data_1UIT
# 
_entry.id   1UIT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1UIT         pdb_00001uit 10.2210/pdb1uit/pdb 
RCSB  RCSB005869   ?            ?                   
WWPDB D_1000005869 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002000567.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UIT 
_pdbx_database_status.recvd_initial_deposition_date   2003-07-22 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Abe, T.'                                                1 
'Hirota, H.'                                             2 
'Kobayashi, N.'                                          3 
'Hayashi, F.'                                            4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of RSGI RUH-006, The third PDZ domain OF hDlg5 (KIAA0583) protein [Homo sapiens]' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Abe, T.'       1 ? 
primary 'Hirota, H.'    2 ? 
primary 'Kobayashi, N.' 3 ? 
primary 'Hayashi, F.'   4 ? 
primary 'Yokoyama, S.'  5 ? 
# 
_cell.entry_id           1UIT 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UIT 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'HUMAN DISCS LARGE 5 PROTEIN' 
_entity.formula_weight             12499.833 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hDlg5/KIAA0583 protein, Discs, large homolog 5' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVGSIAHQAGLEYGDQLLEFNGINLRSATEQ
QARLIIGQQCDTITILAQYNPHVHQLSSHSRSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVGSIAHQAGLEYGDQLLEFNGINLRSATEQ
QARLIIGQQCDTITILAQYNPHVHQLSSHSRSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002000567.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLY n 
1 9   GLU n 
1 10  ARG n 
1 11  ARG n 
1 12  LYS n 
1 13  ASP n 
1 14  ARG n 
1 15  PRO n 
1 16  TYR n 
1 17  VAL n 
1 18  GLU n 
1 19  GLU n 
1 20  PRO n 
1 21  ARG n 
1 22  HIS n 
1 23  VAL n 
1 24  LYS n 
1 25  VAL n 
1 26  GLN n 
1 27  LYS n 
1 28  GLY n 
1 29  SER n 
1 30  GLU n 
1 31  PRO n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  SER n 
1 36  ILE n 
1 37  VAL n 
1 38  SER n 
1 39  GLY n 
1 40  GLU n 
1 41  LYS n 
1 42  GLY n 
1 43  GLY n 
1 44  ILE n 
1 45  TYR n 
1 46  VAL n 
1 47  SER n 
1 48  LYS n 
1 49  VAL n 
1 50  THR n 
1 51  VAL n 
1 52  GLY n 
1 53  SER n 
1 54  ILE n 
1 55  ALA n 
1 56  HIS n 
1 57  GLN n 
1 58  ALA n 
1 59  GLY n 
1 60  LEU n 
1 61  GLU n 
1 62  TYR n 
1 63  GLY n 
1 64  ASP n 
1 65  GLN n 
1 66  LEU n 
1 67  LEU n 
1 68  GLU n 
1 69  PHE n 
1 70  ASN n 
1 71  GLY n 
1 72  ILE n 
1 73  ASN n 
1 74  LEU n 
1 75  ARG n 
1 76  SER n 
1 77  ALA n 
1 78  THR n 
1 79  GLU n 
1 80  GLN n 
1 81  GLN n 
1 82  ALA n 
1 83  ARG n 
1 84  LEU n 
1 85  ILE n 
1 86  ILE n 
1 87  GLY n 
1 88  GLN n 
1 89  GLN n 
1 90  CYS n 
1 91  ASP n 
1 92  THR n 
1 93  ILE n 
1 94  THR n 
1 95  ILE n 
1 96  LEU n 
1 97  ALA n 
1 98  GLN n 
1 99  TYR n 
1 100 ASN n 
1 101 PRO n 
1 102 HIS n 
1 103 VAL n 
1 104 HIS n 
1 105 GLN n 
1 106 LEU n 
1 107 SER n 
1 108 SER n 
1 109 HIS n 
1 110 SER n 
1 111 ARG n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 SER n 
1 116 SER n 
1 117 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'Kazusa cDNA hj00729' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P021030-24 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis system' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DLG5_HUMAN 
_struct_ref.pdbx_db_accession          Q8TDM6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVGSIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIG
QQCDTITILAQYNPHVHQLSSHSR
;
_struct_ref.pdbx_align_begin           1226 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UIT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 111 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8TDM6 
_struct_ref_seq.db_align_beg                  1226 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1329 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       111 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1UIT GLY A 1   ? UNP Q8TDM6 ? ? 'cloning artifact' 1   1  
1 1UIT SER A 2   ? UNP Q8TDM6 ? ? 'cloning artifact' 2   2  
1 1UIT SER A 3   ? UNP Q8TDM6 ? ? 'cloning artifact' 3   3  
1 1UIT GLY A 4   ? UNP Q8TDM6 ? ? 'cloning artifact' 4   4  
1 1UIT SER A 5   ? UNP Q8TDM6 ? ? 'cloning artifact' 5   5  
1 1UIT SER A 6   ? UNP Q8TDM6 ? ? 'cloning artifact' 6   6  
1 1UIT GLY A 7   ? UNP Q8TDM6 ? ? 'cloning artifact' 7   7  
1 1UIT SER A 112 ? UNP Q8TDM6 ? ? 'cloning artifact' 112 8  
1 1UIT GLY A 113 ? UNP Q8TDM6 ? ? 'cloning artifact' 113 9  
1 1UIT PRO A 114 ? UNP Q8TDM6 ? ? 'cloning artifact' 114 10 
1 1UIT SER A 115 ? UNP Q8TDM6 ? ? 'cloning artifact' 115 11 
1 1UIT SER A 116 ? UNP Q8TDM6 ? ? 'cloning artifact' 116 12 
1 1UIT GLY A 117 ? UNP Q8TDM6 ? ? 'cloning artifact' 117 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.3mM RSGI RUH-006 U-15N, 13C; 20mM d-Tris-HCl buffer; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_refine.entry_id           1UIT 
_pdbx_nmr_refine.method             'simulated annealing, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1UIT 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1UIT 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1UIT 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'the structure with the lowest energy and score of target function was selected.' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR    6.1C     collection      Varian           1 
NMRPipe 20020425 processing      'Delaglio, F.'   2 
NMRView 5.0.4    'data analysis' 'Johnson, B. A.' 3 
KUJIRA  0.816    'data analysis' 'Kobayashi, N.'  4 
CYANA   1.0.7    refinement      'Guentert, P.'   5 
# 
_exptl.entry_id          1UIT 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1UIT 
_struct.title                     
'Solution structure of RSGI RUH-006, The third PDZ domain OF hDlg5 (KIAA0583) protein [Homo sapiens]' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UIT 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
'PDZ domain, hDlg5, MAGUK family, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 53 ? GLY A 59 ? SER A 53 GLY A 59 1 ? 7 
HELX_P HELX_P2 2 THR A 78 ? ILE A 86 ? THR A 78 ILE A 86 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 21 ? GLN A 26 ? ARG A 21 GLN A 26 
A 2 THR A 92 ? ALA A 97 ? THR A 92 ALA A 97 
A 3 GLU A 68 ? PHE A 69 ? GLU A 68 PHE A 69 
A 4 ILE A 72 ? ASN A 73 ? ILE A 72 ASN A 73 
B 1 ILE A 34 ? SER A 38 ? ILE A 34 SER A 38 
B 2 ILE A 44 ? VAL A 49 ? ILE A 44 VAL A 49 
B 3 GLN A 65 ? LEU A 66 ? GLN A 65 LEU A 66 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 21 ? N ARG A 21 O ALA A 97 ? O ALA A 97 
A 2 3 O LEU A 96 ? O LEU A 96 N GLU A 68 ? N GLU A 68 
A 3 4 N PHE A 69 ? N PHE A 69 O ILE A 72 ? O ILE A 72 
B 1 2 N SER A 35 ? N SER A 35 O LYS A 48 ? O LYS A 48 
B 2 3 N ILE A 44 ? N ILE A 44 O LEU A 66 ? O LEU A 66 
# 
_database_PDB_matrix.entry_id          1UIT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UIT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -34.071 -1.973  -20.799 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -33.686 -0.872  -19.933 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -32.379 -1.183  -19.200 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -31.778 -2.235  -19.413 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -33.343 -2.628  -21.000 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -33.568 0.037   -20.523 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -34.477 -0.681  -19.208 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -31.978 -0.249  -18.350 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -30.754 -0.410  -17.584 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -30.682 0.650   -16.483 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -31.280 1.718   -16.605 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -29.523 -0.321  -18.488 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -28.334 -0.059  -17.747 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -32.472 0.604   -18.182 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -30.814 -1.408  -17.150 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -29.409 -1.255  -19.039 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -29.671 0.468   -19.226 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -28.076 0.902   -17.842 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -29.944 0.319   -15.434 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -29.786 1.229   -14.313 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -28.346 1.180   -13.798 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -27.652 2.196   -13.787 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -30.764 0.891   -13.186 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -32.108 0.806   -13.654 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -29.460 -0.551  -15.343 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -30.017 2.218   -14.709 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -30.478 -0.057  -12.730 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -30.699 1.652   -12.408 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -32.612 1.629   -13.397 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -27.940 -0.011  -13.383 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -26.595 -0.205  -12.868 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -26.623 -0.938  -11.525 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -27.564 -0.781  -10.748 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -28.511 -0.831  -13.395 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -26.006 -0.776  -13.585 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -26.104 0.761   -12.749 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -25.581 -1.722  -11.293 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -25.474 -2.479  -10.058 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -24.089 -3.122  -9.956  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -23.396 -3.273  -10.960 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -26.564 -3.550  -9.972  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -27.703 -3.096  -9.248  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -24.820 -1.844  -11.931 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -25.618 -1.751  -9.260  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -26.866 -3.841  -10.978 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -26.160 -4.441  -9.491  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -28.028 -3.816  -8.635  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -23.728 -3.482  -8.733  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -22.438 -4.105  -8.487  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -22.606 -5.300  -7.546  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -23.648 -5.454  -6.912  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -21.446 -3.101  -7.897  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -21.992 -2.402  -6.782  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -24.298 -3.356  -7.921  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -22.085 -4.433  -9.464  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -20.540 -3.624  -7.589  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -21.154 -2.385  -8.666  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -22.210 -3.046  -6.049  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -21.563 -6.116  -7.487  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -21.581 -7.293  -6.635  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -20.233 -8.015  -6.669  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -19.449 -7.831  -7.599  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -20.719 -5.983  -8.007  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -21.816 -7.001  -5.611  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -22.370 -7.971  -6.962  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . GLY A 1 8   ? -20.004 -8.822  -5.643  1.00 0.00 ? 8   GLY A N    1  
ATOM 67    C CA   . GLY A 1 8   ? -18.764 -9.573  -5.544  1.00 0.00 ? 8   GLY A CA   1  
ATOM 68    C C    . GLY A 1 8   ? -19.025 -11.000 -5.058  1.00 0.00 ? 8   GLY A C    1  
ATOM 69    O O    . GLY A 1 8   ? -20.154 -11.484 -5.119  1.00 0.00 ? 8   GLY A O    1  
ATOM 70    H H    . GLY A 1 8   ? -20.647 -8.966  -4.891  1.00 0.00 ? 8   GLY A H    1  
ATOM 71    H HA2  . GLY A 1 8   ? -18.273 -9.601  -6.517  1.00 0.00 ? 8   GLY A HA2  1  
ATOM 72    H HA3  . GLY A 1 8   ? -18.084 -9.070  -4.857  1.00 0.00 ? 8   GLY A HA3  1  
ATOM 73    N N    . GLU A 1 9   ? -17.962 -11.634 -4.586  1.00 0.00 ? 9   GLU A N    1  
ATOM 74    C CA   . GLU A 1 9   ? -18.061 -12.996 -4.089  1.00 0.00 ? 9   GLU A CA   1  
ATOM 75    C C    . GLU A 1 9   ? -16.855 -13.329 -3.209  1.00 0.00 ? 9   GLU A C    1  
ATOM 76    O O    . GLU A 1 9   ? -15.738 -13.464 -3.705  1.00 0.00 ? 9   GLU A O    1  
ATOM 77    C CB   . GLU A 1 9   ? -18.190 -13.992 -5.243  1.00 0.00 ? 9   GLU A CB   1  
ATOM 78    C CG   . GLU A 1 9   ? -19.597 -14.589 -5.297  1.00 0.00 ? 9   GLU A CG   1  
ATOM 79    C CD   . GLU A 1 9   ? -19.568 -16.013 -5.857  1.00 0.00 ? 9   GLU A CD   1  
ATOM 80    O OE1  . GLU A 1 9   ? -19.228 -16.146 -7.053  1.00 0.00 ? 9   GLU A OE1  1  
ATOM 81    O OE2  . GLU A 1 9   ? -19.885 -16.936 -5.077  1.00 0.00 ? 9   GLU A OE2  1  
ATOM 82    H H    . GLU A 1 9   ? -17.047 -11.233 -4.539  1.00 0.00 ? 9   GLU A H    1  
ATOM 83    H HA   . GLU A 1 9   ? -18.973 -13.021 -3.492  1.00 0.00 ? 9   GLU A HA   1  
ATOM 84    H HB2  . GLU A 1 9   ? -17.966 -13.493 -6.186  1.00 0.00 ? 9   GLU A HB2  1  
ATOM 85    H HB3  . GLU A 1 9   ? -17.457 -14.790 -5.123  1.00 0.00 ? 9   GLU A HB3  1  
ATOM 86    H HG2  . GLU A 1 9   ? -20.032 -14.597 -4.298  1.00 0.00 ? 9   GLU A HG2  1  
ATOM 87    H HG3  . GLU A 1 9   ? -20.238 -13.964 -5.919  1.00 0.00 ? 9   GLU A HG3  1  
ATOM 88    N N    . ARG A 1 10  ? -17.122 -13.453 -1.917  1.00 0.00 ? 10  ARG A N    1  
ATOM 89    C CA   . ARG A 1 10  ? -16.072 -13.769 -0.963  1.00 0.00 ? 10  ARG A CA   1  
ATOM 90    C C    . ARG A 1 10  ? -15.800 -15.274 -0.951  1.00 0.00 ? 10  ARG A C    1  
ATOM 91    O O    . ARG A 1 10  ? -16.694 -16.068 -0.661  1.00 0.00 ? 10  ARG A O    1  
ATOM 92    C CB   . ARG A 1 10  ? -16.456 -13.316 0.447   1.00 0.00 ? 10  ARG A CB   1  
ATOM 93    C CG   . ARG A 1 10  ? -15.716 -12.033 0.831   1.00 0.00 ? 10  ARG A CG   1  
ATOM 94    C CD   . ARG A 1 10  ? -15.624 -11.887 2.352   1.00 0.00 ? 10  ARG A CD   1  
ATOM 95    N NE   . ARG A 1 10  ? -15.692 -10.457 2.728   1.00 0.00 ? 10  ARG A NE   1  
ATOM 96    C CZ   . ARG A 1 10  ? -15.280 -9.970  3.906   1.00 0.00 ? 10  ARG A CZ   1  
ATOM 97    N NH1  . ARG A 1 10  ? -14.768 -10.794 4.830   1.00 0.00 ? 10  ARG A NH1  1  
ATOM 98    N NH2  . ARG A 1 10  ? -15.381 -8.658  4.161   1.00 0.00 ? 10  ARG A NH2  1  
ATOM 99    H H    . ARG A 1 10  ? -18.033 -13.342 -1.521  1.00 0.00 ? 10  ARG A H    1  
ATOM 100   H HA   . ARG A 1 10  ? -15.201 -13.215 -1.314  1.00 0.00 ? 10  ARG A HA   1  
ATOM 101   H HB2  . ARG A 1 10  ? -17.532 -13.149 0.500   1.00 0.00 ? 10  ARG A HB2  1  
ATOM 102   H HB3  . ARG A 1 10  ? -16.220 -14.103 1.163   1.00 0.00 ? 10  ARG A HB3  1  
ATOM 103   H HG2  . ARG A 1 10  ? -14.714 -12.044 0.402   1.00 0.00 ? 10  ARG A HG2  1  
ATOM 104   H HG3  . ARG A 1 10  ? -16.233 -11.170 0.410   1.00 0.00 ? 10  ARG A HG3  1  
ATOM 105   H HD2  . ARG A 1 10  ? -16.436 -12.436 2.828   1.00 0.00 ? 10  ARG A HD2  1  
ATOM 106   H HD3  . ARG A 1 10  ? -14.692 -12.322 2.711   1.00 0.00 ? 10  ARG A HD3  1  
ATOM 107   H HE   . ARG A 1 10  ? -16.070 -9.814  2.061   1.00 0.00 ? 10  ARG A HE   1  
ATOM 108   H HH11 . ARG A 1 10  ? -14.693 -11.773 4.640   1.00 0.00 ? 10  ARG A HH11 1  
ATOM 109   H HH12 . ARG A 1 10  ? -14.461 -10.431 5.709   1.00 0.00 ? 10  ARG A HH12 1  
ATOM 110   H HH21 . ARG A 1 10  ? -15.763 -8.043  3.471   1.00 0.00 ? 10  ARG A HH21 1  
ATOM 111   H HH22 . ARG A 1 10  ? -15.073 -8.294  5.040   1.00 0.00 ? 10  ARG A HH22 1  
ATOM 112   N N    . ARG A 1 11  ? -14.562 -15.622 -1.270  1.00 0.00 ? 11  ARG A N    1  
ATOM 113   C CA   . ARG A 1 11  ? -14.161 -17.018 -1.300  1.00 0.00 ? 11  ARG A CA   1  
ATOM 114   C C    . ARG A 1 11  ? -12.872 -17.218 -0.501  1.00 0.00 ? 11  ARG A C    1  
ATOM 115   O O    . ARG A 1 11  ? -12.231 -16.248 -0.097  1.00 0.00 ? 11  ARG A O    1  
ATOM 116   C CB   . ARG A 1 11  ? -13.942 -17.498 -2.736  1.00 0.00 ? 11  ARG A CB   1  
ATOM 117   C CG   . ARG A 1 11  ? -15.022 -18.498 -3.151  1.00 0.00 ? 11  ARG A CG   1  
ATOM 118   C CD   . ARG A 1 11  ? -15.148 -18.569 -4.674  1.00 0.00 ? 11  ARG A CD   1  
ATOM 119   N NE   . ARG A 1 11  ? -15.112 -19.980 -5.120  1.00 0.00 ? 11  ARG A NE   1  
ATOM 120   C CZ   . ARG A 1 11  ? -13.998 -20.723 -5.174  1.00 0.00 ? 11  ARG A CZ   1  
ATOM 121   N NH1  . ARG A 1 11  ? -12.822 -20.194 -4.809  1.00 0.00 ? 11  ARG A NH1  1  
ATOM 122   N NH2  . ARG A 1 11  ? -14.060 -21.994 -5.591  1.00 0.00 ? 11  ARG A NH2  1  
ATOM 123   H H    . ARG A 1 11  ? -13.841 -14.970 -1.505  1.00 0.00 ? 11  ARG A H    1  
ATOM 124   H HA   . ARG A 1 11  ? -14.992 -17.557 -0.844  1.00 0.00 ? 11  ARG A HA   1  
ATOM 125   H HB2  . ARG A 1 11  ? -13.952 -16.644 -3.414  1.00 0.00 ? 11  ARG A HB2  1  
ATOM 126   H HB3  . ARG A 1 11  ? -12.959 -17.961 -2.823  1.00 0.00 ? 11  ARG A HB3  1  
ATOM 127   H HG2  . ARG A 1 11  ? -14.780 -19.485 -2.757  1.00 0.00 ? 11  ARG A HG2  1  
ATOM 128   H HG3  . ARG A 1 11  ? -15.979 -18.207 -2.717  1.00 0.00 ? 11  ARG A HG3  1  
ATOM 129   H HD2  . ARG A 1 11  ? -16.080 -18.102 -4.993  1.00 0.00 ? 11  ARG A HD2  1  
ATOM 130   H HD3  . ARG A 1 11  ? -14.336 -18.011 -5.141  1.00 0.00 ? 11  ARG A HD3  1  
ATOM 131   H HE   . ARG A 1 11  ? -15.973 -20.405 -5.399  1.00 0.00 ? 11  ARG A HE   1  
ATOM 132   H HH11 . ARG A 1 11  ? -12.776 -19.245 -4.498  1.00 0.00 ? 11  ARG A HH11 1  
ATOM 133   H HH12 . ARG A 1 11  ? -11.991 -20.748 -4.849  1.00 0.00 ? 11  ARG A HH12 1  
ATOM 134   H HH21 . ARG A 1 11  ? -14.938 -22.389 -5.863  1.00 0.00 ? 11  ARG A HH21 1  
ATOM 135   H HH22 . ARG A 1 11  ? -13.229 -22.549 -5.631  1.00 0.00 ? 11  ARG A HH22 1  
ATOM 136   N N    . LYS A 1 12  ? -12.530 -18.481 -0.295  1.00 0.00 ? 12  LYS A N    1  
ATOM 137   C CA   . LYS A 1 12  ? -11.329 -18.820 0.449   1.00 0.00 ? 12  LYS A CA   1  
ATOM 138   C C    . LYS A 1 12  ? -10.118 -18.739 -0.483  1.00 0.00 ? 12  LYS A C    1  
ATOM 139   O O    . LYS A 1 12  ? -9.551  -19.763 -0.861  1.00 0.00 ? 12  LYS A O    1  
ATOM 140   C CB   . LYS A 1 12  ? -11.488 -20.179 1.134   1.00 0.00 ? 12  LYS A CB   1  
ATOM 141   C CG   . LYS A 1 12  ? -11.731 -20.011 2.635   1.00 0.00 ? 12  LYS A CG   1  
ATOM 142   C CD   . LYS A 1 12  ? -12.068 -21.352 3.289   1.00 0.00 ? 12  LYS A CD   1  
ATOM 143   C CE   . LYS A 1 12  ? -12.336 -21.180 4.786   1.00 0.00 ? 12  LYS A CE   1  
ATOM 144   N NZ   . LYS A 1 12  ? -13.264 -22.226 5.269   1.00 0.00 ? 12  LYS A NZ   1  
ATOM 145   H H    . LYS A 1 12  ? -13.057 -19.264 -0.627  1.00 0.00 ? 12  LYS A H    1  
ATOM 146   H HA   . LYS A 1 12  ? -11.211 -18.074 1.235   1.00 0.00 ? 12  LYS A HA   1  
ATOM 147   H HB2  . LYS A 1 12  ? -12.321 -20.721 0.685   1.00 0.00 ? 12  LYS A HB2  1  
ATOM 148   H HB3  . LYS A 1 12  ? -10.593 -20.779 0.971   1.00 0.00 ? 12  LYS A HB3  1  
ATOM 149   H HG2  . LYS A 1 12  ? -10.845 -19.585 3.105   1.00 0.00 ? 12  LYS A HG2  1  
ATOM 150   H HG3  . LYS A 1 12  ? -12.548 -19.307 2.798   1.00 0.00 ? 12  LYS A HG3  1  
ATOM 151   H HD2  . LYS A 1 12  ? -12.943 -21.787 2.807   1.00 0.00 ? 12  LYS A HD2  1  
ATOM 152   H HD3  . LYS A 1 12  ? -11.243 -22.050 3.141   1.00 0.00 ? 12  LYS A HD3  1  
ATOM 153   H HE2  . LYS A 1 12  ? -11.397 -21.235 5.338   1.00 0.00 ? 12  LYS A HE2  1  
ATOM 154   H HE3  . LYS A 1 12  ? -12.759 -20.194 4.975   1.00 0.00 ? 12  LYS A HE3  1  
ATOM 155   H HZ1  . LYS A 1 12  ? -13.838 -22.539 4.512   1.00 0.00 ? 12  LYS A HZ1  1  
ATOM 156   H HZ2  . LYS A 1 12  ? -12.739 -22.997 5.630   1.00 0.00 ? 12  LYS A HZ2  1  
ATOM 157   H HZ3  . LYS A 1 12  ? -13.843 -21.850 5.993   1.00 0.00 ? 12  LYS A HZ3  1  
ATOM 158   N N    . ASP A 1 13  ? -9.756  -17.511 -0.825  1.00 0.00 ? 13  ASP A N    1  
ATOM 159   C CA   . ASP A 1 13  ? -8.622  -17.283 -1.705  1.00 0.00 ? 13  ASP A CA   1  
ATOM 160   C C    . ASP A 1 13  ? -7.637  -16.331 -1.024  1.00 0.00 ? 13  ASP A C    1  
ATOM 161   O O    . ASP A 1 13  ? -8.044  -15.432 -0.289  1.00 0.00 ? 13  ASP A O    1  
ATOM 162   C CB   . ASP A 1 13  ? -9.066  -16.642 -3.021  1.00 0.00 ? 13  ASP A CB   1  
ATOM 163   C CG   . ASP A 1 13  ? -8.913  -17.531 -4.257  1.00 0.00 ? 13  ASP A CG   1  
ATOM 164   O OD1  . ASP A 1 13  ? -7.786  -18.030 -4.461  1.00 0.00 ? 13  ASP A OD1  1  
ATOM 165   O OD2  . ASP A 1 13  ? -9.927  -17.690 -4.970  1.00 0.00 ? 13  ASP A OD2  1  
ATOM 166   H H    . ASP A 1 13  ? -10.222 -16.683 -0.513  1.00 0.00 ? 13  ASP A H    1  
ATOM 167   H HA   . ASP A 1 13  ? -8.194  -18.270 -1.882  1.00 0.00 ? 13  ASP A HA   1  
ATOM 168   H HB2  . ASP A 1 13  ? -10.112 -16.349 -2.930  1.00 0.00 ? 13  ASP A HB2  1  
ATOM 169   H HB3  . ASP A 1 13  ? -8.492  -15.729 -3.175  1.00 0.00 ? 13  ASP A HB3  1  
ATOM 170   N N    . ARG A 1 14  ? -6.360  -16.560 -1.292  1.00 0.00 ? 14  ARG A N    1  
ATOM 171   C CA   . ARG A 1 14  ? -5.314  -15.734 -0.715  1.00 0.00 ? 14  ARG A CA   1  
ATOM 172   C C    . ARG A 1 14  ? -5.628  -14.252 -0.931  1.00 0.00 ? 14  ARG A C    1  
ATOM 173   O O    . ARG A 1 14  ? -6.248  -13.884 -1.927  1.00 0.00 ? 14  ARG A O    1  
ATOM 174   C CB   . ARG A 1 14  ? -3.953  -16.055 -1.335  1.00 0.00 ? 14  ARG A CB   1  
ATOM 175   C CG   . ARG A 1 14  ? -3.241  -17.160 -0.552  1.00 0.00 ? 14  ARG A CG   1  
ATOM 176   C CD   . ARG A 1 14  ? -2.235  -17.899 -1.438  1.00 0.00 ? 14  ARG A CD   1  
ATOM 177   N NE   . ARG A 1 14  ? -2.164  -19.324 -1.043  1.00 0.00 ? 14  ARG A NE   1  
ATOM 178   C CZ   . ARG A 1 14  ? -1.378  -20.230 -1.640  1.00 0.00 ? 14  ARG A CZ   1  
ATOM 179   N NH1  . ARG A 1 14  ? -0.591  -19.865 -2.661  1.00 0.00 ? 14  ARG A NH1  1  
ATOM 180   N NH2  . ARG A 1 14  ? -1.379  -21.501 -1.215  1.00 0.00 ? 14  ARG A NH2  1  
ATOM 181   H H    . ARG A 1 14  ? -6.037  -17.293 -1.891  1.00 0.00 ? 14  ARG A H    1  
ATOM 182   H HA   . ARG A 1 14  ? -5.315  -15.984 0.346   1.00 0.00 ? 14  ARG A HA   1  
ATOM 183   H HB2  . ARG A 1 14  ? -4.085  -16.366 -2.371  1.00 0.00 ? 14  ARG A HB2  1  
ATOM 184   H HB3  . ARG A 1 14  ? -3.334  -15.158 -1.348  1.00 0.00 ? 14  ARG A HB3  1  
ATOM 185   H HG2  . ARG A 1 14  ? -2.726  -16.729 0.307   1.00 0.00 ? 14  ARG A HG2  1  
ATOM 186   H HG3  . ARG A 1 14  ? -3.975  -17.866 -0.162  1.00 0.00 ? 14  ARG A HG3  1  
ATOM 187   H HD2  . ARG A 1 14  ? -2.530  -17.816 -2.484  1.00 0.00 ? 14  ARG A HD2  1  
ATOM 188   H HD3  . ARG A 1 14  ? -1.251  -17.439 -1.347  1.00 0.00 ? 14  ARG A HD3  1  
ATOM 189   H HE   . ARG A 1 14  ? -2.740  -19.629 -0.285  1.00 0.00 ? 14  ARG A HE   1  
ATOM 190   H HH11 . ARG A 1 14  ? -0.590  -18.917 -2.978  1.00 0.00 ? 14  ARG A HH11 1  
ATOM 191   H HH12 . ARG A 1 14  ? -0.004  -20.542 -3.106  1.00 0.00 ? 14  ARG A HH12 1  
ATOM 192   H HH21 . ARG A 1 14  ? -1.967  -21.773 -0.453  1.00 0.00 ? 14  ARG A HH21 1  
ATOM 193   H HH22 . ARG A 1 14  ? -0.792  -22.177 -1.660  1.00 0.00 ? 14  ARG A HH22 1  
ATOM 194   N N    . PRO A 1 15  ? -5.174  -13.420 0.045   1.00 0.00 ? 15  PRO A N    1  
ATOM 195   C CA   . PRO A 1 15  ? -5.400  -11.987 -0.029  1.00 0.00 ? 15  PRO A CA   1  
ATOM 196   C C    . PRO A 1 15  ? -4.475  -11.338 -1.061  1.00 0.00 ? 15  PRO A C    1  
ATOM 197   O O    . PRO A 1 15  ? -4.738  -10.230 -1.526  1.00 0.00 ? 15  PRO A O    1  
ATOM 198   C CB   . PRO A 1 15  ? -5.163  -11.478 1.384   1.00 0.00 ? 15  PRO A CB   1  
ATOM 199   C CG   . PRO A 1 15  ? -4.365  -12.562 2.089   1.00 0.00 ? 15  PRO A CG   1  
ATOM 200   C CD   . PRO A 1 15  ? -4.436  -13.821 1.239   1.00 0.00 ? 15  PRO A CD   1  
ATOM 201   H HA   . PRO A 1 15  ? -6.331  -11.798 -0.340  1.00 0.00 ? 15  PRO A HA   1  
ATOM 202   H HB2  . PRO A 1 15  ? -4.616  -10.535 1.373   1.00 0.00 ? 15  PRO A HB2  1  
ATOM 203   H HB3  . PRO A 1 15  ? -6.108  -11.293 1.895   1.00 0.00 ? 15  PRO A HB3  1  
ATOM 204   H HG2  . PRO A 1 15  ? -3.330  -12.249 2.222   1.00 0.00 ? 15  PRO A HG2  1  
ATOM 205   H HG3  . PRO A 1 15  ? -4.771  -12.750 3.083   1.00 0.00 ? 15  PRO A HG3  1  
ATOM 206   H HD2  . PRO A 1 15  ? -3.440  -14.184 0.986   1.00 0.00 ? 15  PRO A HD2  1  
ATOM 207   H HD3  . PRO A 1 15  ? -4.945  -14.627 1.767   1.00 0.00 ? 15  PRO A HD3  1  
ATOM 208   N N    . TYR A 1 16  ? -3.411  -12.056 -1.388  1.00 0.00 ? 16  TYR A N    1  
ATOM 209   C CA   . TYR A 1 16  ? -2.445  -11.564 -2.356  1.00 0.00 ? 16  TYR A CA   1  
ATOM 210   C C    . TYR A 1 16  ? -1.678  -10.361 -1.804  1.00 0.00 ? 16  TYR A C    1  
ATOM 211   O O    . TYR A 1 16  ? -0.464  -10.424 -1.622  1.00 0.00 ? 16  TYR A O    1  
ATOM 212   C CB   . TYR A 1 16  ? -3.258  -11.120 -3.574  1.00 0.00 ? 16  TYR A CB   1  
ATOM 213   C CG   . TYR A 1 16  ? -2.720  -11.645 -4.907  1.00 0.00 ? 16  TYR A CG   1  
ATOM 214   C CD1  . TYR A 1 16  ? -2.506  -12.998 -5.079  1.00 0.00 ? 16  TYR A CD1  1  
ATOM 215   C CD2  . TYR A 1 16  ? -2.448  -10.767 -5.936  1.00 0.00 ? 16  TYR A CD2  1  
ATOM 216   C CE1  . TYR A 1 16  ? -2.000  -13.492 -6.334  1.00 0.00 ? 16  TYR A CE1  1  
ATOM 217   C CE2  . TYR A 1 16  ? -1.942  -11.261 -7.190  1.00 0.00 ? 16  TYR A CE2  1  
ATOM 218   C CZ   . TYR A 1 16  ? -1.742  -12.599 -7.327  1.00 0.00 ? 16  TYR A CZ   1  
ATOM 219   O OH   . TYR A 1 16  ? -1.264  -13.066 -8.511  1.00 0.00 ? 16  TYR A OH   1  
ATOM 220   H H    . TYR A 1 16  ? -3.204  -12.956 -1.005  1.00 0.00 ? 16  TYR A H    1  
ATOM 221   H HA   . TYR A 1 16  ? -1.741  -12.369 -2.568  1.00 0.00 ? 16  TYR A HA   1  
ATOM 222   H HB2  . TYR A 1 16  ? -4.288  -11.455 -3.453  1.00 0.00 ? 16  TYR A HB2  1  
ATOM 223   H HB3  . TYR A 1 16  ? -3.279  -10.031 -3.607  1.00 0.00 ? 16  TYR A HB3  1  
ATOM 224   H HD1  . TYR A 1 16  ? -2.720  -13.692 -4.267  1.00 0.00 ? 16  TYR A HD1  1  
ATOM 225   H HD2  . TYR A 1 16  ? -2.617  -9.698  -5.799  1.00 0.00 ? 16  TYR A HD2  1  
ATOM 226   H HE1  . TYR A 1 16  ? -1.826  -14.558 -6.483  1.00 0.00 ? 16  TYR A HE1  1  
ATOM 227   H HE2  . TYR A 1 16  ? -1.723  -10.578 -8.011  1.00 0.00 ? 16  TYR A HE2  1  
ATOM 228   H HH   . TYR A 1 16  ? -1.462  -14.042 -8.599  1.00 0.00 ? 16  TYR A HH   1  
ATOM 229   N N    . VAL A 1 17  ? -2.420  -9.292  -1.551  1.00 0.00 ? 17  VAL A N    1  
ATOM 230   C CA   . VAL A 1 17  ? -1.825  -8.076  -1.023  1.00 0.00 ? 17  VAL A CA   1  
ATOM 231   C C    . VAL A 1 17  ? -2.821  -7.393  -0.083  1.00 0.00 ? 17  VAL A C    1  
ATOM 232   O O    . VAL A 1 17  ? -4.030  -7.460  -0.300  1.00 0.00 ? 17  VAL A O    1  
ATOM 233   C CB   . VAL A 1 17  ? -1.372  -7.174  -2.172  1.00 0.00 ? 17  VAL A CB   1  
ATOM 234   C CG1  . VAL A 1 17  ? -2.573  -6.592  -2.919  1.00 0.00 ? 17  VAL A CG1  1  
ATOM 235   C CG2  . VAL A 1 17  ? -0.450  -6.062  -1.665  1.00 0.00 ? 17  VAL A CG2  1  
ATOM 236   H H    . VAL A 1 17  ? -3.408  -9.249  -1.702  1.00 0.00 ? 17  VAL A H    1  
ATOM 237   H HA   . VAL A 1 17  ? -0.943  -8.364  -0.451  1.00 0.00 ? 17  VAL A HA   1  
ATOM 238   H HB   . VAL A 1 17  ? -0.804  -7.785  -2.874  1.00 0.00 ? 17  VAL A HB   1  
ATOM 239   H HG11 . VAL A 1 17  ? -2.889  -7.288  -3.697  1.00 0.00 ? 17  VAL A HG11 1  
ATOM 240   H HG12 . VAL A 1 17  ? -3.394  -6.432  -2.220  1.00 0.00 ? 17  VAL A HG12 1  
ATOM 241   H HG13 . VAL A 1 17  ? -2.293  -5.642  -3.374  1.00 0.00 ? 17  VAL A HG13 1  
ATOM 242   H HG21 . VAL A 1 17  ? -1.051  -5.262  -1.233  1.00 0.00 ? 17  VAL A HG21 1  
ATOM 243   H HG22 . VAL A 1 17  ? 0.220   -6.464  -0.906  1.00 0.00 ? 17  VAL A HG22 1  
ATOM 244   H HG23 . VAL A 1 17  ? 0.136   -5.669  -2.496  1.00 0.00 ? 17  VAL A HG23 1  
ATOM 245   N N    . GLU A 1 18  ? -2.276  -6.753  0.940   1.00 0.00 ? 18  GLU A N    1  
ATOM 246   C CA   . GLU A 1 18  ? -3.101  -6.058  1.914   1.00 0.00 ? 18  GLU A CA   1  
ATOM 247   C C    . GLU A 1 18  ? -4.230  -5.302  1.210   1.00 0.00 ? 18  GLU A C    1  
ATOM 248   O O    . GLU A 1 18  ? -3.989  -4.289  0.555   1.00 0.00 ? 18  GLU A O    1  
ATOM 249   C CB   . GLU A 1 18  ? -2.258  -5.111  2.771   1.00 0.00 ? 18  GLU A CB   1  
ATOM 250   C CG   . GLU A 1 18  ? -1.022  -5.825  3.323   1.00 0.00 ? 18  GLU A CG   1  
ATOM 251   C CD   . GLU A 1 18  ? -0.958  -5.711  4.847   1.00 0.00 ? 18  GLU A CD   1  
ATOM 252   O OE1  . GLU A 1 18  ? -0.438  -4.676  5.318   1.00 0.00 ? 18  GLU A OE1  1  
ATOM 253   O OE2  . GLU A 1 18  ? -1.431  -6.661  5.507   1.00 0.00 ? 18  GLU A OE2  1  
ATOM 254   H H    . GLU A 1 18  ? -1.291  -6.704  1.109   1.00 0.00 ? 18  GLU A H    1  
ATOM 255   H HA   . GLU A 1 18  ? -3.519  -6.839  2.549   1.00 0.00 ? 18  GLU A HA   1  
ATOM 256   H HB2  . GLU A 1 18  ? -1.951  -4.252  2.175   1.00 0.00 ? 18  GLU A HB2  1  
ATOM 257   H HB3  . GLU A 1 18  ? -2.860  -4.729  3.595   1.00 0.00 ? 18  GLU A HB3  1  
ATOM 258   H HG2  . GLU A 1 18  ? -1.045  -6.875  3.033   1.00 0.00 ? 18  GLU A HG2  1  
ATOM 259   H HG3  . GLU A 1 18  ? -0.123  -5.393  2.884   1.00 0.00 ? 18  GLU A HG3  1  
ATOM 260   N N    . GLU A 1 19  ? -5.437  -5.824  1.368   1.00 0.00 ? 19  GLU A N    1  
ATOM 261   C CA   . GLU A 1 19  ? -6.604  -5.211  0.756   1.00 0.00 ? 19  GLU A CA   1  
ATOM 262   C C    . GLU A 1 19  ? -6.526  -3.688  0.873   1.00 0.00 ? 19  GLU A C    1  
ATOM 263   O O    . GLU A 1 19  ? -5.810  -3.163  1.724   1.00 0.00 ? 19  GLU A O    1  
ATOM 264   C CB   . GLU A 1 19  ? -7.895  -5.744  1.381   1.00 0.00 ? 19  GLU A CB   1  
ATOM 265   C CG   . GLU A 1 19  ? -8.424  -6.950  0.601   1.00 0.00 ? 19  GLU A CG   1  
ATOM 266   C CD   . GLU A 1 19  ? -9.952  -6.936  0.541   1.00 0.00 ? 19  GLU A CD   1  
ATOM 267   O OE1  . GLU A 1 19  ? -10.489 -5.962  -0.029  1.00 0.00 ? 19  GLU A OE1  1  
ATOM 268   O OE2  . GLU A 1 19  ? -10.550 -7.900  1.068   1.00 0.00 ? 19  GLU A OE2  1  
ATOM 269   H H    . GLU A 1 19  ? -5.624  -6.649  1.902   1.00 0.00 ? 19  GLU A H    1  
ATOM 270   H HA   . GLU A 1 19  ? -6.567  -5.504  -0.294  1.00 0.00 ? 19  GLU A HA   1  
ATOM 271   H HB2  . GLU A 1 19  ? -7.711  -6.028  2.417   1.00 0.00 ? 19  GLU A HB2  1  
ATOM 272   H HB3  . GLU A 1 19  ? -8.648  -4.957  1.395   1.00 0.00 ? 19  GLU A HB3  1  
ATOM 273   H HG2  . GLU A 1 19  ? -8.016  -6.941  -0.410  1.00 0.00 ? 19  GLU A HG2  1  
ATOM 274   H HG3  . GLU A 1 19  ? -8.083  -7.871  1.074   1.00 0.00 ? 19  GLU A HG3  1  
ATOM 275   N N    . PRO A 1 20  ? -7.293  -3.003  -0.017  1.00 0.00 ? 20  PRO A N    1  
ATOM 276   C CA   . PRO A 1 20  ? -7.317  -1.550  -0.021  1.00 0.00 ? 20  PRO A CA   1  
ATOM 277   C C    . PRO A 1 20  ? -8.139  -1.012  1.152   1.00 0.00 ? 20  PRO A C    1  
ATOM 278   O O    . PRO A 1 20  ? -9.080  -1.662  1.606   1.00 0.00 ? 20  PRO A O    1  
ATOM 279   C CB   . PRO A 1 20  ? -7.896  -1.170  -1.374  1.00 0.00 ? 20  PRO A CB   1  
ATOM 280   C CG   . PRO A 1 20  ? -8.603  -2.414  -1.889  1.00 0.00 ? 20  PRO A CG   1  
ATOM 281   C CD   . PRO A 1 20  ? -8.153  -3.591  -1.039  1.00 0.00 ? 20  PRO A CD   1  
ATOM 282   H HA   . PRO A 1 20  ? -6.394  -1.187  0.102   1.00 0.00 ? 20  PRO A HA   1  
ATOM 283   H HB2  . PRO A 1 20  ? -8.592  -0.336  -1.282  1.00 0.00 ? 20  PRO A HB2  1  
ATOM 284   H HB3  . PRO A 1 20  ? -7.111  -0.855  -2.061  1.00 0.00 ? 20  PRO A HB3  1  
ATOM 285   H HG2  . PRO A 1 20  ? -9.684  -2.291  -1.830  1.00 0.00 ? 20  PRO A HG2  1  
ATOM 286   H HG3  . PRO A 1 20  ? -8.359  -2.585  -2.938  1.00 0.00 ? 20  PRO A HG3  1  
ATOM 287   H HD2  . PRO A 1 20  ? -9.004  -4.105  -0.592  1.00 0.00 ? 20  PRO A HD2  1  
ATOM 288   H HD3  . PRO A 1 20  ? -7.614  -4.327  -1.635  1.00 0.00 ? 20  PRO A HD3  1  
ATOM 289   N N    . ARG A 1 21  ? -7.752  0.169   1.611   1.00 0.00 ? 21  ARG A N    1  
ATOM 290   C CA   . ARG A 1 21  ? -8.441  0.802   2.723   1.00 0.00 ? 21  ARG A CA   1  
ATOM 291   C C    . ARG A 1 21  ? -8.872  2.220   2.343   1.00 0.00 ? 21  ARG A C    1  
ATOM 292   O O    . ARG A 1 21  ? -8.375  2.784   1.369   1.00 0.00 ? 21  ARG A O    1  
ATOM 293   C CB   . ARG A 1 21  ? -7.545  0.863   3.962   1.00 0.00 ? 21  ARG A CB   1  
ATOM 294   C CG   . ARG A 1 21  ? -6.416  1.878   3.774   1.00 0.00 ? 21  ARG A CG   1  
ATOM 295   C CD   . ARG A 1 21  ? -5.057  1.251   4.088   1.00 0.00 ? 21  ARG A CD   1  
ATOM 296   N NE   . ARG A 1 21  ? -4.834  0.068   3.227   1.00 0.00 ? 21  ARG A NE   1  
ATOM 297   C CZ   . ARG A 1 21  ? -3.972  -0.917  3.513   1.00 0.00 ? 21  ARG A CZ   1  
ATOM 298   N NH1  . ARG A 1 21  ? -3.247  -0.868  4.639   1.00 0.00 ? 21  ARG A NH1  1  
ATOM 299   N NH2  . ARG A 1 21  ? -3.834  -1.952  2.673   1.00 0.00 ? 21  ARG A NH2  1  
ATOM 300   H H    . ARG A 1 21  ? -6.986  0.691   1.237   1.00 0.00 ? 21  ARG A H    1  
ATOM 301   H HA   . ARG A 1 21  ? -9.306  0.167   2.913   1.00 0.00 ? 21  ARG A HA   1  
ATOM 302   H HB2  . ARG A 1 21  ? -8.142  1.135   4.833   1.00 0.00 ? 21  ARG A HB2  1  
ATOM 303   H HB3  . ARG A 1 21  ? -7.124  -0.123  4.160   1.00 0.00 ? 21  ARG A HB3  1  
ATOM 304   H HG2  . ARG A 1 21  ? -6.422  2.247   2.748   1.00 0.00 ? 21  ARG A HG2  1  
ATOM 305   H HG3  . ARG A 1 21  ? -6.583  2.738   4.423   1.00 0.00 ? 21  ARG A HG3  1  
ATOM 306   H HD2  . ARG A 1 21  ? -4.264  1.982   3.929   1.00 0.00 ? 21  ARG A HD2  1  
ATOM 307   H HD3  . ARG A 1 21  ? -5.016  0.960   5.138   1.00 0.00 ? 21  ARG A HD3  1  
ATOM 308   H HE   . ARG A 1 21  ? -5.359  0.000   2.379   1.00 0.00 ? 21  ARG A HE   1  
ATOM 309   H HH11 . ARG A 1 21  ? -3.349  -0.095  5.266   1.00 0.00 ? 21  ARG A HH11 1  
ATOM 310   H HH12 . ARG A 1 21  ? -2.603  -1.603  4.852   1.00 0.00 ? 21  ARG A HH12 1  
ATOM 311   H HH21 . ARG A 1 21  ? -4.375  -1.989  1.832   1.00 0.00 ? 21  ARG A HH21 1  
ATOM 312   H HH22 . ARG A 1 21  ? -3.191  -2.687  2.886   1.00 0.00 ? 21  ARG A HH22 1  
ATOM 313   N N    . HIS A 1 22  ? -9.791  2.756   3.132   1.00 0.00 ? 22  HIS A N    1  
ATOM 314   C CA   . HIS A 1 22  ? -10.295 4.098   2.891   1.00 0.00 ? 22  HIS A CA   1  
ATOM 315   C C    . HIS A 1 22  ? -9.975  4.990   4.092   1.00 0.00 ? 22  HIS A C    1  
ATOM 316   O O    . HIS A 1 22  ? -10.656 4.927   5.115   1.00 0.00 ? 22  HIS A O    1  
ATOM 317   C CB   . HIS A 1 22  ? -11.787 4.066   2.557   1.00 0.00 ? 22  HIS A CB   1  
ATOM 318   C CG   . HIS A 1 22  ? -12.131 3.209   1.362   1.00 0.00 ? 22  HIS A CG   1  
ATOM 319   N ND1  . HIS A 1 22  ? -11.634 1.929   1.190   1.00 0.00 ? 22  HIS A ND1  1  
ATOM 320   C CD2  . HIS A 1 22  ? -12.927 3.461   0.284   1.00 0.00 ? 22  HIS A CD2  1  
ATOM 321   C CE1  . HIS A 1 22  ? -12.115 1.443   0.055   1.00 0.00 ? 22  HIS A CE1  1  
ATOM 322   N NE2  . HIS A 1 22  ? -12.916 2.394   -0.505  1.00 0.00 ? 22  HIS A NE2  1  
ATOM 323   H H    . HIS A 1 22  ? -10.190 2.291   3.923   1.00 0.00 ? 22  HIS A H    1  
ATOM 324   H HA   . HIS A 1 22  ? -9.766  4.477   2.017   1.00 0.00 ? 22  HIS A HA   1  
ATOM 325   H HB2  . HIS A 1 22  ? -12.336 3.699   3.424   1.00 0.00 ? 22  HIS A HB2  1  
ATOM 326   H HB3  . HIS A 1 22  ? -12.129 5.084   2.371   1.00 0.00 ? 22  HIS A HB3  1  
ATOM 327   H HD1  . HIS A 1 22  ? -11.017 1.452   1.815   1.00 0.00 ? 22  HIS A HD1  1  
ATOM 328   H HD2  . HIS A 1 22  ? -13.479 4.384   0.101   1.00 0.00 ? 22  HIS A HD2  1  
ATOM 329   H HE1  . HIS A 1 22  ? -11.908 0.455   -0.358  1.00 0.00 ? 22  HIS A HE1  1  
ATOM 330   N N    . VAL A 1 23  ? -8.939  5.799   3.929   1.00 0.00 ? 23  VAL A N    1  
ATOM 331   C CA   . VAL A 1 23  ? -8.520  6.702   4.987   1.00 0.00 ? 23  VAL A CA   1  
ATOM 332   C C    . VAL A 1 23  ? -9.202  8.059   4.793   1.00 0.00 ? 23  VAL A C    1  
ATOM 333   O O    . VAL A 1 23  ? -9.047  8.691   3.749   1.00 0.00 ? 23  VAL A O    1  
ATOM 334   C CB   . VAL A 1 23  ? -6.994  6.800   5.019   1.00 0.00 ? 23  VAL A CB   1  
ATOM 335   C CG1  . VAL A 1 23  ? -6.535  7.903   5.975   1.00 0.00 ? 23  VAL A CG1  1  
ATOM 336   C CG2  . VAL A 1 23  ? -6.367  5.455   5.391   1.00 0.00 ? 23  VAL A CG2  1  
ATOM 337   H H    . VAL A 1 23  ? -8.390  5.843   3.094   1.00 0.00 ? 23  VAL A H    1  
ATOM 338   H HA   . VAL A 1 23  ? -8.851  6.276   5.934   1.00 0.00 ? 23  VAL A HA   1  
ATOM 339   H HB   . VAL A 1 23  ? -6.653  7.062   4.017   1.00 0.00 ? 23  VAL A HB   1  
ATOM 340   H HG11 . VAL A 1 23  ? -7.323  8.107   6.699   1.00 0.00 ? 23  VAL A HG11 1  
ATOM 341   H HG12 . VAL A 1 23  ? -5.635  7.578   6.499   1.00 0.00 ? 23  VAL A HG12 1  
ATOM 342   H HG13 . VAL A 1 23  ? -6.318  8.808   5.408   1.00 0.00 ? 23  VAL A HG13 1  
ATOM 343   H HG21 . VAL A 1 23  ? -5.647  5.600   6.197   1.00 0.00 ? 23  VAL A HG21 1  
ATOM 344   H HG22 . VAL A 1 23  ? -7.147  4.769   5.721   1.00 0.00 ? 23  VAL A HG22 1  
ATOM 345   H HG23 . VAL A 1 23  ? -5.859  5.037   4.522   1.00 0.00 ? 23  VAL A HG23 1  
ATOM 346   N N    . LYS A 1 24  ? -9.941  8.465   5.814   1.00 0.00 ? 24  LYS A N    1  
ATOM 347   C CA   . LYS A 1 24  ? -10.647 9.735   5.769   1.00 0.00 ? 24  LYS A CA   1  
ATOM 348   C C    . LYS A 1 24  ? -9.682  10.863  6.140   1.00 0.00 ? 24  LYS A C    1  
ATOM 349   O O    . LYS A 1 24  ? -8.757  10.660  6.925   1.00 0.00 ? 24  LYS A O    1  
ATOM 350   C CB   . LYS A 1 24  ? -11.899 9.683   6.646   1.00 0.00 ? 24  LYS A CB   1  
ATOM 351   C CG   . LYS A 1 24  ? -13.152 9.447   5.800   1.00 0.00 ? 24  LYS A CG   1  
ATOM 352   C CD   . LYS A 1 24  ? -14.419 9.585   6.646   1.00 0.00 ? 24  LYS A CD   1  
ATOM 353   C CE   . LYS A 1 24  ? -15.656 9.743   5.760   1.00 0.00 ? 24  LYS A CE   1  
ATOM 354   N NZ   . LYS A 1 24  ? -16.863 9.254   6.462   1.00 0.00 ? 24  LYS A NZ   1  
ATOM 355   H H    . LYS A 1 24  ? -10.062 7.945   6.659   1.00 0.00 ? 24  LYS A H    1  
ATOM 356   H HA   . LYS A 1 24  ? -10.978 9.888   4.742   1.00 0.00 ? 24  LYS A HA   1  
ATOM 357   H HB2  . LYS A 1 24  ? -11.799 8.887   7.384   1.00 0.00 ? 24  LYS A HB2  1  
ATOM 358   H HB3  . LYS A 1 24  ? -11.999 10.617  7.198   1.00 0.00 ? 24  LYS A HB3  1  
ATOM 359   H HG2  . LYS A 1 24  ? -13.180 10.163  4.978   1.00 0.00 ? 24  LYS A HG2  1  
ATOM 360   H HG3  . LYS A 1 24  ? -13.113 8.453   5.356   1.00 0.00 ? 24  LYS A HG3  1  
ATOM 361   H HD2  . LYS A 1 24  ? -14.533 8.707   7.282   1.00 0.00 ? 24  LYS A HD2  1  
ATOM 362   H HD3  . LYS A 1 24  ? -14.328 10.447  7.307   1.00 0.00 ? 24  LYS A HD3  1  
ATOM 363   H HE2  . LYS A 1 24  ? -15.785 10.791  5.489   1.00 0.00 ? 24  LYS A HE2  1  
ATOM 364   H HE3  . LYS A 1 24  ? -15.519 9.189   4.831   1.00 0.00 ? 24  LYS A HE3  1  
ATOM 365   H HZ1  . LYS A 1 24  ? -17.600 9.115   5.801   1.00 0.00 ? 24  LYS A HZ1  1  
ATOM 366   H HZ2  . LYS A 1 24  ? -16.656 8.387   6.917   1.00 0.00 ? 24  LYS A HZ2  1  
ATOM 367   H HZ3  . LYS A 1 24  ? -17.149 9.928   7.144   1.00 0.00 ? 24  LYS A HZ3  1  
ATOM 368   N N    . VAL A 1 25  ? -9.931  12.027  5.558   1.00 0.00 ? 25  VAL A N    1  
ATOM 369   C CA   . VAL A 1 25  ? -9.096  13.187  5.817   1.00 0.00 ? 25  VAL A CA   1  
ATOM 370   C C    . VAL A 1 25  ? -9.986  14.385  6.153   1.00 0.00 ? 25  VAL A C    1  
ATOM 371   O O    . VAL A 1 25  ? -10.942 14.674  5.435   1.00 0.00 ? 25  VAL A O    1  
ATOM 372   C CB   . VAL A 1 25  ? -8.172  13.444  4.625   1.00 0.00 ? 25  VAL A CB   1  
ATOM 373   C CG1  . VAL A 1 25  ? -7.069  14.440  4.991   1.00 0.00 ? 25  VAL A CG1  1  
ATOM 374   C CG2  . VAL A 1 25  ? -7.578  12.136  4.100   1.00 0.00 ? 25  VAL A CG2  1  
ATOM 375   H H    . VAL A 1 25  ? -10.686 12.183  4.920   1.00 0.00 ? 25  VAL A H    1  
ATOM 376   H HA   . VAL A 1 25  ? -8.475  12.958  6.683   1.00 0.00 ? 25  VAL A HA   1  
ATOM 377   H HB   . VAL A 1 25  ? -8.770  13.884  3.827   1.00 0.00 ? 25  VAL A HB   1  
ATOM 378   H HG11 . VAL A 1 25  ? -6.709  14.930  4.087   1.00 0.00 ? 25  VAL A HG11 1  
ATOM 379   H HG12 . VAL A 1 25  ? -7.468  15.188  5.676   1.00 0.00 ? 25  VAL A HG12 1  
ATOM 380   H HG13 . VAL A 1 25  ? -6.246  13.910  5.470   1.00 0.00 ? 25  VAL A HG13 1  
ATOM 381   H HG21 . VAL A 1 25  ? -8.133  11.811  3.220   1.00 0.00 ? 25  VAL A HG21 1  
ATOM 382   H HG22 . VAL A 1 25  ? -6.533  12.293  3.832   1.00 0.00 ? 25  VAL A HG22 1  
ATOM 383   H HG23 . VAL A 1 25  ? -7.643  11.371  4.874   1.00 0.00 ? 25  VAL A HG23 1  
ATOM 384   N N    . GLN A 1 26  ? -9.640  15.052  7.245   1.00 0.00 ? 26  GLN A N    1  
ATOM 385   C CA   . GLN A 1 26  ? -10.395 16.212  7.684   1.00 0.00 ? 26  GLN A CA   1  
ATOM 386   C C    . GLN A 1 26  ? -9.629  17.497  7.365   1.00 0.00 ? 26  GLN A C    1  
ATOM 387   O O    . GLN A 1 26  ? -9.115  18.158  8.266   1.00 0.00 ? 26  GLN A O    1  
ATOM 388   C CB   . GLN A 1 26  ? -10.718 16.123  9.177   1.00 0.00 ? 26  GLN A CB   1  
ATOM 389   C CG   . GLN A 1 26  ? -12.220 15.940  9.404   1.00 0.00 ? 26  GLN A CG   1  
ATOM 390   C CD   . GLN A 1 26  ? -12.681 16.689  10.656  1.00 0.00 ? 26  GLN A CD   1  
ATOM 391   O OE1  . GLN A 1 26  ? -12.017 16.706  11.680  1.00 0.00 ? 26  GLN A OE1  1  
ATOM 392   N NE2  . GLN A 1 26  ? -13.851 17.306  10.518  1.00 0.00 ? 26  GLN A NE2  1  
ATOM 393   H H    . GLN A 1 26  ? -8.861  14.811  7.823   1.00 0.00 ? 26  GLN A H    1  
ATOM 394   H HA   . GLN A 1 26  ? -11.325 16.185  7.116   1.00 0.00 ? 26  GLN A HA   1  
ATOM 395   H HB2  . GLN A 1 26  ? -10.175 15.288  9.621   1.00 0.00 ? 26  GLN A HB2  1  
ATOM 396   H HB3  . GLN A 1 26  ? -10.378 17.028  9.681   1.00 0.00 ? 26  GLN A HB3  1  
ATOM 397   H HG2  . GLN A 1 26  ? -12.769 16.304  8.536   1.00 0.00 ? 26  GLN A HG2  1  
ATOM 398   H HG3  . GLN A 1 26  ? -12.450 14.880  9.505   1.00 0.00 ? 26  GLN A HG3  1  
ATOM 399   H HE21 . GLN A 1 26  ? -14.345 17.252  9.650   1.00 0.00 ? 26  GLN A HE21 1  
ATOM 400   H HE22 . GLN A 1 26  ? -14.237 17.823  11.282  1.00 0.00 ? 26  GLN A HE22 1  
ATOM 401   N N    . LYS A 1 27  ? -9.575  17.812  6.079   1.00 0.00 ? 27  LYS A N    1  
ATOM 402   C CA   . LYS A 1 27  ? -8.880  19.006  5.629   1.00 0.00 ? 27  LYS A CA   1  
ATOM 403   C C    . LYS A 1 27  ? -9.429  20.223  6.377   1.00 0.00 ? 27  LYS A C    1  
ATOM 404   O O    . LYS A 1 27  ? -8.769  20.761  7.264   1.00 0.00 ? 27  LYS A O    1  
ATOM 405   C CB   . LYS A 1 27  ? -8.960  19.132  4.107   1.00 0.00 ? 27  LYS A CB   1  
ATOM 406   C CG   . LYS A 1 27  ? -8.414  17.876  3.423   1.00 0.00 ? 27  LYS A CG   1  
ATOM 407   C CD   . LYS A 1 27  ? -6.935  18.043  3.071   1.00 0.00 ? 27  LYS A CD   1  
ATOM 408   C CE   . LYS A 1 27  ? -6.705  17.857  1.570   1.00 0.00 ? 27  LYS A CE   1  
ATOM 409   N NZ   . LYS A 1 27  ? -6.104  19.075  0.982   1.00 0.00 ? 27  LYS A NZ   1  
ATOM 410   H H    . LYS A 1 27  ? -9.996  17.269  5.352   1.00 0.00 ? 27  LYS A H    1  
ATOM 411   H HA   . LYS A 1 27  ? -7.827  18.888  5.888   1.00 0.00 ? 27  LYS A HA   1  
ATOM 412   H HB2  . LYS A 1 27  ? -9.995  19.293  3.805   1.00 0.00 ? 27  LYS A HB2  1  
ATOM 413   H HB3  . LYS A 1 27  ? -8.394  20.003  3.780   1.00 0.00 ? 27  LYS A HB3  1  
ATOM 414   H HG2  . LYS A 1 27  ? -8.540  17.016  4.081   1.00 0.00 ? 27  LYS A HG2  1  
ATOM 415   H HG3  . LYS A 1 27  ? -8.987  17.672  2.519   1.00 0.00 ? 27  LYS A HG3  1  
ATOM 416   H HD2  . LYS A 1 27  ? -6.595  19.033  3.374   1.00 0.00 ? 27  LYS A HD2  1  
ATOM 417   H HD3  . LYS A 1 27  ? -6.341  17.318  3.626   1.00 0.00 ? 27  LYS A HD3  1  
ATOM 418   H HE2  . LYS A 1 27  ? -6.050  17.002  1.399   1.00 0.00 ? 27  LYS A HE2  1  
ATOM 419   H HE3  . LYS A 1 27  ? -7.651  17.637  1.075   1.00 0.00 ? 27  LYS A HE3  1  
ATOM 420   H HZ1  . LYS A 1 27  ? -5.598  19.571  1.688   1.00 0.00 ? 27  LYS A HZ1  1  
ATOM 421   H HZ2  . LYS A 1 27  ? -5.480  18.816  0.245   1.00 0.00 ? 27  LYS A HZ2  1  
ATOM 422   H HZ3  . LYS A 1 27  ? -6.827  19.661  0.617   1.00 0.00 ? 27  LYS A HZ3  1  
ATOM 423   N N    . GLY A 1 28  ? -10.632 20.621  5.990   1.00 0.00 ? 28  GLY A N    1  
ATOM 424   C CA   . GLY A 1 28  ? -11.278 21.764  6.613   1.00 0.00 ? 28  GLY A CA   1  
ATOM 425   C C    . GLY A 1 28  ? -10.701 23.077  6.079   1.00 0.00 ? 28  GLY A C    1  
ATOM 426   O O    . GLY A 1 28  ? -10.451 24.007  6.845   1.00 0.00 ? 28  GLY A O    1  
ATOM 427   H H    . GLY A 1 28  ? -11.163 20.178  5.268   1.00 0.00 ? 28  GLY A H    1  
ATOM 428   H HA2  . GLY A 1 28  ? -12.350 21.730  6.421   1.00 0.00 ? 28  GLY A HA2  1  
ATOM 429   H HA3  . GLY A 1 28  ? -11.145 21.718  7.693   1.00 0.00 ? 28  GLY A HA3  1  
ATOM 430   N N    . SER A 1 29  ? -10.506 23.112  4.769   1.00 0.00 ? 29  SER A N    1  
ATOM 431   C CA   . SER A 1 29  ? -9.963  24.295  4.124   1.00 0.00 ? 29  SER A CA   1  
ATOM 432   C C    . SER A 1 29  ? -8.446  24.345  4.313   1.00 0.00 ? 29  SER A C    1  
ATOM 433   O O    . SER A 1 29  ? -7.885  25.407  4.579   1.00 0.00 ? 29  SER A O    1  
ATOM 434   C CB   . SER A 1 29  ? -10.609 25.568  4.675   1.00 0.00 ? 29  SER A CB   1  
ATOM 435   O OG   . SER A 1 29  ? -11.120 26.400  3.637   1.00 0.00 ? 29  SER A OG   1  
ATOM 436   H H    . SER A 1 29  ? -10.712 22.351  4.153   1.00 0.00 ? 29  SER A H    1  
ATOM 437   H HA   . SER A 1 29  ? -10.214 24.189  3.068   1.00 0.00 ? 29  SER A HA   1  
ATOM 438   H HB2  . SER A 1 29  ? -11.417 25.299  5.355   1.00 0.00 ? 29  SER A HB2  1  
ATOM 439   H HB3  . SER A 1 29  ? -9.875  26.124  5.257   1.00 0.00 ? 29  SER A HB3  1  
ATOM 440   H HG   . SER A 1 29  ? -10.367 26.845  3.153   1.00 0.00 ? 29  SER A HG   1  
ATOM 441   N N    . GLU A 1 30  ? -7.825  23.184  4.168   1.00 0.00 ? 30  GLU A N    1  
ATOM 442   C CA   . GLU A 1 30  ? -6.384  23.081  4.320   1.00 0.00 ? 30  GLU A CA   1  
ATOM 443   C C    . GLU A 1 30  ? -5.819  22.048  3.343   1.00 0.00 ? 30  GLU A C    1  
ATOM 444   O O    . GLU A 1 30  ? -6.543  21.171  2.874   1.00 0.00 ? 30  GLU A O    1  
ATOM 445   C CB   . GLU A 1 30  ? -6.007  22.736  5.762   1.00 0.00 ? 30  GLU A CB   1  
ATOM 446   C CG   . GLU A 1 30  ? -5.997  23.988  6.641   1.00 0.00 ? 30  GLU A CG   1  
ATOM 447   C CD   . GLU A 1 30  ? -6.884  23.800  7.873   1.00 0.00 ? 30  GLU A CD   1  
ATOM 448   O OE1  . GLU A 1 30  ? -6.890  22.667  8.401   1.00 0.00 ? 30  GLU A OE1  1  
ATOM 449   O OE2  . GLU A 1 30  ? -7.537  24.794  8.259   1.00 0.00 ? 30  GLU A OE2  1  
ATOM 450   H H    . GLU A 1 30  ? -8.289  22.325  3.952   1.00 0.00 ? 30  GLU A H    1  
ATOM 451   H HA   . GLU A 1 30  ? -5.996  24.071  4.077   1.00 0.00 ? 30  GLU A HA   1  
ATOM 452   H HB2  . GLU A 1 30  ? -6.716  22.011  6.163   1.00 0.00 ? 30  GLU A HB2  1  
ATOM 453   H HB3  . GLU A 1 30  ? -5.025  22.265  5.782   1.00 0.00 ? 30  GLU A HB3  1  
ATOM 454   H HG2  . GLU A 1 30  ? -4.976  24.208  6.954   1.00 0.00 ? 30  GLU A HG2  1  
ATOM 455   H HG3  . GLU A 1 30  ? -6.346  24.844  6.064   1.00 0.00 ? 30  GLU A HG3  1  
ATOM 456   N N    . PRO A 1 31  ? -4.497  22.189  3.058   1.00 0.00 ? 31  PRO A N    1  
ATOM 457   C CA   . PRO A 1 31  ? -3.827  21.278  2.145   1.00 0.00 ? 31  PRO A CA   1  
ATOM 458   C C    . PRO A 1 31  ? -3.575  19.923  2.810   1.00 0.00 ? 31  PRO A C    1  
ATOM 459   O O    . PRO A 1 31  ? -3.805  19.763  4.007   1.00 0.00 ? 31  PRO A O    1  
ATOM 460   C CB   . PRO A 1 31  ? -2.545  21.992  1.747   1.00 0.00 ? 31  PRO A CB   1  
ATOM 461   C CG   . PRO A 1 31  ? -2.320  23.063  2.803   1.00 0.00 ? 31  PRO A CG   1  
ATOM 462   C CD   . PRO A 1 31  ? -3.608  23.215  3.595   1.00 0.00 ? 31  PRO A CD   1  
ATOM 463   H HA   . PRO A 1 31  ? -4.408  21.090  1.354   1.00 0.00 ? 31  PRO A HA   1  
ATOM 464   H HB2  . PRO A 1 31  ? -1.706  21.297  1.711   1.00 0.00 ? 31  PRO A HB2  1  
ATOM 465   H HB3  . PRO A 1 31  ? -2.637  22.434  0.755   1.00 0.00 ? 31  PRO A HB3  1  
ATOM 466   H HG2  . PRO A 1 31  ? -1.497  22.783  3.461   1.00 0.00 ? 31  PRO A HG2  1  
ATOM 467   H HG3  . PRO A 1 31  ? -2.046  24.008  2.334   1.00 0.00 ? 31  PRO A HG3  1  
ATOM 468   H HD2  . PRO A 1 31  ? -3.436  23.072  4.662   1.00 0.00 ? 31  PRO A HD2  1  
ATOM 469   H HD3  . PRO A 1 31  ? -4.033  24.211  3.472   1.00 0.00 ? 31  PRO A HD3  1  
ATOM 470   N N    . LEU A 1 32  ? -3.104  18.983  2.004   1.00 0.00 ? 32  LEU A N    1  
ATOM 471   C CA   . LEU A 1 32  ? -2.818  17.647  2.498   1.00 0.00 ? 32  LEU A CA   1  
ATOM 472   C C    . LEU A 1 32  ? -1.390  17.606  3.046   1.00 0.00 ? 32  LEU A C    1  
ATOM 473   O O    . LEU A 1 32  ? -1.164  17.148  4.165   1.00 0.00 ? 32  LEU A O    1  
ATOM 474   C CB   . LEU A 1 32  ? -3.090  16.604  1.413   1.00 0.00 ? 32  LEU A CB   1  
ATOM 475   C CG   . LEU A 1 32  ? -3.115  15.146  1.875   1.00 0.00 ? 32  LEU A CG   1  
ATOM 476   C CD1  . LEU A 1 32  ? -4.177  14.931  2.955   1.00 0.00 ? 32  LEU A CD1  1  
ATOM 477   C CD2  . LEU A 1 32  ? -3.304  14.198  0.689   1.00 0.00 ? 32  LEU A CD2  1  
ATOM 478   H H    . LEU A 1 32  ? -2.919  19.122  1.031   1.00 0.00 ? 32  LEU A H    1  
ATOM 479   H HA   . LEU A 1 32  ? -3.509  17.448  3.318   1.00 0.00 ? 32  LEU A HA   1  
ATOM 480   H HB2  . LEU A 1 32  ? -4.049  16.834  0.948   1.00 0.00 ? 32  LEU A HB2  1  
ATOM 481   H HB3  . LEU A 1 32  ? -2.329  16.706  0.639   1.00 0.00 ? 32  LEU A HB3  1  
ATOM 482   H HG   . LEU A 1 32  ? -2.149  14.913  2.323   1.00 0.00 ? 32  LEU A HG   1  
ATOM 483   H HD11 . LEU A 1 32  ? -4.655  13.963  2.807   1.00 0.00 ? 32  LEU A HD11 1  
ATOM 484   H HD12 . LEU A 1 32  ? -3.706  14.957  3.938   1.00 0.00 ? 32  LEU A HD12 1  
ATOM 485   H HD13 . LEU A 1 32  ? -4.926  15.720  2.890   1.00 0.00 ? 32  LEU A HD13 1  
ATOM 486   H HD21 . LEU A 1 32  ? -4.355  14.181  0.402   1.00 0.00 ? 32  LEU A HD21 1  
ATOM 487   H HD22 . LEU A 1 32  ? -2.703  14.544  -0.152  1.00 0.00 ? 32  LEU A HD22 1  
ATOM 488   H HD23 . LEU A 1 32  ? -2.988  13.194  0.973   1.00 0.00 ? 32  LEU A HD23 1  
ATOM 489   N N    . GLY A 1 33  ? -0.464  18.091  2.233   1.00 0.00 ? 33  GLY A N    1  
ATOM 490   C CA   . GLY A 1 33  ? 0.936   18.116  2.622   1.00 0.00 ? 33  GLY A CA   1  
ATOM 491   C C    . GLY A 1 33  ? 1.562   16.725  2.504   1.00 0.00 ? 33  GLY A C    1  
ATOM 492   O O    . GLY A 1 33  ? 1.886   16.098  3.512   1.00 0.00 ? 33  GLY A O    1  
