH A O   1 
HETATM 5166 O O   . HOH C 2 .   ? 14.118 74.027 116.937 1.00 40.05 ? 438 HOH A O   1 
HETATM 5167 O O   . HOH C 2 .   ? 18.441 76.463 111.398 1.00 41.48 ? 439 HOH A O   1 
HETATM 5168 O O   . HOH C 2 .   ? 35.273 56.704 128.471 1.00 41.57 ? 440 HOH A O   1 
HETATM 5169 O O   . HOH C 2 .   ? 49.366 80.311 118.715 1.00 50.83 ? 441 HOH A O   1 
HETATM 5170 O O   . HOH C 2 .   ? 43.312 82.972 120.079 1.00 42.17 ? 442 HOH A O   1 
HETATM 5171 O O   . HOH C 2 .   ? 56.294 64.968 96.844  1.00 43.93 ? 443 HOH A O   1 
HETATM 5172 O O   . HOH C 2 .   ? 26.266 45.944 132.743 1.00 39.24 ? 444 HOH A O   1 
HETATM 5173 O O   . HOH C 2 .   ? 28.124 45.525 135.139 1.00 23.77 ? 445 HOH A O   1 
HETATM 5174 O O   . HOH C 2 .   ? 42.161 50.011 96.814  1.00 41.05 ? 446 HOH A O   1 
HETATM 5175 O O   . HOH C 2 .   ? 53.409 68.167 111.777 1.00 36.51 ? 447 HOH A O   1 
HETATM 5176 O O   . HOH C 2 .   ? 21.068 57.971 101.408 1.00 46.05 ? 448 HOH A O   1 
HETATM 5177 O O   . HOH C 2 .   ? 45.998 47.211 99.083  1.00 47.45 ? 449 HOH A O   1 
HETATM 5178 O O   . HOH C 2 .   ? 46.918 47.990 101.442 1.00 37.50 ? 450 HOH A O   1 
HETATM 5179 O O   . HOH C 2 .   ? 31.959 54.165 135.269 1.00 31.18 ? 451 HOH A O   1 
HETATM 5180 O O   . HOH C 2 .   ? 48.086 50.961 120.224 1.00 33.46 ? 452 HOH A O   1 
HETATM 5181 O O   . HOH C 2 .   ? 20.754 57.749 113.020 1.00 28.44 ? 453 HOH A O   1 
HETATM 5182 O O   . HOH C 2 .   ? 19.609 59.093 110.579 1.00 41.42 ? 454 HOH A O   1 
HETATM 5183 O O   . HOH C 2 .   ? 15.451 65.166 107.507 1.00 44.82 ? 455 HOH A O   1 
HETATM 5184 O O   . HOH C 2 .   ? 20.243 72.186 106.699 1.00 35.60 ? 456 HOH A O   1 
HETATM 5185 O O   . HOH C 2 .   ? 33.848 52.207 90.856  1.00 45.91 ? 457 HOH A O   1 
HETATM 5186 O O   . HOH C 2 .   ? 51.923 58.065 93.443  1.00 47.36 ? 458 HOH A O   1 
HETATM 5187 O O   . HOH C 2 .   ? 52.052 56.772 101.202 1.00 44.49 ? 459 HOH A O   1 
HETATM 5188 O O   . HOH C 2 .   ? 34.202 50.585 99.237  1.00 39.66 ? 460 HOH A O   1 
HETATM 5189 O O   . HOH C 2 .   ? 15.864 49.946 112.426 1.00 35.89 ? 461 HOH A O   1 
HETATM 5190 O O   . HOH C 2 .   ? 17.181 57.656 111.536 1.00 31.53 ? 462 HOH A O   1 
HETATM 5191 O O   . HOH C 2 .   ? 50.618 42.123 137.472 1.00 52.13 ? 463 HOH A O   1 
HETATM 5192 O O   . HOH C 2 .   ? 28.076 82.124 109.951 1.00 54.88 ? 464 HOH A O   1 
HETATM 5193 O O   . HOH C 2 .   ? 40.166 69.652 122.953 1.00 41.12 ? 465 HOH A O   1 
HETATM 5194 O O   . HOH C 2 .   ? 34.837 72.606 123.933 1.00 43.89 ? 466 HOH A O   1 
HETATM 5195 O O   . HOH C 2 .   ? 25.182 54.724 102.634 1.00 50.35 ? 467 HOH A O   1 
HETATM 5196 O O   . HOH C 2 .   ? 28.986 50.333 103.377 1.00 54.22 ? 468 HOH A O   1 
HETATM 5197 O O   . HOH C 2 .   ? 54.205 58.690 120.042 1.00 45.87 ? 469 HOH A O   1 
HETATM 5198 O O   . HOH C 2 .   ? 11.494 50.712 119.401 1.00 53.76 ? 470 HOH A O   1 
HETATM 5199 O O   . HOH C 2 .   ? 31.400 50.317 137.713 1.00 32.63 ? 471 HOH A O   1 
HETATM 5200 O O   . HOH C 2 .   ? 26.066 80.169 117.099 1.00 55.74 ? 472 HOH A O   1 
HETATM 5201 O O   . HOH C 2 .   ? 39.581 56.912 89.092  1.00 51.66 ? 473 HOH A O   1 
HETATM 5202 O O   . HOH C 2 .   ? 46.061 55.088 90.027  1.00 57.15 ? 474 HOH A O   1 
HETATM 5203 O O   . HOH C 2 .   ? 41.392 85.373 116.228 1.00 53.13 ? 475 HOH A O   1 
HETATM 5204 O O   . HOH C 2 .   ? 55.114 54.609 130.932 1.00 41.84 ? 476 HOH A O   1 
HETATM 5205 O O   . HOH C 2 .   ? 36.438 59.302 97.327  1.00 55.96 ? 477 HOH A O   1 
HETATM 5206 O O   . HOH C 2 .   ? 53.415 67.801 108.183 1.00 37.44 ? 478 HOH A O   1 
HETATM 5207 O O   . HOH C 2 .   ? 53.926 65.636 106.601 1.00 50.56 ? 479 HOH A O   1 
HETATM 5208 O O   . HOH C 2 .   ? 54.877 64.773 99.602  1.00 60.56 ? 480 HOH A O   1 
HETATM 5209 O O   . HOH C 2 .   ? 43.925 79.159 131.966 1.00 51.44 ? 481 HOH A O   1 
HETATM 5210 O O   . HOH C 2 .   ? 58.067 72.106 114.730 1.00 45.03 ? 482 HOH A O   1 
HETATM 5211 O O   . HOH C 2 .   ? 23.018 76.479 131.319 1.00 55.77 ? 483 HOH A O   1 
HETATM 5212 O O   . HOH C 2 .   ? 24.877 76.446 104.119 1.00 44.40 ? 484 HOH A O   1 
HETATM 5213 O O   . HOH C 2 .   ? 27.160 47.899 120.938 1.00 37.06 ? 485 HOH A O   1 
HETATM 5214 O O   . HOH C 2 .   ? 36.439 59.502 92.991  1.00 49.36 ? 486 HOH A O   1 
HETATM 5215 O O   . HOH C 2 .   ? 17.990 44.433 109.825 1.00 41.54 ? 487 HOH A O   1 
HETATM 5216 O O   . HOH C 2 .   ? 13.725 70.219 119.347 1.00 41.51 ? 488 HOH A O   1 
HETATM 5217 O O   . HOH D 2 .   ? 42.257 38.257 106.770 1.00 21.80 ? 315 HOH B O   1 
HETATM 5218 O O   . HOH D 2 .   ? 43.539 26.388 120.259 1.00 21.31 ? 316 HOH B O   1 
HETATM 5219 O O   . HOH D 2 .   ? 28.963 29.024 123.835 1.00 23.94 ? 317 HOH B O   1 
HETATM 5220 O O   . HOH D 2 .   ? 28.809 25.010 122.389 1.00 21.81 ? 318 HOH B O   1 
HETATM 5221 O O   . HOH D 2 .   ? 50.388 26.376 123.890 1.00 25.71 ? 319 HOH B O   1 
HETATM 5222 O O   . HOH D 2 .   ? 34.288 30.846 112.000 1.00 21.39 ? 320 HOH B O   1 
HETATM 5223 O O   . HOH D 2 .   ? 34.272 26.102 127.650 1.00 34.08 ? 321 HOH B O   1 
HETATM 5224 O O   . HOH D 2 .   ? 37.868 21.880 127.090 1.00 35.46 ? 322 HOH B O   1 
HETATM 5225 O O   . HOH D 2 .   ? 39.907 29.269 121.164 1.00 24.29 ? 323 HOH B O   1 
HETATM 5226 O O   . HOH D 2 .   ? 22.822 37.922 122.861 1.00 17.95 ? 324 HOH B O   1 
HETATM 5227 O O   . HOH D 2 .   ? 31.693 30.953 124.159 1.00 25.55 ? 325 HOH B O   1 
HETATM 5228 O O   . HOH D 2 .   ? 41.208 45.100 122.493 1.00 24.97 ? 326 HOH B O   1 
HETATM 5229 O O   . HOH D 2 .   ? 19.079 39.599 132.423 1.00 39.80 ? 327 HOH B O   1 
HETATM 5230 O O   . HOH D 2 .   ? 47.228 40.686 120.904 1.00 40.83 ? 328 HOH B O   1 
HETATM 5231 O O   . HOH D 2 .   ? 45.342 47.571 114.967 1.00 30.94 ? 329 HOH B O   1 
HETATM 5232 O O   . HOH D 2 .   ? 51.138 35.482 112.899 1.00 25.73 ? 330 HOH B O   1 
HETATM 5233 O O   . HOH D 2 .   ? 30.301 37.945 125.105 1.00 24.57 ? 331 HOH B O   1 
HETATM 5234 O O   . HOH D 2 .   ? 45.420 52.689 130.920 1.00 28.89 ? 332 HOH B O   1 
HETATM 5235 O O   . HOH D 2 .   ? 31.470 44.570 116.902 1.00 31.70 ? 333 HOH B O   1 
HETATM 5236 O O   . HOH D 2 .   ? 32.865 47.940 124.562 1.00 18.12 ? 334 HOH B O   1 
HETATM 5237 O O   . HOH D 2 .   ? 37.170 41.948 129.188 1.00 36.09 ? 335 HOH B O   1 