ATOM 493   H H    . GLY A 1 33  ? -0.656  18.462  1.325   1.00 0.00 ? 33  GLY A H    1  
ATOM 494   H HA2  . GLY A 1 33  ? 1.480   18.819  1.992   1.00 0.00 ? 33  GLY A HA2  1  
ATOM 495   H HA3  . GLY A 1 33  ? 1.025   18.473  3.648   1.00 0.00 ? 33  GLY A HA3  1  
ATOM 496   N N    . ILE A 1 34  ? 1.714   16.283  1.264   1.00 0.00 ? 34  ILE A N    1  
ATOM 497   C CA   . ILE A 1 34  ? 2.296   14.978  1.001   1.00 0.00 ? 34  ILE A CA   1  
ATOM 498   C C    . ILE A 1 34  ? 2.972   14.993  -0.372  1.00 0.00 ? 34  ILE A C    1  
ATOM 499   O O    . ILE A 1 34  ? 2.532   15.701  -1.276  1.00 0.00 ? 34  ILE A O    1  
ATOM 500   C CB   . ILE A 1 34  ? 1.242   13.880  1.155   1.00 0.00 ? 34  ILE A CB   1  
ATOM 501   C CG1  . ILE A 1 34  ? 0.059   14.119  0.215   1.00 0.00 ? 34  ILE A CG1  1  
ATOM 502   C CG2  . ILE A 1 34  ? 0.797   13.749  2.613   1.00 0.00 ? 34  ILE A CG2  1  
ATOM 503   C CD1  . ILE A 1 34  ? -0.147  12.926  -0.721  1.00 0.00 ? 34  ILE A CD1  1  
ATOM 504   H H    . ILE A 1 34  ? 1.449   16.799  0.450   1.00 0.00 ? 34  ILE A H    1  
ATOM 505   H HA   . ILE A 1 34  ? 3.059   14.801  1.759   1.00 0.00 ? 34  ILE A HA   1  
ATOM 506   H HB   . ILE A 1 34  ? 1.693   12.930  0.870   1.00 0.00 ? 34  ILE A HB   1  
ATOM 507   H HG12 . ILE A 1 34  ? -0.846  14.289  0.798   1.00 0.00 ? 34  ILE A HG12 1  
ATOM 508   H HG13 . ILE A 1 34  ? 0.234   15.021  -0.373  1.00 0.00 ? 34  ILE A HG13 1  
ATOM 509   H HG21 . ILE A 1 34  ? 0.315   14.673  2.931   1.00 0.00 ? 34  ILE A HG21 1  
ATOM 510   H HG22 . ILE A 1 34  ? 0.093   12.922  2.705   1.00 0.00 ? 34  ILE A HG22 1  
ATOM 511   H HG23 . ILE A 1 34  ? 1.666   13.557  3.243   1.00 0.00 ? 34  ILE A HG23 1  
ATOM 512   H HD11 . ILE A 1 34  ? 0.423   13.080  -1.637  1.00 0.00 ? 34  ILE A HD11 1  
ATOM 513   H HD12 . ILE A 1 34  ? 0.194   12.016  -0.229  1.00 0.00 ? 34  ILE A HD12 1  
ATOM 514   H HD13 . ILE A 1 34  ? -1.206  12.834  -0.963  1.00 0.00 ? 34  ILE A HD13 1  
ATOM 515   N N    . SER A 1 35  ? 4.029   14.203  -0.484  1.00 0.00 ? 35  SER A N    1  
ATOM 516   C CA   . SER A 1 35  ? 4.770   14.116  -1.732  1.00 0.00 ? 35  SER A CA   1  
ATOM 517   C C    . SER A 1 35  ? 4.379   12.843  -2.485  1.00 0.00 ? 35  SER A C    1  
ATOM 518   O O    . SER A 1 35  ? 4.151   11.801  -1.872  1.00 0.00 ? 35  SER A O    1  
ATOM 519   C CB   . SER A 1 35  ? 6.278   14.143  -1.480  1.00 0.00 ? 35  SER A CB   1  
ATOM 520   O OG   . SER A 1 35  ? 7.010   14.484  -2.654  1.00 0.00 ? 35  SER A OG   1  
ATOM 521   H H    . SER A 1 35  ? 4.380   13.630  0.256   1.00 0.00 ? 35  SER A H    1  
ATOM 522   H HA   . SER A 1 35  ? 4.481   15.001  -2.300  1.00 0.00 ? 35  SER A HA   1  
ATOM 523   H HB2  . SER A 1 35  ? 6.502   14.862  -0.691  1.00 0.00 ? 35  SER A HB2  1  
ATOM 524   H HB3  . SER A 1 35  ? 6.603   13.166  -1.121  1.00 0.00 ? 35  SER A HB3  1  
ATOM 525   H HG   . SER A 1 35  ? 7.825   15.008  -2.409  1.00 0.00 ? 35  SER A HG   1  
ATOM 526   N N    . ILE A 1 36  ? 4.314   12.969  -3.802  1.00 0.00 ? 36  ILE A N    1  
ATOM 527   C CA   . ILE A 1 36  ? 3.955   11.841  -4.645  1.00 0.00 ? 36  ILE A CA   1  
ATOM 528   C C    . ILE A 1 36  ? 4.909   11.779  -5.840  1.00 0.00 ? 36  ILE A C    1  
ATOM 529   O O    . ILE A 1 36  ? 5.415   12.807  -6.289  1.00 0.00 ? 36  ILE A O    1  
ATOM 530   C CB   . ILE A 1 36  ? 2.479   11.916  -5.040  1.00 0.00 ? 36  ILE A CB   1  
ATOM 531   C CG1  . ILE A 1 36  ? 2.213   13.124  -5.940  1.00 0.00 ? 36  ILE A CG1  1  
ATOM 532   C CG2  . ILE A 1 36  ? 1.579   11.914  -3.802  1.00 0.00 ? 36  ILE A CG2  1  
ATOM 533   C CD1  . ILE A 1 36  ? 2.187   12.715  -7.414  1.00 0.00 ? 36  ILE A CD1  1  
ATOM 534   H H    . ILE A 1 36  ? 4.501   13.821  -4.292  1.00 0.00 ? 36  ILE A H    1  
ATOM 535   H HA   . ILE A 1 36  ? 4.085   10.936  -4.052  1.00 0.00 ? 36  ILE A HA   1  
ATOM 536   H HB   . ILE A 1 36  ? 2.234   11.024  -5.617  1.00 0.00 ? 36  ILE A HB   1  
ATOM 537   H HG12 . ILE A 1 36  ? 1.261   13.581  -5.669  1.00 0.00 ? 36  ILE A HG12 1  
ATOM 538   H HG13 . ILE A 1 36  ? 2.984   13.878  -5.781  1.00 0.00 ? 36  ILE A HG13 1  
ATOM 539   H HG21 . ILE A 1 36  ? 2.188   11.758  -2.911  1.00 0.00 ? 36  ILE A HG21 1  
ATOM 540   H HG22 . ILE A 1 36  ? 1.063   12.871  -3.727  1.00 0.00 ? 36  ILE A HG22 1  
ATOM 541   H HG23 . ILE A 1 36  ? 0.847   11.112  -3.887  1.00 0.00 ? 36  ILE A HG23 1  
ATOM 542   H HD11 . ILE A 1 36  ? 1.933   13.580  -8.027  1.00 0.00 ? 36  ILE A HD11 1  
ATOM 543   H HD12 . ILE A 1 36  ? 3.169   12.340  -7.704  1.00 0.00 ? 36  ILE A HD12 1  
ATOM 544   H HD13 . ILE A 1 36  ? 1.442   11.933  -7.561  1.00 0.00 ? 36  ILE A HD13 1  
ATOM 545   N N    . VAL A 1 37  ? 5.126   10.564  -6.320  1.00 0.00 ? 37  VAL A N    1  
ATOM 546   C CA   . VAL A 1 37  ? 6.010   10.355  -7.454  1.00 0.00 ? 37  VAL A CA   1  
ATOM 547   C C    . VAL A 1 37  ? 5.362   9.366   -8.425  1.00 0.00 ? 37  VAL A C    1  
ATOM 548   O O    . VAL A 1 37  ? 4.613   8.483   -8.010  1.00 0.00 ? 37  VAL A O    1  
ATOM 549   C CB   . VAL A 1 37  ? 7.387   9.898   -6.967  1.00 0.00 ? 37  VAL A CB   1  
ATOM 550   C CG1  . VAL A 1 37  ? 7.858   10.745  -5.783  1.00 0.00 ? 37  VAL A CG1  1  
ATOM 551   C CG2  . VAL A 1 37  ? 7.376   8.411   -6.608  1.00 0.00 ? 37  VAL A CG2  1  
ATOM 552   H H    . VAL A 1 37  ? 4.711   9.734   -5.949  1.00 0.00 ? 37  VAL A H    1  
ATOM 553   H HA   . VAL A 1 37  ? 6.131   11.313  -7.958  1.00 0.00 ? 37  VAL A HA   1  
ATOM 554   H HB   . VAL A 1 37  ? 8.095   10.041  -7.783  1.00 0.00 ? 37  VAL A HB   1  
ATOM 555   H HG11 . VAL A 1 37  ? 7.111   10.707  -4.990  1.00 0.00 ? 37  VAL A HG11 1  
ATOM 556   H HG12 . VAL A 1 37  ? 8.804   10.354  -5.410  1.00 0.00 ? 37  VAL A HG12 1  
ATOM 557   H HG13 . VAL A 1 37  ? 7.993   11.777  -6.105  1.00 0.00 ? 37  VAL A HG13 1  
ATOM 558   H HG21 . VAL A 1 37  ? 8.379   8.101   -6.315  1.00 0.00 ? 37  VAL A HG21 1  
ATOM 559   H HG22 . VAL A 1 37  ? 6.688   8.242   -5.780  1.00 0.00 ? 37  VAL A HG22 1  
ATOM 560   H HG23 . VAL A 1 37  ? 7.054   7.831   -7.472  1.00 0.00 ? 37  VAL A HG23 1  
ATOM 561   N N    . SER A 1 38  ? 5.673   9.547   -9.700  1.00 0.00 ? 38  SER A N    1  
ATOM 562   C CA   . SER A 1 38  ? 5.130   8.682   -10.734 1.00 0.00 ? 38  SER A CA   1  
ATOM 563   C C    . SER A 1 38  ? 6.169   7.634   -11.137 1.00 0.00 ? 38  SER A C    1  
ATOM 564   O O    . SER A 1 38  ? 7.369   7.905   -11.121 1.00 0.00 ? 38  SER A O    1  
ATOM 565   C CB   . SER A 1 38  ? 4.691   9.492   -11.955 1.00 0.00 ? 38  SER A CB   1  
ATOM 566   O OG   . SER A 1 38  ? 4.151   8.662   -12.980 1.00 0.00 ? 38  SER A OG   1  
ATOM 567   H H    . SER A 1 38  ? 6.283   10.268  -10.030 1.00 0.00 ? 38  SER A H    1  
ATOM 568   H HA   . SER A 1 38  ? 4.260   8.205   -10.283 1.00 0.00 ? 38  SER A HA   1  
ATOM 569   H HB2  . SER A 1 38  ? 3.945   10.228  -11.653 1.00 0.00 ? 38  SER A HB2  1  
ATOM 570   H HB3  . SER A 1 38  ? 5.543   10.046  -12.349 1.00 0.00 ? 38  SER A HB3  1  
ATOM 571   H HG   . SER A 1 38  ? 4.678   7.815   -13.047 1.00 0.00 ? 38  SER A HG   1  
ATOM 572   N N    . GLY A 1 39  ? 5.670   6.459   -11.491 1.00 0.00 ? 39  GLY A N    1  
ATOM 573   C CA   . GLY A 1 39  ? 6.540   5.368   -11.898 1.00 0.00 ? 39  GLY A CA   1  
ATOM 574   C C    . GLY A 1 39  ? 6.442   5.123   -13.405 1.00 0.00 ? 39  GLY A C    1  
ATOM 575   O O    . GLY A 1 39  ? 5.394   5.349   -14.008 1.00 0.00 ? 39  GLY A O    1  
ATOM 576   H H    . GLY A 1 39  ? 4.693   6.246   -11.502 1.00 0.00 ? 39  GLY A H    1  
ATOM 577   H HA2  . GLY A 1 39  ? 7.570   5.600   -11.630 1.00 0.00 ? 39  GLY A HA2  1  
ATOM 578   H HA3  . GLY A 1 39  ? 6.267   4.460   -11.360 1.00 0.00 ? 39  GLY A HA3  1  
ATOM 579   N N    . GLU A 1 40  ? 7.549   4.664   -13.971 1.00 0.00 ? 40  GLU A N    1  
ATOM 580   C CA   . GLU A 1 40  ? 7.602   4.386   -15.396 1.00 0.00 ? 40  GLU A CA   1  
ATOM 581   C C    . GLU A 1 40  ? 6.290   3.751   -15.862 1.00 0.00 ? 40  GLU A C    1  
ATOM 582   O O    . GLU A 1 40  ? 5.475   4.406   -16.509 1.00 0.00 ? 40  GLU A O    1  
ATOM 583   C CB   . GLU A 1 40  ? 8.796   3.491   -15.736 1.00 0.00 ? 40  GLU A CB   1  
ATOM 584   C CG   . GLU A 1 40  ? 10.099  4.293   -15.740 1.00 0.00 ? 40  GLU A CG   1  
ATOM 585   C CD   . GLU A 1 40  ? 11.027  3.825   -16.862 1.00 0.00 ? 40  GLU A CD   1  
ATOM 586   O OE1  . GLU A 1 40  ? 10.528  3.715   -18.003 1.00 0.00 ? 40  GLU A OE1  1  
ATOM 587   O OE2  . GLU A 1 40  ? 12.215  3.588   -16.554 1.00 0.00 ? 40  GLU A OE2  1  
ATOM 588   H H    . GLU A 1 40  ? 8.398   4.483   -13.473 1.00 0.00 ? 40  GLU A H    1  
ATOM 589   H HA   . GLU A 1 40  ? 7.734   5.356   -15.876 1.00 0.00 ? 40  GLU A HA   1  
ATOM 590   H HB2  . GLU A 1 40  ? 8.866   2.681   -15.011 1.00 0.00 ? 40  GLU A HB2  1  
ATOM 591   H HB3  . GLU A 1 40  ? 8.644   3.032   -16.713 1.00 0.00 ? 40  GLU A HB3  1  
ATOM 592   H HG2  . GLU A 1 40  ? 9.877   5.353   -15.865 1.00 0.00 ? 40  GLU A HG2  1  
ATOM 593   H HG3  . GLU A 1 40  ? 10.600  4.184   -14.779 1.00 0.00 ? 40  GLU A HG3  1  
ATOM 594   N N    . LYS A 1 41  ? 6.128   2.483   -15.514 1.00 0.00 ? 41  LYS A N    1  
ATOM 595   C CA   . LYS A 1 41  ? 4.929   1.752   -15.888 1.00 0.00 ? 41  LYS A CA   1  
ATOM 596   C C    . LYS A 1 41  ? 4.217   1.267   -14.623 1.00 0.00 ? 41  LYS A C    1  
ATOM 597   O O    . LYS A 1 41  ? 4.036   0.066   -14.430 1.00 0.00 ? 41  LYS A O    1  
ATOM 598   C CB   . LYS A 1 41  ? 5.270   0.630   -16.870 1.00 0.00 ? 41  LYS A CB   1  
ATOM 599   C CG   . LYS A 1 41  ? 4.862   1.006   -18.296 1.00 0.00 ? 41  LYS A CG   1  
ATOM 600   C CD   . LYS A 1 41  ? 5.981   0.686   -19.289 1.00 0.00 ? 41  LYS A CD   1  
ATOM 601   C CE   . LYS A 1 41  ? 5.636   -0.549  -20.125 1.00 0.00 ? 41  LYS A CE   1  
ATOM 602   N NZ   . LYS A 1 41  ? 6.505   -1.687  -19.751 1.00 0.00 ? 41  LYS A NZ   1  
ATOM 603   H H    . LYS A 1 41  ? 6.796   1.958   -14.987 1.00 0.00 ? 41  LYS A H    1  
ATOM 604   H HA   . LYS A 1 41  ? 4.272   2.448   -16.409 1.00 0.00 ? 41  LYS A HA   1  
ATOM 605   H HB2  . LYS A 1 41  ? 6.340   0.425   -16.836 1.00 0.00 ? 41  LYS A HB2  1  
ATOM 606   H HB3  . LYS A 1 41  ? 4.761   -0.287  -16.572 1.00 0.00 ? 41  LYS A HB3  1  
ATOM 607   H HG2  . LYS A 1 41  ? 3.958   0.464   -18.574 1.00 0.00 ? 41  LYS A HG2  1  
ATOM 608   H HG3  . LYS A 1 41  ? 4.623   2.068   -18.341 1.00 0.00 ? 41  LYS A HG3  1  
ATOM 609   H HD2  . LYS A 1 41  ? 6.144   1.540   -19.946 1.00 0.00 ? 41  LYS A HD2  1  
ATOM 610   H HD3  . LYS A 1 41  ? 6.913   0.516   -18.750 1.00 0.00 ? 41  LYS A HD3  1  
ATOM 611   H HE2  . LYS A 1 41  ? 4.590   -0.817  -19.973 1.00 0.00 ? 41  LYS A HE2  1  
ATOM 612   H HE3  . LYS A 1 41  ? 5.757   -0.323  -21.184 1.00 0.00 ? 41  LYS A HE3  1  
ATOM 613   H HZ1  . LYS A 1 41  ? 7.455   -1.469  -19.977 1.00 0.00 ? 41  LYS A HZ1  1  
ATOM 614   H HZ2  . LYS A 1 41  ? 6.427   -1.858  -18.769 1.00 0.00 ? 41  LYS A HZ2  1  
ATOM 615   H HZ3  . LYS A 1 41  ? 6.221   -2.503  -20.255 1.00 0.00 ? 41  LYS A HZ3  1  
ATOM 616   N N    . GLY A 1 42  ? 3.831   2.227   -13.795 1.00 0.00 ? 42  GLY A N    1  
ATOM 617   C CA   . GLY A 1 42  ? 3.143   1.913   -12.554 1.00 0.00 ? 42  GLY A CA   1  
ATOM 618   C C    . GLY A 1 42  ? 2.071   2.958   -12.242 1.00 0.00 ? 42  GLY A C    1  
ATOM 619   O O    . GLY A 1 42  ? 1.321   3.367   -13.128 1.00 0.00 ? 42  GLY A O    1  
ATOM 620   H H    . GLY A 1 42  ? 3.982   3.202   -13.959 1.00 0.00 ? 42  GLY A H    1  
ATOM 621   H HA2  . GLY A 1 42  ? 2.684   0.927   -12.629 1.00 0.00 ? 42  GLY A HA2  1  
ATOM 622   H HA3  . GLY A 1 42  ? 3.862   1.869   -11.736 1.00 0.00 ? 42  GLY A HA3  1  
ATOM 623   N N    . GLY A 1 43  ? 2.032   3.362   -10.981 1.00 0.00 ? 43  GLY A N    1  
ATOM 624   C CA   . GLY A 1 43  ? 1.064   4.352   -10.541 1.00 0.00 ? 43  GLY A CA   1  
ATOM 625   C C    . GLY A 1 43  ? 1.742   5.459   -9.731  1.00 0.00 ? 43  GLY A C    1  
ATOM 626   O O    . GLY A 1 43  ? 2.899   5.794   -9.978  1.00 0.00 ? 43  GLY A O    1  
ATOM 627   H H    . GLY A 1 43  ? 2.646   3.024   -10.267 1.00 0.00 ? 43  GLY A H    1  
ATOM 628   H HA2  . GLY A 1 43  ? 0.563   4.785   -11.407 1.00 0.00 ? 43  GLY A HA2  1  
ATOM 629   H HA3  . GLY A 1 43  ? 0.296   3.871   -9.935  1.00 0.00 ? 43  GLY A HA3  1  
ATOM 630   N N    . ILE A 1 44  ? 0.992   5.996   -8.780  1.00 0.00 ? 44  ILE A N    1  
ATOM 631   C CA   . ILE A 1 44  ? 1.505   7.058   -7.931  1.00 0.00 ? 44  ILE A CA   1  
ATOM 632   C C    . ILE A 1 44  ? 1.922   6.470   -6.581  1.00 0.00 ? 44  ILE A C    1  
ATOM 633   O O    . ILE A 1 44  ? 1.235   5.606   -6.038  1.00 0.00 ? 44  ILE A O    1  
ATOM 634   C CB   . ILE A 1 44  ? 0.487   8.194   -7.820  1.00 0.00 ? 44  ILE A CB   1  
ATOM 635   C CG1  . ILE A 1 44  ? 0.071   8.695   -9.204  1.00 0.00 ? 44  ILE A CG1  1  
ATOM 636   C CG2  . ILE A 1 44  ? 1.022   9.325   -6.938  1.00 0.00 ? 44  ILE A CG2  1  
ATOM 637   C CD1  . ILE A 1 44  ? 1.195   9.502   -9.857  1.00 0.00 ? 44  ILE A CD1  1  
ATOM 638   H H    . ILE A 1 44  ? 0.051   5.717   -8.585  1.00 0.00 ? 44  ILE A H    1  
ATOM 639   H HA   . ILE A 1 44  ? 2.391   7.465   -8.419  1.00 0.00 ? 44  ILE A HA   1  
ATOM 640   H HB   . ILE A 1 44  ? -0.408  7.804   -7.336  1.00 0.00 ? 44  ILE A HB   1  
ATOM 641   H HG12 . ILE A 1 44  ? -0.189  7.847   -9.839  1.00 0.00 ? 44  ILE A HG12 1  
ATOM 642   H HG13 . ILE A 1 44  ? -0.823  9.313   -9.118  1.00 0.00 ? 44  ILE A HG13 1  
ATOM 643   H HG21 . ILE A 1 44  ? 1.690   9.957   -7.523  1.00 0.00 ? 44  ILE A HG21 1  
ATOM 644   H HG22 . ILE A 1 44  ? 0.188   9.922   -6.568  1.00 0.00 ? 44  ILE A HG22 1  
ATOM 645   H HG23 . ILE A 1 44  ? 1.567   8.901   -6.095  1.00 0.00 ? 44  ILE A HG23 1  
ATOM 646   H HD11 . ILE A 1 44  ? 2.158   9.080   -9.570  1.00 0.00 ? 44  ILE A HD11 1  
ATOM 647   H HD12 . ILE A 1 44  ? 1.089   9.462   -10.941 1.00 0.00 ? 44  ILE A HD12 1  
ATOM 648   H HD13 . ILE A 1 44  ? 1.138   10.538  -9.524  1.00 0.00 ? 44  ILE A HD13 1  
ATOM 649   N N    . TYR A 1 45  ? 3.044   6.962   -6.079  1.00 0.00 ? 45  TYR A N    1  
ATOM 650   C CA   . TYR A 1 45  ? 3.560   6.497   -4.802  1.00 0.00 ? 45  TYR A CA   1  
ATOM 651   C C    . TYR A 1 45  ? 3.955   7.674   -3.908  1.00 0.00 ? 45  TYR A C    1  
ATOM 652   O O    . TYR A 1 45  ? 4.512   8.661   -4.386  1.00 0.00 ? 45  TYR A O    1  
ATOM 653   C CB   . TYR A 1 45  ? 4.810   5.677   -5.127  1.00 0.00 ? 45  TYR A CB   1  
ATOM 654   C CG   . TYR A 1 45  ? 4.532   4.420   -5.954  1.00 0.00 ? 45  TYR A CG   1  
ATOM 655   C CD1  . TYR A 1 45  ? 4.556   4.481   -7.332  1.00 0.00 ? 45  TYR A CD1  1  
ATOM 656   C CD2  . TYR A 1 45  ? 4.258   3.224   -5.321  1.00 0.00 ? 45  TYR A CD2  1  
ATOM 657   C CE1  . TYR A 1 45  ? 4.295   3.298   -8.110  1.00 0.00 ? 45  TYR A CE1  1  
ATOM 658   C CE2  . TYR A 1 45  ? 3.996   2.041   -6.099  1.00 0.00 ? 45  TYR A CE2  1  
ATOM 659   C CZ   . TYR A 1 45  ? 4.028   2.137   -7.456  1.00 0.00 ? 45  TYR A CZ   1  
ATOM 660   O OH   . TYR A 1 45  ? 3.781   1.019   -8.191  1.00 0.00 ? 45  TYR A OH   1  
ATOM 661   H H    . TYR A 1 45  ? 3.597   7.665   -6.527  1.00 0.00 ? 45  TYR A H    1  
ATOM 662   H HA   . TYR A 1 45  ? 2.774   5.924   -4.311  1.00 0.00 ? 45  TYR A HA   1  
ATOM 663   H HB2  . TYR A 1 45  ? 5.515   6.307   -5.668  1.00 0.00 ? 45  TYR A HB2  1  
ATOM 664   H HB3  . TYR A 1 45  ? 5.293   5.386   -4.194  1.00 0.00 ? 45  TYR A HB3  1  
ATOM 665   H HD1  . TYR A 1 45  ? 4.773   5.426   -7.832  1.00 0.00 ? 45  TYR A HD1  1  
ATOM 666   H HD2  . TYR A 1 45  ? 4.239   3.176   -4.232  1.00 0.00 ? 45  TYR A HD2  1  
ATOM 667   H HE1  . TYR A 1 45  ? 4.311   3.333   -9.200  1.00 0.00 ? 45  TYR A HE1  1  
ATOM 668   H HE2  . TYR A 1 45  ? 3.778   1.091   -5.613  1.00 0.00 ? 45  TYR A HE2  1  
ATOM 669   H HH   . TYR A 1 45  ? 4.466   0.927   -8.913  1.00 0.00 ? 45  TYR A HH   1  
ATOM 670   N N    . VAL A 1 46  ? 3.650   7.531   -2.627  1.00 0.00 ? 46  VAL A N    1  
ATOM 671   C CA   . VAL A 1 46  ? 3.966   8.570   -1.662  1.00 0.00 ? 46  VAL A CA   1  
ATOM 672   C C    . VAL A 1 46  ? 5.484   8.661   -1.496  1.00 0.00 ? 46  VAL A C    1  
ATOM 673   O O    . VAL A 1 46  ? 6.142   7.662   -1.212  1.00 0.00 ? 46  VAL A O    1  
ATOM 674   C CB   . VAL A 1 46  ? 3.236   8.300   -0.345  1.00 0.00 ? 46  VAL A CB   1  
ATOM 675   C CG1  . VAL A 1 46  ? 3.760   9.209   0.769   1.00 0.00 ? 46  VAL A CG1  1  
ATOM 676   C CG2  . VAL A 1 46  ? 1.723   8.458   -0.514  1.00 0.00 ? 46  VAL A CG2  1  
ATOM 677   H H    . VAL A 1 46  ? 3.196   6.725   -2.247  1.00 0.00 ? 46  VAL A H    1  
ATOM 678   H HA   . VAL A 1 46  ? 3.599   9.515   -2.064  1.00 0.00 ? 46  VAL A HA   1  
ATOM 679   H HB   . VAL A 1 46  ? 3.435   7.268   -0.056  1.00 0.00 ? 46  VAL A HB   1  
ATOM 680   H HG11 . VAL A 1 46  ? 4.848   9.142   0.811   1.00 0.00 ? 46  VAL A HG11 1  
ATOM 681   H HG12 . VAL A 1 46  ? 3.468   10.239  0.565   1.00 0.00 ? 46  VAL A HG12 1  
ATOM 682   H HG13 . VAL A 1 46  ? 3.340   8.894   1.724   1.00 0.00 ? 46  VAL A HG13 1  
ATOM 683   H HG21 . VAL A 1 46  ? 1.230   7.521   -0.254  1.00 0.00 ? 46  VAL A HG21 1  
ATOM 684   H HG22 . VAL A 1 46  ? 1.365   9.251   0.142   1.00 0.00 ? 46  VAL A HG22 1  
ATOM 685   H HG23 . VAL A 1 46  ? 1.498   8.712   -1.549  1.00 0.00 ? 46  VAL A HG23 1  
ATOM 686   N N    . SER A 1 47  ? 5.996   9.870   -1.681  1.00 0.00 ? 47  SER A N    1  
ATOM 687   C CA   . SER A 1 47  ? 7.424   10.104  -1.555  1.00 0.00 ? 47  SER A CA   1  
ATOM 688   C C    . SER A 1 47  ? 7.736   10.717  -0.188  1.00 0.00 ? 47  SER A C    1  
ATOM 689   O O    . SER A 1 47  ? 8.873   10.659  0.278   1.00 0.00 ? 47  SER A O    1  
ATOM 690   C CB   . SER A 1 47  ? 7.933   11.016  -2.673  1.00 0.00 ? 47  SER A CB   1  
ATOM 691   O OG   . SER A 1 47  ? 8.910   11.942  -2.205  1.00 0.00 ? 47  SER A OG   1  
ATOM 692   H H    . SER A 1 47  ? 5.453   10.677  -1.911  1.00 0.00 ? 47  SER A H    1  
ATOM 693   H HA   . SER A 1 47  ? 7.888   9.122   -1.649  1.00 0.00 ? 47  SER A HA   1  
ATOM 694   H HB2  . SER A 1 47  ? 8.363   10.408  -3.470  1.00 0.00 ? 47  SER A HB2  1  
ATOM 695   H HB3  . SER A 1 47  ? 7.094   11.562  -3.106  1.00 0.00 ? 47  SER A HB3  1  
ATOM 696   H HG   . SER A 1 47  ? 8.486   12.833  -2.042  1.00 0.00 ? 47  SER A HG   1  
ATOM 697   N N    . LYS A 1 48  ? 6.705   11.289  0.417   1.00 0.00 ? 48  LYS A N    1  
ATOM 698   C CA   . LYS A 1 48  ? 6.855   11.912  1.722   1.00 0.00 ? 48  LYS A CA   1  
ATOM 699   C C    . LYS A 1 48  ? 5.485   12.378  2.219   1.00 0.00 ? 48  LYS A C    1  
ATOM 700   O O    . LYS A 1 48  ? 4.529   12.443  1.448   1.00 0.00 ? 48  LYS A O    1  
ATOM 701   C CB   . LYS A 1 48  ? 7.901   13.027  1.666   1.00 0.00 ? 48  LYS A CB   1  
ATOM 702   C CG   . LYS A 1 48  ? 8.320   13.455  3.074   1.00 0.00 ? 48  LYS A CG   1  
ATOM 703   C CD   . LYS A 1 48  ? 9.557   14.355  3.028   1.00 0.00 ? 48  LYS A CD   1  
ATOM 704   C CE   . LYS A 1 48  ? 9.351   15.614  3.872   1.00 0.00 ? 48  LYS A CE   1  
ATOM 705   N NZ   . LYS A 1 48  ? 8.816   16.714  3.039   1.00 0.00 ? 48  LYS A NZ   1  
ATOM 706   H H    . LYS A 1 48  ? 5.784   11.332  0.032   1.00 0.00 ? 48  LYS A H    1  
ATOM 707   H HA   . LYS A 1 48  ? 7.230   11.151  2.405   1.00 0.00 ? 48  LYS A HA   1  
ATOM 708   H HB2  . LYS A 1 48  ? 8.775   12.684  1.112   1.00 0.00 ? 48  LYS A HB2  1  
ATOM 709   H HB3  . LYS A 1 48  ? 7.497   13.883  1.127   1.00 0.00 ? 48  LYS A HB3  1  
ATOM 710   H HG2  . LYS A 1 48  ? 7.499   13.985  3.557   1.00 0.00 ? 48  LYS A HG2  1  
ATOM 711   H HG3  . LYS A 1 48  ? 8.530   12.573  3.679   1.00 0.00 ? 48  LYS A HG3  1  
ATOM 712   H HD2  . LYS A 1 48  ? 10.425  13.805  3.394   1.00 0.00 ? 48  LYS A HD2  1  
ATOM 713   H HD3  . LYS A 1 48  ? 9.769   14.635  1.996   1.00 0.00 ? 48  LYS A HD3  1  
ATOM 714   H HE2  . LYS A 1 48  ? 8.663   15.402  4.690   1.00 0.00 ? 48  LYS A HE2  1  
ATOM 715   H HE3  . LYS A 1 48  ? 10.296  15.917  4.321   1.00 0.00 ? 48  LYS A HE3  1  
ATOM 716   H HZ1  . LYS A 1 48  ? 9.381   16.817  2.220   1.00 0.00 ? 48  LYS A HZ1  1  
ATOM 717   H HZ2  . LYS A 1 48  ? 7.876   16.503  2.771   1.00 0.00 ? 48  LYS A HZ2  1  
ATOM 718   H HZ3  . LYS A 1 48  ? 8.830   17.566  3.562   1.00 0.00 ? 48  LYS A HZ3  1  
ATOM 719   N N    . VAL A 1 49  ? 5.434   12.690  3.506   1.00 0.00 ? 49  VAL A N    1  
ATOM 720   C CA   . VAL A 1 49  ? 4.197   13.148  4.116   1.00 0.00 ? 49  VAL A CA   1  
ATOM 721   C C    . VAL A 1 49  ? 4.524   14.091  5.276   1.00 0.00 ? 49  VAL A C    1  
ATOM 722   O O    . VAL A 1 49  ? 4.867   13.641  6.368   1.00 0.00 ? 49  VAL A O    1  
ATOM 723   C CB   . VAL A 1 49  ? 3.348   11.949  4.541   1.00 0.00 ? 49  VAL A CB   1  
ATOM 724   C CG1  . VAL A 1 49  ? 4.165   10.972  5.389   1.00 0.00 ? 49  VAL A CG1  1  
ATOM 725   C CG2  . VAL A 1 49  ? 2.092   12.404  5.287   1.00 0.00 ? 49  VAL A CG2  1  
ATOM 726   H H    . VAL A 1 49  ? 6.216   12.635  4.127   1.00 0.00 ? 49  VAL A H    1  
ATOM 727   H HA   . VAL A 1 49  ? 3.643   13.703  3.359   1.00 0.00 ? 49  VAL A HA   1  
ATOM 728   H HB   . VAL A 1 49  ? 3.031   11.426  3.639   1.00 0.00 ? 49  VAL A HB   1  
ATOM 729   H HG11 . VAL A 1 49  ? 5.083   10.712  4.861   1.00 0.00 ? 49  VAL A HG11 1  
ATOM 730   H HG12 . VAL A 1 49  ? 4.414   11.437  6.342   1.00 0.00 ? 49  VAL A HG12 1  
ATOM 731   H HG13 . VAL A 1 49  ? 3.581   10.069  5.567   1.00 0.00 ? 49  VAL A HG13 1  
ATOM 732   H HG21 . VAL A 1 49  ? 1.215   11.929  4.845   1.00 0.00 ? 49  VAL A HG21 1  
ATOM 733   H HG22 . VAL A 1 49  ? 2.169   12.119  6.336   1.00 0.00 ? 49  VAL A HG22 1  
ATOM 734   H HG23 . VAL A 1 49  ? 1.996   13.487  5.211   1.00 0.00 ? 49  VAL A HG23 1  
ATOM 735   N N    . THR A 1 50  ? 4.406   15.381  4.999   1.00 0.00 ? 50  THR A N    1  
ATOM 736   C CA   . THR A 1 50  ? 4.685   16.391  6.006   1.00 0.00 ? 50  THR A CA   1  
ATOM 737   C C    . THR A 1 50  ? 4.043   16.005  7.340   1.00 0.00 ? 50  THR A C    1  
ATOM 738   O O    . THR A 1 50  ? 2.865   15.657  7.389   1.00 0.00 ? 50  THR A O    1  
ATOM 739   C CB   . THR A 1 50  ? 4.204   17.740  5.468   1.00 0.00 ? 50  THR A CB   1  
ATOM 740   O OG1  . THR A 1 50  ? 5.102   18.029  4.401   1.00 0.00 ? 50  THR A OG1  1  
ATOM 741   C CG2  . THR A 1 50  ? 4.429   18.881  6.463   1.00 0.00 ? 50  THR A CG2  1  
ATOM 742   H H    . THR A 1 50  ? 4.126   15.739  4.108   1.00 0.00 ? 50  THR A H    1  
ATOM 743   H HA   . THR A 1 50  ? 5.762   16.427  6.168   1.00 0.00 ? 50  THR A HA   1  
ATOM 744   H HB   . THR A 1 50  ? 3.158   17.688  5.165   1.00 0.00 ? 50  THR A HB   1  
ATOM 745   H HG1  . THR A 1 50  ? 6.047   17.970  4.723   1.00 0.00 ? 50  THR A HG1  1  
ATOM 746   H HG21 . THR A 1 50  ? 3.486   19.398  6.642   1.00 0.00 ? 50  THR A HG21 1  
ATOM 747   H HG22 . THR A 1 50  ? 4.805   18.475  7.402   1.00 0.00 ? 50  THR A HG22 1  
ATOM 748   H HG23 . THR A 1 50  ? 5.156   19.582  6.053   1.00 0.00 ? 50  THR A HG23 1  
ATOM 749   N N    . VAL A 1 51  ? 4.848   16.080  8.391   1.00 0.00 ? 51  VAL A N    1  
ATOM 750   C CA   . VAL A 1 51  ? 4.373   15.742  9.722   1.00 0.00 ? 51  VAL A CA   1  
ATOM 751   C C    . VAL A 1 51  ? 3.689   16.964  10.339  1.00 0.00 ? 51  VAL A C    1  
ATOM 752   O O    . VAL A 1 51  ? 4.250   18.058  10.343  1.00 0.00 ? 51  VAL A O    1  
ATOM 753   C CB   . VAL A 1 51  ? 5.530   15.212  10.571  1.00 0.00 ? 51  VAL A CB   1  
ATOM 754   C CG1  . VAL A 1 51  ? 5.130   15.117  12.045  1.00 0.00 ? 51  VAL A CG1  1  
ATOM 755   C CG2  . VAL A 1 51  ? 6.021   13.861  10.047  1.00 0.00 ? 51  VAL A CG2  1  
ATOM 756   H H    . VAL A 1 51  ? 5.805   16.364  8.342   1.00 0.00 ? 51  VAL A H    1  
ATOM 757   H HA   . VAL A 1 51  ? 3.639   14.944  9.617   1.00 0.00 ? 51  VAL A HA   1  
ATOM 758   H HB   . VAL A 1 51  ? 6.355   15.921  10.493  1.00 0.00 ? 51  VAL A HB   1  
ATOM 759   H HG11 . VAL A 1 51  ? 4.105   15.466  12.166  1.00 0.00 ? 51  VAL A HG11 1  
ATOM 760   H HG12 . VAL A 1 51  ? 5.202   14.080  12.374  1.00 0.00 ? 51  VAL A HG12 1  
ATOM 761   H HG13 . VAL A 1 51  ? 5.798   15.736  12.643  1.00 0.00 ? 51  VAL A HG13 1  
ATOM 762   H HG21 . VAL A 1 51  ? 5.185   13.317  9.608   1.00 0.00 ? 51  VAL A HG21 1  
ATOM 763   H HG22 . VAL A 1 51  ? 6.788   14.022  9.290   1.00 0.00 ? 51  VAL A HG22 1  
ATOM 764   H HG23 . VAL A 1 51  ? 6.439   13.282  10.871  1.00 0.00 ? 51  VAL A HG23 1  
ATOM 765   N N    . GLY A 1 52  ? 2.487   16.735  10.846  1.00 0.00 ? 52  GLY A N    1  
ATOM 766   C CA   . GLY A 1 52  ? 1.720   17.803  11.465  1.00 0.00 ? 52  GLY A CA   1  
ATOM 767   C C    . GLY A 1 52  ? 0.682   18.367  10.493  1.00 0.00 ? 52  GLY A C    1  
ATOM 768   O O    . GLY A 1 52  ? -0.170  19.164  10.882  1.00 0.00 ? 52  GLY A O    1  
ATOM 769   H H    . GLY A 1 52  ? 2.037   15.842  10.839  1.00 0.00 ? 52  GLY A H    1  
ATOM 770   H HA2  . GLY A 1 52  ? 1.221   17.427  12.358  1.00 0.00 ? 52  GLY A HA2  1  
ATOM 771   H HA3  . GLY A 1 52  ? 2.392   18.599  11.786  1.00 0.00 ? 52  GLY A HA3  1  
ATOM 772   N N    . SER A 1 53  ? 0.787   17.931  9.246   1.00 0.00 ? 53  SER A N    1  
ATOM 773   C CA   . SER A 1 53  ? -0.132  18.382  8.215   1.00 0.00 ? 53  SER A CA   1  
ATOM 774   C C    . SER A 1 53  ? -1.350  17.458  8.159   1.00 0.00 ? 53  SER A C    1  
ATOM 775   O O    . SER A 1 53  ? -1.339  16.374  8.740   1.00 0.00 ? 53  SER A O    1  
ATOM 776   C CB   . SER A 1 53  ? 0.556   18.437  6.850   1.00 0.00 ? 53  SER A CB   1  
ATOM 777   O OG   . SER A 1 53  ? 1.290   19.645  6.670   1.00 0.00 ? 53  SER A OG   1  
ATOM 778   H H    . SER A 1 53  ? 1.483   17.283  8.937   1.00 0.00 ? 53  SER A H    1  
ATOM 779   H HA   . SER A 1 53  ? -0.429  19.388  8.513   1.00 0.00 ? 53  SER A HA   1  
ATOM 780   H HB2  . SER A 1 53  ? 1.228   17.585  6.748   1.00 0.00 ? 53  SER A HB2  1  
ATOM 781   H HB3  . SER A 1 53  ? -0.193  18.348  6.063   1.00 0.00 ? 53  SER A HB3  1  
ATOM 782   H HG   . SER A 1 53  ? 1.459   20.077  7.556   1.00 0.00 ? 53  SER A HG   1  
ATOM 783   N N    . ILE A 1 54  ? -2.372  17.920  7.454   1.00 0.00 ? 54  ILE A N    1  
ATOM 784   C CA   . ILE A 1 54  ? -3.595  17.149  7.314   1.00 0.00 ? 54  ILE A CA   1  
ATOM 785   C C    . ILE A 1 54  ? -3.244  15.667  7.164   1.00 0.00 ? 54  ILE A C    1  
ATOM 786   O O    . ILE A 1 54  ? -3.618  14.849  8.003   1.00 0.00 ? 54  ILE A O    1  
ATOM 787   C CB   . ILE A 1 54  ? -4.448  17.698  6.168   1.00 0.00 ? 54  ILE A CB   1  
ATOM 788   C CG1  . ILE A 1 54  ? -4.874  19.141  6.445   1.00 0.00 ? 54  ILE A CG1  1  
ATOM 789   C CG2  . ILE A 1 54  ? -5.646  16.789  5.892   1.00 0.00 ? 54  ILE A CG2  1  
ATOM 790   C CD1  . ILE A 1 54  ? -5.754  19.223  7.695   1.00 0.00 ? 54  ILE A CD1  1  
ATOM 791   H H    . ILE A 1 54  ? -2.373  18.803  6.984   1.00 0.00 ? 54  ILE A H    1  
ATOM 792   H HA   . ILE A 1 54  ? -4.169  17.277  8.232   1.00 0.00 ? 54  ILE A HA   1  
ATOM 793   H HB   . ILE A 1 54  ? -3.838  17.710  5.265   1.00 0.00 ? 54  ILE A HB   1  
ATOM 794   H HG12 . ILE A 1 54  ? -3.991  19.766  6.576   1.00 0.00 ? 54  ILE A HG12 1  
ATOM 795   H HG13 . ILE A 1 54  ? -5.419  19.534  5.587   1.00 0.00 ? 54  ILE A HG13 1  
ATOM 796   H HG21 . ILE A 1 54  ? -5.424  16.142  5.043   1.00 0.00 ? 54  ILE A HG21 1  
ATOM 797   H HG22 . ILE A 1 54  ? -5.849  16.177  6.771   1.00 0.00 ? 54  ILE A HG22 1  
ATOM 798   H HG23 . ILE A 1 54  ? -6.521  17.399  5.665   1.00 0.00 ? 54  ILE A HG23 1  
ATOM 799   H HD11 . ILE A 1 54  ? -6.490  18.419  7.674   1.00 0.00 ? 54  ILE A HD11 1  
ATOM 800   H HD12 . ILE A 1 54  ? -5.132  19.123  8.584   1.00 0.00 ? 54  ILE A HD12 1  
ATOM 801   H HD13 . ILE A 1 54  ? -6.266  20.184  7.716   1.00 0.00 ? 54  ILE A HD13 1  
ATOM 802   N N    . ALA A 1 55  ? -2.530  15.367  6.090   1.00 0.00 ? 55  ALA A N    1  
ATOM 803   C CA   . ALA A 1 55  ? -2.124  13.998  5.819   1.00 0.00 ? 55  ALA A CA   1  
ATOM 804   C C    . ALA A 1 55  ? -1.739  13.316  7.133   1.00 0.00 ? 55  ALA A C    1  
ATOM 805   O O    . ALA A 1 55  ? -2.421  12.395  7.581   1.00 0.00 ? 55  ALA A O    1  
ATOM 806   C CB   . ALA A 1 55  ? -0.980  13.996  4.803   1.00 0.00 ? 55  ALA A CB   1  
ATOM 807   H H    . ALA A 1 55  ? -2.230  16.039  5.412   1.00 0.00 ? 55  ALA A H    1  
ATOM 808   H HA   . ALA A 1 55  ? -2.979  13.478  5.386   1.00 0.00 ? 55  ALA A HA   1  
ATOM 809   H HB1  . ALA A 1 55  ? -0.555  14.998  4.732   1.00 0.00 ? 55  ALA A HB1  1  
ATOM 810   H HB2  . ALA A 1 55  ? -0.209  13.297  5.127   1.00 0.00 ? 55  ALA A HB2  1  
ATOM 811   H HB3  . ALA A 1 55  ? -1.360  13.693  3.828   1.00 0.00 ? 55  ALA A HB3  1  
ATOM 812   N N    . HIS A 1 56  ? -0.648  13.793  7.713   1.00 0.00 ? 56  HIS A N    1  
ATOM 813   C CA   . HIS A 1 56  ? -0.164  13.240  8.966   1.00 0.00 ? 56  HIS A CA   1  
ATOM 814   C C    . HIS A 1 56  ? -1.352  12.881  9.861   1.00 0.00 ? 56  HIS A C    1  
ATOM 815   O O    . HIS A 1 56  ? -1.492  11.733  10.281  1.00 0.00 ? 56  HIS A O    1  
ATOM 816   C CB   . HIS A 1 56  ? 0.817   14.201  9.641   1.00 0.00 ? 56  HIS A CB   1  
ATOM 817   C CG   . HIS A 1 56  ? 1.811   13.524  10.555  1.00 0.00 ? 56  HIS A CG   1  
ATOM 818   N ND1  . HIS A 1 56  ? 1.745   13.616  11.934  1.00 0.00 ? 56  HIS A ND1  1  
ATOM 819   C CD2  . HIS A 1 56  ? 2.892   12.742  10.272  1.00 0.00 ? 56  HIS A CD2  1  
ATOM 820   C CE1  . HIS A 1 56  ? 2.748   12.919  12.448  1.00 0.00 ? 56  HIS A CE1  1  
ATOM 821   N NE2  . HIS A 1 56  ? 3.457   12.378  11.416  1.00 0.00 ? 56  HIS A NE2  1  
ATOM 822   H H    . HIS A 1 56  ? -0.099  14.542  7.341   1.00 0.00 ? 56  HIS A H    1  
ATOM 823   H HA   . HIS A 1 56  ? 0.381   12.330  8.717   1.00 0.00 ? 56  HIS A HA   1  
ATOM 824   H HB2  . HIS A 1 56  ? 1.361   14.748  8.872   1.00 0.00 ? 56  HIS A HB2  1  
ATOM 825   H HB3  . HIS A 1 56  ? 0.253   14.936  10.216  1.00 0.00 ? 56  HIS A HB3  1  
ATOM 826   H HD1  . HIS A 1 56  ? 1.058   14.124  12.454  1.00 0.00 ? 56  HIS A HD1  1  
ATOM 827   H HD2  . HIS A 1 56  ? 3.233   12.463  9.275   1.00 0.00 ? 56  HIS A HD2  1  
ATOM 828   H HE1  . HIS A 1 56  ? 2.967   12.799  13.509  1.00 0.00 ? 56  HIS A HE1  1  
ATOM 829   N N    . GLN A 1 57  ? -2.176  13.883  10.127  1.00 0.00 ? 57  GLN A N    1  
ATOM 830   C CA   . GLN A 1 57  ? -3.347  13.687  10.964  1.00 0.00 ? 57  GLN A CA   1  
ATOM 831   C C    . GLN A 1 57  ? -4.126  12.452  10.507  1.00 0.00 ? 57  GLN A C    1  
ATOM 832   O O    . GLN A 1 57  ? -4.509  11.617  11.325  1.00 0.00 ? 57  GLN A O    1  
ATOM 833   C CB   . GLN A 1 57  ? -4.239  14.930  10.960  1.00 0.00 ? 57  GLN A CB   1  
ATOM 834   C CG   . GLN A 1 57  ? -3.409  16.201  11.151  1.00 0.00 ? 57  GLN A CG   1  
ATOM 835   C CD   . GLN A 1 57  ? -4.275  17.349  11.672  1.00 0.00 ? 57  GLN A CD   1  
ATOM 836   O OE1  . GLN A 1 57  ? -5.413  17.534  11.272  1.00 0.00 ? 57  GLN A OE1  1  
ATOM 837   N NE2  . GLN A 1 57  ? -3.676  18.107  12.586  1.00 0.00 ? 57  GLN A NE2  1  
ATOM 838   H H    . GLN A 1 57  ? -2.054  14.814  9.782   1.00 0.00 ? 57  GLN A H    1  
ATOM 839   H HA   . GLN A 1 57  ? -2.960  13.529  11.971  1.00 0.00 ? 57  GLN A HA   1  
ATOM 840   H HB2  . GLN A 1 57  ? -4.786  14.986  10.019  1.00 0.00 ? 57  GLN A HB2  1  
ATOM 841   H HB3  . GLN A 1 57  ? -4.980  14.853  11.755  1.00 0.00 ? 57  GLN A HB3  1  
ATOM 842   H HG2  . GLN A 1 57  ? -2.596  16.007  11.850  1.00 0.00 ? 57  GLN A HG2  1  
ATOM 843   H HG3  . GLN A 1 57  ? -2.952  16.487  10.203  1.00 0.00 ? 57  GLN A HG3  1  
ATOM 844   H HE21 . GLN A 1 57  ? -2.740  17.901  12.871  1.00 0.00 ? 57  GLN A HE21 1  
ATOM 845   H HE22 . GLN A 1 57  ? -4.161  18.884  12.988  1.00 0.00 ? 57  GLN A HE22 1  
ATOM 846   N N    . ALA A 1 58  ? -4.337  12.375  9.201   1.00 0.00 ? 58  ALA A N    1  
ATOM 847   C CA   . ALA A 1 58  ? -5.063  11.256  8.625   1.00 0.00 ? 58  ALA A CA   1  
ATOM 848   C C    . ALA A 1 58  ? -4.330  9.954   8.956   1.00 0.00 ? 58  ALA A C    1  
ATOM 849   O O    . ALA A 1 58  ? -4.961  8.938   9.243   1.00 0.00 ? 58  ALA A O    1  
ATOM 850   C CB   . ALA A 1 58  ? -5.220  11.470  7.118   1.00 0.00 ? 58  ALA A CB   1  
ATOM 851   H H    . ALA A 1 58  ? -4.021  13.058  8.543   1.00 0.00 ? 58  ALA A H    1  
ATOM 852   H HA   . ALA A 1 58  ? -6.052  11.232  9.081   1.00 0.00 ? 58  ALA A HA   1  
ATOM 853   H HB1  . ALA A 1 58  ? -6.244  11.243  6.824   1.00 0.00 ? 58  ALA A HB1  1  
ATOM 854   H HB2  . ALA A 1 58  ? -4.993  12.508  6.873   1.00 0.00 ? 58  ALA A HB2  1  
ATOM 855   H HB3  . ALA A 1 58  ? -4.534  10.812  6.584   1.00 0.00 ? 58  ALA A HB3  1  
ATOM 856   N N    . GLY A 1 59  ? -3.008  10.026  8.903   1.00 0.00 ? 59  GLY A N    1  
ATOM 857   C CA   . GLY A 1 59  ? -2.183  8.866   9.193   1.00 0.00 ? 59  GLY A CA   1  
ATOM 858   C C    . GLY A 1 59  ? -1.646  8.239   7.905   1.00 0.00 ? 59  GLY A C    1  
ATOM 859   O O    . GLY A 1 59  ? -1.732  7.027   7.717   1.00 0.00 ? 59  GLY A O    1  
ATOM 860   H H    . GLY A 1 59  ? -2.503  10.856  8.668   1.00 0.00 ? 59  GLY A H    1  
ATOM 861   H HA2  . GLY A 1 59  ? -1.351  9.158   9.834   1.00 0.00 ? 59  GLY A HA2  1  
ATOM 862   H HA3  . GLY A 1 59  ? -2.767  8.129   9.744   1.00 0.00 ? 59  GLY A HA3  1  
ATOM 863   N N    . LEU A 1 60  ? -1.103  9.095   7.051   1.00 0.00 ? 60  LEU A N    1  
ATOM 864   C CA   . LEU A 1 60  ? -0.551  8.640   5.786   1.00 0.00 ? 60  LEU A CA   1  
ATOM 865   C C    . LEU A 1 60  ? 0.959   8.441   5.934   1.00 0.00 ? 60  LEU A C    1  
ATOM 866   O O    . LEU A 1 60  ? 1.612   9.163   6.685   1.00 0.00 ? 60  LEU A O    1  
ATOM 867   C CB   . LEU A 1 60  ? -0.937  9.599   4.658   1.00 0.00 ? 60  LEU A CB   1  
ATOM 868   C CG   . LEU A 1 60  ? -2.429  9.684   4.331   1.00 0.00 ? 60  LEU A CG   1  
ATOM 869   C CD1  . LEU A 1 60  ? -2.729  10.900  3.452   1.00 0.00 ? 60  LEU A CD1  1  
ATOM 870   C CD2  . LEU A 1 60  ? -2.927  8.383   3.698   1.00 0.00 ? 60  LEU A CD2  1  
ATOM 871   H H    . LEU A 1 60  ? -1.036  10.079  7.211   1.00 0.00 ? 60  LEU A H    1  
ATOM 872   H HA   . LEU A 1 60  ? -1.006  7.676   5.558   1.00 0.00 ? 60  LEU A HA   1  
ATOM 873   H HB2  . LEU A 1 60  ? -0.585  10.597  4.919   1.00 0.00 ? 60  LEU A HB2  1  
ATOM 874   H HB3  . LEU A 1 60  ? -0.404  9.300   3.755   1.00 0.00 ? 60  LEU A HB3  1  
ATOM 875   H HG   . LEU A 1 60  ? -2.976  9.819   5.264   1.00 0.00 ? 60  LEU A HG   1  
ATOM 876   H HD11 . LEU A 1 60  ? -3.676  11.346  3.759   1.00 0.00 ? 60  LEU A HD11 1  
ATOM 877   H HD12 . LEU A 1 60  ? -1.930  11.633  3.561   1.00 0.00 ? 60  LEU A HD12 1  
ATOM 878   H HD13 . LEU A 1 60  ? -2.796  10.588  2.410   1.00 0.00 ? 60  LEU A HD13 1  
ATOM 879   H HD21 . LEU A 1 60  ? -3.921  8.151   4.080   1.00 0.00 ? 60  LEU A HD21 1  
ATOM 880   H HD22 . LEU A 1 60  ? -2.972  8.499   2.615   1.00 0.00 ? 60  LEU A HD22 1  
ATOM 881   H HD23 . LEU A 1 60  ? -2.243  7.572   3.949   1.00 0.00 ? 60  LEU A HD23 1  
ATOM 882   N N    . GLU A 1 61  ? 1.468   7.459   5.206   1.00 0.00 ? 61  GLU A N    1  
ATOM 883   C CA   . GLU A 1 61  ? 2.889   7.156   5.248   1.00 0.00 ? 61  GLU A CA   1  
ATOM 884   C C    . GLU A 1 61  ? 3.424   6.927   3.833   1.00 0.00 ? 61  GLU A C    1  
ATOM 885   O O    . GLU A 1 61  ? 2.651   6.826   2.882   1.00 0.00 ? 61  GLU A O    1  
ATOM 886   C CB   . GLU A 1 61  ? 3.165   5.945   6.141   1.00 0.00 ? 61  GLU A CB   1  
ATOM 887   C CG   . GLU A 1 61  ? 2.582   4.669   5.532   1.00 0.00 ? 61  GLU A CG   1  
ATOM 888   C CD   . GLU A 1 61  ? 1.230   4.329   6.162   1.00 0.00 ? 61  GLU A CD   1  
ATOM 889   O OE1  . GLU A 1 61  ? 0.338   5.203   6.098   1.00 0.00 ? 61  GLU A OE1  1  
ATOM 890   O OE2  . GLU A 1 61  ? 1.118   3.203   6.693   1.00 0.00 ? 61  GLU A OE2  1  
ATOM 891   H H    . GLU A 1 61  ? 0.930   6.876   4.598   1.00 0.00 ? 61  GLU A H    1  
ATOM 892   H HA   . GLU A 1 61  ? 3.360   8.036   5.684   1.00 0.00 ? 61  GLU A HA   1  
ATOM 893   H HB2  . GLU A 1 61  ? 4.240   5.828   6.279   1.00 0.00 ? 61  GLU A HB2  1  
ATOM 894   H HB3  . GLU A 1 61  ? 2.734   6.111   7.129   1.00 0.00 ? 61  GLU A HB3  1  
ATOM 895   H HG2  . GLU A 1 61  ? 2.463   4.797   4.456   1.00 0.00 ? 61  GLU A HG2  1  
ATOM 896   H HG3  . GLU A 1 61  ? 3.275   3.841   5.680   1.00 0.00 ? 61  GLU A HG3  1  
ATOM 897   N N    . TYR A 1 62  ? 4.744   6.852   3.739   1.00 0.00 ? 62  TYR A N    1  
ATOM 898   C CA   . TYR A 1 62  ? 5.392   6.637   2.456   1.00 0.00 ? 62  TYR A CA   1  
ATOM 899   C C    . TYR A 1 62  ? 5.224   5.189   1.993   1.00 0.00 ? 62  TYR A C    1  
ATOM 900   O O    . TYR A 1 62  ? 5.099   4.281   2.814   1.00 0.00 ? 62  TYR A O    1  
ATOM 901   C CB   . TYR A 1 62  ? 6.879   6.918   2.683   1.00 0.00 ? 62  TYR A CB   1  
ATOM 902   C CG   . TYR A 1 62  ? 7.748   6.705   1.442   1.00 0.00 ? 62  TYR A CG   1  
ATOM 903   C CD1  . TYR A 1 62  ? 7.962   5.430   0.960   1.00 0.00 ? 62  TYR A CD1  1  
ATOM 904   C CD2  . TYR A 1 62  ? 8.318   7.788   0.804   1.00 0.00 ? 62  TYR A CD2  1  
ATOM 905   C CE1  . TYR A 1 62  ? 8.781   5.229   -0.208  1.00 0.00 ? 62  TYR A CE1  1  
ATOM 906   C CE2  . TYR A 1 62  ? 9.136   7.588   -0.364  1.00 0.00 ? 62  TYR A CE2  1  
ATOM 907   C CZ   . TYR A 1 62  ? 9.327   6.318   -0.812  1.00 0.00 ? 62  TYR A CZ   1  
ATOM 908   O OH   . TYR A 1 62  ? 10.100  6.128   -1.915  1.00 0.00 ? 62  TYR A OH   1  
ATOM 909   H H    . TYR A 1 62  ? 5.366   6.935   4.518   1.00 0.00 ? 62  TYR A H    1  
ATOM 910   H HA   . TYR A 1 62  ? 4.925   7.300   1.728   1.00 0.00 ? 62  TYR A HA   1  
ATOM 911   H HB2  . TYR A 1 62  ? 6.996   7.947   3.023   1.00 0.00 ? 62  TYR A HB2  1  
ATOM 912   H HB3  . TYR A 1 62  ? 7.242   6.274   3.483   1.00 0.00 ? 62  TYR A HB3  1  
ATOM 913   H HD1  . TYR A 1 62  ? 7.512   4.574   1.464   1.00 0.00 ? 62  TYR A HD1  1  
ATOM 914   H HD2  . TYR A 1 62  ? 8.149   8.796   1.185   1.00 0.00 ? 62  TYR A HD2  1  
ATOM 915   H HE1  . TYR A 1 62  ? 8.958   4.227   -0.598  1.00 0.00 ? 62  TYR A HE1  1  
ATOM 916   H HE2  . TYR A 1 62  ? 9.592   8.434   -0.877  1.00 0.00 ? 62  TYR A HE2  1  
ATOM 917   H HH   . TYR A 1 62  ? 11.036  6.431   -1.733  1.00 0.00 ? 62  TYR A HH   1  
ATOM 918   N N    . GLY A 1 63  ? 5.225   5.018   0.679   1.00 0.00 ? 63  GLY A N    1  
ATOM 919   C CA   . GLY A 1 63  ? 5.074   3.695   0.097   1.00 0.00 ? 63  GLY A CA   1  
ATOM 920   C C    . GLY A 1 63  ? 3.603   3.388   -0.193  1.00 0.00 ? 63  GLY A C    1  
ATOM 921   O O    . GLY A 1 63  ? 3.292   2.648   -1.124  1.00 0.00 ? 63  GLY A O    1  
ATOM 922   H H    . GLY A 1 63  ? 5.326   5.761   0.018   1.00 0.00 ? 63  GLY A H    1  
ATOM 923   H HA2  . GLY A 1 63  ? 5.651   3.632   -0.826  1.00 0.00 ? 63  GLY A HA2  1  
ATOM 924   H HA3  . GLY A 1 63  ? 5.478   2.946   0.777   1.00 0.00 ? 63  GLY A HA3  1  
ATOM 925   N N    . ASP A 1 64  ? 2.738   3.973   0.623   1.00 0.00 ? 64  ASP A N    1  
ATOM 926   C CA   . ASP A 1 64  ? 1.308   3.771   0.466   1.00 0.00 ? 64  ASP A CA   1  
ATOM 927   C C    . ASP A 1 64  ? 0.887   4.202   -0.941  1.00 0.00 ? 64  ASP A C    1  
ATOM 928   O O    . ASP A 1 64  ? 0.801   5.395   -1.228  1.00 0.00 ? 64  ASP A O    1  
ATOM 929   C CB   . ASP A 1 64  ? 0.519   4.610   1.473   1.00 0.00 ? 64  ASP A CB   1  
ATOM 930   C CG   . ASP A 1 64  ? -0.051  3.830   2.659   1.00 0.00 ? 64  ASP A CG   1  
ATOM 931   O OD1  . ASP A 1 64  ? -0.068  2.584   2.563   1.00 0.00 ? 64  ASP A OD1  1  
ATOM 932   O OD2  . ASP A 1 64  ? -0.458  4.498   3.635   1.00 0.00 ? 64  ASP A OD2  1  
ATOM 933   H H    . ASP A 1 64  ? 3.000   4.573   1.378   1.00 0.00 ? 64  ASP A H    1  
ATOM 934   H HA   . ASP A 1 64  ? 1.148   2.707   0.641   1.00 0.00 ? 64  ASP A HA   1  
ATOM 935   H HB2  . ASP A 1 64  ? 1.169   5.398   1.855   1.00 0.00 ? 64  ASP A HB2  1  
ATOM 936   H HB3  . ASP A 1 64  ? -0.302  5.101   0.951   1.00 0.00 ? 64  ASP A HB3  1  
ATOM 937   N N    . GLN A 1 65  ? 0.637   3.208   -1.780  1.00 0.00 ? 65  GLN A N    1  
ATOM 938   C CA   . GLN A 1 65  ? 0.228   3.469   -3.149  1.00 0.00 ? 65  GLN A CA   1  
ATOM 939   C C    . GLN A 1 65  ? -1.202  4.015   -3.181  1.00 0.00 ? 65  GLN A C    1  
ATOM 940   O O    . GLN A 1 65  ? -2.130  3.361   -2.707  1.00 0.00 ? 65  GLN A O    1  
ATOM 941   C CB   . GLN A 1 65  ? 0.353   2.210   -4.009  1.00 0.00 ? 65  GLN A CB   1  
ATOM 942   C CG   . GLN A 1 65  ? 0.494   2.568   -5.489  1.00 0.00 ? 65  GLN A CG   1  
ATOM 943   C CD   . GLN A 1 65  ? -0.201  1.530   -6.373  1.00 0.00 ? 65  GLN A CD   1  
ATOM 944   O OE1  . GLN A 1 65  ? -0.018  0.333   -6.230  1.00 0.00 ? 65  GLN A OE1  1  
ATOM 945   N NE2  . GLN A 1 65  ? -1.006  2.055   -7.293  1.00 0.00 ? 65  GLN A NE2  1  
ATOM 946   H H    . GLN A 1 65  ? 0.709   2.240   -1.538  1.00 0.00 ? 65  GLN A H    1  
ATOM 947   H HA   . GLN A 1 65  ? 0.920   4.225   -3.519  1.00 0.00 ? 65  GLN A HA   1  
ATOM 948   H HB2  . GLN A 1 65  ? 1.219   1.631   -3.688  1.00 0.00 ? 65  GLN A HB2  1  
ATOM 949   H HB3  . GLN A 1 65  ? -0.524  1.578   -3.865  1.00 0.00 ? 65  GLN A HB3  1  
ATOM 950   H HG2  . GLN A 1 65  ? 0.063   3.553   -5.671  1.00 0.00 ? 65  GLN A HG2  1  
ATOM 951   H HG3  . GLN A 1 65  ? 1.549   2.629   -5.754  1.00 0.00 ? 65  GLN A HG3  1  
ATOM 952   H HE21 . GLN A 1 65  ? -1.112  3.047   -7.358  1.00 0.00 ? 65  GLN A HE21 1  
ATOM 953   H HE22 . GLN A 1 65  ? -1.506  1.457   -7.920  1.00 0.00 ? 65  GLN A HE22 1  
ATOM 954   N N    . LEU A 1 66  ? -1.334  5.207   -3.744  1.00 0.00 ? 66  LEU A N    1  
ATOM 955   C CA   . LEU A 1 66  ? -2.634  5.847   -3.844  1.00 0.00 ? 66  LEU A CA   1  
ATOM 956   C C    . LEU A 1 66  ? -3.389  5.274   -5.045  1.00 0.00 ? 66  LEU A C    1  
ATOM 957   O O    . LEU A 1 66  ? -3.009  5.508   -6.191  1.00 0.00 ? 66  LEU A O    1  
ATOM 958   C CB   . LEU A 1 66  ? -2.480  7.369   -3.884  1.00 0.00 ? 66  LEU A CB   1  
ATOM 959   C CG   . LEU A 1 66  ? -1.412  7.959   -2.961  1.00 0.00 ? 66  LEU A CG   1  
ATOM 960   C CD1  . LEU A 1 66  ? -1.127  9.420   -3.317  1.00 0.00 ? 66  LEU A CD1  1  
ATOM 961   C CD2  . LEU A 1 66  ? -1.804  7.793   -1.492  1.00 0.00 ? 66  LEU A CD2  1  
ATOM 962   H H    . LEU A 1 66  ? -0.573  5.731   -4.127  1.00 0.00 ? 66  LEU A H    1  
ATOM 963   H HA   . LEU A 1 66  ? -3.189  5.603   -2.938  1.00 0.00 ? 66  LEU A HA   1  
ATOM 964   H HB2  . LEU A 1 66  ? -2.250  7.664   -4.908  1.00 0.00 ? 66  LEU A HB2  1  
ATOM 965   H HB3  . LEU A 1 66  ? -3.440  7.818   -3.630  1.00 0.00 ? 66  LEU A HB3  1  
ATOM 966   H HG   . LEU A 1 66  ? -0.486  7.405   -3.112  1.00 0.00 ? 66  LEU A HG   1  
ATOM 967   H HD11 . LEU A 1 66  ? -0.802  9.954   -2.424  1.00 0.00 ? 66  LEU A HD11 1  
ATOM 968   H HD12 . LEU A 1 66  ? -0.342  9.464   -4.072  1.00 0.00 ? 66  LEU A HD12 1  
ATOM 969   H HD13 . LEU A 1 66  ? -2.034  9.882   -3.707  1.00 0.00 ? 66  LEU A HD13 1  
ATOM 970   H HD21 . LEU A 1 66  ? -1.182  7.024   -1.034  1.00 0.00 ? 66  LEU A HD21 1  
ATOM 971   H HD22 . LEU A 1 66  ? -1.659  8.738   -0.968  1.00 0.00 ? 66  LEU A HD22 1  
ATOM 972   H HD23 . LEU A 1 66  ? -2.852  7.499   -1.427  1.00 0.00 ? 66  LEU A HD23 1  
ATOM 973   N N    . LEU A 1 67  ? -4.445  4.534   -4.740  1.00 0.00 ? 67  LEU A N    1  
ATOM 974   C CA   . LEU A 1 67  ? -5.257  3.925   -5.780  1.00 0.00 ? 67  LEU A CA   1  
ATOM 975   C C    . LEU A 1 67  ? -6.244  4.961   -6.322  1.00 0.00 ? 67  LEU A C    1  
ATOM 976   O O    . LEU A 1 67  ? -6.272  5.228   -7.522  1.00 0.00 ? 67  LEU A O    1  
ATOM 977   C CB   . LEU A 1 67  ? -5.926  2.651   -5.261  1.00 0.00 ? 67  LEU A CB   1  
ATOM 978   C CG   . LEU A 1 67  ? -5.007  1.444   -5.063  1.00 0.00 ? 67  LEU A CG   1  
ATOM 979   C CD1  . LEU A 1 67  ? -5.779  0.254   -4.489  1.00 0.00 ? 67  LEU A CD1  1  
ATOM 980   C CD2  . LEU A 1 67  ? -4.285  1.085   -6.364  1.00 0.00 ? 67  LEU A CD2  1  
ATOM 981   H H    . LEU A 1 67  ? -4.747  4.348   -3.805  1.00 0.00 ? 67  LEU A H    1  
ATOM 982   H HA   . LEU A 1 67  ? -4.587  3.631   -6.588  1.00 0.00 ? 67  LEU A HA   1  
ATOM 983   H HB2  . LEU A 1 67  ? -6.405  2.878   -4.308  1.00 0.00 ? 67  LEU A HB2  1  
ATOM 984   H HB3  . LEU A 1 67  ? -6.717  2.370   -5.956  1.00 0.00 ? 67  LEU A HB3  1  
ATOM 985   H HG   . LEU A 1 67  ? -4.242  1.712   -4.335  1.00 0.00 ? 67  LEU A HG   1  
ATOM 986   H HD11 . LEU A 1 67  ? -5.193  -0.211  -3.696  1.00 0.00 ? 67  LEU A HD11 1  
ATOM 987   H HD12 . LEU A 1 67  ? -6.730  0.600   -4.083  1.00 0.00 ? 67  LEU A HD12 1  
ATOM 988   H HD13 . LEU A 1 67  ? -5.965  -0.474  -5.279  1.00 0.00 ? 67  LEU A HD13 1  
ATOM 989   H HD21 . LEU A 1 67  ? -4.793  1.559   -7.204  1.00 0.00 ? 67  LEU A HD21 1  
ATOM 990   H HD22 . LEU A 1 67  ? -3.255  1.436   -6.317  1.00 0.00 ? 67  LEU A HD22 1  
ATOM 991   H HD23 . LEU A 1 67  ? -4.295  0.003   -6.498  1.00 0.00 ? 67  LEU A HD23 1  
ATOM 992   N N    . GLU A 1 68  ? -7.031  5.515   -5.411  1.00 0.00 ? 68  GLU A N    1  
ATOM 993   C CA   . GLU A 1 68  ? -8.017  6.515   -5.782  1.00 0.00 ? 68  GLU A CA   1  
ATOM 994   C C    . GLU A 1 68  ? -8.096  7.606   -4.712  1.00 0.00 ? 68  GLU A C    1  
ATOM 995   O O    . GLU A 1 68  ? -7.987  7.321   -3.521  1.00 0.00 ? 68  GLU A O    1  
ATOM 996   C CB   . GLU A 1 68  ? -9.387  5.875   -6.014  1.00 0.00 ? 68  GLU A CB   1  
ATOM 997   C CG   . GLU A 1 68  ? -9.340  4.886   -7.181  1.00 0.00 ? 68  GLU A CG   1  
ATOM 998   C CD   . GLU A 1 68  ? -10.684 4.833   -7.910  1.00 0.00 ? 68  GLU A CD   1  
ATOM 999   O OE1  . GLU A 1 68  ? -11.676 4.463   -7.246  1.00 0.00 ? 68  GLU A OE1  1  
ATOM 1000  O OE2  . GLU A 1 68  ? -10.689 5.165   -9.115  1.00 0.00 ? 68  GLU A OE2  1  
ATOM 1001  H H    . GLU A 1 68  ? -7.001  5.291   -4.437  1.00 0.00 ? 68  GLU A H    1  
ATOM 1002  H HA   . GLU A 1 68  ? -7.659  6.941   -6.720  1.00 0.00 ? 68  GLU A HA   1  
ATOM 1003  H HB2  . GLU A 1 68  ? -9.709  5.360   -5.109  1.00 0.00 ? 68  GLU A HB2  1  
ATOM 1004  H HB3  . GLU A 1 68  ? -10.125 6.650   -6.220  1.00 0.00 ? 68  GLU A HB3  1  
ATOM 1005  H HG2  . GLU A 1 68  ? -8.555  5.178   -7.878  1.00 0.00 ? 68  GLU A HG2  1  
ATOM 1006  H HG3  . GLU A 1 68  ? -9.084  3.893   -6.810  1.00 0.00 ? 68  GLU A HG3  1  
ATOM 1007  N N    . PHE A 1 69  ? -8.284  8.833   -5.176  1.00 0.00 ? 69  PHE A N    1  
ATOM 1008  C CA   . PHE A 1 69  ? -8.378  9.968   -4.274  1.00 0.00 ? 69  PHE A CA   1  
ATOM 1009  C C    . PHE A 1 69  ? -9.791  10.555  -4.278  1.00 0.00 ? 69  PHE A C    1  
ATOM 1010  O O    . PHE A 1 69  ? -10.154 11.302  -5.186  1.00 0.00 ? 69  PHE A O    1  
ATOM 1011  C CB   . PHE A 1 69  ? -7.397  11.026  -4.782  1.00 0.00 ? 69  PHE A CB   1  
ATOM 1012  C CG   . PHE A 1 69  ? -7.534  12.384  -4.091  1.00 0.00 ? 69  PHE A CG   1  
ATOM 1013  C CD1  . PHE A 1 69  ? -6.815  12.653  -2.969  1.00 0.00 ? 69  PHE A CD1  1  
ATOM 1014  C CD2  . PHE A 1 69  ? -8.376  13.324  -4.600  1.00 0.00 ? 69  PHE A CD2  1  
ATOM 1015  C CE1  . PHE A 1 69  ? -6.942  13.914  -2.328  1.00 0.00 ? 69  PHE A CE1  1  
ATOM 1016  C CE2  . PHE A 1 69  ? -8.503  14.584  -3.960  1.00 0.00 ? 69  PHE A CE2  1  
ATOM 1017  C CZ   . PHE A 1 69  ? -7.784  14.853  -2.837  1.00 0.00 ? 69  PHE A CZ   1  
ATOM 1018  H H    . PHE A 1 69  ? -8.371  9.056   -6.147  1.00 0.00 ? 69  PHE A H    1  
ATOM 1019  H HA   . PHE A 1 69  ? -8.140  9.606   -3.273  1.00 0.00 ? 69  PHE A HA   1  
ATOM 1020  H HB2  . PHE A 1 69  ? -6.379  10.660  -4.642  1.00 0.00 ? 69  PHE A HB2  1  
ATOM 1021  H HB3  . PHE A 1 69  ? -7.543  11.158  -5.854  1.00 0.00 ? 69  PHE A HB3  1  
ATOM 1022  H HD1  . PHE A 1 69  ? -6.140  11.900  -2.561  1.00 0.00 ? 69  PHE A HD1  1  
ATOM 1023  H HD2  . PHE A 1 69  ? -8.952  13.108  -5.500  1.00 0.00 ? 69  PHE A HD2  1  
ATOM 1024  H HE1  . PHE A 1 69  ? -6.366  14.129  -1.429  1.00 0.00 ? 69  PHE A HE1  1  
ATOM 1025  H HE2  . PHE A 1 69  ? -9.178  15.337  -4.368  1.00 0.00 ? 69  PHE A HE2  1  
ATOM 1026  H HZ   . PHE A 1 69  ? -7.882  15.821  -2.346  1.00 0.00 ? 69  PHE A HZ   1  
ATOM 1027  N N    . ASN A 1 70  ? -10.550 10.197  -3.253  1.00 0.00 ? 70  ASN A N    1  
ATOM 1028  C CA   . ASN A 1 70  ? -11.914 10.679  -3.127  1.00 0.00 ? 70  ASN A CA   1  
ATOM 1029  C C    . ASN A 1 70  ? -12.742 10.170  -4.309  1.00 0.00 ? 70  ASN A C    1  
ATOM 1030  O O    . ASN A 1 70  ? -13.849 10.649  -4.549  1.00 0.00 ? 70  ASN A O    1  
ATOM 1031  C CB   . ASN A 1 70  ? -11.961 12.208  -3.141  1.00 0.00 ? 70  ASN A CB   1  
ATOM 1032  C CG   . ASN A 1 70  ? -12.638 12.748  -1.880  1.00 0.00 ? 70  ASN A CG   1  
ATOM 1033  O OD1  . ASN A 1 70  ? -13.236 12.019  -1.105  1.00 0.00 ? 70  ASN A OD1  1  
ATOM 1034  N ND2  . ASN A 1 70  ? -12.511 14.062  -1.717  1.00 0.00 ? 70  ASN A ND2  1  
ATOM 1035  H H    . ASN A 1 70  ? -10.247 9.589   -2.519  1.00 0.00 ? 70  ASN A H    1  
ATOM 1036  H HA   . ASN A 1 70  ? -12.269 10.291  -2.172  1.00 0.00 ? 70  ASN A HA   1  
ATOM 1037  H HB2  . ASN A 1 70  ? -10.949 12.606  -3.214  1.00 0.00 ? 70  ASN A HB2  1  
ATOM 1038  H HB3  . ASN A 1 70  ? -12.502 12.551  -4.023  1.00 0.00 ? 70  ASN A HB3  1  
ATOM 1039  H HD21 . ASN A 1 70  ? -12.007 14.602  -2.391  1.00 0.00 ? 70  ASN A HD21 1  
ATOM 1040  H HD22 . ASN A 1 70  ? -12.919 14.509  -0.921  1.00 0.00 ? 70  ASN A HD22 1  
ATOM 1041  N N    . GLY A 1 71  ? -12.173 9.206   -5.017  1.00 0.00 ? 71  GLY A N    1  
ATOM 1042  C CA   . GLY A 1 71  ? -12.844 8.626   -6.168  1.00 0.00 ? 71  GLY A CA   1  
ATOM 1043  C C    . GLY A 1 71  ? -11.924 8.615   -7.391  1.00 0.00 ? 71  GLY A C    1  
ATOM 1044  O O    . GLY A 1 71  ? -11.840 7.613   -8.100  1.00 0.00 ? 71  GLY A O    1  
ATOM 1045  H H    . GLY A 1 71  ? -11.272 8.821   -4.816  1.00 0.00 ? 71  GLY A H    1  
ATOM 1046  H HA2  . GLY A 1 71  ? -13.158 7.609   -5.936  1.00 0.00 ? 71  GLY A HA2  1  
ATOM 1047  H HA3  . GLY A 1 71  ? -13.746 9.196   -6.392  1.00 0.00 ? 71  GLY A HA3  1  
ATOM 1048  N N    . ILE A 1 72  ? -11.258 9.741   -7.601  1.00 0.00 ? 72  ILE A N    1  
ATOM 1049  C CA   . ILE A 1 72  ? -10.348 9.873   -8.725  1.00 0.00 ? 72  ILE A CA   1  
ATOM 1050  C C    . ILE A 1 72  ? -9.481  8.616   -8.826  1.00 0.00 ? 72  ILE A C    1  
ATOM 1051  O O    . ILE A 1 72  ? -9.322  7.888   -7.847  1.00 0.00 ? 72  ILE A O    1  
ATOM 1052  C CB   . ILE A 1 72  ? -9.541  11.169  -8.612  1.00 0.00 ? 72  ILE A CB   1  
ATOM 1053  C CG1  . ILE A 1 72  ? -10.296 12.342  -9.239  1.00 0.00 ? 72  ILE A CG1  1  
ATOM 1054  C CG2  . ILE A 1 72  ? -8.144  10.999  -9.214  1.00 0.00 ? 72  ILE A CG2  1  