HETATM 5238 O O   . HOH D 2 .   ? 29.728 18.254 102.303 1.00 28.16 ? 336 HOH B O   1 
HETATM 5239 O O   . HOH D 2 .   ? 18.156 37.285 126.897 1.00 25.75 ? 337 HOH B O   1 
HETATM 5240 O O   . HOH D 2 .   ? 58.913 29.557 118.740 1.00 31.13 ? 338 HOH B O   1 
HETATM 5241 O O   . HOH D 2 .   ? 54.281 17.279 114.513 1.00 40.11 ? 339 HOH B O   1 
HETATM 5242 O O   . HOH D 2 .   ? 37.537 45.649 108.875 1.00 21.60 ? 340 HOH B O   1 
HETATM 5243 O O   . HOH D 2 .   ? 45.918 47.098 119.908 1.00 26.51 ? 341 HOH B O   1 
HETATM 5244 O O   . HOH D 2 .   ? 19.243 23.417 111.294 1.00 35.72 ? 342 HOH B O   1 
HETATM 5245 O O   . HOH D 2 .   ? 34.473 19.211 104.135 1.00 28.13 ? 343 HOH B O   1 
HETATM 5246 O O   . HOH D 2 .   ? 21.836 35.498 125.440 1.00 23.52 ? 344 HOH B O   1 
HETATM 5247 O O   . HOH D 2 .   ? 32.457 43.834 102.453 1.00 23.50 ? 345 HOH B O   1 
HETATM 5248 O O   . HOH D 2 .   ? 58.788 26.475 118.357 1.00 25.33 ? 346 HOH B O   1 
HETATM 5249 O O   . HOH D 2 .   ? 22.404 34.942 116.825 1.00 28.10 ? 347 HOH B O   1 
HETATM 5250 O O   . HOH D 2 .   ? 34.037 43.946 109.830 1.00 18.30 ? 348 HOH B O   1 
HETATM 5251 O O   . HOH D 2 .   ? 43.462 42.488 105.368 1.00 24.80 ? 349 HOH B O   1 
HETATM 5252 O O   . HOH D 2 .   ? 35.249 43.871 112.361 1.00 22.00 ? 350 HOH B O   1 
HETATM 5253 O O   . HOH D 2 .   ? 23.854 17.125 126.770 1.00 36.73 ? 351 HOH B O   1 
HETATM 5254 O O   . HOH D 2 .   ? 20.335 26.504 117.128 1.00 35.52 ? 352 HOH B O   1 
HETATM 5255 O O   . HOH D 2 .   ? 44.398 46.362 104.767 1.00 19.04 ? 353 HOH B O   1 
HETATM 5256 O O   . HOH D 2 .   ? 34.315 17.403 134.136 1.00 37.38 ? 354 HOH B O   1 
HETATM 5257 O O   . HOH D 2 .   ? 20.976 35.657 97.559  1.00 42.00 ? 355 HOH B O   1 
HETATM 5258 O O   . HOH D 2 .   ? 20.077 31.512 98.180  1.00 36.12 ? 356 HOH B O   1 
HETATM 5259 O O   . HOH D 2 .   ? 31.731 16.752 103.174 1.00 37.08 ? 357 HOH B O   1 
HETATM 5260 O O   . HOH D 2 .   ? 25.302 46.258 143.833 1.00 29.46 ? 358 HOH B O   1 
HETATM 5261 O O   . HOH D 2 .   ? 22.964 49.851 139.342 1.00 41.92 ? 359 HOH B O   1 
HETATM 5262 O O   . HOH D 2 .   ? 21.524 35.485 121.882 1.00 24.72 ? 360 HOH B O   1 
HETATM 5263 O O   . HOH D 2 .   ? 40.879 41.259 103.037 1.00 40.46 ? 361 HOH B O   1 
HETATM 5264 O O   . HOH D 2 .   ? 23.620 40.168 104.175 1.00 31.33 ? 362 HOH B O   1 
HETATM 5265 O O   . HOH D 2 .   ? 39.088 32.171 132.058 1.00 40.41 ? 363 HOH B O   1 
HETATM 5266 O O   . HOH D 2 .   ? 52.399 46.281 114.418 1.00 31.88 ? 364 HOH B O   1 
HETATM 5267 O O   . HOH D 2 .   ? 20.216 22.640 125.750 1.00 30.65 ? 365 HOH B O   1 
HETATM 5268 O O   . HOH D 2 .   ? 37.612 45.195 115.248 1.00 30.28 ? 366 HOH B O   1 
HETATM 5269 O O   . HOH D 2 .   ? 33.755 10.403 109.685 1.00 55.05 ? 367 HOH B O   1 
HETATM 5270 O O   . HOH D 2 .   ? 37.111 45.645 111.672 1.00 30.65 ? 368 HOH B O   1 
HETATM 5271 O O   . HOH D 2 .   ? 33.154 27.303 98.323  1.00 39.12 ? 369 HOH B O   1 
HETATM 5272 O O   . HOH D 2 .   ? 44.254 47.526 136.817 1.00 31.68 ? 370 HOH B O   1 
HETATM 5273 O O   . HOH D 2 .   ? 59.502 24.148 119.758 1.00 24.77 ? 371 HOH B O   1 
HETATM 5274 O O   . HOH D 2 .   ? 31.103 46.071 101.488 1.00 33.89 ? 372 HOH B O   1 
HETATM 5275 O O   . HOH D 2 .   ? 43.336 44.307 103.270 1.00 29.20 ? 373 HOH B O   1 
HETATM 5276 O O   . HOH D 2 .   ? 20.781 35.017 119.151 1.00 30.78 ? 374 HOH B O   1 
HETATM 5277 O O   . HOH D 2 .   ? 34.925 44.275 103.133 1.00 34.13 ? 375 HOH B O   1 
HETATM 5278 O O   . HOH D 2 .   ? 19.322 36.107 124.881 1.00 30.01 ? 376 HOH B O   1 
HETATM 5279 O O   . HOH D 2 .   ? 41.470 27.703 136.210 1.00 45.39 ? 377 HOH B O   1 
HETATM 5280 O O   . HOH D 2 .   ? 18.622 28.747 117.153 1.00 35.80 ? 378 HOH B O   1 
HETATM 5281 O O   . HOH D 2 .   ? 17.463 37.187 134.062 1.00 35.10 ? 379 HOH B O   1 
HETATM 5282 O O   . HOH D 2 .   ? 45.213 40.505 104.511 1.00 33.23 ? 380 HOH B O   1 
HETATM 5283 O O   . HOH D 2 .   ? 46.969 46.294 103.583 1.00 31.60 ? 381 HOH B O   1 
HETATM 5284 O O   . HOH D 2 .   ? 49.563 46.948 105.088 1.00 33.27 ? 382 HOH B O   1 
HETATM 5285 O O   . HOH D 2 .   ? 46.455 47.809 117.333 1.00 40.86 ? 383 HOH B O   1 
HETATM 5286 O O   . HOH D 2 .   ? 56.895 19.514 119.871 1.00 34.26 ? 384 HOH B O   1 
HETATM 5287 O O   . HOH D 2 .   ? 52.683 31.633 135.243 1.00 44.32 ? 385 HOH B O   1 
HETATM 5288 O O   . HOH D 2 .   ? 45.818 36.972 108.013 1.00 26.58 ? 386 HOH B O   1 
HETATM 5289 O O   . HOH D 2 .   ? 24.837 14.538 124.104 1.00 42.11 ? 387 HOH B O   1 
HETATM 5290 O O   . HOH D 2 .   ? 25.979 17.740 131.209 1.00 43.74 ? 388 HOH B O   1 
HETATM 5291 O O   . HOH D 2 .   ? 34.663 45.422 114.539 1.00 33.88 ? 389 HOH B O   1 
HETATM 5292 O O   . HOH D 2 .   ? 25.745 28.839 142.969 1.00 42.32 ? 390 HOH B O   1 
HETATM 5293 O O   . HOH D 2 .   ? 30.331 35.370 124.351 1.00 19.40 ? 391 HOH B O   1 
HETATM 5294 O O   . HOH D 2 .   ? 35.583 34.128 124.776 1.00 29.43 ? 392 HOH B O   1 
HETATM 5295 O O   . HOH D 2 .   ? 32.799 33.722 124.831 1.00 22.48 ? 393 HOH B O   1 
HETATM 5296 O O   . HOH D 2 .   ? 42.751 36.934 125.023 1.00 31.53 ? 394 HOH B O   1 
HETATM 5297 O O   . HOH D 2 .   ? 41.388 43.795 101.711 1.00 26.90 ? 395 HOH B O   1 
HETATM 5298 O O   . HOH D 2 .   ? 34.222 19.575 136.038 1.00 36.64 ? 396 HOH B O   1 
HETATM 5299 O O   . HOH D 2 .   ? 19.730 42.707 114.916 1.00 32.90 ? 397 HOH B O   1 
HETATM 5300 O O   . HOH D 2 .   ? 40.791 34.034 134.089 1.00 31.44 ? 398 HOH B O   1 
HETATM 5301 O O   . HOH D 2 .   ? 42.932 46.421 117.774 1.00 37.53 ? 399 HOH B O   1 
HETATM 5302 O O   . HOH D 2 .   ? 30.522 15.107 106.209 1.00 29.72 ? 400 HOH B O   1 
HETATM 5303 O O   . HOH D 2 .   ? 18.663 22.943 118.342 1.00 40.08 ? 401 HOH B O   1 
HETATM 5304 O O   . HOH D 2 .   ? 18.239 27.762 110.252 1.00 33.87 ? 402 HOH B O   1 
HETATM 5305 O O   . HOH D 2 .   ? 17.479 36.423 131.426 1.00 33.89 ? 403 HOH B O   1 
HETATM 5306 O O   . HOH D 2 .   ? 58.594 24.929 115.820 1.00 32.68 ? 404 HOH B O   1 
HETATM 5307 O O   . HOH D 2 .   ? 48.080 28.711 119.514 1.00 26.65 ? 405 HOH B O   1 
HETATM 5308 O O   . HOH D 2 .   ? 17.425 31.253 98.928  1.00 53.74 ? 406 HOH B O   1 
HETATM 5309 O O   . HOH D 2 .   ? 42.681 27.809 130.307 1.00 35.71 ? 407 HOH B O   1 
HETATM 5310 O O   . HOH D 2 .   ? 50.161 49.281 104.030 1.00 42.30 ? 408 HOH B O   1 
HETATM 5311 O O   . HOH D 2 .   ? 24.007 26.535 101.453 1.00 49.59 ? 409 HOH B O   1 
HETATM 5312 O O   . HOH D 2 .   ? 19.353 42.254 117.667 1.00 44.31 ? 410 HOH B O   1 
HETATM 5313 O O   . HOH D 2 .   ? 42.103 36.272 100.024 1.00 42.00 ? 411 HOH B O   1 
HETATM 5314 O O   . HOH D 2 .   ? 56.872 22.831 111.860 1.00 40.56 ? 412 HOH B O   1 
HETATM 5315 O O   . HOH D 2 .   ? 34.873 26.614 100.108 1.00 43.36 ? 413 HOH B O   1 
HETATM 5316 O O   . HOH D 2 .   ? 52.098 16.111 114.937 1.00 42.84 ? 414 HOH B O   1 
HETATM 5317 O O   . HOH D 2 .   ? 51.633 24.763 107.185 1.00 37.48 ? 415 HOH B O   1 
HETATM 5318 O O   . HOH D 2 .   ? 37.055 33.501 130.606 1.00 32.43 ? 416 HOH B O   1 
HETATM 5319 O O   . HOH D 2 .   ? 47.650 16.661 110.289 1.00 33.39 ? 417 HOH B O   1 
HETATM 5320 O O   . HOH D 2 .   ? 47.151 49.029 121.607 1.00 30.40 ? 418 HOH B O   1 
HETATM 5321 O O   . HOH D 2 .   ? 23.844 12.949 114.186 1.00 43.18 ? 419 HOH B O   1 
HETATM 5322 O O   . HOH D 2 .   ? 35.591 30.884 125.013 1.00 33.76 ? 420 HOH B O   1 
HETATM 5323 O O   . HOH D 2 .   ? 58.463 32.577 111.187 1.00 41.21 ? 421 HOH B O   1 
HETATM 5324 O O   . HOH D 2 .   ? 32.892 25.523 96.391  1.00 36.92 ? 422 HOH B O   1 
HETATM 5325 O O   . HOH D 2 .   ? 20.402 17.359 109.219 1.00 37.12 ? 423 HOH B O   1 
HETATM 5326 O O   . HOH D 2 .   ? 27.736 22.223 138.043 1.00 45.29 ? 424 HOH B O   1 
HETATM 5327 O O   . HOH D 2 .   ? 22.047 39.811 108.447 1.00 28.48 ? 425 HOH B O   1 
HETATM 5328 O O   . HOH D 2 .   ? 60.125 39.318 112.996 1.00 45.19 ? 426 HOH B O   1 
HETATM 5329 O O   . HOH D 2 .   ? 40.927 34.495 124.792 1.00 32.28 ? 427 HOH B O   1 
HETATM 5330 O O   . HOH D 2 .   ? 49.100 22.234 105.208 1.00 45.65 ? 428 HOH B O   1 
HETATM 5331 O O   . HOH D 2 .   ? 15.453 31.134 110.793 1.00 47.61 ? 429 HOH B O   1 
HETATM 5332 O O   . HOH D 2 .   ? 60.263 31.625 122.672 1.00 32.74 ? 430 HOH B O   1 
HETATM 5333 O O   . HOH D 2 .   ? 61.399 27.596 125.425 1.00 39.65 ? 431 HOH B O   1 
HETATM 5334 O O   . HOH D 2 .   ? 55.609 38.734 131.143 1.00 32.40 ? 432 HOH B O   1 
HETATM 5335 O O   . HOH D 2 .   ? 19.488 15.633 111.021 1.00 39.69 ? 433 HOH B O   1 
HETATM 5336 O O   . HOH D 2 .   ? 19.907 25.312 119.363 1.00 39.49 ? 434 HOH B O   1 
HETATM 5337 O O   . HOH D 2 .   ? 49.923 17.653 109.294 1.00 37.80 ? 435 HOH B O   1 
HETATM 5338 O O   . HOH D 2 .   ? 23.824 11.687 109.600 1.00 49.57 ? 436 HOH B O   1 
HETATM 5339 O O   . HOH D 2 .   ? 20.695 42.218 107.100 1.00 39.84 ? 437 HOH B O   1 
HETATM 5340 O O   . HOH D 2 .   ? 22.837 17.418 105.556 1.00 36.69 ? 438 HOH B O   1 
HETATM 5341 O O   . HOH D 2 .   ? 41.879 47.096 115.090 1.00 49.12 ? 439 HOH B O   1 
HETATM 5342 O O   . HOH D 2 .   ? 26.281 54.249 145.786 1.00 41.27 ? 440 HOH B O   1 
HETATM 5343 O O   . HOH D 2 .   ? 28.419 20.437 98.300  1.00 42.10 ? 441 HOH B O   1 
HETATM 5344 O O   . HOH D 2 .   ? 30.474 22.243 96.356  1.00 36.98 ? 442 HOH B O   1 
HETATM 5345 O O   . HOH D 2 .   ? 18.230 30.384 134.618 1.00 47.99 ? 443 HOH B O   1 
HETATM 5346 O O   . HOH D 2 .   ? 55.404 43.543 107.858 1.00 47.80 ? 444 HOH B O   1 
HETATM 5347 O O   . HOH D 2 .   ? 48.676 50.900 130.262 1.00 34.57 ? 445 HOH B O   1 
HETATM 5348 O O   . HOH D 2 .   ? 17.361 38.064 113.253 1.00 42.64 ? 446 HOH B O   1 
HETATM 5349 O O   . HOH D 2 .   ? 21.384 44.744 107.619 1.00 31.67 ? 447 HOH B O   1 
HETATM 5350 O O   . HOH D 2 .   ? 52.706 43.612 119.377 1.00 40.02 ? 448 HOH B O   1 
HETATM 5351 O O   . HOH D 2 .   ? 47.845 35.511 106.960 1.00 42.96 ? 449 HOH B O   1 
HETATM 5352 O O   . HOH D 2 .   ? 15.586 31.600 128.070 1.00 42.28 ? 450 HOH B O   1 
HETATM 5353 O O   . HOH D 2 .   ? 37.323 40.532 102.779 1.00 34.70 ? 451 HOH B O   1 
HETATM 5354 O O   . HOH D 2 .   ? 24.285 17.345 124.078 1.00 33.03 ? 452 HOH B O   1 
HETATM 5355 O O   . HOH D 2 .   ? 24.741 46.268 137.021 1.00 24.28 ? 453 HOH B O   1 
HETATM 5356 O O   . HOH D 2 .   ? 43.310 46.457 120.105 1.00 32.71 ? 454 HOH B O   1 
HETATM 5357 O O   . HOH D 2 .   ? 46.358 38.520 127.881 1.00 41.42 ? 455 HOH B O   1 
HETATM 5358 O O   . HOH D 2 .   ? 46.237 40.726 129.190 1.00 36.09 ? 456 HOH B O   1 
HETATM 5359 O O   . HOH D 2 .   ? 47.836 43.718 102.497 1.00 40.97 ? 457 HOH B O   1 
HETATM 5360 O O   . HOH D 2 .   ? 53.419 49.358 124.767 1.00 43.71 ? 458 HOH B O   1 
HETATM 5361 O O   . HOH D 2 .   ? 28.844 47.030 102.120 1.00 36.04 ? 459 HOH B O   1 
HETATM 5362 O O   . HOH D 2 .   ? 43.940 35.991 133.405 1.00 41.24 ? 460 HOH B O   1 
HETATM 5363 O O   . HOH D 2 .   ? 45.954 37.649 130.238 1.00 45.36 ? 461 HOH B O   1 
HETATM 5364 O O   . HOH D 2 .   ? 47.593 37.311 132.394 1.00 39.94 ? 462 HOH B O   1 
HETATM 5365 O O   . HOH D 2 .   ? 22.017 47.676 142.473 1.00 53.75 ? 463 HOH B O   1 
HETATM 5366 O O   . HOH D 2 .   ? 31.751 31.697 145.375 1.00 36.80 ? 464 HOH B O   1 
HETATM 5367 O O   . HOH D 2 .   ? 37.185 35.021 126.811 1.00 42.52 ? 465 HOH B O   1 
HETATM 5368 O O   . HOH D 2 .   ? 18.492 30.039 111.681 1.00 45.47 ? 466 HOH B O   1 
HETATM 5369 O O   . HOH D 2 .   ? 28.386 18.127 131.797 1.00 33.83 ? 467 HOH B O   1 
HETATM 5370 O O   . HOH D 2 .   ? 17.514 26.964 138.376 1.00 48.48 ? 468 HOH B O   1 
HETATM 5371 O O   . HOH D 2 .   ? 16.825 21.757 120.184 1.00 32.92 ? 469 HOH B O   1 
HETATM 5372 O O   . HOH D 2 .   ? 36.010 6.042  115.625 1.00 44.80 ? 470 HOH B O   1 
HETATM 5373 O O   . HOH D 2 .   ? 38.989 26.617 128.022 1.00 39.61 ? 471 HOH B O   1 
HETATM 5374 O O   . HOH D 2 .   ? 45.575 25.681 135.436 1.00 51.08 ? 472 HOH B O   1 
HETATM 5375 O O   . HOH D 2 .   ? 49.531 15.984 116.158 1.00 37.44 ? 473 HOH B O   1 
HETATM 5376 O O   . HOH D 2 .   ? 48.185 14.750 114.174 1.00 42.38 ? 474 HOH B O   1 
HETATM 5377 O O   . HOH D 2 .   ? 52.963 14.511 118.653 1.00 53.01 ? 475 HOH B O   1 
HETATM 5378 O O   . HOH D 2 .   ? 51.726 20.677 109.328 1.00 37.90 ? 476 HOH B O   1 
HETATM 5379 O O   . HOH D 2 .   ? 36.262 23.849 130.093 1.00 39.05 ? 477 HOH B O   1 
HETATM 5380 O O   . HOH D 2 .   ? 38.984 24.304 130.936 1.00 46.24 ? 478 HOH B O   1 