ATOM 1055  C CD1  . ILE A 1 72  ? -10.257 13.570  -8.327  1.00 0.00 ? 72  ILE A CD1  1  
ATOM 1056  H H    . ILE A 1 72  ? -11.332 10.551  -7.019  1.00 0.00 ? 72  ILE A H    1  
ATOM 1057  H HA   . ILE A 1 72  ? -10.953 9.949   -9.629  1.00 0.00 ? 72  ILE A HA   1  
ATOM 1058  H HB   . ILE A 1 72  ? -9.410  11.398  -7.555  1.00 0.00 ? 72  ILE A HB   1  
ATOM 1059  H HG12 . ILE A 1 72  ? -9.856  12.588  -10.206 1.00 0.00 ? 72  ILE A HG12 1  
ATOM 1060  H HG13 . ILE A 1 72  ? -11.332 12.055  -9.424  1.00 0.00 ? 72  ILE A HG13 1  
ATOM 1061  H HG21 . ILE A 1 72  ? -7.619  11.954  -9.187  1.00 0.00 ? 72  ILE A HG21 1  
ATOM 1062  H HG22 . ILE A 1 72  ? -7.587  10.262  -8.636  1.00 0.00 ? 72  ILE A HG22 1  
ATOM 1063  H HG23 . ILE A 1 72  ? -8.232  10.661  -10.246 1.00 0.00 ? 72  ILE A HG23 1  
ATOM 1064  H HD11 . ILE A 1 72  ? -10.567 13.286  -7.322  1.00 0.00 ? 72  ILE A HD11 1  
ATOM 1065  H HD12 . ILE A 1 72  ? -9.242  13.966  -8.296  1.00 0.00 ? 72  ILE A HD12 1  
ATOM 1066  H HD13 . ILE A 1 72  ? -10.933 14.332  -8.715  1.00 0.00 ? 72  ILE A HD13 1  
ATOM 1067  N N    . ASN A 1 73  ? -8.945  8.399   -10.018 1.00 0.00 ? 73  ASN A N    1  
ATOM 1068  C CA   . ASN A 1 73  ? -8.100  7.243   -10.259 1.00 0.00 ? 73  ASN A CA   1  
ATOM 1069  C C    . ASN A 1 73  ? -6.641  7.694   -10.355 1.00 0.00 ? 73  ASN A C    1  
ATOM 1070  O O    . ASN A 1 73  ? -6.239  8.299   -11.347 1.00 0.00 ? 73  ASN A O    1  
ATOM 1071  C CB   . ASN A 1 73  ? -8.469  6.555   -11.574 1.00 0.00 ? 73  ASN A CB   1  
ATOM 1072  C CG   . ASN A 1 73  ? -8.266  5.041   -11.478 1.00 0.00 ? 73  ASN A CG   1  
ATOM 1073  O OD1  . ASN A 1 73  ? -7.465  4.545   -10.702 1.00 0.00 ? 73  ASN A OD1  1  
ATOM 1074  N ND2  . ASN A 1 73  ? -9.034  4.338   -12.306 1.00 0.00 ? 73  ASN A ND2  1  
ATOM 1075  H H    . ASN A 1 73  ? -9.080  8.996   -10.809 1.00 0.00 ? 73  ASN A H    1  
ATOM 1076  H HA   . ASN A 1 73  ? -8.276  6.578   -9.413  1.00 0.00 ? 73  ASN A HA   1  
ATOM 1077  H HB2  . ASN A 1 73  ? -9.508  6.771   -11.823 1.00 0.00 ? 73  ASN A HB2  1  
ATOM 1078  H HB3  . ASN A 1 73  ? -7.858  6.956   -12.383 1.00 0.00 ? 73  ASN A HB3  1  
ATOM 1079  H HD21 . ASN A 1 73  ? -9.671  4.808   -12.917 1.00 0.00 ? 73  ASN A HD21 1  
ATOM 1080  H HD22 . ASN A 1 73  ? -8.974  3.340   -12.317 1.00 0.00 ? 73  ASN A HD22 1  
ATOM 1081  N N    . LEU A 1 74  ? -5.888  7.382   -9.310  1.00 0.00 ? 74  LEU A N    1  
ATOM 1082  C CA   . LEU A 1 74  ? -4.483  7.748   -9.264  1.00 0.00 ? 74  LEU A CA   1  
ATOM 1083  C C    . LEU A 1 74  ? -3.690  6.830   -10.197 1.00 0.00 ? 74  LEU A C    1  
ATOM 1084  O O    . LEU A 1 74  ? -2.643  7.217   -10.712 1.00 0.00 ? 74  LEU A O    1  
ATOM 1085  C CB   . LEU A 1 74  ? -3.975  7.745   -7.821  1.00 0.00 ? 74  LEU A CB   1  
ATOM 1086  C CG   . LEU A 1 74  ? -4.171  9.045   -7.038  1.00 0.00 ? 74  LEU A CG   1  
ATOM 1087  C CD1  . LEU A 1 74  ? -3.472  10.215  -7.735  1.00 0.00 ? 74  LEU A CD1  1  
ATOM 1088  C CD2  . LEU A 1 74  ? -5.656  9.324   -6.801  1.00 0.00 ? 74  LEU A CD2  1  
ATOM 1089  H H    . LEU A 1 74  ? -6.223  6.890   -8.507  1.00 0.00 ? 74  LEU A H    1  
ATOM 1090  H HA   . LEU A 1 74  ? -4.399  8.771   -9.633  1.00 0.00 ? 74  LEU A HA   1  
ATOM 1091  H HB2  . LEU A 1 74  ? -4.476  6.941   -7.282  1.00 0.00 ? 74  LEU A HB2  1  
ATOM 1092  H HB3  . LEU A 1 74  ? -2.911  7.507   -7.832  1.00 0.00 ? 74  LEU A HB3  1  
ATOM 1093  H HG   . LEU A 1 74  ? -3.705  8.928   -6.060  1.00 0.00 ? 74  LEU A HG   1  
ATOM 1094  H HD11 . LEU A 1 74  ? -2.977  10.838  -6.990  1.00 0.00 ? 74  LEU A HD11 1  
ATOM 1095  H HD12 . LEU A 1 74  ? -2.732  9.830   -8.437  1.00 0.00 ? 74  LEU A HD12 1  
ATOM 1096  H HD13 . LEU A 1 74  ? -4.210  10.810  -8.274  1.00 0.00 ? 74  LEU A HD13 1  
ATOM 1097  H HD21 . LEU A 1 74  ? -5.791  10.372  -6.533  1.00 0.00 ? 74  LEU A HD21 1  
ATOM 1098  H HD22 . LEU A 1 74  ? -6.217  9.106   -7.710  1.00 0.00 ? 74  LEU A HD22 1  
ATOM 1099  H HD23 . LEU A 1 74  ? -6.019  8.692   -5.990  1.00 0.00 ? 74  LEU A HD23 1  
ATOM 1100  N N    . ARG A 1 75  ? -4.221  5.631   -10.386 1.00 0.00 ? 75  ARG A N    1  
ATOM 1101  C CA   . ARG A 1 75  ? -3.577  4.654   -11.247 1.00 0.00 ? 75  ARG A CA   1  
ATOM 1102  C C    . ARG A 1 75  ? -3.260  5.275   -12.609 1.00 0.00 ? 75  ARG A C    1  
ATOM 1103  O O    . ARG A 1 75  ? -2.329  4.846   -13.290 1.00 0.00 ? 75  ARG A O    1  
ATOM 1104  C CB   . ARG A 1 75  ? -4.466  3.426   -11.449 1.00 0.00 ? 75  ARG A CB   1  
ATOM 1105  C CG   . ARG A 1 75  ? -4.102  2.317   -10.460 1.00 0.00 ? 75  ARG A CG   1  
ATOM 1106  C CD   . ARG A 1 75  ? -3.132  1.316   -11.092 1.00 0.00 ? 75  ARG A CD   1  
ATOM 1107  N NE   . ARG A 1 75  ? -3.770  0.658   -12.254 1.00 0.00 ? 75  ARG A NE   1  
ATOM 1108  C CZ   . ARG A 1 75  ? -3.255  -0.401  -12.894 1.00 0.00 ? 75  ARG A CZ   1  
ATOM 1109  N NH1  . ARG A 1 75  ? -2.091  -0.928  -12.488 1.00 0.00 ? 75  ARG A NH1  1  
ATOM 1110  N NH2  . ARG A 1 75  ? -3.903  -0.932  -13.939 1.00 0.00 ? 75  ARG A NH2  1  
ATOM 1111  H H    . ARG A 1 75  ? -5.074  5.324   -9.963  1.00 0.00 ? 75  ARG A H    1  
ATOM 1112  H HA   . ARG A 1 75  ? -2.664  4.377   -10.720 1.00 0.00 ? 75  ARG A HA   1  
ATOM 1113  H HB2  . ARG A 1 75  ? -5.512  3.704   -11.320 1.00 0.00 ? 75  ARG A HB2  1  
ATOM 1114  H HB3  . ARG A 1 75  ? -4.358  3.058   -12.470 1.00 0.00 ? 75  ARG A HB3  1  
ATOM 1115  H HG2  . ARG A 1 75  ? -3.651  2.753   -9.569  1.00 0.00 ? 75  ARG A HG2  1  
ATOM 1116  H HG3  . ARG A 1 75  ? -5.006  1.800   -10.139 1.00 0.00 ? 75  ARG A HG3  1  
ATOM 1117  H HD2  . ARG A 1 75  ? -2.223  1.827   -11.406 1.00 0.00 ? 75  ARG A HD2  1  
ATOM 1118  H HD3  . ARG A 1 75  ? -2.839  0.567   -10.355 1.00 0.00 ? 75  ARG A HD3  1  
ATOM 1119  H HE   . ARG A 1 75  ? -4.639  1.026   -12.583 1.00 0.00 ? 75  ARG A HE   1  
ATOM 1120  H HH11 . ARG A 1 75  ? -1.608  -0.531  -11.708 1.00 0.00 ? 75  ARG A HH11 1  
ATOM 1121  H HH12 . ARG A 1 75  ? -1.707  -1.718  -12.966 1.00 0.00 ? 75  ARG A HH12 1  
ATOM 1122  H HH21 . ARG A 1 75  ? -4.771  -0.539  -14.242 1.00 0.00 ? 75  ARG A HH21 1  
ATOM 1123  H HH22 . ARG A 1 75  ? -3.518  -1.722  -14.417 1.00 0.00 ? 75  ARG A HH22 1  
ATOM 1124  N N    . SER A 1 76  ? -4.051  6.276   -12.966 1.00 0.00 ? 76  SER A N    1  
ATOM 1125  C CA   . SER A 1 76  ? -3.866  6.961   -14.234 1.00 0.00 ? 76  SER A CA   1  
ATOM 1126  C C    . SER A 1 76  ? -3.373  8.389   -13.992 1.00 0.00 ? 76  SER A C    1  
ATOM 1127  O O    . SER A 1 76  ? -2.687  8.964   -14.835 1.00 0.00 ? 76  SER A O    1  
ATOM 1128  C CB   . SER A 1 76  ? -5.164  6.978   -15.045 1.00 0.00 ? 76  SER A CB   1  
ATOM 1129  O OG   . SER A 1 76  ? -4.945  6.631   -16.410 1.00 0.00 ? 76  SER A OG   1  
ATOM 1130  H H    . SER A 1 76  ? -4.805  6.619   -12.407 1.00 0.00 ? 76  SER A H    1  
ATOM 1131  H HA   . SER A 1 76  ? -3.113  6.381   -14.768 1.00 0.00 ? 76  SER A HA   1  
ATOM 1132  H HB2  . SER A 1 76  ? -5.876  6.281   -14.604 1.00 0.00 ? 76  SER A HB2  1  
ATOM 1133  H HB3  . SER A 1 76  ? -5.612  7.970   -14.990 1.00 0.00 ? 76  SER A HB3  1  
ATOM 1134  H HG   . SER A 1 76  ? -5.763  6.197   -16.788 1.00 0.00 ? 76  SER A HG   1  
ATOM 1135  N N    . ALA A 1 77  ? -3.742  8.920   -12.835 1.00 0.00 ? 77  ALA A N    1  
ATOM 1136  C CA   . ALA A 1 77  ? -3.346  10.269  -12.471 1.00 0.00 ? 77  ALA A CA   1  
ATOM 1137  C C    . ALA A 1 77  ? -1.821  10.377  -12.514 1.00 0.00 ? 77  ALA A C    1  
ATOM 1138  O O    . ALA A 1 77  ? -1.118  9.496   -12.022 1.00 0.00 ? 77  ALA A O    1  
ATOM 1139  C CB   . ALA A 1 77  ? -3.916  10.615  -11.094 1.00 0.00 ? 77  ALA A CB   1  
ATOM 1140  H H    . ALA A 1 77  ? -4.301  8.445   -12.155 1.00 0.00 ? 77  ALA A H    1  
ATOM 1141  H HA   . ALA A 1 77  ? -3.772  10.950  -13.208 1.00 0.00 ? 77  ALA A HA   1  
ATOM 1142  H HB1  . ALA A 1 77  ? -4.897  10.152  -10.980 1.00 0.00 ? 77  ALA A HB1  1  
ATOM 1143  H HB2  . ALA A 1 77  ? -3.246  10.241  -10.319 1.00 0.00 ? 77  ALA A HB2  1  
ATOM 1144  H HB3  . ALA A 1 77  ? -4.012  11.696  -11.001 1.00 0.00 ? 77  ALA A HB3  1  
ATOM 1145  N N    . THR A 1 78  ? -1.353  11.466  -13.108 1.00 0.00 ? 78  THR A N    1  
ATOM 1146  C CA   . THR A 1 78  ? 0.076   11.701  -13.222 1.00 0.00 ? 78  THR A CA   1  
ATOM 1147  C C    . THR A 1 78  ? 0.599   12.422  -11.978 1.00 0.00 ? 78  THR A C    1  
ATOM 1148  O O    . THR A 1 78  ? -0.183  12.867  -11.139 1.00 0.00 ? 78  THR A O    1  
ATOM 1149  C CB   . THR A 1 78  ? 0.327   12.470  -14.521 1.00 0.00 ? 78  THR A CB   1  
ATOM 1150  O OG1  . THR A 1 78  ? -0.778  13.366  -14.612 1.00 0.00 ? 78  THR A OG1  1  
ATOM 1151  C CG2  . THR A 1 78  ? 0.192   11.585  -15.761 1.00 0.00 ? 78  THR A CG2  1  
ATOM 1152  H H    . THR A 1 78  ? -1.932  12.178  -13.506 1.00 0.00 ? 78  THR A H    1  
ATOM 1153  H HA   . THR A 1 78  ? 0.580   10.735  -13.268 1.00 0.00 ? 78  THR A HA   1  
ATOM 1154  H HB   . THR A 1 78  ? 1.298   12.965  -14.499 1.00 0.00 ? 78  THR A HB   1  
ATOM 1155  H HG1  . THR A 1 78  ? -0.554  14.231  -14.163 1.00 0.00 ? 78  THR A HG1  1  
ATOM 1156  H HG21 . THR A 1 78  ? 0.036   10.551  -15.454 1.00 0.00 ? 78  THR A HG21 1  
ATOM 1157  H HG22 . THR A 1 78  ? -0.658  11.920  -16.356 1.00 0.00 ? 78  THR A HG22 1  
ATOM 1158  H HG23 . THR A 1 78  ? 1.102   11.653  -16.357 1.00 0.00 ? 78  THR A HG23 1  
ATOM 1159  N N    . GLU A 1 79  ? 1.918   12.514  -11.898 1.00 0.00 ? 79  GLU A N    1  
ATOM 1160  C CA   . GLU A 1 79  ? 2.555   13.174  -10.770 1.00 0.00 ? 79  GLU A CA   1  
ATOM 1161  C C    . GLU A 1 79  ? 2.084   14.626  -10.670 1.00 0.00 ? 79  GLU A C    1  
ATOM 1162  O O    . GLU A 1 79  ? 1.879   15.141  -9.572  1.00 0.00 ? 79  GLU A O    1  
ATOM 1163  C CB   . GLU A 1 79  ? 4.079   13.098  -10.880 1.00 0.00 ? 79  GLU A CB   1  
ATOM 1164  C CG   . GLU A 1 79  ? 4.538   13.334  -12.320 1.00 0.00 ? 79  GLU A CG   1  
ATOM 1165  C CD   . GLU A 1 79  ? 5.989   13.817  -12.361 1.00 0.00 ? 79  GLU A CD   1  
ATOM 1166  O OE1  . GLU A 1 79  ? 6.189   15.032  -12.146 1.00 0.00 ? 79  GLU A OE1  1  
ATOM 1167  O OE2  . GLU A 1 79  ? 6.866   12.961  -12.608 1.00 0.00 ? 79  GLU A OE2  1  
ATOM 1168  H H    . GLU A 1 79  ? 2.547   12.150  -12.584 1.00 0.00 ? 79  GLU A H    1  
ATOM 1169  H HA   . GLU A 1 79  ? 2.232   12.618  -9.890  1.00 0.00 ? 79  GLU A HA   1  
ATOM 1170  H HB2  . GLU A 1 79  ? 4.532   13.841  -10.224 1.00 0.00 ? 79  GLU A HB2  1  
ATOM 1171  H HB3  . GLU A 1 79  ? 4.423   12.121  -10.540 1.00 0.00 ? 79  GLU A HB3  1  
ATOM 1172  H HG2  . GLU A 1 79  ? 4.442   12.411  -12.892 1.00 0.00 ? 79  GLU A HG2  1  
ATOM 1173  H HG3  . GLU A 1 79  ? 3.891   14.072  -12.795 1.00 0.00 ? 79  GLU A HG3  1  
ATOM 1174  N N    . GLN A 1 80  ? 1.927   15.245  -11.830 1.00 0.00 ? 80  GLN A N    1  
ATOM 1175  C CA   . GLN A 1 80  ? 1.484   16.628  -11.887 1.00 0.00 ? 80  GLN A CA   1  
ATOM 1176  C C    . GLN A 1 80  ? 0.019   16.734  -11.457 1.00 0.00 ? 80  GLN A C    1  
ATOM 1177  O O    . GLN A 1 80  ? -0.373  17.706  -10.813 1.00 0.00 ? 80  GLN A O    1  
ATOM 1178  C CB   . GLN A 1 80  ? 1.689   17.213  -13.286 1.00 0.00 ? 80  GLN A CB   1  
ATOM 1179  C CG   . GLN A 1 80  ? 0.840   16.471  -14.320 1.00 0.00 ? 80  GLN A CG   1  
ATOM 1180  C CD   . GLN A 1 80  ? 0.806   17.231  -15.648 1.00 0.00 ? 80  GLN A CD   1  
ATOM 1181  O OE1  . GLN A 1 80  ? 1.175   18.390  -15.739 1.00 0.00 ? 80  GLN A OE1  1  
ATOM 1182  N NE2  . GLN A 1 80  ? 0.345   16.514  -16.669 1.00 0.00 ? 80  GLN A NE2  1  
ATOM 1183  H H    . GLN A 1 80  ? 2.096   14.819  -12.719 1.00 0.00 ? 80  GLN A H    1  
ATOM 1184  H HA   . GLN A 1 80  ? 2.117   17.164  -11.179 1.00 0.00 ? 80  GLN A HA   1  
ATOM 1185  H HB2  . GLN A 1 80  ? 1.425   18.270  -13.284 1.00 0.00 ? 80  GLN A HB2  1  
ATOM 1186  H HB3  . GLN A 1 80  ? 2.742   17.148  -13.560 1.00 0.00 ? 80  GLN A HB3  1  
ATOM 1187  H HG2  . GLN A 1 80  ? 1.244   15.472  -14.478 1.00 0.00 ? 80  GLN A HG2  1  
ATOM 1188  H HG3  . GLN A 1 80  ? -0.175  16.348  -13.941 1.00 0.00 ? 80  GLN A HG3  1  
ATOM 1189  H HE21 . GLN A 1 80  ? 0.058   15.567  -16.526 1.00 0.00 ? 80  GLN A HE21 1  
ATOM 1190  H HE22 . GLN A 1 80  ? 0.284   16.923  -17.580 1.00 0.00 ? 80  GLN A HE22 1  
ATOM 1191  N N    . GLN A 1 81  ? -0.749  15.722  -11.832 1.00 0.00 ? 81  GLN A N    1  
ATOM 1192  C CA   . GLN A 1 81  ? -2.161  15.689  -11.493 1.00 0.00 ? 81  GLN A CA   1  
ATOM 1193  C C    . GLN A 1 81  ? -2.347  15.285  -10.029 1.00 0.00 ? 81  GLN A C    1  
ATOM 1194  O O    . GLN A 1 81  ? -3.100  15.924  -9.296  1.00 0.00 ? 81  GLN A O    1  
ATOM 1195  C CB   . GLN A 1 81  ? -2.927  14.747  -12.424 1.00 0.00 ? 81  GLN A CB   1  
ATOM 1196  C CG   . GLN A 1 81  ? -3.231  15.425  -13.761 1.00 0.00 ? 81  GLN A CG   1  
ATOM 1197  C CD   . GLN A 1 81  ? -4.001  14.484  -14.690 1.00 0.00 ? 81  GLN A CD   1  
ATOM 1198  O OE1  . GLN A 1 81  ? -5.219  14.503  -14.766 1.00 0.00 ? 81  GLN A OE1  1  
ATOM 1199  N NE2  . GLN A 1 81  ? -3.225  13.662  -15.391 1.00 0.00 ? 81  GLN A NE2  1  
ATOM 1200  H H    . GLN A 1 81  ? -0.421  14.936  -12.355 1.00 0.00 ? 81  GLN A H    1  
ATOM 1201  H HA   . GLN A 1 81  ? -2.519  16.708  -11.644 1.00 0.00 ? 81  GLN A HA   1  
ATOM 1202  H HB2  . GLN A 1 81  ? -2.340  13.844  -12.595 1.00 0.00 ? 81  GLN A HB2  1  
ATOM 1203  H HB3  . GLN A 1 81  ? -3.858  14.437  -11.949 1.00 0.00 ? 81  GLN A HB3  1  
ATOM 1204  H HG2  . GLN A 1 81  ? -3.815  16.330  -13.590 1.00 0.00 ? 81  GLN A HG2  1  
ATOM 1205  H HG3  . GLN A 1 81  ? -2.300  15.731  -14.238 1.00 0.00 ? 81  GLN A HG3  1  
ATOM 1206  H HE21 . GLN A 1 81  ? -2.232  13.697  -15.282 1.00 0.00 ? 81  GLN A HE21 1  
ATOM 1207  H HE22 . GLN A 1 81  ? -3.636  13.008  -16.027 1.00 0.00 ? 81  GLN A HE22 1  
ATOM 1208  N N    . ALA A 1 82  ? -1.649  14.225  -9.648  1.00 0.00 ? 82  ALA A N    1  
ATOM 1209  C CA   . ALA A 1 82  ? -1.728  13.728  -8.285  1.00 0.00 ? 82  ALA A CA   1  
ATOM 1210  C C    . ALA A 1 82  ? -1.358  14.851  -7.315  1.00 0.00 ? 82  ALA A C    1  
ATOM 1211  O O    . ALA A 1 82  ? -1.998  15.015  -6.277  1.00 0.00 ? 82  ALA A O    1  
ATOM 1212  C CB   . ALA A 1 82  ? -0.820  12.505  -8.135  1.00 0.00 ? 82  ALA A CB   1  
ATOM 1213  H H    . ALA A 1 82  ? -1.039  13.711  -10.251 1.00 0.00 ? 82  ALA A H    1  
ATOM 1214  H HA   . ALA A 1 82  ? -2.758  13.425  -8.102  1.00 0.00 ? 82  ALA A HA   1  
ATOM 1215  H HB1  . ALA A 1 82  ? -1.381  11.604  -8.380  1.00 0.00 ? 82  ALA A HB1  1  
ATOM 1216  H HB2  . ALA A 1 82  ? 0.031   12.599  -8.810  1.00 0.00 ? 82  ALA A HB2  1  
ATOM 1217  H HB3  . ALA A 1 82  ? -0.463  12.442  -7.107  1.00 0.00 ? 82  ALA A HB3  1  
ATOM 1218  N N    . ARG A 1 83  ? -0.327  15.596  -7.687  1.00 0.00 ? 83  ARG A N    1  
ATOM 1219  C CA   . ARG A 1 83  ? 0.135   16.699  -6.862  1.00 0.00 ? 83  ARG A CA   1  
ATOM 1220  C C    . ARG A 1 83  ? -0.948  17.775  -6.759  1.00 0.00 ? 83  ARG A C    1  
ATOM 1221  O O    . ARG A 1 83  ? -0.899  18.628  -5.874  1.00 0.00 ? 83  ARG A O    1  
ATOM 1222  C CB   . ARG A 1 83  ? 1.409   17.321  -7.437  1.00 0.00 ? 83  ARG A CB   1  
ATOM 1223  C CG   . ARG A 1 83  ? 2.629   16.449  -7.136  1.00 0.00 ? 83  ARG A CG   1  
ATOM 1224  C CD   . ARG A 1 83  ? 3.865   16.961  -7.879  1.00 0.00 ? 83  ARG A CD   1  
ATOM 1225  N NE   . ARG A 1 83  ? 5.048   16.907  -6.990  1.00 0.00 ? 83  ARG A NE   1  
ATOM 1226  C CZ   . ARG A 1 83  ? 5.185   17.641  -5.878  1.00 0.00 ? 83  ARG A CZ   1  
ATOM 1227  N NH1  . ARG A 1 83  ? 4.215   18.489  -5.510  1.00 0.00 ? 83  ARG A NH1  1  
ATOM 1228  N NH2  . ARG A 1 83  ? 6.293   17.527  -5.132  1.00 0.00 ? 83  ARG A NH2  1  
ATOM 1229  H H    . ARG A 1 83  ? 0.188   15.456  -8.532  1.00 0.00 ? 83  ARG A H    1  
ATOM 1230  H HA   . ARG A 1 83  ? 0.339   16.253  -5.888  1.00 0.00 ? 83  ARG A HA   1  
ATOM 1231  H HB2  . ARG A 1 83  ? 1.302   17.445  -8.515  1.00 0.00 ? 83  ARG A HB2  1  
ATOM 1232  H HB3  . ARG A 1 83  ? 1.555   18.316  -7.016  1.00 0.00 ? 83  ARG A HB3  1  
ATOM 1233  H HG2  . ARG A 1 83  ? 2.821   16.444  -6.064  1.00 0.00 ? 83  ARG A HG2  1  
ATOM 1234  H HG3  . ARG A 1 83  ? 2.426   15.419  -7.429  1.00 0.00 ? 83  ARG A HG3  1  
ATOM 1235  H HD2  . ARG A 1 83  ? 4.041   16.357  -8.769  1.00 0.00 ? 83  ARG A HD2  1  
ATOM 1236  H HD3  . ARG A 1 83  ? 3.700   17.984  -8.216  1.00 0.00 ? 83  ARG A HD3  1  
ATOM 1237  H HE   . ARG A 1 83  ? 5.791   16.284  -7.236  1.00 0.00 ? 83  ARG A HE   1  
ATOM 1238  H HH11 . ARG A 1 83  ? 3.388   18.574  -6.066  1.00 0.00 ? 83  ARG A HH11 1  
ATOM 1239  H HH12 . ARG A 1 83  ? 4.318   19.037  -4.679  1.00 0.00 ? 83  ARG A HH12 1  
ATOM 1240  H HH21 . ARG A 1 83  ? 7.017   16.894  -5.407  1.00 0.00 ? 83  ARG A HH21 1  
ATOM 1241  H HH22 . ARG A 1 83  ? 6.396   18.074  -4.302  1.00 0.00 ? 83  ARG A HH22 1  
ATOM 1242  N N    . LEU A 1 84  ? -1.901  17.700  -7.676  1.00 0.00 ? 84  LEU A N    1  
ATOM 1243  C CA   . LEU A 1 84  ? -2.995  18.657  -7.699  1.00 0.00 ? 84  LEU A CA   1  
ATOM 1244  C C    . LEU A 1 84  ? -4.226  18.034  -7.038  1.00 0.00 ? 84  LEU A C    1  
ATOM 1245  O O    . LEU A 1 84  ? -4.786  18.602  -6.102  1.00 0.00 ? 84  LEU A O    1  
ATOM 1246  C CB   . LEU A 1 84  ? -3.246  19.149  -9.126  1.00 0.00 ? 84  LEU A CB   1  
ATOM 1247  C CG   . LEU A 1 84  ? -4.598  18.775  -9.736  1.00 0.00 ? 84  LEU A CG   1  
ATOM 1248  C CD1  . LEU A 1 84  ? -5.748  19.393  -8.939  1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1249  C CD2  . LEU A 1 84  ? -4.656  19.158  -11.217 1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1250  H H    . LEU A 1 84  ? -1.934  17.003  -8.392  1.00 0.00 ? 84  LEU A H    1  
ATOM 1251  H HA   . LEU A 1 84  ? -2.686  19.520  -7.110  1.00 0.00 ? 84  LEU A HA   1  
ATOM 1252  H HB2  . LEU A 1 84  ? -3.152  20.235  -9.137  1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1253  H HB3  . LEU A 1 84  ? -2.458  18.755  -9.769  1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1254  H HG   . LEU A 1 84  ? -4.712  17.693  -9.679  1.00 0.00 ? 84  LEU A HG   1  
ATOM 1255  H HD11 . LEU A 1 84  ? -6.505  19.772  -9.627  1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1256  H HD12 . LEU A 1 84  ? -6.192  18.635  -8.294  1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1257  H HD13 . LEU A 1 84  ? -5.369  20.213  -8.329  1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1258  H HD21 . LEU A 1 84  ? -3.831  18.683  -11.747 1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1259  H HD22 . LEU A 1 84  ? -5.602  18.823  -11.642 1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1260  H HD23 . LEU A 1 84  ? -4.577  20.240  -11.315 1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1261  N N    . ILE A 1 85  ? -4.610  16.874  -7.551  1.00 0.00 ? 85  ILE A N    1  
ATOM 1262  C CA   . ILE A 1 85  ? -5.765  16.168  -7.022  1.00 0.00 ? 85  ILE A CA   1  
ATOM 1263  C C    . ILE A 1 85  ? -5.717  16.195  -5.493  1.00 0.00 ? 85  ILE A C    1  
ATOM 1264  O O    . ILE A 1 85  ? -6.713  16.508  -4.842  1.00 0.00 ? 85  ILE A O    1  
ATOM 1265  C CB   . ILE A 1 85  ? -5.846  14.758  -7.610  1.00 0.00 ? 85  ILE A CB   1  
ATOM 1266  C CG1  . ILE A 1 85  ? -5.943  14.805  -9.136  1.00 0.00 ? 85  ILE A CG1  1  
ATOM 1267  C CG2  . ILE A 1 85  ? -6.999  13.969  -6.986  1.00 0.00 ? 85  ILE A CG2  1  
ATOM 1268  C CD1  . ILE A 1 85  ? -5.270  13.584  -9.766  1.00 0.00 ? 85  ILE A CD1  1  
ATOM 1269  H H    . ILE A 1 85  ? -4.149  16.419  -8.312  1.00 0.00 ? 85  ILE A H    1  
ATOM 1270  H HA   . ILE A 1 85  ? -6.655  16.706  -7.349  1.00 0.00 ? 85  ILE A HA   1  
ATOM 1271  H HB   . ILE A 1 85  ? -4.925  14.231  -7.362  1.00 0.00 ? 85  ILE A HB   1  
ATOM 1272  H HG12 . ILE A 1 85  ? -6.990  14.842  -9.436  1.00 0.00 ? 85  ILE A HG12 1  
ATOM 1273  H HG13 . ILE A 1 85  ? -5.473  15.716  -9.506  1.00 0.00 ? 85  ILE A HG13 1  
ATOM 1274  H HG21 . ILE A 1 85  ? -7.756  14.662  -6.618  1.00 0.00 ? 85  ILE A HG21 1  
ATOM 1275  H HG22 . ILE A 1 85  ? -7.440  13.315  -7.738  1.00 0.00 ? 85  ILE A HG22 1  
ATOM 1276  H HG23 . ILE A 1 85  ? -6.623  13.369  -6.158  1.00 0.00 ? 85  ILE A HG23 1  
ATOM 1277  H HD11 . ILE A 1 85  ? -5.583  13.493  -10.806 1.00 0.00 ? 85  ILE A HD11 1  
ATOM 1278  H HD12 . ILE A 1 85  ? -4.187  13.703  -9.722  1.00 0.00 ? 85  ILE A HD12 1  
ATOM 1279  H HD13 . ILE A 1 85  ? -5.559  12.687  -9.219  1.00 0.00 ? 85  ILE A HD13 1  
ATOM 1280  N N    . ILE A 1 86  ? -4.549  15.863  -4.963  1.00 0.00 ? 86  ILE A N    1  
ATOM 1281  C CA   . ILE A 1 86  ? -4.358  15.845  -3.523  1.00 0.00 ? 86  ILE A CA   1  
ATOM 1282  C C    . ILE A 1 86  ? -4.352  17.282  -2.996  1.00 0.00 ? 86  ILE A C    1  
ATOM 1283  O O    . ILE A 1 86  ? -4.794  17.538  -1.876  1.00 0.00 ? 86  ILE A O    1  
ATOM 1284  C CB   . ILE A 1 86  ? -3.102  15.052  -3.158  1.00 0.00 ? 86  ILE A CB   1  
ATOM 1285  C CG1  . ILE A 1 86  ? -1.837  15.814  -3.557  1.00 0.00 ? 86  ILE A CG1  1  
ATOM 1286  C CG2  . ILE A 1 86  ? -3.142  13.650  -3.769  1.00 0.00 ? 86  ILE A CG2  1  
ATOM 1287  C CD1  . ILE A 1 86  ? -0.640  14.868  -3.675  1.00 0.00 ? 86  ILE A CD1  1  
ATOM 1288  H H    . ILE A 1 86  ? -3.743  15.610  -5.499  1.00 0.00 ? 86  ILE A H    1  
ATOM 1289  H HA   . ILE A 1 86  ? -5.208  15.321  -3.087  1.00 0.00 ? 86  ILE A HA   1  
ATOM 1290  H HB   . ILE A 1 86  ? -3.077  14.930  -2.075  1.00 0.00 ? 86  ILE A HB   1  
ATOM 1291  H HG12 . ILE A 1 86  ? -1.998  16.322  -4.508  1.00 0.00 ? 86  ILE A HG12 1  
ATOM 1292  H HG13 . ILE A 1 86  ? -1.623  16.585  -2.817  1.00 0.00 ? 86  ILE A HG13 1  
ATOM 1293  H HG21 . ILE A 1 86  ? -2.508  13.621  -4.655  1.00 0.00 ? 86  ILE A HG21 1  
ATOM 1294  H HG22 . ILE A 1 86  ? -2.781  12.925  -3.040  1.00 0.00 ? 86  ILE A HG22 1  
ATOM 1295  H HG23 . ILE A 1 86  ? -4.167  13.404  -4.048  1.00 0.00 ? 86  ILE A HG23 1  
ATOM 1296  H HD11 . ILE A 1 86  ? -0.813  13.985  -3.059  1.00 0.00 ? 86  ILE A HD11 1  
ATOM 1297  H HD12 . ILE A 1 86  ? -0.516  14.566  -4.715  1.00 0.00 ? 86  ILE A HD12 1  
ATOM 1298  H HD13 . ILE A 1 86  ? 0.261   15.377  -3.334  1.00 0.00 ? 86  ILE A HD13 1  
ATOM 1299  N N    . GLY A 1 87  ? -3.847  18.181  -3.827  1.00 0.00 ? 87  GLY A N    1  
ATOM 1300  C CA   . GLY A 1 87  ? -3.778  19.585  -3.459  1.00 0.00 ? 87  GLY A CA   1  
ATOM 1301  C C    . GLY A 1 87  ? -5.044  20.328  -3.891  1.00 0.00 ? 87  GLY A C    1  
ATOM 1302  O O    . GLY A 1 87  ? -4.970  21.451  -4.388  1.00 0.00 ? 87  GLY A O    1  
ATOM 1303  H H    . GLY A 1 87  ? -3.490  17.965  -4.736  1.00 0.00 ? 87  GLY A H    1  
ATOM 1304  H HA2  . GLY A 1 87  ? -3.650  19.676  -2.380  1.00 0.00 ? 87  GLY A HA2  1  
ATOM 1305  H HA3  . GLY A 1 87  ? -2.906  20.044  -3.924  1.00 0.00 ? 87  GLY A HA3  1  
ATOM 1306  N N    . GLN A 1 88  ? -6.177  19.672  -3.686  1.00 0.00 ? 88  GLN A N    1  
ATOM 1307  C CA   . GLN A 1 88  ? -7.457  20.256  -4.048  1.00 0.00 ? 88  GLN A CA   1  
ATOM 1308  C C    . GLN A 1 88  ? -8.072  20.973  -2.845  1.00 0.00 ? 88  GLN A C    1  
ATOM 1309  O O    . GLN A 1 88  ? -7.442  21.084  -1.794  1.00 0.00 ? 88  GLN A O    1  
ATOM 1310  C CB   . GLN A 1 88  ? -8.409  19.192  -4.599  1.00 0.00 ? 88  GLN A CB   1  
ATOM 1311  C CG   . GLN A 1 88  ? -8.170  18.964  -6.093  1.00 0.00 ? 88  GLN A CG   1  
ATOM 1312  C CD   . GLN A 1 88  ? -9.492  18.962  -6.865  1.00 0.00 ? 88  GLN A CD   1  
ATOM 1313  O OE1  . GLN A 1 88  ? -10.563 19.155  -6.313  1.00 0.00 ? 88  GLN A OE1  1  
ATOM 1314  N NE2  . GLN A 1 88  ? -9.356  18.735  -8.168  1.00 0.00 ? 88  GLN A NE2  1  
ATOM 1315  H H    . GLN A 1 88  ? -6.228  18.759  -3.281  1.00 0.00 ? 88  GLN A H    1  
ATOM 1316  H HA   . GLN A 1 88  ? -7.234  20.977  -4.834  1.00 0.00 ? 88  GLN A HA   1  
ATOM 1317  H HB2  . GLN A 1 88  ? -8.267  18.257  -4.057  1.00 0.00 ? 88  GLN A HB2  1  
ATOM 1318  H HB3  . GLN A 1 88  ? -9.441  19.503  -4.435  1.00 0.00 ? 88  GLN A HB3  1  
ATOM 1319  H HG2  . GLN A 1 88  ? -7.518  19.745  -6.484  1.00 0.00 ? 88  GLN A HG2  1  
ATOM 1320  H HG3  . GLN A 1 88  ? -7.657  18.015  -6.242  1.00 0.00 ? 88  GLN A HG3  1  
ATOM 1321  H HE21 . GLN A 1 88  ? -8.448  18.585  -8.558  1.00 0.00 ? 88  GLN A HE21 1  
ATOM 1322  H HE22 . GLN A 1 88  ? -10.163 18.714  -8.758  1.00 0.00 ? 88  GLN A HE22 1  
ATOM 1323  N N    . GLN A 1 89  ? -9.297  21.441  -3.038  1.00 0.00 ? 89  GLN A N    1  
ATOM 1324  C CA   . GLN A 1 89  ? -10.005 22.144  -1.982  1.00 0.00 ? 89  GLN A CA   1  
ATOM 1325  C C    . GLN A 1 89  ? -11.269 21.377  -1.589  1.00 0.00 ? 89  GLN A C    1  
ATOM 1326  O O    . GLN A 1 89  ? -12.313 21.526  -2.222  1.00 0.00 ? 89  GLN A O    1  
ATOM 1327  C CB   . GLN A 1 89  ? -10.342 23.575  -2.406  1.00 0.00 ? 89  GLN A CB   1  
ATOM 1328  C CG   . GLN A 1 89  ? -9.556  23.975  -3.656  1.00 0.00 ? 89  GLN A CG   1  
ATOM 1329  C CD   . GLN A 1 89  ? -10.251 23.474  -4.924  1.00 0.00 ? 89  GLN A CD   1  
ATOM 1330  O OE1  . GLN A 1 89  ? -11.344 23.891  -5.271  1.00 0.00 ? 89  GLN A OE1  1  
ATOM 1331  N NE2  . GLN A 1 89  ? -9.558  22.557  -5.594  1.00 0.00 ? 89  GLN A NE2  1  
ATOM 1332  H H    . GLN A 1 89  ? -9.803  21.346  -3.896  1.00 0.00 ? 89  GLN A H    1  
ATOM 1333  H HA   . GLN A 1 89  ? -9.313  22.174  -1.140  1.00 0.00 ? 89  GLN A HA   1  
ATOM 1334  H HB2  . GLN A 1 89  ? -11.411 23.658  -2.601  1.00 0.00 ? 89  GLN A HB2  1  
ATOM 1335  H HB3  . GLN A 1 89  ? -10.112 24.262  -1.592  1.00 0.00 ? 89  GLN A HB3  1  
ATOM 1336  H HG2  . GLN A 1 89  ? -9.458  25.060  -3.696  1.00 0.00 ? 89  GLN A HG2  1  
ATOM 1337  H HG3  . GLN A 1 89  ? -8.548  23.565  -3.604  1.00 0.00 ? 89  GLN A HG3  1  
ATOM 1338  H HE21 . GLN A 1 89  ? -8.666  22.258  -5.255  1.00 0.00 ? 89  GLN A HE21 1  
ATOM 1339  H HE22 . GLN A 1 89  ? -9.928  22.168  -6.437  1.00 0.00 ? 89  GLN A HE22 1  
ATOM 1340  N N    . CYS A 1 90  ? -11.133 20.572  -0.545  1.00 0.00 ? 90  CYS A N    1  
ATOM 1341  C CA   . CYS A 1 90  ? -12.251 19.781  -0.059  1.00 0.00 ? 90  CYS A CA   1  
ATOM 1342  C C    . CYS A 1 90  ? -12.120 19.645  1.459   1.00 0.00 ? 90  CYS A C    1  
ATOM 1343  O O    . CYS A 1 90  ? -11.193 19.003  1.950   1.00 0.00 ? 90  CYS A O    1  
ATOM 1344  C CB   . CYS A 1 90  ? -12.323 18.418  -0.750  1.00 0.00 ? 90  CYS A CB   1  
ATOM 1345  S SG   . CYS A 1 90  ? -13.503 18.485  -2.147  1.00 0.00 ? 90  CYS A SG   1  
ATOM 1346  H H    . CYS A 1 90  ? -10.281 20.456  -0.035  1.00 0.00 ? 90  CYS A H    1  
ATOM 1347  H HA   . CYS A 1 90  ? -13.158 20.326  -0.322  1.00 0.00 ? 90  CYS A HA   1  
ATOM 1348  H HB2  . CYS A 1 90  ? -11.335 18.132  -1.112  1.00 0.00 ? 90  CYS A HB2  1  
ATOM 1349  H HB3  . CYS A 1 90  ? -12.634 17.655  -0.037  1.00 0.00 ? 90  CYS A HB3  1  
ATOM 1350  H HG   . CYS A 1 90  ? -12.639 18.090  -3.078  1.00 0.00 ? 90  CYS A HG   1  
ATOM 1351  N N    . ASP A 1 91  ? -13.062 20.259  2.160   1.00 0.00 ? 91  ASP A N    1  
ATOM 1352  C CA   . ASP A 1 91  ? -13.064 20.215  3.612   1.00 0.00 ? 91  ASP A CA   1  
ATOM 1353  C C    . ASP A 1 91  ? -12.702 18.802  4.075   1.00 0.00 ? 91  ASP A C    1  
ATOM 1354  O O    . ASP A 1 91  ? -11.791 18.624  4.883   1.00 0.00 ? 91  ASP A O    1  
ATOM 1355  C CB   . ASP A 1 91  ? -14.446 20.556  4.172   1.00 0.00 ? 91  ASP A CB   1  
ATOM 1356  C CG   . ASP A 1 91  ? -14.886 22.007  3.968   1.00 0.00 ? 91  ASP A CG   1  
ATOM 1357  O OD1  . ASP A 1 91  ? -14.022 22.809  3.553   1.00 0.00 ? 91  ASP A OD1  1  
ATOM 1358  O OD2  . ASP A 1 91  ? -16.077 22.281  4.232   1.00 0.00 ? 91  ASP A OD2  1  
ATOM 1359  H H    . ASP A 1 91  ? -13.813 20.779  1.752   1.00 0.00 ? 91  ASP A H    1  
ATOM 1360  H HA   . ASP A 1 91  ? -12.328 20.957  3.922   1.00 0.00 ? 91  ASP A HA   1  
ATOM 1361  H HB2  . ASP A 1 91  ? -15.182 19.900  3.707   1.00 0.00 ? 91  ASP A HB2  1  
ATOM 1362  H HB3  . ASP A 1 91  ? -14.453 20.336  5.240   1.00 0.00 ? 91  ASP A HB3  1  
ATOM 1363  N N    . THR A 1 92  ? -13.433 17.834  3.543   1.00 0.00 ? 92  THR A N    1  
ATOM 1364  C CA   . THR A 1 92  ? -13.200 16.442  3.892   1.00 0.00 ? 92  THR A CA   1  
ATOM 1365  C C    . THR A 1 92  ? -13.022 15.599  2.628   1.00 0.00 ? 92  THR A C    1  
ATOM 1366  O O    . THR A 1 92  ? -13.893 15.584  1.759   1.00 0.00 ? 92  THR A O    1  
ATOM 1367  C CB   . THR A 1 92  ? -14.359 15.976  4.775   1.00 0.00 ? 92  THR A CB   1  
ATOM 1368  O OG1  . THR A 1 92  ? -14.250 16.783  5.945   1.00 0.00 ? 92  THR A OG1  1  
ATOM 1369  C CG2  . THR A 1 92  ? -14.166 14.548  5.289   1.00 0.00 ? 92  THR A CG2  1  
ATOM 1370  H H    . THR A 1 92  ? -14.172 17.987  2.887   1.00 0.00 ? 92  THR A H    1  
ATOM 1371  H HA   . THR A 1 92  ? -12.267 16.380  4.452   1.00 0.00 ? 92  THR A HA   1  
ATOM 1372  H HB   . THR A 1 92  ? -15.311 16.077  4.255   1.00 0.00 ? 92  THR A HB   1  
ATOM 1373  H HG1  . THR A 1 92  ? -14.633 17.690  5.772   1.00 0.00 ? 92  THR A HG1  1  
ATOM 1374  H HG21 . THR A 1 92  ? -14.878 13.886  4.797   1.00 0.00 ? 92  THR A HG21 1  
ATOM 1375  H HG22 . THR A 1 92  ? -13.150 14.217  5.069   1.00 0.00 ? 92  THR A HG22 1  
ATOM 1376  H HG23 . THR A 1 92  ? -14.331 14.524  6.366   1.00 0.00 ? 92  THR A HG23 1  
ATOM 1377  N N    . ILE A 1 93  ? -11.889 14.916  2.566   1.00 0.00 ? 93  ILE A N    1  
ATOM 1378  C CA   . ILE A 1 93  ? -11.585 14.071  1.423   1.00 0.00 ? 93  ILE A CA   1  
ATOM 1379  C C    . ILE A 1 93  ? -11.056 12.723  1.916   1.00 0.00 ? 93  ILE A C    1  
ATOM 1380  O O    . ILE A 1 93  ? -10.395 12.654  2.951   1.00 0.00 ? 93  ILE A O    1  
ATOM 1381  C CB   . ILE A 1 93  ? -10.637 14.791  0.462   1.00 0.00 ? 93  ILE A CB   1  
ATOM 1382  C CG1  . ILE A 1 93  ? -9.783  13.789  -0.318  1.00 0.00 ? 93  ILE A CG1  1  
ATOM 1383  C CG2  . ILE A 1 93  ? -9.780  15.818  1.204   1.00 0.00 ? 93  ILE A CG2  1  
ATOM 1384  C CD1  . ILE A 1 93  ? -8.525  13.411  0.467   1.00 0.00 ? 93  ILE A CD1  1  
ATOM 1385  H H    . ILE A 1 93  ? -11.186 14.933  3.277   1.00 0.00 ? 93  ILE A H    1  
ATOM 1386  H HA   . ILE A 1 93  ? -12.519 13.900  0.886   1.00 0.00 ? 93  ILE A HA   1  
ATOM 1387  H HB   . ILE A 1 93  ? -11.237 15.337  -0.265  1.00 0.00 ? 93  ILE A HB   1  
ATOM 1388  H HG12 . ILE A 1 93  ? -10.368 12.893  -0.528  1.00 0.00 ? 93  ILE A HG12 1  
ATOM 1389  H HG13 . ILE A 1 93  ? -9.501  14.217  -1.280  1.00 0.00 ? 93  ILE A HG13 1  
ATOM 1390  H HG21 . ILE A 1 93  ? -10.381 16.699  1.428   1.00 0.00 ? 93  ILE A HG21 1  
ATOM 1391  H HG22 . ILE A 1 93  ? -9.414  15.382  2.134   1.00 0.00 ? 93  ILE A HG22 1  
ATOM 1392  H HG23 . ILE A 1 93  ? -8.934  16.104  0.580   1.00 0.00 ? 93  ILE A HG23 1  
ATOM 1393  H HD11 . ILE A 1 93  ? -8.286  12.363  0.289   1.00 0.00 ? 93  ILE A HD11 1  
ATOM 1394  H HD12 . ILE A 1 93  ? -7.692  14.034  0.140   1.00 0.00 ? 93  ILE A HD12 1  
ATOM 1395  H HD13 . ILE A 1 93  ? -8.701  13.568  1.531   1.00 0.00 ? 93  ILE A HD13 1  
ATOM 1396  N N    . THR A 1 94  ? -11.365 11.686  1.152   1.00 0.00 ? 94  THR A N    1  
ATOM 1397  C CA   . THR A 1 94  ? -10.929 10.344  1.499   1.00 0.00 ? 94  THR A CA   1  
ATOM 1398  C C    . THR A 1 94  ? -9.833  9.876   0.539   1.00 0.00 ? 94  THR A C    1  
ATOM 1399  O O    . THR A 1 94  ? -9.631  10.473  -0.517  1.00 0.00 ? 94  THR A O    1  
ATOM 1400  C CB   . THR A 1 94  ? -12.159 9.435   1.508   1.00 0.00 ? 94  THR A CB   1  
ATOM 1401  O OG1  . THR A 1 94  ? -13.187 10.247  2.067   1.00 0.00 ? 94  THR A OG1  1  
ATOM 1402  C CG2  . THR A 1 94  ? -12.021 8.274   2.496   1.00 0.00 ? 94  THR A CG2  1  
ATOM 1403  H H    . THR A 1 94  ? -11.904 11.752  0.312   1.00 0.00 ? 94  THR A H    1  
ATOM 1404  H HA   . THR A 1 94  ? -10.490 10.373  2.496   1.00 0.00 ? 94  THR A HA   1  
ATOM 1405  H HB   . THR A 1 94  ? -12.379 9.068   0.506   1.00 0.00 ? 94  THR A HB   1  
ATOM 1406  H HG1  . THR A 1 94  ? -12.968 10.471  3.017   1.00 0.00 ? 94  THR A HG1  1  
ATOM 1407  H HG21 . THR A 1 94  ? -12.309 7.344   2.006   1.00 0.00 ? 94  THR A HG21 1  
ATOM 1408  H HG22 . THR A 1 94  ? -10.987 8.204   2.832   1.00 0.00 ? 94  THR A HG22 1  
ATOM 1409  H HG23 . THR A 1 94  ? -12.671 8.449   3.354   1.00 0.00 ? 94  THR A HG23 1  
ATOM 1410  N N    . ILE A 1 95  ? -9.155  8.810   0.941   1.00 0.00 ? 95  ILE A N    1  
ATOM 1411  C CA   . ILE A 1 95  ? -8.086  8.255   0.130   1.00 0.00 ? 95  ILE A CA   1  
ATOM 1412  C C    . ILE A 1 95  ? -8.189  6.728   0.134   1.00 0.00 ? 95  ILE A C    1  
ATOM 1413  O O    . ILE A 1 95  ? -8.546  6.129   1.147   1.00 0.00 ? 95  ILE A O    1  
ATOM 1414  C CB   . ILE A 1 95  ? -6.728  8.780   0.600   1.00 0.00 ? 95  ILE A CB   1  
ATOM 1415  C CG1  . ILE A 1 95  ? -6.423  10.144  -0.022  1.00 0.00 ? 95  ILE A CG1  1  
ATOM 1416  C CG2  . ILE A 1 95  ? -5.620  7.763   0.322   1.00 0.00 ? 95  ILE A CG2  1  
ATOM 1417  C CD1  . ILE A 1 95  ? -5.548  10.988  0.907   1.00 0.00 ? 95  ILE A CD1  1  
ATOM 1418  H H    . ILE A 1 95  ? -9.326  8.330   1.801   1.00 0.00 ? 95  ILE A H    1  
ATOM 1419  H HA   . ILE A 1 95  ? -8.232  8.608   -0.891  1.00 0.00 ? 95  ILE A HA   1  
ATOM 1420  H HB   . ILE A 1 95  ? -6.772  8.922   1.680   1.00 0.00 ? 95  ILE A HB   1  
ATOM 1421  H HG12 . ILE A 1 95  ? -5.917  10.007  -0.978  1.00 0.00 ? 95  ILE A HG12 1  
ATOM 1422  H HG13 . ILE A 1 95  ? -7.355  10.671  -0.228  1.00 0.00 ? 95  ILE A HG13 1  
ATOM 1423  H HG21 . ILE A 1 95  ? -5.704  6.933   1.024   1.00 0.00 ? 95  ILE A HG21 1  
ATOM 1424  H HG22 . ILE A 1 95  ? -5.718  7.388   -0.697  1.00 0.00 ? 95  ILE A HG22 1  
ATOM 1425  H HG23 . ILE A 1 95  ? -4.648  8.242   0.441   1.00 0.00 ? 95  ILE A HG23 1  
ATOM 1426  H HD11 . ILE A 1 95  ? -4.579  11.158  0.439   1.00 0.00 ? 95  ILE A HD11 1  
ATOM 1427  H HD12 . ILE A 1 95  ? -6.034  11.946  1.094   1.00 0.00 ? 95  ILE A HD12 1  
ATOM 1428  H HD13 . ILE A 1 95  ? -5.409  10.462  1.852   1.00 0.00 ? 95  ILE A HD13 1  
ATOM 1429  N N    . LEU A 1 96  ? -7.870  6.142   -1.011  1.00 0.00 ? 96  LEU A N    1  
ATOM 1430  C CA   . LEU A 1 96  ? -7.923  4.697   -1.152  1.00 0.00 ? 96  LEU A CA   1  
ATOM 1431  C C    . LEU A 1 96  ? -6.502  4.154   -1.321  1.00 0.00 ? 96  LEU A C    1  
ATOM 1432  O O    . LEU A 1 96  ? -6.007  4.040   -2.441  1.00 0.00 ? 96  LEU A O    1  
ATOM 1433  C CB   . LEU A 1 96  ? -8.871  4.303   -2.287  1.00 0.00 ? 96  LEU A CB   1  
ATOM 1434  C CG   . LEU A 1 96  ? -8.890  2.820   -2.660  1.00 0.00 ? 96  LEU A CG   1  
ATOM 1435  C CD1  . LEU A 1 96  ? -9.576  1.990   -1.573  1.00 0.00 ? 96  LEU A CD1  1  
ATOM 1436  C CD2  . LEU A 1 96  ? -9.532  2.609   -4.033  1.00 0.00 ? 96  LEU A CD2  1  
ATOM 1437  H H    . LEU A 1 96  ? -7.581  6.637   -1.831  1.00 0.00 ? 96  LEU A H    1  
ATOM 1438  H HA   . LEU A 1 96  ? -8.339  4.294   -0.229  1.00 0.00 ? 96  LEU A HA   1  
ATOM 1439  H HB2  . LEU A 1 96  ? -9.882  4.601   -2.008  1.00 0.00 ? 96  LEU A HB2  1  
ATOM 1440  H HB3  . LEU A 1 96  ? -8.602  4.878   -3.173  1.00 0.00 ? 96  LEU A HB3  1  
ATOM 1441  H HG   . LEU A 1 96  ? -7.860  2.471   -2.730  1.00 0.00 ? 96  LEU A HG   1  
ATOM 1442  H HD11 . LEU A 1 96  ? -10.460 2.518   -1.216  1.00 0.00 ? 96  LEU A HD11 1  
ATOM 1443  H HD12 . LEU A 1 96  ? -9.871  1.024   -1.985  1.00 0.00 ? 96  LEU A HD12 1  
ATOM 1444  H HD13 . LEU A 1 96  ? -8.885  1.835   -0.744  1.00 0.00 ? 96  LEU A HD13 1  
ATOM 1445  H HD21 . LEU A 1 96  ? -8.843  2.938   -4.811  1.00 0.00 ? 96  LEU A HD21 1  
ATOM 1446  H HD22 . LEU A 1 96  ? -9.756  1.551   -4.171  1.00 0.00 ? 96  LEU A HD22 1  
ATOM 1447  H HD23 . LEU A 1 96  ? -10.454 3.186   -4.096  1.00 0.00 ? 96  LEU A HD23 1  
ATOM 1448  N N    . ALA A 1 97  ? -5.888  3.832   -0.192  1.00 0.00 ? 97  ALA A N    1  
ATOM 1449  C CA   . ALA A 1 97  ? -4.535  3.303   -0.201  1.00 0.00 ? 97  ALA A CA   1  
ATOM 1450  C C    . ALA A 1 97  ? -4.589  1.774   -0.210  1.00 0.00 ? 97  ALA A C    1  
ATOM 1451  O O    . ALA A 1 97  ? -5.667  1.187   -0.124  1.00 0.00 ? 97  ALA A O    1  
ATOM 1452  C CB   . ALA A 1 97  ? -3.764  3.852   1.001   1.00 0.00 ? 97  ALA A CB   1  
ATOM 1453  H H    . ALA A 1 97  ? -6.298  3.927   0.715   1.00 0.00 ? 97  ALA A H    1  
ATOM 1454  H HA   . ALA A 1 97  ? -4.050  3.646   -1.115  1.00 0.00 ? 97  ALA A HA   1  
ATOM 1455  H HB1  . ALA A 1 97  ? -4.465  4.276   1.720   1.00 0.00 ? 97  ALA A HB1  1  
ATOM 1456  H HB2  . ALA A 1 97  ? -3.203  3.045   1.472   1.00 0.00 ? 97  ALA A HB2  1  
ATOM 1457  H HB3  . ALA A 1 97  ? -3.074  4.627   0.667   1.00 0.00 ? 97  ALA A HB3  1  
ATOM 1458  N N    . GLN A 1 98  ? -3.413  1.173   -0.315  1.00 0.00 ? 98  GLN A N    1  
ATOM 1459  C CA   . GLN A 1 98  ? -3.314  -0.277  -0.336  1.00 0.00 ? 98  GLN A CA   1  
ATOM 1460  C C    . GLN A 1 98  ? -1.849  -0.710  -0.248  1.00 0.00 ? 98  GLN A C    1  
ATOM 1461  O O    . GLN A 1 98  ? -1.229  -1.027  -1.262  1.00 0.00 ? 98  GLN A O    1  
ATOM 1462  C CB   . GLN A 1 98  ? -3.981  -0.854  -1.586  1.00 0.00 ? 98  GLN A CB   1  
ATOM 1463  C CG   . GLN A 1 98  ? -4.125  -2.374  -1.478  1.00 0.00 ? 98  GLN A CG   1  
ATOM 1464  C CD   . GLN A 1 98  ? -4.553  -2.980  -2.816  1.00 0.00 ? 98  GLN A CD   1  
ATOM 1465  O OE1  . GLN A 1 98  ? -4.386  -2.395  -3.874  1.00 0.00 ? 98  GLN A OE1  1  
ATOM 1466  N NE2  . GLN A 1 98  ? -5.113  -4.182  -2.711  1.00 0.00 ? 98  GLN A NE2  1  
ATOM 1467  H H    . GLN A 1 98  ? -2.541  1.657   -0.385  1.00 0.00 ? 98  GLN A H    1  
ATOM 1468  H HA   . GLN A 1 98  ? -3.854  -0.617  0.547   1.00 0.00 ? 98  GLN A HA   1  
ATOM 1469  H HB2  . GLN A 1 98  ? -4.964  -0.402  -1.719  1.00 0.00 ? 98  GLN A HB2  1  
ATOM 1470  H HB3  . GLN A 1 98  ? -3.392  -0.602  -2.467  1.00 0.00 ? 98  GLN A HB3  1  
ATOM 1471  H HG2  . GLN A 1 98  ? -3.177  -2.811  -1.164  1.00 0.00 ? 98  GLN A HG2  1  
ATOM 1472  H HG3  . GLN A 1 98  ? -4.859  -2.620  -0.712  1.00 0.00 ? 98  GLN A HG3  1  
ATOM 1473  H HE21 . GLN A 1 98  ? -5.220  -4.606  -1.812  1.00 0.00 ? 98  GLN A HE21 1  
ATOM 1474  H HE22 . GLN A 1 98  ? -5.426  -4.661  -3.531  1.00 0.00 ? 98  GLN A HE22 1  
ATOM 1475  N N    . TYR A 1 99  ? -1.337  -0.708  0.974   1.00 0.00 ? 99  TYR A N    1  
ATOM 1476  C CA   . TYR A 1 99  ? 0.043   -1.096  1.208   1.00 0.00 ? 99  TYR A CA   1  
ATOM 1477  C C    . TYR A 1 99  ? 0.455   -2.243  0.283   1.00 0.00 ? 99  TYR A C    1  
ATOM 1478  O O    . TYR A 1 99  ? -0.263  -3.235  0.161   1.00 0.00 ? 99  TYR A O    1  
ATOM 1479  C CB   . TYR A 1 99  ? 0.106   -1.579  2.659   1.00 0.00 ? 99  TYR A CB   1  
ATOM 1480  C CG   . TYR A 1 99  ? 1.504   -1.998  3.116   1.00 0.00 ? 99  TYR A CG   1  
ATOM 1481  C CD1  . TYR A 1 99  ? 1.932   -3.296  2.929   1.00 0.00 ? 99  TYR A CD1  1  
ATOM 1482  C CD2  . TYR A 1 99  ? 2.339   -1.076  3.715   1.00 0.00 ? 99  TYR A CD2  1  
ATOM 1483  C CE1  . TYR A 1 99  ? 3.249   -3.690  3.359   1.00 0.00 ? 99  TYR A CE1  1  
ATOM 1484  C CE2  . TYR A 1 99  ? 3.655   -1.469  4.146   1.00 0.00 ? 99  TYR A CE2  1  
ATOM 1485  C CZ   . TYR A 1 99  ? 4.045   -2.757  3.946   1.00 0.00 ? 99  TYR A CZ   1  
ATOM 1486  O OH   . TYR A 1 99  ? 5.289   -3.129  4.353   1.00 0.00 ? 99  TYR A OH   1  
ATOM 1487  H H    . TYR A 1 99  ? -1.848  -0.448  1.794   1.00 0.00 ? 99  TYR A H    1  
ATOM 1488  H HA   . TYR A 1 99  ? 0.675   -0.231  1.006   1.00 0.00 ? 99  TYR A HA   1  
ATOM 1489  H HB2  . TYR A 1 99  ? -0.256  -0.785  3.311   1.00 0.00 ? 99  TYR A HB2  1  
ATOM 1490  H HB3  . TYR A 1 99  ? -0.572  -2.424  2.779   1.00 0.00 ? 99  TYR A HB3  1  
ATOM 1491  H HD1  . TYR A 1 99  ? 1.273   -4.024  2.455   1.00 0.00 ? 99  TYR A HD1  1  
ATOM 1492  H HD2  . TYR A 1 99  ? 2.001   -0.050  3.863   1.00 0.00 ? 99  TYR A HD2  1  
ATOM 1493  H HE1  . TYR A 1 99  ? 3.599   -4.712  3.217   1.00 0.00 ? 99  TYR A HE1  1  
ATOM 1494  H HE2  . TYR A 1 99  ? 4.324   -0.752  4.620   1.00 0.00 ? 99  TYR A HE2  1  
ATOM 1495  H HH   . TYR A 1 99  ? 5.918   -3.125  3.575   1.00 0.00 ? 99  TYR A HH   1  
ATOM 1496  N N    . ASN A 1 100 ? 1.608   -2.070  -0.345  1.00 0.00 ? 100 ASN A N    1  
ATOM 1497  C CA   . ASN A 1 100 ? 2.123   -3.078  -1.256  1.00 0.00 ? 100 ASN A CA   1  
ATOM 1498  C C    . ASN A 1 100 ? 3.558   -3.431  -0.860  1.00 0.00 ? 100 ASN A C    1  
ATOM 1499  O O    . ASN A 1 100 ? 4.449   -2.586  -0.922  1.00 0.00 ? 100 ASN A O    1  
ATOM 1500  C CB   . ASN A 1 100 ? 2.144   -2.561  -2.696  1.00 0.00 ? 100 ASN A CB   1  
ATOM 1501  C CG   . ASN A 1 100 ? 0.961   -3.113  -3.493  1.00 0.00 ? 100 ASN A CG   1  
ATOM 1502  O OD1  . ASN A 1 100 ? -0.106  -3.381  -2.966  1.00 0.00 ? 100 ASN A OD1  1  
ATOM 1503  N ND2  . ASN A 1 100 ? 1.208   -3.267  -4.791  1.00 0.00 ? 100 ASN A ND2  1  
ATOM 1504  H H    . ASN A 1 100 ? 2.186   -1.260  -0.241  1.00 0.00 ? 100 ASN A H    1  
ATOM 1505  H HA   . ASN A 1 100 ? 1.444   -3.925  -1.160  1.00 0.00 ? 100 ASN A HA   1  
ATOM 1506  H HB2  . ASN A 1 100 ? 2.110   -1.471  -2.695  1.00 0.00 ? 100 ASN A HB2  1  
ATOM 1507  H HB3  . ASN A 1 100 ? 3.078   -2.851  -3.177  1.00 0.00 ? 100 ASN A HB3  1  
ATOM 1508  H HD21 . ASN A 1 100 ? 2.106   -3.028  -5.161  1.00 0.00 ? 100 ASN A HD21 1  
ATOM 1509  H HD22 . ASN A 1 100 ? 0.497   -3.623  -5.397  1.00 0.00 ? 100 ASN A HD22 1  
ATOM 1510  N N    . PRO A 1 101 ? 3.742   -4.715  -0.450  1.00 0.00 ? 101 PRO A N    1  
ATOM 1511  C CA   . PRO A 1 101 ? 5.054   -5.190  -0.044  1.00 0.00 ? 101 PRO A CA   1  
ATOM 1512  C C    . PRO A 1 101 ? 5.957   -5.412  -1.259  1.00 0.00 ? 101 PRO A C    1  
ATOM 1513  O O    . PRO A 1 101 ? 6.503   -6.499  -1.441  1.00 0.00 ? 101 PRO A O    1  
ATOM 1514  C CB   . PRO A 1 101 ? 4.785   -6.466  0.737   1.00 0.00 ? 101 PRO A CB   1  
ATOM 1515  C CG   . PRO A 1 101 ? 3.384   -6.907  0.346   1.00 0.00 ? 101 PRO A CG   1  
ATOM 1516  C CD   . PRO A 1 101 ? 2.710   -5.744  -0.363  1.00 0.00 ? 101 PRO A CD   1  
ATOM 1517  H HA   . PRO A 1 101 ? 5.514   -4.502  0.517   1.00 0.00 ? 101 PRO A HA   1  
ATOM 1518  H HB2  . PRO A 1 101 ? 5.519   -7.235  0.494   1.00 0.00 ? 101 PRO A HB2  1  
ATOM 1519  H HB3  . PRO A 1 101 ? 4.854   -6.289  1.811   1.00 0.00 ? 101 PRO A HB3  1  
ATOM 1520  H HG2  . PRO A 1 101 ? 3.426   -7.779  -0.306  1.00 0.00 ? 101 PRO A HG2  1  
ATOM 1521  H HG3  . PRO A 1 101 ? 2.815   -7.197  1.230   1.00 0.00 ? 101 PRO A HG3  1  
ATOM 1522  H HD2  . PRO A 1 101 ? 2.357   -6.035  -1.352  1.00 0.00 ? 101 PRO A HD2  1  
ATOM 1523  H HD3  . PRO A 1 101 ? 1.843   -5.389  0.194   1.00 0.00 ? 101 PRO A HD3  1  
ATOM 1524  N N    . HIS A 1 102 ? 6.087   -4.364  -2.059  1.00 0.00 ? 102 HIS A N    1  
ATOM 1525  C CA   . HIS A 1 102 ? 6.915   -4.430  -3.251  1.00 0.00 ? 102 HIS A CA   1  
ATOM 1526  C C    . HIS A 1 102 ? 7.299   -3.016  -3.689  1.00 0.00 ? 102 HIS A C    1  
ATOM 1527  O O    . HIS A 1 102 ? 7.056   -2.628  -4.830  1.00 0.00 ? 102 HIS A O    1  
ATOM 1528  C CB   . HIS A 1 102 ? 6.213   -5.223  -4.356  1.00 0.00 ? 102 HIS A CB   1  
ATOM 1529  C CG   . HIS A 1 102 ? 7.148   -6.047  -5.208  1.00 0.00 ? 102 HIS A CG   1  
ATOM 1530  N ND1  . HIS A 1 102 ? 6.699   -7.000  -6.107  1.00 0.00 ? 102 HIS A ND1  1  
ATOM 1531  C CD2  . HIS A 1 102 ? 8.509   -6.052  -5.291  1.00 0.00 ? 102 HIS A CD2  1  
ATOM 1532  C CE1  . HIS A 1 102 ? 7.752   -7.547  -6.696  1.00 0.00 ? 102 HIS A CE1  1  
ATOM 1533  N NE2  . HIS A 1 102 ? 8.873   -6.958  -6.189  1.00 0.00 ? 102 HIS A NE2  1  
ATOM 1534  H H    . HIS A 1 102 ? 5.639   -3.483  -1.903  1.00 0.00 ? 102 HIS A H    1  
ATOM 1535  H HA   . HIS A 1 102 ? 7.818   -4.974  -2.975  1.00 0.00 ? 102 HIS A HA   1  
ATOM 1536  H HB2  . HIS A 1 102 ? 5.474   -5.883  -3.902  1.00 0.00 ? 102 HIS A HB2  1  
ATOM 1537  H HB3  . HIS A 1 102 ? 5.670   -4.529  -4.997  1.00 0.00 ? 102 HIS A HB3  1  
ATOM 1538  H HD1  . HIS A 1 102 ? 5.743   -7.235  -6.281  1.00 0.00 ? 102 HIS A HD1  1  
ATOM 1539  H HD2  . HIS A 1 102 ? 9.184   -5.418  -4.716  1.00 0.00 ? 102 HIS A HD2  1  
ATOM 1540  H HE1  . HIS A 1 102 ? 7.726   -8.330  -7.454  1.00 0.00 ? 102 HIS A HE1  1  
ATOM 1541  N N    . VAL A 1 103 ? 7.893   -2.284  -2.757  1.00 0.00 ? 103 VAL A N    1  
ATOM 1542  C CA   . VAL A 1 103 ? 8.313   -0.920  -3.033  1.00 0.00 ? 103 VAL A CA   1  
ATOM 1543  C C    . VAL A 1 103 ? 9.287   -0.462  -1.945  1.00 0.00 ? 103 VAL A C    1  
ATOM 1544  O O    . VAL A 1 103 ? 9.000   0.478   -1.206  1.00 0.00 ? 103 VAL A O    1  
ATOM 1545  C CB   . VAL A 1 103 ? 7.089   -0.011  -3.160  1.00 0.00 ? 103 VAL A CB   1  
ATOM 1546  C CG1  . VAL A 1 103 ? 6.383   0.150   -1.813  1.00 0.00 ? 103 VAL A CG1  1  
ATOM 1547  C CG2  . VAL A 1 103 ? 7.476   1.350   -3.743  1.00 0.00 ? 103 VAL A CG2  1  
ATOM 1548  H H    . VAL A 1 103 ? 8.087   -2.607  -1.831  1.00 0.00 ? 103 VAL A H    1  
ATOM 1549  H HA   . VAL A 1 103 ? 8.833   -0.923  -3.991  1.00 0.00 ? 103 VAL A HA   1  
ATOM 1550  H HB   . VAL A 1 103 ? 6.391   -0.484  -3.850  1.00 0.00 ? 103 VAL A HB   1  
ATOM 1551  H HG11 . VAL A 1 103 ? 6.933   -0.396  -1.047  1.00 0.00 ? 103 VAL A HG11 1  
ATOM 1552  H HG12 . VAL A 1 103 ? 6.341   1.207   -1.548  1.00 0.00 ? 103 VAL A HG12 1  
ATOM 1553  H HG13 . VAL A 1 103 ? 5.370   -0.247  -1.884  1.00 0.00 ? 103 VAL A HG13 1  
ATOM 1554  H HG21 . VAL A 1 103 ? 7.570   2.077   -2.936  1.00 0.00 ? 103 VAL A HG21 1  
ATOM 1555  H HG22 . VAL A 1 103 ? 8.427   1.264   -4.268  1.00 0.00 ? 103 VAL A HG22 1  
ATOM 1556  H HG23 . VAL A 1 103 ? 6.705   1.679   -4.440  1.00 0.00 ? 103 VAL A HG23 1  
ATOM 1557  N N    . HIS A 1 104 ? 10.419  -1.148  -1.883  1.00 0.00 ? 104 HIS A N    1  
ATOM 1558  C CA   . HIS A 1 104 ? 11.437  -0.823  -0.898  1.00 0.00 ? 104 HIS A CA   1  
ATOM 1559  C C    . HIS A 1 104 ? 12.665  -0.242  -1.602  1.00 0.00 ? 104 HIS A C    1  
ATOM 1560  O O    . HIS A 1 104 ? 13.632  -0.956  -1.861  1.00 0.00 ? 104 HIS A O    1  
ATOM 1561  C CB   . HIS A 1 104 ? 11.770  -2.043  -0.038  1.00 0.00 ? 104 HIS A CB   1  
ATOM 1562  C CG   . HIS A 1 104 ? 10.660  -2.454  0.900   1.00 0.00 ? 104 HIS A CG   1  
ATOM 1563  N ND1  . HIS A 1 104 ? 10.303  -1.710  2.011   1.00 0.00 ? 104 HIS A ND1  1  
ATOM 1564  C CD2  . HIS A 1 104 ? 9.832   -3.538  0.881   1.00 0.00 ? 104 HIS A CD2  1  
ATOM 1565  C CE1  . HIS A 1 104 ? 9.305   -2.327  2.626   1.00 0.00 ? 104 HIS A CE1  1  
ATOM 1566  N NE2  . HIS A 1 104 ? 9.015   -3.461  1.924   1.00 0.00 ? 104 HIS A NE2  1  
ATOM 1567  H H    . HIS A 1 104 ? 10.645  -1.911  -2.488  1.00 0.00 ? 104 HIS A H    1  
ATOM 1568  H HA   . HIS A 1 104 ? 11.009  -0.062  -0.245  1.00 0.00 ? 104 HIS A HA   1  
ATOM 1569  H HB2  . HIS A 1 104 ? 12.008  -2.882  -0.692  1.00 0.00 ? 104 HIS A HB2  1  
ATOM 1570  H HB3  . HIS A 1 104 ? 12.665  -1.830  0.547   1.00 0.00 ? 104 HIS A HB3  1  
ATOM 1571  H HD1  . HIS A 1 104 ? 10.726  -0.851  2.301   1.00 0.00 ? 104 HIS A HD1  1  
ATOM 1572  H HD2  . HIS A 1 104 ? 9.840   -4.333  0.135   1.00 0.00 ? 104 HIS A HD2  1  
ATOM 1573  H HE1  . HIS A 1 104 ? 8.803   -1.989  3.532   1.00 0.00 ? 104 HIS A HE1  1  
ATOM 1574  N N    . GLN A 1 105 ? 12.586  1.049   -1.891  1.00 0.00 ? 105 GLN A N    1  
ATOM 1575  C CA   . GLN A 1 105 ? 13.678  1.734   -2.560  1.00 0.00 ? 105 GLN A CA   1  
ATOM 1576  C C    . GLN A 1 105 ? 14.041  3.016   -1.807  1.00 0.00 ? 105 GLN A C    1  
ATOM 1577  O O    . GLN A 1 105 ? 13.336  3.418   -0.883  1.00 0.00 ? 105 GLN A O    1  
ATOM 1578  C CB   . GLN A 1 105 ? 13.326  2.036   -4.018  1.00 0.00 ? 105 GLN A CB   1  
ATOM 1579  C CG   . GLN A 1 105 ? 13.871  0.952   -4.950  1.00 0.00 ? 105 GLN A CG   1  
ATOM 1580  C CD   . GLN A 1 105 ? 14.097  1.503   -6.359  1.00 0.00 ? 105 GLN A CD   1  
ATOM 1581  O OE1  . GLN A 1 105 ? 15.036  2.236   -6.623  1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1582  N NE2  . GLN A 1 105 ? 13.187  1.111   -7.246  1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1583  H H    . GLN A 1 105 ? 11.795  1.623   -1.677  1.00 0.00 ? 105 GLN A H    1  
ATOM 1584  H HA   . GLN A 1 105 ? 14.517  1.039   -2.532  1.00 0.00 ? 105 GLN A HA   1  
ATOM 1585  H HB2  . GLN A 1 105 ? 12.243  2.105   -4.128  1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1586  H HB3  . GLN A 1 105 ? 13.737  3.005   -4.302  1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1587  H HG2  . GLN A 1 105 ? 14.808  0.563   -4.552  1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1588  H HG3  . GLN A 1 105 ? 13.171  0.117   -4.990  1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1589  H HE21 . GLN A 1 105 ? 12.441  0.508   -6.964  1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1590  H HE22 . GLN A 1 105 ? 13.250  1.418   -8.196  1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1591  N N    . LEU A 1 106 ? 15.140  3.622   -2.231  1.00 0.00 ? 106 LEU A N    1  
ATOM 1592  C CA   . LEU A 1 106 ? 15.605  4.850   -1.608  1.00 0.00 ? 106 LEU A CA   1  
ATOM 1593  C C    . LEU A 1 106 ? 16.597  5.547   -2.542  1.00 0.00 ? 106 LEU A C    1  
ATOM 1594  O O    . LEU A 1 106 ? 17.299  4.890   -3.309  1.00 0.00 ? 106 LEU A O    1  
ATOM 1595  C CB   . LEU A 1 106 ? 16.170  4.564   -0.215  1.00 0.00 ? 106 LEU A CB   1  
ATOM 1596  C CG   . LEU A 1 106 ? 15.501  5.304   0.945   1.00 0.00 ? 106 LEU A CG   1  
ATOM 1597  C CD1  . LEU A 1 106 ? 15.823  4.633   2.282   1.00 0.00 ? 106 LEU A CD1  1  
ATOM 1598  C CD2  . LEU A 1 106 ? 15.881  6.786   0.941   1.00 0.00 ? 106 LEU A CD2  1  
ATOM 1599  H H    . LEU A 1 106 ? 15.708  3.289   -2.984  1.00 0.00 ? 106 LEU A H    1  
ATOM 1600  H HA   . LEU A 1 106 ? 14.739  5.498   -1.478  1.00 0.00 ? 106 LEU A HA   1  
ATOM 1601  H HB2  . LEU A 1 106 ? 16.096  3.492   -0.028  1.00 0.00 ? 106 LEU A HB2  1  
ATOM 1602  H HB3  . LEU A 1 106 ? 17.231  4.814   -0.217  1.00 0.00 ? 106 LEU A HB3  1  
ATOM 1603  H HG   . LEU A 1 106 ? 14.421  5.248   0.808   1.00 0.00 ? 106 LEU A HG   1  
ATOM 1604  H HD11 . LEU A 1 106 ? 15.285  3.688   2.353   1.00 0.00 ? 106 LEU A HD11 1  
ATOM 1605  H HD12 . LEU A 1 106 ? 16.895  4.446   2.345   1.00 0.00 ? 106 LEU A HD12 1  
ATOM 1606  H HD13 . LEU A 1 106 ? 15.519  5.287   3.099   1.00 0.00 ? 106 LEU A HD13 1  
ATOM 1607  H HD21 . LEU A 1 106 ? 15.478  7.262   0.047   1.00 0.00 ? 106 LEU A HD21 1  
ATOM 1608  H HD22 . LEU A 1 106 ? 15.467  7.269   1.827   1.00 0.00 ? 106 LEU A HD22 1  
ATOM 1609  H HD23 . LEU A 1 106 ? 16.966  6.883   0.947   1.00 0.00 ? 106 LEU A HD23 1  
ATOM 1610  N N    . SER A 1 107 ? 16.622  6.868   -2.447  1.00 0.00 ? 107 SER A N    1  
ATOM 1611  C CA   . SER A 1 107 ? 17.515  7.661   -3.274  1.00 0.00 ? 107 SER A CA   1  
ATOM 1612  C C    . SER A 1 107 ? 17.768  9.020   -2.617  1.00 0.00 ? 107 SER A C    1  