HETATM 5381 O O   . HOH D 2 .   ? 41.177 26.449 132.386 1.00 57.25 ? 479 HOH B O   1 
HETATM 5382 O O   . HOH D 2 .   ? 43.353 18.103 129.635 1.00 50.66 ? 480 HOH B O   1 
HETATM 5383 O O   . HOH D 2 .   ? 42.474 21.756 129.114 1.00 45.99 ? 481 HOH B O   1 
HETATM 5384 O O   . HOH D 2 .   ? 53.821 44.057 123.302 1.00 38.95 ? 482 HOH B O   1 
HETATM 5385 O O   . HOH D 2 .   ? 56.774 45.477 116.823 1.00 58.19 ? 483 HOH B O   1 
HETATM 5386 O O   . HOH D 2 .   ? 24.519 40.697 100.684 1.00 38.40 ? 484 HOH B O   1 
HETATM 5387 O O   . HOH D 2 .   ? 12.042 34.338 108.382 1.00 57.35 ? 485 HOH B O   1 
HETATM 5388 O O   . HOH D 2 .   ? 49.930 40.020 107.918 1.00 36.45 ? 486 HOH B O   1 
HETATM 5389 O O   . HOH D 2 .   ? 59.249 20.085 118.606 1.00 41.80 ? 487 HOH B O   1 
HETATM 5390 O O   . HOH D 2 .   ? 50.304 33.490 134.036 1.00 47.05 ? 488 HOH B O   1 
HETATM 5391 O O   . HOH D 2 .   ? 48.475 34.270 135.896 1.00 48.05 ? 489 HOH B O   1 
HETATM 5392 O O   . HOH D 2 .   ? 55.475 33.187 133.894 1.00 54.44 ? 490 HOH B O   1 
HETATM 5393 O O   . HOH D 2 .   ? 60.068 24.482 131.670 1.00 45.94 ? 491 HOH B O   1 
HETATM 5394 O O   . HOH D 2 .   ? 28.499 17.092 100.215 1.00 46.16 ? 492 HOH B O   1 
HETATM 5395 O O   . HOH D 2 .   ? 39.097 11.433 101.681 1.00 50.91 ? 493 HOH B O   1 
HETATM 5396 O O   . HOH D 2 .   ? 36.801 15.949 132.245 1.00 42.80 ? 494 HOH B O   1 
HETATM 5397 O O   . HOH D 2 .   ? 41.188 16.064 134.033 1.00 55.98 ? 495 HOH B O   1 
HETATM 5398 O O   . HOH D 2 .   ? 27.383 15.855 134.882 1.00 44.10 ? 496 HOH B O   1 
HETATM 5399 O O   . HOH D 2 .   ? 45.470 43.998 101.148 1.00 51.34 ? 497 HOH B O   1 
HETATM 5400 O O   . HOH D 2 .   ? 26.345 26.986 141.217 1.00 39.16 ? 498 HOH B O   1 
HETATM 5401 O O   . HOH D 2 .   ? 23.402 26.050 146.156 1.00 57.30 ? 499 HOH B O   1 
HETATM 5402 O O   . HOH D 2 .   ? 23.260 29.743 143.031 1.00 36.53 ? 500 HOH B O   1 
HETATM 5403 O O   . HOH D 2 .   ? 18.383 42.673 141.896 1.00 46.19 ? 501 HOH B O   1 
HETATM 5404 O O   . HOH D 2 .   ? 28.819 26.560 144.219 1.00 40.94 ? 502 HOH B O   1 
HETATM 5405 O O   . HOH D 2 .   ? 42.636 24.000 134.983 1.00 47.19 ? 503 HOH B O   1 
HETATM 5406 O O   . HOH D 2 .   ? 29.167 22.835 140.308 1.00 46.45 ? 504 HOH B O   1 
HETATM 5407 O O   . HOH D 2 .   ? 19.349 43.336 130.769 1.00 59.77 ? 505 HOH B O   1 
HETATM 5408 O O   . HOH D 2 .   ? 30.792 19.992 100.030 1.00 48.44 ? 506 HOH B O   1 
HETATM 5409 O O   . HOH D 2 .   ? 27.444 9.000  113.078 1.00 58.35 ? 507 HOH B O   1 
HETATM 5410 O O   . HOH D 2 .   ? 19.733 21.332 128.131 1.00 42.36 ? 508 HOH B O   1 
HETATM 5411 O O   . HOH D 2 .   ? 21.423 17.093 130.373 1.00 53.35 ? 509 HOH B O   1 
HETATM 5412 O O   . HOH D 2 .   ? 13.232 30.856 119.402 1.00 52.73 ? 510 HOH B O   1 
HETATM 5413 O O   . HOH D 2 .   ? 46.969 8.046  119.504 1.00 53.63 ? 511 HOH B O   1 
HETATM 5414 O O   . HOH D 2 .   ? 40.133 23.326 128.167 1.00 53.00 ? 512 HOH B O   1 
HETATM 5415 O O   . HOH D 2 .   ? 41.584 18.281 104.433 1.00 49.85 ? 513 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   MET 5   5   5   MET MET A . n 
A 1 6   TYR 6   6   6   TYR TYR A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  HIS 10  10  10  HIS HIS A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 HIS 120 120 120 HIS HIS A . n 
A 1 121 MET 121 121 121 MET MET A . n 
A 1 122 PRO 122 122 122 PRO PRO A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 TRP 124 124 124 TRP TRP A . n 
A 1 125 HIS 125 125 125 HIS HIS A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 TYR 178 178 178 TYR TYR A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 HIS 184 184 184 HIS HIS A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 MET 193 193 193 MET MET A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 MET 197 197 197 MET MET A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 THR 201 201 ?   ?   ?   A . n 
A 1 202 HIS 202 202 ?   ?   ?   A . n 
A 1 203 HIS 203 203 ?   ?   ?   A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 HIS 206 206 206 HIS HIS A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 HIS 210 210 210 HIS HIS A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 TYR 219 219 219 TYR TYR A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 HIS 226 226 226 HIS HIS A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 PHE 234 234 234 PHE PHE A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 PHE 236 236 236 PHE PHE A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 ASP 244 244 244 ASP ASP A . n 
A 1 245 PRO 245 245 245 PRO PRO A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ARG 265 265 265 ARG ARG A . n 
A 1 266 HIS 266 266 266 HIS HIS A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 MET 275 275 275 MET MET A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 LYS 280 280 280 LYS LYS A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 GLU 284 284 284 GLU GLU A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 LYS 288 288 288 LYS LYS A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 MET 291 291 291 MET MET A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 GLN 296 296 296 GLN GLN A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 PRO 298 298 298 PRO PRO A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 TYR 300 300 300 TYR TYR A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 ALA 310 310 310 ALA ALA A . n 
A 1 311 PRO 311 311 311 PRO PRO A . n 
A 1 312 TYR 312 312 312 TYR TYR A . n 
A 1 313 LYS 313 313 ?   ?   ?   A . n 
A 1 314 GLY 314 314 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   TYR 3   3   3   TYR TYR B . n 
B 1 4   GLY 4   4   4   GLY GLY B . n 
B 1 5   MET 5   5   5   MET MET B . n 
B 1 6   TYR 6   6   6   TYR TYR B . n 
B 1 7   PHE 7   7   7   PHE PHE B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  HIS 10  10  10  HIS HIS B . n 
B 1 11  VAL 11  11  11  VAL VAL B . n 
B 1 12  THR 12  12  12  THR THR B . n 
B 1 13  PRO 13  13  13  PRO PRO B . n 
B 1 14  TYR 14  14  14  TYR TYR B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  THR 16  16  16  THR THR B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  VAL 18  18  18  VAL VAL B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  ARG 20  20  20  ARG ARG B . n 