ATOM 1613  O O    . SER A 1 107 ? 16.983  9.465   -1.782  1.00 0.00 ? 107 SER A O    1  
ATOM 1614  C CB   . SER A 1 107 ? 16.942  7.850   -4.680  1.00 0.00 ? 107 SER A CB   1  
ATOM 1615  O OG   . SER A 1 107 ? 17.963  8.093   -5.644  1.00 0.00 ? 107 SER A OG   1  
ATOM 1616  H H    . SER A 1 107 ? 16.047  7.395   -1.821  1.00 0.00 ? 107 SER A H    1  
ATOM 1617  H HA   . SER A 1 107 ? 18.440  7.087   -3.333  1.00 0.00 ? 107 SER A HA   1  
ATOM 1618  H HB2  . SER A 1 107 ? 16.379  6.961   -4.964  1.00 0.00 ? 107 SER A HB2  1  
ATOM 1619  H HB3  . SER A 1 107 ? 16.240  8.684   -4.677  1.00 0.00 ? 107 SER A HB3  1  
ATOM 1620  H HG   . SER A 1 107 ? 18.233  9.056   -5.621  1.00 0.00 ? 107 SER A HG   1  
ATOM 1621  N N    . SER A 1 108 ? 18.867  9.641   -3.020  1.00 0.00 ? 108 SER A N    1  
ATOM 1622  C CA   . SER A 1 108 ? 19.233  10.939  -2.481  1.00 0.00 ? 108 SER A CA   1  
ATOM 1623  C C    . SER A 1 108 ? 18.849  12.043  -3.469  1.00 0.00 ? 108 SER A C    1  
ATOM 1624  O O    . SER A 1 108 ? 18.812  11.814  -4.677  1.00 0.00 ? 108 SER A O    1  
ATOM 1625  C CB   . SER A 1 108 ? 20.729  11.004  -2.168  1.00 0.00 ? 108 SER A CB   1  
ATOM 1626  O OG   . SER A 1 108 ? 20.978  11.128  -0.771  1.00 0.00 ? 108 SER A OG   1  
ATOM 1627  H H    . SER A 1 108 ? 19.500  9.271   -3.700  1.00 0.00 ? 108 SER A H    1  
ATOM 1628  H HA   . SER A 1 108 ? 18.665  11.039  -1.557  1.00 0.00 ? 108 SER A HA   1  
ATOM 1629  H HB2  . SER A 1 108 ? 21.218  10.105  -2.545  1.00 0.00 ? 108 SER A HB2  1  
ATOM 1630  H HB3  . SER A 1 108 ? 21.173  11.851  -2.692  1.00 0.00 ? 108 SER A HB3  1  
ATOM 1631  H HG   . SER A 1 108 ? 20.910  12.087  -0.495  1.00 0.00 ? 108 SER A HG   1  
ATOM 1632  N N    . HIS A 1 109 ? 18.573  13.216  -2.918  1.00 0.00 ? 109 HIS A N    1  
ATOM 1633  C CA   . HIS A 1 109 ? 18.193  14.355  -3.736  1.00 0.00 ? 109 HIS A CA   1  
ATOM 1634  C C    . HIS A 1 109 ? 19.395  14.818  -4.562  1.00 0.00 ? 109 HIS A C    1  
ATOM 1635  O O    . HIS A 1 109 ? 20.513  14.348  -4.355  1.00 0.00 ? 109 HIS A O    1  
ATOM 1636  C CB   . HIS A 1 109 ? 17.603  15.472  -2.872  1.00 0.00 ? 109 HIS A CB   1  
ATOM 1637  C CG   . HIS A 1 109 ? 16.376  16.123  -3.464  1.00 0.00 ? 109 HIS A CG   1  
ATOM 1638  N ND1  . HIS A 1 109 ? 16.108  17.475  -3.335  1.00 0.00 ? 109 HIS A ND1  1  
ATOM 1639  C CD2  . HIS A 1 109 ? 15.349  15.595  -4.189  1.00 0.00 ? 109 HIS A CD2  1  
ATOM 1640  C CE1  . HIS A 1 109 ? 14.969  17.737  -3.958  1.00 0.00 ? 109 HIS A CE1  1  
ATOM 1641  N NE2  . HIS A 1 109 ? 14.499  16.571  -4.486  1.00 0.00 ? 109 HIS A NE2  1  
ATOM 1642  H H    . HIS A 1 109 ? 18.605  13.393  -1.935  1.00 0.00 ? 109 HIS A H    1  
ATOM 1643  H HA   . HIS A 1 109 ? 17.411  14.009  -4.411  1.00 0.00 ? 109 HIS A HA   1  
ATOM 1644  H HB2  . HIS A 1 109 ? 17.349  15.064  -1.893  1.00 0.00 ? 109 HIS A HB2  1  
ATOM 1645  H HB3  . HIS A 1 109 ? 18.365  16.234  -2.711  1.00 0.00 ? 109 HIS A HB3  1  
ATOM 1646  H HD1  . HIS A 1 109 ? 16.679  18.140  -2.854  1.00 0.00 ? 109 HIS A HD1  1  
ATOM 1647  H HD2  . HIS A 1 109 ? 15.243  14.548  -4.476  1.00 0.00 ? 109 HIS A HD2  1  
ATOM 1648  H HE1  . HIS A 1 109 ? 14.491  18.714  -4.035  1.00 0.00 ? 109 HIS A HE1  1  
ATOM 1649  N N    . SER A 1 110 ? 19.124  15.733  -5.481  1.00 0.00 ? 110 SER A N    1  
ATOM 1650  C CA   . SER A 1 110 ? 20.170  16.264  -6.339  1.00 0.00 ? 110 SER A CA   1  
ATOM 1651  C C    . SER A 1 110 ? 20.955  17.348  -5.597  1.00 0.00 ? 110 SER A C    1  
ATOM 1652  O O    . SER A 1 110 ? 20.426  17.994  -4.694  1.00 0.00 ? 110 SER A O    1  
ATOM 1653  C CB   . SER A 1 110 ? 19.585  16.826  -7.636  1.00 0.00 ? 110 SER A CB   1  
ATOM 1654  O OG   . SER A 1 110 ? 20.497  17.697  -8.300  1.00 0.00 ? 110 SER A OG   1  
ATOM 1655  H H    . SER A 1 110 ? 18.212  16.110  -5.643  1.00 0.00 ? 110 SER A H    1  
ATOM 1656  H HA   . SER A 1 110 ? 20.813  15.415  -6.569  1.00 0.00 ? 110 SER A HA   1  
ATOM 1657  H HB2  . SER A 1 110 ? 19.320  16.004  -8.301  1.00 0.00 ? 110 SER A HB2  1  
ATOM 1658  H HB3  . SER A 1 110 ? 18.664  17.366  -7.415  1.00 0.00 ? 110 SER A HB3  1  
ATOM 1659  H HG   . SER A 1 110 ? 20.765  17.305  -9.180  1.00 0.00 ? 110 SER A HG   1  
ATOM 1660  N N    . ARG A 1 111 ? 22.204  17.514  -6.007  1.00 0.00 ? 111 ARG A N    1  
ATOM 1661  C CA   . ARG A 1 111 ? 23.067  18.509  -5.393  1.00 0.00 ? 111 ARG A CA   1  
ATOM 1662  C C    . ARG A 1 111 ? 22.724  19.905  -5.916  1.00 0.00 ? 111 ARG A C    1  
ATOM 1663  O O    . ARG A 1 111 ? 22.953  20.207  -7.086  1.00 0.00 ? 111 ARG A O    1  
ATOM 1664  C CB   . ARG A 1 111 ? 24.540  18.212  -5.680  1.00 0.00 ? 111 ARG A CB   1  
ATOM 1665  C CG   . ARG A 1 111 ? 25.227  17.609  -4.453  1.00 0.00 ? 111 ARG A CG   1  
ATOM 1666  C CD   . ARG A 1 111 ? 26.750  17.685  -4.585  1.00 0.00 ? 111 ARG A CD   1  
ATOM 1667  N NE   . ARG A 1 111 ? 27.387  16.731  -3.649  1.00 0.00 ? 111 ARG A NE   1  
ATOM 1668  C CZ   . ARG A 1 111 ? 27.558  16.964  -2.341  1.00 0.00 ? 111 ARG A CZ   1  
ATOM 1669  N NH1  . ARG A 1 111 ? 27.141  18.119  -1.805  1.00 0.00 ? 111 ARG A NH1  1  
ATOM 1670  N NH2  . ARG A 1 111 ? 28.146  16.041  -1.567  1.00 0.00 ? 111 ARG A NH2  1  
ATOM 1671  H H    . ARG A 1 111 ? 22.626  16.985  -6.743  1.00 0.00 ? 111 ARG A H    1  
ATOM 1672  H HA   . ARG A 1 111 ? 22.867  18.430  -4.325  1.00 0.00 ? 111 ARG A HA   1  
ATOM 1673  H HB2  . ARG A 1 111 ? 24.619  17.522  -6.521  1.00 0.00 ? 111 ARG A HB2  1  
ATOM 1674  H HB3  . ARG A 1 111 ? 25.050  19.130  -5.972  1.00 0.00 ? 111 ARG A HB3  1  
ATOM 1675  H HG2  . ARG A 1 111 ? 24.909  18.140  -3.556  1.00 0.00 ? 111 ARG A HG2  1  
ATOM 1676  H HG3  . ARG A 1 111 ? 24.920  16.570  -4.334  1.00 0.00 ? 111 ARG A HG3  1  
ATOM 1677  H HD2  . ARG A 1 111 ? 27.046  17.456  -5.608  1.00 0.00 ? 111 ARG A HD2  1  
ATOM 1678  H HD3  . ARG A 1 111 ? 27.091  18.698  -4.373  1.00 0.00 ? 111 ARG A HD3  1  
ATOM 1679  H HE   . ARG A 1 111 ? 27.710  15.859  -4.016  1.00 0.00 ? 111 ARG A HE   1  
ATOM 1680  H HH11 . ARG A 1 111 ? 26.702  18.808  -2.382  1.00 0.00 ? 111 ARG A HH11 1  
ATOM 1681  H HH12 . ARG A 1 111 ? 27.269  18.293  -0.829  1.00 0.00 ? 111 ARG A HH12 1  
ATOM 1682  H HH21 . ARG A 1 111 ? 28.458  15.179  -1.967  1.00 0.00 ? 111 ARG A HH21 1  
ATOM 1683  H HH22 . ARG A 1 111 ? 28.274  16.215  -0.591  1.00 0.00 ? 111 ARG A HH22 1  
ATOM 1684  N N    . SER A 1 112 ? 22.180  20.719  -5.024  1.00 0.00 ? 112 SER A N    1  
ATOM 1685  C CA   . SER A 1 112 ? 21.803  22.076  -5.380  1.00 0.00 ? 112 SER A CA   1  
ATOM 1686  C C    . SER A 1 112 ? 21.275  22.814  -4.148  1.00 0.00 ? 112 SER A C    1  
ATOM 1687  O O    . SER A 1 112 ? 20.936  22.189  -3.144  1.00 0.00 ? 112 SER A O    1  
ATOM 1688  C CB   . SER A 1 112 ? 20.753  22.082  -6.493  1.00 0.00 ? 112 SER A CB   1  
ATOM 1689  O OG   . SER A 1 112 ? 21.329  22.341  -7.770  1.00 0.00 ? 112 SER A OG   1  
ATOM 1690  H H    . SER A 1 112 ? 21.997  20.466  -4.074  1.00 0.00 ? 112 SER A H    1  
ATOM 1691  H HA   . SER A 1 112 ? 22.718  22.544  -5.743  1.00 0.00 ? 112 SER A HA   1  
ATOM 1692  H HB2  . SER A 1 112 ? 20.242  21.119  -6.514  1.00 0.00 ? 112 SER A HB2  1  
ATOM 1693  H HB3  . SER A 1 112 ? 19.998  22.838  -6.275  1.00 0.00 ? 112 SER A HB3  1  
ATOM 1694  H HG   . SER A 1 112 ? 21.964  21.608  -8.014  1.00 0.00 ? 112 SER A HG   1  
ATOM 1695  N N    . GLY A 1 113 ? 21.223  24.133  -4.265  1.00 0.00 ? 113 GLY A N    1  
ATOM 1696  C CA   . GLY A 1 113 ? 20.742  24.962  -3.173  1.00 0.00 ? 113 GLY A CA   1  
ATOM 1697  C C    . GLY A 1 113 ? 19.516  25.772  -3.598  1.00 0.00 ? 113 GLY A C    1  
ATOM 1698  O O    . GLY A 1 113 ? 18.701  25.302  -4.390  1.00 0.00 ? 113 GLY A O    1  
ATOM 1699  H H    . GLY A 1 113 ? 21.501  24.633  -5.085  1.00 0.00 ? 113 GLY A H    1  
ATOM 1700  H HA2  . GLY A 1 113 ? 20.489  24.334  -2.319  1.00 0.00 ? 113 GLY A HA2  1  
ATOM 1701  H HA3  . GLY A 1 113 ? 21.534  25.637  -2.848  1.00 0.00 ? 113 GLY A HA3  1  
ATOM 1702  N N    . PRO A 1 114 ? 19.422  27.009  -3.039  1.00 0.00 ? 114 PRO A N    1  
ATOM 1703  C CA   . PRO A 1 114 ? 18.309  27.889  -3.353  1.00 0.00 ? 114 PRO A CA   1  
ATOM 1704  C C    . PRO A 1 114 ? 18.465  28.494  -4.749  1.00 0.00 ? 114 PRO A C    1  
ATOM 1705  O O    . PRO A 1 114 ? 18.673  29.699  -4.888  1.00 0.00 ? 114 PRO A O    1  
ATOM 1706  C CB   . PRO A 1 114 ? 18.311  28.934  -2.249  1.00 0.00 ? 114 PRO A CB   1  
ATOM 1707  C CG   . PRO A 1 114 ? 19.695  28.876  -1.623  1.00 0.00 ? 114 PRO A CG   1  
ATOM 1708  C CD   . PRO A 1 114 ? 20.369  27.599  -2.098  1.00 0.00 ? 114 PRO A CD   1  
ATOM 1709  H HA   . PRO A 1 114 ? 17.453  27.372  -3.373  1.00 0.00 ? 114 PRO A HA   1  
ATOM 1710  H HB2  . PRO A 1 114 ? 18.105  29.926  -2.650  1.00 0.00 ? 114 PRO A HB2  1  
ATOM 1711  H HB3  . PRO A 1 114 ? 17.539  28.722  -1.509  1.00 0.00 ? 114 PRO A HB3  1  
ATOM 1712  H HG2  . PRO A 1 114 ? 20.282  29.748  -1.913  1.00 0.00 ? 114 PRO A HG2  1  
ATOM 1713  H HG3  . PRO A 1 114 ? 19.623  28.888  -0.535  1.00 0.00 ? 114 PRO A HG3  1  
ATOM 1714  H HD2  . PRO A 1 114 ? 21.324  27.810  -2.577  1.00 0.00 ? 114 PRO A HD2  1  
ATOM 1715  H HD3  . PRO A 1 114 ? 20.572  26.925  -1.265  1.00 0.00 ? 114 PRO A HD3  1  
ATOM 1716  N N    . SER A 1 115 ? 18.359  27.631  -5.749  1.00 0.00 ? 115 SER A N    1  
ATOM 1717  C CA   . SER A 1 115 ? 18.486  28.065  -7.129  1.00 0.00 ? 115 SER A CA   1  
ATOM 1718  C C    . SER A 1 115 ? 17.131  27.973  -7.834  1.00 0.00 ? 115 SER A C    1  
ATOM 1719  O O    . SER A 1 115 ? 16.170  27.449  -7.272  1.00 0.00 ? 115 SER A O    1  
ATOM 1720  C CB   . SER A 1 115 ? 19.530  27.232  -7.875  1.00 0.00 ? 115 SER A CB   1  
ATOM 1721  O OG   . SER A 1 115 ? 19.263  25.835  -7.785  1.00 0.00 ? 115 SER A OG   1  
ATOM 1722  H H    . SER A 1 115 ? 18.190  26.653  -5.627  1.00 0.00 ? 115 SER A H    1  
ATOM 1723  H HA   . SER A 1 115 ? 18.820  29.102  -7.076  1.00 0.00 ? 115 SER A HA   1  
ATOM 1724  H HB2  . SER A 1 115 ? 19.550  27.530  -8.924  1.00 0.00 ? 115 SER A HB2  1  
ATOM 1725  H HB3  . SER A 1 115 ? 20.519  27.439  -7.466  1.00 0.00 ? 115 SER A HB3  1  
ATOM 1726  H HG   . SER A 1 115 ? 20.029  25.368  -7.345  1.00 0.00 ? 115 SER A HG   1  
ATOM 1727  N N    . SER A 1 116 ? 17.097  28.489  -9.053  1.00 0.00 ? 116 SER A N    1  
ATOM 1728  C CA   . SER A 1 116 ? 15.876  28.471  -9.840  1.00 0.00 ? 116 SER A CA   1  
ATOM 1729  C C    . SER A 1 116 ? 14.702  28.972  -8.996  1.00 0.00 ? 116 SER A C    1  
ATOM 1730  O O    . SER A 1 116 ? 13.936  28.175  -8.457  1.00 0.00 ? 116 SER A O    1  
ATOM 1731  C CB   . SER A 1 116 ? 15.585  27.067  -10.374 1.00 0.00 ? 116 SER A CB   1  
ATOM 1732  O OG   . SER A 1 116 ? 16.292  26.798  -11.581 1.00 0.00 ? 116 SER A OG   1  
ATOM 1733  H H    . SER A 1 116 ? 17.884  28.913  -9.503  1.00 0.00 ? 116 SER A H    1  
ATOM 1734  H HA   . SER A 1 116 ? 16.061  29.146  -10.676 1.00 0.00 ? 116 SER A HA   1  
ATOM 1735  H HB2  . SER A 1 116 ? 15.860  26.329  -9.620  1.00 0.00 ? 116 SER A HB2  1  
ATOM 1736  H HB3  . SER A 1 116 ? 14.515  26.960  -10.549 1.00 0.00 ? 116 SER A HB3  1  
ATOM 1737  H HG   . SER A 1 116 ? 16.964  26.073  -11.430 1.00 0.00 ? 116 SER A HG   1  
ATOM 1738  N N    . GLY A 1 117 ? 14.598  30.290  -8.908  1.00 0.00 ? 117 GLY A N    1  
ATOM 1739  C CA   . GLY A 1 117 ? 13.531  30.906  -8.138  1.00 0.00 ? 117 GLY A CA   1  
ATOM 1740  C C    . GLY A 1 117 ? 14.082  31.591  -6.886  1.00 0.00 ? 117 GLY A C    1  
ATOM 1741  O O    . GLY A 1 117 ? 15.293  31.759  -6.749  1.00 0.00 ? 117 GLY A O    1  
ATOM 1742  H H    . GLY A 1 117 ? 15.226  30.931  -9.349  1.00 0.00 ? 117 GLY A H    1  
ATOM 1743  H HA2  . GLY A 1 117 ? 13.008  31.636  -8.756  1.00 0.00 ? 117 GLY A HA2  1  
ATOM 1744  H HA3  . GLY A 1 117 ? 12.801  30.149  -7.852  1.00 0.00 ? 117 GLY A HA3  1  
ATOM 1745  N N    . GLY A 1 1   ? -5.144  -11.915 -12.975 1.00 0.00 ? 1   GLY A N    2  
ATOM 1746  C CA   . GLY A 1 1   ? -5.615  -12.387 -14.267 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1747  C C    . GLY A 1 1   ? -6.876  -11.637 -14.698 1.00 0.00 ? 1   GLY A C    2  
ATOM 1748  O O    . GLY A 1 1   ? -6.792  -10.582 -15.325 1.00 0.00 ? 1   GLY A O    2  
ATOM 1749  H H1   . GLY A 1 1   ? -5.810  -11.385 -12.451 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1750  H HA2  . GLY A 1 1   ? -4.833  -12.252 -15.014 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1751  H HA3  . GLY A 1 1   ? -5.823  -13.456 -14.213 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1752  N N    . SER A 1 2   ? -8.017  -12.211 -14.346 1.00 0.00 ? 2   SER A N    2  
ATOM 1753  C CA   . SER A 1 2   ? -9.295  -11.610 -14.689 1.00 0.00 ? 2   SER A CA   2  
ATOM 1754  C C    . SER A 1 2   ? -10.280 -11.777 -13.530 1.00 0.00 ? 2   SER A C    2  
ATOM 1755  O O    . SER A 1 2   ? -10.954 -12.800 -13.426 1.00 0.00 ? 2   SER A O    2  
ATOM 1756  C CB   . SER A 1 2   ? -9.868  -12.227 -15.966 1.00 0.00 ? 2   SER A CB   2  
ATOM 1757  O OG   . SER A 1 2   ? -10.185 -11.237 -16.941 1.00 0.00 ? 2   SER A OG   2  
ATOM 1758  H H    . SER A 1 2   ? -8.077  -13.069 -13.836 1.00 0.00 ? 2   SER A H    2  
ATOM 1759  H HA   . SER A 1 2   ? -9.080  -10.555 -14.860 1.00 0.00 ? 2   SER A HA   2  
ATOM 1760  H HB2  . SER A 1 2   ? -9.148  -12.930 -16.384 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1761  H HB3  . SER A 1 2   ? -10.766 -12.796 -15.722 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1762  H HG   . SER A 1 2   ? -11.113 -11.378 -17.283 1.00 0.00 ? 2   SER A HG   2  
ATOM 1763  N N    . SER A 1 3   ? -10.331 -10.756 -12.687 1.00 0.00 ? 3   SER A N    2  
ATOM 1764  C CA   . SER A 1 3   ? -11.222 -10.777 -11.540 1.00 0.00 ? 3   SER A CA   2  
ATOM 1765  C C    . SER A 1 3   ? -11.764 -9.371  -11.272 1.00 0.00 ? 3   SER A C    2  
ATOM 1766  O O    . SER A 1 3   ? -11.294 -8.399  -11.861 1.00 0.00 ? 3   SER A O    2  
ATOM 1767  C CB   . SER A 1 3   ? -10.509 -11.316 -10.298 1.00 0.00 ? 3   SER A CB   2  
ATOM 1768  O OG   . SER A 1 3   ? -11.187 -12.438 -9.738  1.00 0.00 ? 3   SER A OG   2  
ATOM 1769  H H    . SER A 1 3   ? -9.779  -9.927  -12.778 1.00 0.00 ? 3   SER A H    2  
ATOM 1770  H HA   . SER A 1 3   ? -12.032 -11.452 -11.815 1.00 0.00 ? 3   SER A HA   2  
ATOM 1771  H HB2  . SER A 1 3   ? -9.490  -11.602 -10.561 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1772  H HB3  . SER A 1 3   ? -10.436 -10.526 -9.550  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1773  H HG   . SER A 1 3   ? -12.162 -12.390 -9.953  1.00 0.00 ? 3   SER A HG   2  
ATOM 1774  N N    . GLY A 1 4   ? -12.744 -9.308  -10.383 1.00 0.00 ? 4   GLY A N    2  
ATOM 1775  C CA   . GLY A 1 4   ? -13.354 -8.038  -10.030 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1776  C C    . GLY A 1 4   ? -13.016 -7.648  -8.590  1.00 0.00 ? 4   GLY A C    2  
ATOM 1777  O O    . GLY A 1 4   ? -11.864 -7.353  -8.277  1.00 0.00 ? 4   GLY A O    2  
ATOM 1778  H H    . GLY A 1 4   ? -13.120 -10.104 -9.908  1.00 0.00 ? 4   GLY A H    2  
ATOM 1779  H HA2  . GLY A 1 4   ? -13.007 -7.262  -10.712 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1780  H HA3  . GLY A 1 4   ? -14.436 -8.105  -10.148 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1781  N N    . SER A 1 5   ? -14.041 -7.660  -7.751  1.00 0.00 ? 5   SER A N    2  
ATOM 1782  C CA   . SER A 1 5   ? -13.867 -7.312  -6.351  1.00 0.00 ? 5   SER A CA   2  
ATOM 1783  C C    . SER A 1 5   ? -14.860 -8.095  -5.489  1.00 0.00 ? 5   SER A C    2  
ATOM 1784  O O    . SER A 1 5   ? -16.048 -8.153  -5.802  1.00 0.00 ? 5   SER A O    2  
ATOM 1785  C CB   . SER A 1 5   ? -14.045 -5.808  -6.131  1.00 0.00 ? 5   SER A CB   2  
ATOM 1786  O OG   . SER A 1 5   ? -15.308 -5.345  -6.602  1.00 0.00 ? 5   SER A OG   2  
ATOM 1787  H H    . SER A 1 5   ? -14.976 -7.902  -8.013  1.00 0.00 ? 5   SER A H    2  
ATOM 1788  H HA   . SER A 1 5   ? -12.843 -7.595  -6.108  1.00 0.00 ? 5   SER A HA   2  
ATOM 1789  H HB2  . SER A 1 5   ? -13.949 -5.583  -5.069  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1790  H HB3  . SER A 1 5   ? -13.248 -5.270  -6.644  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1791  H HG   . SER A 1 5   ? -16.009 -6.040  -6.440  1.00 0.00 ? 5   SER A HG   2  
ATOM 1792  N N    . SER A 1 6   ? -14.336 -8.678  -4.421  1.00 0.00 ? 6   SER A N    2  
ATOM 1793  C CA   . SER A 1 6   ? -15.161 -9.455  -3.512  1.00 0.00 ? 6   SER A CA   2  
ATOM 1794  C C    . SER A 1 6   ? -15.195 -8.788  -2.136  1.00 0.00 ? 6   SER A C    2  
ATOM 1795  O O    . SER A 1 6   ? -14.382 -7.911  -1.847  1.00 0.00 ? 6   SER A O    2  
ATOM 1796  C CB   . SER A 1 6   ? -14.647 -10.891 -3.393  1.00 0.00 ? 6   SER A CB   2  
ATOM 1797  O OG   . SER A 1 6   ? -14.453 -11.496 -4.668  1.00 0.00 ? 6   SER A OG   2  
ATOM 1798  H H    . SER A 1 6   ? -13.368 -8.626  -4.174  1.00 0.00 ? 6   SER A H    2  
ATOM 1799  H HA   . SER A 1 6   ? -16.155 -9.462  -3.959  1.00 0.00 ? 6   SER A HA   2  
ATOM 1800  H HB2  . SER A 1 6   ? -13.706 -10.895 -2.843  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1801  H HB3  . SER A 1 6   ? -15.356 -11.484 -2.815  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1802  H HG   . SER A 1 6   ? -13.789 -10.970 -5.199  1.00 0.00 ? 6   SER A HG   2  
ATOM 1803  N N    . GLY A 1 7   ? -16.144 -9.228  -1.323  1.00 0.00 ? 7   GLY A N    2  
ATOM 1804  C CA   . GLY A 1 7   ? -16.295 -8.685  0.016   1.00 0.00 ? 7   GLY A CA   2  
ATOM 1805  C C    . GLY A 1 7   ? -15.737 -9.649  1.065   1.00 0.00 ? 7   GLY A C    2  
ATOM 1806  O O    . GLY A 1 7   ? -15.619 -10.847 0.812   1.00 0.00 ? 7   GLY A O    2  
ATOM 1807  H H    . GLY A 1 7   ? -16.801 -9.942  -1.566  1.00 0.00 ? 7   GLY A H    2  
ATOM 1808  H HA2  . GLY A 1 7   ? -15.776 -7.728  0.084   1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1809  H HA3  . GLY A 1 7   ? -17.348 -8.491  0.217   1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1810  N N    . GLY A 1 8   ? -15.410 -9.090  2.221   1.00 0.00 ? 8   GLY A N    2  
ATOM 1811  C CA   . GLY A 1 8   ? -14.869 -9.886  3.310   1.00 0.00 ? 8   GLY A CA   2  
ATOM 1812  C C    . GLY A 1 8   ? -13.423 -9.487  3.613   1.00 0.00 ? 8   GLY A C    2  
ATOM 1813  O O    . GLY A 1 8   ? -12.504 -9.879  2.897   1.00 0.00 ? 8   GLY A O    2  
ATOM 1814  H H    . GLY A 1 8   ? -15.510 -8.115  2.419   1.00 0.00 ? 8   GLY A H    2  
ATOM 1815  H HA2  . GLY A 1 8   ? -15.481 -9.753  4.202   1.00 0.00 ? 8   GLY A HA2  2  
ATOM 1816  H HA3  . GLY A 1 8   ? -14.911 -10.943 3.049   1.00 0.00 ? 8   GLY A HA3  2  
ATOM 1817  N N    . GLU A 1 9   ? -13.267 -8.713  4.677   1.00 0.00 ? 9   GLU A N    2  
ATOM 1818  C CA   . GLU A 1 9   ? -11.949 -8.257  5.085   1.00 0.00 ? 9   GLU A CA   2  
ATOM 1819  C C    . GLU A 1 9   ? -11.805 -8.340  6.606   1.00 0.00 ? 9   GLU A C    2  
ATOM 1820  O O    . GLU A 1 9   ? -12.586 -7.737  7.340   1.00 0.00 ? 9   GLU A O    2  
ATOM 1821  C CB   . GLU A 1 9   ? -11.682 -6.835  4.586   1.00 0.00 ? 9   GLU A CB   2  
ATOM 1822  C CG   . GLU A 1 9   ? -12.690 -5.848  5.178   1.00 0.00 ? 9   GLU A CG   2  
ATOM 1823  C CD   . GLU A 1 9   ? -12.008 -4.889  6.156   1.00 0.00 ? 9   GLU A CD   2  
ATOM 1824  O OE1  . GLU A 1 9   ? -11.055 -4.211  5.715   1.00 0.00 ? 9   GLU A OE1  2  
ATOM 1825  O OE2  . GLU A 1 9   ? -12.455 -4.857  7.323   1.00 0.00 ? 9   GLU A OE2  2  
ATOM 1826  H H    . GLU A 1 9   ? -14.021 -8.398  5.255   1.00 0.00 ? 9   GLU A H    2  
ATOM 1827  H HA   . GLU A 1 9   ? -11.246 -8.940  4.608   1.00 0.00 ? 9   GLU A HA   2  
ATOM 1828  H HB2  . GLU A 1 9   ? -10.670 -6.535  4.857   1.00 0.00 ? 9   GLU A HB2  2  
ATOM 1829  H HB3  . GLU A 1 9   ? -11.741 -6.811  3.497   1.00 0.00 ? 9   GLU A HB3  2  
ATOM 1830  H HG2  . GLU A 1 9   ? -13.162 -5.280  4.376   1.00 0.00 ? 9   GLU A HG2  2  
ATOM 1831  H HG3  . GLU A 1 9   ? -13.481 -6.394  5.691   1.00 0.00 ? 9   GLU A HG3  2  
ATOM 1832  N N    . ARG A 1 10  ? -10.801 -9.092  7.033   1.00 0.00 ? 10  ARG A N    2  
ATOM 1833  C CA   . ARG A 1 10  ? -10.545 -9.261  8.453   1.00 0.00 ? 10  ARG A CA   2  
ATOM 1834  C C    . ARG A 1 10  ? -9.086  -9.661  8.685   1.00 0.00 ? 10  ARG A C    2  
ATOM 1835  O O    . ARG A 1 10  ? -8.356  -9.936  7.735   1.00 0.00 ? 10  ARG A O    2  
ATOM 1836  C CB   . ARG A 1 10  ? -11.461 -10.329 9.054   1.00 0.00 ? 10  ARG A CB   2  
ATOM 1837  C CG   . ARG A 1 10  ? -12.535 -9.695  9.940   1.00 0.00 ? 10  ARG A CG   2  
ATOM 1838  C CD   . ARG A 1 10  ? -13.604 -10.720 10.324  1.00 0.00 ? 10  ARG A CD   2  
ATOM 1839  N NE   . ARG A 1 10  ? -14.119 -10.430 11.681  1.00 0.00 ? 10  ARG A NE   2  
ATOM 1840  C CZ   . ARG A 1 10  ? -15.157 -11.064 12.242  1.00 0.00 ? 10  ARG A CZ   2  
ATOM 1841  N NH1  . ARG A 1 10  ? -15.797 -12.029 11.567  1.00 0.00 ? 10  ARG A NH1  2  
ATOM 1842  N NH2  . ARG A 1 10  ? -15.556 -10.735 13.478  1.00 0.00 ? 10  ARG A NH2  2  
ATOM 1843  H H    . ARG A 1 10  ? -10.170 -9.578  6.428   1.00 0.00 ? 10  ARG A H    2  
ATOM 1844  H HA   . ARG A 1 10  ? -10.760 -8.288  8.893   1.00 0.00 ? 10  ARG A HA   2  
ATOM 1845  H HB2  . ARG A 1 10  ? -11.934 -10.900 8.255   1.00 0.00 ? 10  ARG A HB2  2  
ATOM 1846  H HB3  . ARG A 1 10  ? -10.869 -11.033 9.640   1.00 0.00 ? 10  ARG A HB3  2  
ATOM 1847  H HG2  . ARG A 1 10  ? -12.075 -9.289  10.841  1.00 0.00 ? 10  ARG A HG2  2  
ATOM 1848  H HG3  . ARG A 1 10  ? -12.998 -8.860  9.415   1.00 0.00 ? 10  ARG A HG3  2  
ATOM 1849  H HD2  . ARG A 1 10  ? -14.421 -10.693 9.603   1.00 0.00 ? 10  ARG A HD2  2  
ATOM 1850  H HD3  . ARG A 1 10  ? -13.184 -11.725 10.293  1.00 0.00 ? 10  ARG A HD3  2  
ATOM 1851  H HE   . ARG A 1 10  ? -13.664 -9.715  12.212  1.00 0.00 ? 10  ARG A HE   2  
ATOM 1852  H HH11 . ARG A 1 10  ? -15.500 -12.275 10.644  1.00 0.00 ? 10  ARG A HH11 2  
ATOM 1853  H HH12 . ARG A 1 10  ? -16.572 -12.502 11.985  1.00 0.00 ? 10  ARG A HH12 2  
ATOM 1854  H HH21 . ARG A 1 10  ? -15.078 -10.015 13.982  1.00 0.00 ? 10  ARG A HH21 2  
ATOM 1855  H HH22 . ARG A 1 10  ? -16.330 -11.208 13.897  1.00 0.00 ? 10  ARG A HH22 2  
ATOM 1856  N N    . ARG A 1 11  ? -8.706  -9.679  9.954   1.00 0.00 ? 11  ARG A N    2  
ATOM 1857  C CA   . ARG A 1 11  ? -7.348  -10.040 10.323  1.00 0.00 ? 11  ARG A CA   2  
ATOM 1858  C C    . ARG A 1 11  ? -7.172  -11.560 10.280  1.00 0.00 ? 11  ARG A C    2  
ATOM 1859  O O    . ARG A 1 11  ? -7.972  -12.297 10.854  1.00 0.00 ? 11  ARG A O    2  
ATOM 1860  C CB   . ARG A 1 11  ? -7.005  -9.534  11.725  1.00 0.00 ? 11  ARG A CB   2  
ATOM 1861  C CG   . ARG A 1 11  ? -6.254  -8.202  11.659  1.00 0.00 ? 11  ARG A CG   2  
ATOM 1862  C CD   . ARG A 1 11  ? -6.338  -7.458  12.993  1.00 0.00 ? 11  ARG A CD   2  
ATOM 1863  N NE   . ARG A 1 11  ? -4.978  -7.224  13.528  1.00 0.00 ? 11  ARG A NE   2  
ATOM 1864  C CZ   . ARG A 1 11  ? -4.054  -6.464  12.924  1.00 0.00 ? 11  ARG A CZ   2  
ATOM 1865  N NH1  . ARG A 1 11  ? -4.337  -5.861  11.762  1.00 0.00 ? 11  ARG A NH1  2  
ATOM 1866  N NH2  . ARG A 1 11  ? -2.846  -6.308  13.482  1.00 0.00 ? 11  ARG A NH2  2  
ATOM 1867  H H    . ARG A 1 11  ? -9.307  -9.454  10.721  1.00 0.00 ? 11  ARG A H    2  
ATOM 1868  H HA   . ARG A 1 11  ? -6.718  -9.552  9.580   1.00 0.00 ? 11  ARG A HA   2  
ATOM 1869  H HB2  . ARG A 1 11  ? -7.919  -9.411  12.305  1.00 0.00 ? 11  ARG A HB2  2  
ATOM 1870  H HB3  . ARG A 1 11  ? -6.395  -10.273 12.244  1.00 0.00 ? 11  ARG A HB3  2  
ATOM 1871  H HG2  . ARG A 1 11  ? -5.210  -8.381  11.403  1.00 0.00 ? 11  ARG A HG2  2  
ATOM 1872  H HG3  . ARG A 1 11  ? -6.675  -7.583  10.866  1.00 0.00 ? 11  ARG A HG3  2  
ATOM 1873  H HD2  . ARG A 1 11  ? -6.853  -6.507  12.857  1.00 0.00 ? 11  ARG A HD2  2  
ATOM 1874  H HD3  . ARG A 1 11  ? -6.923  -8.039  13.706  1.00 0.00 ? 11  ARG A HD3  2  
ATOM 1875  H HE   . ARG A 1 11  ? -4.733  -7.660  14.394  1.00 0.00 ? 11  ARG A HE   2  
ATOM 1876  H HH11 . ARG A 1 11  ? -5.239  -5.978  11.345  1.00 0.00 ? 11  ARG A HH11 2  
ATOM 1877  H HH12 . ARG A 1 11  ? -3.648  -5.294  11.311  1.00 0.00 ? 11  ARG A HH12 2  
ATOM 1878  H HH21 . ARG A 1 11  ? -2.634  -6.758  14.350  1.00 0.00 ? 11  ARG A HH21 2  
ATOM 1879  H HH22 . ARG A 1 11  ? -2.156  -5.741  13.032  1.00 0.00 ? 11  ARG A HH22 2  
ATOM 1880  N N    . LYS A 1 12  ? -6.120  -11.983 9.595   1.00 0.00 ? 12  LYS A N    2  
ATOM 1881  C CA   . LYS A 1 12  ? -5.829  -13.401 9.470   1.00 0.00 ? 12  LYS A CA   2  
ATOM 1882  C C    . LYS A 1 12  ? -4.558  -13.585 8.638   1.00 0.00 ? 12  LYS A C    2  
ATOM 1883  O O    . LYS A 1 12  ? -3.565  -14.122 9.126   1.00 0.00 ? 12  LYS A O    2  
ATOM 1884  C CB   . LYS A 1 12  ? -7.042  -14.149 8.913   1.00 0.00 ? 12  LYS A CB   2  
ATOM 1885  C CG   . LYS A 1 12  ? -7.237  -15.487 9.630   1.00 0.00 ? 12  LYS A CG   2  
ATOM 1886  C CD   . LYS A 1 12  ? -8.722  -15.778 9.853   1.00 0.00 ? 12  LYS A CD   2  
ATOM 1887  C CE   . LYS A 1 12  ? -9.042  -15.882 11.346  1.00 0.00 ? 12  LYS A CE   2  
ATOM 1888  N NZ   . LYS A 1 12  ? -9.343  -14.546 11.906  1.00 0.00 ? 12  LYS A NZ   2  
ATOM 1889  H H    . LYS A 1 12  ? -5.474  -11.376 9.131   1.00 0.00 ? 12  LYS A H    2  
ATOM 1890  H HA   . LYS A 1 12  ? -5.645  -13.786 10.473  1.00 0.00 ? 12  LYS A HA   2  
ATOM 1891  H HB2  . LYS A 1 12  ? -7.937  -13.537 9.029   1.00 0.00 ? 12  LYS A HB2  2  
ATOM 1892  H HB3  . LYS A 1 12  ? -6.910  -14.321 7.845   1.00 0.00 ? 12  LYS A HB3  2  
ATOM 1893  H HG2  . LYS A 1 12  ? -6.790  -16.288 9.041   1.00 0.00 ? 12  LYS A HG2  2  
ATOM 1894  H HG3  . LYS A 1 12  ? -6.718  -15.469 10.588  1.00 0.00 ? 12  LYS A HG3  2  
ATOM 1895  H HD2  . LYS A 1 12  ? -9.323  -14.988 9.403   1.00 0.00 ? 12  LYS A HD2  2  
ATOM 1896  H HD3  . LYS A 1 12  ? -8.993  -16.709 9.354   1.00 0.00 ? 12  LYS A HD3  2  
ATOM 1897  H HE2  . LYS A 1 12  ? -9.894  -16.546 11.496  1.00 0.00 ? 12  LYS A HE2  2  
ATOM 1898  H HE3  . LYS A 1 12  ? -8.197  -16.323 11.875  1.00 0.00 ? 12  LYS A HE3  2  
ATOM 1899  H HZ1  . LYS A 1 12  ? -9.098  -13.842 11.239  1.00 0.00 ? 12  LYS A HZ1  2  
ATOM 1900  H HZ2  . LYS A 1 12  ? -10.319 -14.483 12.113  1.00 0.00 ? 12  LYS A HZ2  2  
ATOM 1901  H HZ3  . LYS A 1 12  ? -8.814  -14.409 12.744  1.00 0.00 ? 12  LYS A HZ3  2  
ATOM 1902  N N    . ASP A 1 13  ? -4.631  -13.129 7.396   1.00 0.00 ? 13  ASP A N    2  
ATOM 1903  C CA   . ASP A 1 13  ? -3.498  -13.237 6.492   1.00 0.00 ? 13  ASP A CA   2  
ATOM 1904  C C    . ASP A 1 13  ? -3.833  -12.531 5.177   1.00 0.00 ? 13  ASP A C    2  
ATOM 1905  O O    . ASP A 1 13  ? -4.991  -12.208 4.918   1.00 0.00 ? 13  ASP A O    2  
ATOM 1906  C CB   . ASP A 1 13  ? -3.183  -14.700 6.177   1.00 0.00 ? 13  ASP A CB   2  
ATOM 1907  C CG   . ASP A 1 13  ? -4.183  -15.392 5.248   1.00 0.00 ? 13  ASP A CG   2  
ATOM 1908  O OD1  . ASP A 1 13  ? -3.987  -15.280 4.019   1.00 0.00 ? 13  ASP A OD1  2  
ATOM 1909  O OD2  . ASP A 1 13  ? -5.121  -16.016 5.789   1.00 0.00 ? 13  ASP A OD2  2  
ATOM 1910  H H    . ASP A 1 13  ? -5.442  -12.693 7.007   1.00 0.00 ? 13  ASP A H    2  
ATOM 1911  H HA   . ASP A 1 13  ? -2.667  -12.767 7.017   1.00 0.00 ? 13  ASP A HA   2  
ATOM 1912  H HB2  . ASP A 1 13  ? -2.193  -14.753 5.724   1.00 0.00 ? 13  ASP A HB2  2  
ATOM 1913  H HB3  . ASP A 1 13  ? -3.135  -15.256 7.113   1.00 0.00 ? 13  ASP A HB3  2  
ATOM 1914  N N    . ARG A 1 14  ? -2.797  -12.312 4.379   1.00 0.00 ? 14  ARG A N    2  
ATOM 1915  C CA   . ARG A 1 14  ? -2.967  -11.651 3.097   1.00 0.00 ? 14  ARG A CA   2  
ATOM 1916  C C    . ARG A 1 14  ? -2.979  -12.681 1.966   1.00 0.00 ? 14  ARG A C    2  
ATOM 1917  O O    . ARG A 1 14  ? -2.007  -13.412 1.776   1.00 0.00 ? 14  ARG A O    2  
ATOM 1918  C CB   . ARG A 1 14  ? -1.845  -10.641 2.846   1.00 0.00 ? 14  ARG A CB   2  
ATOM 1919  C CG   . ARG A 1 14  ? -1.796  -9.589  3.956   1.00 0.00 ? 14  ARG A CG   2  
ATOM 1920  C CD   . ARG A 1 14  ? -0.546  -9.764  4.821   1.00 0.00 ? 14  ARG A CD   2  
ATOM 1921  N NE   . ARG A 1 14  ? 0.662   -9.785  3.967   1.00 0.00 ? 14  ARG A NE   2  
ATOM 1922  C CZ   . ARG A 1 14  ? 1.913   -9.878  4.438   1.00 0.00 ? 14  ARG A CZ   2  
ATOM 1923  N NH1  . ARG A 1 14  ? 2.128   -9.959  5.758   1.00 0.00 ? 14  ARG A NH1  2  
ATOM 1924  N NH2  . ARG A 1 14  ? 2.949   -9.890  3.588   1.00 0.00 ? 14  ARG A NH2  2  
ATOM 1925  H H    . ARG A 1 14  ? -1.858  -12.579 4.597   1.00 0.00 ? 14  ARG A H    2  
ATOM 1926  H HA   . ARG A 1 14  ? -3.926  -11.139 3.172   1.00 0.00 ? 14  ARG A HA   2  
ATOM 1927  H HB2  . ARG A 1 14  ? -0.889  -11.161 2.789   1.00 0.00 ? 14  ARG A HB2  2  
ATOM 1928  H HB3  . ARG A 1 14  ? -2.000  -10.152 1.884   1.00 0.00 ? 14  ARG A HB3  2  
ATOM 1929  H HG2  . ARG A 1 14  ? -1.802  -8.591  3.517   1.00 0.00 ? 14  ARG A HG2  2  
ATOM 1930  H HG3  . ARG A 1 14  ? -2.687  -9.670  4.578   1.00 0.00 ? 14  ARG A HG3  2  
ATOM 1931  H HD2  . ARG A 1 14  ? -0.477  -8.950  5.543   1.00 0.00 ? 14  ARG A HD2  2  
ATOM 1932  H HD3  . ARG A 1 14  ? -0.615  -10.690 5.391   1.00 0.00 ? 14  ARG A HD3  2  
ATOM 1933  H HE   . ARG A 1 14  ? 0.537   -9.726  2.977   1.00 0.00 ? 14  ARG A HE   2  
ATOM 1934  H HH11 . ARG A 1 14  ? 1.355   -9.950  6.392   1.00 0.00 ? 14  ARG A HH11 2  
ATOM 1935  H HH12 . ARG A 1 14  ? 3.062   -10.028 6.109   1.00 0.00 ? 14  ARG A HH12 2  
ATOM 1936  H HH21 . ARG A 1 14  ? 2.789   -9.829  2.603   1.00 0.00 ? 14  ARG A HH21 2  
ATOM 1937  H HH22 . ARG A 1 14  ? 3.883   -9.959  3.939   1.00 0.00 ? 14  ARG A HH22 2  
ATOM 1938  N N    . PRO A 1 15  ? -4.118  -12.707 1.224   1.00 0.00 ? 15  PRO A N    2  
ATOM 1939  C CA   . PRO A 1 15  ? -4.269  -13.636 0.116   1.00 0.00 ? 15  PRO A CA   2  
ATOM 1940  C C    . PRO A 1 15  ? -3.451  -13.183 -1.094  1.00 0.00 ? 15  PRO A C    2  
ATOM 1941  O O    . PRO A 1 15  ? -3.199  -13.968 -2.007  1.00 0.00 ? 15  PRO A O    2  
ATOM 1942  C CB   . PRO A 1 15  ? -5.763  -13.679 -0.160  1.00 0.00 ? 15  PRO A CB   2  
ATOM 1943  C CG   . PRO A 1 15  ? -6.343  -12.431 0.487   1.00 0.00 ? 15  PRO A CG   2  
ATOM 1944  C CD   . PRO A 1 15  ? -5.289  -11.857 1.419   1.00 0.00 ? 15  PRO A CD   2  
ATOM 1945  H HA   . PRO A 1 15  ? -3.912  -14.535 0.367   1.00 0.00 ? 15  PRO A HA   2  
ATOM 1946  H HB2  . PRO A 1 15  ? -5.962  -13.692 -1.231  1.00 0.00 ? 15  PRO A HB2  2  
ATOM 1947  H HB3  . PRO A 1 15  ? -6.212  -14.580 0.258   1.00 0.00 ? 15  PRO A HB3  2  
ATOM 1948  H HG2  . PRO A 1 15  ? -6.620  -11.701 -0.273  1.00 0.00 ? 15  PRO A HG2  2  
ATOM 1949  H HG3  . PRO A 1 15  ? -7.250  -12.675 1.041   1.00 0.00 ? 15  PRO A HG3  2  
ATOM 1950  H HD2  . PRO A 1 15  ? -5.068  -10.817 1.175   1.00 0.00 ? 15  PRO A HD2  2  
ATOM 1951  H HD3  . PRO A 1 15  ? -5.624  -11.876 2.456   1.00 0.00 ? 15  PRO A HD3  2  
ATOM 1952  N N    . TYR A 1 16  ? -3.057  -11.918 -1.063  1.00 0.00 ? 16  TYR A N    2  
ATOM 1953  C CA   . TYR A 1 16  ? -2.272  -11.351 -2.146  1.00 0.00 ? 16  TYR A CA   2  
ATOM 1954  C C    . TYR A 1 16  ? -1.548  -10.082 -1.693  1.00 0.00 ? 16  TYR A C    2  
ATOM 1955  O O    . TYR A 1 16  ? -0.377  -9.882  -2.015  1.00 0.00 ? 16  TYR A O    2  
ATOM 1956  C CB   . TYR A 1 16  ? -3.271  -10.988 -3.246  1.00 0.00 ? 16  TYR A CB   2  
ATOM 1957  C CG   . TYR A 1 16  ? -4.446  -10.136 -2.763  1.00 0.00 ? 16  TYR A CG   2  
ATOM 1958  C CD1  . TYR A 1 16  ? -5.588  -10.744 -2.282  1.00 0.00 ? 16  TYR A CD1  2  
ATOM 1959  C CD2  . TYR A 1 16  ? -4.364  -8.759  -2.808  1.00 0.00 ? 16  TYR A CD2  2  
ATOM 1960  C CE1  . TYR A 1 16  ? -6.694  -9.942  -1.827  1.00 0.00 ? 16  TYR A CE1  2  
ATOM 1961  C CE2  . TYR A 1 16  ? -5.470  -7.957  -2.353  1.00 0.00 ? 16  TYR A CE2  2  
ATOM 1962  C CZ   . TYR A 1 16  ? -6.581  -8.588  -1.885  1.00 0.00 ? 16  TYR A CZ   2  
ATOM 1963  O OH   . TYR A 1 16  ? -7.625  -7.830  -1.455  1.00 0.00 ? 16  TYR A OH   2  
ATOM 1964  H H    . TYR A 1 16  ? -3.266  -11.286 -0.317  1.00 0.00 ? 16  TYR A H    2  
ATOM 1965  H HA   . TYR A 1 16  ? -1.534  -12.093 -2.450  1.00 0.00 ? 16  TYR A HA   2  
ATOM 1966  H HB2  . TYR A 1 16  ? -2.747  -10.451 -4.037  1.00 0.00 ? 16  TYR A HB2  2  
ATOM 1967  H HB3  . TYR A 1 16  ? -3.659  -11.906 -3.688  1.00 0.00 ? 16  TYR A HB3  2  
ATOM 1968  H HD1  . TYR A 1 16  ? -5.653  -11.832 -2.246  1.00 0.00 ? 16  TYR A HD1  2  
ATOM 1969  H HD2  . TYR A 1 16  ? -3.463  -8.279  -3.188  1.00 0.00 ? 16  TYR A HD2  2  
ATOM 1970  H HE1  . TYR A 1 16  ? -7.601  -10.409 -1.445  1.00 0.00 ? 16  TYR A HE1  2  
ATOM 1971  H HE2  . TYR A 1 16  ? -5.419  -6.869  -2.383  1.00 0.00 ? 16  TYR A HE2  2  
ATOM 1972  H HH   . TYR A 1 16  ? -8.411  -7.957  -2.060  1.00 0.00 ? 16  TYR A HH   2  
ATOM 1973  N N    . VAL A 1 17  ? -2.273  -9.258  -0.952  1.00 0.00 ? 17  VAL A N    2  
ATOM 1974  C CA   . VAL A 1 17  ? -1.715  -8.013  -0.451  1.00 0.00 ? 17  VAL A CA   2  
ATOM 1975  C C    . VAL A 1 17  ? -2.713  -7.360  0.506   1.00 0.00 ? 17  VAL A C    2  
ATOM 1976  O O    . VAL A 1 17  ? -3.915  -7.606  0.418   1.00 0.00 ? 17  VAL A O    2  
ATOM 1977  C CB   . VAL A 1 17  ? -1.326  -7.106  -1.620  1.00 0.00 ? 17  VAL A CB   2  
ATOM 1978  C CG1  . VAL A 1 17  ? -2.472  -6.161  -1.986  1.00 0.00 ? 17  VAL A CG1  2  
ATOM 1979  C CG2  . VAL A 1 17  ? -0.049  -6.324  -1.306  1.00 0.00 ? 17  VAL A CG2  2  
ATOM 1980  H H    . VAL A 1 17  ? -3.224  -9.428  -0.695  1.00 0.00 ? 17  VAL A H    2  
ATOM 1981  H HA   . VAL A 1 17  ? -0.808  -8.259  0.102   1.00 0.00 ? 17  VAL A HA   2  
ATOM 1982  H HB   . VAL A 1 17  ? -1.126  -7.740  -2.484  1.00 0.00 ? 17  VAL A HB   2  
ATOM 1983  H HG11 . VAL A 1 17  ? -2.502  -5.335  -1.275  1.00 0.00 ? 17  VAL A HG11 2  
ATOM 1984  H HG12 . VAL A 1 17  ? -2.314  -5.770  -2.991  1.00 0.00 ? 17  VAL A HG12 2  
ATOM 1985  H HG13 . VAL A 1 17  ? -3.416  -6.704  -1.951  1.00 0.00 ? 17  VAL A HG13 2  
ATOM 1986  H HG21 . VAL A 1 17  ? 0.508   -6.152  -2.228  1.00 0.00 ? 17  VAL A HG21 2  
ATOM 1987  H HG22 . VAL A 1 17  ? -0.310  -5.367  -0.855  1.00 0.00 ? 17  VAL A HG22 2  
ATOM 1988  H HG23 . VAL A 1 17  ? 0.567   -6.897  -0.612  1.00 0.00 ? 17  VAL A HG23 2  
ATOM 1989  N N    . GLU A 1 18  ? -2.178  -6.540  1.399   1.00 0.00 ? 18  GLU A N    2  
ATOM 1990  C CA   . GLU A 1 18  ? -3.008  -5.849  2.372   1.00 0.00 ? 18  GLU A CA   2  
ATOM 1991  C C    . GLU A 1 18  ? -4.184  -5.162  1.674   1.00 0.00 ? 18  GLU A C    2  
ATOM 1992  O O    . GLU A 1 18  ? -4.003  -4.153  0.994   1.00 0.00 ? 18  GLU A O    2  
ATOM 1993  C CB   . GLU A 1 18  ? -2.184  -4.842  3.178   1.00 0.00 ? 18  GLU A CB   2  
ATOM 1994  C CG   . GLU A 1 18  ? -0.883  -5.473  3.677   1.00 0.00 ? 18  GLU A CG   2  
ATOM 1995  C CD   . GLU A 1 18  ? -0.705  -5.245  5.180   1.00 0.00 ? 18  GLU A CD   2  
ATOM 1996  O OE1  . GLU A 1 18  ? -1.697  -5.459  5.908   1.00 0.00 ? 18  GLU A OE1  2  
ATOM 1997  O OE2  . GLU A 1 18  ? 0.421   -4.861  5.565   1.00 0.00 ? 18  GLU A OE2  2  
ATOM 1998  H H    . GLU A 1 18  ? -1.200  -6.345  1.464   1.00 0.00 ? 18  GLU A H    2  
ATOM 1999  H HA   . GLU A 1 18  ? -3.377  -6.626  3.041   1.00 0.00 ? 18  GLU A HA   2  
ATOM 2000  H HB2  . GLU A 1 18  ? -1.958  -3.974  2.559   1.00 0.00 ? 18  GLU A HB2  2  
ATOM 2001  H HB3  . GLU A 1 18  ? -2.769  -4.485  4.026   1.00 0.00 ? 18  GLU A HB3  2  
ATOM 2002  H HG2  . GLU A 1 18  ? -0.889  -6.543  3.467   1.00 0.00 ? 18  GLU A HG2  2  
ATOM 2003  H HG3  . GLU A 1 18  ? -0.038  -5.047  3.138   1.00 0.00 ? 18  GLU A HG3  2  
ATOM 2004  N N    . GLU A 1 19  ? -5.362  -5.736  1.867   1.00 0.00 ? 19  GLU A N    2  
ATOM 2005  C CA   . GLU A 1 19  ? -6.567  -5.192  1.265   1.00 0.00 ? 19  GLU A CA   2  
ATOM 2006  C C    . GLU A 1 19  ? -6.540  -3.663  1.312   1.00 0.00 ? 19  GLU A C    2  
ATOM 2007  O O    . GLU A 1 19  ? -5.901  -3.076  2.184   1.00 0.00 ? 19  GLU A O    2  
ATOM 2008  C CB   . GLU A 1 19  ? -7.819  -5.739  1.953   1.00 0.00 ? 19  GLU A CB   2  
ATOM 2009  C CG   . GLU A 1 19  ? -7.909  -5.247  3.399   1.00 0.00 ? 19  GLU A CG   2  
ATOM 2010  C CD   . GLU A 1 19  ? -7.287  -6.261  4.363   1.00 0.00 ? 19  GLU A CD   2  
ATOM 2011  O OE1  . GLU A 1 19  ? -6.092  -6.570  4.167   1.00 0.00 ? 19  GLU A OE1  2  
ATOM 2012  O OE2  . GLU A 1 19  ? -8.021  -6.704  5.272   1.00 0.00 ? 19  GLU A OE2  2  
ATOM 2013  H H    . GLU A 1 19  ? -5.500  -6.557  2.422   1.00 0.00 ? 19  GLU A H    2  
ATOM 2014  H HA   . GLU A 1 19  ? -6.552  -5.531  0.229   1.00 0.00 ? 19  GLU A HA   2  
ATOM 2015  H HB2  . GLU A 1 19  ? -8.707  -5.426  1.403   1.00 0.00 ? 19  GLU A HB2  2  
ATOM 2016  H HB3  . GLU A 1 19  ? -7.801  -6.829  1.936   1.00 0.00 ? 19  GLU A HB3  2  
ATOM 2017  H HG2  . GLU A 1 19  ? -7.398  -4.289  3.494   1.00 0.00 ? 19  GLU A HG2  2  
ATOM 2018  H HG3  . GLU A 1 19  ? -8.953  -5.080  3.666   1.00 0.00 ? 19  GLU A HG3  2  
ATOM 2019  N N    . PRO A 1 20  ? -7.259  -3.045  0.337   1.00 0.00 ? 20  PRO A N    2  
ATOM 2020  C CA   . PRO A 1 20  ? -7.324  -1.595  0.259   1.00 0.00 ? 20  PRO A CA   2  
ATOM 2021  C C    . PRO A 1 20  ? -8.241  -1.028  1.344   1.00 0.00 ? 20  PRO A C    2  
ATOM 2022  O O    . PRO A 1 20  ? -9.241  -1.647  1.702   1.00 0.00 ? 20  PRO A O    2  
ATOM 2023  C CB   . PRO A 1 20  ? -7.814  -1.299  -1.149  1.00 0.00 ? 20  PRO A CB   2  
ATOM 2024  C CG   . PRO A 1 20  ? -8.448  -2.587  -1.650  1.00 0.00 ? 20  PRO A CG   2  
ATOM 2025  C CD   . PRO A 1 20  ? -8.028  -3.707  -0.713  1.00 0.00 ? 20  PRO A CD   2  
ATOM 2026  H HA   . PRO A 1 20  ? -6.421  -1.198  0.428   1.00 0.00 ? 20  PRO A HA   2  
ATOM 2027  H HB2  . PRO A 1 20  ? -8.537  -0.483  -1.147  1.00 0.00 ? 20  PRO A HB2  2  
ATOM 2028  H HB3  . PRO A 1 20  ? -6.990  -0.993  -1.794  1.00 0.00 ? 20  PRO A HB3  2  
ATOM 2029  H HG2  . PRO A 1 20  ? -9.534  -2.494  -1.672  1.00 0.00 ? 20  PRO A HG2  2  
ATOM 2030  H HG3  . PRO A 1 20  ? -8.125  -2.800  -2.669  1.00 0.00 ? 20  PRO A HG3  2  
ATOM 2031  H HD2  . PRO A 1 20  ? -8.895  -4.225  -0.302  1.00 0.00 ? 20  PRO A HD2  2  
ATOM 2032  H HD3  . PRO A 1 20  ? -7.428  -4.454  -1.232  1.00 0.00 ? 20  PRO A HD3  2  
ATOM 2033  N N    . ARG A 1 21  ? -7.867  0.144   1.836   1.00 0.00 ? 21  ARG A N    2  
ATOM 2034  C CA   . ARG A 1 21  ? -8.644  0.802   2.873   1.00 0.00 ? 21  ARG A CA   2  
ATOM 2035  C C    . ARG A 1 21  ? -9.019  2.220   2.436   1.00 0.00 ? 21  ARG A C    2  
ATOM 2036  O O    . ARG A 1 21  ? -8.540  2.705   1.412   1.00 0.00 ? 21  ARG A O    2  
ATOM 2037  C CB   . ARG A 1 21  ? -7.862  0.871   4.186   1.00 0.00 ? 21  ARG A CB   2  
ATOM 2038  C CG   . ARG A 1 21  ? -6.759  1.929   4.114   1.00 0.00 ? 21  ARG A CG   2  
ATOM 2039  C CD   . ARG A 1 21  ? -5.732  1.728   5.230   1.00 0.00 ? 21  ARG A CD   2  
ATOM 2040  N NE   . ARG A 1 21  ? -6.073  2.580   6.391   1.00 0.00 ? 21  ARG A NE   2  
ATOM 2041  C CZ   . ARG A 1 21  ? -5.314  2.693   7.489   1.00 0.00 ? 21  ARG A CZ   2  
ATOM 2042  N NH1  . ARG A 1 21  ? -4.166  2.007   7.583   1.00 0.00 ? 21  ARG A NH1  2  
ATOM 2043  N NH2  . ARG A 1 21  ? -5.702  3.490   8.493   1.00 0.00 ? 21  ARG A NH2  2  
ATOM 2044  H H    . ARG A 1 21  ? -7.052  0.641   1.538   1.00 0.00 ? 21  ARG A H    2  
ATOM 2045  H HA   . ARG A 1 21  ? -9.531  0.181   2.993   1.00 0.00 ? 21  ARG A HA   2  
ATOM 2046  H HB2  . ARG A 1 21  ? -8.542  1.105   5.006   1.00 0.00 ? 21  ARG A HB2  2  
ATOM 2047  H HB3  . ARG A 1 21  ? -7.423  -0.103  4.404   1.00 0.00 ? 21  ARG A HB3  2  
ATOM 2048  H HG2  . ARG A 1 21  ? -6.263  1.876   3.144   1.00 0.00 ? 21  ARG A HG2  2  
ATOM 2049  H HG3  . ARG A 1 21  ? -7.199  2.923   4.193   1.00 0.00 ? 21  ARG A HG3  2  
ATOM 2050  H HD2  . ARG A 1 21  ? -5.711  0.681   5.531   1.00 0.00 ? 21  ARG A HD2  2  
ATOM 2051  H HD3  . ARG A 1 21  ? -4.735  1.976   4.866   1.00 0.00 ? 21  ARG A HD3  2  
ATOM 2052  H HE   . ARG A 1 21  ? -6.923  3.106   6.353   1.00 0.00 ? 21  ARG A HE   2  
ATOM 2053  H HH11 . ARG A 1 21  ? -3.876  1.412   6.833   1.00 0.00 ? 21  ARG A HH11 2  
ATOM 2054  H HH12 . ARG A 1 21  ? -3.599  2.091   8.403   1.00 0.00 ? 21  ARG A HH12 2  
ATOM 2055  H HH21 . ARG A 1 21  ? -6.558  4.002   8.423   1.00 0.00 ? 21  ARG A HH21 2  
ATOM 2056  H HH22 . ARG A 1 21  ? -5.135  3.574   9.313   1.00 0.00 ? 21  ARG A HH22 2  
ATOM 2057  N N    . HIS A 1 22  ? -9.872  2.845   3.234   1.00 0.00 ? 22  HIS A N    2  
ATOM 2058  C CA   . HIS A 1 22  ? -10.317 4.197   2.943   1.00 0.00 ? 22  HIS A CA   2  
ATOM 2059  C C    . HIS A 1 22  ? -9.945  5.121   4.104   1.00 0.00 ? 22  HIS A C    2  
ATOM 2060  O O    . HIS A 1 22  ? -10.610 5.123   5.138   1.00 0.00 ? 22  HIS A O    2  
ATOM 2061  C CB   . HIS A 1 22  ? -11.813 4.220   2.623   1.00 0.00 ? 22  HIS A CB   2  
ATOM 2062  C CG   . HIS A 1 22  ? -12.223 3.255   1.536   1.00 0.00 ? 22  HIS A CG   2  
ATOM 2063  N ND1  . HIS A 1 22  ? -11.823 1.930   1.519   1.00 0.00 ? 22  HIS A ND1  2  
ATOM 2064  C CD2  . HIS A 1 22  ? -13.001 3.437   0.430   1.00 0.00 ? 22  HIS A CD2  2  
ATOM 2065  C CE1  . HIS A 1 22  ? -12.342 1.350   0.447   1.00 0.00 ? 22  HIS A CE1  2  
ATOM 2066  N NE2  . HIS A 1 22  ? -13.072 2.286   -0.227  1.00 0.00 ? 22  HIS A NE2  2  
ATOM 2067  H H    . HIS A 1 22  ? -10.256 2.443   4.065   1.00 0.00 ? 22  HIS A H    2  
ATOM 2068  H HA   . HIS A 1 22  ? -9.781  4.517   2.049   1.00 0.00 ? 22  HIS A HA   2  
ATOM 2069  H HB2  . HIS A 1 22  ? -12.371 3.988   3.530   1.00 0.00 ? 22  HIS A HB2  2  
ATOM 2070  H HB3  . HIS A 1 22  ? -12.094 5.229   2.324   1.00 0.00 ? 22  HIS A HB3  2  
ATOM 2071  H HD1  . HIS A 1 22  ? -11.240 1.486   2.200   1.00 0.00 ? 22  HIS A HD1  2  
ATOM 2072  H HD2  . HIS A 1 22  ? -13.484 4.369   0.137   1.00 0.00 ? 22  HIS A HD2  2  
ATOM 2073  H HE1  . HIS A 1 22  ? -12.210 0.309   0.154   1.00 0.00 ? 22  HIS A HE1  2  
ATOM 2074  N N    . VAL A 1 23  ? -8.882  5.884   3.894   1.00 0.00 ? 23  VAL A N    2  
ATOM 2075  C CA   . VAL A 1 23  ? -8.414  6.811   4.910   1.00 0.00 ? 23  VAL A CA   2  
ATOM 2076  C C    . VAL A 1 23  ? -9.104  8.163   4.719   1.00 0.00 ? 23  VAL A C    2  
ATOM 2077  O O    . VAL A 1 23  ? -8.984  8.781   3.662   1.00 0.00 ? 23  VAL A O    2  
ATOM 2078  C CB   . VAL A 1 23  ? -6.887  6.907   4.867   1.00 0.00 ? 23  VAL A CB   2  
ATOM 2079  C CG1  . VAL A 1 23  ? -6.381  8.012   5.797   1.00 0.00 ? 23  VAL A CG1  2  
ATOM 2080  C CG2  . VAL A 1 23  ? -6.243  5.563   5.211   1.00 0.00 ? 23  VAL A CG2  2  
ATOM 2081  H H    . VAL A 1 23  ? -8.346  5.876   3.050   1.00 0.00 ? 23  VAL A H    2  
ATOM 2082  H HA   . VAL A 1 23  ? -8.699  6.405   5.881   1.00 0.00 ? 23  VAL A HA   2  
ATOM 2083  H HB   . VAL A 1 23  ? -6.597  7.167   3.849   1.00 0.00 ? 23  VAL A HB   2  
ATOM 2084  H HG11 . VAL A 1 23  ? -5.385  7.755   6.158   1.00 0.00 ? 23  VAL A HG11 2  
ATOM 2085  H HG12 . VAL A 1 23  ? -6.337  8.954   5.251   1.00 0.00 ? 23  VAL A HG12 2  
ATOM 2086  H HG13 . VAL A 1 23  ? -7.060  8.113   6.644   1.00 0.00 ? 23  VAL A HG13 2  
ATOM 2087  H HG21 . VAL A 1 23  ? -6.180  4.949   4.312   1.00 0.00 ? 23  VAL A HG21 2  
ATOM 2088  H HG22 . VAL A 1 23  ? -5.241  5.731   5.607   1.00 0.00 ? 23  VAL A HG22 2  
ATOM 2089  H HG23 . VAL A 1 23  ? -6.848  5.050   5.959   1.00 0.00 ? 23  VAL A HG23 2  
ATOM 2090  N N    . LYS A 1 24  ? -9.811  8.582   5.758   1.00 0.00 ? 24  LYS A N    2  
ATOM 2091  C CA   . LYS A 1 24  ? -10.520 9.850   5.717   1.00 0.00 ? 24  LYS A CA   2  
ATOM 2092  C C    . LYS A 1 24  ? -9.550  10.983  6.056   1.00 0.00 ? 24  LYS A C    2  
ATOM 2093  O O    . LYS A 1 24  ? -8.586  10.781  6.794   1.00 0.00 ? 24  LYS A O    2  
ATOM 2094  C CB   . LYS A 1 24  ? -11.753 9.803   6.623   1.00 0.00 ? 24  LYS A CB   2  
ATOM 2095  C CG   . LYS A 1 24  ? -13.013 9.482   5.817   1.00 0.00 ? 24  LYS A CG   2  
ATOM 2096  C CD   . LYS A 1 24  ? -14.252 9.484   6.715   1.00 0.00 ? 24  LYS A CD   2  
ATOM 2097  C CE   . LYS A 1 24  ? -15.534 9.490   5.879   1.00 0.00 ? 24  LYS A CE   2  
ATOM 2098  N NZ   . LYS A 1 24  ? -16.725 9.502   6.758   1.00 0.00 ? 24  LYS A NZ   2  
ATOM 2099  H H    . LYS A 1 24  ? -9.903  8.074   6.614   1.00 0.00 ? 24  LYS A H    2  
ATOM 2100  H HA   . LYS A 1 24  ? -10.875 9.993   4.697   1.00 0.00 ? 24  LYS A HA   2  
ATOM 2101  H HB2  . LYS A 1 24  ? -11.611 9.051   7.399   1.00 0.00 ? 24  LYS A HB2  2  
ATOM 2102  H HB3  . LYS A 1 24  ? -11.874 10.762  7.128   1.00 0.00 ? 24  LYS A HB3  2  
ATOM 2103  H HG2  . LYS A 1 24  ? -13.136 10.215  5.020   1.00 0.00 ? 24  LYS A HG2  2  
ATOM 2104  H HG3  . LYS A 1 24  ? -12.906 8.508   5.341   1.00 0.00 ? 24  LYS A HG3  2  
ATOM 2105  H HD2  . LYS A 1 24  ? -14.239 8.606   7.361   1.00 0.00 ? 24  LYS A HD2  2  
ATOM 2106  H HD3  . LYS A 1 24  ? -14.234 10.359  7.365   1.00 0.00 ? 24  LYS A HD3  2  
ATOM 2107  H HE2  . LYS A 1 24  ? -15.546 10.363  5.227   1.00 0.00 ? 24  LYS A HE2  2  
ATOM 2108  H HE3  . LYS A 1 24  ? -15.559 8.611   5.235   1.00 0.00 ? 24  LYS A HE3  2  
ATOM 2109  H HZ1  . LYS A 1 24  ? -16.452 9.753   7.686   1.00 0.00 ? 24  LYS A HZ1  2  
ATOM 2110  H HZ2  . LYS A 1 24  ? -17.386 10.169  6.413   1.00 0.00 ? 24  LYS A HZ2  2  
ATOM 2111  H HZ3  . LYS A 1 24  ? -17.142 8.593   6.767   1.00 0.00 ? 24  LYS A HZ3  2  
ATOM 2112  N N    . VAL A 1 25  ? -9.839  12.152  5.502   1.00 0.00 ? 25  VAL A N    2  
ATOM 2113  C CA   . VAL A 1 25  ? -9.004  13.318  5.737   1.00 0.00 ? 25  VAL A CA   2  
ATOM 2114  C C    . VAL A 1 25  ? -9.889  14.504  6.122   1.00 0.00 ? 25  VAL A C    2  
ATOM 2115  O O    . VAL A 1 25  ? -10.911 14.754  5.485   1.00 0.00 ? 25  VAL A O    2  
ATOM 2116  C CB   . VAL A 1 25  ? -8.134  13.594  4.509   1.00 0.00 ? 25  VAL A CB   2  
ATOM 2117  C CG1  . VAL A 1 25  ? -7.118  14.702  4.795   1.00 0.00 ? 25  VAL A CG1  2  
ATOM 2118  C CG2  . VAL A 1 25  ? -7.436  12.319  4.033   1.00 0.00 ? 25  VAL A CG2  2  
ATOM 2119  H H    . VAL A 1 25  ? -10.624 12.308  4.904   1.00 0.00 ? 25  VAL A H    2  
ATOM 2120  H HA   . VAL A 1 25  ? -8.343  13.087  6.573   1.00 0.00 ? 25  VAL A HA   2  
ATOM 2121  H HB   . VAL A 1 25  ? -8.787  13.938  3.706   1.00 0.00 ? 25  VAL A HB   2  
ATOM 2122  H HG11 . VAL A 1 25  ? -6.115  14.276  4.824   1.00 0.00 ? 25  VAL A HG11 2  
ATOM 2123  H HG12 . VAL A 1 25  ? -7.170  15.455  4.008   1.00 0.00 ? 25  VAL A HG12 2  
ATOM 2124  H HG13 . VAL A 1 25  ? -7.345  15.164  5.756   1.00 0.00 ? 25  VAL A HG13 2  
ATOM 2125  H HG21 . VAL A 1 25  ? -7.621  11.516  4.746   1.00 0.00 ? 25  VAL A HG21 2  
ATOM 2126  H HG22 . VAL A 1 25  ? -7.826  12.034  3.056   1.00 0.00 ? 25  VAL A HG22 2  
ATOM 2127  H HG23 . VAL A 1 25  ? -6.363  12.498  3.958   1.00 0.00 ? 25  VAL A HG23 2  
ATOM 2128  N N    . GLN A 1 26  ? -9.465  15.205  7.164   1.00 0.00 ? 26  GLN A N    2  
ATOM 2129  C CA   . GLN A 1 26  ? -10.206 16.360  7.641   1.00 0.00 ? 26  GLN A CA   2  
ATOM 2130  C C    . GLN A 1 26  ? -9.466  17.650  7.285   1.00 0.00 ? 26  GLN A C    2  
ATOM 2131  O O    . GLN A 1 26  ? -8.968  18.348  8.167   1.00 0.00 ? 26  GLN A O    2  
ATOM 2132  C CB   . GLN A 1 26  ? -10.453 16.267  9.148   1.00 0.00 ? 26  GLN A CB   2  
ATOM 2133  C CG   . GLN A 1 26  ? -11.937 16.045  9.448   1.00 0.00 ? 26  GLN A CG   2  
ATOM 2134  C CD   . GLN A 1 26  ? -12.367 16.821  10.695  1.00 0.00 ? 26  GLN A CD   2  
ATOM 2135  O OE1  . GLN A 1 26  ? -11.751 17.795  11.095  1.00 0.00 ? 26  GLN A OE1  2  
ATOM 2136  N NE2  . GLN A 1 26  ? -13.456 16.336  11.285  1.00 0.00 ? 26  GLN A NE2  2  
ATOM 2137  H H    . GLN A 1 26  ? -8.632  14.996  7.677   1.00 0.00 ? 26  GLN A H    2  
ATOM 2138  H HA   . GLN A 1 26  ? -11.163 16.325  7.120   1.00 0.00 ? 26  GLN A HA   2  
ATOM 2139  H HB2  . GLN A 1 26  ? -9.867  15.449  9.567   1.00 0.00 ? 26  GLN A HB2  2  
ATOM 2140  H HB3  . GLN A 1 26  ? -10.114 17.183  9.633   1.00 0.00 ? 26  GLN A HB3  2  
ATOM 2141  H HG2  . GLN A 1 26  ? -12.536 16.361  8.594   1.00 0.00 ? 26  GLN A HG2  2  
ATOM 2142  H HG3  . GLN A 1 26  ? -12.127 14.981  9.594   1.00 0.00 ? 26  GLN A HG3  2  
ATOM 2143  H HE21 . GLN A 1 26  ? -13.914 15.533  10.906  1.00 0.00 ? 26  GLN A HE21 2  
ATOM 2144  H HE22 . GLN A 1 26  ? -13.816 16.775  12.108  1.00 0.00 ? 26  GLN A HE22 2  
ATOM 2145  N N    . LYS A 1 27  ? -9.418  17.929  5.991   1.00 0.00 ? 27  LYS A N    2  
ATOM 2146  C CA   . LYS A 1 27  ? -8.747  19.124  5.507   1.00 0.00 ? 27  LYS A CA   2  
ATOM 2147  C C    . LYS A 1 27  ? -9.342  20.352  6.197   1.00 0.00 ? 27  LYS A C    2  
ATOM 2148  O O    . LYS A 1 27  ? -8.765  20.874  7.149   1.00 0.00 ? 27  LYS A O    2  
ATOM 2149  C CB   . LYS A 1 27  ? -8.803  19.188  3.979   1.00 0.00 ? 27  LYS A CB   2  
ATOM 2150  C CG   . LYS A 1 27  ? -7.420  19.472  3.391   1.00 0.00 ? 27  LYS A CG   2  
ATOM 2151  C CD   . LYS A 1 27  ? -6.761  18.184  2.894   1.00 0.00 ? 27  LYS A CD   2  
ATOM 2152  C CE   . LYS A 1 27  ? -6.550  18.225  1.379   1.00 0.00 ? 27  LYS A CE   2  
ATOM 2153  N NZ   . LYS A 1 27  ? -6.907  16.924  0.770   1.00 0.00 ? 27  LYS A NZ   2  
ATOM 2154  H H    . LYS A 1 27  ? -9.825  17.356  5.280   1.00 0.00 ? 27  LYS A H    2  
ATOM 2155  H HA   . LYS A 1 27  ? -7.696  19.045  5.787   1.00 0.00 ? 27  LYS A HA   2  
ATOM 2156  H HB2  . LYS A 1 27  ? -9.184  18.246  3.585   1.00 0.00 ? 27  LYS A HB2  2  
ATOM 2157  H HB3  . LYS A 1 27  ? -9.501  19.967  3.670   1.00 0.00 ? 27  LYS A HB3  2  
ATOM 2158  H HG2  . LYS A 1 27  ? -7.509  20.180  2.567   1.00 0.00 ? 27  LYS A HG2  2  
ATOM 2159  H HG3  . LYS A 1 27  ? -6.788  19.940  4.146   1.00 0.00 ? 27  LYS A HG3  2  
ATOM 2160  H HD2  . LYS A 1 27  ? -5.802  18.045  3.394   1.00 0.00 ? 27  LYS A HD2  2  
ATOM 2161  H HD3  . LYS A 1 27  ? -7.383  17.328  3.155   1.00 0.00 ? 27  LYS A HD3  2  
ATOM 2162  H HE2  . LYS A 1 27  ? -7.159  19.017  0.943   1.00 0.00 ? 27  LYS A HE2  2  
ATOM 2163  H HE3  . LYS A 1 27  ? -5.510  18.464  1.157   1.00 0.00 ? 27  LYS A HE3  2  
ATOM 2164  H HZ1  . LYS A 1 27  ? -6.075  16.460  0.465   1.00 0.00 ? 27  LYS A HZ1  2  
ATOM 2165  H HZ2  . LYS A 1 27  ? -7.375  16.357  1.448   1.00 0.00 ? 27  LYS A HZ2  2  
ATOM 2166  H HZ3  . LYS A 1 27  ? -7.510  17.077  -0.012  1.00 0.00 ? 27  LYS A HZ3  2  
ATOM 2167  N N    . GLY A 1 28  ? -10.489 20.779  5.689   1.00 0.00 ? 28  GLY A N    2  
ATOM 2168  C CA   . GLY A 1 28  ? -11.169 21.937  6.245   1.00 0.00 ? 28  GLY A CA   2  
ATOM 2169  C C    . GLY A 1 28  ? -10.732 23.221  5.538   1.00 0.00 ? 28  GLY A C    2  
ATOM 2170  O O    . GLY A 1 28  ? -11.534 23.869  4.867   1.00 0.00 ? 28  GLY A O    2  
ATOM 2171  H H    . GLY A 1 28  ? -10.952 20.349  4.914   1.00 0.00 ? 28  GLY A H    2  
ATOM 2172  H HA2  . GLY A 1 28  ? -12.247 21.812  6.146   1.00 0.00 ? 28  GLY A HA2  2  
ATOM 2173  H HA3  . GLY A 1 28  ? -10.954 22.012  7.311   1.00 0.00 ? 28  GLY A HA3  2  
ATOM 2174  N N    . SER A 1 29  ? -9.461  23.551  5.712   1.00 0.00 ? 29  SER A N    2  
ATOM 2175  C CA   . SER A 1 29  ? -8.907  24.746  5.099   1.00 0.00 ? 29  SER A CA   2  
ATOM 2176  C C    . SER A 1 29  ? -7.381  24.735  5.215   1.00 0.00 ? 29  SER A C    2  
ATOM 2177  O O    . SER A 1 29  ? -6.761  25.783  5.389   1.00 0.00 ? 29  SER A O    2  
ATOM 2178  C CB   . SER A 1 29  ? -9.479  26.011  5.743   1.00 0.00 ? 29  SER A CB   2  
ATOM 2179  O OG   . SER A 1 29  ? -9.319  26.008  7.159   1.00 0.00 ? 29  SER A OG   2  
ATOM 2180  H H    . SER A 1 29  ? -8.815  23.019  6.259   1.00 0.00 ? 29  SER A H    2  
ATOM 2181  H HA   . SER A 1 29  ? -9.211  24.702  4.053   1.00 0.00 ? 29  SER A HA   2  
ATOM 2182  H HB2  . SER A 1 29  ? -8.983  26.887  5.324   1.00 0.00 ? 29  SER A HB2  2  
ATOM 2183  H HB3  . SER A 1 29  ? -10.537 26.096  5.497   1.00 0.00 ? 29  SER A HB3  2  
ATOM 2184  H HG   . SER A 1 29  ? -10.181 25.759  7.600   1.00 0.00 ? 29  SER A HG   2  
ATOM 2185  N N    . GLU A 1 30  ? -6.821  23.539  5.113   1.00 0.00 ? 30  GLU A N    2  
ATOM 2186  C CA   . GLU A 1 30  ? -5.380  23.378  5.204   1.00 0.00 ? 30  GLU A CA   2  
ATOM 2187  C C    . GLU A 1 30  ? -4.875  22.470  4.081   1.00 0.00 ? 30  GLU A C    2  
ATOM 2188  O O    . GLU A 1 30  ? -5.642  21.694  3.513   1.00 0.00 ? 30  GLU A O    2  
ATOM 2189  C CB   . GLU A 1 30  ? -4.975  22.831  6.575   1.00 0.00 ? 30  GLU A CB   2  
ATOM 2190  C CG   . GLU A 1 30  ? -4.831  23.962  7.596   1.00 0.00 ? 30  GLU A CG   2  
ATOM 2191  C CD   . GLU A 1 30  ? -5.768  23.748  8.786   1.00 0.00 ? 30  GLU A CD   2  
ATOM 2192  O OE1  . GLU A 1 30  ? -6.974  23.543  8.529   1.00 0.00 ? 30  GLU A OE1  2  
ATOM 2193  O OE2  . GLU A 1 30  ? -5.257  23.795  9.926   1.00 0.00 ? 30  GLU A OE2  2  
ATOM 2194  H H    . GLU A 1 30  ? -7.332  22.692  4.971   1.00 0.00 ? 30  GLU A H    2  
ATOM 2195  H HA   . GLU A 1 30  ? -4.968  24.380  5.084   1.00 0.00 ? 30  GLU A HA   2  
ATOM 2196  H HB2  . GLU A 1 30  ? -5.722  22.117  6.921   1.00 0.00 ? 30  GLU A HB2  2  
ATOM 2197  H HB3  . GLU A 1 30  ? -4.032  22.291  6.491   1.00 0.00 ? 30  GLU A HB3  2  
ATOM 2198  H HG2  . GLU A 1 30  ? -3.800  24.013  7.944   1.00 0.00 ? 30  GLU A HG2  2  
ATOM 2199  H HG3  . GLU A 1 30  ? -5.054  24.917  7.119   1.00 0.00 ? 30  GLU A HG3  2  
ATOM 2200  N N    . PRO A 1 31  ? -3.554  22.601  3.786   1.00 0.00 ? 31  PRO A N    2  
ATOM 2201  C CA   . PRO A 1 31  ? -2.937  21.802  2.741   1.00 0.00 ? 31  PRO A CA   2  
ATOM 2202  C C    . PRO A 1 31  ? -2.726  20.359  3.206   1.00 0.00 ? 31  PRO A C    2  
ATOM 2203  O O    . PRO A 1 31  ? -2.760  20.078  4.403   1.00 0.00 ? 31  PRO A O    2  
ATOM 2204  C CB   . PRO A 1 31  ? -1.637  22.517  2.414   1.00 0.00 ? 31  PRO A CB   2  
ATOM 2205  C CG   . PRO A 1 31  ? -1.349  23.422  3.600   1.00 0.00 ? 31  PRO A CG   2  
ATOM 2206  C CD   . PRO A 1 31  ? -2.615  23.510  4.437   1.00 0.00 ? 31  PRO A CD   2  
ATOM 2207  H HA   . PRO A 1 31  ? -3.540  21.747  1.945   1.00 0.00 ? 31  PRO A HA   2  
ATOM 2208  H HB2  . PRO A 1 31  ? -0.827  21.804  2.261   1.00 0.00 ? 31  PRO A HB2  2  
ATOM 2209  H HB3  . PRO A 1 31  ? -1.729  23.095  1.495   1.00 0.00 ? 31  PRO A HB3  2  
ATOM 2210  H HG2  . PRO A 1 31  ? -0.526  23.024  4.194   1.00 0.00 ? 31  PRO A HG2  2  
ATOM 2211  H HG3  . PRO A 1 31  ? -1.047  24.413  3.260   1.00 0.00 ? 31  PRO A HG3  2  
ATOM 2212  H HD2  . PRO A 1 31  ? -2.428  23.213  5.470   1.00 0.00 ? 31  PRO A HD2  2  
ATOM 2213  H HD3  . PRO A 1 31  ? -3.003  24.528  4.463   1.00 0.00 ? 31  PRO A HD3  2  
ATOM 2214  N N    . LEU A 1 32  ? -2.513  19.484  2.235   1.00 0.00 ? 32  LEU A N    2  
ATOM 2215  C CA   . LEU A 1 32  ? -2.296  18.077  2.530   1.00 0.00 ? 32  LEU A CA   2  
ATOM 2216  C C    . LEU A 1 32  ? -0.914  17.900  3.161   1.00 0.00 ? 32  LEU A C    2  
ATOM 2217  O O    . LEU A 1 32  ? -0.799  17.431  4.292   1.00 0.00 ? 32  LEU A O    2  
ATOM 2218  C CB   . LEU A 1 32  ? -2.513  17.227  1.276   1.00 0.00 ? 32  LEU A CB   2  
ATOM 2219  C CG   . LEU A 1 32  ? -2.958  15.783  1.514   1.00 0.00 ? 32  LEU A CG   2  
ATOM 2220  C CD1  . LEU A 1 32  ? -4.339  15.735  2.171   1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2221  C CD2  . LEU A 1 32  ? -2.912  14.974  0.216   1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2222  H H    . LEU A 1 32  ? -2.486  19.721  1.264   1.00 0.00 ? 32  LEU A H    2  
ATOM 2223  H HA   . LEU A 1 32  ? -3.049  17.776  3.258   1.00 0.00 ? 32  LEU A HA   2  
ATOM 2224  H HB2  . LEU A 1 32  ? -3.260  17.719  0.653   1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2225  H HB3  . LEU A 1 32  ? -1.584  17.211  0.707   1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2226  H HG   . LEU A 1 32  ? -2.256  15.319  2.207   1.00 0.00 ? 32  LEU A HG   2  
ATOM 2227  H HD11 . LEU A 1 32  ? -4.268  15.219  3.128   1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2228  H HD12 . LEU A 1 32  ? -4.700  16.751  2.331   1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2229  H HD13 . LEU A 1 32  ? -5.032  15.202  1.521   1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2230  H HD21 . LEU A 1 32  ? -3.892  14.998  -0.261  1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2231  H HD22 . LEU A 1 32  ? -2.170  15.406  -0.455  1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2232  H HD23 . LEU A 1 32  ? -2.642  13.942  0.440   1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2233  N N    . GLY A 1 33  ? 0.102   18.285  2.402   1.00 0.00 ? 33  GLY A N    2  
ATOM 2234  C CA   . GLY A 1 33  ? 1.472   18.175  2.873   1.00 0.00 ? 33  GLY A CA   2  
ATOM 2235  C C    . GLY A 1 33  ? 1.995   16.746  2.708   1.00 0.00 ? 33  GLY A C    2  
ATOM 2236  O O    . GLY A 1 33  ? 2.379   16.105  3.685   1.00 0.00 ? 33  GLY A O    2  
ATOM 2237  H H    . GLY A 1 33  ? 0.001   18.666  1.483   1.00 0.00 ? 33  GLY A H    2  
ATOM 2238  H HA2  . GLY A 1 33  ? 2.108   18.865  2.319   1.00 0.00 ? 33  GLY A HA2  2  
ATOM 2239  H HA3  . GLY A 1 33  ? 1.524   18.466  3.922   1.00 0.00 ? 33  GLY A HA3  2  
ATOM 2240  N N    . ILE A 1 34  ? 1.993   16.290  1.464   1.00 0.00 ? 34  ILE A N    2  
ATOM 2241  C CA   . ILE A 1 34  ? 2.463   14.949  1.159   1.00 0.00 ? 34  ILE A CA   2  
ATOM 2242  C C    . ILE A 1 34  ? 3.153   14.954  -0.207  1.00 0.00 ? 34  ILE A C    2  
ATOM 2243  O O    . ILE A 1 34  ? 2.715   15.645  -1.125  1.00 0.00 ? 34  ILE A O    2  
ATOM 2244  C CB   . ILE A 1 34  ? 1.316   13.942  1.265   1.00 0.00 ? 34  ILE A CB   2  
ATOM 2245  C CG1  . ILE A 1 34  ? 0.083   14.433  0.502   1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2246  C CG2  . ILE A 1 34  ? 0.996   13.627  2.728   1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2247  C CD1  . ILE A 1 34  ? -0.240  13.506  -0.671  1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2248  H H    . ILE A 1 34  ? 1.679   16.818  0.675   1.00 0.00 ? 34  ILE A H    2  
ATOM 2249  H HA   . ILE A 1 34  ? 3.199   14.680  1.917   1.00 0.00 ? 34  ILE A HA   2  
ATOM 2250  H HB   . ILE A 1 34  ? 1.634   13.011  0.797   1.00 0.00 ? 34  ILE A HB   2  
ATOM 2251  H HG12 . ILE A 1 34  ? -0.771  14.483  1.177   1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2252  H HG13 . ILE A 1 34  ? 0.258   15.444  0.134   1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2253  H HG21 . ILE A 1 34  ? 0.886   14.557  3.284   1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2254  H HG22 . ILE A 1 34  ? 0.068   13.058  2.782   1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2255  H HG23 . ILE A 1 34  ? 1.808   13.040  3.158   1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2256  H HD11 . ILE A 1 34  ? -0.382  12.490  -0.303  1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2257  H HD12 . ILE A 1 34  ? -1.153  13.845  -1.162  1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2258  H HD13 . ILE A 1 34  ? 0.583   13.522  -1.385  1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2259  N N    . SER A 1 35  ? 4.220   14.174  -0.298  1.00 0.00 ? 35  SER A N    2  
ATOM 2260  C CA   . SER A 1 35  ? 4.975   14.080  -1.536  1.00 0.00 ? 35  SER A CA   2  
ATOM 2261  C C    . SER A 1 35  ? 4.576   12.814  -2.297  1.00 0.00 ? 35  SER A C    2  
ATOM 2262  O O    . SER A 1 35  ? 4.298   11.781  -1.689  1.00 0.00 ? 35  SER A O    2  
ATOM 2263  C CB   . SER A 1 35  ? 6.480   14.084  -1.265  1.00 0.00 ? 35  SER A CB   2  
ATOM 2264  O OG   . SER A 1 35  ? 7.225   14.532  -2.394  1.00 0.00 ? 35  SER A OG   2  
ATOM 2265  H H    . SER A 1 35  ? 4.570   13.615  0.454   1.00 0.00 ? 35  SER A H    2  
ATOM 2266  H HA   . SER A 1 35  ? 4.706   14.969  -2.106  1.00 0.00 ? 35  SER A HA   2  
ATOM 2267  H HB2  . SER A 1 35  ? 6.694   14.728  -0.412  1.00 0.00 ? 35  SER A HB2  2  
ATOM 2268  H HB3  . SER A 1 35  ? 6.803   13.078  -0.994  1.00 0.00 ? 35  SER A HB3  2  
ATOM 2269  H HG   . SER A 1 35  ? 6.952   15.463  -2.636  1.00 0.00 ? 35  SER A HG   2  
ATOM 2270  N N    . ILE A 1 36  ? 4.559   12.935  -3.616  1.00 0.00 ? 36  ILE A N    2  
ATOM 2271  C CA   . ILE A 1 36  ? 4.199   11.813  -4.466  1.00 0.00 ? 36  ILE A CA   2  
ATOM 2272  C C    . ILE A 1 36  ? 5.198   11.712  -5.621  1.00 0.00 ? 36  ILE A C    2  
ATOM 2273  O O    . ILE A 1 36  ? 5.812   12.707  -6.004  1.00 0.00 ? 36  ILE A O    2  
ATOM 2274  C CB   . ILE A 1 36  ? 2.743   11.933  -4.922  1.00 0.00 ? 36  ILE A CB   2  
ATOM 2275  C CG1  . ILE A 1 36  ? 2.532   13.194  -5.761  1.00 0.00 ? 36  ILE A CG1  2  
ATOM 2276  C CG2  . ILE A 1 36  ? 1.788   11.873  -3.728  1.00 0.00 ? 36  ILE A CG2  2  
ATOM 2277  C CD1  . ILE A 1 36  ? 2.718   12.899  -7.251  1.00 0.00 ? 36  ILE A CD1  2  
ATOM 2278  H H    . ILE A 1 36  ? 4.786   13.779  -4.103  1.00 0.00 ? 36  ILE A H    2  
ATOM 2279  H HA   . ILE A 1 36  ? 4.275   10.909  -3.863  1.00 0.00 ? 36  ILE A HA   2  
ATOM 2280  H HB   . ILE A 1 36  ? 2.514   11.079  -5.560  1.00 0.00 ? 36  ILE A HB   2  
ATOM 2281  H HG12 . ILE A 1 36  ? 1.531   13.588  -5.587  1.00 0.00 ? 36  ILE A HG12 2  
ATOM 2282  H HG13 . ILE A 1 36  ? 3.237   13.965  -5.449  1.00 0.00 ? 36  ILE A HG13 2  
ATOM 2283  H HG21 . ILE A 1 36  ? 0.933   11.244  -3.977  1.00 0.00 ? 36  ILE A HG21 2  
ATOM 2284  H HG22 . ILE A 1 36  ? 2.309   11.453  -2.867  1.00 0.00 ? 36  ILE A HG22 2  
ATOM 2285  H HG23 . ILE A 1 36  ? 1.442   12.878  -3.488  1.00 0.00 ? 36  ILE A HG23 2  
ATOM 2286  H HD11 . ILE A 1 36  ? 2.065   12.076  -7.542  1.00 0.00 ? 36  ILE A HD11 2  
ATOM 2287  H HD12 . ILE A 1 36  ? 2.466   13.786  -7.831  1.00 0.00 ? 36  ILE A HD12 2  
ATOM 2288  H HD13 . ILE A 1 36  ? 3.756   12.624  -7.440  1.00 0.00 ? 36  ILE A HD13 2  
ATOM 2289  N N    . VAL A 1 37  ? 5.329   10.502  -6.143  1.00 0.00 ? 37  VAL A N    2  
ATOM 2290  C CA   . VAL A 1 37  ? 6.243   10.258  -7.246  1.00 0.00 ? 37  VAL A CA   2  
ATOM 2291  C C    . VAL A 1 37  ? 5.607   9.263   -8.219  1.00 0.00 ? 37  VAL A C    2  
ATOM 2292  O O    . VAL A 1 37  ? 4.842   8.392   -7.810  1.00 0.00 ? 37  VAL A O    2  
ATOM 2293  C CB   . VAL A 1 37  ? 7.597   9.787   -6.709  1.00 0.00 ? 37  VAL A CB   2  
ATOM 2294  C CG1  . VAL A 1 37  ? 8.036   10.631  -5.511  1.00 0.00 ? 37  VAL A CG1  2  
ATOM 2295  C CG2  . VAL A 1 37  ? 7.556   8.301   -6.347  1.00 0.00 ? 37  VAL A CG2  2  
ATOM 2296  H H    . VAL A 1 37  ? 4.826   9.698   -5.825  1.00 0.00 ? 37  VAL A H    2  
ATOM 2297  H HA   . VAL A 1 37  ? 6.396   11.205  -7.762  1.00 0.00 ? 37  VAL A HA   2  
ATOM 2298  H HB   . VAL A 1 37  ? 8.335   9.919   -7.500  1.00 0.00 ? 37  VAL A HB   2  
ATOM 2299  H HG11 . VAL A 1 37  ? 9.006   10.284  -5.158  1.00 0.00 ? 37  VAL A HG11 2  
ATOM 2300  H HG12 . VAL A 1 37  ? 8.111   11.676  -5.812  1.00 0.00 ? 37  VAL A HG12 2  
ATOM 2301  H HG13 . VAL A 1 37  ? 7.302   10.535  -4.711  1.00 0.00 ? 37  VAL A HG13 2  
ATOM 2302  H HG21 . VAL A 1 37  ? 7.248   7.723   -7.218  1.00 0.00 ? 37  VAL A HG21 2  
ATOM 2303  H HG22 . VAL A 1 37  ? 8.547   7.977   -6.029  1.00 0.00 ? 37  VAL A HG22 2  
ATOM 2304  H HG23 . VAL A 1 37  ? 6.845   8.144   -5.536  1.00 0.00 ? 37  VAL A HG23 2  
ATOM 2305  N N    . SER A 1 38  ? 5.948   9.427   -9.489  1.00 0.00 ? 38  SER A N    2  
ATOM 2306  C CA   . SER A 1 38  ? 5.420   8.554   -10.524 1.00 0.00 ? 38  SER A CA   2  
ATOM 2307  C C    . SER A 1 38  ? 6.476   7.524   -10.929 1.00 0.00 ? 38  SER A C    2  
ATOM 2308  O O    . SER A 1 38  ? 7.671   7.815   -10.911 1.00 0.00 ? 38  SER A O    2  
ATOM 2309  C CB   . SER A 1 38  ? 4.967   9.358   -11.744 1.00 0.00 ? 38  SER A CB   2  
ATOM 2310  O OG   . SER A 1 38  ? 4.438   8.521   -12.769 1.00 0.00 ? 38  SER A OG   2  
ATOM 2311  H H    . SER A 1 38  ? 6.572   10.138  -9.813  1.00 0.00 ? 38  SER A H    2  
ATOM 2312  H HA   . SER A 1 38  ? 4.558   8.062   -10.074 1.00 0.00 ? 38  SER A HA   2  
ATOM 2313  H HB2  . SER A 1 38  ? 4.212   10.083  -11.441 1.00 0.00 ? 38  SER A HB2  2  
ATOM 2314  H HB3  . SER A 1 38  ? 5.811   9.924   -12.139 1.00 0.00 ? 38  SER A HB3  2  
ATOM 2315  H HG   . SER A 1 38  ? 4.401   7.574   -12.451 1.00 0.00 ? 38  SER A HG   2  
ATOM 2316  N N    . GLY A 1 39  ? 5.997   6.341   -11.285 1.00 0.00 ? 39  GLY A N    2  
ATOM 2317  C CA   . GLY A 1 39  ? 6.885   5.266   -11.694 1.00 0.00 ? 39  GLY A CA   2  
ATOM 2318  C C    . GLY A 1 39  ? 7.105   5.283   -13.208 1.00 0.00 ? 39  GLY A C    2  
ATOM 2319  O O    . GLY A 1 39  ? 7.576   4.302   -13.781 1.00 0.00 ? 39  GLY A O    2  
ATOM 2320  H H    . GLY A 1 39  ? 5.023   6.113   -11.297 1.00 0.00 ? 39  GLY A H    2  
ATOM 2321  H HA2  . GLY A 1 39  ? 7.842   5.366   -11.182 1.00 0.00 ? 39  GLY A HA2  2  
ATOM 2322  H HA3  . GLY A 1 39  ? 6.462   4.307   -11.395 1.00 0.00 ? 39  GLY A HA3  2  
ATOM 2323  N N    . GLU A 1 40  ? 6.754   6.408   -13.812 1.00 0.00 ? 40  GLU A N    2  
ATOM 2324  C CA   . GLU A 1 40  ? 6.907   6.565   -15.249 1.00 0.00 ? 40  GLU A CA   2  
ATOM 2325  C C    . GLU A 1 40  ? 5.846   5.749   -15.988 1.00 0.00 ? 40  GLU A C    2  
ATOM 2326  O O    . GLU A 1 40  ? 4.966   6.311   -16.638 1.00 0.00 ? 40  GLU A O    2  
ATOM 2327  C CB   . GLU A 1 40  ? 8.315   6.168   -15.696 1.00 0.00 ? 40  GLU A CB   2  
ATOM 2328  C CG   . GLU A 1 40  ? 8.835   7.117   -16.778 1.00 0.00 ? 40  GLU A CG   2  
ATOM 2329  C CD   . GLU A 1 40  ? 9.948   8.014   -16.232 1.00 0.00 ? 40  GLU A CD   2  
ATOM 2330  O OE1  . GLU A 1 40  ? 10.966  7.444   -15.782 1.00 0.00 ? 40  GLU A OE1  2  
ATOM 2331  O OE2  . GLU A 1 40  ? 9.756   9.248   -16.276 1.00 0.00 ? 40  GLU A OE2  2  
ATOM 2332  H H    . GLU A 1 40  ? 6.371   7.201   -13.339 1.00 0.00 ? 40  GLU A H    2  
ATOM 2333  H HA   . GLU A 1 40  ? 6.757   7.628   -15.441 1.00 0.00 ? 40  GLU A HA   2  
ATOM 2334  H HB2  . GLU A 1 40  ? 8.990   6.182   -14.841 1.00 0.00 ? 40  GLU A HB2  2  
ATOM 2335  H HB3  . GLU A 1 40  ? 8.305   5.147   -16.078 1.00 0.00 ? 40  GLU A HB3  2  
ATOM 2336  H HG2  . GLU A 1 40  ? 9.209   6.541   -17.624 1.00 0.00 ? 40  GLU A HG2  2  
ATOM 2337  H HG3  . GLU A 1 40  ? 8.016   7.734   -17.150 1.00 0.00 ? 40  GLU A HG3  2  
ATOM 2338  N N    . LYS A 1 41  ? 5.964   4.435   -15.865 1.00 0.00 ? 41  LYS A N    2  
ATOM 2339  C CA   . LYS A 1 41  ? 5.025   3.535   -16.514 1.00 0.00 ? 41  LYS A CA   2  
ATOM 2340  C C    . LYS A 1 41  ? 3.603   3.882   -16.071 1.00 0.00 ? 41  LYS A C    2  
ATOM 2341  O O    . LYS A 1 41  ? 2.694   3.964   -16.896 1.00 0.00 ? 41  LYS A O    2  
ATOM 2342  C CB   . LYS A 1 41  ? 5.412   2.078   -16.253 1.00 0.00 ? 41  LYS A CB   2  
ATOM 2343  C CG   . LYS A 1 41  ? 5.760   1.361   -17.560 1.00 0.00 ? 41  LYS A CG   2  
ATOM 2344  C CD   . LYS A 1 41  ? 5.302   -0.098  -17.523 1.00 0.00 ? 41  LYS A CD   2  
ATOM 2345  C CE   . LYS A 1 41  ? 6.430   -1.015  -17.044 1.00 0.00 ? 41  LYS A CE   2  
ATOM 2346  N NZ   . LYS A 1 41  ? 6.481   -2.246  -17.864 1.00 0.00 ? 41  LYS A NZ   2  
ATOM 2347  H H    . LYS A 1 41  ? 6.682   3.985   -15.335 1.00 0.00 ? 41  LYS A H    2  
ATOM 2348  H HA   . LYS A 1 41  ? 5.103   3.702   -17.589 1.00 0.00 ? 41  LYS A HA   2  
ATOM 2349  H HB2  . LYS A 1 41  ? 6.264   2.040   -15.575 1.00 0.00 ? 41  LYS A HB2  2  
ATOM 2350  H HB3  . LYS A 1 41  ? 4.589   1.562   -15.759 1.00 0.00 ? 41  LYS A HB3  2  
ATOM 2351  H HG2  . LYS A 1 41  ? 5.287   1.873   -18.397 1.00 0.00 ? 41  LYS A HG2  2  
ATOM 2352  H HG3  . LYS A 1 41  ? 6.836   1.404   -17.726 1.00 0.00 ? 41  LYS A HG3  2  
ATOM 2353  H HD2  . LYS A 1 41  ? 4.442   -0.197  -16.860 1.00 0.00 ? 41  LYS A HD2  2  
ATOM 2354  H HD3  . LYS A 1 41  ? 4.976   -0.406  -18.516 1.00 0.00 ? 41  LYS A HD3  2  
ATOM 2355  H HE2  . LYS A 1 41  ? 7.383   -0.490  -17.105 1.00 0.00 ? 41  LYS A HE2  2  
ATOM 2356  H HE3  . LYS A 1 41  ? 6.275   -1.275  -15.997 1.00 0.00 ? 41  LYS A HE3  2  
ATOM 2357  H HZ1  . LYS A 1 41  ? 5.567   -2.648  -17.919 1.00 0.00 ? 41  LYS A HZ1  2  
ATOM 2358  H HZ2  . LYS A 1 41  ? 6.802   -2.021  -18.784 1.00 0.00 ? 41  LYS A HZ2  2  
ATOM 2359  H HZ3  . LYS A 1 41  ? 7.108   -2.901  -17.443 1.00 0.00 ? 41  LYS A HZ3  2  
ATOM 2360  N N    . GLY A 1 42  ? 3.454   4.078   -14.769 1.00 0.00 ? 42  GLY A N    2  
ATOM 2361  C CA   . GLY A 1 42  ? 2.157   4.414   -14.206 1.00 0.00 ? 42  GLY A CA   2  
ATOM 2362  C C    . GLY A 1 42  ? 2.107   4.090   -12.712 1.00 0.00 ? 42  GLY A C    2  
ATOM 2363  O O    . GLY A 1 42  ? 2.826   3.210   -12.239 1.00 0.00 ? 42  GLY A O    2  
ATOM 2364  H H    . GLY A 1 42  ? 4.198   4.009   -14.105 1.00 0.00 ? 42  GLY A H    2  
ATOM 2365  H HA2  . GLY A 1 42  ? 1.955   5.474   -14.358 1.00 0.00 ? 42  GLY A HA2  2  
ATOM 2366  H HA3  . GLY A 1 42  ? 1.376   3.862   -14.728 1.00 0.00 ? 42  GLY A HA3  2  
ATOM 2367  N N    . GLY A 1 43  ? 1.252   4.818   -12.009 1.00 0.00 ? 43  GLY A N    2  
ATOM 2368  C CA   . GLY A 1 43  ? 1.099   4.619   -10.578 1.00 0.00 ? 43  GLY A CA   2  
ATOM 2369  C C    . GLY A 1 43  ? 1.737   5.767   -9.793  1.00 0.00 ? 43  GLY A C    2  
ATOM 2370  O O    . GLY A 1 43  ? 2.697   6.382   -10.255 1.00 0.00 ? 43  GLY A O    2  
ATOM 2371  H H    . GLY A 1 43  ? 0.672   5.532   -12.400 1.00 0.00 ? 43  GLY A H    2  
ATOM 2372  H HA2  . GLY A 1 43  ? 0.041   4.546   -10.328 1.00 0.00 ? 43  GLY A HA2  2  
ATOM 2373  H HA3  . GLY A 1 43  ? 1.561   3.675   -10.287 1.00 0.00 ? 43  GLY A HA3  2  
ATOM 2374  N N    . ILE A 1 44  ? 1.176   6.022   -8.619  1.00 0.00 ? 44  ILE A N    2  
ATOM 2375  C CA   . ILE A 1 44  ? 1.678   7.086   -7.766  1.00 0.00 ? 44  ILE A CA   2  
ATOM 2376  C C    . ILE A 1 44  ? 2.045   6.507   -6.399  1.00 0.00 ? 44  ILE A C    2  
ATOM 2377  O O    . ILE A 1 44  ? 1.296   5.709   -5.837  1.00 0.00 ? 44  ILE A O    2  
ATOM 2378  C CB   . ILE A 1 44  ? 0.672   8.236   -7.696  1.00 0.00 ? 44  ILE A CB   2  
ATOM 2379  C CG1  . ILE A 1 44  ? 0.438   8.845   -9.081  1.00 0.00 ? 44  ILE A CG1  2  
ATOM 2380  C CG2  . ILE A 1 44  ? 1.110   9.287   -6.674  1.00 0.00 ? 44  ILE A CG2  2  
ATOM 2381  C CD1  . ILE A 1 44  ? 1.655   9.653   -9.536  1.00 0.00 ? 44  ILE A CD1  2  
ATOM 2382  H H    . ILE A 1 44  ? 0.396   5.518   -8.251  1.00 0.00 ? 44  ILE A H    2  
ATOM 2383  H HA   . ILE A 1 44  ? 2.583   7.477   -8.230  1.00 0.00 ? 44  ILE A HA   2  
ATOM 2384  H HB   . ILE A 1 44  ? -0.283  7.835   -7.356  1.00 0.00 ? 44  ILE A HB   2  
ATOM 2385  H HG12 . ILE A 1 44  ? 0.233   8.053   -9.800  1.00 0.00 ? 44  ILE A HG12 2  
ATOM 2386  H HG13 . ILE A 1 44  ? -0.441  9.488   -9.055  1.00 0.00 ? 44  ILE A HG13 2  
ATOM 2387  H HG21 . ILE A 1 44  ? 2.011   8.945   -6.165  1.00 0.00 ? 44  ILE A HG21 2  
ATOM 2388  H HG22 . ILE A 1 44  ? 1.317   10.227  -7.186  1.00 0.00 ? 44  ILE A HG22 2  
ATOM 2389  H HG23 . ILE A 1 44  ? 0.315   9.438   -5.944  1.00 0.00 ? 44  ILE A HG23 2  
ATOM 2390  H HD11 . ILE A 1 44  ? 2.498   9.442   -8.879  1.00 0.00 ? 44  ILE A HD11 2  
ATOM 2391  H HD12 . ILE A 1 44  ? 1.912   9.377   -10.559 1.00 0.00 ? 44  ILE A HD12 2  
ATOM 2392  H HD13 . ILE A 1 44  ? 1.421   10.717  -9.496  1.00 0.00 ? 44  ILE A HD13 2  
ATOM 2393  N N    . TYR A 1 45  ? 3.198   6.931   -5.902  1.00 0.00 ? 45  TYR A N    2  
ATOM 2394  C CA   . TYR A 1 45  ? 3.674   6.464   -4.611  1.00 0.00 ? 45  TYR A CA   2  
ATOM 2395  C C    . TYR A 1 45  ? 4.108   7.637   -3.730  1.00 0.00 ? 45  TYR A C    2  
ATOM 2396  O O    . TYR A 1 45  ? 4.789   8.549   -4.196  1.00 0.00 ? 45  TYR A O    2  
ATOM 2397  C CB   . TYR A 1 45  ? 4.891   5.583   -4.903  1.00 0.00 ? 45  TYR A CB   2  
ATOM 2398  C CG   . TYR A 1 45  ? 4.587   4.378   -5.795  1.00 0.00 ? 45  TYR A CG   2  
ATOM 2399  C CD1  . TYR A 1 45  ? 4.625   4.508   -7.168  1.00 0.00 ? 45  TYR A CD1  2  
ATOM 2400  C CD2  . TYR A 1 45  ? 4.274   3.160   -5.225  1.00 0.00 ? 45  TYR A CD2  2  
ATOM 2401  C CE1  . TYR A 1 45  ? 4.339   3.373   -8.007  1.00 0.00 ? 45  TYR A CE1  2  
ATOM 2402  C CE2  . TYR A 1 45  ? 3.988   2.025   -6.064  1.00 0.00 ? 45  TYR A CE2  2  
ATOM 2403  C CZ   . TYR A 1 45  ? 4.034   2.187   -7.413  1.00 0.00 ? 45  TYR A CZ   2  
ATOM 2404  O OH   . TYR A 1 45  ? 3.764   1.115   -8.205  1.00 0.00 ? 45  TYR A OH   2  
ATOM 2405  H H    . TYR A 1 45  ? 3.802   7.580   -6.365  1.00 0.00 ? 45  TYR A H    2  
ATOM 2406  H HA   . TYR A 1 45  ? 2.856   5.935   -4.122  1.00 0.00 ? 45  TYR A HA   2  
ATOM 2407  H HB2  . TYR A 1 45  ? 5.660   6.191   -5.381  1.00 0.00 ? 45  TYR A HB2  2  
ATOM 2408  H HB3  . TYR A 1 45  ? 5.305   5.229   -3.959  1.00 0.00 ? 45  TYR A HB3  2  
ATOM 2409  H HD1  . TYR A 1 45  ? 4.871   5.469   -7.618  1.00 0.00 ? 45  TYR A HD1  2  
ATOM 2410  H HD2  . TYR A 1 45  ? 4.245   3.057   -4.140  1.00 0.00 ? 45  TYR A HD2  2  
ATOM 2411  H HE1  . TYR A 1 45  ? 4.365   3.462   -9.093  1.00 0.00 ? 45  TYR A HE1  2  
ATOM 2412  H HE2  . TYR A 1 45  ? 3.740   1.057   -5.627  1.00 0.00 ? 45  TYR A HE2  2  
ATOM 2413  H HH   . TYR A 1 45  ? 2.890   1.247   -8.672  1.00 0.00 ? 45  TYR A HH   2  
ATOM 2414  N N    . VAL A 1 46  ? 3.696   7.575   -2.472  1.00 0.00 ? 46  VAL A N    2  
ATOM 2415  C CA   . VAL A 1 46  ? 4.034   8.621   -1.522  1.00 0.00 ? 46  VAL A CA   2  
ATOM 2416  C C    . VAL A 1 46  ? 5.548   8.636   -1.303  1.00 0.00 ? 46  VAL A C    2  
ATOM 2417  O O    . VAL A 1 46  ? 6.138   7.616   -0.952  1.00 0.00 ? 46  VAL A O    2  
ATOM 2418  C CB   . VAL A 1 46  ? 3.245   8.424   -0.225  1.00 0.00 ? 46  VAL A CB   2  
ATOM 2419  C CG1  . VAL A 1 46  ? 3.810   9.295   0.898   1.00 0.00 ? 46  VAL A CG1  2  
ATOM 2420  C CG2  . VAL A 1 46  ? 1.756   8.705   -0.441  1.00 0.00 ? 46  VAL A CG2  2  
ATOM 2421  H H    . VAL A 1 46  ? 3.142   6.829   -2.101  1.00 0.00 ? 46  VAL A H    2  
ATOM 2422  H HA   . VAL A 1 46  ? 3.732   9.572   -1.959  1.00 0.00 ? 46  VAL A HA   2  
ATOM 2423  H HB   . VAL A 1 46  ? 3.348   7.381   0.075   1.00 0.00 ? 46  VAL A HB   2  
ATOM 2424  H HG11 . VAL A 1 46  ? 4.861   9.050   1.054   1.00 0.00 ? 46  VAL A HG11 2  
ATOM 2425  H HG12 . VAL A 1 46  ? 3.720   10.346  0.623   1.00 0.00 ? 46  VAL A HG12 2  
ATOM 2426  H HG13 . VAL A 1 46  ? 3.254   9.111   1.817   1.00 0.00 ? 46  VAL A HG13 2  
ATOM 2427  H HG21 . VAL A 1 46  ? 1.239   7.772   -0.662  1.00 0.00 ? 46  VAL A HG21 2  
ATOM 2428  H HG22 . VAL A 1 46  ? 1.336   9.149   0.461   1.00 0.00 ? 46  VAL A HG22 2  
ATOM 2429  H HG23 . VAL A 1 46  ? 1.634   9.395   -1.276  1.00 0.00 ? 46  VAL A HG23 2  
ATOM 2430  N N    . SER A 1 47  ? 6.133   9.805   -1.521  1.00 0.00 ? 47  SER A N    2  
ATOM 2431  C CA   . SER A 1 47  ? 7.567   9.966   -1.353  1.00 0.00 ? 47  SER A CA   2  
ATOM 2432  C C    . SER A 1 47  ? 7.874   10.482  0.054   1.00 0.00 ? 47  SER A C    2  
ATOM 2433  O O    . SER A 1 47  ? 8.982   10.303  0.557   1.00 0.00 ? 47  SER A O    2  
ATOM 2434  C CB   . SER A 1 47  ? 8.141   10.918  -2.404  1.00 0.00 ? 47  SER A CB   2  
ATOM 2435  O OG   . SER A 1 47  ? 9.109   11.805  -1.849  1.00 0.00 ? 47  SER A OG   2  
ATOM 2436  H H    . SER A 1 47  ? 5.646   10.629  -1.807  1.00 0.00 ? 47  SER A H    2  
ATOM 2437  H HA   . SER A 1 47  ? 7.989   8.971   -1.496  1.00 0.00 ? 47  SER A HA   2  
ATOM 2438  H HB2  . SER A 1 47  ? 8.599   10.339  -3.207  1.00 0.00 ? 47  SER A HB2  2  
ATOM 2439  H HB3  . SER A 1 47  ? 7.332   11.496  -2.850  1.00 0.00 ? 47  SER A HB3  2  
ATOM 2440  H HG   . SER A 1 47  ? 9.873   11.284  -1.469  1.00 0.00 ? 47  SER A HG   2  
ATOM 2441  N N    . LYS A 1 48  ? 6.873   11.113  0.650   1.00 0.00 ? 48  LYS A N    2  
ATOM 2442  C CA   . LYS A 1 48  ? 7.022   11.656  1.990   1.00 0.00 ? 48  LYS A CA   2  
ATOM 2443  C C    . LYS A 1 48  ? 5.691   12.261  2.441   1.00 0.00 ? 48  LYS A C    2  
ATOM 2444  O O    . LYS A 1 48  ? 4.769   12.409  1.640   1.00 0.00 ? 48  LYS A O    2  
ATOM 2445  C CB   . LYS A 1 48  ? 8.193   12.639  2.042   1.00 0.00 ? 48  LYS A CB   2  
ATOM 2446  C CG   . LYS A 1 48  ? 8.826   12.664  3.435   1.00 0.00 ? 48  LYS A CG   2  
ATOM 2447  C CD   . LYS A 1 48  ? 10.300  12.258  3.375   1.00 0.00 ? 48  LYS A CD   2  
ATOM 2448  C CE   . LYS A 1 48  ? 10.448  10.737  3.316   1.00 0.00 ? 48  LYS A CE   2  
ATOM 2449  N NZ   . LYS A 1 48  ? 11.035  10.323  2.021   1.00 0.00 ? 48  LYS A NZ   2  
ATOM 2450  H H    . LYS A 1 48  ? 5.974   11.254  0.234   1.00 0.00 ? 48  LYS A H    2  
ATOM 2451  H HA   . LYS A 1 48  ? 7.267   10.827  2.653   1.00 0.00 ? 48  LYS A HA   2  
ATOM 2452  H HB2  . LYS A 1 48  ? 8.943   12.357  1.303   1.00 0.00 ? 48  LYS A HB2  2  
ATOM 2453  H HB3  . LYS A 1 48  ? 7.846   13.638  1.778   1.00 0.00 ? 48  LYS A HB3  2  
ATOM 2454  H HG2  . LYS A 1 48  ? 8.737   13.663  3.861   1.00 0.00 ? 48  LYS A HG2  2  
ATOM 2455  H HG3  . LYS A 1 48  ? 8.286   11.986  4.096   1.00 0.00 ? 48  LYS A HG3  2  
ATOM 2456  H HD2  . LYS A 1 48  ? 10.769  12.707  2.499   1.00 0.00 ? 48  LYS A HD2  2  
ATOM 2457  H HD3  . LYS A 1 48  ? 10.823  12.645  4.249   1.00 0.00 ? 48  LYS A HD3  2  
ATOM 2458  H HE2  . LYS A 1 48  ? 11.082  10.395  4.134   1.00 0.00 ? 48  LYS A HE2  2  
ATOM 2459  H HE3  . LYS A 1 48  ? 9.475   10.265  3.448   1.00 0.00 ? 48  LYS A HE3  2  
ATOM 2460  H HZ1  . LYS A 1 48  ? 11.033  11.099  1.391   1.00 0.00 ? 48  LYS A HZ1  2  
ATOM 2461  H HZ2  . LYS A 1 48  ? 11.974  10.012  2.165   1.00 0.00 ? 48  LYS A HZ2  2  
ATOM 2462  H HZ3  . LYS A 1 48  ? 10.493  9.577   1.633   1.00 0.00 ? 48  LYS A HZ3  2  
ATOM 2463  N N    . VAL A 1 49  ? 5.633   12.595  3.722   1.00 0.00 ? 49  VAL A N    2  
ATOM 2464  C CA   . VAL A 1 49  ? 4.430   13.181  4.289   1.00 0.00 ? 49  VAL A CA   2  
ATOM 2465  C C    . VAL A 1 49  ? 4.814   14.098  5.452   1.00 0.00 ? 49  VAL A C    2  
ATOM 2466  O O    . VAL A 1 49  ? 5.385   13.644  6.443   1.00 0.00 ? 49  VAL A O    2  
ATOM 2467  C CB   . VAL A 1 49  ? 3.452   12.077  4.696   1.00 0.00 ? 49  VAL A CB   2  
ATOM 2468  C CG1  . VAL A 1 49  ? 4.161   10.986  5.502   1.00 0.00 ? 49  VAL A CG1  2  
ATOM 2469  C CG2  . VAL A 1 49  ? 2.268   12.653  5.475   1.00 0.00 ? 49  VAL A CG2  2  
ATOM 2470  H H    . VAL A 1 49  ? 6.387   12.472  4.366   1.00 0.00 ? 49  VAL A H    2  
ATOM 2471  H HA   . VAL A 1 49  ? 3.958   13.780  3.511   1.00 0.00 ? 49  VAL A HA   2  
ATOM 2472  H HB   . VAL A 1 49  ? 3.064   11.621  3.785   1.00 0.00 ? 49  VAL A HB   2  
ATOM 2473  H HG11 . VAL A 1 49  ? 3.486   10.603  6.267   1.00 0.00 ? 49  VAL A HG11 2  
ATOM 2474  H HG12 . VAL A 1 49  ? 4.454   10.174  4.836   1.00 0.00 ? 49  VAL A HG12 2  
ATOM 2475  H HG13 . VAL A 1 49  ? 5.048   11.404  5.977   1.00 0.00 ? 49  VAL A HG13 2  
ATOM 2476  H HG21 . VAL A 1 49  ? 2.543   12.762  6.524   1.00 0.00 ? 49  VAL A HG21 2  
ATOM 2477  H HG22 . VAL A 1 49  ? 2.004   13.628  5.065   1.00 0.00 ? 49  VAL A HG22 2  
ATOM 2478  H HG23 . VAL A 1 49  ? 1.416   11.979  5.391   1.00 0.00 ? 49  VAL A HG23 2  
ATOM 2479  N N    . THR A 1 50  ? 4.486   15.371  5.293   1.00 0.00 ? 50  THR A N    2  
ATOM 2480  C CA   . THR A 1 50  ? 4.789   16.356  6.317   1.00 0.00 ? 50  THR A CA   2  
ATOM 2481  C C    . THR A 1 50  ? 4.235   15.906  7.671   1.00 0.00 ? 50  THR A C    2  
ATOM 2482  O O    . THR A 1 50  ? 3.471   14.945  7.744   1.00 0.00 ? 50  THR A O    2  
ATOM 2483  C CB   . THR A 1 50  ? 4.238   17.706  5.854   1.00 0.00 ? 50  THR A CB   2  
ATOM 2484  O OG1  . THR A 1 50  ? 4.964   17.985  4.659   1.00 0.00 ? 50  THR A OG1  2  
ATOM 2485  C CG2  . THR A 1 50  ? 4.619   18.849  6.797   1.00 0.00 ? 50  THR A CG2  2  
ATOM 2486  H H    . THR A 1 50  ? 4.022   15.732  4.484   1.00 0.00 ? 50  THR A H    2  
ATOM 2487  H HA   . THR A 1 50  ? 5.873   16.421  6.421   1.00 0.00 ? 50  THR A HA   2  
ATOM 2488  H HB   . THR A 1 50  ? 3.158   17.658  5.715   1.00 0.00 ? 50  THR A HB   2  
ATOM 2489  H HG1  . THR A 1 50  ? 4.415   18.561  4.053   1.00 0.00 ? 50  THR A HG1  2  
ATOM 2490  H HG21 . THR A 1 50  ? 4.313   19.799  6.359   1.00 0.00 ? 50  THR A HG21 2  
ATOM 2491  H HG22 . THR A 1 50  ? 4.117   18.712  7.755   1.00 0.00 ? 50  THR A HG22 2  
ATOM 2492  H HG23 . THR A 1 50  ? 5.699   18.850  6.949   1.00 0.00 ? 50  THR A HG23 2  
ATOM 2493  N N    . VAL A 1 51  ? 4.642   16.622  8.709   1.00 0.00 ? 51  VAL A N    2  
ATOM 2494  C CA   . VAL A 1 51  ? 4.196   16.308  10.055  1.00 0.00 ? 51  VAL A CA   2  
ATOM 2495  C C    . VAL A 1 51  ? 3.254   17.409  10.545  1.00 0.00 ? 51  VAL A C    2  
ATOM 2496  O O    . VAL A 1 51  ? 3.441   18.581  10.222  1.00 0.00 ? 51  VAL A O    2  
ATOM 2497  C CB   . VAL A 1 51  ? 5.404   16.103  10.972  1.00 0.00 ? 51  VAL A CB   2  
ATOM 2498  C CG1  . VAL A 1 51  ? 6.050   17.441  11.335  1.00 0.00 ? 51  VAL A CG1  2  
ATOM 2499  C CG2  . VAL A 1 51  ? 5.011   15.325  12.230  1.00 0.00 ? 51  VAL A CG2  2  
ATOM 2500  H H    . VAL A 1 51  ? 5.264   17.402  8.640   1.00 0.00 ? 51  VAL A H    2  
ATOM 2501  H HA   . VAL A 1 51  ? 3.645   15.369  10.009  1.00 0.00 ? 51  VAL A HA   2  
ATOM 2502  H HB   . VAL A 1 51  ? 6.141   15.511  10.429  1.00 0.00 ? 51  VAL A HB   2  
ATOM 2503  H HG11 . VAL A 1 51  ? 6.398   17.934  10.427  1.00 0.00 ? 51  VAL A HG11 2  
ATOM 2504  H HG12 . VAL A 1 51  ? 5.318   18.075  11.835  1.00 0.00 ? 51  VAL A HG12 2  
ATOM 2505  H HG13 . VAL A 1 51  ? 6.895   17.268  12.001  1.00 0.00 ? 51  VAL A HG13 2  
ATOM 2506  H HG21 . VAL A 1 51  ? 3.965   15.519  12.465  1.00 0.00 ? 51  VAL A HG21 2  
ATOM 2507  H HG22 . VAL A 1 51  ? 5.153   14.258  12.056  1.00 0.00 ? 51  VAL A HG22 2  
ATOM 2508  H HG23 . VAL A 1 51  ? 5.637   15.643  13.064  1.00 0.00 ? 51  VAL A HG23 2  
ATOM 2509  N N    . GLY A 1 52  ? 2.260   16.993  11.317  1.00 0.00 ? 52  GLY A N    2  
ATOM 2510  C CA   . GLY A 1 52  ? 1.288   17.930  11.855  1.00 0.00 ? 52  GLY A CA   2  
ATOM 2511  C C    . GLY A 1 52  ? 0.423   18.522  10.740  1.00 0.00 ? 52  GLY A C    2  
ATOM 2512  O O    . GLY A 1 52  ? -0.269  19.518  10.949  1.00 0.00 ? 52  GLY A O    2  
ATOM 2513  H H    . GLY A 1 52  ? 2.115   16.038  11.575  1.00 0.00 ? 52  GLY A H    2  
ATOM 2514  H HA2  . GLY A 1 52  ? 0.654   17.423  12.582  1.00 0.00 ? 52  GLY A HA2  2  
ATOM 2515  H HA3  . GLY A 1 52  ? 1.804   18.731  12.385  1.00 0.00 ? 52  GLY A HA3  2  
ATOM 2516  N N    . SER A 1 53  ? 0.491   17.885  9.581   1.00 0.00 ? 53  SER A N    2  
ATOM 2517  C CA   . SER A 1 53  ? -0.278  18.337  8.433   1.00 0.00 ? 53  SER A CA   2  
ATOM 2518  C C    . SER A 1 53  ? -1.499  17.437  8.234   1.00 0.00 ? 53  SER A C    2  
ATOM 2519  O O    . SER A 1 53  ? -1.546  16.324  8.756   1.00 0.00 ? 53  SER A O    2  
ATOM 2520  C CB   . SER A 1 53  ? 0.581   18.354  7.167   1.00 0.00 ? 53  SER A CB   2  
ATOM 2521  O OG   . SER A 1 53  ? 1.936   18.697  7.446   1.00 0.00 ? 53  SER A OG   2  
ATOM 2522  H H    . SER A 1 53  ? 1.056   17.076  9.419   1.00 0.00 ? 53  SER A H    2  
ATOM 2523  H HA   . SER A 1 53  ? -0.587  19.353  8.675   1.00 0.00 ? 53  SER A HA   2  
ATOM 2524  H HB2  . SER A 1 53  ? 0.546   17.374  6.692   1.00 0.00 ? 53  SER A HB2  2  
ATOM 2525  H HB3  . SER A 1 53  ? 0.166   19.068  6.456   1.00 0.00 ? 53  SER A HB3  2  
ATOM 2526  H HG   . SER A 1 53  ? 2.021   19.014  8.390   1.00 0.00 ? 53  SER A HG   2  
ATOM 2527  N N    . ILE A 1 54  ? -2.457  17.952  7.477   1.00 0.00 ? 54  ILE A N    2  
ATOM 2528  C CA   . ILE A 1 54  ? -3.675  17.208  7.203   1.00 0.00 ? 54  ILE A CA   2  
ATOM 2529  C C    . ILE A 1 54  ? -3.331  15.731  7.002   1.00 0.00 ? 54  ILE A C    2  
ATOM 2530  O O    . ILE A 1 54  ? -3.731  14.883  7.798   1.00 0.00 ? 54  ILE A O    2  
ATOM 2531  C CB   . ILE A 1 54  ? -4.428  17.830  6.025   1.00 0.00 ? 54  ILE A CB   2  
ATOM 2532  C CG1  . ILE A 1 54  ? -4.832  19.273  6.333   1.00 0.00 ? 54  ILE A CG1  2  
ATOM 2533  C CG2  . ILE A 1 54  ? -5.629  16.971  5.627   1.00 0.00 ? 54  ILE A CG2  2  
ATOM 2534  C CD1  . ILE A 1 54  ? -5.776  19.333  7.537   1.00 0.00 ? 54  ILE A CD1  2  
ATOM 2535  H H    . ILE A 1 54  ? -2.411  18.858  7.057   1.00 0.00 ? 54  ILE A H    2  
ATOM 2536  H HA   . ILE A 1 54  ? -4.316  17.298  8.079   1.00 0.00 ? 54  ILE A HA   2  
ATOM 2537  H HB   . ILE A 1 54  ? -3.756  17.861  5.167   1.00 0.00 ? 54  ILE A HB   2  
ATOM 2538  H HG12 . ILE A 1 54  ? -3.942  19.869  6.535   1.00 0.00 ? 54  ILE A HG12 2  
ATOM 2539  H HG13 . ILE A 1 54  ? -5.319  19.712  5.463   1.00 0.00 ? 54  ILE A HG13 2  
ATOM 2540  H HG21 . ILE A 1 54  ? -6.422  17.611  5.240   1.00 0.00 ? 54  ILE A HG21 2  
ATOM 2541  H HG22 . ILE A 1 54  ? -5.329  16.259  4.858   1.00 0.00 ? 54  ILE A HG22 2  
ATOM 2542  H HG23 . ILE A 1 54  ? -5.994  16.429  6.500   1.00 0.00 ? 54  ILE A HG23 2  
ATOM 2543  H HD11 . ILE A 1 54  ? -6.374  18.423  7.575   1.00 0.00 ? 54  ILE A HD11 2  
ATOM 2544  H HD12 . ILE A 1 54  ? -5.191  19.423  8.452   1.00 0.00 ? 54  ILE A HD12 2  
ATOM 2545  H HD13 . ILE A 1 54  ? -6.434  20.197  7.440   1.00 0.00 ? 54  ILE A HD13 2  
ATOM 2546  N N    . ALA A 1 55  ? -2.593  15.468  5.933   1.00 0.00 ? 55  ALA A N    2  
ATOM 2547  C CA   . ALA A 1 55  ? -2.191  14.108  5.617   1.00 0.00 ? 55  ALA A CA   2  
ATOM 2548  C C    . ALA A 1 55  ? -1.822  13.377  6.910   1.00 0.00 ? 55  ALA A C    2  
ATOM 2549  O O    . ALA A 1 55  ? -2.507  12.439  7.313   1.00 0.00 ? 55  ALA A O    2  
ATOM 2550  C CB   . ALA A 1 55  ? -1.036  14.137  4.614   1.00 0.00 ? 55  ALA A CB   2  
ATOM 2551  H H    . ALA A 1 55  ? -2.271  16.164  5.290   1.00 0.00 ? 55  ALA A H    2  
ATOM 2552  H HA   . ALA A 1 55  ? -3.043  13.609  5.157   1.00 0.00 ? 55  ALA A HA   2  
ATOM 2553  H HB1  . ALA A 1 55  ? -0.476  15.065  4.731   1.00 0.00 ? 55  ALA A HB1  2  
ATOM 2554  H HB2  . ALA A 1 55  ? -0.376  13.289  4.795   1.00 0.00 ? 55  ALA A HB2  2  
ATOM 2555  H HB3  . ALA A 1 55  ? -1.434  14.078  3.601   1.00 0.00 ? 55  ALA A HB3  2  
ATOM 2556  N N    . HIS A 1 56  ? -0.740  13.835  7.523   1.00 0.00 ? 56  HIS A N    2  
ATOM 2557  C CA   . HIS A 1 56  ? -0.272  13.236  8.761   1.00 0.00 ? 56  HIS A CA   2  
ATOM 2558  C C    . HIS A 1 56  ? -1.467  12.926  9.665   1.00 0.00 ? 56  HIS A C    2  
ATOM 2559  O O    . HIS A 1 56  ? -1.562  11.833  10.221  1.00 0.00 ? 56  HIS A O    2  
ATOM 2560  C CB   . HIS A 1 56  ? 0.768   14.131  9.439   1.00 0.00 ? 56  HIS A CB   2  
ATOM 2561  C CG   . HIS A 1 56  ? 1.709   13.391  10.359  1.00 0.00 ? 56  HIS A CG   2  
ATOM 2562  N ND1  . HIS A 1 56  ? 1.333   12.944  11.614  1.00 0.00 ? 56  HIS A ND1  2  
ATOM 2563  C CD2  . HIS A 1 56  ? 3.012   13.024  10.193  1.00 0.00 ? 56  HIS A CD2  2  
ATOM 2564  C CE1  . HIS A 1 56  ? 2.372   12.338  12.170  1.00 0.00 ? 56  HIS A CE1  2  
ATOM 2565  N NE2  . HIS A 1 56  ? 3.411   12.389  11.288  1.00 0.00 ? 56  HIS A NE2  2  
ATOM 2566  H H    . HIS A 1 56  ? -0.188  14.599  7.188   1.00 0.00 ? 56  HIS A H    2  
ATOM 2567  H HA   . HIS A 1 56  ? 0.220   12.301  8.490   1.00 0.00 ? 56  HIS A HA   2  
ATOM 2568  H HB2  . HIS A 1 56  ? 1.351   14.638  8.670   1.00 0.00 ? 56  HIS A HB2  2  
ATOM 2569  H HB3  . HIS A 1 56  ? 0.251   14.903  10.008  1.00 0.00 ? 56  HIS A HB3  2  
ATOM 2570  H HD1  . HIS A 1 56  ? 0.431   13.060  12.030  1.00 0.00 ? 56  HIS A HD1  2  
ATOM 2571  H HD2  . HIS A 1 56  ? 3.622   13.219  9.311   1.00 0.00 ? 56  HIS A HD2  2  
ATOM 2572  H HE1  . HIS A 1 56  ? 2.392   11.879  13.158  1.00 0.00 ? 56  HIS A HE1  2  
ATOM 2573  N N    . GLN A 1 57  ? -2.349  13.908  9.784   1.00 0.00 ? 57  GLN A N    2  
ATOM 2574  C CA   . GLN A 1 57  ? -3.533  13.754  10.611  1.00 0.00 ? 57  GLN A CA   2  
ATOM 2575  C C    . GLN A 1 57  ? -4.393  12.598  10.096  1.00 0.00 ? 57  GLN A C    2  
ATOM 2576  O O    . GLN A 1 57  ? -4.904  11.801  10.882  1.00 0.00 ? 57  GLN A O    2  
ATOM 2577  C CB   . GLN A 1 57  ? -4.338  15.054  10.664  1.00 0.00 ? 57  GLN A CB   2  
ATOM 2578  C CG   . GLN A 1 57  ? -3.463  16.222  11.125  1.00 0.00 ? 57  GLN A CG   2  
ATOM 2579  C CD   . GLN A 1 57  ? -4.258  17.189  12.004  1.00 0.00 ? 57  GLN A CD   2  
ATOM 2580  O OE1  . GLN A 1 57  ? -5.478  17.198  12.016  1.00 0.00 ? 57  GLN A OE1  2  
ATOM 2581  N NE2  . GLN A 1 57  ? -3.501  18.002  12.736  1.00 0.00 ? 57  GLN A NE2  2  
ATOM 2582  H H    . GLN A 1 57  ? -2.264  14.794  9.328   1.00 0.00 ? 57  GLN A H    2  
ATOM 2583  H HA   . GLN A 1 57  ? -3.162  13.522  11.609  1.00 0.00 ? 57  GLN A HA   2  
ATOM 2584  H HB2  . GLN A 1 57  ? -4.751  15.271  9.679   1.00 0.00 ? 57  GLN A HB2  2  
ATOM 2585  H HB3  . GLN A 1 57  ? -5.181  14.937  11.344  1.00 0.00 ? 57  GLN A HB3  2  
ATOM 2586  H HG2  . GLN A 1 57  ? -2.605  15.841  11.680  1.00 0.00 ? 57  GLN A HG2  2  
ATOM 2587  H HG3  . GLN A 1 57  ? -3.071  16.752  10.257  1.00 0.00 ? 57  GLN A HG3  2  
ATOM 2588  H HE21 . GLN A 1 57  ? -2.504  17.943  12.678  1.00 0.00 ? 57  GLN A HE21 2  
ATOM 2589  H HE22 . GLN A 1 57  ? -3.928  18.671  13.343  1.00 0.00 ? 57  GLN A HE22 2  
ATOM 2590  N N    . ALA A 1 58  ? -4.528  12.543  8.779   1.00 0.00 ? 58  ALA A N    2  
ATOM 2591  C CA   . ALA A 1 58  ? -5.317  11.498  8.150   1.00 0.00 ? 58  ALA A CA   2  
ATOM 2592  C C    . ALA A 1 58  ? -4.727  10.133  8.509   1.00 0.00 ? 58  ALA A C    2  
ATOM 2593  O O    . ALA A 1 58  ? -5.461  9.161   8.680   1.00 0.00 ? 58  ALA A O    2  
ATOM 2594  C CB   . ALA A 1 58  ? -5.365  11.733  6.638   1.00 0.00 ? 58  ALA A CB   2  
ATOM 2595  H H    . ALA A 1 58  ? -4.109  13.195  8.146   1.00 0.00 ? 58  ALA A H    2  
ATOM 2596  H HA   . ALA A 1 58  ? -6.330  11.563  8.547   1.00 0.00 ? 58  ALA A HA   2  
ATOM 2597  H HB1  . ALA A 1 58  ? -5.267  12.799  6.434   1.00 0.00 ? 58  ALA A HB1  2  
ATOM 2598  H HB2  . ALA A 1 58  ? -4.546  11.195  6.161   1.00 0.00 ? 58  ALA A HB2  2  
ATOM 2599  H HB3  . ALA A 1 58  ? -6.315  11.374  6.244   1.00 0.00 ? 58  ALA A HB3  2  
ATOM 2600  N N    . GLY A 1 59  ? -3.406  10.103  8.612   1.00 0.00 ? 59  GLY A N    2  
ATOM 2601  C CA   . GLY A 1 59  ? -2.709  8.874   8.947   1.00 0.00 ? 59  GLY A CA   2  
ATOM 2602  C C    . GLY A 1 59  ? -2.122  8.217   7.696   1.00 0.00 ? 59  GLY A C    2  
ATOM 2603  O O    . GLY A 1 59  ? -2.256  7.009   7.503   1.00 0.00 ? 59  GLY A O    2  
ATOM 2604  H H    . GLY A 1 59  ? -2.816  10.899  8.470   1.00 0.00 ? 59  GLY A H    2  
ATOM 2605  H HA2  . GLY A 1 59  ? -1.911  9.086   9.659   1.00 0.00 ? 59  GLY A HA2  2  
ATOM 2606  H HA3  . GLY A 1 59  ? -3.396  8.183   9.436   1.00 0.00 ? 59  GLY A HA3  2  
ATOM 2607  N N    . LEU A 1 60  ? -1.485  9.041   6.878   1.00 0.00 ? 60  LEU A N    2  
ATOM 2608  C CA   . LEU A 1 60  ? -0.877  8.556   5.650   1.00 0.00 ? 60  LEU A CA   2  
ATOM 2609  C C    . LEU A 1 60  ? 0.567   8.138   5.932   1.00 0.00 ? 60  LEU A C    2  
ATOM 2610  O O    . LEU A 1 60  ? 1.073   8.343   7.034   1.00 0.00 ? 60  LEU A O    2  
ATOM 2611  C CB   . LEU A 1 60  ? -1.010  9.598   4.538   1.00 0.00 ? 60  LEU A CB   2  
ATOM 2612  C CG   . LEU A 1 60  ? -2.403  9.749   3.923   1.00 0.00 ? 60  LEU A CG   2  
ATOM 2613  C CD1  . LEU A 1 60  ? -2.425  10.872  2.885   1.00 0.00 ? 60  LEU A CD1  2  
ATOM 2614  C CD2  . LEU A 1 60  ? -2.892  8.421   3.341   1.00 0.00 ? 60  LEU A CD2  2  
ATOM 2615  H H    . LEU A 1 60  ? -1.381  10.022  7.041   1.00 0.00 ? 60  LEU A H    2  
ATOM 2616  H HA   . LEU A 1 60  ? -1.437  7.675   5.335   1.00 0.00 ? 60  LEU A HA   2  
ATOM 2617  H HB2  . LEU A 1 60  ? -0.703  10.565  4.935   1.00 0.00 ? 60  LEU A HB2  2  
ATOM 2618  H HB3  . LEU A 1 60  ? -0.309  9.343   3.743   1.00 0.00 ? 60  LEU A HB3  2  
ATOM 2619  H HG   . LEU A 1 60  ? -3.097  10.029  4.715   1.00 0.00 ? 60  LEU A HG   2  
ATOM 2620  H HD11 . LEU A 1 60  ? -2.394  11.837  3.392   1.00 0.00 ? 60  LEU A HD11 2  
ATOM 2621  H HD12 . LEU A 1 60  ? -1.559  10.779  2.229   1.00 0.00 ? 60  LEU A HD12 2  
ATOM 2622  H HD13 . LEU A 1 60  ? -3.337  10.802  2.293   1.00 0.00 ? 60  LEU A HD13 2  
ATOM 2623  H HD21 . LEU A 1 60  ? -2.083  7.691   3.371   1.00 0.00 ? 60  LEU A HD21 2  
ATOM 2624  H HD22 . LEU A 1 60  ? -3.734  8.055   3.929   1.00 0.00 ? 60  LEU A HD22 2  
ATOM 2625  H HD23 . LEU A 1 60  ? -3.208  8.571   2.309   1.00 0.00 ? 60  LEU A HD23 2  
ATOM 2626  N N    . GLU A 1 61  ? 1.191   7.558   4.917   1.00 0.00 ? 61  GLU A N    2  
ATOM 2627  C CA   . GLU A 1 61  ? 2.567   7.109   5.041   1.00 0.00 ? 61  GLU A CA   2  
ATOM 2628  C C    . GLU A 1 61  ? 3.180   6.887   3.657   1.00 0.00 ? 61  GLU A C    2  
ATOM 2629  O O    . GLU A 1 61  ? 2.491   6.997   2.644   1.00 0.00 ? 61  GLU A O    2  
ATOM 2630  C CB   . GLU A 1 61  ? 2.655   5.839   5.890   1.00 0.00 ? 61  GLU A CB   2  
ATOM 2631  C CG   . GLU A 1 61  ? 1.993   4.657   5.178   1.00 0.00 ? 61  GLU A CG   2  
ATOM 2632  C CD   . GLU A 1 61  ? 1.417   3.662   6.187   1.00 0.00 ? 61  GLU A CD   2  
ATOM 2633  O OE1  . GLU A 1 61  ? 0.391   4.014   6.809   1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2634  O OE2  . GLU A 1 61  ? 2.015   2.572   6.314   1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2635  H H    . GLU A 1 61  ? 0.772   7.394   4.023   1.00 0.00 ? 61  GLU A H    2  
ATOM 2636  H HA   . GLU A 1 61  ? 3.090   7.917   5.553   1.00 0.00 ? 61  GLU A HA   2  
ATOM 2637  H HB2  . GLU A 1 61  ? 3.699   5.606   6.096   1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2638  H HB3  . GLU A 1 61  ? 2.170   6.006   6.852   1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2639  H HG2  . GLU A 1 61  ? 1.199   5.019   4.525   1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2640  H HG3  . GLU A 1 61  ? 2.724   4.155   4.544   1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2641  N N    . TYR A 1 62  ? 4.469   6.579   3.659   1.00 0.00 ? 62  TYR A N    2  
ATOM 2642  C CA   . TYR A 1 62  ? 5.183   6.341   2.416   1.00 0.00 ? 62  TYR A CA   2  
ATOM 2643  C C    . TYR A 1 62  ? 5.020   4.890   1.960   1.00 0.00 ? 62  TYR A C    2  
ATOM 2644  O O    . TYR A 1 62  ? 4.897   3.986   2.785   1.00 0.00 ? 62  TYR A O    2  
ATOM 2645  C CB   . TYR A 1 62  ? 6.659   6.604   2.720   1.00 0.00 ? 62  TYR A CB   2  
ATOM 2646  C CG   . TYR A 1 62  ? 7.590   6.378   1.528   1.00 0.00 ? 62  TYR A CG   2  
ATOM 2647  C CD1  . TYR A 1 62  ? 7.793   5.102   1.043   1.00 0.00 ? 62  TYR A CD1  2  
ATOM 2648  C CD2  . TYR A 1 62  ? 8.227   7.450   0.936   1.00 0.00 ? 62  TYR A CD2  2  
ATOM 2649  C CE1  . TYR A 1 62  ? 8.670   4.888   -0.079  1.00 0.00 ? 62  TYR A CE1  2  
ATOM 2650  C CE2  . TYR A 1 62  ? 9.104   7.237   -0.186  1.00 0.00 ? 62  TYR A CE2  2  
ATOM 2651  C CZ   . TYR A 1 62  ? 9.282   5.966   -0.638  1.00 0.00 ? 62  TYR A CZ   2  
ATOM 2652  O OH   . TYR A 1 62  ? 10.110  5.765   -1.698  1.00 0.00 ? 62  TYR A OH   2  
ATOM 2653  H H    . TYR A 1 62  ? 5.022   6.492   4.487   1.00 0.00 ? 62  TYR A H    2  
ATOM 2654  H HA   . TYR A 1 62  ? 4.766   7.002   1.656   1.00 0.00 ? 62  TYR A HA   2  
ATOM 2655  H HB2  . TYR A 1 62  ? 6.770   7.633   3.065   1.00 0.00 ? 62  TYR A HB2  2  
ATOM 2656  H HB3  . TYR A 1 62  ? 6.971   5.958   3.540   1.00 0.00 ? 62  TYR A HB3  2  
ATOM 2657  H HD1  . TYR A 1 62  ? 7.290   4.255   1.511   1.00 0.00 ? 62  TYR A HD1  2  
ATOM 2658  H HD2  . TYR A 1 62  ? 8.067   8.458   1.319   1.00 0.00 ? 62  TYR A HD2  2  
ATOM 2659  H HE1  . TYR A 1 62  ? 8.839   3.886   -0.471  1.00 0.00 ? 62  TYR A HE1  2  
ATOM 2660  H HE2  . TYR A 1 62  ? 9.613   8.074   -0.663  1.00 0.00 ? 62  TYR A HE2  2  
ATOM 2661  H HH   . TYR A 1 62  ? 9.954   6.468   -2.392  1.00 0.00 ? 62  TYR A HH   2  
ATOM 2662  N N    . GLY A 1 63  ? 5.024   4.712   0.647   1.00 0.00 ? 63  GLY A N    2  
ATOM 2663  C CA   . GLY A 1 63  ? 4.878   3.386   0.071   1.00 0.00 ? 63  GLY A CA   2  
ATOM 2664  C C    . GLY A 1 63  ? 3.406   3.063   -0.197  1.00 0.00 ? 63  GLY A C    2  
ATOM 2665  O O    . GLY A 1 63  ? 3.096   2.160   -0.972  1.00 0.00 ? 63  GLY A O    2  
ATOM 2666  H H    . GLY A 1 63  ? 5.124   5.452   -0.018  1.00 0.00 ? 63  GLY A H    2  
ATOM 2667  H HA2  . GLY A 1 63  ? 5.442   3.326   -0.860  1.00 0.00 ? 63  GLY A HA2  2  
ATOM 2668  H HA3  . GLY A 1 63  ? 5.300   2.643   0.747   1.00 0.00 ? 63  GLY A HA3  2  
ATOM 2669  N N    . ASP A 1 64  ? 2.539   3.819   0.460   1.00 0.00 ? 64  ASP A N    2  
ATOM 2670  C CA   . ASP A 1 64  ? 1.107   3.625   0.303   1.00 0.00 ? 64  ASP A CA   2  
ATOM 2671  C C    . ASP A 1 64  ? 0.683   4.094   -1.090  1.00 0.00 ? 64  ASP A C    2  
ATOM 2672  O O    . ASP A 1 64  ? 0.613   5.295   -1.349  1.00 0.00 ? 64  ASP A O    2  
ATOM 2673  C CB   . ASP A 1 64  ? 0.325   4.439   1.336   1.00 0.00 ? 64  ASP A CB   2  
ATOM 2674  C CG   . ASP A 1 64  ? -0.235  3.630   2.507   1.00 0.00 ? 64  ASP A CG   2  
ATOM 2675  O OD1  . ASP A 1 64  ? -0.089  2.389   2.462   1.00 0.00 ? 64  ASP A OD1  2  
ATOM 2676  O OD2  . ASP A 1 64  ? -0.796  4.271   3.422   1.00 0.00 ? 64  ASP A OD2  2  
ATOM 2677  H H    . ASP A 1 64  ? 2.800   4.552   1.089   1.00 0.00 ? 64  ASP A H    2  
ATOM 2678  H HA   . ASP A 1 64  ? 0.946   2.557   0.451   1.00 0.00 ? 64  ASP A HA   2  
ATOM 2679  H HB2  . ASP A 1 64  ? 0.976   5.219   1.730   1.00 0.00 ? 64  ASP A HB2  2  
ATOM 2680  H HB3  . ASP A 1 64  ? -0.502  4.939   0.831   1.00 0.00 ? 64  ASP A HB3  2  
ATOM 2681  N N    . GLN A 1 65  ? 0.411   3.124   -1.949  1.00 0.00 ? 65  GLN A N    2  
ATOM 2682  C CA   . GLN A 1 65  ? -0.004  3.423   -3.309  1.00 0.00 ? 65  GLN A CA   2  
ATOM 2683  C C    . GLN A 1 65  ? -1.436  3.963   -3.320  1.00 0.00 ? 65  GLN A C    2  
ATOM 2684  O O    . GLN A 1 65  ? -2.346  3.328   -2.789  1.00 0.00 ? 65  GLN A O    2  
ATOM 2685  C CB   . GLN A 1 65  ? 0.123   2.189   -4.205  1.00 0.00 ? 65  GLN A CB   2  
ATOM 2686  C CG   . GLN A 1 65  ? 0.334   2.592   -5.666  1.00 0.00 ? 65  GLN A CG   2  
ATOM 2687  C CD   . GLN A 1 65  ? -0.083  1.464   -6.612  1.00 0.00 ? 65  GLN A CD   2  
ATOM 2688  O OE1  . GLN A 1 65  ? 0.464   0.373   -6.598  1.00 0.00 ? 65  GLN A OE1  2  
ATOM 2689  N NE2  . GLN A 1 65  ? -1.079  1.786   -7.432  1.00 0.00 ? 65  GLN A NE2  2  
ATOM 2690  H H    . GLN A 1 65  ? 0.471   2.150   -1.730  1.00 0.00 ? 65  GLN A H    2  
ATOM 2691  H HA   . GLN A 1 65  ? 0.684   4.192   -3.660  1.00 0.00 ? 65  GLN A HA   2  
ATOM 2692  H HB2  . GLN A 1 65  ? 0.960   1.576   -3.869  1.00 0.00 ? 65  GLN A HB2  2  
ATOM 2693  H HB3  . GLN A 1 65  ? -0.775  1.578   -4.119  1.00 0.00 ? 65  GLN A HB3  2  
ATOM 2694  H HG2  . GLN A 1 65  ? -0.245  3.489   -5.887  1.00 0.00 ? 65  GLN A HG2  2  
ATOM 2695  H HG3  . GLN A 1 65  ? 1.383   2.841   -5.831  1.00 0.00 ? 65  GLN A HG3  2  
ATOM 2696  H HE21 . GLN A 1 65  ? -1.484  2.699   -7.392  1.00 0.00 ? 65  GLN A HE21 2  
ATOM 2697  H HE22 . GLN A 1 65  ? -1.423  1.114   -8.088  1.00 0.00 ? 65  GLN A HE22 2  
ATOM 2698  N N    . LEU A 1 66  ? -1.590  5.128   -3.930  1.00 0.00 ? 66  LEU A N    2  
ATOM 2699  C CA   . LEU A 1 66  ? -2.895  5.761   -4.017  1.00 0.00 ? 66  LEU A CA   2  
ATOM 2700  C C    . LEU A 1 66  ? -3.691  5.124   -5.159  1.00 0.00 ? 66  LEU A C    2  
ATOM 2701  O O    . LEU A 1 66  ? -3.396  5.355   -6.330  1.00 0.00 ? 66  LEU A O    2  
ATOM 2702  C CB   . LEU A 1 66  ? -2.748  7.279   -4.143  1.00 0.00 ? 66  LEU A CB   2  
ATOM 2703  C CG   . LEU A 1 66  ? -1.707  7.929   -3.229  1.00 0.00 ? 66  LEU A CG   2  
ATOM 2704  C CD1  . LEU A 1 66  ? -1.450  9.381   -3.638  1.00 0.00 ? 66  LEU A CD1  2  
ATOM 2705  C CD2  . LEU A 1 66  ? -2.119  7.812   -1.760  1.00 0.00 ? 66  LEU A CD2  2  
ATOM 2706  H H    . LEU A 1 66  ? -0.844  5.638   -4.360  1.00 0.00 ? 66  LEU A H    2  
ATOM 2707  H HA   . LEU A 1 66  ? -3.417  5.564   -3.081  1.00 0.00 ? 66  LEU A HA   2  
ATOM 2708  H HB2  . LEU A 1 66  ? -2.493  7.515   -5.176  1.00 0.00 ? 66  LEU A HB2  2  
ATOM 2709  H HB3  . LEU A 1 66  ? -3.716  7.736   -3.941  1.00 0.00 ? 66  LEU A HB3  2  
ATOM 2710  H HG   . LEU A 1 66  ? -0.767  7.390   -3.344  1.00 0.00 ? 66  LEU A HG   2  
ATOM 2711  H HD11 . LEU A 1 66  ? -1.406  9.450   -4.725  1.00 0.00 ? 66  LEU A HD11 2  
ATOM 2712  H HD12 . LEU A 1 66  ? -2.257  10.012  -3.266  1.00 0.00 ? 66  LEU A HD12 2  
ATOM 2713  H HD13 . LEU A 1 66  ? -0.502  9.715   -3.214  1.00 0.00 ? 66  LEU A HD13 2  
ATOM 2714  H HD21 . LEU A 1 66  ? -1.379  7.219   -1.222  1.00 0.00 ? 66  LEU A HD21 2  
ATOM 2715  H HD22 . LEU A 1 66  ? -2.178  8.807   -1.319  1.00 0.00 ? 66  LEU A HD22 2  
ATOM 2716  H HD23 . LEU A 1 66  ? -3.092  7.327   -1.693  1.00 0.00 ? 66  LEU A HD23 2  
ATOM 2717  N N    . LEU A 1 67  ? -4.683  4.334   -4.777  1.00 0.00 ? 67  LEU A N    2  
ATOM 2718  C CA   . LEU A 1 67  ? -5.523  3.662   -5.753  1.00 0.00 ? 67  LEU A CA   2  
ATOM 2719  C C    . LEU A 1 67  ? -6.579  4.641   -6.271  1.00 0.00 ? 67  LEU A C    2  
ATOM 2720  O O    . LEU A 1 67  ? -6.782  4.758   -7.479  1.00 0.00 ? 67  LEU A O    2  
ATOM 2721  C CB   . LEU A 1 67  ? -6.112  2.379   -5.162  1.00 0.00 ? 67  LEU A CB   2  
ATOM 2722  C CG   . LEU A 1 67  ? -5.138  1.212   -4.988  1.00 0.00 ? 67  LEU A CG   2  
ATOM 2723  C CD1  . LEU A 1 67  ? -5.832  0.010   -4.346  1.00 0.00 ? 67  LEU A CD1  2  
ATOM 2724  C CD2  . LEU A 1 67  ? -4.476  0.848   -6.319  1.00 0.00 ? 67  LEU A CD2  2  
ATOM 2725  H H    . LEU A 1 67  ? -4.916  4.151   -3.822  1.00 0.00 ? 67  LEU A H    2  
ATOM 2726  H HA   . LEU A 1 67  ? -4.885  3.369   -6.587  1.00 0.00 ? 67  LEU A HA   2  
ATOM 2727  H HB2  . LEU A 1 67  ? -6.542  2.616   -4.188  1.00 0.00 ? 67  LEU A HB2  2  