B 1 21  MET 21  21  21  MET MET B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  ARG 23  23  23  ARG ARG B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  ALA 26  26  26  ALA ALA B . n 
B 1 27  SER 27  27  27  SER SER B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  THR 30  30  30  THR THR B . n 
B 1 31  PRO 31  31  31  PRO PRO B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  GLN 33  33  33  GLN GLN B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  PHE 36  36  36  PHE PHE B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  PHE 38  38  38  PHE PHE B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  LYS 45  45  45  LYS LYS B . n 
B 1 46  VAL 46  46  46  VAL VAL B . n 
B 1 47  LEU 47  47  47  LEU LEU B . n 
B 1 48  ILE 48  48  48  ILE ILE B . n 
B 1 49  LEU 49  49  49  LEU LEU B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  ASP 52  52  52  ASP ASP B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  GLN 54  54  54  GLN GLN B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  GLU 57  57  57  GLU GLU B . n 
B 1 58  ARG 58  58  58  ARG ARG B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  TYR 61  61  61  TYR TYR B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  HIS 64  64  64  HIS HIS B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  THR 66  66  66  THR THR B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  MET 72  72  72  MET MET B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  THR 74  74  74  THR THR B . n 
B 1 75  HIS 75  75  75  HIS HIS B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ARG 80  80  80  ARG ARG B . n 
B 1 81  VAL 81  81  81  VAL VAL B . n 
B 1 82  LEU 82  82  82  LEU LEU B . n 
B 1 83  ILE 83  83  83  ILE ILE B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  GLY 89  89  89  GLY GLY B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  THR 91  91  91  THR THR B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  ARG 93  93  93  ARG ARG B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  LYS 97  97  97  LYS LYS B . n 
B 1 98  HIS 98  98  98  HIS HIS B . n 
B 1 99  PRO 99  99  99  PRO PRO B . n 
B 1 100 THR 100 100 100 THR THR B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 GLU 102 102 102 GLU GLU B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 VAL 105 105 105 VAL VAL B . n 
B 1 106 MET 106 106 106 MET MET B . n 
B 1 107 VAL 107 107 107 VAL VAL B . n 
B 1 108 ASP 108 108 108 ASP ASP B . n 
B 1 109 ILE 109 109 109 ILE ILE B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 HIS 120 120 120 HIS HIS B . n 
B 1 121 MET 121 121 121 MET MET B . n 
B 1 122 PRO 122 122 122 PRO PRO B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 TRP 124 124 124 TRP TRP B . n 
B 1 125 HIS 125 125 125 HIS HIS B . n 
B 1 126 GLN 126 126 126 GLN GLN B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 ARG 133 133 133 ARG ARG B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 VAL 137 137 137 VAL VAL B . n 
B 1 138 ILE 138 138 138 ILE ILE B . n 
B 1 139 ASP 139 139 139 ASP ASP B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 ALA 141 141 141 ALA ALA B . n 
B 1 142 ARG 142 142 142 ARG ARG B . n 
B 1 143 ALA 143 143 143 ALA ALA B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 GLU 146 146 146 GLU GLU B . n 
B 1 147 ARG 147 147 147 ARG ARG B . n 
B 1 148 THR 148 148 148 THR THR B . n 
B 1 149 GLU 149 149 149 GLU GLU B . n 
B 1 150 GLU 150 150 150 GLU GLU B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 ASP 153 153 153 ASP ASP B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 ILE 157 157 157 ILE ILE B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 THR 160 160 160 THR THR B . n 
B 1 161 ASP 161 161 161 ASP ASP B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 VAL 163 163 163 VAL VAL B . n 
B 1 164 GLY 164 164 164 GLY GLY B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 ASN 167 167 167 ASN ASN B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 ARG 170 170 170 ARG ARG B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 THR 174 174 174 THR THR B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 GLU 176 176 176 GLU GLU B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 TYR 178 178 178 TYR TYR B . n 
B 1 179 ARG 179 179 179 ARG ARG B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 VAL 181 181 181 VAL VAL B . n 
B 1 182 LYS 182 182 182 LYS LYS B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 HIS 184 184 184 HIS HIS B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 PRO 187 187 187 PRO PRO B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 MET 191 191 191 MET MET B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 MET 193 193 193 MET MET B . n 
B 1 194 GLN 194 194 194 GLN GLN B . n 
B 1 195 THR 195 195 195 THR THR B . n 
B 1 196 GLY 196 196 196 GLY GLY B . n 
B 1 197 MET 197 197 197 MET MET B . n 
B 1 198 ILE 198 198 198 ILE ILE B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 HIS 202 202 202 HIS HIS B . n 
B 1 203 HIS 203 203 203 HIS HIS B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 HIS 206 206 206 HIS HIS B . n 
B 1 207 PRO 207 207 207 PRO PRO B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 HIS 210 210 210 HIS HIS B . n 
B 1 211 ARG 211 211 211 ARG ARG B . n 
B 1 212 THR 212 212 212 THR THR B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 ARG 214 214 214 ARG ARG B . n 
B 1 215 GLU 215 215 215 GLU GLU B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 PHE 217 217 217 PHE PHE B . n 
B 1 218 ARG 218 218 218 ARG ARG B . n 
B 1 219 TYR 219 219 219 TYR TYR B . n 
B 1 220 VAL 220 220 220 VAL VAL B . n 
B 1 221 ARG 221 221 221 ARG ARG B . n 
B 1 222 SER 222 222 222 SER SER B . n 
B 1 223 TYR 223 223 223 TYR TYR B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 ASN 225 225 225 ASN ASN B . n 
B 1 226 HIS 226 226 226 HIS HIS B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 PRO 228 228 228 PRO PRO B . n 
B 1 229 GLY 229 229 229 GLY GLY B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 PHE 231 231 231 PHE PHE B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 PHE 234 234 234 PHE PHE B . n 