ATOM 2728  H HB3  . LEU A 1 67  ? -6.931  2.051   -5.801  1.00 0.00 ? 67  LEU A HB3  2  
ATOM 2729  H HG   . LEU A 1 67  ? -4.345  1.527   -4.310  1.00 0.00 ? 67  LEU A HG   2  
ATOM 2730  H HD11 . LEU A 1 67  ? -5.528  -0.070  -3.302  1.00 0.00 ? 67  LEU A HD11 2  
ATOM 2731  H HD12 . LEU A 1 67  ? -6.913  0.142   -4.400  1.00 0.00 ? 67  LEU A HD12 2  
ATOM 2732  H HD13 . LEU A 1 67  ? -5.550  -0.899  -4.877  1.00 0.00 ? 67  LEU A HD13 2  
ATOM 2733  H HD21 . LEU A 1 67  ? -5.008  1.337   -7.135  1.00 0.00 ? 67  LEU A HD21 2  
ATOM 2734  H HD22 . LEU A 1 67  ? -3.438  1.181   -6.311  1.00 0.00 ? 67  LEU A HD22 2  
ATOM 2735  H HD23 . LEU A 1 67  ? -4.510  -0.232  -6.458  1.00 0.00 ? 67  LEU A HD23 2  
ATOM 2736  N N    . GLU A 1 68  ? -7.222  5.319   -5.333  1.00 0.00 ? 68  GLU A N    2  
ATOM 2737  C CA   . GLU A 1 68  ? -8.252  6.284   -5.679  1.00 0.00 ? 68  GLU A CA   2  
ATOM 2738  C C    . GLU A 1 68  ? -8.339  7.374   -4.610  1.00 0.00 ? 68  GLU A C    2  
ATOM 2739  O O    . GLU A 1 68  ? -8.363  7.077   -3.416  1.00 0.00 ? 68  GLU A O    2  
ATOM 2740  C CB   . GLU A 1 68  ? -9.605  5.597   -5.873  1.00 0.00 ? 68  GLU A CB   2  
ATOM 2741  C CG   . GLU A 1 68  ? -9.616  4.759   -7.154  1.00 0.00 ? 68  GLU A CG   2  
ATOM 2742  C CD   . GLU A 1 68  ? -11.029 4.662   -7.733  1.00 0.00 ? 68  GLU A CD   2  
ATOM 2743  O OE1  . GLU A 1 68  ? -11.931 4.263   -6.965  1.00 0.00 ? 68  GLU A OE1  2  
ATOM 2744  O OE2  . GLU A 1 68  ? -11.175 4.987   -8.931  1.00 0.00 ? 68  GLU A OE2  2  
ATOM 2745  H H    . GLU A 1 68  ? -7.051  5.218   -4.353  1.00 0.00 ? 68  GLU A H    2  
ATOM 2746  H HA   . GLU A 1 68  ? -7.933  6.719   -6.626  1.00 0.00 ? 68  GLU A HA   2  
ATOM 2747  H HB2  . GLU A 1 68  ? -9.819  4.959   -5.016  1.00 0.00 ? 68  GLU A HB2  2  
ATOM 2748  H HB3  . GLU A 1 68  ? -10.395 6.346   -5.918  1.00 0.00 ? 68  GLU A HB3  2  
ATOM 2749  H HG2  . GLU A 1 68  ? -8.947  5.205   -7.890  1.00 0.00 ? 68  GLU A HG2  2  
ATOM 2750  H HG3  . GLU A 1 68  ? -9.236  3.760   -6.942  1.00 0.00 ? 68  GLU A HG3  2  
ATOM 2751  N N    . PHE A 1 69  ? -8.384  8.614   -5.076  1.00 0.00 ? 69  PHE A N    2  
ATOM 2752  C CA   . PHE A 1 69  ? -8.468  9.750   -4.174  1.00 0.00 ? 69  PHE A CA   2  
ATOM 2753  C C    . PHE A 1 69  ? -9.884  10.331  -4.154  1.00 0.00 ? 69  PHE A C    2  
ATOM 2754  O O    . PHE A 1 69  ? -10.295 11.006  -5.096  1.00 0.00 ? 69  PHE A O    2  
ATOM 2755  C CB   . PHE A 1 69  ? -7.501  10.812  -4.701  1.00 0.00 ? 69  PHE A CB   2  
ATOM 2756  C CG   . PHE A 1 69  ? -7.578  12.147  -3.957  1.00 0.00 ? 69  PHE A CG   2  
ATOM 2757  C CD1  . PHE A 1 69  ? -8.487  13.085  -4.335  1.00 0.00 ? 69  PHE A CD1  2  
ATOM 2758  C CD2  . PHE A 1 69  ? -6.737  12.396  -2.918  1.00 0.00 ? 69  PHE A CD2  2  
ATOM 2759  C CE1  . PHE A 1 69  ? -8.559  14.324  -3.646  1.00 0.00 ? 69  PHE A CE1  2  
ATOM 2760  C CE2  . PHE A 1 69  ? -6.808  13.635  -2.228  1.00 0.00 ? 69  PHE A CE2  2  
ATOM 2761  C CZ   . PHE A 1 69  ? -7.717  14.573  -2.606  1.00 0.00 ? 69  PHE A CZ   2  
ATOM 2762  H H    . PHE A 1 69  ? -8.364  8.847   -6.048  1.00 0.00 ? 69  PHE A H    2  
ATOM 2763  H HA   . PHE A 1 69  ? -8.211  9.391   -3.177  1.00 0.00 ? 69  PHE A HA   2  
ATOM 2764  H HB2  . PHE A 1 69  ? -6.483  10.428  -4.633  1.00 0.00 ? 69  PHE A HB2  2  
ATOM 2765  H HB3  . PHE A 1 69  ? -7.707  10.984  -5.757  1.00 0.00 ? 69  PHE A HB3  2  
ATOM 2766  H HD1  . PHE A 1 69  ? -9.162  12.885  -5.168  1.00 0.00 ? 69  PHE A HD1  2  
ATOM 2767  H HD2  . PHE A 1 69  ? -6.008  11.644  -2.615  1.00 0.00 ? 69  PHE A HD2  2  
ATOM 2768  H HE1  . PHE A 1 69  ? -9.287  15.075  -3.949  1.00 0.00 ? 69  PHE A HE1  2  
ATOM 2769  H HE2  . PHE A 1 69  ? -6.133  13.834  -1.395  1.00 0.00 ? 69  PHE A HE2  2  
ATOM 2770  H HZ   . PHE A 1 69  ? -7.772  15.524  -2.077  1.00 0.00 ? 69  PHE A HZ   2  
ATOM 2771  N N    . ASN A 1 70  ? -10.590 10.047  -3.070  1.00 0.00 ? 70  ASN A N    2  
ATOM 2772  C CA   . ASN A 1 70  ? -11.951 10.532  -2.915  1.00 0.00 ? 70  ASN A CA   2  
ATOM 2773  C C    . ASN A 1 70  ? -12.807 10.018  -4.075  1.00 0.00 ? 70  ASN A C    2  
ATOM 2774  O O    . ASN A 1 70  ? -13.892 10.539  -4.329  1.00 0.00 ? 70  ASN A O    2  
ATOM 2775  C CB   . ASN A 1 70  ? -11.996 12.062  -2.936  1.00 0.00 ? 70  ASN A CB   2  
ATOM 2776  C CG   . ASN A 1 70  ? -12.660 12.608  -1.671  1.00 0.00 ? 70  ASN A CG   2  
ATOM 2777  O OD1  . ASN A 1 70  ? -13.074 11.874  -0.789  1.00 0.00 ? 70  ASN A OD1  2  
ATOM 2778  N ND2  . ASN A 1 70  ? -12.737 13.936  -1.631  1.00 0.00 ? 70  ASN A ND2  2  
ATOM 2779  H H    . ASN A 1 70  ? -10.249 9.497   -2.308  1.00 0.00 ? 70  ASN A H    2  
ATOM 2780  H HA   . ASN A 1 70  ? -12.283 10.150  -1.950  1.00 0.00 ? 70  ASN A HA   2  
ATOM 2781  H HB2  . ASN A 1 70  ? -10.984 12.457  -3.020  1.00 0.00 ? 70  ASN A HB2  2  
ATOM 2782  H HB3  . ASN A 1 70  ? -12.545 12.401  -3.815  1.00 0.00 ? 70  ASN A HB3  2  
ATOM 2783  H HD21 . ASN A 1 70  ? -12.377 14.480  -2.388  1.00 0.00 ? 70  ASN A HD21 2  
ATOM 2784  H HD22 . ASN A 1 70  ? -13.155 14.389  -0.844  1.00 0.00 ? 70  ASN A HD22 2  
ATOM 2785  N N    . GLY A 1 71  ? -12.286 9.002   -4.747  1.00 0.00 ? 71  GLY A N    2  
ATOM 2786  C CA   . GLY A 1 71  ? -12.989 8.412   -5.873  1.00 0.00 ? 71  GLY A CA   2  
ATOM 2787  C C    . GLY A 1 71  ? -12.125 8.443   -7.136  1.00 0.00 ? 71  GLY A C    2  
ATOM 2788  O O    . GLY A 1 71  ? -12.050 7.455   -7.865  1.00 0.00 ? 71  GLY A O    2  
ATOM 2789  H H    . GLY A 1 71  ? -11.403 8.584   -4.534  1.00 0.00 ? 71  GLY A H    2  
ATOM 2790  H HA2  . GLY A 1 71  ? -13.259 7.382   -5.639  1.00 0.00 ? 71  GLY A HA2  2  
ATOM 2791  H HA3  . GLY A 1 71  ? -13.918 8.953   -6.051  1.00 0.00 ? 71  GLY A HA3  2  
ATOM 2792  N N    . ILE A 1 72  ? -11.494 9.587   -7.355  1.00 0.00 ? 72  ILE A N    2  
ATOM 2793  C CA   . ILE A 1 72  ? -10.638 9.760   -8.516  1.00 0.00 ? 72  ILE A CA   2  
ATOM 2794  C C    . ILE A 1 72  ? -9.829  8.482   -8.743  1.00 0.00 ? 72  ILE A C    2  
ATOM 2795  O O    . ILE A 1 72  ? -9.454  7.803   -7.788  1.00 0.00 ? 72  ILE A O    2  
ATOM 2796  C CB   . ILE A 1 72  ? -9.776  11.015  -8.365  1.00 0.00 ? 72  ILE A CB   2  
ATOM 2797  C CG1  . ILE A 1 72  ? -10.543 12.264  -8.804  1.00 0.00 ? 72  ILE A CG1  2  
ATOM 2798  C CG2  . ILE A 1 72  ? -8.450  10.863  -9.113  1.00 0.00 ? 72  ILE A CG2  2  
ATOM 2799  C CD1  . ILE A 1 72  ? -10.437 13.371  -7.753  1.00 0.00 ? 72  ILE A CD1  2  
ATOM 2800  H H    . ILE A 1 72  ? -11.561 10.386  -6.756  1.00 0.00 ? 72  ILE A H    2  
ATOM 2801  H HA   . ILE A 1 72  ? -11.286 9.917   -9.379  1.00 0.00 ? 72  ILE A HA   2  
ATOM 2802  H HB   . ILE A 1 72  ? -9.537  11.139  -7.308  1.00 0.00 ? 72  ILE A HB   2  
ATOM 2803  H HG12 . ILE A 1 72  ? -10.148 12.622  -9.755  1.00 0.00 ? 72  ILE A HG12 2  
ATOM 2804  H HG13 . ILE A 1 72  ? -11.591 12.012  -8.969  1.00 0.00 ? 72  ILE A HG13 2  
ATOM 2805  H HG21 . ILE A 1 72  ? -7.725  10.363  -8.471  1.00 0.00 ? 72  ILE A HG21 2  
ATOM 2806  H HG22 . ILE A 1 72  ? -8.608  10.269  -10.014 1.00 0.00 ? 72  ILE A HG22 2  
ATOM 2807  H HG23 . ILE A 1 72  ? -8.074  11.848  -9.389  1.00 0.00 ? 72  ILE A HG23 2  
ATOM 2808  H HD11 . ILE A 1 72  ? -9.591  13.169  -7.097  1.00 0.00 ? 72  ILE A HD11 2  
ATOM 2809  H HD12 . ILE A 1 72  ? -10.292 14.330  -8.249  1.00 0.00 ? 72  ILE A HD12 2  
ATOM 2810  H HD13 . ILE A 1 72  ? -11.354 13.401  -7.164  1.00 0.00 ? 72  ILE A HD13 2  
ATOM 2811  N N    . ASN A 1 73  ? -9.584  8.191   -10.012 1.00 0.00 ? 73  ASN A N    2  
ATOM 2812  C CA   . ASN A 1 73  ? -8.827  7.006   -10.376 1.00 0.00 ? 73  ASN A CA   2  
ATOM 2813  C C    . ASN A 1 73  ? -7.346  7.371   -10.500 1.00 0.00 ? 73  ASN A C    2  
ATOM 2814  O O    . ASN A 1 73  ? -6.922  7.927   -11.513 1.00 0.00 ? 73  ASN A O    2  
ATOM 2815  C CB   . ASN A 1 73  ? -9.290  6.448   -11.723 1.00 0.00 ? 73  ASN A CB   2  
ATOM 2816  C CG   . ASN A 1 73  ? -8.900  4.976   -11.870 1.00 0.00 ? 73  ASN A CG   2  
ATOM 2817  O OD1  . ASN A 1 73  ? -7.796  4.636   -12.262 1.00 0.00 ? 73  ASN A OD1  2  
ATOM 2818  N ND2  . ASN A 1 73  ? -9.866  4.125   -11.536 1.00 0.00 ? 73  ASN A ND2  2  
ATOM 2819  H H    . ASN A 1 73  ? -9.893  8.749   -10.783 1.00 0.00 ? 73  ASN A H    2  
ATOM 2820  H HA   . ASN A 1 73  ? -9.014  6.290   -9.577  1.00 0.00 ? 73  ASN A HA   2  
ATOM 2821  H HB2  . ASN A 1 73  ? -10.372 6.552   -11.811 1.00 0.00 ? 73  ASN A HB2  2  
ATOM 2822  H HB3  . ASN A 1 73  ? -8.848  7.028   -12.533 1.00 0.00 ? 73  ASN A HB3  2  
ATOM 2823  H HD21 . ASN A 1 73  ? -10.750 4.470   -11.222 1.00 0.00 ? 73  ASN A HD21 2  
ATOM 2824  H HD22 . ASN A 1 73  ? -9.707  3.139   -11.599 1.00 0.00 ? 73  ASN A HD22 2  
ATOM 2825  N N    . LEU A 1 74  ? -6.599  7.044   -9.456  1.00 0.00 ? 74  LEU A N    2  
ATOM 2826  C CA   . LEU A 1 74  ? -5.175  7.330   -9.435  1.00 0.00 ? 74  LEU A CA   2  
ATOM 2827  C C    . LEU A 1 74  ? -4.464  6.431   -10.448 1.00 0.00 ? 74  LEU A C    2  
ATOM 2828  O O    . LEU A 1 74  ? -3.638  6.901   -11.229 1.00 0.00 ? 74  LEU A O    2  
ATOM 2829  C CB   . LEU A 1 74  ? -4.625  7.209   -8.012  1.00 0.00 ? 74  LEU A CB   2  
ATOM 2830  C CG   . LEU A 1 74  ? -4.446  8.523   -7.249  1.00 0.00 ? 74  LEU A CG   2  
ATOM 2831  C CD1  . LEU A 1 74  ? -3.447  9.438   -7.959  1.00 0.00 ? 74  LEU A CD1  2  
ATOM 2832  C CD2  . LEU A 1 74  ? -5.793  9.212   -7.020  1.00 0.00 ? 74  LEU A CD2  2  
ATOM 2833  H H    . LEU A 1 74  ? -6.952  6.592   -8.636  1.00 0.00 ? 74  LEU A H    2  
ATOM 2834  H HA   . LEU A 1 74  ? -5.046  8.367   -9.743  1.00 0.00 ? 74  LEU A HA   2  
ATOM 2835  H HB2  . LEU A 1 74  ? -5.293  6.567   -7.439  1.00 0.00 ? 74  LEU A HB2  2  
ATOM 2836  H HB3  . LEU A 1 74  ? -3.660  6.705   -8.059  1.00 0.00 ? 74  LEU A HB3  2  
ATOM 2837  H HG   . LEU A 1 74  ? -4.031  8.293   -6.267  1.00 0.00 ? 74  LEU A HG   2  
ATOM 2838  H HD11 . LEU A 1 74  ? -2.679  9.755   -7.253  1.00 0.00 ? 74  LEU A HD11 2  
ATOM 2839  H HD12 . LEU A 1 74  ? -2.982  8.898   -8.783  1.00 0.00 ? 74  LEU A HD12 2  
ATOM 2840  H HD13 . LEU A 1 74  ? -3.968  10.314  -8.346  1.00 0.00 ? 74  LEU A HD13 2  
ATOM 2841  H HD21 . LEU A 1 74  ? -5.653  10.293  -7.027  1.00 0.00 ? 74  LEU A HD21 2  
ATOM 2842  H HD22 . LEU A 1 74  ? -6.485  8.929   -7.813  1.00 0.00 ? 74  LEU A HD22 2  
ATOM 2843  H HD23 . LEU A 1 74  ? -6.199  8.904   -6.056  1.00 0.00 ? 74  LEU A HD23 2  
ATOM 2844  N N    . ARG A 1 75  ? -4.810  5.153   -10.402 1.00 0.00 ? 75  ARG A N    2  
ATOM 2845  C CA   . ARG A 1 75  ? -4.215  4.183   -11.306 1.00 0.00 ? 75  ARG A CA   2  
ATOM 2846  C C    . ARG A 1 75  ? -4.055  4.788   -12.703 1.00 0.00 ? 75  ARG A C    2  
ATOM 2847  O O    . ARG A 1 75  ? -5.043  5.047   -13.388 1.00 0.00 ? 75  ARG A O    2  
ATOM 2848  C CB   . ARG A 1 75  ? -5.072  2.919   -11.400 1.00 0.00 ? 75  ARG A CB   2  
ATOM 2849  C CG   . ARG A 1 75  ? -5.500  2.442   -10.011 1.00 0.00 ? 75  ARG A CG   2  
ATOM 2850  C CD   . ARG A 1 75  ? -5.695  0.925   -9.988  1.00 0.00 ? 75  ARG A CD   2  
ATOM 2851  N NE   . ARG A 1 75  ? -6.628  0.551   -8.902  1.00 0.00 ? 75  ARG A NE   2  
ATOM 2852  C CZ   . ARG A 1 75  ? -6.965  -0.711  -8.602  1.00 0.00 ? 75  ARG A CZ   2  
ATOM 2853  N NH1  . ARG A 1 75  ? -6.448  -1.727  -9.306  1.00 0.00 ? 75  ARG A NH1  2  
ATOM 2854  N NH2  . ARG A 1 75  ? -7.819  -0.956  -7.599  1.00 0.00 ? 75  ARG A NH2  2  
ATOM 2855  H H    . ARG A 1 75  ? -5.482  4.778   -9.764  1.00 0.00 ? 75  ARG A H    2  
ATOM 2856  H HA   . ARG A 1 75  ? -3.245  3.951   -10.866 1.00 0.00 ? 75  ARG A HA   2  
ATOM 2857  H HB2  . ARG A 1 75  ? -5.954  3.119   -12.008 1.00 0.00 ? 75  ARG A HB2  2  
ATOM 2858  H HB3  . ARG A 1 75  ? -4.510  2.131   -11.902 1.00 0.00 ? 75  ARG A HB3  2  
ATOM 2859  H HG2  . ARG A 1 75  ? -4.746  2.726   -9.277  1.00 0.00 ? 75  ARG A HG2  2  
ATOM 2860  H HG3  . ARG A 1 75  ? -6.428  2.936   -9.723  1.00 0.00 ? 75  ARG A HG3  2  
ATOM 2861  H HD2  . ARG A 1 75  ? -6.087  0.586   -10.948 1.00 0.00 ? 75  ARG A HD2  2  
ATOM 2862  H HD3  . ARG A 1 75  ? -4.736  0.429   -9.843  1.00 0.00 ? 75  ARG A HD3  2  
ATOM 2863  H HE   . ARG A 1 75  ? -7.031  1.286   -8.357  1.00 0.00 ? 75  ARG A HE   2  
ATOM 2864  H HH11 . ARG A 1 75  ? -5.811  -1.544  -10.055 1.00 0.00 ? 75  ARG A HH11 2  
ATOM 2865  H HH12 . ARG A 1 75  ? -6.700  -2.669  -9.083  1.00 0.00 ? 75  ARG A HH12 2  
ATOM 2866  H HH21 . ARG A 1 75  ? -8.204  -0.197  -7.074  1.00 0.00 ? 75  ARG A HH21 2  
ATOM 2867  H HH22 . ARG A 1 75  ? -8.070  -1.898  -7.376  1.00 0.00 ? 75  ARG A HH22 2  
ATOM 2868  N N    . SER A 1 76  ? -2.803  4.996   -13.083 1.00 0.00 ? 76  SER A N    2  
ATOM 2869  C CA   . SER A 1 76  ? -2.501  5.565   -14.385 1.00 0.00 ? 76  SER A CA   2  
ATOM 2870  C C    . SER A 1 76  ? -2.555  7.093   -14.314 1.00 0.00 ? 76  SER A C    2  
ATOM 2871  O O    . SER A 1 76  ? -2.946  7.749   -15.278 1.00 0.00 ? 76  SER A O    2  
ATOM 2872  C CB   . SER A 1 76  ? -3.471  5.049   -15.450 1.00 0.00 ? 76  SER A CB   2  
ATOM 2873  O OG   . SER A 1 76  ? -2.825  4.842   -16.704 1.00 0.00 ? 76  SER A OG   2  
ATOM 2874  H H    . SER A 1 76  ? -2.005  4.783   -12.520 1.00 0.00 ? 76  SER A H    2  
ATOM 2875  H HA   . SER A 1 76  ? -1.491  5.229   -14.620 1.00 0.00 ? 76  SER A HA   2  
ATOM 2876  H HB2  . SER A 1 76  ? -3.915  4.113   -15.112 1.00 0.00 ? 76  SER A HB2  2  
ATOM 2877  H HB3  . SER A 1 76  ? -4.285  5.762   -15.575 1.00 0.00 ? 76  SER A HB3  2  
ATOM 2878  H HG   . SER A 1 76  ? -2.821  5.691   -17.231 1.00 0.00 ? 76  SER A HG   2  
ATOM 2879  N N    . ALA A 1 77  ? -2.159  7.614   -13.162 1.00 0.00 ? 77  ALA A N    2  
ATOM 2880  C CA   . ALA A 1 77  ? -2.157  9.052   -12.952 1.00 0.00 ? 77  ALA A CA   2  
ATOM 2881  C C    . ALA A 1 77  ? -0.718  9.569   -13.004 1.00 0.00 ? 77  ALA A C    2  
ATOM 2882  O O    . ALA A 1 77  ? 0.222   8.826   -12.729 1.00 0.00 ? 77  ALA A O    2  
ATOM 2883  C CB   . ALA A 1 77  ? -2.846  9.375   -11.625 1.00 0.00 ? 77  ALA A CB   2  
ATOM 2884  H H    . ALA A 1 77  ? -1.843  7.073   -12.383 1.00 0.00 ? 77  ALA A H    2  
ATOM 2885  H HA   . ALA A 1 77  ? -2.727  9.506   -13.763 1.00 0.00 ? 77  ALA A HA   2  
ATOM 2886  H HB1  . ALA A 1 77  ? -2.385  8.795   -10.826 1.00 0.00 ? 77  ALA A HB1  2  
ATOM 2887  H HB2  . ALA A 1 77  ? -2.740  10.438  -11.410 1.00 0.00 ? 77  ALA A HB2  2  
ATOM 2888  H HB3  . ALA A 1 77  ? -3.904  9.122   -11.694 1.00 0.00 ? 77  ALA A HB3  2  
ATOM 2889  N N    . THR A 1 78  ? -0.592  10.840  -13.357 1.00 0.00 ? 78  THR A N    2  
ATOM 2890  C CA   . THR A 1 78  ? 0.716   11.465  -13.448 1.00 0.00 ? 78  THR A CA   2  
ATOM 2891  C C    . THR A 1 78  ? 1.013   12.267  -12.179 1.00 0.00 ? 78  THR A C    2  
ATOM 2892  O O    . THR A 1 78  ? 0.103   12.813  -11.558 1.00 0.00 ? 78  THR A O    2  
ATOM 2893  C CB   . THR A 1 78  ? 0.749   12.310  -14.723 1.00 0.00 ? 78  THR A CB   2  
ATOM 2894  O OG1  . THR A 1 78  ? -0.567  12.849  -14.816 1.00 0.00 ? 78  THR A OG1  2  
ATOM 2895  C CG2  . THR A 1 78  ? 0.893   11.459  -15.986 1.00 0.00 ? 78  THR A CG2  2  
ATOM 2896  H H    . THR A 1 78  ? -1.363  11.438  -13.579 1.00 0.00 ? 78  THR A H    2  
ATOM 2897  H HA   . THR A 1 78  ? 1.469   10.679  -13.513 1.00 0.00 ? 78  THR A HA   2  
ATOM 2898  H HB   . THR A 1 78  ? 1.534   13.065  -14.670 1.00 0.00 ? 78  THR A HB   2  
ATOM 2899  H HG1  . THR A 1 78  ? -0.651  13.651  -14.225 1.00 0.00 ? 78  THR A HG1  2  
ATOM 2900  H HG21 . THR A 1 78  ? 0.807   12.097  -16.866 1.00 0.00 ? 78  THR A HG21 2  
ATOM 2901  H HG22 . THR A 1 78  ? 1.868   10.971  -15.986 1.00 0.00 ? 78  THR A HG22 2  
ATOM 2902  H HG23 . THR A 1 78  ? 0.108   10.703  -16.007 1.00 0.00 ? 78  THR A HG23 2  
ATOM 2903  N N    . GLU A 1 79  ? 2.291   12.313  -11.832 1.00 0.00 ? 79  GLU A N    2  
ATOM 2904  C CA   . GLU A 1 79  ? 2.719   13.039  -10.649 1.00 0.00 ? 79  GLU A CA   2  
ATOM 2905  C C    . GLU A 1 79  ? 2.063   14.420  -10.607 1.00 0.00 ? 79  GLU A C    2  
ATOM 2906  O O    . GLU A 1 79  ? 1.639   14.878  -9.547  1.00 0.00 ? 79  GLU A O    2  
ATOM 2907  C CB   . GLU A 1 79  ? 4.244   13.155  -10.599 1.00 0.00 ? 79  GLU A CB   2  
ATOM 2908  C CG   . GLU A 1 79  ? 4.827   13.334  -12.002 1.00 0.00 ? 79  GLU A CG   2  
ATOM 2909  C CD   . GLU A 1 79  ? 6.217   13.970  -11.941 1.00 0.00 ? 79  GLU A CD   2  
ATOM 2910  O OE1  . GLU A 1 79  ? 7.105   13.335  -11.331 1.00 0.00 ? 79  GLU A OE1  2  
ATOM 2911  O OE2  . GLU A 1 79  ? 6.361   15.075  -12.506 1.00 0.00 ? 79  GLU A OE2  2  
ATOM 2912  H H    . GLU A 1 79  ? 3.026   11.866  -12.343 1.00 0.00 ? 79  GLU A H    2  
ATOM 2913  H HA   . GLU A 1 79  ? 2.379   12.442  -9.803  1.00 0.00 ? 79  GLU A HA   2  
ATOM 2914  H HB2  . GLU A 1 79  ? 4.528   14.000  -9.973  1.00 0.00 ? 79  GLU A HB2  2  
ATOM 2915  H HB3  . GLU A 1 79  ? 4.665   12.261  -10.138 1.00 0.00 ? 79  GLU A HB3  2  
ATOM 2916  H HG2  . GLU A 1 79  ? 4.887   12.367  -12.501 1.00 0.00 ? 79  GLU A HG2  2  
ATOM 2917  H HG3  . GLU A 1 79  ? 4.163   13.959  -12.598 1.00 0.00 ? 79  GLU A HG3  2  
ATOM 2918  N N    . GLN A 1 80  ? 2.000   15.046  -11.774 1.00 0.00 ? 80  GLN A N    2  
ATOM 2919  C CA   . GLN A 1 80  ? 1.403   16.366  -11.884 1.00 0.00 ? 80  GLN A CA   2  
ATOM 2920  C C    . GLN A 1 80  ? -0.090  16.302  -11.556 1.00 0.00 ? 80  GLN A C    2  
ATOM 2921  O O    . GLN A 1 80  ? -0.651  17.251  -11.010 1.00 0.00 ? 80  GLN A O    2  
ATOM 2922  C CB   . GLN A 1 80  ? 1.633   16.958  -13.276 1.00 0.00 ? 80  GLN A CB   2  
ATOM 2923  C CG   . GLN A 1 80  ? 0.964   16.102  -14.353 1.00 0.00 ? 80  GLN A CG   2  
ATOM 2924  C CD   . GLN A 1 80  ? -0.182  16.862  -15.023 1.00 0.00 ? 80  GLN A CD   2  
ATOM 2925  O OE1  . GLN A 1 80  ? -0.221  18.081  -15.050 1.00 0.00 ? 80  GLN A OE1  2  
ATOM 2926  N NE2  . GLN A 1 80  ? -1.111  16.076  -15.561 1.00 0.00 ? 80  GLN A NE2  2  
ATOM 2927  H H    . GLN A 1 80  ? 2.348   14.666  -12.631 1.00 0.00 ? 80  GLN A H    2  
ATOM 2928  H HA   . GLN A 1 80  ? 1.918   16.979  -11.145 1.00 0.00 ? 80  GLN A HA   2  
ATOM 2929  H HB2  . GLN A 1 80  ? 1.237   17.972  -13.314 1.00 0.00 ? 80  GLN A HB2  2  
ATOM 2930  H HB3  . GLN A 1 80  ? 2.703   17.026  -13.473 1.00 0.00 ? 80  GLN A HB3  2  
ATOM 2931  H HG2  . GLN A 1 80  ? 1.701   15.813  -15.103 1.00 0.00 ? 80  GLN A HG2  2  
ATOM 2932  H HG3  . GLN A 1 80  ? 0.584   15.182  -13.908 1.00 0.00 ? 80  GLN A HG3  2  
ATOM 2933  H HE21 . GLN A 1 80  ? -1.019  15.082  -15.503 1.00 0.00 ? 80  GLN A HE21 2  
ATOM 2934  H HE22 . GLN A 1 80  ? -1.901  16.480  -16.022 1.00 0.00 ? 80  GLN A HE22 2  
ATOM 2935  N N    . GLN A 1 81  ? -0.692  15.173  -11.902 1.00 0.00 ? 81  GLN A N    2  
ATOM 2936  C CA   . GLN A 1 81  ? -2.109  14.973  -11.651 1.00 0.00 ? 81  GLN A CA   2  
ATOM 2937  C C    . GLN A 1 81  ? -2.360  14.769  -10.156 1.00 0.00 ? 81  GLN A C    2  
ATOM 2938  O O    . GLN A 1 81  ? -3.222  15.424  -9.573  1.00 0.00 ? 81  GLN A O    2  
ATOM 2939  C CB   . GLN A 1 81  ? -2.648  13.793  -12.463 1.00 0.00 ? 81  GLN A CB   2  
ATOM 2940  C CG   . GLN A 1 81  ? -3.325  14.276  -13.748 1.00 0.00 ? 81  GLN A CG   2  
ATOM 2941  C CD   . GLN A 1 81  ? -3.928  13.103  -14.524 1.00 0.00 ? 81  GLN A CD   2  
ATOM 2942  O OE1  . GLN A 1 81  ? -5.007  12.617  -14.227 1.00 0.00 ? 81  GLN A OE1  2  
ATOM 2943  N NE2  . GLN A 1 81  ? -3.172  12.677  -15.532 1.00 0.00 ? 81  GLN A NE2  2  
ATOM 2944  H H    . GLN A 1 81  ? -0.229  14.406  -12.346 1.00 0.00 ? 81  GLN A H    2  
ATOM 2945  H HA   . GLN A 1 81  ? -2.595  15.889  -11.987 1.00 0.00 ? 81  GLN A HA   2  
ATOM 2946  H HB2  . GLN A 1 81  ? -1.832  13.115  -12.711 1.00 0.00 ? 81  GLN A HB2  2  
ATOM 2947  H HB3  . GLN A 1 81  ? -3.361  13.229  -11.862 1.00 0.00 ? 81  GLN A HB3  2  
ATOM 2948  H HG2  . GLN A 1 81  ? -4.108  14.994  -13.503 1.00 0.00 ? 81  GLN A HG2  2  
ATOM 2949  H HG3  . GLN A 1 81  ? -2.599  14.796  -14.373 1.00 0.00 ? 81  GLN A HG3  2  
ATOM 2950  H HE21 . GLN A 1 81  ? -2.296  13.120  -15.722 1.00 0.00 ? 81  GLN A HE21 2  
ATOM 2951  H HE22 . GLN A 1 81  ? -3.481  11.913  -16.100 1.00 0.00 ? 81  GLN A HE22 2  
ATOM 2952  N N    . ALA A 1 82  ? -1.590  13.858  -9.578  1.00 0.00 ? 82  ALA A N    2  
ATOM 2953  C CA   . ALA A 1 82  ? -1.718  13.560  -8.162  1.00 0.00 ? 82  ALA A CA   2  
ATOM 2954  C C    . ALA A 1 82  ? -1.598  14.857  -7.359  1.00 0.00 ? 82  ALA A C    2  
ATOM 2955  O O    . ALA A 1 82  ? -2.495  15.202  -6.591  1.00 0.00 ? 82  ALA A O    2  
ATOM 2956  C CB   . ALA A 1 82  ? -0.664  12.526  -7.760  1.00 0.00 ? 82  ALA A CB   2  
ATOM 2957  H H    . ALA A 1 82  ? -0.891  13.330  -10.060 1.00 0.00 ? 82  ALA A H    2  
ATOM 2958  H HA   . ALA A 1 82  ? -2.708  13.133  -8.001  1.00 0.00 ? 82  ALA A HA   2  
ATOM 2959  H HB1  . ALA A 1 82  ? -0.079  12.245  -8.636  1.00 0.00 ? 82  ALA A HB1  2  
ATOM 2960  H HB2  . ALA A 1 82  ? -0.005  12.954  -7.005  1.00 0.00 ? 82  ALA A HB2  2  
ATOM 2961  H HB3  . ALA A 1 82  ? -1.158  11.644  -7.354  1.00 0.00 ? 82  ALA A HB3  2  
ATOM 2962  N N    . ARG A 1 83  ? -0.482  15.542  -7.564  1.00 0.00 ? 83  ARG A N    2  
ATOM 2963  C CA   . ARG A 1 83  ? -0.233  16.793  -6.869  1.00 0.00 ? 83  ARG A CA   2  
ATOM 2964  C C    . ARG A 1 83  ? -1.444  17.720  -6.996  1.00 0.00 ? 83  ARG A C    2  
ATOM 2965  O O    . ARG A 1 83  ? -1.628  18.621  -6.179  1.00 0.00 ? 83  ARG A O    2  
ATOM 2966  C CB   . ARG A 1 83  ? 1.002   17.499  -7.432  1.00 0.00 ? 83  ARG A CB   2  
ATOM 2967  C CG   . ARG A 1 83  ? 2.286   16.804  -6.976  1.00 0.00 ? 83  ARG A CG   2  
ATOM 2968  C CD   . ARG A 1 83  ? 3.519   17.632  -7.344  1.00 0.00 ? 83  ARG A CD   2  
ATOM 2969  N NE   . ARG A 1 83  ? 4.484   17.629  -6.223  1.00 0.00 ? 83  ARG A NE   2  
ATOM 2970  C CZ   . ARG A 1 83  ? 5.658   18.274  -6.240  1.00 0.00 ? 83  ARG A CZ   2  
ATOM 2971  N NH1  . ARG A 1 83  ? 6.019   18.979  -7.321  1.00 0.00 ? 83  ARG A NH1  2  
ATOM 2972  N NH2  . ARG A 1 83  ? 6.471   18.215  -5.177  1.00 0.00 ? 83  ARG A NH2  2  
ATOM 2973  H H    . ARG A 1 83  ? 0.242   15.254  -8.191  1.00 0.00 ? 83  ARG A H    2  
ATOM 2974  H HA   . ARG A 1 83  ? -0.065  16.507  -5.831  1.00 0.00 ? 83  ARG A HA   2  
ATOM 2975  H HB2  . ARG A 1 83  ? 0.956   17.508  -8.521  1.00 0.00 ? 83  ARG A HB2  2  
ATOM 2976  H HB3  . ARG A 1 83  ? 1.011   18.539  -7.105  1.00 0.00 ? 83  ARG A HB3  2  
ATOM 2977  H HG2  . ARG A 1 83  ? 2.257   16.648  -5.898  1.00 0.00 ? 83  ARG A HG2  2  
ATOM 2978  H HG3  . ARG A 1 83  ? 2.354   15.819  -7.438  1.00 0.00 ? 83  ARG A HG3  2  
ATOM 2979  H HD2  . ARG A 1 83  ? 3.987   17.224  -8.240  1.00 0.00 ? 83  ARG A HD2  2  
ATOM 2980  H HD3  . ARG A 1 83  ? 3.223   18.655  -7.578  1.00 0.00 ? 83  ARG A HD3  2  
ATOM 2981  H HE   . ARG A 1 83  ? 4.246   17.112  -5.400  1.00 0.00 ? 83  ARG A HE   2  
ATOM 2982  H HH11 . ARG A 1 83  ? 5.413   19.023  -8.115  1.00 0.00 ? 83  ARG A HH11 2  
ATOM 2983  H HH12 . ARG A 1 83  ? 6.896   19.461  -7.334  1.00 0.00 ? 83  ARG A HH12 2  
ATOM 2984  H HH21 . ARG A 1 83  ? 6.202   17.689  -4.370  1.00 0.00 ? 83  ARG A HH21 2  
ATOM 2985  H HH22 . ARG A 1 83  ? 7.348   18.697  -5.190  1.00 0.00 ? 83  ARG A HH22 2  
ATOM 2986  N N    . LEU A 1 84  ? -2.238  17.467  -8.026  1.00 0.00 ? 84  LEU A N    2  
ATOM 2987  C CA   . LEU A 1 84  ? -3.426  18.268  -8.269  1.00 0.00 ? 84  LEU A CA   2  
ATOM 2988  C C    . LEU A 1 84  ? -4.617  17.639  -7.543  1.00 0.00 ? 84  LEU A C    2  
ATOM 2989  O O    . LEU A 1 84  ? -5.315  18.314  -6.788  1.00 0.00 ? 84  LEU A O    2  
ATOM 2990  C CB   . LEU A 1 84  ? -3.649  18.452  -9.771  1.00 0.00 ? 84  LEU A CB   2  
ATOM 2991  C CG   . LEU A 1 84  ? -2.759  19.488  -10.460 1.00 0.00 ? 84  LEU A CG   2  
ATOM 2992  C CD1  . LEU A 1 84  ? -2.612  19.181  -11.952 1.00 0.00 ? 84  LEU A CD1  2  
ATOM 2993  C CD2  . LEU A 1 84  ? -3.278  20.907  -10.214 1.00 0.00 ? 84  LEU A CD2  2  
ATOM 2994  H H    . LEU A 1 84  ? -2.081  16.732  -8.685  1.00 0.00 ? 84  LEU A H    2  
ATOM 2995  H HA   . LEU A 1 84  ? -3.246  19.256  -7.846  1.00 0.00 ? 84  LEU A HA   2  
ATOM 2996  H HB2  . LEU A 1 84  ? -3.499  17.490  -10.262 1.00 0.00 ? 84  LEU A HB2  2  
ATOM 2997  H HB3  . LEU A 1 84  ? -4.690  18.732  -9.932  1.00 0.00 ? 84  LEU A HB3  2  
ATOM 2998  H HG   . LEU A 1 84  ? -1.763  19.429  -10.020 1.00 0.00 ? 84  LEU A HG   2  
ATOM 2999  H HD11 . LEU A 1 84  ? -1.575  19.328  -12.253 1.00 0.00 ? 84  LEU A HD11 2  
ATOM 3000  H HD12 . LEU A 1 84  ? -2.903  18.148  -12.140 1.00 0.00 ? 84  LEU A HD12 2  
ATOM 3001  H HD13 . LEU A 1 84  ? -3.255  19.850  -12.525 1.00 0.00 ? 84  LEU A HD13 2  
ATOM 3002  H HD21 . LEU A 1 84  ? -4.117  21.107  -10.881 1.00 0.00 ? 84  LEU A HD21 2  
ATOM 3003  H HD22 . LEU A 1 84  ? -3.606  20.999  -9.179  1.00 0.00 ? 84  LEU A HD22 2  
ATOM 3004  H HD23 . LEU A 1 84  ? -2.480  21.624  -10.408 1.00 0.00 ? 84  LEU A HD23 2  
ATOM 3005  N N    . ILE A 1 85  ? -4.813  16.354  -7.797  1.00 0.00 ? 85  ILE A N    2  
ATOM 3006  C CA   . ILE A 1 85  ? -5.908  15.627  -7.177  1.00 0.00 ? 85  ILE A CA   2  
ATOM 3007  C C    . ILE A 1 85  ? -5.816  15.774  -5.657  1.00 0.00 ? 85  ILE A C    2  
ATOM 3008  O O    . ILE A 1 85  ? -6.792  16.142  -5.005  1.00 0.00 ? 85  ILE A O    2  
ATOM 3009  C CB   . ILE A 1 85  ? -5.924  14.173  -7.655  1.00 0.00 ? 85  ILE A CB   2  
ATOM 3010  C CG1  . ILE A 1 85  ? -6.050  14.098  -9.177  1.00 0.00 ? 85  ILE A CG1  2  
ATOM 3011  C CG2  . ILE A 1 85  ? -7.023  13.377  -6.948  1.00 0.00 ? 85  ILE A CG2  2  
ATOM 3012  C CD1  . ILE A 1 85  ? -5.840  12.666  -9.674  1.00 0.00 ? 85  ILE A CD1  2  
ATOM 3013  H H    . ILE A 1 85  ? -4.241  15.812  -8.413  1.00 0.00 ? 85  ILE A H    2  
ATOM 3014  H HA   . ILE A 1 85  ? -6.837  16.087  -7.513  1.00 0.00 ? 85  ILE A HA   2  
ATOM 3015  H HB   . ILE A 1 85  ? -4.972  13.716  -7.387  1.00 0.00 ? 85  ILE A HB   2  
ATOM 3016  H HG12 . ILE A 1 85  ? -7.035  14.451  -9.482  1.00 0.00 ? 85  ILE A HG12 2  
ATOM 3017  H HG13 . ILE A 1 85  ? -5.317  14.758  -9.640  1.00 0.00 ? 85  ILE A HG13 2  
ATOM 3018  H HG21 . ILE A 1 85  ? -6.574  12.727  -6.196  1.00 0.00 ? 85  ILE A HG21 2  
ATOM 3019  H HG22 . ILE A 1 85  ? -7.718  14.064  -6.466  1.00 0.00 ? 85  ILE A HG22 2  
ATOM 3020  H HG23 . ILE A 1 85  ? -7.559  12.770  -7.678  1.00 0.00 ? 85  ILE A HG23 2  
ATOM 3021  H HD11 . ILE A 1 85  ? -6.485  12.481  -10.533 1.00 0.00 ? 85  ILE A HD11 2  
ATOM 3022  H HD12 . ILE A 1 85  ? -4.799  12.532  -9.967  1.00 0.00 ? 85  ILE A HD12 2  
ATOM 3023  H HD13 . ILE A 1 85  ? -6.086  11.965  -8.877  1.00 0.00 ? 85  ILE A HD13 2  
ATOM 3024  N N    . ILE A 1 86  ? -4.634  15.480  -5.137  1.00 0.00 ? 86  ILE A N    2  
ATOM 3025  C CA   . ILE A 1 86  ? -4.402  15.575  -3.706  1.00 0.00 ? 86  ILE A CA   2  
ATOM 3026  C C    . ILE A 1 86  ? -4.433  17.046  -3.285  1.00 0.00 ? 86  ILE A C    2  
ATOM 3027  O O    . ILE A 1 86  ? -4.966  17.381  -2.228  1.00 0.00 ? 86  ILE A O    2  
ATOM 3028  C CB   . ILE A 1 86  ? -3.107  14.854  -3.324  1.00 0.00 ? 86  ILE A CB   2  
ATOM 3029  C CG1  . ILE A 1 86  ? -1.882  15.679  -3.721  1.00 0.00 ? 86  ILE A CG1  2  
ATOM 3030  C CG2  . ILE A 1 86  ? -3.068  13.446  -3.920  1.00 0.00 ? 86  ILE A CG2  2  
ATOM 3031  C CD1  . ILE A 1 86  ? -0.639  14.795  -3.836  1.00 0.00 ? 86  ILE A CD1  2  
ATOM 3032  H H    . ILE A 1 86  ? -3.845  15.182  -5.674  1.00 0.00 ? 86  ILE A H    2  
ATOM 3033  H HA   . ILE A 1 86  ? -5.219  15.055  -3.207  1.00 0.00 ? 86  ILE A HA   2  
ATOM 3034  H HB   . ILE A 1 86  ? -3.085  14.745  -2.239  1.00 0.00 ? 86  ILE A HB   2  
ATOM 3035  H HG12 . ILE A 1 86  ? -2.067  16.177  -4.673  1.00 0.00 ? 86  ILE A HG12 2  
ATOM 3036  H HG13 . ILE A 1 86  ? -1.710  16.461  -2.981  1.00 0.00 ? 86  ILE A HG13 2  
ATOM 3037  H HG21 . ILE A 1 86  ? -4.084  13.061  -4.010  1.00 0.00 ? 86  ILE A HG21 2  
ATOM 3038  H HG22 . ILE A 1 86  ? -2.604  13.482  -4.906  1.00 0.00 ? 86  ILE A HG22 2  
ATOM 3039  H HG23 . ILE A 1 86  ? -2.488  12.792  -3.269  1.00 0.00 ? 86  ILE A HG23 2  
ATOM 3040  H HD11 . ILE A 1 86  ? -0.457  14.558  -4.884  1.00 0.00 ? 86  ILE A HD11 2  
ATOM 3041  H HD12 . ILE A 1 86  ? 0.223   15.324  -3.428  1.00 0.00 ? 86  ILE A HD12 2  
ATOM 3042  H HD13 . ILE A 1 86  ? -0.796  13.873  -3.276  1.00 0.00 ? 86  ILE A HD13 2  
ATOM 3043  N N    . GLY A 1 87  ? -3.856  17.884  -4.133  1.00 0.00 ? 87  GLY A N    2  
ATOM 3044  C CA   . GLY A 1 87  ? -3.811  19.311  -3.863  1.00 0.00 ? 87  GLY A CA   2  
ATOM 3045  C C    . GLY A 1 87  ? -5.082  20.003  -4.359  1.00 0.00 ? 87  GLY A C    2  
ATOM 3046  O O    . GLY A 1 87  ? -5.017  21.079  -4.951  1.00 0.00 ? 87  GLY A O    2  
ATOM 3047  H H    . GLY A 1 87  ? -3.425  17.603  -4.991  1.00 0.00 ? 87  GLY A H    2  
ATOM 3048  H HA2  . GLY A 1 87  ? -3.697  19.478  -2.792  1.00 0.00 ? 87  GLY A HA2  2  
ATOM 3049  H HA3  . GLY A 1 87  ? -2.940  19.750  -4.349  1.00 0.00 ? 87  GLY A HA3  2  
ATOM 3050  N N    . GLN A 1 88  ? -6.210  19.357  -4.100  1.00 0.00 ? 88  GLN A N    2  
ATOM 3051  C CA   . GLN A 1 88  ? -7.494  19.897  -4.513  1.00 0.00 ? 88  GLN A CA   2  
ATOM 3052  C C    . GLN A 1 88  ? -8.219  20.515  -3.316  1.00 0.00 ? 88  GLN A C    2  
ATOM 3053  O O    . GLN A 1 88  ? -7.653  20.620  -2.229  1.00 0.00 ? 88  GLN A O    2  
ATOM 3054  C CB   . GLN A 1 88  ? -8.353  18.820  -5.178  1.00 0.00 ? 88  GLN A CB   2  
ATOM 3055  C CG   . GLN A 1 88  ? -8.081  18.753  -6.682  1.00 0.00 ? 88  GLN A CG   2  
ATOM 3056  C CD   . GLN A 1 88  ? -9.389  18.766  -7.477  1.00 0.00 ? 88  GLN A CD   2  
ATOM 3057  O OE1  . GLN A 1 88  ? -10.157 19.713  -7.444  1.00 0.00 ? 88  GLN A OE1  2  
ATOM 3058  N NE2  . GLN A 1 88  ? -9.599  17.663  -8.190  1.00 0.00 ? 88  GLN A NE2  2  
ATOM 3059  H H    . GLN A 1 88  ? -6.255  18.482  -3.618  1.00 0.00 ? 88  GLN A H    2  
ATOM 3060  H HA   . GLN A 1 88  ? -7.261  20.670  -5.245  1.00 0.00 ? 88  GLN A HA   2  
ATOM 3061  H HB2  . GLN A 1 88  ? -8.144  17.851  -4.724  1.00 0.00 ? 88  GLN A HB2  2  
ATOM 3062  H HB3  . GLN A 1 88  ? -9.408  19.032  -5.005  1.00 0.00 ? 88  GLN A HB3  2  
ATOM 3063  H HG2  . GLN A 1 88  ? -7.462  19.599  -6.981  1.00 0.00 ? 88  GLN A HG2  2  
ATOM 3064  H HG3  . GLN A 1 88  ? -7.519  17.849  -6.915  1.00 0.00 ? 88  GLN A HG3  2  
ATOM 3065  H HE21 . GLN A 1 88  ? -8.928  16.921  -8.173  1.00 0.00 ? 88  GLN A HE21 2  
ATOM 3066  H HE22 . GLN A 1 88  ? -10.427 17.576  -8.744  1.00 0.00 ? 88  GLN A HE22 2  
ATOM 3067  N N    . GLN A 1 89  ? -9.462  20.908  -3.556  1.00 0.00 ? 89  GLN A N    2  
ATOM 3068  C CA   . GLN A 1 89  ? -10.270 21.513  -2.512  1.00 0.00 ? 89  GLN A CA   2  
ATOM 3069  C C    . GLN A 1 89  ? -11.338 20.529  -2.030  1.00 0.00 ? 89  GLN A C    2  
ATOM 3070  O O    . GLN A 1 89  ? -11.878 19.757  -2.821  1.00 0.00 ? 89  GLN A O    2  
ATOM 3071  C CB   . GLN A 1 89  ? -10.906 22.818  -2.997  1.00 0.00 ? 89  GLN A CB   2  
ATOM 3072  C CG   . GLN A 1 89  ? -11.259 22.736  -4.484  1.00 0.00 ? 89  GLN A CG   2  
ATOM 3073  C CD   . GLN A 1 89  ? -12.142 21.520  -4.772  1.00 0.00 ? 89  GLN A CD   2  
ATOM 3074  O OE1  . GLN A 1 89  ? -13.201 21.339  -4.193  1.00 0.00 ? 89  GLN A OE1  2  
ATOM 3075  N NE2  . GLN A 1 89  ? -11.649 20.700  -5.696  1.00 0.00 ? 89  GLN A NE2  2  
ATOM 3076  H H    . GLN A 1 89  ? -9.915  20.819  -4.443  1.00 0.00 ? 89  GLN A H    2  
ATOM 3077  H HA   . GLN A 1 89  ? -9.577  21.734  -1.700  1.00 0.00 ? 89  GLN A HA   2  
ATOM 3078  H HB2  . GLN A 1 89  ? -11.805 23.026  -2.417  1.00 0.00 ? 89  GLN A HB2  2  
ATOM 3079  H HB3  . GLN A 1 89  ? -10.219 23.646  -2.827  1.00 0.00 ? 89  GLN A HB3  2  
ATOM 3080  H HG2  . GLN A 1 89  ? -11.775 23.646  -4.789  1.00 0.00 ? 89  GLN A HG2  2  
ATOM 3081  H HG3  . GLN A 1 89  ? -10.345 22.675  -5.075  1.00 0.00 ? 89  GLN A HG3  2  
ATOM 3082  H HE21 . GLN A 1 89  ? -10.774 20.908  -6.132  1.00 0.00 ? 89  GLN A HE21 2  
ATOM 3083  H HE22 . GLN A 1 89  ? -12.154 19.877  -5.954  1.00 0.00 ? 89  GLN A HE22 2  
ATOM 3084  N N    . CYS A 1 90  ? -11.611 20.588  -0.735  1.00 0.00 ? 90  CYS A N    2  
ATOM 3085  C CA   . CYS A 1 90  ? -12.604 19.712  -0.138  1.00 0.00 ? 90  CYS A CA   2  
ATOM 3086  C C    . CYS A 1 90  ? -12.348 19.651  1.369   1.00 0.00 ? 90  CYS A C    2  
ATOM 3087  O O    . CYS A 1 90  ? -11.329 19.119  1.808   1.00 0.00 ? 90  CYS A O    2  
ATOM 3088  C CB   . CYS A 1 90  ? -12.588 18.321  -0.777  1.00 0.00 ? 90  CYS A CB   2  
ATOM 3089  S SG   . CYS A 1 90  ? -13.991 18.150  -1.939  1.00 0.00 ? 90  CYS A SG   2  
ATOM 3090  H H    . CYS A 1 90  ? -11.167 21.219  -0.098  1.00 0.00 ? 90  CYS A H    2  
ATOM 3091  H HA   . CYS A 1 90  ? -13.578 20.154  -0.348  1.00 0.00 ? 90  CYS A HA   2  
ATOM 3092  H HB2  . CYS A 1 90  ? -11.647 18.165  -1.304  1.00 0.00 ? 90  CYS A HB2  2  
ATOM 3093  H HB3  . CYS A 1 90  ? -12.650 17.556  -0.003  1.00 0.00 ? 90  CYS A HB3  2  
ATOM 3094  H HG   . CYS A 1 90  ? -14.934 18.507  -1.071  1.00 0.00 ? 90  CYS A HG   2  
ATOM 3095  N N    . ASP A 1 91  ? -13.290 20.202  2.120   1.00 0.00 ? 91  ASP A N    2  
ATOM 3096  C CA   . ASP A 1 91  ? -13.179 20.217  3.568   1.00 0.00 ? 91  ASP A CA   2  
ATOM 3097  C C    . ASP A 1 91  ? -12.798 18.820  4.061   1.00 0.00 ? 91  ASP A C    2  
ATOM 3098  O O    . ASP A 1 91  ? -11.902 18.673  4.891   1.00 0.00 ? 91  ASP A O    2  
ATOM 3099  C CB   . ASP A 1 91  ? -14.510 20.601  4.219   1.00 0.00 ? 91  ASP A CB   2  
ATOM 3100  C CG   . ASP A 1 91  ? -14.772 22.105  4.316   1.00 0.00 ? 91  ASP A CG   2  
ATOM 3101  O OD1  . ASP A 1 91  ? -14.820 22.744  3.242   1.00 0.00 ? 91  ASP A OD1  2  
ATOM 3102  O OD2  . ASP A 1 91  ? -14.918 22.583  5.462   1.00 0.00 ? 91  ASP A OD2  2  
ATOM 3103  H H    . ASP A 1 91  ? -14.116 20.633  1.755   1.00 0.00 ? 91  ASP A H    2  
ATOM 3104  H HA   . ASP A 1 91  ? -12.413 20.961  3.789   1.00 0.00 ? 91  ASP A HA   2  
ATOM 3105  H HB2  . ASP A 1 91  ? -15.320 20.142  3.652   1.00 0.00 ? 91  ASP A HB2  2  
ATOM 3106  H HB3  . ASP A 1 91  ? -14.542 20.176  5.222   1.00 0.00 ? 91  ASP A HB3  2  
ATOM 3107  N N    . THR A 1 92  ? -13.497 17.829  3.529   1.00 0.00 ? 92  THR A N    2  
ATOM 3108  C CA   . THR A 1 92  ? -13.243 16.448  3.904   1.00 0.00 ? 92  THR A CA   2  
ATOM 3109  C C    . THR A 1 92  ? -13.097 15.575  2.656   1.00 0.00 ? 92  THR A C    2  
ATOM 3110  O O    . THR A 1 92  ? -13.990 15.540  1.810   1.00 0.00 ? 92  THR A O    2  
ATOM 3111  C CB   . THR A 1 92  ? -14.371 15.995  4.833   1.00 0.00 ? 92  THR A CB   2  
ATOM 3112  O OG1  . THR A 1 92  ? -14.474 17.045  5.791   1.00 0.00 ? 92  THR A OG1  2  
ATOM 3113  C CG2  . THR A 1 92  ? -13.988 14.769  5.664   1.00 0.00 ? 92  THR A CG2  2  
ATOM 3114  H H    . THR A 1 92  ? -14.225 17.956  2.854   1.00 0.00 ? 92  THR A H    2  
ATOM 3115  H HA   . THR A 1 92  ? -12.294 16.406  4.437   1.00 0.00 ? 92  THR A HA   2  
ATOM 3116  H HB   . THR A 1 92  ? -15.289 15.816  4.274   1.00 0.00 ? 92  THR A HB   2  
ATOM 3117  H HG1  . THR A 1 92  ? -14.799 17.881  5.349   1.00 0.00 ? 92  THR A HG1  2  
ATOM 3118  H HG21 . THR A 1 92  ? -14.788 14.030  5.612   1.00 0.00 ? 92  THR A HG21 2  
ATOM 3119  H HG22 . THR A 1 92  ? -13.068 14.337  5.272   1.00 0.00 ? 92  THR A HG22 2  
ATOM 3120  H HG23 . THR A 1 92  ? -13.836 15.066  6.702   1.00 0.00 ? 92  THR A HG23 2  
ATOM 3121  N N    . ILE A 1 93  ? -11.965 14.890  2.581   1.00 0.00 ? 93  ILE A N    2  
ATOM 3122  C CA   . ILE A 1 93  ? -11.691 14.019  1.451   1.00 0.00 ? 93  ILE A CA   2  
ATOM 3123  C C    . ILE A 1 93  ? -11.131 12.690  1.961   1.00 0.00 ? 93  ILE A C    2  
ATOM 3124  O O    . ILE A 1 93  ? -10.455 12.650  2.988   1.00 0.00 ? 93  ILE A O    2  
ATOM 3125  C CB   . ILE A 1 93  ? -10.782 14.722  0.441   1.00 0.00 ? 93  ILE A CB   2  
ATOM 3126  C CG1  . ILE A 1 93  ? -9.958  13.708  -0.354  1.00 0.00 ? 93  ILE A CG1  2  
ATOM 3127  C CG2  . ILE A 1 93  ? -9.898  15.764  1.131   1.00 0.00 ? 93  ILE A CG2  2  
ATOM 3128  C CD1  . ILE A 1 93  ? -8.684  13.323  0.401   1.00 0.00 ? 93  ILE A CD1  2  
ATOM 3129  H H    . ILE A 1 93  ? -11.244 14.924  3.273   1.00 0.00 ? 93  ILE A H    2  
ATOM 3130  H HA   . ILE A 1 93  ? -12.639 13.825  0.950   1.00 0.00 ? 93  ILE A HA   2  
ATOM 3131  H HB   . ILE A 1 93  ? -11.411 15.255  -0.272  1.00 0.00 ? 93  ILE A HB   2  
ATOM 3132  H HG12 . ILE A 1 93  ? -10.556 12.816  -0.544  1.00 0.00 ? 93  ILE A HG12 2  
ATOM 3133  H HG13 . ILE A 1 93  ? -9.696  14.128  -1.326  1.00 0.00 ? 93  ILE A HG13 2  
ATOM 3134  H HG21 . ILE A 1 93  ? -9.558  15.374  2.090   1.00 0.00 ? 93  ILE A HG21 2  
ATOM 3135  H HG22 . ILE A 1 93  ? -9.036  15.983  0.501   1.00 0.00 ? 93  ILE A HG22 2  
ATOM 3136  H HG23 . ILE A 1 93  ? -10.471 16.677  1.292   1.00 0.00 ? 93  ILE A HG23 2  
ATOM 3137  H HD11 . ILE A 1 93  ? -7.828  13.824  -0.051  1.00 0.00 ? 93  ILE A HD11 2  
ATOM 3138  H HD12 . ILE A 1 93  ? -8.774  13.627  1.444   1.00 0.00 ? 93  ILE A HD12 2  
ATOM 3139  H HD13 . ILE A 1 93  ? -8.543  12.243  0.349   1.00 0.00 ? 93  ILE A HD13 2  
ATOM 3140  N N    . THR A 1 94  ? -11.433 11.634  1.220   1.00 0.00 ? 94  THR A N    2  
ATOM 3141  C CA   . THR A 1 94  ? -10.968 10.306  1.585   1.00 0.00 ? 94  THR A CA   2  
ATOM 3142  C C    . THR A 1 94  ? -9.854  9.853   0.639   1.00 0.00 ? 94  THR A C    2  
ATOM 3143  O O    . THR A 1 94  ? -9.618  10.479  -0.393  1.00 0.00 ? 94  THR A O    2  
ATOM 3144  C CB   . THR A 1 94  ? -12.176 9.368   1.594   1.00 0.00 ? 94  THR A CB   2  
ATOM 3145  O OG1  . THR A 1 94  ? -13.217 10.149  2.175   1.00 0.00 ? 94  THR A OG1  2  
ATOM 3146  C CG2  . THR A 1 94  ? -12.002 8.199   2.565   1.00 0.00 ? 94  THR A CG2  2  
ATOM 3147  H H    . THR A 1 94  ? -11.983 11.675  0.386   1.00 0.00 ? 94  THR A H    2  
ATOM 3148  H HA   . THR A 1 94  ? -10.538 10.356  2.585   1.00 0.00 ? 94  THR A HA   2  
ATOM 3149  H HB   . THR A 1 94  ? -12.399 9.010   0.589   1.00 0.00 ? 94  THR A HB   2  
ATOM 3150  H HG1  . THR A 1 94  ? -12.920 10.515  3.056   1.00 0.00 ? 94  THR A HG1  2  
ATOM 3151  H HG21 . THR A 1 94  ? -11.000 8.228   2.993   1.00 0.00 ? 94  THR A HG21 2  
ATOM 3152  H HG22 . THR A 1 94  ? -12.740 8.276   3.364   1.00 0.00 ? 94  THR A HG22 2  
ATOM 3153  H HG23 . THR A 1 94  ? -12.142 7.259   2.031   1.00 0.00 ? 94  THR A HG23 2  
ATOM 3154  N N    . ILE A 1 95  ? -9.198  8.768   1.026   1.00 0.00 ? 95  ILE A N    2  
ATOM 3155  C CA   . ILE A 1 95  ? -8.115  8.224   0.225   1.00 0.00 ? 95  ILE A CA   2  
ATOM 3156  C C    . ILE A 1 95  ? -8.195  6.696   0.238   1.00 0.00 ? 95  ILE A C    2  
ATOM 3157  O O    . ILE A 1 95  ? -8.450  6.093   1.280   1.00 0.00 ? 95  ILE A O    2  
ATOM 3158  C CB   . ILE A 1 95  ? -6.769  8.774   0.700   1.00 0.00 ? 95  ILE A CB   2  
ATOM 3159  C CG1  . ILE A 1 95  ? -6.451  10.108  0.022   1.00 0.00 ? 95  ILE A CG1  2  
ATOM 3160  C CG2  . ILE A 1 95  ? -5.653  7.746   0.495   1.00 0.00 ? 95  ILE A CG2  2  
ATOM 3161  C CD1  . ILE A 1 95  ? -5.424  10.903  0.831   1.00 0.00 ? 95  ILE A CD1  2  
ATOM 3162  H H    . ILE A 1 95  ? -9.396  8.265   1.867   1.00 0.00 ? 95  ILE A H    2  
ATOM 3163  H HA   . ILE A 1 95  ? -8.260  8.568   -0.799  1.00 0.00 ? 95  ILE A HA   2  
ATOM 3164  H HB   . ILE A 1 95  ? -6.837  8.965   1.771   1.00 0.00 ? 95  ILE A HB   2  
ATOM 3165  H HG12 . ILE A 1 95  ? -6.067  9.927   -0.982  1.00 0.00 ? 95  ILE A HG12 2  
ATOM 3166  H HG13 . ILE A 1 95  ? -7.365  10.692  -0.086  1.00 0.00 ? 95  ILE A HG13 2  
ATOM 3167  H HG21 . ILE A 1 95  ? -5.669  7.026   1.313   1.00 0.00 ? 95  ILE A HG21 2  
ATOM 3168  H HG22 . ILE A 1 95  ? -5.808  7.226   -0.450  1.00 0.00 ? 95  ILE A HG22 2  
ATOM 3169  H HG23 . ILE A 1 95  ? -4.690  8.255   0.477   1.00 0.00 ? 95  ILE A HG23 2  
ATOM 3170  H HD11 . ILE A 1 95  ? -5.819  11.896  1.044   1.00 0.00 ? 95  ILE A HD11 2  
ATOM 3171  H HD12 . ILE A 1 95  ? -5.218  10.385  1.767   1.00 0.00 ? 95  ILE A HD12 2  
ATOM 3172  H HD13 . ILE A 1 95  ? -4.501  10.995  0.257   1.00 0.00 ? 95  ILE A HD13 2  
ATOM 3173  N N    . LEU A 1 96  ? -7.972  6.113   -0.930  1.00 0.00 ? 96  LEU A N    2  
ATOM 3174  C CA   . LEU A 1 96  ? -8.015  4.667   -1.066  1.00 0.00 ? 96  LEU A CA   2  
ATOM 3175  C C    . LEU A 1 96  ? -6.595  4.136   -1.268  1.00 0.00 ? 96  LEU A C    2  
ATOM 3176  O O    . LEU A 1 96  ? -6.135  3.996   -2.400  1.00 0.00 ? 96  LEU A O    2  
ATOM 3177  C CB   . LEU A 1 96  ? -8.987  4.262   -2.176  1.00 0.00 ? 96  LEU A CB   2  
ATOM 3178  C CG   . LEU A 1 96  ? -9.075  2.765   -2.477  1.00 0.00 ? 96  LEU A CG   2  
ATOM 3179  C CD1  . LEU A 1 96  ? -9.494  1.979   -1.233  1.00 0.00 ? 96  LEU A CD1  2  
ATOM 3180  C CD2  . LEU A 1 96  ? -10.003 2.498   -3.664  1.00 0.00 ? 96  LEU A CD2  2  
ATOM 3181  H H    . LEU A 1 96  ? -7.765  6.611   -1.773  1.00 0.00 ? 96  LEU A H    2  
ATOM 3182  H HA   . LEU A 1 96  ? -8.406  4.263   -0.132  1.00 0.00 ? 96  LEU A HA   2  
ATOM 3183  H HB2  . LEU A 1 96  ? -9.982  4.618   -1.908  1.00 0.00 ? 96  LEU A HB2  2  
ATOM 3184  H HB3  . LEU A 1 96  ? -8.699  4.780   -3.091  1.00 0.00 ? 96  LEU A HB3  2  
ATOM 3185  H HG   . LEU A 1 96  ? -8.082  2.414   -2.760  1.00 0.00 ? 96  LEU A HG   2  
ATOM 3186  H HD11 . LEU A 1 96  ? -8.609  1.575   -0.743  1.00 0.00 ? 96  LEU A HD11 2  
ATOM 3187  H HD12 . LEU A 1 96  ? -10.020 2.641   -0.546  1.00 0.00 ? 96  LEU A HD12 2  
ATOM 3188  H HD13 . LEU A 1 96  ? -10.153 1.161   -1.525  1.00 0.00 ? 96  LEU A HD13 2  
ATOM 3189  H HD21 . LEU A 1 96  ? -10.036 1.427   -3.865  1.00 0.00 ? 96  LEU A HD21 2  
ATOM 3190  H HD22 . LEU A 1 96  ? -11.005 2.855   -3.429  1.00 0.00 ? 96  LEU A HD22 2  
ATOM 3191  H HD23 . LEU A 1 96  ? -9.628  3.021   -4.544  1.00 0.00 ? 96  LEU A HD23 2  
ATOM 3192  N N    . ALA A 1 97  ? -5.939  3.853   -0.152  1.00 0.00 ? 97  ALA A N    2  
ATOM 3193  C CA   . ALA A 1 97  ? -4.580  3.340   -0.192  1.00 0.00 ? 97  ALA A CA   2  
ATOM 3194  C C    . ALA A 1 97  ? -4.613  1.813   -0.101  1.00 0.00 ? 97  ALA A C    2  
ATOM 3195  O O    . ALA A 1 97  ? -5.680  1.220   0.053   1.00 0.00 ? 97  ALA A O    2  
ATOM 3196  C CB   . ALA A 1 97  ? -3.761  3.973   0.934   1.00 0.00 ? 97  ALA A CB   2  
ATOM 3197  H H    . ALA A 1 97  ? -6.319  3.970   0.765   1.00 0.00 ? 97  ALA A H    2  
ATOM 3198  H HA   . ALA A 1 97  ? -4.144  3.629   -1.148  1.00 0.00 ? 97  ALA A HA   2  
ATOM 3199  H HB1  . ALA A 1 97  ? -3.394  4.948   0.613   1.00 0.00 ? 97  ALA A HB1  2  
ATOM 3200  H HB2  . ALA A 1 97  ? -4.390  4.094   1.817   1.00 0.00 ? 97  ALA A HB2  2  
ATOM 3201  H HB3  . ALA A 1 97  ? -2.916  3.329   1.176   1.00 0.00 ? 97  ALA A HB3  2  
ATOM 3202  N N    . GLN A 1 98  ? -3.433  1.220   -0.200  1.00 0.00 ? 98  GLN A N    2  
ATOM 3203  C CA   . GLN A 1 98  ? -3.313  -0.226  -0.131  1.00 0.00 ? 98  GLN A CA   2  
ATOM 3204  C C    . GLN A 1 98  ? -1.840  -0.639  -0.156  1.00 0.00 ? 98  GLN A C    2  
ATOM 3205  O O    . GLN A 1 98  ? -1.307  -0.985  -1.210  1.00 0.00 ? 98  GLN A O    2  
ATOM 3206  C CB   . GLN A 1 98  ? -4.090  -0.895  -1.266  1.00 0.00 ? 98  GLN A CB   2  
ATOM 3207  C CG   . GLN A 1 98  ? -4.247  -2.396  -1.013  1.00 0.00 ? 98  GLN A CG   2  
ATOM 3208  C CD   . GLN A 1 98  ? -4.739  -3.116  -2.271  1.00 0.00 ? 98  GLN A CD   2  
ATOM 3209  O OE1  . GLN A 1 98  ? -4.706  -2.590  -3.371  1.00 0.00 ? 98  GLN A OE1  2  
ATOM 3210  N NE2  . GLN A 1 98  ? -5.196  -4.345  -2.047  1.00 0.00 ? 98  GLN A NE2  2  
ATOM 3211  H H    . GLN A 1 98  ? -2.570  1.710   -0.325  1.00 0.00 ? 98  GLN A H    2  
ATOM 3212  H HA   . GLN A 1 98  ? -3.760  -0.508  0.822   1.00 0.00 ? 98  GLN A HA   2  
ATOM 3213  H HB2  . GLN A 1 98  ? -5.073  -0.434  -1.361  1.00 0.00 ? 98  GLN A HB2  2  
ATOM 3214  H HB3  . GLN A 1 98  ? -3.571  -0.735  -2.211  1.00 0.00 ? 98  GLN A HB3  2  
ATOM 3215  H HG2  . GLN A 1 98  ? -3.292  -2.818  -0.699  1.00 0.00 ? 98  GLN A HG2  2  
ATOM 3216  H HG3  . GLN A 1 98  ? -4.952  -2.559  -0.198  1.00 0.00 ? 98  GLN A HG3  2  
ATOM 3217  H HE21 . GLN A 1 98  ? -5.195  -4.717  -1.119  1.00 0.00 ? 98  GLN A HE21 2  
ATOM 3218  H HE22 . GLN A 1 98  ? -5.539  -4.896  -2.807  1.00 0.00 ? 98  GLN A HE22 2  
ATOM 3219  N N    . TYR A 1 99  ? -1.224  -0.589  1.016   1.00 0.00 ? 99  TYR A N    2  
ATOM 3220  C CA   . TYR A 1 99  ? 0.177   -0.954  1.141   1.00 0.00 ? 99  TYR A CA   2  
ATOM 3221  C C    . TYR A 1 99  ? 0.518   -2.137  0.234   1.00 0.00 ? 99  TYR A C    2  
ATOM 3222  O O    . TYR A 1 99  ? -0.289  -3.051  0.069   1.00 0.00 ? 99  TYR A O    2  
ATOM 3223  C CB   . TYR A 1 99  ? 0.375   -1.370  2.600   1.00 0.00 ? 99  TYR A CB   2  
ATOM 3224  C CG   . TYR A 1 99  ? 1.802   -1.813  2.931   1.00 0.00 ? 99  TYR A CG   2  
ATOM 3225  C CD1  . TYR A 1 99  ? 2.170   -3.133  2.767   1.00 0.00 ? 99  TYR A CD1  2  
ATOM 3226  C CD2  . TYR A 1 99  ? 2.720   -0.893  3.396   1.00 0.00 ? 99  TYR A CD2  2  
ATOM 3227  C CE1  . TYR A 1 99  ? 3.513   -3.550  3.079   1.00 0.00 ? 99  TYR A CE1  2  
ATOM 3228  C CE2  . TYR A 1 99  ? 4.062   -1.310  3.708   1.00 0.00 ? 99  TYR A CE2  2  
ATOM 3229  C CZ   . TYR A 1 99  ? 4.392   -2.618  3.534   1.00 0.00 ? 99  TYR A CZ   2  
ATOM 3230  O OH   . TYR A 1 99  ? 5.660   -3.012  3.830   1.00 0.00 ? 99  TYR A OH   2  
ATOM 3231  H H    . TYR A 1 99  ? -1.665  -0.306  1.867   1.00 0.00 ? 99  TYR A H    2  
ATOM 3232  H HA   . TYR A 1 99  ? 0.776   -0.093  0.844   1.00 0.00 ? 99  TYR A HA   2  
ATOM 3233  H HB2  . TYR A 1 99  ? 0.106   -0.534  3.245   1.00 0.00 ? 99  TYR A HB2  2  
ATOM 3234  H HB3  . TYR A 1 99  ? -0.310  -2.185  2.831   1.00 0.00 ? 99  TYR A HB3  2  
ATOM 3235  H HD1  . TYR A 1 99  ? 1.445   -3.860  2.400   1.00 0.00 ? 99  TYR A HD1  2  
ATOM 3236  H HD2  . TYR A 1 99  ? 2.429   0.149   3.526   1.00 0.00 ? 99  TYR A HD2  2  
ATOM 3237  H HE1  . TYR A 1 99  ? 3.817   -4.589  2.953   1.00 0.00 ? 99  TYR A HE1  2  
ATOM 3238  H HE2  . TYR A 1 99  ? 4.797   -0.594  4.076   1.00 0.00 ? 99  TYR A HE2  2  
ATOM 3239  H HH   . TYR A 1 99  ? 6.309   -2.293  3.579   1.00 0.00 ? 99  TYR A HH   2  
ATOM 3240  N N    . ASN A 1 100 ? 1.716   -2.083  -0.330  1.00 0.00 ? 100 ASN A N    2  
ATOM 3241  C CA   . ASN A 1 100 ? 2.175   -3.140  -1.216  1.00 0.00 ? 100 ASN A CA   2  
ATOM 3242  C C    . ASN A 1 100 ? 3.653   -3.422  -0.943  1.00 0.00 ? 100 ASN A C    2  
ATOM 3243  O O    . ASN A 1 100 ? 4.505   -2.564  -1.168  1.00 0.00 ? 100 ASN A O    2  
ATOM 3244  C CB   . ASN A 1 100 ? 2.035   -2.728  -2.683  1.00 0.00 ? 100 ASN A CB   2  
ATOM 3245  C CG   . ASN A 1 100 ? 2.099   -3.948  -3.604  1.00 0.00 ? 100 ASN A CG   2  
ATOM 3246  O OD1  . ASN A 1 100 ? 2.385   -5.058  -3.187  1.00 0.00 ? 100 ASN A OD1  2  
ATOM 3247  N ND2  . ASN A 1 100 ? 1.817   -3.681  -4.876  1.00 0.00 ? 100 ASN A ND2  2  
ATOM 3248  H H    . ASN A 1 100 ? 2.367   -1.337  -0.191  1.00 0.00 ? 100 ASN A H    2  
ATOM 3249  H HA   . ASN A 1 100 ? 1.538   -3.996  -0.994  1.00 0.00 ? 100 ASN A HA   2  
ATOM 3250  H HB2  . ASN A 1 100 ? 1.089   -2.206  -2.830  1.00 0.00 ? 100 ASN A HB2  2  
ATOM 3251  H HB3  . ASN A 1 100 ? 2.828   -2.028  -2.945  1.00 0.00 ? 100 ASN A HB3  2  
ATOM 3252  H HD21 . ASN A 1 100 ? 1.589   -2.748  -5.152  1.00 0.00 ? 100 ASN A HD21 2  
ATOM 3253  H HD22 . ASN A 1 100 ? 1.832   -4.415  -5.556  1.00 0.00 ? 100 ASN A HD22 2  
ATOM 3254  N N    . PRO A 1 101 ? 3.920   -4.662  -0.451  1.00 0.00 ? 101 PRO A N    2  
ATOM 3255  C CA   . PRO A 1 101 ? 5.281   -5.068  -0.145  1.00 0.00 ? 101 PRO A CA   2  
ATOM 3256  C C    . PRO A 1 101 ? 6.064   -5.371  -1.424  1.00 0.00 ? 101 PRO A C    2  
ATOM 3257  O O    . PRO A 1 101 ? 6.626   -6.455  -1.571  1.00 0.00 ? 101 PRO A O    2  
ATOM 3258  C CB   . PRO A 1 101 ? 5.136   -6.279  0.762   1.00 0.00 ? 101 PRO A CB   2  
ATOM 3259  C CG   . PRO A 1 101 ? 3.718   -6.786  0.557   1.00 0.00 ? 101 PRO A CG   2  
ATOM 3260  C CD   . PRO A 1 101 ? 2.937   -5.705  -0.173  1.00 0.00 ? 101 PRO A CD   2  
ATOM 3261  H HA   . PRO A 1 101 ? 5.773   -4.324  0.306   1.00 0.00 ? 101 PRO A HA   2  
ATOM 3262  H HB2  . PRO A 1 101 ? 5.866   -7.047  0.509   1.00 0.00 ? 101 PRO A HB2  2  
ATOM 3263  H HB3  . PRO A 1 101 ? 5.307   -6.009  1.805   1.00 0.00 ? 101 PRO A HB3  2  
ATOM 3264  H HG2  . PRO A 1 101 ? 3.723   -7.709  -0.022  1.00 0.00 ? 101 PRO A HG2  2  
ATOM 3265  H HG3  . PRO A 1 101 ? 3.251   -7.013  1.515   1.00 0.00 ? 101 PRO A HG3  2  
ATOM 3266  H HD2  . PRO A 1 101 ? 2.495   -6.087  -1.092  1.00 0.00 ? 101 PRO A HD2  2  
ATOM 3267  H HD3  . PRO A 1 101 ? 2.120   -5.325  0.440   1.00 0.00 ? 101 PRO A HD3  2  
ATOM 3268  N N    . HIS A 1 102 ? 6.075   -4.393  -2.318  1.00 0.00 ? 102 HIS A N    2  
ATOM 3269  C CA   . HIS A 1 102 ? 6.779   -4.541  -3.581  1.00 0.00 ? 102 HIS A CA   2  
ATOM 3270  C C    . HIS A 1 102 ? 7.043   -3.161  -4.186  1.00 0.00 ? 102 HIS A C    2  
ATOM 3271  O O    . HIS A 1 102 ? 6.725   -2.918  -5.349  1.00 0.00 ? 102 HIS A O    2  
ATOM 3272  C CB   . HIS A 1 102 ? 6.011   -5.466  -4.526  1.00 0.00 ? 102 HIS A CB   2  
ATOM 3273  C CG   . HIS A 1 102 ? 6.667   -6.809  -4.739  1.00 0.00 ? 102 HIS A CG   2  
ATOM 3274  N ND1  . HIS A 1 102 ? 6.047   -8.005  -4.420  1.00 0.00 ? 102 HIS A ND1  2  
ATOM 3275  C CD2  . HIS A 1 102 ? 7.892   -7.133  -5.242  1.00 0.00 ? 102 HIS A CD2  2  
ATOM 3276  C CE1  . HIS A 1 102 ? 6.872   -8.997  -4.721  1.00 0.00 ? 102 HIS A CE1  2  
ATOM 3277  N NE2  . HIS A 1 102 ? 8.016   -8.454  -5.229  1.00 0.00 ? 102 HIS A NE2  2  
ATOM 3278  H H    . HIS A 1 102 ? 5.615   -3.514  -2.191  1.00 0.00 ? 102 HIS A H    2  
ATOM 3279  H HA   . HIS A 1 102 ? 7.733   -5.016  -3.353  1.00 0.00 ? 102 HIS A HA   2  
ATOM 3280  H HB2  . HIS A 1 102 ? 5.007   -5.622  -4.130  1.00 0.00 ? 102 HIS A HB2  2  
ATOM 3281  H HB3  . HIS A 1 102 ? 5.899   -4.971  -5.491  1.00 0.00 ? 102 HIS A HB3  2  
ATOM 3282  H HD1  . HIS A 1 102 ? 5.132   -8.104  -4.029  1.00 0.00 ? 102 HIS A HD1  2  
ATOM 3283  H HD2  . HIS A 1 102 ? 8.643   -6.426  -5.594  1.00 0.00 ? 102 HIS A HD2  2  
ATOM 3284  H HE1  . HIS A 1 102 ? 6.673   -10.060 -4.585  1.00 0.00 ? 102 HIS A HE1  2  
ATOM 3285  N N    . VAL A 1 103 ? 7.621   -2.292  -3.369  1.00 0.00 ? 103 VAL A N    2  
ATOM 3286  C CA   . VAL A 1 103 ? 7.931   -0.943  -3.810  1.00 0.00 ? 103 VAL A CA   2  
ATOM 3287  C C    . VAL A 1 103 ? 9.026   -0.358  -2.916  1.00 0.00 ? 103 VAL A C    2  
ATOM 3288  O O    . VAL A 1 103 ? 8.763   0.528   -2.104  1.00 0.00 ? 103 VAL A O    2  
ATOM 3289  C CB   . VAL A 1 103 ? 6.658   -0.093  -3.829  1.00 0.00 ? 103 VAL A CB   2  
ATOM 3290  C CG1  . VAL A 1 103 ? 5.805   -0.355  -2.586  1.00 0.00 ? 103 VAL A CG1  2  
ATOM 3291  C CG2  . VAL A 1 103 ? 6.994   1.394   -3.961  1.00 0.00 ? 103 VAL A CG2  2  
ATOM 3292  H H    . VAL A 1 103 ? 7.876   -2.497  -2.424  1.00 0.00 ? 103 VAL A H    2  
ATOM 3293  H HA   . VAL A 1 103 ? 8.309   -1.008  -4.830  1.00 0.00 ? 103 VAL A HA   2  
ATOM 3294  H HB   . VAL A 1 103 ? 6.075   -0.384  -4.703  1.00 0.00 ? 103 VAL A HB   2  
ATOM 3295  H HG11 . VAL A 1 103 ? 4.864   -0.818  -2.883  1.00 0.00 ? 103 VAL A HG11 2  
ATOM 3296  H HG12 . VAL A 1 103 ? 6.342   -1.022  -1.911  1.00 0.00 ? 103 VAL A HG12 2  
ATOM 3297  H HG13 . VAL A 1 103 ? 5.602   0.588   -2.080  1.00 0.00 ? 103 VAL A HG13 2  
ATOM 3298  H HG21 . VAL A 1 103 ? 6.238   1.883   -4.576  1.00 0.00 ? 103 VAL A HG21 2  
ATOM 3299  H HG22 . VAL A 1 103 ? 7.010   1.852   -2.972  1.00 0.00 ? 103 VAL A HG22 2  
ATOM 3300  H HG23 . VAL A 1 103 ? 7.971   1.506   -4.429  1.00 0.00 ? 103 VAL A HG23 2  
ATOM 3301  N N    . HIS A 1 104 ? 10.232  -0.877  -3.095  1.00 0.00 ? 104 HIS A N    2  
ATOM 3302  C CA   . HIS A 1 104 ? 11.368  -0.418  -2.314  1.00 0.00 ? 104 HIS A CA   2  
ATOM 3303  C C    . HIS A 1 104 ? 11.804  0.963   -2.808  1.00 0.00 ? 104 HIS A C    2  
ATOM 3304  O O    . HIS A 1 104 ? 11.583  1.966   -2.131  1.00 0.00 ? 104 HIS A O    2  
ATOM 3305  C CB   . HIS A 1 104 ? 12.501  -1.445  -2.348  1.00 0.00 ? 104 HIS A CB   2  
ATOM 3306  C CG   . HIS A 1 104 ? 12.611  -2.280  -1.095  1.00 0.00 ? 104 HIS A CG   2  
ATOM 3307  N ND1  . HIS A 1 104 ? 13.764  -2.338  -0.332  1.00 0.00 ? 104 HIS A ND1  2  
ATOM 3308  C CD2  . HIS A 1 104 ? 11.701  -3.088  -0.480  1.00 0.00 ? 104 HIS A CD2  2  
ATOM 3309  C CE1  . HIS A 1 104 ? 13.547  -3.149  0.693   1.00 0.00 ? 104 HIS A CE1  2  
ATOM 3310  N NE2  . HIS A 1 104 ? 12.268  -3.613  0.600   1.00 0.00 ? 104 HIS A NE2  2  
ATOM 3311  H H    . HIS A 1 104 ? 10.438  -1.598  -3.757  1.00 0.00 ? 104 HIS A H    2  
ATOM 3312  H HA   . HIS A 1 104 ? 11.026  -0.334  -1.283  1.00 0.00 ? 104 HIS A HA   2  
ATOM 3313  H HB2  . HIS A 1 104 ? 12.353  -2.107  -3.202  1.00 0.00 ? 104 HIS A HB2  2  
ATOM 3314  H HB3  . HIS A 1 104 ? 13.445  -0.924  -2.510  1.00 0.00 ? 104 HIS A HB3  2  
ATOM 3315  H HD1  . HIS A 1 104 ? 14.617  -1.852  -0.522  1.00 0.00 ? 104 HIS A HD1  2  
ATOM 3316  H HD2  . HIS A 1 104 ? 10.681  -3.272  -0.818  1.00 0.00 ? 104 HIS A HD2  2  
ATOM 3317  H HE1  . HIS A 1 104 ? 14.264  -3.401  1.475   1.00 0.00 ? 104 HIS A HE1  2  
ATOM 3318  N N    . GLN A 1 105 ? 12.417  0.970   -3.982  1.00 0.00 ? 105 GLN A N    2  
ATOM 3319  C CA   . GLN A 1 105 ? 12.887  2.212   -4.574  1.00 0.00 ? 105 GLN A CA   2  
ATOM 3320  C C    . GLN A 1 105 ? 13.790  2.960   -3.591  1.00 0.00 ? 105 GLN A C    2  
ATOM 3321  O O    . GLN A 1 105 ? 13.310  3.750   -2.780  1.00 0.00 ? 105 GLN A O    2  
ATOM 3322  C CB   . GLN A 1 105 ? 11.713  3.088   -5.015  1.00 0.00 ? 105 GLN A CB   2  
ATOM 3323  C CG   . GLN A 1 105 ? 11.925  3.615   -6.435  1.00 0.00 ? 105 GLN A CG   2  
ATOM 3324  C CD   . GLN A 1 105 ? 11.169  4.928   -6.651  1.00 0.00 ? 105 GLN A CD   2  
ATOM 3325  O OE1  . GLN A 1 105 ? 9.960   5.008   -6.507  1.00 0.00 ? 105 GLN A OE1  2  
ATOM 3326  N NE2  . GLN A 1 105 ? 11.945  5.948   -7.005  1.00 0.00 ? 105 GLN A NE2  2  
ATOM 3327  H H    . GLN A 1 105 ? 12.594  0.150   -4.526  1.00 0.00 ? 105 GLN A H    2  
ATOM 3328  H HA   . GLN A 1 105 ? 13.461  1.915   -5.452  1.00 0.00 ? 105 GLN A HA   2  
ATOM 3329  H HB2  . GLN A 1 105 ? 10.788  2.511   -4.972  1.00 0.00 ? 105 GLN A HB2  2  
ATOM 3330  H HB3  . GLN A 1 105 ? 11.599  3.924   -4.325  1.00 0.00 ? 105 GLN A HB3  2  
ATOM 3331  H HG2  . GLN A 1 105 ? 12.989  3.771   -6.613  1.00 0.00 ? 105 GLN A HG2  2  
ATOM 3332  H HG3  . GLN A 1 105 ? 11.587  2.873   -7.157  1.00 0.00 ? 105 GLN A HG3  2  
ATOM 3333  H HE21 . GLN A 1 105 ? 12.931  5.814   -7.106  1.00 0.00 ? 105 GLN A HE21 2  
ATOM 3334  H HE22 . GLN A 1 105 ? 11.543  6.848   -7.169  1.00 0.00 ? 105 GLN A HE22 2  
ATOM 3335  N N    . LEU A 1 106 ? 15.082  2.683   -3.696  1.00 0.00 ? 106 LEU A N    2  
ATOM 3336  C CA   . LEU A 1 106 ? 16.056  3.320   -2.827  1.00 0.00 ? 106 LEU A CA   2  
ATOM 3337  C C    . LEU A 1 106 ? 16.982  4.203   -3.666  1.00 0.00 ? 106 LEU A C    2  
ATOM 3338  O O    . LEU A 1 106 ? 16.956  5.427   -3.545  1.00 0.00 ? 106 LEU A O    2  
ATOM 3339  C CB   . LEU A 1 106 ? 16.796  2.272   -1.992  1.00 0.00 ? 106 LEU A CB   2  
ATOM 3340  C CG   . LEU A 1 106 ? 16.692  2.429   -0.474  1.00 0.00 ? 106 LEU A CG   2  
ATOM 3341  C CD1  . LEU A 1 106 ? 17.283  1.214   0.244   1.00 0.00 ? 106 LEU A CD1  2  
ATOM 3342  C CD2  . LEU A 1 106 ? 17.338  3.738   -0.013  1.00 0.00 ? 106 LEU A CD2  2  
ATOM 3343  H H    . LEU A 1 106 ? 15.464  2.039   -4.358  1.00 0.00 ? 106 LEU A H    2  
ATOM 3344  H HA   . LEU A 1 106 ? 15.508  3.957   -2.132  1.00 0.00 ? 106 LEU A HA   2  
ATOM 3345  H HB2  . LEU A 1 106 ? 16.415  1.287   -2.263  1.00 0.00 ? 106 LEU A HB2  2  
ATOM 3346  H HB3  . LEU A 1 106 ? 17.850  2.294   -2.269  1.00 0.00 ? 106 LEU A HB3  2  
ATOM 3347  H HG   . LEU A 1 106 ? 15.637  2.479   -0.206  1.00 0.00 ? 106 LEU A HG   2  
ATOM 3348  H HD11 . LEU A 1 106 ? 16.778  1.076   1.200   1.00 0.00 ? 106 LEU A HD11 2  
ATOM 3349  H HD12 . LEU A 1 106 ? 17.146  0.326   -0.372  1.00 0.00 ? 106 LEU A HD12 2  
ATOM 3350  H HD13 . LEU A 1 106 ? 18.348  1.376   0.416   1.00 0.00 ? 106 LEU A HD13 2  
ATOM 3351  H HD21 . LEU A 1 106 ? 18.420  3.665   -0.117  1.00 0.00 ? 106 LEU A HD21 2  
ATOM 3352  H HD22 . LEU A 1 106 ? 16.968  4.561   -0.624  1.00 0.00 ? 106 LEU A HD22 2  
ATOM 3353  H HD23 . LEU A 1 106 ? 17.084  3.919   1.032   1.00 0.00 ? 106 LEU A HD23 2  
ATOM 3354  N N    . SER A 1 107 ? 17.778  3.548   -4.497  1.00 0.00 ? 107 SER A N    2  
ATOM 3355  C CA   . SER A 1 107 ? 18.711  4.258   -5.357  1.00 0.00 ? 107 SER A CA   2  
ATOM 3356  C C    . SER A 1 107 ? 17.988  5.389   -6.091  1.00 0.00 ? 107 SER A C    2  
ATOM 3357  O O    . SER A 1 107 ? 16.759  5.424   -6.129  1.00 0.00 ? 107 SER A O    2  
ATOM 3358  C CB   . SER A 1 107 ? 19.368  3.308   -6.360  1.00 0.00 ? 107 SER A CB   2  
ATOM 3359  O OG   . SER A 1 107 ? 20.787  3.304   -6.240  1.00 0.00 ? 107 SER A OG   2  
ATOM 3360  H H    . SER A 1 107 ? 17.793  2.552   -4.589  1.00 0.00 ? 107 SER A H    2  
ATOM 3361  H HA   . SER A 1 107 ? 19.470  4.661   -4.687  1.00 0.00 ? 107 SER A HA   2  
ATOM 3362  H HB2  . SER A 1 107 ? 18.988  2.298   -6.206  1.00 0.00 ? 107 SER A HB2  2  
ATOM 3363  H HB3  . SER A 1 107 ? 19.090  3.602   -7.372  1.00 0.00 ? 107 SER A HB3  2  
ATOM 3364  H HG   . SER A 1 107 ? 21.100  2.415   -5.905  1.00 0.00 ? 107 SER A HG   2  
ATOM 3365  N N    . SER A 1 108 ? 18.782  6.287   -6.656  1.00 0.00 ? 108 SER A N    2  
ATOM 3366  C CA   . SER A 1 108 ? 18.233  7.417   -7.387  1.00 0.00 ? 108 SER A CA   2  
ATOM 3367  C C    . SER A 1 108 ? 17.308  8.229   -6.478  1.00 0.00 ? 108 SER A C    2  
ATOM 3368  O O    . SER A 1 108 ? 16.104  7.981   -6.431  1.00 0.00 ? 108 SER A O    2  
ATOM 3369  C CB   . SER A 1 108 ? 17.478  6.952   -8.633  1.00 0.00 ? 108 SER A CB   2  
ATOM 3370  O OG   . SER A 1 108 ? 17.704  7.812   -9.747  1.00 0.00 ? 108 SER A OG   2  
ATOM 3371  H H    . SER A 1 108 ? 19.780  6.252   -6.620  1.00 0.00 ? 108 SER A H    2  
ATOM 3372  H HA   . SER A 1 108 ? 19.095  8.013   -7.686  1.00 0.00 ? 108 SER A HA   2  
ATOM 3373  H HB2  . SER A 1 108 ? 17.789  5.939   -8.889  1.00 0.00 ? 108 SER A HB2  2  
ATOM 3374  H HB3  . SER A 1 108 ? 16.410  6.912   -8.417  1.00 0.00 ? 108 SER A HB3  2  
ATOM 3375  H HG   . SER A 1 108 ? 18.525  7.525   -10.240 1.00 0.00 ? 108 SER A HG   2  
ATOM 3376  N N    . HIS A 1 109 ? 17.906  9.182   -5.779  1.00 0.00 ? 109 HIS A N    2  
ATOM 3377  C CA   . HIS A 1 109 ? 17.151  10.032  -4.874  1.00 0.00 ? 109 HIS A CA   2  
ATOM 3378  C C    . HIS A 1 109 ? 17.937  11.316  -4.600  1.00 0.00 ? 109 HIS A C    2  
ATOM 3379  O O    . HIS A 1 109 ? 18.385  11.546  -3.478  1.00 0.00 ? 109 HIS A O    2  
ATOM 3380  C CB   . HIS A 1 109 ? 16.786  9.275   -3.595  1.00 0.00 ? 109 HIS A CB   2  
ATOM 3381  C CG   . HIS A 1 109 ? 15.301  9.100   -3.387  1.00 0.00 ? 109 HIS A CG   2  
ATOM 3382  N ND1  . HIS A 1 109 ? 14.377  10.076  -3.720  1.00 0.00 ? 109 HIS A ND1  2  
ATOM 3383  C CD2  . HIS A 1 109 ? 14.589  8.054   -2.879  1.00 0.00 ? 109 HIS A CD2  2  
ATOM 3384  C CE1  . HIS A 1 109 ? 13.167  9.626   -3.420  1.00 0.00 ? 109 HIS A CE1  2  
ATOM 3385  N NE2  . HIS A 1 109 ? 13.301  8.373   -2.899  1.00 0.00 ? 109 HIS A NE2  2  
ATOM 3386  H H    . HIS A 1 109 ? 18.886  9.377   -5.823  1.00 0.00 ? 109 HIS A H    2  
ATOM 3387  H HA   . HIS A 1 109 ? 16.223  10.287  -5.386  1.00 0.00 ? 109 HIS A HA   2  
ATOM 3388  H HB2  . HIS A 1 109 ? 17.257  8.293   -3.619  1.00 0.00 ? 109 HIS A HB2  2  
ATOM 3389  H HB3  . HIS A 1 109 ? 17.202  9.807   -2.739  1.00 0.00 ? 109 HIS A HB3  2  
ATOM 3390  H HD1  . HIS A 1 109 ? 14.587  10.969  -4.119  1.00 0.00 ? 109 HIS A HD1  2  
ATOM 3391  H HD2  . HIS A 1 109 ? 15.008  7.114   -2.518  1.00 0.00 ? 109 HIS A HD2  2  
ATOM 3392  H HE1  . HIS A 1 109 ? 12.230  10.164  -3.565  1.00 0.00 ? 109 HIS A HE1  2  
ATOM 3393  N N    . SER A 1 110 ? 18.079  12.119  -5.644  1.00 0.00 ? 110 SER A N    2  
ATOM 3394  C CA   . SER A 1 110 ? 18.803  13.373  -5.530  1.00 0.00 ? 110 SER A CA   2  
ATOM 3395  C C    . SER A 1 110 ? 17.869  14.546  -5.836  1.00 0.00 ? 110 SER A C    2  
ATOM 3396  O O    . SER A 1 110 ? 17.666  15.418  -4.992  1.00 0.00 ? 110 SER A O    2  
ATOM 3397  C CB   . SER A 1 110 ? 20.012  13.399  -6.468  1.00 0.00 ? 110 SER A CB   2  
ATOM 3398  O OG   . SER A 1 110 ? 20.886  12.297  -6.242  1.00 0.00 ? 110 SER A OG   2  
ATOM 3399  H H    . SER A 1 110 ? 17.711  11.924  -6.553  1.00 0.00 ? 110 SER A H    2  
ATOM 3400  H HA   . SER A 1 110 ? 19.145  13.416  -4.496  1.00 0.00 ? 110 SER A HA   2  
ATOM 3401  H HB2  . SER A 1 110 ? 19.668  13.384  -7.502  1.00 0.00 ? 110 SER A HB2  2  
ATOM 3402  H HB3  . SER A 1 110 ? 20.559  14.331  -6.327  1.00 0.00 ? 110 SER A HB3  2  
ATOM 3403  H HG   . SER A 1 110 ? 20.658  11.851  -5.377  1.00 0.00 ? 110 SER A HG   2  
ATOM 3404  N N    . ARG A 1 111 ? 17.326  14.529  -7.044  1.00 0.00 ? 111 ARG A N    2  
ATOM 3405  C CA   . ARG A 1 111 ? 16.418  15.580  -7.471  1.00 0.00 ? 111 ARG A CA   2  
ATOM 3406  C C    . ARG A 1 111 ? 17.102  16.946  -7.369  1.00 0.00 ? 111 ARG A C    2  
ATOM 3407  O O    . ARG A 1 111 ? 18.177  17.063  -6.785  1.00 0.00 ? 111 ARG A O    2  
ATOM 3408  C CB   . ARG A 1 111 ? 15.146  15.589  -6.621  1.00 0.00 ? 111 ARG A CB   2  
ATOM 3409  C CG   . ARG A 1 111 ? 13.944  15.098  -7.429  1.00 0.00 ? 111 ARG A CG   2  
ATOM 3410  C CD   . ARG A 1 111 ? 12.638  15.336  -6.668  1.00 0.00 ? 111 ARG A CD   2  
ATOM 3411  N NE   . ARG A 1 111 ? 11.758  14.152  -6.789  1.00 0.00 ? 111 ARG A NE   2  
ATOM 3412  C CZ   . ARG A 1 111 ? 11.086  13.826  -7.901  1.00 0.00 ? 111 ARG A CZ   2  
ATOM 3413  N NH1  . ARG A 1 111 ? 11.188  14.594  -8.995  1.00 0.00 ? 111 ARG A NH1  2  
ATOM 3414  N NH2  . ARG A 1 111 ? 10.311  12.733  -7.920  1.00 0.00 ? 111 ARG A NH2  2  
ATOM 3415  H H    . ARG A 1 111 ? 17.497  13.816  -7.724  1.00 0.00 ? 111 ARG A H    2  
ATOM 3416  H HA   . ARG A 1 111 ? 16.179  15.338  -8.507  1.00 0.00 ? 111 ARG A HA   2  
ATOM 3417  H HB2  . ARG A 1 111 ? 15.285  14.954  -5.746  1.00 0.00 ? 111 ARG A HB2  2  
ATOM 3418  H HB3  . ARG A 1 111 ? 14.956  16.598  -6.256  1.00 0.00 ? 111 ARG A HB3  2  
ATOM 3419  H HG2  . ARG A 1 111 ? 13.909  15.614  -8.388  1.00 0.00 ? 111 ARG A HG2  2  
ATOM 3420  H HG3  . ARG A 1 111 ? 14.055  14.035  -7.643  1.00 0.00 ? 111 ARG A HG3  2  
ATOM 3421  H HD2  . ARG A 1 111 ? 12.851  15.535  -5.617  1.00 0.00 ? 111 ARG A HD2  2  
ATOM 3422  H HD3  . ARG A 1 111 ? 12.132  16.217  -7.063  1.00 0.00 ? 111 ARG A HD3  2  
ATOM 3423  H HE   . ARG A 1 111 ? 11.659  13.557  -5.991  1.00 0.00 ? 111 ARG A HE   2  
ATOM 3424  H HH11 . ARG A 1 111 ? 11.766  15.410  -8.981  1.00 0.00 ? 111 ARG A HH11 2  
ATOM 3425  H HH12 . ARG A 1 111 ? 10.686  14.351  -9.825  1.00 0.00 ? 111 ARG A HH12 2  
ATOM 3426  H HH21 . ARG A 1 111 ? 10.234  12.160  -7.104  1.00 0.00 ? 111 ARG A HH21 2  
ATOM 3427  H HH22 . ARG A 1 111 ? 9.809   12.490  -8.750  1.00 0.00 ? 111 ARG A HH22 2  
ATOM 3428  N N    . SER A 1 112 ? 16.449  17.943  -7.947  1.00 0.00 ? 112 SER A N    2  
ATOM 3429  C CA   . SER A 1 112 ? 16.979  19.296  -7.928  1.00 0.00 ? 112 SER A CA   2  
ATOM 3430  C C    . SER A 1 112 ? 16.238  20.134  -6.885  1.00 0.00 ? 112 SER A C    2  
ATOM 3431  O O    . SER A 1 112 ? 15.057  20.436  -7.051  1.00 0.00 ? 112 SER A O    2  
ATOM 3432  C CB   . SER A 1 112 ? 16.873  19.948  -9.307  1.00 0.00 ? 112 SER A CB   2  
ATOM 3433  O OG   . SER A 1 112 ? 15.538  20.346  -9.608  1.00 0.00 ? 112 SER A OG   2  
ATOM 3434  H H    . SER A 1 112 ? 15.574  17.839  -8.420  1.00 0.00 ? 112 SER A H    2  
ATOM 3435  H HA   . SER A 1 112 ? 18.030  19.189  -7.657  1.00 0.00 ? 112 SER A HA   2  
ATOM 3436  H HB2  . SER A 1 112 ? 17.528  20.819  -9.348  1.00 0.00 ? 112 SER A HB2  2  
ATOM 3437  H HB3  . SER A 1 112 ? 17.223  19.250  -10.067 1.00 0.00 ? 112 SER A HB3  2  
ATOM 3438  H HG   . SER A 1 112 ? 15.543  21.215  -10.104 1.00 0.00 ? 112 SER A HG   2  
ATOM 3439  N N    . GLY A 1 113 ? 16.962  20.488  -5.833  1.00 0.00 ? 113 GLY A N    2  
ATOM 3440  C CA   . GLY A 1 113 ? 16.387  21.286  -4.763  1.00 0.00 ? 113 GLY A CA   2  
ATOM 3441  C C    . GLY A 1 113 ? 16.273  22.755  -5.176  1.00 0.00 ? 113 GLY A C    2  
ATOM 3442  O O    . GLY A 1 113 ? 17.283  23.427  -5.376  1.00 0.00 ? 113 GLY A O    2  
ATOM 3443  H H    . GLY A 1 113 ? 17.922  20.239  -5.705  1.00 0.00 ? 113 GLY A H    2  
ATOM 3444  H HA2  . GLY A 1 113 ? 15.401  20.899  -4.505  1.00 0.00 ? 113 GLY A HA2  2  
ATOM 3445  H HA3  . GLY A 1 113 ? 17.006  21.202  -3.870  1.00 0.00 ? 113 GLY A HA3  2  
ATOM 3446  N N    . PRO A 1 114 ? 15.001  23.222  -5.293  1.00 0.00 ? 114 PRO A N    2  
ATOM 3447  C CA   . PRO A 1 114 ? 14.742  24.598  -5.678  1.00 0.00 ? 114 PRO A CA   2  
ATOM 3448  C C    . PRO A 1 114 ? 15.022  25.555  -4.517  1.00 0.00 ? 114 PRO A C    2  
ATOM 3449  O O    . PRO A 1 114 ? 14.781  25.218  -3.359  1.00 0.00 ? 114 PRO A O    2  
ATOM 3450  C CB   . PRO A 1 114 ? 13.289  24.615  -6.124  1.00 0.00 ? 114 PRO A CB   2  
ATOM 3451  C CG   . PRO A 1 114 ? 12.658  23.363  -5.537  1.00 0.00 ? 114 PRO A CG   2  
ATOM 3452  C CD   . PRO A 1 114 ? 13.781  22.454  -5.064  1.00 0.00 ? 114 PRO A CD   2  
ATOM 3453  H HA   . PRO A 1 114 ? 15.359  24.875  -6.415  1.00 0.00 ? 114 PRO A HA   2  
ATOM 3454  H HB2  . PRO A 1 114 ? 12.781  25.512  -5.767  1.00 0.00 ? 114 PRO A HB2  2  
ATOM 3455  H HB3  . PRO A 1 114 ? 13.214  24.618  -7.211  1.00 0.00 ? 114 PRO A HB3  2  
ATOM 3456  H HG2  . PRO A 1 114 ? 11.999  23.620  -4.707  1.00 0.00 ? 114 PRO A HG2  2  
ATOM 3457  H HG3  . PRO A 1 114 ? 12.047  22.857  -6.284  1.00 0.00 ? 114 PRO A HG3  2  
ATOM 3458  H HD2  . PRO A 1 114 ? 13.666  22.199  -4.010  1.00 0.00 ? 114 PRO A HD2  2  
ATOM 3459  H HD3  . PRO A 1 114 ? 13.792  21.516  -5.619  1.00 0.00 ? 114 PRO A HD3  2  
ATOM 3460  N N    . SER A 1 115 ? 15.528  26.728  -4.868  1.00 0.00 ? 115 SER A N    2  
ATOM 3461  C CA   . SER A 1 115 ? 15.843  27.735  -3.869  1.00 0.00 ? 115 SER A CA   2  
ATOM 3462  C C    . SER A 1 115 ? 16.160  29.068  -4.552  1.00 0.00 ? 115 SER A C    2  
ATOM 3463  O O    . SER A 1 115 ? 15.508  30.076  -4.284  1.00 0.00 ? 115 SER A O    2  
ATOM 3464  C CB   . SER A 1 115 ? 17.019  27.295  -2.995  1.00 0.00 ? 115 SER A CB   2  
ATOM 3465  O OG   . SER A 1 115 ? 16.585  26.734  -1.759  1.00 0.00 ? 115 SER A OG   2  
ATOM 3466  H H    . SER A 1 115 ? 15.721  26.994  -5.812  1.00 0.00 ? 115 SER A H    2  
ATOM 3467  H HA   . SER A 1 115 ? 14.948  27.823  -3.255  1.00 0.00 ? 115 SER A HA   2  
ATOM 3468  H HB2  . SER A 1 115 ? 17.618  26.561  -3.536  1.00 0.00 ? 115 SER A HB2  2  
ATOM 3469  H HB3  . SER A 1 115 ? 17.665  28.150  -2.798  1.00 0.00 ? 115 SER A HB3  2  
ATOM 3470  H HG   . SER A 1 115 ? 15.629  26.450  -1.830  1.00 0.00 ? 115 SER A HG   2  
ATOM 3471  N N    . SER A 1 116 ? 17.160  29.029  -5.420  1.00 0.00 ? 116 SER A N    2  
ATOM 3472  C CA   . SER A 1 116 ? 17.570  30.220  -6.143  1.00 0.00 ? 116 SER A CA   2  
ATOM 3473  C C    . SER A 1 116 ? 16.377  30.812  -6.896  1.00 0.00 ? 116 SER A C    2  
ATOM 3474  O O    . SER A 1 116 ? 16.012  31.967  -6.678  1.00 0.00 ? 116 SER A O    2  
ATOM 3475  C CB   . SER A 1 116 ? 18.710  29.910  -7.115  1.00 0.00 ? 116 SER A CB   2  
ATOM 3476  O OG   . SER A 1 116 ? 18.415  28.788  -7.942  1.00 0.00 ? 116 SER A OG   2  
ATOM 3477  H H    . SER A 1 116 ? 17.684  28.204  -5.632  1.00 0.00 ? 116 SER A H    2  
ATOM 3478  H HA   . SER A 1 116 ? 17.923  30.913  -5.380  1.00 0.00 ? 116 SER A HA   2  
ATOM 3479  H HB2  . SER A 1 116 ? 18.901  30.781  -7.741  1.00 0.00 ? 116 SER A HB2  2  
ATOM 3480  H HB3  . SER A 1 116 ? 19.623  29.715  -6.552  1.00 0.00 ? 116 SER A HB3  2  
ATOM 3481  H HG   . SER A 1 116 ? 19.263  28.390  -8.294  1.00 0.00 ? 116 SER A HG   2  
ATOM 3482  N N    . GLY A 1 117 ? 15.803  29.995  -7.766  1.00 0.00 ? 117 GLY A N    2  
ATOM 3483  C CA   . GLY A 1 117 ? 14.659  30.424  -8.553  1.00 0.00 ? 117 GLY A CA   2  
ATOM 3484  C C    . GLY A 1 117 ? 14.629  29.715  -9.909  1.00 0.00 ? 117 GLY A C    2  
ATOM 3485  O O    . GLY A 1 117 ? 14.429  28.503  -9.975  1.00 0.00 ? 117 GLY A O    2  
ATOM 3486  H H    . GLY A 1 117 ? 16.106  29.058  -7.938  1.00 0.00 ? 117 GLY A H    2  
ATOM 3487  H HA2  . GLY A 1 117 ? 13.739  30.213  -8.008  1.00 0.00 ? 117 GLY A HA2  2  
ATOM 3488  H HA3  . GLY A 1 117 ? 14.700  31.503  -8.703  1.00 0.00 ? 117 GLY A HA3  2  
ATOM 3489  N N    . GLY A 1 1   ? -26.324 -5.672  0.447   1.00 0.00 ? 1   GLY A N    3  
ATOM 3490  C CA   . GLY A 1 1   ? -27.571 -6.009  1.112   1.00 0.00 ? 1   GLY A CA   3  
ATOM 3491  C C    . GLY A 1 1   ? -27.336 -7.012  2.243   1.00 0.00 ? 1   GLY A C    3  
ATOM 3492  O O    . GLY A 1 1   ? -26.385 -7.791  2.199   1.00 0.00 ? 1   GLY A O    3  
ATOM 3493  H H1   . GLY A 1 1   ? -25.969 -6.377  -0.166  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3494  H HA2  . GLY A 1 1   ? -28.030 -5.104  1.513   1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3495  H HA3  . GLY A 1 1   ? -28.272 -6.428  0.390   1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3496  N N    . SER A 1 2   ? -28.218 -6.960  3.230   1.00 0.00 ? 2   SER A N    3  
ATOM 3497  C CA   . SER A 1 2   ? -28.118 -7.854  4.371   1.00 0.00 ? 2   SER A CA   3  
ATOM 3498  C C    . SER A 1 2   ? -28.944 -9.117  4.119   1.00 0.00 ? 2   SER A C    3  
ATOM 3499  O O    . SER A 1 2   ? -30.174 -9.069  4.114   1.00 0.00 ? 2   SER A O    3  
ATOM 3500  C CB   . SER A 1 2   ? -28.583 -7.164  5.655   1.00 0.00 ? 2   SER A CB   3  
ATOM 3501  O OG   . SER A 1 2   ? -27.545 -6.389  6.249   1.00 0.00 ? 2   SER A OG   3  
ATOM 3502  H H    . SER A 1 2   ? -28.989 -6.323  3.259   1.00 0.00 ? 2   SER A H    3  
ATOM 3503  H HA   . SER A 1 2   ? -27.060 -8.100  4.454   1.00 0.00 ? 2   SER A HA   3  
ATOM 3504  H HB2  . SER A 1 2   ? -29.434 -6.520  5.433   1.00 0.00 ? 2   SER A HB2  3  
ATOM 3505  H HB3  . SER A 1 2   ? -28.928 -7.914  6.366   1.00 0.00 ? 2   SER A HB3  3  
ATOM 3506  H HG   . SER A 1 2   ? -26.764 -6.329  5.628   1.00 0.00 ? 2   SER A HG   3  
ATOM 3507  N N    . SER A 1 3   ? -28.236 -10.219 3.917   1.00 0.00 ? 3   SER A N    3  
ATOM 3508  C CA   . SER A 1 3   ? -28.888 -11.492 3.665   1.00 0.00 ? 3   SER A CA   3  
ATOM 3509  C C    . SER A 1 3   ? -27.994 -12.640 4.138   1.00 0.00 ? 3   SER A C    3  
ATOM 3510  O O    . SER A 1 3   ? -26.787 -12.466 4.300   1.00 0.00 ? 3   SER A O    3  
ATOM 3511  C CB   . SER A 1 3   ? -29.223 -11.656 2.182   1.00 0.00 ? 3   SER A CB   3  
ATOM 3512  O OG   . SER A 1 3   ? -30.368 -10.897 1.805   1.00 0.00 ? 3   SER A OG   3  
ATOM 3513  H H    . SER A 1 3   ? -27.237 -10.250 3.923   1.00 0.00 ? 3   SER A H    3  
ATOM 3514  H HA   . SER A 1 3   ? -29.811 -11.463 4.244   1.00 0.00 ? 3   SER A HA   3  
ATOM 3515  H HB2  . SER A 1 3   ? -28.368 -11.345 1.581   1.00 0.00 ? 3   SER A HB2  3  
ATOM 3516  H HB3  . SER A 1 3   ? -29.399 -12.710 1.964   1.00 0.00 ? 3   SER A HB3  3  
ATOM 3517  H HG   . SER A 1 3   ? -30.089 -9.990  1.489   1.00 0.00 ? 3   SER A HG   3  
ATOM 3518  N N    . GLY A 1 4   ? -28.621 -13.789 4.346   1.00 0.00 ? 4   GLY A N    3  
ATOM 3519  C CA   . GLY A 1 4   ? -27.897 -14.966 4.797   1.00 0.00 ? 4   GLY A CA   3  
ATOM 3520  C C    . GLY A 1 4   ? -28.352 -16.214 4.038   1.00 0.00 ? 4   GLY A C    3  
ATOM 3521  O O    . GLY A 1 4   ? -29.259 -16.917 4.480   1.00 0.00 ? 4   GLY A O    3  
ATOM 3522  H H    . GLY A 1 4   ? -29.603 -13.923 4.212   1.00 0.00 ? 4   GLY A H    3  
ATOM 3523  H HA2  . GLY A 1 4   ? -26.827 -14.817 4.651   1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3524  H HA3  . GLY A 1 4   ? -28.056 -15.107 5.866   1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3525  N N    . SER A 1 5   ? -27.702 -16.450 2.908   1.00 0.00 ? 5   SER A N    3  
ATOM 3526  C CA   . SER A 1 5   ? -28.029 -17.601 2.084   1.00 0.00 ? 5   SER A CA   3  
ATOM 3527  C C    . SER A 1 5   ? -27.099 -17.656 0.870   1.00 0.00 ? 5   SER A C    3  
ATOM 3528  O O    . SER A 1 5   ? -27.129 -16.767 0.020   1.00 0.00 ? 5   SER A O    3  
ATOM 3529  C CB   . SER A 1 5   ? -29.490 -17.558 1.632   1.00 0.00 ? 5   SER A CB   3  
ATOM 3530  O OG   . SER A 1 5   ? -29.768 -18.534 0.631   1.00 0.00 ? 5   SER A OG   3  
ATOM 3531  H H    . SER A 1 5   ? -26.966 -15.873 2.556   1.00 0.00 ? 5   SER A H    3  
ATOM 3532  H HA   . SER A 1 5   ? -27.872 -18.469 2.725   1.00 0.00 ? 5   SER A HA   3  
ATOM 3533  H HB2  . SER A 1 5   ? -30.140 -17.724 2.491   1.00 0.00 ? 5   SER A HB2  3  
ATOM 3534  H HB3  . SER A 1 5   ? -29.721 -16.566 1.245   1.00 0.00 ? 5   SER A HB3  3  
ATOM 3535  H HG   . SER A 1 5   ? -30.687 -18.393 0.262   1.00 0.00 ? 5   SER A HG   3  
ATOM 3536  N N    . SER A 1 6   ? -26.296 -18.708 0.827   1.00 0.00 ? 6   SER A N    3  
ATOM 3537  C CA   . SER A 1 6   ? -25.359 -18.891 -0.269  1.00 0.00 ? 6   SER A CA   3  
ATOM 3538  C C    . SER A 1 6   ? -24.535 -20.160 -0.048  1.00 0.00 ? 6   SER A C    3  
ATOM 3539  O O    . SER A 1 6   ? -24.529 -20.717 1.049   1.00 0.00 ? 6   SER A O    3  
ATOM 3540  C CB   . SER A 1 6   ? -24.438 -17.678 -0.414  1.00 0.00 ? 6   SER A CB   3  
ATOM 3541  O OG   . SER A 1 6   ? -24.114 -17.413 -1.776  1.00 0.00 ? 6   SER A OG   3  
ATOM 3542  H H    . SER A 1 6   ? -26.278 -19.427 1.522   1.00 0.00 ? 6   SER A H    3  
ATOM 3543  H HA   . SER A 1 6   ? -25.976 -18.986 -1.163  1.00 0.00 ? 6   SER A HA   3  
ATOM 3544  H HB2  . SER A 1 6   ? -24.920 -16.802 0.021   1.00 0.00 ? 6   SER A HB2  3  
ATOM 3545  H HB3  . SER A 1 6   ? -23.521 -17.850 0.150   1.00 0.00 ? 6   SER A HB3  3  
ATOM 3546  H HG   . SER A 1 6   ? -24.784 -17.847 -2.378  1.00 0.00 ? 6   SER A HG   3  
ATOM 3547  N N    . GLY A 1 7   ? -23.858 -20.581 -1.106  1.00 0.00 ? 7   GLY A N    3  
ATOM 3548  C CA   . GLY A 1 7   ? -23.032 -21.774 -1.041  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3549  C C    . GLY A 1 7   ? -22.000 -21.789 -2.170  1.00 0.00 ? 7   GLY A C    3  
ATOM 3550  O O    . GLY A 1 7   ? -22.348 -21.610 -3.336  1.00 0.00 ? 7   GLY A O    3  
ATOM 3551  H H    . GLY A 1 7   ? -23.868 -20.122 -1.995  1.00 0.00 ? 7   GLY A H    3  
ATOM 3552  H HA2  . GLY A 1 7   ? -22.524 -21.817 -0.078  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3553  H HA3  . GLY A 1 7   ? -23.663 -22.661 -1.108  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3554  N N    . GLY A 1 8   ? -20.751 -22.005 -1.784  1.00 0.00 ? 8   GLY A N    3  
ATOM 3555  C CA   . GLY A 1 8   ? -19.666 -22.046 -2.750  1.00 0.00 ? 8   GLY A CA   3  
ATOM 3556  C C    . GLY A 1 8   ? -18.314 -22.192 -2.049  1.00 0.00 ? 8   GLY A C    3  
ATOM 3557  O O    . GLY A 1 8   ? -18.183 -21.864 -0.870  1.00 0.00 ? 8   GLY A O    3  
ATOM 3558  H H    . GLY A 1 8   ? -20.477 -22.150 -0.834  1.00 0.00 ? 8   GLY A H    3  
ATOM 3559  H HA2  . GLY A 1 8   ? -19.816 -22.879 -3.436  1.00 0.00 ? 8   GLY A HA2  3  
ATOM 3560  H HA3  . GLY A 1 8   ? -19.673 -21.135 -3.348  1.00 0.00 ? 8   GLY A HA3  3  
ATOM 3561  N N    . GLU A 1 9   ? -17.342 -22.684 -2.803  1.00 0.00 ? 9   GLU A N    3  
ATOM 3562  C CA   . GLU A 1 9   ? -16.005 -22.877 -2.269  1.00 0.00 ? 9   GLU A CA   3  
ATOM 3563  C C    . GLU A 1 9   ? -14.979 -22.905 -3.404  1.00 0.00 ? 9   GLU A C    3  
ATOM 3564  O O    . GLU A 1 9   ? -14.863 -23.901 -4.116  1.00 0.00 ? 9   GLU A O    3  
ATOM 3565  C CB   . GLU A 1 9   ? -15.929 -24.154 -1.430  1.00 0.00 ? 9   GLU A CB   3  
ATOM 3566  C CG   . GLU A 1 9   ? -14.712 -24.129 -0.502  1.00 0.00 ? 9   GLU A CG   3  
ATOM 3567  C CD   . GLU A 1 9   ? -15.122 -24.403 0.947   1.00 0.00 ? 9   GLU A CD   3  
ATOM 3568  O OE1  . GLU A 1 9   ? -15.754 -25.458 1.167   1.00 0.00 ? 9   GLU A OE1  3  
ATOM 3569  O OE2  . GLU A 1 9   ? -14.793 -23.552 1.800   1.00 0.00 ? 9   GLU A OE2  3  
ATOM 3570  H H    . GLU A 1 9   ? -17.457 -22.948 -3.761  1.00 0.00 ? 9   GLU A H    3  
ATOM 3571  H HA   . GLU A 1 9   ? -15.822 -22.016 -1.626  1.00 0.00 ? 9   GLU A HA   3  
ATOM 3572  H HB2  . GLU A 1 9   ? -16.839 -24.260 -0.839  1.00 0.00 ? 9   GLU A HB2  3  
ATOM 3573  H HB3  . GLU A 1 9   ? -15.872 -25.023 -2.086  1.00 0.00 ? 9   GLU A HB3  3  
ATOM 3574  H HG2  . GLU A 1 9   ? -13.988 -24.876 -0.826  1.00 0.00 ? 9   GLU A HG2  3  
ATOM 3575  H HG3  . GLU A 1 9   ? -14.221 -23.159 -0.567  1.00 0.00 ? 9   GLU A HG3  3  
ATOM 3576  N N    . ARG A 1 10  ? -14.260 -21.800 -3.536  1.00 0.00 ? 10  ARG A N    3  
ATOM 3577  C CA   . ARG A 1 10  ? -13.248 -21.685 -4.572  1.00 0.00 ? 10  ARG A CA   3  
ATOM 3578  C C    . ARG A 1 10  ? -12.028 -20.929 -4.041  1.00 0.00 ? 10  ARG A C    3  
ATOM 3579  O O    . ARG A 1 10  ? -12.166 -19.863 -3.444  1.00 0.00 ? 10  ARG A O    3  
ATOM 3580  C CB   . ARG A 1 10  ? -13.797 -20.955 -5.800  1.00 0.00 ? 10  ARG A CB   3  
ATOM 3581  C CG   . ARG A 1 10  ? -13.994 -21.922 -6.969  1.00 0.00 ? 10  ARG A CG   3  
ATOM 3582  C CD   . ARG A 1 10  ? -13.991 -21.175 -8.305  1.00 0.00 ? 10  ARG A CD   3  
ATOM 3583  N NE   . ARG A 1 10  ? -15.378 -20.990 -8.785  1.00 0.00 ? 10  ARG A NE   3  
ATOM 3584  C CZ   . ARG A 1 10  ? -16.095 -21.944 -9.395  1.00 0.00 ? 10  ARG A CZ   3  
ATOM 3585  N NH1  . ARG A 1 10  ? -15.559 -23.154 -9.604  1.00 0.00 ? 10  ARG A NH1  3  
ATOM 3586  N NH2  . ARG A 1 10  ? -17.347 -21.687 -9.797  1.00 0.00 ? 10  ARG A NH2  3  
ATOM 3587  H H    . ARG A 1 10  ? -14.360 -20.994 -2.952  1.00 0.00 ? 10  ARG A H    3  
ATOM 3588  H HA   . ARG A 1 10  ? -12.992 -22.714 -4.827  1.00 0.00 ? 10  ARG A HA   3  
ATOM 3589  H HB2  . ARG A 1 10  ? -14.746 -20.481 -5.551  1.00 0.00 ? 10  ARG A HB2  3  
ATOM 3590  H HB3  . ARG A 1 10  ? -13.110 -20.161 -6.092  1.00 0.00 ? 10  ARG A HB3  3  
ATOM 3591  H HG2  . ARG A 1 10  ? -13.201 -22.670 -6.965  1.00 0.00 ? 10  ARG A HG2  3  
ATOM 3592  H HG3  . ARG A 1 10  ? -14.937 -22.456 -6.849  1.00 0.00 ? 10  ARG A HG3  3  
ATOM 3593  H HD2  . ARG A 1 10  ? -13.506 -20.206 -8.187  1.00 0.00 ? 10  ARG A HD2  3  
ATOM 3594  H HD3  . ARG A 1 10  ? -13.413 -21.733 -9.042  1.00 0.00 ? 10  ARG A HD3  3  
ATOM 3595  H HE   . ARG A 1 10  ? -15.808 -20.098 -8.645  1.00 0.00 ? 10  ARG A HE   3  
ATOM 3596  H HH11 . ARG A 1 10  ? -14.625 -23.346 -9.304  1.00 0.00 ? 10  ARG A HH11 3  
ATOM 3597  H HH12 . ARG A 1 10  ? -16.094 -23.866 -10.060 1.00 0.00 ? 10  ARG A HH12 3  
ATOM 3598  H HH21 . ARG A 1 10  ? -17.747 -20.784 -9.642  1.00 0.00 ? 10  ARG A HH21 3  
ATOM 3599  H HH22 . ARG A 1 10  ? -17.882 -22.398 -10.253 1.00 0.00 ? 10  ARG A HH22 3  
ATOM 3600  N N    . ARG A 1 11  ? -10.862 -21.512 -4.277  1.00 0.00 ? 11  ARG A N    3  
ATOM 3601  C CA   . ARG A 1 11  ? -9.619  -20.907 -3.830  1.00 0.00 ? 11  ARG A CA   3  
ATOM 3602  C C    . ARG A 1 11  ? -8.598  -20.888 -4.969  1.00 0.00 ? 11  ARG A C    3  
ATOM 3603  O O    . ARG A 1 11  ? -8.123  -21.938 -5.399  1.00 0.00 ? 11  ARG A O    3  
ATOM 3604  C CB   . ARG A 1 11  ? -9.032  -21.669 -2.641  1.00 0.00 ? 11  ARG A CB   3  
ATOM 3605  C CG   . ARG A 1 11  ? -8.969  -20.780 -1.397  1.00 0.00 ? 11  ARG A CG   3  
ATOM 3606  C CD   . ARG A 1 11  ? -8.596  -21.597 -0.158  1.00 0.00 ? 11  ARG A CD   3  
ATOM 3607  N NE   . ARG A 1 11  ? -7.970  -20.720 0.857   1.00 0.00 ? 11  ARG A NE   3  
ATOM 3608  C CZ   . ARG A 1 11  ? -7.281  -21.168 1.915   1.00 0.00 ? 11  ARG A CZ   3  
ATOM 3609  N NH1  . ARG A 1 11  ? -7.124  -22.485 2.104   1.00 0.00 ? 11  ARG A NH1  3  
ATOM 3610  N NH2  . ARG A 1 11  ? -6.748  -20.299 2.785   1.00 0.00 ? 11  ARG A NH2  3  
ATOM 3611  H H    . ARG A 1 11  ? -10.759 -22.380 -4.764  1.00 0.00 ? 11  ARG A H    3  
ATOM 3612  H HA   . ARG A 1 11  ? -9.893  -19.895 -3.532  1.00 0.00 ? 11  ARG A HA   3  
ATOM 3613  H HB2  . ARG A 1 11  ? -9.640  -22.550 -2.432  1.00 0.00 ? 11  ARG A HB2  3  
ATOM 3614  H HB3  . ARG A 1 11  ? -8.032  -22.024 -2.889  1.00 0.00 ? 11  ARG A HB3  3  
ATOM 3615  H HG2  . ARG A 1 11  ? -8.236  -19.988 -1.549  1.00 0.00 ? 11  ARG A HG2  3  
ATOM 3616  H HG3  . ARG A 1 11  ? -9.933  -20.297 -1.242  1.00 0.00 ? 11  ARG A HG3  3  
ATOM 3617  H HD2  . ARG A 1 11  ? -9.485  -22.070 0.257   1.00 0.00 ? 11  ARG A HD2  3  
ATOM 3618  H HD3  . ARG A 1 11  ? -7.908  -22.397 -0.433  1.00 0.00 ? 11  ARG A HD3  3  
ATOM 3619  H HE   . ARG A 1 11  ? -8.068  -19.731 0.746   1.00 0.00 ? 11  ARG A HE   3  
ATOM 3620  H HH11 . ARG A 1 11  ? -7.522  -23.134 1.455   1.00 0.00 ? 11  ARG A HH11 3  
ATOM 3621  H HH12 . ARG A 1 11  ? -6.610  -22.820 2.893   1.00 0.00 ? 11  ARG A HH12 3  
ATOM 3622  H HH21 . ARG A 1 11  ? -6.865  -19.315 2.644   1.00 0.00 ? 11  ARG A HH21 3  
ATOM 3623  H HH22 . ARG A 1 11  ? -6.234  -20.633 3.574   1.00 0.00 ? 11  ARG A HH22 3  
ATOM 3624  N N    . LYS A 1 12  ? -8.290  -19.683 -5.426  1.00 0.00 ? 12  LYS A N    3  
ATOM 3625  C CA   . LYS A 1 12  ? -7.334  -19.514 -6.507  1.00 0.00 ? 12  LYS A CA   3  
ATOM 3626  C C    . LYS A 1 12  ? -5.956  -19.200 -5.919  1.00 0.00 ? 12  LYS A C    3  
ATOM 3627  O O    . LYS A 1 12  ? -5.854  -18.703 -4.798  1.00 0.00 ? 12  LYS A O    3  
ATOM 3628  C CB   . LYS A 1 12  ? -7.831  -18.465 -7.503  1.00 0.00 ? 12  LYS A CB   3  
ATOM 3629  C CG   . LYS A 1 12  ? -8.058  -19.083 -8.884  1.00 0.00 ? 12  LYS A CG   3  
ATOM 3630  C CD   . LYS A 1 12  ? -8.711  -18.078 -9.834  1.00 0.00 ? 12  LYS A CD   3  
ATOM 3631  C CE   . LYS A 1 12  ? -7.872  -17.897 -11.101 1.00 0.00 ? 12  LYS A CE   3  
ATOM 3632  N NZ   . LYS A 1 12  ? -8.743  -17.855 -12.297 1.00 0.00 ? 12  LYS A NZ   3  
ATOM 3633  H H    . LYS A 1 12  ? -8.680  -18.834 -5.070  1.00 0.00 ? 12  LYS A H    3  
ATOM 3634  H HA   . LYS A 1 12  ? -7.273  -20.462 -7.041  1.00 0.00 ? 12  LYS A HA   3  
ATOM 3635  H HB2  . LYS A 1 12  ? -8.760  -18.025 -7.140  1.00 0.00 ? 12  LYS A HB2  3  
ATOM 3636  H HB3  . LYS A 1 12  ? -7.104  -17.656 -7.578  1.00 0.00 ? 12  LYS A HB3  3  
ATOM 3637  H HG2  . LYS A 1 12  ? -7.106  -19.415 -9.298  1.00 0.00 ? 12  LYS A HG2  3  
ATOM 3638  H HG3  . LYS A 1 12  ? -8.690  -19.966 -8.791  1.00 0.00 ? 12  LYS A HG3  3  
ATOM 3639  H HD2  . LYS A 1 12  ? -9.710  -18.421 -10.102 1.00 0.00 ? 12  LYS A HD2  3  
ATOM 3640  H HD3  . LYS A 1 12  ? -8.828  -17.119 -9.331  1.00 0.00 ? 12  LYS A HD3  3  
ATOM 3641  H HE2  . LYS A 1 12  ? -7.294  -16.975 -11.032 1.00 0.00 ? 12  LYS A HE2  3  
ATOM 3642  H HE3  . LYS A 1 12  ? -7.158  -18.715 -11.192 1.00 0.00 ? 12  LYS A HE3  3  
ATOM 3643  H HZ1  . LYS A 1 12  ? -9.640  -17.494 -12.044 1.00 0.00 ? 12  LYS A HZ1  3  
ATOM 3644  H HZ2  . LYS A 1 12  ? -8.329  -17.264 -12.990 1.00 0.00 ? 12  LYS A HZ2  3  
ATOM 3645  H HZ3  . LYS A 1 12  ? -8.846  -18.779 -12.666 1.00 0.00 ? 12  LYS A HZ3  3  
ATOM 3646  N N    . ASP A 1 13  ? -4.931  -19.503 -6.702  1.00 0.00 ? 13  ASP A N    3  
ATOM 3647  C CA   . ASP A 1 13  ? -3.564  -19.259 -6.273  1.00 0.00 ? 13  ASP A CA   3  
ATOM 3648  C C    . ASP A 1 13  ? -3.214  -17.789 -6.513  1.00 0.00 ? 13  ASP A C    3  
ATOM 3649  O O    . ASP A 1 13  ? -3.189  -17.332 -7.655  1.00 0.00 ? 13  ASP A O    3  
ATOM 3650  C CB   . ASP A 1 13  ? -2.577  -20.116 -7.066  1.00 0.00 ? 13  ASP A CB   3  
ATOM 3651  C CG   . ASP A 1 13  ? -2.767  -20.085 -8.584  1.00 0.00 ? 13  ASP A CG   3  
ATOM 3652  O OD1  . ASP A 1 13  ? -3.821  -20.584 -9.034  1.00 0.00 ? 13  ASP A OD1  3  
ATOM 3653  O OD2  . ASP A 1 13  ? -1.855  -19.563 -9.260  1.00 0.00 ? 13  ASP A OD2  3  
ATOM 3654  H H    . ASP A 1 13  ? -5.023  -19.907 -7.612  1.00 0.00 ? 13  ASP A H    3  
ATOM 3655  H HA   . ASP A 1 13  ? -3.544  -19.525 -5.216  1.00 0.00 ? 13  ASP A HA   3  
ATOM 3656  H HB2  . ASP A 1 13  ? -1.564  -19.785 -6.835  1.00 0.00 ? 13  ASP A HB2  3  
ATOM 3657  H HB3  . ASP A 1 13  ? -2.660  -21.149 -6.726  1.00 0.00 ? 13  ASP A HB3  3  
ATOM 3658  N N    . ARG A 1 14  ? -2.951  -17.090 -5.419  1.00 0.00 ? 14  ARG A N    3  
ATOM 3659  C CA   . ARG A 1 14  ? -2.603  -15.681 -5.496  1.00 0.00 ? 14  ARG A CA   3  
ATOM 3660  C C    . ARG A 1 14  ? -1.632  -15.312 -4.373  1.00 0.00 ? 14  ARG A C    3  
ATOM 3661  O O    . ARG A 1 14  ? -1.683  -15.891 -3.289  1.00 0.00 ? 14  ARG A O    3  
ATOM 3662  C CB   . ARG A 1 14  ? -3.849  -14.799 -5.394  1.00 0.00 ? 14  ARG A CB   3  
ATOM 3663  C CG   . ARG A 1 14  ? -4.469  -14.565 -6.774  1.00 0.00 ? 14  ARG A CG   3  
ATOM 3664  C CD   . ARG A 1 14  ? -5.930  -14.127 -6.651  1.00 0.00 ? 14  ARG A CD   3  
ATOM 3665  N NE   . ARG A 1 14  ? -6.000  -12.715 -6.212  1.00 0.00 ? 14  ARG A NE   3  
ATOM 3666  C CZ   . ARG A 1 14  ? -5.607  -11.676 -6.960  1.00 0.00 ? 14  ARG A CZ   3  
ATOM 3667  N NH1  . ARG A 1 14  ? -5.113  -11.882 -8.189  1.00 0.00 ? 14  ARG A NH1  3  
ATOM 3668  N NH2  . ARG A 1 14  ? -5.708  -10.429 -6.480  1.00 0.00 ? 14  ARG A NH2  3  
ATOM 3669  H H    . ARG A 1 14  ? -2.974  -17.469 -4.494  1.00 0.00 ? 14  ARG A H    3  
ATOM 3670  H HA   . ARG A 1 14  ? -2.135  -15.563 -6.474  1.00 0.00 ? 14  ARG A HA   3  
ATOM 3671  H HB2  . ARG A 1 14  ? -4.581  -15.272 -4.739  1.00 0.00 ? 14  ARG A HB2  3  
ATOM 3672  H HB3  . ARG A 1 14  ? -3.586  -13.843 -4.942  1.00 0.00 ? 14  ARG A HB3  3  
ATOM 3673  H HG2  . ARG A 1 14  ? -3.900  -13.802 -7.306  1.00 0.00 ? 14  ARG A HG2  3  
ATOM 3674  H HG3  . ARG A 1 14  ? -4.408  -15.479 -7.364  1.00 0.00 ? 14  ARG A HG3  3  
ATOM 3675  H HD2  . ARG A 1 14  ? -6.435  -14.244 -7.610  1.00 0.00 ? 14  ARG A HD2  3  
ATOM 3676  H HD3  . ARG A 1 14  ? -6.450  -14.765 -5.937  1.00 0.00 ? 14  ARG A HD3  3  
ATOM 3677  H HE   . ARG A 1 14  ? -6.364  -12.526 -5.300  1.00 0.00 ? 14  ARG A HE   3  
ATOM 3678  H HH11 . ARG A 1 14  ? -5.038  -12.813 -8.547  1.00 0.00 ? 14  ARG A HH11 3  
ATOM 3679  H HH12 . ARG A 1 14  ? -4.820  -11.106 -8.747  1.00 0.00 ? 14  ARG A HH12 3  
ATOM 3680  H HH21 . ARG A 1 14  ? -6.076  -10.274 -5.563  1.00 0.00 ? 14  ARG A HH21 3  
ATOM 3681  H HH22 . ARG A 1 14  ? -5.414  -9.653  -7.038  1.00 0.00 ? 14  ARG A HH22 3  
ATOM 3682  N N    . PRO A 1 15  ? -0.748  -14.325 -4.679  1.00 0.00 ? 15  PRO A N    3  
ATOM 3683  C CA   . PRO A 1 15  ? 0.233   -13.872 -3.707  1.00 0.00 ? 15  PRO A CA   3  
ATOM 3684  C C    . PRO A 1 15  ? -0.421  -13.000 -2.633  1.00 0.00 ? 15  PRO A C    3  
ATOM 3685  O O    . PRO A 1 15  ? 0.129   -12.832 -1.546  1.00 0.00 ? 15  PRO A O    3  
ATOM 3686  C CB   . PRO A 1 15  ? 1.278   -13.127 -4.522  1.00 0.00 ? 15  PRO A CB   3  
ATOM 3687  C CG   . PRO A 1 15  ? 0.612   -12.790 -5.846  1.00 0.00 ? 15  PRO A CG   3  
ATOM 3688  C CD   . PRO A 1 15  ? -0.659  -13.618 -5.952  1.00 0.00 ? 15  PRO A CD   3  
ATOM 3689  H HA   . PRO A 1 15  ? 0.628   -14.652 -3.223  1.00 0.00 ? 15  PRO A HA   3  
ATOM 3690  H HB2  . PRO A 1 15  ? 1.603   -12.223 -4.007  1.00 0.00 ? 15  PRO A HB2  3  
ATOM 3691  H HB3  . PRO A 1 15  ? 2.165   -13.742 -4.676  1.00 0.00 ? 15  PRO A HB3  3  
ATOM 3692  H HG2  . PRO A 1 15  ? 0.380   -11.726 -5.897  1.00 0.00 ? 15  PRO A HG2  3  
ATOM 3693  H HG3  . PRO A 1 15  ? 1.282   -13.010 -6.677  1.00 0.00 ? 15  PRO A HG3  3  
ATOM 3694  H HD2  . PRO A 1 15  ? -1.531  -12.985 -6.116  1.00 0.00 ? 15  PRO A HD2  3  
ATOM 3695  H HD3  . PRO A 1 15  ? -0.609  -14.314 -6.790  1.00 0.00 ? 15  PRO A HD3  3  
ATOM 3696  N N    . TYR A 1 16  ? -1.585  -12.469 -2.976  1.00 0.00 ? 16  TYR A N    3  
ATOM 3697  C CA   . TYR A 1 16  ? -2.320  -11.619 -2.055  1.00 0.00 ? 16  TYR A CA   3  
ATOM 3698  C C    . TYR A 1 16  ? -1.468  -10.429 -1.608  1.00 0.00 ? 16  TYR A C    3  
ATOM 3699  O O    . TYR A 1 16  ? -0.243  -10.525 -1.551  1.00 0.00 ? 16  TYR A O    3  
ATOM 3700  C CB   . TYR A 1 16  ? -2.636  -12.491 -0.837  1.00 0.00 ? 16  TYR A CB   3  
ATOM 3701  C CG   . TYR A 1 16  ? -3.708  -13.551 -1.092  1.00 0.00 ? 16  TYR A CG   3  
ATOM 3702  C CD1  . TYR A 1 16  ? -4.949  -13.177 -1.567  1.00 0.00 ? 16  TYR A CD1  3  
ATOM 3703  C CD2  . TYR A 1 16  ? -3.436  -14.881 -0.847  1.00 0.00 ? 16  TYR A CD2  3  
ATOM 3704  C CE1  . TYR A 1 16  ? -5.959  -14.175 -1.807  1.00 0.00 ? 16  TYR A CE1  3  
ATOM 3705  C CE2  . TYR A 1 16  ? -4.446  -15.879 -1.087  1.00 0.00 ? 16  TYR A CE2  3  
ATOM 3706  C CZ   . TYR A 1 16  ? -5.657  -15.477 -1.555  1.00 0.00 ? 16  TYR A CZ   3  
ATOM 3707  O OH   . TYR A 1 16  ? -6.611  -16.420 -1.782  1.00 0.00 ? 16  TYR A OH   3  
ATOM 3708  H H    . TYR A 1 16  ? -2.026  -12.611 -3.862  1.00 0.00 ? 16  TYR A H    3  
ATOM 3709  H HA   . TYR A 1 16  ? -3.206  -11.249 -2.572  1.00 0.00 ? 16  TYR A HA   3  
ATOM 3710  H HB2  . TYR A 1 16  ? -1.721  -12.985 -0.510  1.00 0.00 ? 16  TYR A HB2  3  
ATOM 3711  H HB3  . TYR A 1 16  ? -2.961  -11.849 -0.018  1.00 0.00 ? 16  TYR A HB3  3  
ATOM 3712  H HD1  . TYR A 1 16  ? -5.165  -12.126 -1.760  1.00 0.00 ? 16  TYR A HD1  3  
ATOM 3713  H HD2  . TYR A 1 16  ? -2.456  -15.177 -0.472  1.00 0.00 ? 16  TYR A HD2  3  
ATOM 3714  H HE1  . TYR A 1 16  ? -6.943  -13.893 -2.182  1.00 0.00 ? 16  TYR A HE1  3  
ATOM 3715  H HE2  . TYR A 1 16  ? -4.243  -16.934 -0.898  1.00 0.00 ? 16  TYR A HE2  3  
ATOM 3716  H HH   . TYR A 1 16  ? -7.225  -16.117 -2.510  1.00 0.00 ? 16  TYR A HH   3  
ATOM 3717  N N    . VAL A 1 17  ? -2.151  -9.335  -1.304  1.00 0.00 ? 17  VAL A N    3  
ATOM 3718  C CA   . VAL A 1 17  ? -1.472  -8.128  -0.864  1.00 0.00 ? 17  VAL A CA   3  
ATOM 3719  C C    . VAL A 1 17  ? -2.404  -7.326  0.046   1.00 0.00 ? 17  VAL A C    3  
ATOM 3720  O O    . VAL A 1 17  ? -3.619  -7.514  0.016   1.00 0.00 ? 17  VAL A O    3  
ATOM 3721  C CB   . VAL A 1 17  ? -0.988  -7.329  -2.076  1.00 0.00 ? 17  VAL A CB   3  
ATOM 3722  C CG1  . VAL A 1 17  ? -2.167  -6.710  -2.831  1.00 0.00 ? 17  VAL A CG1  3  
ATOM 3723  C CG2  . VAL A 1 17  ? 0.020   -6.257  -1.659  1.00 0.00 ? 17  VAL A CG2  3  
ATOM 3724  H H    . VAL A 1 17  ? -3.147  -9.265  -1.353  1.00 0.00 ? 17  VAL A H    3  
ATOM 3725  H HA   . VAL A 1 17  ? -0.597  -8.433  -0.290  1.00 0.00 ? 17  VAL A HA   3  
ATOM 3726  H HB   . VAL A 1 17  ? -0.483  -8.019  -2.753  1.00 0.00 ? 17  VAL A HB   3  
ATOM 3727  H HG11 . VAL A 1 17  ? -2.954  -6.449  -2.124  1.00 0.00 ? 17  VAL A HG11 3  
ATOM 3728  H HG12 . VAL A 1 17  ? -1.833  -5.812  -3.351  1.00 0.00 ? 17  VAL A HG12 3  
ATOM 3729  H HG13 . VAL A 1 17  ? -2.552  -7.428  -3.555  1.00 0.00 ? 17  VAL A HG13 3  
ATOM 3730  H HG21 . VAL A 1 17  ? 0.629   -6.631  -0.836  1.00 0.00 ? 17  VAL A HG21 3  
ATOM 3731  H HG22 . VAL A 1 17  ? 0.663   -6.014  -2.505  1.00 0.00 ? 17  VAL A HG22 3  
ATOM 3732  H HG23 . VAL A 1 17  ? -0.513  -5.361  -1.339  1.00 0.00 ? 17  VAL A HG23 3  
ATOM 3733  N N    . GLU A 1 18  ? -1.799  -6.451  0.835   1.00 0.00 ? 18  GLU A N    3  
ATOM 3734  C CA   . GLU A 1 18  ? -2.560  -5.620  1.753   1.00 0.00 ? 18  GLU A CA   3  
ATOM 3735  C C    . GLU A 1 18  ? -3.753  -4.988  1.033   1.00 0.00 ? 18  GLU A C    3  
ATOM 3736  O O    . GLU A 1 18  ? -3.580  -4.100  0.199   1.00 0.00 ? 18  GLU A O    3  
ATOM 3737  C CB   . GLU A 1 18  ? -1.672  -4.548  2.388   1.00 0.00 ? 18  GLU A CB   3  
ATOM 3738  C CG   . GLU A 1 18  ? -0.459  -5.178  3.076   1.00 0.00 ? 18  GLU A CG   3  
ATOM 3739  C CD   . GLU A 1 18  ? -0.618  -5.152  4.598   1.00 0.00 ? 18  GLU A CD   3  
ATOM 3740  O OE1  . GLU A 1 18  ? -0.476  -4.048  5.165   1.00 0.00 ? 18  GLU A OE1  3  
ATOM 3741  O OE2  . GLU A 1 18  ? -0.878  -6.238  5.159   1.00 0.00 ? 18  GLU A OE2  3  
ATOM 3742  H H    . GLU A 1 18  ? -0.810  -6.305  0.854   1.00 0.00 ? 18  GLU A H    3  
ATOM 3743  H HA   . GLU A 1 18  ? -2.914  -6.297  2.531   1.00 0.00 ? 18  GLU A HA   3  
ATOM 3744  H HB2  . GLU A 1 18  ? -1.337  -3.848  1.622   1.00 0.00 ? 18  GLU A HB2  3  
ATOM 3745  H HB3  . GLU A 1 18  ? -2.249  -3.975  3.113   1.00 0.00 ? 18  GLU A HB3  3  
ATOM 3746  H HG2  . GLU A 1 18  ? -0.337  -6.207  2.737   1.00 0.00 ? 18  GLU A HG2  3  
ATOM 3747  H HG3  . GLU A 1 18  ? 0.445   -4.639  2.792   1.00 0.00 ? 18  GLU A HG3  3  
ATOM 3748  N N    . GLU A 1 19  ? -4.937  -5.470  1.381   1.00 0.00 ? 19  GLU A N    3  
ATOM 3749  C CA   . GLU A 1 19  ? -6.158  -4.963  0.778   1.00 0.00 ? 19  GLU A CA   3  
ATOM 3750  C C    . GLU A 1 19  ? -6.159  -3.433  0.788   1.00 0.00 ? 19  GLU A C    3  
ATOM 3751  O O    . GLU A 1 19  ? -5.479  -2.814  1.604   1.00 0.00 ? 19  GLU A O    3  
ATOM 3752  C CB   . GLU A 1 19  ? -7.392  -5.517  1.492   1.00 0.00 ? 19  GLU A CB   3  
ATOM 3753  C CG   . GLU A 1 19  ? -7.492  -4.972  2.918   1.00 0.00 ? 19  GLU A CG   3  
ATOM 3754  C CD   . GLU A 1 19  ? -7.323  -6.092  3.947   1.00 0.00 ? 19  GLU A CD   3  
ATOM 3755  O OE1  . GLU A 1 19  ? -7.871  -7.185  3.690   1.00 0.00 ? 19  GLU A OE1  3  
ATOM 3756  O OE2  . GLU A 1 19  ? -6.649  -5.829  4.966   1.00 0.00 ? 19  GLU A OE2  3  
ATOM 3757  H H    . GLU A 1 19  ? -5.069  -6.192  2.060   1.00 0.00 ? 19  GLU A H    3  
ATOM 3758  H HA   . GLU A 1 19  ? -6.146  -5.327  -0.249  1.00 0.00 ? 19  GLU A HA   3  
ATOM 3759  H HB2  . GLU A 1 19  ? -8.290  -5.251  0.934   1.00 0.00 ? 19  GLU A HB2  3  
ATOM 3760  H HB3  . GLU A 1 19  ? -7.345  -6.606  1.518   1.00 0.00 ? 19  GLU A HB3  3  
ATOM 3761  H HG2  . GLU A 1 19  ? -6.727  -4.211  3.075   1.00 0.00 ? 19  GLU A HG2  3  
ATOM 3762  H HG3  . GLU A 1 19  ? -8.458  -4.486  3.059   1.00 0.00 ? 19  GLU A HG3  3  
ATOM 3763  N N    . PRO A 1 20  ? -6.951  -2.854  -0.154  1.00 0.00 ? 20  PRO A N    3  
ATOM 3764  C CA   . PRO A 1 20  ? -7.050  -1.408  -0.261  1.00 0.00 ? 20  PRO A CA   3  
ATOM 3765  C C    . PRO A 1 20  ? -7.909  -0.832  0.866   1.00 0.00 ? 20  PRO A C    3  
ATOM 3766  O O    . PRO A 1 20  ? -9.065  -1.218  1.030   1.00 0.00 ? 20  PRO A O    3  
ATOM 3767  C CB   . PRO A 1 20  ? -7.634  -1.155  -1.642  1.00 0.00 ? 20  PRO A CB   3  
ATOM 3768  C CG   . PRO A 1 20  ? -8.271  -2.467  -2.071  1.00 0.00 ? 20  PRO A CG   3  
ATOM 3769  C CD   . PRO A 1 20  ? -7.770  -3.556  -1.137  1.00 0.00 ? 20  PRO A CD   3  
ATOM 3770  H HA   . PRO A 1 20  ? -6.147  -0.990  -0.159  1.00 0.00 ? 20  PRO A HA   3  
ATOM 3771  H HB2  . PRO A 1 20  ? -8.372  -0.353  -1.613  1.00 0.00 ? 20  PRO A HB2  3  
ATOM 3772  H HB3  . PRO A 1 20  ? -6.858  -0.849  -2.344  1.00 0.00 ? 20  PRO A HB3  3  
ATOM 3773  H HG2  . PRO A 1 20  ? -9.358  -2.396  -2.027  1.00 0.00 ? 20  PRO A HG2  3  
ATOM 3774  H HG3  . PRO A 1 20  ? -8.008  -2.699  -3.103  1.00 0.00 ? 20  PRO A HG3  3  
ATOM 3775  H HD2  . PRO A 1 20  ? -8.598  -4.080  -0.660  1.00 0.00 ? 20  PRO A HD2  3  
ATOM 3776  H HD3  . PRO A 1 20  ? -7.188  -4.303  -1.676  1.00 0.00 ? 20  PRO A HD3  3  
ATOM 3777  N N    . ARG A 1 21  ? -7.310  0.083   1.614   1.00 0.00 ? 21  ARG A N    3  
ATOM 3778  C CA   . ARG A 1 21  ? -8.006  0.717   2.722   1.00 0.00 ? 21  ARG A CA   3  
ATOM 3779  C C    . ARG A 1 21  ? -8.445  2.130   2.334   1.00 0.00 ? 21  ARG A C    3  
ATOM 3780  O O    . ARG A 1 21  ? -7.907  2.716   1.395   1.00 0.00 ? 21  ARG A O    3  
ATOM 3781  C CB   . ARG A 1 21  ? -7.114  0.790   3.963   1.00 0.00 ? 21  ARG A CB   3  
ATOM 3782  C CG   . ARG A 1 21  ? -6.119  1.947   3.856   1.00 0.00 ? 21  ARG A CG   3  
ATOM 3783  C CD   . ARG A 1 21  ? -4.746  1.542   4.395   1.00 0.00 ? 21  ARG A CD   3  
ATOM 3784  N NE   . ARG A 1 21  ? -4.329  0.253   3.799   1.00 0.00 ? 21  ARG A NE   3  
ATOM 3785  C CZ   . ARG A 1 21  ? -3.426  -0.571  4.348   1.00 0.00 ? 21  ARG A CZ   3  
ATOM 3786  N NH1  . ARG A 1 21  ? -2.840  -0.247  5.508   1.00 0.00 ? 21  ARG A NH1  3  
ATOM 3787  N NH2  . ARG A 1 21  ? -3.109  -1.721  3.736   1.00 0.00 ? 21  ARG A NH2  3  
ATOM 3788  H H    . ARG A 1 21  ? -6.369  0.392   1.474   1.00 0.00 ? 21  ARG A H    3  
ATOM 3789  H HA   . ARG A 1 21  ? -8.867  0.077   2.912   1.00 0.00 ? 21  ARG A HA   3  
ATOM 3790  H HB2  . ARG A 1 21  ? -7.732  0.918   4.852   1.00 0.00 ? 21  ARG A HB2  3  
ATOM 3791  H HB3  . ARG A 1 21  ? -6.574  -0.149  4.083   1.00 0.00 ? 21  ARG A HB3  3  
ATOM 3792  H HG2  . ARG A 1 21  ? -6.028  2.258   2.815   1.00 0.00 ? 21  ARG A HG2  3  
ATOM 3793  H HG3  . ARG A 1 21  ? -6.493  2.806   4.413   1.00 0.00 ? 21  ARG A HG3  3  
ATOM 3794  H HD2  . ARG A 1 21  ? -4.012  2.314   4.163   1.00 0.00 ? 21  ARG A HD2  3  
ATOM 3795  H HD3  . ARG A 1 21  ? -4.784  1.454   5.481   1.00 0.00 ? 21  ARG A HD3  3  
ATOM 3796  H HE   . ARG A 1 21  ? -4.746  -0.020  2.932   1.00 0.00 ? 21  ARG A HE   3  
ATOM 3797  H HH11 . ARG A 1 21  ? -3.077  0.611   5.965   1.00 0.00 ? 21  ARG A HH11 3  
ATOM 3798  H HH12 . ARG A 1 21  ? -2.167  -0.862  5.918   1.00 0.00 ? 21  ARG A HH12 3  
ATOM 3799  H HH21 . ARG A 1 21  ? -3.546  -1.963  2.869   1.00 0.00 ? 21  ARG A HH21 3  
ATOM 3800  H HH22 . ARG A 1 21  ? -2.435  -2.336  4.145   1.00 0.00 ? 21  ARG A HH22 3  
ATOM 3801  N N    . HIS A 1 22  ? -9.418  2.638   3.076   1.00 0.00 ? 22  HIS A N    3  
ATOM 3802  C CA   . HIS A 1 22  ? -9.936  3.971   2.821   1.00 0.00 ? 22  HIS A CA   3  
ATOM 3803  C C    . HIS A 1 22  ? -9.653  4.870   4.026   1.00 0.00 ? 22  HIS A C    3  
ATOM 3804  O O    . HIS A 1 22  ? -10.250 4.697   5.088   1.00 0.00 ? 22  HIS A O    3  
ATOM 3805  C CB   . HIS A 1 22  ? -11.421 3.917   2.457   1.00 0.00 ? 22  HIS A CB   3  
ATOM 3806  C CG   . HIS A 1 22  ? -11.728 3.052   1.258   1.00 0.00 ? 22  HIS A CG   3  
ATOM 3807  N ND1  . HIS A 1 22  ? -11.186 1.790   1.086   1.00 0.00 ? 22  HIS A ND1  3  
ATOM 3808  C CD2  . HIS A 1 22  ? -12.528 3.278   0.177   1.00 0.00 ? 22  HIS A CD2  3  
ATOM 3809  C CE1  . HIS A 1 22  ? -11.644 1.290   -0.053  1.00 0.00 ? 22  HIS A CE1  3  
ATOM 3810  N NE2  . HIS A 1 22  ? -12.475 2.214   -0.615  1.00 0.00 ? 22  HIS A NE2  3  
ATOM 3811  H H    . HIS A 1 22  ? -9.850  2.155   3.837   1.00 0.00 ? 22  HIS A H    3  
ATOM 3812  H HA   . HIS A 1 22  ? -9.395  4.357   1.956   1.00 0.00 ? 22  HIS A HA   3  
ATOM 3813  H HB2  . HIS A 1 22  ? -11.981 3.545   3.314   1.00 0.00 ? 22  HIS A HB2  3  
ATOM 3814  H HB3  . HIS A 1 22  ? -11.773 4.930   2.261   1.00 0.00 ? 22  HIS A HB3  3  
ATOM 3815  H HD1  . HIS A 1 22  ? -10.555 1.334   1.713   1.00 0.00 ? 22  HIS A HD1  3  
ATOM 3816  H HD2  . HIS A 1 22  ? -13.111 4.181   -0.006  1.00 0.00 ? 22  HIS A HD2  3  
ATOM 3817  H HE1  . HIS A 1 22  ? -11.400 0.312   -0.467  1.00 0.00 ? 22  HIS A HE1  3  
ATOM 3818  N N    . VAL A 1 23  ? -8.743  5.811   3.822   1.00 0.00 ? 23  VAL A N    3  
ATOM 3819  C CA   . VAL A 1 23  ? -8.373  6.737   4.878   1.00 0.00 ? 23  VAL A CA   3  
ATOM 3820  C C    . VAL A 1 23  ? -9.086  8.072   4.652   1.00 0.00 ? 23  VAL A C    3  
ATOM 3821  O O    . VAL A 1 23  ? -8.992  8.656   3.573   1.00 0.00 ? 23  VAL A O    3  
ATOM 3822  C CB   . VAL A 1 23  ? -6.851  6.876   4.944   1.00 0.00 ? 23  VAL A CB   3  
ATOM 3823  C CG1  . VAL A 1 23  ? -6.448  8.135   5.716   1.00 0.00 ? 23  VAL A CG1  3  
ATOM 3824  C CG2  . VAL A 1 23  ? -6.213  5.629   5.558   1.00 0.00 ? 23  VAL A CG2  3  
ATOM 3825  H H    . VAL A 1 23  ? -8.262  5.945   2.955   1.00 0.00 ? 23  VAL A H    3  
ATOM 3826  H HA   . VAL A 1 23  ? -8.715  6.313   5.822   1.00 0.00 ? 23  VAL A HA   3  
ATOM 3827  H HB   . VAL A 1 23  ? -6.479  6.975   3.924   1.00 0.00 ? 23  VAL A HB   3  
ATOM 3828  H HG11 . VAL A 1 23  ? -6.884  8.104   6.714   1.00 0.00 ? 23  VAL A HG11 3  
ATOM 3829  H HG12 . VAL A 1 23  ? -5.362  8.180   5.795   1.00 0.00 ? 23  VAL A HG12 3  
ATOM 3830  H HG13 . VAL A 1 23  ? -6.812  9.016   5.188   1.00 0.00 ? 23  VAL A HG13 3  
ATOM 3831  H HG21 . VAL A 1 23  ? -5.168  5.568   5.255   1.00 0.00 ? 23  VAL A HG21 3  
ATOM 3832  H HG22 . VAL A 1 23  ? -6.273  5.688   6.645   1.00 0.00 ? 23  VAL A HG22 3  
ATOM 3833  H HG23 . VAL A 1 23  ? -6.744  4.741   5.213   1.00 0.00 ? 23  VAL A HG23 3  
ATOM 3834  N N    . LYS A 1 24  ? -9.784  8.517   5.687   1.00 0.00 ? 24  LYS A N    3  
ATOM 3835  C CA   . LYS A 1 24  ? -10.512 9.772   5.615   1.00 0.00 ? 24  LYS A CA   3  
ATOM 3836  C C    . LYS A 1 24  ? -9.572  10.924  5.976   1.00 0.00 ? 24  LYS A C    3  
ATOM 3837  O O    . LYS A 1 24  ? -8.631  10.743  6.747   1.00 0.00 ? 24  LYS A O    3  
ATOM 3838  C CB   . LYS A 1 24  ? -11.771 9.711   6.482   1.00 0.00 ? 24  LYS A CB   3  
ATOM 3839  C CG   . LYS A 1 24  ? -13.013 9.444   5.628   1.00 0.00 ? 24  LYS A CG   3  
ATOM 3840  C CD   . LYS A 1 24  ? -14.291 9.598   6.455   1.00 0.00 ? 24  LYS A CD   3  
ATOM 3841  C CE   . LYS A 1 24  ? -15.518 9.718   5.549   1.00 0.00 ? 24  LYS A CE   3  
ATOM 3842  N NZ   . LYS A 1 24  ? -16.722 9.200   6.237   1.00 0.00 ? 24  LYS A NZ   3  
ATOM 3843  H H    . LYS A 1 24  ? -9.855  8.036   6.561   1.00 0.00 ? 24  LYS A H    3  
ATOM 3844  H HA   . LYS A 1 24  ? -10.837 9.902   4.583   1.00 0.00 ? 24  LYS A HA   3  
ATOM 3845  H HB2  . LYS A 1 24  ? -11.665 8.926   7.230   1.00 0.00 ? 24  LYS A HB2  3  
ATOM 3846  H HB3  . LYS A 1 24  ? -11.892 10.651  7.021   1.00 0.00 ? 24  LYS A HB3  3  
ATOM 3847  H HG2  . LYS A 1 24  ? -13.034 10.136  4.786   1.00 0.00 ? 24  LYS A HG2  3  
ATOM 3848  H HG3  . LYS A 1 24  ? -12.963 8.438   5.212   1.00 0.00 ? 24  LYS A HG3  3  
ATOM 3849  H HD2  . LYS A 1 24  ? -14.405 8.739   7.117   1.00 0.00 ? 24  LYS A HD2  3  