B 1 235 GLY 235 235 235 GLY GLY B . n 
B 1 236 PHE 236 236 236 PHE PHE B . n 
B 1 237 LEU 237 237 237 LEU LEU B . n 
B 1 238 LEU 238 238 238 LEU LEU B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ASP 241 241 241 ASP ASP B . n 
B 1 242 ALA 242 242 242 ALA ALA B . n 
B 1 243 PHE 243 243 243 PHE PHE B . n 
B 1 244 ASP 244 244 244 ASP ASP B . n 
B 1 245 PRO 245 245 245 PRO PRO B . n 
B 1 246 ALA 246 246 246 ALA ALA B . n 
B 1 247 ALA 247 247 247 ALA ALA B . n 
B 1 248 PHE 248 248 248 PHE PHE B . n 
B 1 249 SER 249 249 249 SER SER B . n 
B 1 250 GLU 250 250 250 GLU GLU B . n 
B 1 251 GLY 251 251 251 GLY GLY B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 ILE 253 253 253 ILE ILE B . n 
B 1 254 GLU 254 254 254 GLU GLU B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 ARG 256 256 256 ARG ARG B . n 
B 1 257 ILE 257 257 257 ILE ILE B . n 
B 1 258 ARG 258 258 258 ARG ARG B . n 
B 1 259 GLU 259 259 259 GLU GLU B . n 
B 1 260 ARG 260 260 260 ARG ARG B . n 
B 1 261 ASN 261 261 261 ASN ASN B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 ALA 263 263 263 ALA ALA B . n 
B 1 264 LEU 264 264 264 LEU LEU B . n 
B 1 265 ARG 265 265 265 ARG ARG B . n 
B 1 266 HIS 266 266 266 HIS HIS B . n 
B 1 267 LEU 267 267 267 LEU LEU B . n 
B 1 268 THR 268 268 268 THR THR B . n 
B 1 269 ALA 269 269 269 ALA ALA B . n 
B 1 270 PRO 270 270 270 PRO PRO B . n 
B 1 271 TYR 271 271 271 TYR TYR B . n 
B 1 272 LEU 272 272 272 LEU LEU B . n 
B 1 273 GLU 273 273 273 GLU GLU B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 MET 275 275 275 MET MET B . n 
B 1 276 PHE 276 276 276 PHE PHE B . n 
B 1 277 VAL 277 277 277 VAL VAL B . n 
B 1 278 LEU 278 278 278 LEU LEU B . n 
B 1 279 PRO 279 279 279 PRO PRO B . n 
B 1 280 LYS 280 280 280 LYS LYS B . n 
B 1 281 ASP 281 281 281 ASP ASP B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 LEU 283 283 283 LEU LEU B . n 
B 1 284 GLU 284 284 284 GLU GLU B . n 
B 1 285 ALA 285 285 285 ALA ALA B . n 
B 1 286 LEU 286 286 286 LEU LEU B . n 
B 1 287 GLU 287 287 287 GLU GLU B . n 
B 1 288 LYS 288 288 288 LYS LYS B . n 
B 1 289 GLU 289 289 289 GLU GLU B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 MET 291 291 291 MET MET B . n 
B 1 292 VAL 292 292 292 VAL VAL B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 THR 294 294 294 THR THR B . n 
B 1 295 ASP 295 295 295 ASP ASP B . n 
B 1 296 GLN 296 296 296 GLN GLN B . n 
B 1 297 ASN 297 297 297 ASN ASN B . n 
B 1 298 PRO 298 298 298 PRO PRO B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 TYR 300 300 300 TYR TYR B . n 
B 1 301 VAL 301 301 301 VAL VAL B . n 
B 1 302 THR 302 302 302 THR THR B . n 
B 1 303 PRO 303 303 303 PRO PRO B . n 
B 1 304 GLU 304 304 304 GLU GLU B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 ALA 307 307 307 ALA ALA B . n 
B 1 308 ARG 308 308 308 ARG ARG B . n 
B 1 309 GLN 309 309 309 GLN GLN B . n 
B 1 310 ALA 310 310 310 ALA ALA B . n 
B 1 311 PRO 311 311 311 PRO PRO B . n 
B 1 312 TYR 312 312 312 TYR TYR B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 GLY 314 314 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   315 1   HOH HOH A . 
C 2 HOH 2   316 5   HOH HOH A . 
C 2 HOH 3   317 8   HOH HOH A . 
C 2 HOH 4   318 11  HOH HOH A . 
C 2 HOH 5   319 12  HOH HOH A . 
C 2 HOH 6   320 13  HOH HOH A . 
C 2 HOH 7   321 18  HOH HOH A . 
C 2 HOH 8   322 19  HOH HOH A . 
C 2 HOH 9   323 20  HOH HOH A . 
C 2 HOH 10  324 23  HOH HOH A . 
C 2 HOH 11  325 24  HOH HOH A . 
C 2 HOH 12  326 25  HOH HOH A . 
C 2 HOH 13  327 26  HOH HOH A . 
C 2 HOH 14  328 27  HOH HOH A . 
C 2 HOH 15  329 31  HOH HOH A . 
C 2 HOH 16  330 32  HOH HOH A . 
C 2 HOH 17  331 35  HOH HOH A . 
C 2 HOH 18  332 37  HOH HOH A . 
C 2 HOH 19  333 38  HOH HOH A . 
C 2 HOH 20  334 39  HOH HOH A . 
C 2 HOH 21  335 40  HOH HOH A . 
C 2 HOH 22  336 43  HOH HOH A . 
C 2 HOH 23  337 45  HOH HOH A . 
C 2 HOH 24  338 49  HOH HOH A . 
C 2 HOH 25  339 51  HOH HOH A . 
C 2 HOH 26  340 55  HOH HOH A . 
C 2 HOH 27  341 57  HOH HOH A . 
C 2 HOH 28  342 63  HOH HOH A . 
C 2 HOH 29  343 66  HOH HOH A . 
C 2 HOH 30  344 67  HOH HOH A . 
C 2 HOH 31  345 68  HOH HOH A . 
C 2 HOH 32  346 70  HOH HOH A . 
C 2 HOH 33  347 71  HOH HOH A . 
C 2 HOH 34  348 72  HOH HOH A . 
C 2 HOH 35  349 73  HOH HOH A . 
C 2 HOH 36  350 74  HOH HOH A . 
C 2 HOH 37  351 76  HOH HOH A . 
C 2 HOH 38  352 78  HOH HOH A . 
C 2 HOH 39  353 79  HOH HOH A . 
C 2 HOH 40  354 80  HOH HOH A . 
C 2 HOH 41  355 83  HOH HOH A . 
C 2 HOH 42  356 87  HOH HOH A . 
C 2 HOH 43  357 89  HOH HOH A . 
C 2 HOH 44  358 92  HOH HOH A . 
C 2 HOH 45  359 93  HOH HOH A . 
C 2 HOH 46  360 95  HOH HOH A . 
C 2 HOH 47  361 96  HOH HOH A . 
C 2 HOH 48  362 97  HOH HOH A . 
C 2 HOH 49  363 100 HOH HOH A . 
C 2 HOH 50  364 101 HOH HOH A . 
C 2 HOH 51  365 102 HOH HOH A . 
C 2 HOH 52  366 104 HOH HOH A . 
C 2 HOH 53  367 105 HOH HOH A . 
C 2 HOH 54  368 106 HOH HOH A . 
C 2 HOH 55  369 107 HOH HOH A . 
C 2 HOH 56  370 108 HOH HOH A . 
C 2 HOH 57  371 111 HOH HOH A . 
C 2 HOH 58  372 113 HOH HOH A . 
C 2 HOH 59  373 114 HOH HOH A . 
C 2 HOH 60  374 115 HOH HOH A . 
C 2 HOH 61  375 116 HOH HOH A . 
C 2 HOH 62  376 117 HOH HOH A . 
C 2 HOH 63  377 118 HOH HOH A . 
C 2 HOH 64  378 120 HOH HOH A . 
C 2 HOH 65  379 121 HOH HOH A . 
C 2 HOH 66  380 122 HOH HOH A . 
C 2 HOH 67  381 124 HOH HOH A . 
C 2 HOH 68  382 125 HOH HOH A . 
C 2 HOH 69  383 126 HOH HOH A . 
C 2 HOH 70  384 127 HOH HOH A . 
C 2 HOH 71  385 128 HOH HOH A . 
C 2 HOH 72  386 130 HOH HOH A . 
C 2 HOH 73  387 131 HOH HOH A . 
C 2 HOH 74  388 134 HOH HOH A . 
C 2 HOH 75  389 135 HOH HOH A . 
C 2 HOH 76  390 139 HOH HOH A . 
C 2 HOH 77  391 140 HOH HOH A . 
C 2 HOH 78  392 141 HOH HOH A . 
C 2 HOH 79  393 145 HOH HOH A . 
C 2 HOH 80  394 147 HOH HOH A . 
C 2 HOH 81  395 148 HOH HOH A . 
C 2 HOH 82  396 149 HOH HOH A . 
C 2 HOH 83  397 150 HOH HOH A . 
C 2 HOH 84  398 151 HOH HOH A . 
C 2 HOH 85  399 154 HOH HOH A . 
C 2 HOH 86  400 160 HOH HOH A . 
C 2 HOH 87  401 162 HOH HOH A . 
C 2 HOH 88  402 163 HOH HOH A . 
C 2 HOH 89  403 168 HOH HOH A . 
C 2 HOH 90  404 169 HOH HOH A . 
C 2 HOH 91  405 170 HOH HOH A . 
C 2 HOH 92  406 171 HOH HOH A . 
C 2 HOH 93  407 173 HOH HOH A . 
C 2 HOH 94  408 174 HOH HOH A . 
C 2 HOH 95  409 177 HOH HOH A . 
C 2 HOH 96  410 181 HOH HOH A . 
C 2 HOH 97  411 182 HOH HOH A . 
C 2 HOH 98  412 189 HOH HOH A . 
C 2 HOH 99  413 195 HOH HOH A . 
C 2 HOH 100 414 196 HOH HOH A . 
C 2 HOH 101 415 200 HOH HOH A . 
C 2 HOH 102 416 201 HOH HOH A . 
C 2 HOH 103 417 204 HOH HOH A . 
C 2 HOH 104 418 207 HOH HOH A . 
C 2 HOH 105 419 209 HOH HOH A . 
C 2 HOH 106 420 210 HOH HOH A . 
C 2 HOH 107 421 211 HOH HOH A . 
C 2 HOH 108 422 223 HOH HOH A . 
C 2 HOH 109 423 224 HOH HOH A . 
C 2 HOH 110 424 225 HOH HOH A . 
C 2 HOH 111 425 226 HOH HOH A . 
C 2 HOH 112 426 228 HOH HOH A . 
C 2 HOH 113 427 231 HOH HOH A . 
C 2 HOH 114 428 233 HOH HOH A . 
C 2 HOH 115 429 234 HOH HOH A . 
C 2 HOH 116 430 235 HOH HOH A . 
C 2 HOH 117 431 238 HOH HOH A . 
C 2 HOH 118 432 239 HOH HOH A . 
C 2 HOH 119 433 242 HOH HOH A . 
C 2 HOH 120 434 243 HOH HOH A . 
C 2 HOH 121 435 244 HOH HOH A . 
C 2 HOH 122 436 247 HOH HOH A . 
C 2 HOH 123 437 248 HOH HOH A . 
C 2 HOH 124 438 256 HOH HOH A . 
C 2 HOH 125 439 257 HOH HOH A . 
C 2 HOH 126 440 258 HOH HOH A . 
C 2 HOH 127 441 263 HOH HOH A . 
C 2 HOH 128 442 264 HOH HOH A . 
C 2 HOH 129 443 267 HOH HOH A . 
C 2 HOH 130 444 269 HOH HOH A . 
C 2 HOH 131 445 270 HOH HOH A . 
C 2 HOH 132 446 271 HOH HOH A . 
C 2 HOH 133 447 272 HOH HOH A . 
C 2 HOH 134 448 274 HOH HOH A . 
C 2 HOH 135 449 277 HOH HOH A . 
C 2 HOH 136 450 278 HOH HOH A . 
C 2 HOH 137 451 280 HOH HOH A . 
C 2 HOH 138 452 282 HOH HOH A . 
C 2 HOH 139 453 283 HOH HOH A . 
C 2 HOH 140 454 284 HOH HOH A . 
C 2 HOH 141 455 285 HOH HOH A . 
C 2 HOH 142 456 286 HOH HOH A . 
C 2 HOH 143 457 287 HOH HOH A . 
C 2 HOH 144 458 288 HOH HOH A . 
C 2 HOH 145 459 289 HOH HOH A . 
C 2 HOH 146 460 290 HOH HOH A . 
C 2 HOH 147 461 292 HOH HOH A . 
C 2 HOH 148 462 293 HOH HOH A . 
C 2 HOH 149 463 297 HOH HOH A . 
C 2 HOH 150 464 312 HOH HOH A . 
C 2 HOH 151 465 328 HOH HOH A . 
C 2 HOH 152 466 329 HOH HOH A . 
C 2 HOH 153 467 330 HOH HOH A . 
C 2 HOH 154 468 333 HOH HOH A . 
C 2 HOH 155 469 337 HOH HOH A . 
C 2 HOH 156 470 338 HOH HOH A . 
C 2 HOH 157 471 339 HOH HOH A . 
C 2 HOH 158 472 340 HOH HOH A . 
C 2 HOH 159 473 342 HOH HOH A . 
C 2 HOH 160 474 343 HOH HOH A . 
C 2 HOH 161 475 347 HOH HOH A . 
C 2 HOH 162 476 348 HOH HOH A . 
C 2 HOH 163 477 349 HOH HOH A . 
C 2 HOH 164 478 350 HOH HOH A . 
C 2 HOH 165 479 351 HOH HOH A . 
C 2 HOH 166 480 352 HOH HOH A . 
C 2 HOH 167 481 353 HOH HOH A . 
C 2 HOH 168 482 354 HOH HOH A . 
C 2 HOH 169 483 355 HOH HOH A . 
C 2 HOH 170 484 356 HOH HOH A . 
C 2 HOH 171 485 357 HOH HOH A . 
C 2 HOH 172 486 358 HOH HOH A . 
C 2 HOH 173 487 359 HOH HOH A . 
C 2 HOH 174 488 360 HOH HOH A . 
D 2 HOH 1   315 2   HOH HOH B . 
D 2 HOH 2   316 3   HOH HOH B . 
D 2 HOH 3   317 4   HOH HOH B . 
D 2 HOH 4   318 6   HOH HOH B . 
D 2 HOH 5   319 7   HOH HOH B . 
D 2 HOH 6   320 9   HOH HOH B . 
D 2 HOH 7   321 10  HOH HOH B . 
D 2 HOH 8   322 14  HOH HOH B . 
D 2 HOH 9   323 15  HOH HOH B . 
D 2 HOH 10  324 16  HOH HOH B . 
D 2 HOH 11  325 17  HOH HOH B . 
D 2 HOH 12  326 21  HOH HOH B . 
D 2 HOH 13  327 22  HOH HOH B . 
D 2 HOH 14  328 28  HOH HOH B . 
D 2 HOH 15  329 29  HOH HOH B . 
D 2 HOH 16  330 30  HOH HOH B . 
D 2 HOH 17  331 33  HOH HOH B . 
D 2 HOH 18  332 34  HOH HOH B . 
D 2 HOH 19  333 36  HOH HOH B . 
D 2 HOH 20  334 41  HOH HOH B . 
D 2 HOH 21  335 42  HOH HOH B . 
D 2 HOH 22  336 44  HOH HOH B . 
D 2 HOH 23  337 46  HOH HOH B . 
D 2 HOH 24  338 47  HOH HOH B . 
D 2 HOH 25  339 48  HOH HOH B . 
D 2 HOH 26  340 50  HOH HOH B . 
D 2 HOH 27  341 52  HOH HOH B . 
D 2 HOH 28  342 53  HOH HOH B . 
D 2 HOH 29  343 54  HOH HOH B . 
D 2 HOH 30  344 56  HOH HOH B . 
D 2 HOH 31  345 58  HOH HOH B . 
D 2 HOH 32  346 59  HOH HOH B . 
D 2 HOH 33  347 60  HOH HOH B . 
D 2 HOH 34  348 61  HOH HOH B . 
D 2 HOH 35  349 62  HOH HOH B . 
D 2 HOH 36  350 64  HOH HOH B . 
D 2 HOH 37  351 65  HOH HOH B . 
D 2 HOH 38  352 69  HOH HOH B . 
D 2 HOH 39  353 75  HOH HOH B . 
D 2 HOH 40  354 77  HOH HOH B . 
D 2 HOH 41  355 81  HOH HOH B . 
D 2 HOH 42  356 82  HOH HOH B . 
D 2 HOH 43  357 84  HOH HOH B . 
D 2 HOH 44  358 85  HOH HOH B . 
D 2 HOH 45  359 86  HOH HOH B . 
D 2 HOH 46  360 88  HOH HOH B . 
D 2 HOH 47  361 90  HOH HOH B . 
D 2 HOH 48  362 91  HOH HOH B . 
D 2 HOH 49  363 94  HOH HOH B . 
D 2 HOH 50  364 98  HOH HOH B . 
D 2 HOH 51  365 99  HOH HOH B . 
D 2 HOH 52  366 103 HOH HOH B . 
D 2 HOH 53  367 109 HOH HOH B . 
D 2 HOH 54  368 110 HOH HOH B . 
D 2 HOH 55  369 112 HOH HOH B . 
D 2 HOH 56  370 119 HOH HOH B . 
D 2 HOH 57  371 123 HOH HOH B . 
D 2 HOH 58  372 129 HOH HOH B . 
D 2 HOH 59  373 132 HOH HOH B . 
D 2 HOH 60  374 133 HOH HOH B . 
D 2 HOH 61  375 136 HOH HOH B . 
D 2 HOH 62  376 137 HOH HOH B . 
D 2 HOH 63  377 138 HOH HOH B . 
D 2 HOH 64  378 142 HOH HOH B . 
D 2 HOH 65  379 143 HOH HOH B . 
D 2 HOH 66  380 144 HOH HOH B . 
D 2 HOH 67  381 146 HOH HOH B . 
D 2 HOH 68  382 152 HOH HOH B . 
D 2 HOH 69  383 153 HOH HOH B . 
D 2 HOH 70  384 155 HOH HOH B . 
D 2 HOH 71  385 156 HOH HOH B . 
D 2 HOH 72  386 157 HOH HOH B . 
D 2 HOH 73  387 158 HOH HOH B . 
D 2 HOH 74  388 159 HOH HOH B . 
D 2 HOH 75  389 161 HOH HOH B . 
D 2 HOH 76  390 164 HOH HOH B . 
D 2 HOH 77  391 165 HOH HOH B . 
D 2 HOH 78  392 166 HOH HOH B . 
D 2 HOH 79  393 167 HOH HOH B . 
D 2 HOH 80  394 172 HOH HOH B . 
D 2 HOH 81  395 175 HOH HOH B . 
D 2 HOH 82  396 176 HOH HOH B . 
D 2 HOH 83  397 178 HOH HOH B . 
D 2 HOH 84  398 179 HOH HOH B . 
D 2 HOH 85  399 180 HOH HOH B . 
D 2 HOH 86  400 183 HOH HOH B . 
D 2 HOH 87  401 184 HOH HOH B . 
D 2 HOH 88  402 185 HOH HOH B . 
D 2 HOH 89  403 186 HOH HOH B . 
D 2 HOH 90  404 187 HOH HOH B . 
D 2 HOH 91  405 188 HOH HOH B . 
D 2 HOH 92  406 190 HOH HOH B . 
D 2 HOH 93  407 191 HOH HOH B . 
D 2 HOH 94  408 192 HOH HOH B . 
D 2 HOH 95  409 193 HOH HOH B . 
D 2 HOH 96  410 194 HOH HOH B . 
D 2 HOH 97  411 197 HOH HOH B . 
D 2 HOH 98  412 198 HOH HOH B . 
D 2 HOH 99  413 199 HOH HOH B . 
D 2 HOH 100 414 202 HOH HOH B . 
D 2 HOH 101 415 203 HOH HOH B . 
D 2 HOH 102 416 205 HOH HOH B . 
D 2 HOH 103 417 206 HOH HOH B . 
D 2 HOH 104 418 208 HOH HOH B . 
D 2 HOH 105 419 212 HOH HOH B . 
D 2 HOH 106 420 213 HOH HOH B . 
D 2 HOH 107 421 214 HOH HOH B . 
D 2 HOH 108 422 215 HOH HOH B . 
D 2 HOH 109 423 216 HOH HOH B . 
D 2 HOH 110 424 217 HOH HOH B . 
D 2 HOH 111 425 218 HOH HOH B . 
D 2 HOH 112 426 219 HOH HOH B . 
D 2 HOH 113 427 220 HOH HOH B . 
D 2 HOH 114 428 221 HOH HOH B . 
D 2 HOH 115 429 222 HOH HOH B . 
D 2 HOH 116 430 227 HOH HOH B . 
D 2 HOH 117 431 229 HOH HOH B . 
D 2 HOH 118 432 230 HOH HOH B . 
D 2 HOH 119 433 232 HOH HOH B . 
D 2 HOH 120 434 236 HOH HOH B . 
D 2 HOH 121 435 237 HOH HOH B . 
D 2 HOH 122 436 240 HOH HOH B . 
D 2 HOH 123 437 241 HOH HOH B . 
D 2 HOH 124 438 245 HOH HOH B . 
D 2 HOH 125 439 246 HOH HOH B . 
D 2 HOH 126 440 249 HOH HOH B . 
D 2 HOH 127 441 250 HOH HOH B . 
D 2 HOH 128 442 251 HOH HOH B . 
D 2 HOH 129 443 252 HOH HOH B . 
D 2 HOH 130 444 253 HOH HOH B . 
D 2 HOH 131 445 254 HOH HOH B . 
D 2 HOH 132 446 255 HOH HOH B . 
D 2 HOH 133 447 259 HOH HOH B . 
D 2 HOH 134 448 260 HOH HOH B . 
D 2 HOH 135 449 261 HOH HOH B . 
D 2 HOH 136 450 262 HOH HOH B . 
D 2 HOH 137 451 265 HOH HOH B . 
D 2 HOH 138 452 266 HOH HOH B . 
D 2 HOH 139 453 268 HOH HOH B . 
D 2 HOH 140 454 273 HOH HOH B . 
D 2 HOH 141 455 275 HOH HOH B . 
D 2 HOH 142 456 276 HOH HOH B . 
D 2 HOH 143 457 279 HOH HOH B . 
D 2 HOH 144 458 281 HOH HOH B . 
D 2 HOH 145 459 291 HOH HOH B . 
D 2 HOH 146 460 294 HOH HOH B . 
D 2 HOH 147 461 295 HOH HOH B . 
D 2 HOH 148 462 296 HOH HOH B . 
D 2 HOH 149 463 298 HOH HOH B . 
D 2 HOH 150 464 299 HOH HOH B . 
D 2 HOH 151 465 300 HOH HOH B . 
D 2 HOH 152 466 301 HOH HOH B . 
D 2 HOH 153 467 302 HOH HOH B . 
D 2 HOH 154 468 303 HOH HOH B . 
D 2 HOH 155 469 304 HOH HOH B . 
D 2 HOH 156 470 305 HOH HOH B . 
D 2 HOH 157 471 306 HOH HOH B . 
D 2 HOH 158 472 307 HOH HOH B . 
D 2 HOH 159 473 308 HOH HOH B . 
D 2 HOH 160 474 309 HOH HOH B . 
D 2 HOH 161 475 310 HOH HOH B . 
D 2 HOH 162 476 311 HOH HOH B . 
D 2 HOH 163 477 313 HOH HOH B . 
D 2 HOH 164 478 314 HOH HOH B . 
D 2 HOH 165 479 315 HOH HOH B . 
D 2 HOH 166 480 316 HOH HOH B . 
D 2 HOH 167 481 317 HOH HOH B . 
D 2 HOH 168 482 318 HOH HOH B . 
D 2 HOH 169 483 319 HOH HOH B . 
D 2 HOH 170 484 320 HOH HOH B . 
D 2 HOH 171 485 321 HOH HOH B . 
D 2 HOH 172 486 322 HOH HOH B . 
D 2 HOH 173 487 323 HOH HOH B . 
D 2 HOH 174 488 324 HOH HOH B . 
D 2 HOH 175 489 325 HOH HOH B . 
D 2 HOH 176 490 326 HOH HOH B . 
D 2 HOH 177 491 327 HOH HOH B . 
D 2 HOH 178 492 331 HOH HOH B . 
D 2 HOH 179 493 332 HOH HOH B . 
D 2 HOH 180 494 334 HOH HOH B . 
D 2 HOH 181 495 335 HOH HOH B . 
D 2 HOH 182 496 336 HOH HOH B . 
D 2 HOH 183 497 341 HOH HOH B . 
D 2 HOH 184 498 344 HOH HOH B . 
D 2 HOH 185 499 345 HOH HOH B . 
D 2 HOH 186 500 346 HOH HOH B . 
D 2 HOH 187 501 361 HOH HOH B . 
D 2 HOH 188 502 362 HOH HOH B . 
D 2 HOH 189 503 363 HOH HOH B . 
D 2 HOH 190 504 364 HOH HOH B . 
D 2 HOH 191 505 365 HOH HOH B . 
D 2 HOH 192 506 366 HOH HOH B . 
D 2 HOH 193 507 367 HOH HOH B . 
D 2 HOH 194 508 368 HOH HOH B . 
D 2 HOH 195 509 369 HOH HOH B . 
D 2 HOH 196 510 370 HOH HOH B . 
D 2 HOH 197 511 371 HOH HOH B . 
D 2 HOH 198 512 372 HOH HOH B . 
D 2 HOH 199 513 373 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 software_defined_assembly            PQS  dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,C,D 
2 1   A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10520 ? 
1 MORE         -90   ? 
1 'SSA (A^2)'  44310 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_666 -y+1,-x+1,-z+3/2 0.0000000000 -1.0000000000 0.0000000000 87.7750000000 -1.0000000000 
0.0000000000 0.0000000000 87.7750000000 0.0000000000 0.0000000000 -1.0000000000 286.2375000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-08-05 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2014-01-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1       ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
EPMR   phasing          .         ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              237 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              237 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              237 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.90 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            14.60 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 11  ? ? -128.67 -54.36  
2 1 ASP A 50  ? ? 68.73   -102.80 
3 1 GLU A 77  ? ? -161.52 78.43   
4 1 VAL B 11  ? ? -126.80 -59.55  
5 1 ASP B 50  ? ? 65.41   -104.70 
6 1 GLU B 77  ? ? -161.59 79.26   
7 1 LEU B 199 ? ? -158.32 72.58   
8 1 PHE B 248 ? ? -71.99  -150.91 
9 1 SER B 249 ? ? 178.72  118.60  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 201 ? A THR 201 
2 1 Y 1 A HIS 202 ? A HIS 202 
3 1 Y 1 A HIS 203 ? A HIS 203 
4 1 Y 1 A LYS 313 ? A LYS 313 
5 1 Y 1 A GLY 314 ? A GLY 314 
6 1 Y 1 B GLY 314 ? B GLY 314 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#