ATOM 3850  H HD3  . LYS A 1 24  ? -14.214 10.481  7.089   1.00 0.00 ? 24  LYS A HD3  3  
ATOM 3851  H HE2  . LYS A 1 24  ? -15.672 10.761  5.271   1.00 0.00 ? 24  LYS A HE2  3  
ATOM 3852  H HE3  . LYS A 1 24  ? -15.352 9.163   4.626   1.00 0.00 ? 24  LYS A HE3  3  
ATOM 3853  H HZ1  . LYS A 1 24  ? -17.531 9.684   5.904   1.00 0.00 ? 24  LYS A HZ1  3  
ATOM 3854  H HZ2  . LYS A 1 24  ? -16.818 8.222   6.049   1.00 0.00 ? 24  LYS A HZ2  3  
ATOM 3855  H HZ3  . LYS A 1 24  ? -16.630 9.342   7.222   1.00 0.00 ? 24  LYS A HZ3  3  
ATOM 3856  N N    . VAL A 1 25  ? -9.860  12.082  5.402   1.00 0.00 ? 25  VAL A N    3  
ATOM 3857  C CA   . VAL A 1 25  ? -9.052  13.264  5.654   1.00 0.00 ? 25  VAL A CA   3  
ATOM 3858  C C    . VAL A 1 25  ? -9.970  14.449  5.956   1.00 0.00 ? 25  VAL A C    3  
ATOM 3859  O O    . VAL A 1 25  ? -10.938 14.689  5.236   1.00 0.00 ? 25  VAL A O    3  
ATOM 3860  C CB   . VAL A 1 25  ? -8.115  13.519  4.471   1.00 0.00 ? 25  VAL A CB   3  
ATOM 3861  C CG1  . VAL A 1 25  ? -7.067  14.578  4.820   1.00 0.00 ? 25  VAL A CG1  3  
ATOM 3862  C CG2  . VAL A 1 25  ? -7.451  12.221  4.008   1.00 0.00 ? 25  VAL A CG2  3  
ATOM 3863  H H    . VAL A 1 25  ? -10.627 12.221  4.776   1.00 0.00 ? 25  VAL A H    3  
ATOM 3864  H HA   . VAL A 1 25  ? -8.439  13.061  6.532   1.00 0.00 ? 25  VAL A HA   3  
ATOM 3865  H HB   . VAL A 1 25  ? -8.715  13.901  3.645   1.00 0.00 ? 25  VAL A HB   3  
ATOM 3866  H HG11 . VAL A 1 25  ? -6.916  15.235  3.964   1.00 0.00 ? 25  VAL A HG11 3  
ATOM 3867  H HG12 . VAL A 1 25  ? -7.413  15.164  5.672   1.00 0.00 ? 25  VAL A HG12 3  
ATOM 3868  H HG13 . VAL A 1 25  ? -6.127  14.088  5.073   1.00 0.00 ? 25  VAL A HG13 3  
ATOM 3869  H HG21 . VAL A 1 25  ? -7.958  11.851  3.117   1.00 0.00 ? 25  VAL A HG21 3  
ATOM 3870  H HG22 . VAL A 1 25  ? -6.403  12.412  3.777   1.00 0.00 ? 25  VAL A HG22 3  
ATOM 3871  H HG23 . VAL A 1 25  ? -7.518  11.475  4.800   1.00 0.00 ? 25  VAL A HG23 3  
ATOM 3872  N N    . GLN A 1 26  ? -9.634  15.160  7.023   1.00 0.00 ? 26  GLN A N    3  
ATOM 3873  C CA   . GLN A 1 26  ? -10.416 16.315  7.429   1.00 0.00 ? 26  GLN A CA   3  
ATOM 3874  C C    . GLN A 1 26  ? -9.629  17.604  7.181   1.00 0.00 ? 26  GLN A C    3  
ATOM 3875  O O    . GLN A 1 26  ? -9.148  18.233  8.122   1.00 0.00 ? 26  GLN A O    3  
ATOM 3876  C CB   . GLN A 1 26  ? -10.836 16.204  8.896   1.00 0.00 ? 26  GLN A CB   3  
ATOM 3877  C CG   . GLN A 1 26  ? -12.338 15.936  9.017   1.00 0.00 ? 26  GLN A CG   3  
ATOM 3878  C CD   . GLN A 1 26  ? -12.925 16.650  10.236  1.00 0.00 ? 26  GLN A CD   3  
ATOM 3879  O OE1  . GLN A 1 26  ? -12.354 16.666  11.314  1.00 0.00 ? 26  GLN A OE1  3  
ATOM 3880  N NE2  . GLN A 1 26  ? -14.096 17.238  10.006  1.00 0.00 ? 26  GLN A NE2  3  
ATOM 3881  H H    . GLN A 1 26  ? -8.845  14.959  7.603   1.00 0.00 ? 26  GLN A H    3  
ATOM 3882  H HA   . GLN A 1 26  ? -11.306 16.298  6.800   1.00 0.00 ? 26  GLN A HA   3  
ATOM 3883  H HB2  . GLN A 1 26  ? -10.279 15.400  9.378   1.00 0.00 ? 26  GLN A HB2  3  
ATOM 3884  H HB3  . GLN A 1 26  ? -10.584 17.125  9.421   1.00 0.00 ? 26  GLN A HB3  3  
ATOM 3885  H HG2  . GLN A 1 26  ? -12.845 16.274  8.114   1.00 0.00 ? 26  GLN A HG2  3  
ATOM 3886  H HG3  . GLN A 1 26  ? -12.514 14.863  9.100   1.00 0.00 ? 26  GLN A HG3  3  
ATOM 3887  H HE21 . GLN A 1 26  ? -14.511 17.187  9.098   1.00 0.00 ? 26  GLN A HE21 3  
ATOM 3888  H HE22 . GLN A 1 26  ? -14.561 17.731  10.742  1.00 0.00 ? 26  GLN A HE22 3  
ATOM 3889  N N    . LYS A 1 27  ? -9.522  17.958  5.908   1.00 0.00 ? 27  LYS A N    3  
ATOM 3890  C CA   . LYS A 1 27  ? -8.801  19.160  5.524   1.00 0.00 ? 27  LYS A CA   3  
ATOM 3891  C C    . LYS A 1 27  ? -9.394  20.362  6.262   1.00 0.00 ? 27  LYS A C    3  
ATOM 3892  O O    . LYS A 1 27  ? -8.808  20.854  7.225   1.00 0.00 ? 27  LYS A O    3  
ATOM 3893  C CB   . LYS A 1 27  ? -8.792  19.315  4.002   1.00 0.00 ? 27  LYS A CB   3  
ATOM 3894  C CG   . LYS A 1 27  ? -8.132  18.108  3.331   1.00 0.00 ? 27  LYS A CG   3  
ATOM 3895  C CD   . LYS A 1 27  ? -6.886  18.529  2.550   1.00 0.00 ? 27  LYS A CD   3  
ATOM 3896  C CE   . LYS A 1 27  ? -6.675  17.630  1.330   1.00 0.00 ? 27  LYS A CE   3  
ATOM 3897  N NZ   . LYS A 1 27  ? -6.007  18.381  0.243   1.00 0.00 ? 27  LYS A NZ   3  
ATOM 3898  H H    . LYS A 1 27  ? -9.916  17.440  5.149   1.00 0.00 ? 27  LYS A H    3  
ATOM 3899  H HA   . LYS A 1 27  ? -7.766  19.035  5.842   1.00 0.00 ? 27  LYS A HA   3  
ATOM 3900  H HB2  . LYS A 1 27  ? -9.813  19.425  3.638   1.00 0.00 ? 27  LYS A HB2  3  
ATOM 3901  H HB3  . LYS A 1 27  ? -8.257  20.225  3.729   1.00 0.00 ? 27  LYS A HB3  3  
ATOM 3902  H HG2  . LYS A 1 27  ? -7.861  17.371  4.087   1.00 0.00 ? 27  LYS A HG2  3  
ATOM 3903  H HG3  . LYS A 1 27  ? -8.843  17.628  2.659   1.00 0.00 ? 27  LYS A HG3  3  
ATOM 3904  H HD2  . LYS A 1 27  ? -6.985  19.566  2.230   1.00 0.00 ? 27  LYS A HD2  3  
ATOM 3905  H HD3  . LYS A 1 27  ? -6.011  18.478  3.199   1.00 0.00 ? 27  LYS A HD3  3  
ATOM 3906  H HE2  . LYS A 1 27  ? -6.071  16.766  1.607   1.00 0.00 ? 27  LYS A HE2  3  
ATOM 3907  H HE3  . LYS A 1 27  ? -7.634  17.250  0.981   1.00 0.00 ? 27  LYS A HE3  3  
ATOM 3908  H HZ1  . LYS A 1 27  ? -5.111  17.975  0.060   1.00 0.00 ? 27  LYS A HZ1  3  
ATOM 3909  H HZ2  . LYS A 1 27  ? -6.567  18.339  -0.584  1.00 0.00 ? 27  LYS A HZ2  3  
ATOM 3910  H HZ3  . LYS A 1 27  ? -5.891  19.335  0.519   1.00 0.00 ? 27  LYS A HZ3  3  
ATOM 3911  N N    . GLY A 1 28  ? -10.548 20.800  5.782   1.00 0.00 ? 28  GLY A N    3  
ATOM 3912  C CA   . GLY A 1 28  ? -11.227 21.935  6.383   1.00 0.00 ? 28  GLY A CA   3  
ATOM 3913  C C    . GLY A 1 28  ? -10.873 23.234  5.655   1.00 0.00 ? 28  GLY A C    3  
ATOM 3914  O O    . GLY A 1 28  ? -11.747 23.893  5.095   1.00 0.00 ? 28  GLY A O    3  
ATOM 3915  H H    . GLY A 1 28  ? -11.018 20.394  4.998   1.00 0.00 ? 28  GLY A H    3  
ATOM 3916  H HA2  . GLY A 1 28  ? -12.305 21.778  6.351   1.00 0.00 ? 28  GLY A HA2  3  
ATOM 3917  H HA3  . GLY A 1 28  ? -10.947 22.015  7.434   1.00 0.00 ? 28  GLY A HA3  3  
ATOM 3918  N N    . SER A 1 29  ? -9.590  23.563  5.688   1.00 0.00 ? 29  SER A N    3  
ATOM 3919  C CA   . SER A 1 29  ? -9.111  24.770  5.038   1.00 0.00 ? 29  SER A CA   3  
ATOM 3920  C C    . SER A 1 29  ? -7.591  24.709  4.875   1.00 0.00 ? 29  SER A C    3  
ATOM 3921  O O    . SER A 1 29  ? -6.915  25.735  4.927   1.00 0.00 ? 29  SER A O    3  
ATOM 3922  C CB   . SER A 1 29  ? -9.509  26.017  5.830   1.00 0.00 ? 29  SER A CB   3  
ATOM 3923  O OG   . SER A 1 29  ? -9.309  25.847  7.230   1.00 0.00 ? 29  SER A OG   3  
ATOM 3924  H H    . SER A 1 29  ? -8.885  23.021  6.146   1.00 0.00 ? 29  SER A H    3  
ATOM 3925  H HA   . SER A 1 29  ? -9.599  24.788  4.064   1.00 0.00 ? 29  SER A HA   3  
ATOM 3926  H HB2  . SER A 1 29  ? -8.926  26.870  5.482   1.00 0.00 ? 29  SER A HB2  3  
ATOM 3927  H HB3  . SER A 1 29  ? -10.557 26.249  5.639   1.00 0.00 ? 29  SER A HB3  3  
ATOM 3928  H HG   . SER A 1 29  ? -8.383  26.127  7.480   1.00 0.00 ? 29  SER A HG   3  
ATOM 3929  N N    . GLU A 1 30  ? -7.097  23.495  4.681   1.00 0.00 ? 30  GLU A N    3  
ATOM 3930  C CA   . GLU A 1 30  ? -5.669  23.286  4.510   1.00 0.00 ? 30  GLU A CA   3  
ATOM 3931  C C    . GLU A 1 30  ? -5.414  22.130  3.541   1.00 0.00 ? 30  GLU A C    3  
ATOM 3932  O O    . GLU A 1 30  ? -6.280  21.279  3.343   1.00 0.00 ? 30  GLU A O    3  
ATOM 3933  C CB   . GLU A 1 30  ? -4.987  23.033  5.857   1.00 0.00 ? 30  GLU A CB   3  
ATOM 3934  C CG   . GLU A 1 30  ? -4.587  24.350  6.524   1.00 0.00 ? 30  GLU A CG   3  
ATOM 3935  C CD   . GLU A 1 30  ? -3.077  24.576  6.432   1.00 0.00 ? 30  GLU A CD   3  
ATOM 3936  O OE1  . GLU A 1 30  ? -2.341  23.591  6.660   1.00 0.00 ? 30  GLU A OE1  3  
ATOM 3937  O OE2  . GLU A 1 30  ? -2.692  25.727  6.135   1.00 0.00 ? 30  GLU A OE2  3  
ATOM 3938  H H    . GLU A 1 30  ? -7.653  22.665  4.640   1.00 0.00 ? 30  GLU A H    3  
ATOM 3939  H HA   . GLU A 1 30  ? -5.289  24.215  4.086   1.00 0.00 ? 30  GLU A HA   3  
ATOM 3940  H HB2  . GLU A 1 30  ? -5.660  22.479  6.511   1.00 0.00 ? 30  GLU A HB2  3  
ATOM 3941  H HB3  . GLU A 1 30  ? -4.103  22.413  5.710   1.00 0.00 ? 30  GLU A HB3  3  
ATOM 3942  H HG2  . GLU A 1 30  ? -5.112  25.178  6.047   1.00 0.00 ? 30  GLU A HG2  3  
ATOM 3943  H HG3  . GLU A 1 30  ? -4.894  24.339  7.570   1.00 0.00 ? 30  GLU A HG3  3  
ATOM 3944  N N    . PRO A 1 31  ? -4.190  22.136  2.948   1.00 0.00 ? 31  PRO A N    3  
ATOM 3945  C CA   . PRO A 1 31  ? -3.810  21.099  2.004   1.00 0.00 ? 31  PRO A CA   3  
ATOM 3946  C C    . PRO A 1 31  ? -3.491  19.790  2.728   1.00 0.00 ? 31  PRO A C    3  
ATOM 3947  O O    . PRO A 1 31  ? -3.512  19.734  3.957   1.00 0.00 ? 31  PRO A O    3  
ATOM 3948  C CB   . PRO A 1 31  ? -2.618  21.668  1.252   1.00 0.00 ? 31  PRO A CB   3  
ATOM 3949  C CG   . PRO A 1 31  ? -2.087  22.803  2.113   1.00 0.00 ? 31  PRO A CG   3  
ATOM 3950  C CD   . PRO A 1 31  ? -3.140  23.128  3.159   1.00 0.00 ? 31  PRO A CD   3  
ATOM 3951  H HA   . PRO A 1 31  ? -4.572  20.893  1.390   1.00 0.00 ? 31  PRO A HA   3  
ATOM 3952  H HB2  . PRO A 1 31  ? -1.855  20.906  1.095   1.00 0.00 ? 31  PRO A HB2  3  
ATOM 3953  H HB3  . PRO A 1 31  ? -2.914  22.030  0.268   1.00 0.00 ? 31  PRO A HB3  3  
ATOM 3954  H HG2  . PRO A 1 31  ? -1.150  22.514  2.590   1.00 0.00 ? 31  PRO A HG2  3  
ATOM 3955  H HG3  . PRO A 1 31  ? -1.874  23.679  1.500   1.00 0.00 ? 31  PRO A HG3  3  
ATOM 3956  H HD2  . PRO A 1 31  ? -2.730  23.062  4.167   1.00 0.00 ? 31  PRO A HD2  3  
ATOM 3957  H HD3  . PRO A 1 31  ? -3.521  24.142  3.036   1.00 0.00 ? 31  PRO A HD3  3  
ATOM 3958  N N    . LEU A 1 32  ? -3.201  18.768  1.936   1.00 0.00 ? 32  LEU A N    3  
ATOM 3959  C CA   . LEU A 1 32  ? -2.877  17.463  2.486   1.00 0.00 ? 32  LEU A CA   3  
ATOM 3960  C C    . LEU A 1 32  ? -1.470  17.501  3.083   1.00 0.00 ? 32  LEU A C    3  
ATOM 3961  O O    . LEU A 1 32  ? -1.277  17.161  4.250   1.00 0.00 ? 32  LEU A O    3  
ATOM 3962  C CB   . LEU A 1 32  ? -3.067  16.373  1.428   1.00 0.00 ? 32  LEU A CB   3  
ATOM 3963  C CG   . LEU A 1 32  ? -3.235  14.947  1.956   1.00 0.00 ? 32  LEU A CG   3  
ATOM 3964  C CD1  . LEU A 1 32  ? -4.338  14.881  3.014   1.00 0.00 ? 32  LEU A CD1  3  
ATOM 3965  C CD2  . LEU A 1 32  ? -3.479  13.963  0.810   1.00 0.00 ? 32  LEU A CD2  3  
ATOM 3966  H H    . LEU A 1 32  ? -3.186  18.821  0.937   1.00 0.00 ? 32  LEU A H    3  
ATOM 3967  H HA   . LEU A 1 32  ? -3.588  17.260  3.287   1.00 0.00 ? 32  LEU A HA   3  
ATOM 3968  H HB2  . LEU A 1 32  ? -3.943  16.624  0.830   1.00 0.00 ? 32  LEU A HB2  3  
ATOM 3969  H HB3  . LEU A 1 32  ? -2.208  16.392  0.757   1.00 0.00 ? 32  LEU A HB3  3  
ATOM 3970  H HG   . LEU A 1 32  ? -2.305  14.651  2.442   1.00 0.00 ? 32  LEU A HG   3  
ATOM 3971  H HD11 . LEU A 1 32  ? -4.941  13.987  2.855   1.00 0.00 ? 32  LEU A HD11 3  
ATOM 3972  H HD12 . LEU A 1 32  ? -3.889  14.844  4.006   1.00 0.00 ? 32  LEU A HD12 3  
ATOM 3973  H HD13 . LEU A 1 32  ? -4.971  15.765  2.935   1.00 0.00 ? 32  LEU A HD13 3  
ATOM 3974  H HD21 . LEU A 1 32  ? -2.750  14.138  0.020   1.00 0.00 ? 32  LEU A HD21 3  
ATOM 3975  H HD22 . LEU A 1 32  ? -3.378  12.943  1.180   1.00 0.00 ? 32  LEU A HD22 3  
ATOM 3976  H HD23 . LEU A 1 32  ? -4.485  14.108  0.415   1.00 0.00 ? 32  LEU A HD23 3  
ATOM 3977  N N    . GLY A 1 33  ? -0.521  17.917  2.257   1.00 0.00 ? 33  GLY A N    3  
ATOM 3978  C CA   . GLY A 1 33  ? 0.863   18.004  2.689   1.00 0.00 ? 33  GLY A CA   3  
ATOM 3979  C C    . GLY A 1 33  ? 1.552   16.641  2.599   1.00 0.00 ? 33  GLY A C    3  
ATOM 3980  O O    . GLY A 1 33  ? 1.978   16.089  3.613   1.00 0.00 ? 33  GLY A O    3  
ATOM 3981  H H    . GLY A 1 33  ? -0.686  18.192  1.310   1.00 0.00 ? 33  GLY A H    3  
ATOM 3982  H HA2  . GLY A 1 33  ? 1.396   18.727  2.071   1.00 0.00 ? 33  GLY A HA2  3  
ATOM 3983  H HA3  . GLY A 1 33  ? 0.905   18.370  3.715   1.00 0.00 ? 33  GLY A HA3  3  
ATOM 3984  N N    . ILE A 1 34  ? 1.641   16.138  1.377   1.00 0.00 ? 34  ILE A N    3  
ATOM 3985  C CA   . ILE A 1 34  ? 2.271   14.851  1.141   1.00 0.00 ? 34  ILE A CA   3  
ATOM 3986  C C    . ILE A 1 34  ? 2.947   14.862  -0.231  1.00 0.00 ? 34  ILE A C    3  
ATOM 3987  O O    . ILE A 1 34  ? 2.430   15.454  -1.177  1.00 0.00 ? 34  ILE A O    3  
ATOM 3988  C CB   . ILE A 1 34  ? 1.258   13.718  1.318   1.00 0.00 ? 34  ILE A CB   3  
ATOM 3989  C CG1  . ILE A 1 34  ? -0.005  13.978  0.494   1.00 0.00 ? 34  ILE A CG1  3  
ATOM 3990  C CG2  . ILE A 1 34  ? 0.940   13.492  2.798   1.00 0.00 ? 34  ILE A CG2  3  
ATOM 3991  C CD1  . ILE A 1 34  ? -0.386  12.745  -0.328  1.00 0.00 ? 34  ILE A CD1  3  
ATOM 3992  H H    . ILE A 1 34  ? 1.292   16.594  0.558   1.00 0.00 ? 34  ILE A H    3  
ATOM 3993  H HA   . ILE A 1 34  ? 3.039   14.718  1.904   1.00 0.00 ? 34  ILE A HA   3  
ATOM 3994  H HB   . ILE A 1 34  ? 1.705   12.798  0.941   1.00 0.00 ? 34  ILE A HB   3  
ATOM 3995  H HG12 . ILE A 1 34  ? -0.827  14.246  1.157   1.00 0.00 ? 34  ILE A HG12 3  
ATOM 3996  H HG13 . ILE A 1 34  ? 0.159   14.826  -0.170  1.00 0.00 ? 34  ILE A HG13 3  
ATOM 3997  H HG21 . ILE A 1 34  ? 0.185   12.712  2.892   1.00 0.00 ? 34  ILE A HG21 3  
ATOM 3998  H HG22 . ILE A 1 34  ? 1.846   13.186  3.321   1.00 0.00 ? 34  ILE A HG22 3  
ATOM 3999  H HG23 . ILE A 1 34  ? 0.564   14.418  3.234   1.00 0.00 ? 34  ILE A HG23 3  
ATOM 4000  H HD11 . ILE A 1 34  ? 0.339   12.604  -1.129  1.00 0.00 ? 34  ILE A HD11 3  
ATOM 4001  H HD12 . ILE A 1 34  ? -0.392  11.866  0.316   1.00 0.00 ? 34  ILE A HD12 3  
ATOM 4002  H HD13 . ILE A 1 34  ? -1.378  12.888  -0.757  1.00 0.00 ? 34  ILE A HD13 3  
ATOM 4003  N N    . SER A 1 35  ? 4.093   14.200  -0.296  1.00 0.00 ? 35  SER A N    3  
ATOM 4004  C CA   . SER A 1 35  ? 4.846   14.127  -1.537  1.00 0.00 ? 35  SER A CA   3  
ATOM 4005  C C    . SER A 1 35  ? 4.460   12.864  -2.309  1.00 0.00 ? 35  SER A C    3  
ATOM 4006  O O    . SER A 1 35  ? 4.157   11.833  -1.709  1.00 0.00 ? 35  SER A O    3  
ATOM 4007  C CB   . SER A 1 35  ? 6.352   14.146  -1.270  1.00 0.00 ? 35  SER A CB   3  
ATOM 4008  O OG   . SER A 1 35  ? 7.088   14.617  -2.396  1.00 0.00 ? 35  SER A OG   3  
ATOM 4009  H H    . SER A 1 35  ? 4.507   13.721  0.478   1.00 0.00 ? 35  SER A H    3  
ATOM 4010  H HA   . SER A 1 35  ? 4.566   15.018  -2.098  1.00 0.00 ? 35  SER A HA   3  
ATOM 4011  H HB2  . SER A 1 35  ? 6.560   14.781  -0.409  1.00 0.00 ? 35  SER A HB2  3  
ATOM 4012  H HB3  . SER A 1 35  ? 6.687   13.141  -1.012  1.00 0.00 ? 35  SER A HB3  3  
ATOM 4013  H HG   . SER A 1 35  ? 6.949   14.006  -3.175  1.00 0.00 ? 35  SER A HG   3  
ATOM 4014  N N    . ILE A 1 36  ? 4.483   12.985  -3.628  1.00 0.00 ? 36  ILE A N    3  
ATOM 4015  C CA   . ILE A 1 36  ? 4.139   11.865  -4.489  1.00 0.00 ? 36  ILE A CA   3  
ATOM 4016  C C    . ILE A 1 36  ? 5.154   11.774  -5.629  1.00 0.00 ? 36  ILE A C    3  
ATOM 4017  O O    . ILE A 1 36  ? 5.832   12.751  -5.942  1.00 0.00 ? 36  ILE A O    3  
ATOM 4018  C CB   . ILE A 1 36  ? 2.689   11.981  -4.964  1.00 0.00 ? 36  ILE A CB   3  
ATOM 4019  C CG1  . ILE A 1 36  ? 2.468   13.281  -5.740  1.00 0.00 ? 36  ILE A CG1  3  
ATOM 4020  C CG2  . ILE A 1 36  ? 1.715   11.840  -3.793  1.00 0.00 ? 36  ILE A CG2  3  
ATOM 4021  C CD1  . ILE A 1 36  ? 2.786   13.093  -7.225  1.00 0.00 ? 36  ILE A CD1  3  
ATOM 4022  H H    . ILE A 1 36  ? 4.730   13.826  -4.109  1.00 0.00 ? 36  ILE A H    3  
ATOM 4023  H HA   . ILE A 1 36  ? 4.210   10.958  -3.889  1.00 0.00 ? 36  ILE A HA   3  
ATOM 4024  H HB   . ILE A 1 36  ? 2.488   11.158  -5.650  1.00 0.00 ? 36  ILE A HB   3  
ATOM 4025  H HG12 . ILE A 1 36  ? 1.435   13.606  -5.624  1.00 0.00 ? 36  ILE A HG12 3  
ATOM 4026  H HG13 . ILE A 1 36  ? 3.099   14.067  -5.326  1.00 0.00 ? 36  ILE A HG13 3  
ATOM 4027  H HG21 . ILE A 1 36  ? 1.612   10.787  -3.530  1.00 0.00 ? 36  ILE A HG21 3  
ATOM 4028  H HG22 . ILE A 1 36  ? 2.097   12.393  -2.934  1.00 0.00 ? 36  ILE A HG22 3  
ATOM 4029  H HG23 . ILE A 1 36  ? 0.743   12.240  -4.079  1.00 0.00 ? 36  ILE A HG23 3  
ATOM 4030  H HD11 . ILE A 1 36  ? 3.617   13.742  -7.504  1.00 0.00 ? 36  ILE A HD11 3  
ATOM 4031  H HD12 . ILE A 1 36  ? 3.058   12.054  -7.410  1.00 0.00 ? 36  ILE A HD12 3  
ATOM 4032  H HD13 . ILE A 1 36  ? 1.909   13.351  -7.820  1.00 0.00 ? 36  ILE A HD13 3  
ATOM 4033  N N    . VAL A 1 37  ? 5.228   10.590  -6.220  1.00 0.00 ? 37  VAL A N    3  
ATOM 4034  C CA   . VAL A 1 37  ? 6.149   10.358  -7.319  1.00 0.00 ? 37  VAL A CA   3  
ATOM 4035  C C    . VAL A 1 37  ? 5.515   9.383   -8.314  1.00 0.00 ? 37  VAL A C    3  
ATOM 4036  O O    . VAL A 1 37  ? 4.730   8.519   -7.926  1.00 0.00 ? 37  VAL A O    3  
ATOM 4037  C CB   . VAL A 1 37  ? 7.495   9.869   -6.780  1.00 0.00 ? 37  VAL A CB   3  
ATOM 4038  C CG1  . VAL A 1 37  ? 7.941   10.706  -5.579  1.00 0.00 ? 37  VAL A CG1  3  
ATOM 4039  C CG2  . VAL A 1 37  ? 7.435   8.383   -6.420  1.00 0.00 ? 37  VAL A CG2  3  
ATOM 4040  H H    . VAL A 1 37  ? 4.673   9.800   -5.960  1.00 0.00 ? 37  VAL A H    3  
ATOM 4041  H HA   . VAL A 1 37  ? 6.312   11.312  -7.819  1.00 0.00 ? 37  VAL A HA   3  
ATOM 4042  H HB   . VAL A 1 37  ? 8.237   9.993   -7.568  1.00 0.00 ? 37  VAL A HB   3  
ATOM 4043  H HG11 . VAL A 1 37  ? 7.185   10.648  -4.795  1.00 0.00 ? 37  VAL A HG11 3  
ATOM 4044  H HG12 . VAL A 1 37  ? 8.888   10.323  -5.200  1.00 0.00 ? 37  VAL A HG12 3  
ATOM 4045  H HG13 . VAL A 1 37  ? 8.065   11.745  -5.886  1.00 0.00 ? 37  VAL A HG13 3  
ATOM 4046  H HG21 . VAL A 1 37  ? 7.217   7.802   -7.316  1.00 0.00 ? 37  VAL A HG21 3  
ATOM 4047  H HG22 . VAL A 1 37  ? 8.395   8.070   -6.009  1.00 0.00 ? 37  VAL A HG22 3  
ATOM 4048  H HG23 . VAL A 1 37  ? 6.652   8.220   -5.680  1.00 0.00 ? 37  VAL A HG23 3  
ATOM 4049  N N    . SER A 1 38  ? 5.879   9.555   -9.576  1.00 0.00 ? 38  SER A N    3  
ATOM 4050  C CA   . SER A 1 38  ? 5.355   8.702   -10.629 1.00 0.00 ? 38  SER A CA   3  
ATOM 4051  C C    . SER A 1 38  ? 6.388   7.637   -11.002 1.00 0.00 ? 38  SER A C    3  
ATOM 4052  O O    . SER A 1 38  ? 7.591   7.874   -10.906 1.00 0.00 ? 38  SER A O    3  
ATOM 4053  C CB   . SER A 1 38  ? 4.968   9.522   -11.861 1.00 0.00 ? 38  SER A CB   3  
ATOM 4054  O OG   . SER A 1 38  ? 4.557   8.694   -12.946 1.00 0.00 ? 38  SER A OG   3  
ATOM 4055  H H    . SER A 1 38  ? 6.517   10.261  -9.883  1.00 0.00 ? 38  SER A H    3  
ATOM 4056  H HA   . SER A 1 38  ? 4.463   8.238   -10.207 1.00 0.00 ? 38  SER A HA   3  
ATOM 4057  H HB2  . SER A 1 38  ? 4.161   10.207  -11.602 1.00 0.00 ? 38  SER A HB2  3  
ATOM 4058  H HB3  . SER A 1 38  ? 5.817   10.131  -12.172 1.00 0.00 ? 38  SER A HB3  3  
ATOM 4059  H HG   . SER A 1 38  ? 4.532   9.226   -13.792 1.00 0.00 ? 38  SER A HG   3  
ATOM 4060  N N    . GLY A 1 39  ? 5.881   6.487   -11.421 1.00 0.00 ? 39  GLY A N    3  
ATOM 4061  C CA   . GLY A 1 39  ? 6.745   5.385   -11.809 1.00 0.00 ? 39  GLY A CA   3  
ATOM 4062  C C    . GLY A 1 39  ? 6.490   4.973   -13.260 1.00 0.00 ? 39  GLY A C    3  
ATOM 4063  O O    . GLY A 1 39  ? 5.720   5.622   -13.967 1.00 0.00 ? 39  GLY A O    3  
ATOM 4064  H H    . GLY A 1 39  ? 4.901   6.302   -11.496 1.00 0.00 ? 39  GLY A H    3  
ATOM 4065  H HA2  . GLY A 1 39  ? 7.789   5.677   -11.688 1.00 0.00 ? 39  GLY A HA2  3  
ATOM 4066  H HA3  . GLY A 1 39  ? 6.574   4.534   -11.150 1.00 0.00 ? 39  GLY A HA3  3  
ATOM 4067  N N    . GLU A 1 40  ? 7.150   3.896   -13.661 1.00 0.00 ? 40  GLU A N    3  
ATOM 4068  C CA   . GLU A 1 40  ? 7.003   3.390   -15.014 1.00 0.00 ? 40  GLU A CA   3  
ATOM 4069  C C    . GLU A 1 40  ? 5.651   2.693   -15.177 1.00 0.00 ? 40  GLU A C    3  
ATOM 4070  O O    . GLU A 1 40  ? 5.589   1.471   -15.299 1.00 0.00 ? 40  GLU A O    3  
ATOM 4071  C CB   . GLU A 1 40  ? 8.153   2.446   -15.374 1.00 0.00 ? 40  GLU A CB   3  
ATOM 4072  C CG   . GLU A 1 40  ? 9.067   3.073   -16.428 1.00 0.00 ? 40  GLU A CG   3  
ATOM 4073  C CD   . GLU A 1 40  ? 8.503   2.867   -17.836 1.00 0.00 ? 40  GLU A CD   3  
ATOM 4074  O OE1  . GLU A 1 40  ? 8.088   1.723   -18.119 1.00 0.00 ? 40  GLU A OE1  3  
ATOM 4075  O OE2  . GLU A 1 40  ? 8.501   3.859   -18.596 1.00 0.00 ? 40  GLU A OE2  3  
ATOM 4076  H H    . GLU A 1 40  ? 7.774   3.374   -13.079 1.00 0.00 ? 40  GLU A H    3  
ATOM 4077  H HA   . GLU A 1 40  ? 7.047   4.268   -15.659 1.00 0.00 ? 40  GLU A HA   3  
ATOM 4078  H HB2  . GLU A 1 40  ? 8.730   2.213   -14.479 1.00 0.00 ? 40  GLU A HB2  3  
ATOM 4079  H HB3  . GLU A 1 40  ? 7.752   1.504   -15.749 1.00 0.00 ? 40  GLU A HB3  3  
ATOM 4080  H HG2  . GLU A 1 40  ? 9.180   4.139   -16.230 1.00 0.00 ? 40  GLU A HG2  3  
ATOM 4081  H HG3  . GLU A 1 40  ? 10.061  2.630   -16.363 1.00 0.00 ? 40  GLU A HG3  3  
ATOM 4082  N N    . LYS A 1 41  ? 4.601   3.501   -15.174 1.00 0.00 ? 41  LYS A N    3  
ATOM 4083  C CA   . LYS A 1 41  ? 3.253   2.978   -15.320 1.00 0.00 ? 41  LYS A CA   3  
ATOM 4084  C C    . LYS A 1 41  ? 2.936   2.060   -14.138 1.00 0.00 ? 41  LYS A C    3  
ATOM 4085  O O    . LYS A 1 41  ? 2.390   0.973   -14.320 1.00 0.00 ? 41  LYS A O    3  
ATOM 4086  C CB   . LYS A 1 41  ? 3.085   2.304   -16.684 1.00 0.00 ? 41  LYS A CB   3  
ATOM 4087  C CG   . LYS A 1 41  ? 1.622   2.331   -17.132 1.00 0.00 ? 41  LYS A CG   3  
ATOM 4088  C CD   . LYS A 1 41  ? 1.515   2.305   -18.658 1.00 0.00 ? 41  LYS A CD   3  
ATOM 4089  C CE   . LYS A 1 41  ? 0.056   2.187   -19.103 1.00 0.00 ? 41  LYS A CE   3  
ATOM 4090  N NZ   . LYS A 1 41  ? -0.118  1.025   -20.003 1.00 0.00 ? 41  LYS A NZ   3  
ATOM 4091  H H    . LYS A 1 41  ? 4.660   4.494   -15.075 1.00 0.00 ? 41  LYS A H    3  
ATOM 4092  H HA   . LYS A 1 41  ? 2.569   3.826   -15.293 1.00 0.00 ? 41  LYS A HA   3  
ATOM 4093  H HB2  . LYS A 1 41  ? 3.705   2.811   -17.424 1.00 0.00 ? 41  LYS A HB2  3  
ATOM 4094  H HB3  . LYS A 1 41  ? 3.434   1.273   -16.630 1.00 0.00 ? 41  LYS A HB3  3  
ATOM 4095  H HG2  . LYS A 1 41  ? 1.094   1.475   -16.712 1.00 0.00 ? 41  LYS A HG2  3  
ATOM 4096  H HG3  . LYS A 1 41  ? 1.136   3.226   -16.744 1.00 0.00 ? 41  LYS A HG3  3  
ATOM 4097  H HD2  . LYS A 1 41  ? 1.953   3.213   -19.072 1.00 0.00 ? 41  LYS A HD2  3  
ATOM 4098  H HD3  . LYS A 1 41  ? 2.089   1.466   -19.052 1.00 0.00 ? 41  LYS A HD3  3  
ATOM 4099  H HE2  . LYS A 1 41  ? -0.589  2.078   -18.231 1.00 0.00 ? 41  LYS A HE2  3  
ATOM 4100  H HE3  . LYS A 1 41  ? -0.250  3.100   -19.614 1.00 0.00 ? 41  LYS A HE3  3  
ATOM 4101  H HZ1  . LYS A 1 41  ? 0.304   0.218   -19.591 1.00 0.00 ? 41  LYS A HZ1  3  
ATOM 4102  H HZ2  . LYS A 1 41  ? -1.094  0.856   -20.144 1.00 0.00 ? 41  LYS A HZ2  3  
ATOM 4103  H HZ3  . LYS A 1 41  ? 0.317   1.217   -20.883 1.00 0.00 ? 41  LYS A HZ3  3  
ATOM 4104  N N    . GLY A 1 42  ? 3.293   2.532   -12.952 1.00 0.00 ? 42  GLY A N    3  
ATOM 4105  C CA   . GLY A 1 42  ? 3.053   1.767   -11.740 1.00 0.00 ? 42  GLY A CA   3  
ATOM 4106  C C    . GLY A 1 42  ? 2.117   2.520   -10.793 1.00 0.00 ? 42  GLY A C    3  
ATOM 4107  O O    . GLY A 1 42  ? 1.795   2.029   -9.712  1.00 0.00 ? 42  GLY A O    3  
ATOM 4108  H H    . GLY A 1 42  ? 3.736   3.417   -12.812 1.00 0.00 ? 42  GLY A H    3  
ATOM 4109  H HA2  . GLY A 1 42  ? 2.618   0.801   -11.995 1.00 0.00 ? 42  GLY A HA2  3  
ATOM 4110  H HA3  . GLY A 1 42  ? 4.000   1.567   -11.239 1.00 0.00 ? 42  GLY A HA3  3  
ATOM 4111  N N    . GLY A 1 43  ? 1.707   3.701   -11.232 1.00 0.00 ? 43  GLY A N    3  
ATOM 4112  C CA   . GLY A 1 43  ? 0.814   4.526   -10.437 1.00 0.00 ? 43  GLY A CA   3  
ATOM 4113  C C    . GLY A 1 43  ? 1.598   5.569   -9.638  1.00 0.00 ? 43  GLY A C    3  
ATOM 4114  O O    . GLY A 1 43  ? 2.792   5.763   -9.866  1.00 0.00 ? 43  GLY A O    3  
ATOM 4115  H H    . GLY A 1 43  ? 1.973   4.093   -12.113 1.00 0.00 ? 43  GLY A H    3  
ATOM 4116  H HA2  . GLY A 1 43  ? 0.098   5.026   -11.089 1.00 0.00 ? 43  GLY A HA2  3  
ATOM 4117  H HA3  . GLY A 1 43  ? 0.241   3.897   -9.756  1.00 0.00 ? 43  GLY A HA3  3  
ATOM 4118  N N    . ILE A 1 44  ? 0.896   6.214   -8.718  1.00 0.00 ? 44  ILE A N    3  
ATOM 4119  C CA   . ILE A 1 44  ? 1.512   7.232   -7.884  1.00 0.00 ? 44  ILE A CA   3  
ATOM 4120  C C    . ILE A 1 44  ? 1.894   6.618   -6.536  1.00 0.00 ? 44  ILE A C    3  
ATOM 4121  O O    . ILE A 1 44  ? 1.135   5.834   -5.969  1.00 0.00 ? 44  ILE A O    3  
ATOM 4122  C CB   . ILE A 1 44  ? 0.597   8.453   -7.766  1.00 0.00 ? 44  ILE A CB   3  
ATOM 4123  C CG1  . ILE A 1 44  ? 0.220   8.991   -9.148  1.00 0.00 ? 44  ILE A CG1  3  
ATOM 4124  C CG2  . ILE A 1 44  ? 1.233   9.531   -6.886  1.00 0.00 ? 44  ILE A CG2  3  
ATOM 4125  C CD1  . ILE A 1 44  ? 1.395   9.734   -9.787  1.00 0.00 ? 44  ILE A CD1  3  
ATOM 4126  H H    . ILE A 1 44  ? -0.074  6.050   -8.538  1.00 0.00 ? 44  ILE A H    3  
ATOM 4127  H HA   . ILE A 1 44  ? 2.423   7.559   -8.386  1.00 0.00 ? 44  ILE A HA   3  
ATOM 4128  H HB   . ILE A 1 44  ? -0.326  8.142   -7.279  1.00 0.00 ? 44  ILE A HB   3  
ATOM 4129  H HG12 . ILE A 1 44  ? -0.087  8.166   -9.792  1.00 0.00 ? 44  ILE A HG12 3  
ATOM 4130  H HG13 . ILE A 1 44  ? -0.634  9.662   -9.061  1.00 0.00 ? 44  ILE A HG13 3  
ATOM 4131  H HG21 . ILE A 1 44  ? 0.455   10.189  -6.499  1.00 0.00 ? 44  ILE A HG21 3  
ATOM 4132  H HG22 . ILE A 1 44  ? 1.756   9.059   -6.054  1.00 0.00 ? 44  ILE A HG22 3  
ATOM 4133  H HG23 . ILE A 1 44  ? 1.940   10.113  -7.477  1.00 0.00 ? 44  ILE A HG23 3  
ATOM 4134  H HD11 . ILE A 1 44  ? 1.354   10.786  -9.508  1.00 0.00 ? 44  ILE A HD11 3  
ATOM 4135  H HD12 . ILE A 1 44  ? 2.332   9.301   -9.437  1.00 0.00 ? 44  ILE A HD12 3  
ATOM 4136  H HD13 . ILE A 1 44  ? 1.336   9.642   -10.872 1.00 0.00 ? 44  ILE A HD13 3  
ATOM 4137  N N    . TYR A 1 45  ? 3.072   6.998   -6.061  1.00 0.00 ? 45  TYR A N    3  
ATOM 4138  C CA   . TYR A 1 45  ? 3.564   6.495   -4.790  1.00 0.00 ? 45  TYR A CA   3  
ATOM 4139  C C    . TYR A 1 45  ? 3.975   7.644   -3.867  1.00 0.00 ? 45  TYR A C    3  
ATOM 4140  O O    . TYR A 1 45  ? 4.588   8.613   -4.312  1.00 0.00 ? 45  TYR A O    3  
ATOM 4141  C CB   . TYR A 1 45  ? 4.800   5.655   -5.120  1.00 0.00 ? 45  TYR A CB   3  
ATOM 4142  C CG   . TYR A 1 45  ? 4.517   4.468   -6.043  1.00 0.00 ? 45  TYR A CG   3  
ATOM 4143  C CD1  . TYR A 1 45  ? 4.576   4.630   -7.412  1.00 0.00 ? 45  TYR A CD1  3  
ATOM 4144  C CD2  . TYR A 1 45  ? 4.203   3.236   -5.506  1.00 0.00 ? 45  TYR A CD2  3  
ATOM 4145  C CE1  . TYR A 1 45  ? 4.310   3.513   -8.281  1.00 0.00 ? 45  TYR A CE1  3  
ATOM 4146  C CE2  . TYR A 1 45  ? 3.937   2.119   -6.375  1.00 0.00 ? 45  TYR A CE2  3  
ATOM 4147  C CZ   . TYR A 1 45  ? 4.004   2.312   -7.720  1.00 0.00 ? 45  TYR A CZ   3  
ATOM 4148  O OH   . TYR A 1 45  ? 3.752   1.257   -8.541  1.00 0.00 ? 45  TYR A OH   3  
ATOM 4149  H H    . TYR A 1 45  ? 3.683   7.636   -6.529  1.00 0.00 ? 45  TYR A H    3  
ATOM 4150  H HA   . TYR A 1 45  ? 2.761   5.929   -4.318  1.00 0.00 ? 45  TYR A HA   3  
ATOM 4151  H HB2  . TYR A 1 45  ? 5.548   6.295   -5.587  1.00 0.00 ? 45  TYR A HB2  3  
ATOM 4152  H HB3  . TYR A 1 45  ? 5.233   5.284   -4.191  1.00 0.00 ? 45  TYR A HB3  3  
ATOM 4153  H HD1  . TYR A 1 45  ? 4.824   5.603   -7.836  1.00 0.00 ? 45  TYR A HD1  3  
ATOM 4154  H HD2  . TYR A 1 45  ? 4.156   3.108   -4.425  1.00 0.00 ? 45  TYR A HD2  3  
ATOM 4155  H HE1  . TYR A 1 45  ? 4.354   3.626   -9.364  1.00 0.00 ? 45  TYR A HE1  3  
ATOM 4156  H HE2  . TYR A 1 45  ? 3.688   1.140   -5.965  1.00 0.00 ? 45  TYR A HE2  3  
ATOM 4157  H HH   . TYR A 1 45  ? 2.784   1.011   -8.494  1.00 0.00 ? 45  TYR A HH   3  
ATOM 4158  N N    . VAL A 1 46  ? 3.620   7.498   -2.599  1.00 0.00 ? 46  VAL A N    3  
ATOM 4159  C CA   . VAL A 1 46  ? 3.944   8.512   -1.610  1.00 0.00 ? 46  VAL A CA   3  
ATOM 4160  C C    . VAL A 1 46  ? 5.463   8.588   -1.443  1.00 0.00 ? 46  VAL A C    3  
ATOM 4161  O O    . VAL A 1 46  ? 6.118   7.572   -1.215  1.00 0.00 ? 46  VAL A O    3  
ATOM 4162  C CB   . VAL A 1 46  ? 3.212   8.217   -0.299  1.00 0.00 ? 46  VAL A CB   3  
ATOM 4163  C CG1  . VAL A 1 46  ? 3.760   9.078   0.841   1.00 0.00 ? 46  VAL A CG1  3  
ATOM 4164  C CG2  . VAL A 1 46  ? 1.703   8.412   -0.458  1.00 0.00 ? 46  VAL A CG2  3  
ATOM 4165  H H    . VAL A 1 46  ? 3.121   6.707   -2.246  1.00 0.00 ? 46  VAL A H    3  
ATOM 4166  H HA   . VAL A 1 46  ? 3.584   9.468   -1.989  1.00 0.00 ? 46  VAL A HA   3  
ATOM 4167  H HB   . VAL A 1 46  ? 3.390   7.172   -0.044  1.00 0.00 ? 46  VAL A HB   3  
ATOM 4168  H HG11 . VAL A 1 46  ? 3.475   10.118  0.679   1.00 0.00 ? 46  VAL A HG11 3  
ATOM 4169  H HG12 . VAL A 1 46  ? 3.348   8.731   1.788   1.00 0.00 ? 46  VAL A HG12 3  
ATOM 4170  H HG13 . VAL A 1 46  ? 4.847   8.999   0.865   1.00 0.00 ? 46  VAL A HG13 3  
ATOM 4171  H HG21 . VAL A 1 46  ? 1.272   8.707   0.499   1.00 0.00 ? 46  VAL A HG21 3  
ATOM 4172  H HG22 . VAL A 1 46  ? 1.513   9.190   -1.197  1.00 0.00 ? 46  VAL A HG22 3  
ATOM 4173  H HG23 . VAL A 1 46  ? 1.248   7.478   -0.788  1.00 0.00 ? 46  VAL A HG23 3  
ATOM 4174  N N    . SER A 1 47  ? 5.979   9.802   -1.562  1.00 0.00 ? 47  SER A N    3  
ATOM 4175  C CA   . SER A 1 47  ? 7.409   10.024  -1.427  1.00 0.00 ? 47  SER A CA   3  
ATOM 4176  C C    . SER A 1 47  ? 7.727   10.546  -0.024  1.00 0.00 ? 47  SER A C    3  
ATOM 4177  O O    . SER A 1 47  ? 8.847   10.390  0.461   1.00 0.00 ? 47  SER A O    3  
ATOM 4178  C CB   . SER A 1 47  ? 7.917   11.005  -2.486  1.00 0.00 ? 47  SER A CB   3  
ATOM 4179  O OG   . SER A 1 47  ? 8.775   11.996  -1.928  1.00 0.00 ? 47  SER A OG   3  
ATOM 4180  H H    . SER A 1 47  ? 5.440   10.624  -1.747  1.00 0.00 ? 47  SER A H    3  
ATOM 4181  H HA   . SER A 1 47  ? 7.869   9.049   -1.586  1.00 0.00 ? 47  SER A HA   3  
ATOM 4182  H HB2  . SER A 1 47  ? 8.452   10.457  -3.261  1.00 0.00 ? 47  SER A HB2  3  
ATOM 4183  H HB3  . SER A 1 47  ? 7.068   11.491  -2.967  1.00 0.00 ? 47  SER A HB3  3  
ATOM 4184  H HG   . SER A 1 47  ? 9.633   11.577  -1.630  1.00 0.00 ? 47  SER A HG   3  
ATOM 4185  N N    . LYS A 1 48  ? 6.722   11.155  0.588   1.00 0.00 ? 48  LYS A N    3  
ATOM 4186  C CA   . LYS A 1 48  ? 6.881   11.700  1.925   1.00 0.00 ? 48  LYS A CA   3  
ATOM 4187  C C    . LYS A 1 48  ? 5.553   12.304  2.387   1.00 0.00 ? 48  LYS A C    3  
ATOM 4188  O O    . LYS A 1 48  ? 4.629   12.462  1.590   1.00 0.00 ? 48  LYS A O    3  
ATOM 4189  C CB   . LYS A 1 48  ? 8.051   12.685  1.967   1.00 0.00 ? 48  LYS A CB   3  
ATOM 4190  C CG   . LYS A 1 48  ? 8.773   12.623  3.315   1.00 0.00 ? 48  LYS A CG   3  
ATOM 4191  C CD   . LYS A 1 48  ? 10.241  12.232  3.133   1.00 0.00 ? 48  LYS A CD   3  
ATOM 4192  C CE   . LYS A 1 48  ? 10.639  11.127  4.114   1.00 0.00 ? 48  LYS A CE   3  
ATOM 4193  N NZ   . LYS A 1 48  ? 12.110  11.079  4.271   1.00 0.00 ? 48  LYS A NZ   3  
ATOM 4194  H H    . LYS A 1 48  ? 5.815   11.278  0.187   1.00 0.00 ? 48  LYS A H    3  
ATOM 4195  H HA   . LYS A 1 48  ? 7.133   10.873  2.588   1.00 0.00 ? 48  LYS A HA   3  
ATOM 4196  H HB2  . LYS A 1 48  ? 8.752   12.458  1.164   1.00 0.00 ? 48  LYS A HB2  3  
ATOM 4197  H HB3  . LYS A 1 48  ? 7.685   13.697  1.792   1.00 0.00 ? 48  LYS A HB3  3  
ATOM 4198  H HG2  . LYS A 1 48  ? 8.709   13.592  3.810   1.00 0.00 ? 48  LYS A HG2  3  
ATOM 4199  H HG3  . LYS A 1 48  ? 8.278   11.901  3.963   1.00 0.00 ? 48  LYS A HG3  3  
ATOM 4200  H HD2  . LYS A 1 48  ? 10.406  11.893  2.110   1.00 0.00 ? 48  LYS A HD2  3  
ATOM 4201  H HD3  . LYS A 1 48  ? 10.875  13.105  3.286   1.00 0.00 ? 48  LYS A HD3  3  
ATOM 4202  H HE2  . LYS A 1 48  ? 10.170  11.305  5.081   1.00 0.00 ? 48  LYS A HE2  3  
ATOM 4203  H HE3  . LYS A 1 48  ? 10.274  10.165  3.754   1.00 0.00 ? 48  LYS A HE3  3  
ATOM 4204  H HZ1  . LYS A 1 48  ? 12.390  11.717  4.988   1.00 0.00 ? 48  LYS A HZ1  3  
ATOM 4205  H HZ2  . LYS A 1 48  ? 12.388  10.152  4.522   1.00 0.00 ? 48  LYS A HZ2  3  
ATOM 4206  H HZ3  . LYS A 1 48  ? 12.546  11.336  3.408   1.00 0.00 ? 48  LYS A HZ3  3  
ATOM 4207  N N    . VAL A 1 49  ? 5.499   12.623  3.671   1.00 0.00 ? 49  VAL A N    3  
ATOM 4208  C CA   . VAL A 1 49  ? 4.299   13.206  4.248   1.00 0.00 ? 49  VAL A CA   3  
ATOM 4209  C C    . VAL A 1 49  ? 4.695   14.236  5.307   1.00 0.00 ? 49  VAL A C    3  
ATOM 4210  O O    . VAL A 1 49  ? 5.444   13.924  6.232   1.00 0.00 ? 49  VAL A O    3  
ATOM 4211  C CB   . VAL A 1 49  ? 3.394   12.101  4.798   1.00 0.00 ? 49  VAL A CB   3  
ATOM 4212  C CG1  . VAL A 1 49  ? 4.211   11.037  5.533   1.00 0.00 ? 49  VAL A CG1  3  
ATOM 4213  C CG2  . VAL A 1 49  ? 2.308   12.683  5.706   1.00 0.00 ? 49  VAL A CG2  3  
ATOM 4214  H H    . VAL A 1 49  ? 6.254   12.491  4.313   1.00 0.00 ? 49  VAL A H    3  
ATOM 4215  H HA   . VAL A 1 49  ? 3.762   13.714  3.447   1.00 0.00 ? 49  VAL A HA   3  
ATOM 4216  H HB   . VAL A 1 49  ? 2.901   11.620  3.953   1.00 0.00 ? 49  VAL A HB   3  
ATOM 4217  H HG11 . VAL A 1 49  ? 5.159   11.467  5.856   1.00 0.00 ? 49  VAL A HG11 3  
ATOM 4218  H HG12 . VAL A 1 49  ? 3.655   10.688  6.403   1.00 0.00 ? 49  VAL A HG12 3  
ATOM 4219  H HG13 . VAL A 1 49  ? 4.402   10.199  4.863   1.00 0.00 ? 49  VAL A HG13 3  
ATOM 4220  H HG21 . VAL A 1 49  ? 1.500   11.960  5.815   1.00 0.00 ? 49  VAL A HG21 3  
ATOM 4221  H HG22 . VAL A 1 49  ? 2.734   12.904  6.685   1.00 0.00 ? 49  VAL A HG22 3  
ATOM 4222  H HG23 . VAL A 1 49  ? 1.918   13.600  5.264   1.00 0.00 ? 49  VAL A HG23 3  
ATOM 4223  N N    . THR A 1 50  ? 4.176   15.443  5.137   1.00 0.00 ? 50  THR A N    3  
ATOM 4224  C CA   . THR A 1 50  ? 4.466   16.521  6.066   1.00 0.00 ? 50  THR A CA   3  
ATOM 4225  C C    . THR A 1 50  ? 3.926   16.185  7.458   1.00 0.00 ? 50  THR A C    3  
ATOM 4226  O O    . THR A 1 50  ? 2.742   15.890  7.613   1.00 0.00 ? 50  THR A O    3  
ATOM 4227  C CB   . THR A 1 50  ? 3.889   17.814  5.486   1.00 0.00 ? 50  THR A CB   3  
ATOM 4228  O OG1  . THR A 1 50  ? 4.652   18.034  4.303   1.00 0.00 ? 50  THR A OG1  3  
ATOM 4229  C CG2  . THR A 1 50  ? 4.193   19.034  6.358   1.00 0.00 ? 50  THR A CG2  3  
ATOM 4230  H H    . THR A 1 50  ? 3.567   15.688  4.382   1.00 0.00 ? 50  THR A H    3  
ATOM 4231  H HA   . THR A 1 50  ? 5.548   16.614  6.157   1.00 0.00 ? 50  THR A HA   3  
ATOM 4232  H HB   . THR A 1 50  ? 2.818   17.717  5.311   1.00 0.00 ? 50  THR A HB   3  
ATOM 4233  H HG1  . THR A 1 50  ? 4.139   17.726  3.502   1.00 0.00 ? 50  THR A HG1  3  
ATOM 4234  H HG21 . THR A 1 50  ? 4.535   18.703  7.339   1.00 0.00 ? 50  THR A HG21 3  
ATOM 4235  H HG22 . THR A 1 50  ? 4.971   19.633  5.886   1.00 0.00 ? 50  THR A HG22 3  
ATOM 4236  H HG23 . THR A 1 50  ? 3.290   19.634  6.471   1.00 0.00 ? 50  THR A HG23 3  
ATOM 4237  N N    . VAL A 1 51  ? 4.820   16.241  8.434   1.00 0.00 ? 51  VAL A N    3  
ATOM 4238  C CA   . VAL A 1 51  ? 4.448   15.947  9.807   1.00 0.00 ? 51  VAL A CA   3  
ATOM 4239  C C    . VAL A 1 51  ? 3.667   17.130  10.385  1.00 0.00 ? 51  VAL A C    3  
ATOM 4240  O O    . VAL A 1 51  ? 4.146   18.263  10.365  1.00 0.00 ? 51  VAL A O    3  
ATOM 4241  C CB   . VAL A 1 51  ? 5.694   15.597  10.624  1.00 0.00 ? 51  VAL A CB   3  
ATOM 4242  C CG1  . VAL A 1 51  ? 5.373   15.547  12.119  1.00 0.00 ? 51  VAL A CG1  3  
ATOM 4243  C CG2  . VAL A 1 51  ? 6.307   14.279  10.150  1.00 0.00 ? 51  VAL A CG2  3  
ATOM 4244  H H    . VAL A 1 51  ? 5.781   16.482  8.299   1.00 0.00 ? 51  VAL A H    3  
ATOM 4245  H HA   . VAL A 1 51  ? 3.798   15.072  9.792   1.00 0.00 ? 51  VAL A HA   3  
ATOM 4246  H HB   . VAL A 1 51  ? 6.430   16.385  10.465  1.00 0.00 ? 51  VAL A HB   3  
ATOM 4247  H HG11 . VAL A 1 51  ? 5.555   14.540  12.496  1.00 0.00 ? 51  VAL A HG11 3  
ATOM 4248  H HG12 . VAL A 1 51  ? 6.009   16.254  12.651  1.00 0.00 ? 51  VAL A HG12 3  
ATOM 4249  H HG13 . VAL A 1 51  ? 4.327   15.810  12.275  1.00 0.00 ? 51  VAL A HG13 3  
ATOM 4250  H HG21 . VAL A 1 51  ? 5.528   13.650  9.719   1.00 0.00 ? 51  VAL A HG21 3  
ATOM 4251  H HG22 . VAL A 1 51  ? 7.068   14.482  9.396   1.00 0.00 ? 51  VAL A HG22 3  
ATOM 4252  H HG23 . VAL A 1 51  ? 6.763   13.765  10.996  1.00 0.00 ? 51  VAL A HG23 3  
ATOM 4253  N N    . GLY A 1 52  ? 2.479   16.826  10.885  1.00 0.00 ? 52  GLY A N    3  
ATOM 4254  C CA   . GLY A 1 52  ? 1.628   17.850  11.467  1.00 0.00 ? 52  GLY A CA   3  
ATOM 4255  C C    . GLY A 1 52  ? 0.628   18.382  10.437  1.00 0.00 ? 52  GLY A C    3  
ATOM 4256  O O    . GLY A 1 52  ? -0.239  19.189  10.768  1.00 0.00 ? 52  GLY A O    3  
ATOM 4257  H H    . GLY A 1 52  ? 2.097   15.902  10.897  1.00 0.00 ? 52  GLY A H    3  
ATOM 4258  H HA2  . GLY A 1 52  ? 1.091   17.439  12.322  1.00 0.00 ? 52  GLY A HA2  3  
ATOM 4259  H HA3  . GLY A 1 52  ? 2.242   18.669  11.840  1.00 0.00 ? 52  GLY A HA3  3  
ATOM 4260  N N    . SER A 1 53  ? 0.782   17.907  9.210   1.00 0.00 ? 53  SER A N    3  
ATOM 4261  C CA   . SER A 1 53  ? -0.096  18.324  8.130   1.00 0.00 ? 53  SER A CA   3  
ATOM 4262  C C    . SER A 1 53  ? -1.344  17.439  8.099   1.00 0.00 ? 53  SER A C    3  
ATOM 4263  O O    . SER A 1 53  ? -1.365  16.368  8.703   1.00 0.00 ? 53  SER A O    3  
ATOM 4264  C CB   . SER A 1 53  ? 0.625   18.273  6.782   1.00 0.00 ? 53  SER A CB   3  
ATOM 4265  O OG   . SER A 1 53  ? 0.570   19.522  6.099   1.00 0.00 ? 53  SER A OG   3  
ATOM 4266  H H    . SER A 1 53  ? 1.489   17.250  8.949   1.00 0.00 ? 53  SER A H    3  
ATOM 4267  H HA   . SER A 1 53  ? -0.365  19.356  8.359   1.00 0.00 ? 53  SER A HA   3  
ATOM 4268  H HB2  . SER A 1 53  ? 1.667   17.991  6.939   1.00 0.00 ? 53  SER A HB2  3  
ATOM 4269  H HB3  . SER A 1 53  ? 0.176   17.499  6.160   1.00 0.00 ? 53  SER A HB3  3  
ATOM 4270  H HG   . SER A 1 53  ? -0.029  19.450  5.302   1.00 0.00 ? 53  SER A HG   3  
ATOM 4271  N N    . ILE A 1 54  ? -2.353  17.920  7.388   1.00 0.00 ? 54  ILE A N    3  
ATOM 4272  C CA   . ILE A 1 54  ? -3.602  17.185  7.269   1.00 0.00 ? 54  ILE A CA   3  
ATOM 4273  C C    . ILE A 1 54  ? -3.300  15.690  7.158   1.00 0.00 ? 54  ILE A C    3  
ATOM 4274  O O    . ILE A 1 54  ? -3.680  14.909  8.029   1.00 0.00 ? 54  ILE A O    3  
ATOM 4275  C CB   . ILE A 1 54  ? -4.437  17.732  6.110   1.00 0.00 ? 54  ILE A CB   3  
ATOM 4276  C CG1  . ILE A 1 54  ? -4.830  19.190  6.357   1.00 0.00 ? 54  ILE A CG1  3  
ATOM 4277  C CG2  . ILE A 1 54  ? -5.657  16.847  5.848   1.00 0.00 ? 54  ILE A CG2  3  
ATOM 4278  C CD1  . ILE A 1 54  ? -5.738  19.313  7.583   1.00 0.00 ? 54  ILE A CD1  3  
ATOM 4279  H H    . ILE A 1 54  ? -2.328  18.792  6.899   1.00 0.00 ? 54  ILE A H    3  
ATOM 4280  H HA   . ILE A 1 54  ? -4.169  17.356  8.184   1.00 0.00 ? 54  ILE A HA   3  
ATOM 4281  H HB   . ILE A 1 54  ? -3.825  17.712  5.209   1.00 0.00 ? 54  ILE A HB   3  
ATOM 4282  H HG12 . ILE A 1 54  ? -3.933  19.792  6.503   1.00 0.00 ? 54  ILE A HG12 3  
ATOM 4283  H HG13 . ILE A 1 54  ? -5.341  19.587  5.480   1.00 0.00 ? 54  ILE A HG13 3  
ATOM 4284  H HG21 . ILE A 1 54  ? -5.590  16.424  4.845   1.00 0.00 ? 54  ILE A HG21 3  
ATOM 4285  H HG22 . ILE A 1 54  ? -5.685  16.040  6.580   1.00 0.00 ? 54  ILE A HG22 3  
ATOM 4286  H HG23 . ILE A 1 54  ? -6.564  17.444  5.930   1.00 0.00 ? 54  ILE A HG23 3  
ATOM 4287  H HD11 . ILE A 1 54  ? -5.126  19.404  8.480   1.00 0.00 ? 54  ILE A HD11 3  
ATOM 4288  H HD12 . ILE A 1 54  ? -6.367  20.197  7.481   1.00 0.00 ? 54  ILE A HD12 3  
ATOM 4289  H HD13 . ILE A 1 54  ? -6.367  18.426  7.659   1.00 0.00 ? 54  ILE A HD13 3  
ATOM 4290  N N    . ALA A 1 55  ? -2.619  15.335  6.078   1.00 0.00 ? 55  ALA A N    3  
ATOM 4291  C CA   . ALA A 1 55  ? -2.261  13.946  5.841   1.00 0.00 ? 55  ALA A CA   3  
ATOM 4292  C C    . ALA A 1 55  ? -1.855  13.296  7.165   1.00 0.00 ? 55  ALA A C    3  
ATOM 4293  O O    . ALA A 1 55  ? -2.535  12.394  7.652   1.00 0.00 ? 55  ALA A O    3  
ATOM 4294  C CB   . ALA A 1 55  ? -1.150  13.877  4.792   1.00 0.00 ? 55  ALA A CB   3  
ATOM 4295  H H    . ALA A 1 55  ? -2.313  15.976  5.374   1.00 0.00 ? 55  ALA A H    3  
ATOM 4296  H HA   . ALA A 1 55  ? -3.144  13.438  5.452   1.00 0.00 ? 55  ALA A HA   3  
ATOM 4297  H HB1  . ALA A 1 55  ? -0.190  13.737  5.288   1.00 0.00 ? 55  ALA A HB1  3  
ATOM 4298  H HB2  . ALA A 1 55  ? -1.337  13.040  4.120   1.00 0.00 ? 55  ALA A HB2  3  
ATOM 4299  H HB3  . ALA A 1 55  ? -1.132  14.805  4.220   1.00 0.00 ? 55  ALA A HB3  3  
ATOM 4300  N N    . HIS A 1 56  ? -0.748  13.779  7.709   1.00 0.00 ? 56  HIS A N    3  
ATOM 4301  C CA   . HIS A 1 56  ? -0.242  13.256  8.967   1.00 0.00 ? 56  HIS A CA   3  
ATOM 4302  C C    . HIS A 1 56  ? -1.414  12.936  9.898   1.00 0.00 ? 56  HIS A C    3  
ATOM 4303  O O    . HIS A 1 56  ? -1.511  11.827  10.421  1.00 0.00 ? 56  HIS A O    3  
ATOM 4304  C CB   . HIS A 1 56  ? 0.764   14.223  9.593   1.00 0.00 ? 56  HIS A CB   3  
ATOM 4305  C CG   . HIS A 1 56  ? 1.802   13.553  10.461  1.00 0.00 ? 56  HIS A CG   3  
ATOM 4306  N ND1  . HIS A 1 56  ? 1.835   13.696  11.837  1.00 0.00 ? 56  HIS A ND1  3  
ATOM 4307  C CD2  . HIS A 1 56  ? 2.843   12.734  10.134  1.00 0.00 ? 56  HIS A CD2  3  
ATOM 4308  C CE1  . HIS A 1 56  ? 2.854   12.992  12.307  1.00 0.00 ? 56  HIS A CE1  3  
ATOM 4309  N NE2  . HIS A 1 56  ? 3.478   12.397  11.250  1.00 0.00 ? 56  HIS A NE2  3  
ATOM 4310  H H    . HIS A 1 56  ? -0.200  14.512  7.306   1.00 0.00 ? 56  HIS A H    3  
ATOM 4311  H HA   . HIS A 1 56  ? 0.286   12.332  8.732   1.00 0.00 ? 56  HIS A HA   3  
ATOM 4312  H HB2  . HIS A 1 56  ? 1.270   14.770  8.797   1.00 0.00 ? 56  HIS A HB2  3  
ATOM 4313  H HB3  . HIS A 1 56  ? 0.224   14.957  10.191  1.00 0.00 ? 56  HIS A HB3  3  
ATOM 4314  H HD1  . HIS A 1 56  ? 1.197   14.239  12.384  1.00 0.00 ? 56  HIS A HD1  3  
ATOM 4315  H HD2  . HIS A 1 56  ? 3.109   12.412  9.127   1.00 0.00 ? 56  HIS A HD2  3  
ATOM 4316  H HE1  . HIS A 1 56  ? 3.143   12.903  13.354  1.00 0.00 ? 56  HIS A HE1  3  
ATOM 4317  N N    . GLN A 1 57  ? -2.275  13.927  10.075  1.00 0.00 ? 57  GLN A N    3  
ATOM 4318  C CA   . GLN A 1 57  ? -3.436  13.766  10.933  1.00 0.00 ? 57  GLN A CA   3  
ATOM 4319  C C    . GLN A 1 57  ? -4.259  12.555  10.490  1.00 0.00 ? 57  GLN A C    3  
ATOM 4320  O O    . GLN A 1 57  ? -4.653  11.731  11.314  1.00 0.00 ? 57  GLN A O    3  
ATOM 4321  C CB   . GLN A 1 57  ? -4.290  15.035  10.945  1.00 0.00 ? 57  GLN A CB   3  
ATOM 4322  C CG   . GLN A 1 57  ? -3.419  16.281  11.117  1.00 0.00 ? 57  GLN A CG   3  
ATOM 4323  C CD   . GLN A 1 57  ? -4.238  17.450  11.668  1.00 0.00 ? 57  GLN A CD   3  
ATOM 4324  O OE1  . GLN A 1 57  ? -5.324  17.755  11.202  1.00 0.00 ? 57  GLN A OE1  3  
ATOM 4325  N NE2  . GLN A 1 57  ? -3.659  18.086  12.682  1.00 0.00 ? 57  GLN A NE2  3  
ATOM 4326  H H    . GLN A 1 57  ? -2.189  14.826  9.646   1.00 0.00 ? 57  GLN A H    3  
ATOM 4327  H HA   . GLN A 1 57  ? -3.036  13.595  11.933  1.00 0.00 ? 57  GLN A HA   3  
ATOM 4328  H HB2  . GLN A 1 57  ? -4.854  15.107  10.014  1.00 0.00 ? 57  GLN A HB2  3  
ATOM 4329  H HB3  . GLN A 1 57  ? -5.018  14.980  11.754  1.00 0.00 ? 57  GLN A HB3  3  
ATOM 4330  H HG2  . GLN A 1 57  ? -2.593  16.060  11.794  1.00 0.00 ? 57  GLN A HG2  3  
ATOM 4331  H HG3  . GLN A 1 57  ? -2.981  16.558  10.159  1.00 0.00 ? 57  GLN A HG3  3  
ATOM 4332  H HE21 . GLN A 1 57  ? -2.765  17.785  13.016  1.00 0.00 ? 57  GLN A HE21 3  
ATOM 4333  H HE22 . GLN A 1 57  ? -4.116  18.866  13.110  1.00 0.00 ? 57  GLN A HE22 3  
ATOM 4334  N N    . ALA A 1 58  ? -4.495  12.484  9.188   1.00 0.00 ? 58  ALA A N    3  
ATOM 4335  C CA   . ALA A 1 58  ? -5.265  11.388  8.625   1.00 0.00 ? 58  ALA A CA   3  
ATOM 4336  C C    . ALA A 1 58  ? -4.568  10.064  8.946   1.00 0.00 ? 58  ALA A C    3  
ATOM 4337  O O    . ALA A 1 58  ? -5.219  9.091   9.322   1.00 0.00 ? 58  ALA A O    3  
ATOM 4338  C CB   . ALA A 1 58  ? -5.438  11.605  7.120   1.00 0.00 ? 58  ALA A CB   3  
ATOM 4339  H H    . ALA A 1 58  ? -4.172  13.158  8.524   1.00 0.00 ? 58  ALA A H    3  
ATOM 4340  H HA   . ALA A 1 58  ? -6.247  11.395  9.096   1.00 0.00 ? 58  ALA A HA   3  
ATOM 4341  H HB1  . ALA A 1 58  ? -5.103  12.609  6.857   1.00 0.00 ? 58  ALA A HB1  3  
ATOM 4342  H HB2  . ALA A 1 58  ? -4.846  10.870  6.576   1.00 0.00 ? 58  ALA A HB2  3  
ATOM 4343  H HB3  . ALA A 1 58  ? -6.490  11.493  6.856   1.00 0.00 ? 58  ALA A HB3  3  
ATOM 4344  N N    . GLY A 1 59  ? -3.252  10.070  8.785   1.00 0.00 ? 59  GLY A N    3  
ATOM 4345  C CA   . GLY A 1 59  ? -2.460  8.882   9.052   1.00 0.00 ? 59  GLY A CA   3  
ATOM 4346  C C    . GLY A 1 59  ? -1.908  8.287   7.755   1.00 0.00 ? 59  GLY A C    3  
ATOM 4347  O O    . GLY A 1 59  ? -2.037  7.088   7.514   1.00 0.00 ? 59  GLY A O    3  
ATOM 4348  H H    . GLY A 1 59  ? -2.730  10.866  8.478   1.00 0.00 ? 59  GLY A H    3  
ATOM 4349  H HA2  . GLY A 1 59  ? -1.637  9.133   9.721   1.00 0.00 ? 59  GLY A HA2  3  
ATOM 4350  H HA3  . GLY A 1 59  ? -3.072  8.140   9.565   1.00 0.00 ? 59  GLY A HA3  3  
ATOM 4351  N N    . LEU A 1 60  ? -1.306  9.153   6.954   1.00 0.00 ? 60  LEU A N    3  
ATOM 4352  C CA   . LEU A 1 60  ? -0.734  8.728   5.687   1.00 0.00 ? 60  LEU A CA   3  
ATOM 4353  C C    . LEU A 1 60  ? 0.735   8.355   5.896   1.00 0.00 ? 60  LEU A C    3  
ATOM 4354  O O    . LEU A 1 60  ? 1.389   8.874   6.799   1.00 0.00 ? 60  LEU A O    3  
ATOM 4355  C CB   . LEU A 1 60  ? -0.950  9.799   4.616   1.00 0.00 ? 60  LEU A CB   3  
ATOM 4356  C CG   . LEU A 1 60  ? -2.306  9.775   3.908   1.00 0.00 ? 60  LEU A CG   3  
ATOM 4357  C CD1  . LEU A 1 60  ? -2.511  11.039  3.072   1.00 0.00 ? 60  LEU A CD1  3  
ATOM 4358  C CD2  . LEU A 1 60  ? -2.466  8.503   3.072   1.00 0.00 ? 60  LEU A CD2  3  
ATOM 4359  H H    . LEU A 1 60  ? -1.205  10.127  7.157   1.00 0.00 ? 60  LEU A H    3  
ATOM 4360  H HA   . LEU A 1 60  ? -1.275  7.838   5.367   1.00 0.00 ? 60  LEU A HA   3  
ATOM 4361  H HB2  . LEU A 1 60  ? -0.821  10.778  5.077   1.00 0.00 ? 60  LEU A HB2  3  
ATOM 4362  H HB3  . LEU A 1 60  ? -0.168  9.695   3.864   1.00 0.00 ? 60  LEU A HB3  3  
ATOM 4363  H HG   . LEU A 1 60  ? -3.088  9.761   4.667   1.00 0.00 ? 60  LEU A HG   3  
ATOM 4364  H HD11 . LEU A 1 60  ? -1.543  11.422  2.749   1.00 0.00 ? 60  LEU A HD11 3  
ATOM 4365  H HD12 . LEU A 1 60  ? -3.118  10.803  2.198   1.00 0.00 ? 60  LEU A HD12 3  
ATOM 4366  H HD13 . LEU A 1 60  ? -3.017  11.794  3.673   1.00 0.00 ? 60  LEU A HD13 3  
ATOM 4367  H HD21 . LEU A 1 60  ? -1.567  7.893   3.163   1.00 0.00 ? 60  LEU A HD21 3  
ATOM 4368  H HD22 . LEU A 1 60  ? -3.326  7.938   3.431   1.00 0.00 ? 60  LEU A HD22 3  
ATOM 4369  H HD23 . LEU A 1 60  ? -2.618  8.772   2.027   1.00 0.00 ? 60  LEU A HD23 3  
ATOM 4370  N N    . GLU A 1 61  ? 1.211   7.457   5.045   1.00 0.00 ? 61  GLU A N    3  
ATOM 4371  C CA   . GLU A 1 61  ? 2.590   7.008   5.125   1.00 0.00 ? 61  GLU A CA   3  
ATOM 4372  C C    . GLU A 1 61  ? 3.169   6.819   3.721   1.00 0.00 ? 61  GLU A C    3  
ATOM 4373  O O    . GLU A 1 61  ? 2.443   6.900   2.731   1.00 0.00 ? 61  GLU A O    3  
ATOM 4374  C CB   . GLU A 1 61  ? 2.701   5.719   5.942   1.00 0.00 ? 61  GLU A CB   3  
ATOM 4375  C CG   . GLU A 1 61  ? 1.984   4.563   5.242   1.00 0.00 ? 61  GLU A CG   3  
ATOM 4376  C CD   . GLU A 1 61  ? 1.565   3.488   6.247   1.00 0.00 ? 61  GLU A CD   3  
ATOM 4377  O OE1  . GLU A 1 61  ? 0.667   3.793   7.062   1.00 0.00 ? 61  GLU A OE1  3  
ATOM 4378  O OE2  . GLU A 1 61  ? 2.152   2.387   6.179   1.00 0.00 ? 61  GLU A OE2  3  
ATOM 4379  H H    . GLU A 1 61  ? 0.672   7.039   4.314   1.00 0.00 ? 61  GLU A H    3  
ATOM 4380  H HA   . GLU A 1 61  ? 3.125   7.805   5.641   1.00 0.00 ? 61  GLU A HA   3  
ATOM 4381  H HB2  . GLU A 1 61  ? 3.751   5.466   6.088   1.00 0.00 ? 61  GLU A HB2  3  
ATOM 4382  H HB3  . GLU A 1 61  ? 2.270   5.873   6.931   1.00 0.00 ? 61  GLU A HB3  3  
ATOM 4383  H HG2  . GLU A 1 61  ? 1.105   4.939   4.718   1.00 0.00 ? 61  GLU A HG2  3  
ATOM 4384  H HG3  . GLU A 1 61  ? 2.641   4.125   4.490   1.00 0.00 ? 61  GLU A HG3  3  
ATOM 4385  N N    . TYR A 1 62  ? 4.470   6.571   3.680   1.00 0.00 ? 62  TYR A N    3  
ATOM 4386  C CA   . TYR A 1 62  ? 5.154   6.369   2.414   1.00 0.00 ? 62  TYR A CA   3  
ATOM 4387  C C    . TYR A 1 62  ? 5.012   4.922   1.938   1.00 0.00 ? 62  TYR A C    3  
ATOM 4388  O O    . TYR A 1 62  ? 4.836   4.013   2.748   1.00 0.00 ? 62  TYR A O    3  
ATOM 4389  C CB   . TYR A 1 62  ? 6.631   6.663   2.682   1.00 0.00 ? 62  TYR A CB   3  
ATOM 4390  C CG   . TYR A 1 62  ? 7.539   6.445   1.470   1.00 0.00 ? 62  TYR A CG   3  
ATOM 4391  C CD1  . TYR A 1 62  ? 7.756   5.169   0.992   1.00 0.00 ? 62  TYR A CD1  3  
ATOM 4392  C CD2  . TYR A 1 62  ? 8.140   7.524   0.855   1.00 0.00 ? 62  TYR A CD2  3  
ATOM 4393  C CE1  . TYR A 1 62  ? 8.610   4.963   -0.149  1.00 0.00 ? 62  TYR A CE1  3  
ATOM 4394  C CE2  . TYR A 1 62  ? 8.994   7.319   -0.287  1.00 0.00 ? 62  TYR A CE2  3  
ATOM 4395  C CZ   . TYR A 1 62  ? 9.187   6.048   -0.732  1.00 0.00 ? 62  TYR A CZ   3  
ATOM 4396  O OH   . TYR A 1 62  ? 9.994   5.854   -1.810  1.00 0.00 ? 62  TYR A OH   3  
ATOM 4397  H H    . TYR A 1 62  ? 5.052   6.507   4.490   1.00 0.00 ? 62  TYR A H    3  
ATOM 4398  H HA   . TYR A 1 62  ? 4.700   7.033   1.678   1.00 0.00 ? 62  TYR A HA   3  
ATOM 4399  H HB2  . TYR A 1 62  ? 6.731   7.695   3.017   1.00 0.00 ? 62  TYR A HB2  3  
ATOM 4400  H HB3  . TYR A 1 62  ? 6.975   6.028   3.499   1.00 0.00 ? 62  TYR A HB3  3  
ATOM 4401  H HD1  . TYR A 1 62  ? 7.282   4.316   1.478   1.00 0.00 ? 62  TYR A HD1  3  
ATOM 4402  H HD2  . TYR A 1 62  ? 7.968   8.532   1.232   1.00 0.00 ? 62  TYR A HD2  3  
ATOM 4403  H HE1  . TYR A 1 62  ? 8.791   3.961   -0.537  1.00 0.00 ? 62  TYR A HE1  3  
ATOM 4404  H HE2  . TYR A 1 62  ? 9.475   8.162   -0.782  1.00 0.00 ? 62  TYR A HE2  3  
ATOM 4405  H HH   . TYR A 1 62  ? 10.862  6.332   -1.677  1.00 0.00 ? 62  TYR A HH   3  
ATOM 4406  N N    . GLY A 1 63  ? 5.093   4.754   0.627   1.00 0.00 ? 63  GLY A N    3  
ATOM 4407  C CA   . GLY A 1 63  ? 4.975   3.433   0.033   1.00 0.00 ? 63  GLY A CA   3  
ATOM 4408  C C    . GLY A 1 63  ? 3.508   3.058   -0.184  1.00 0.00 ? 63  GLY A C    3  
ATOM 4409  O O    . GLY A 1 63  ? 3.208   2.090   -0.881  1.00 0.00 ? 63  GLY A O    3  
ATOM 4410  H H    . GLY A 1 63  ? 5.236   5.499   -0.025  1.00 0.00 ? 63  GLY A H    3  
ATOM 4411  H HA2  . GLY A 1 63  ? 5.505   3.410   -0.919  1.00 0.00 ? 63  GLY A HA2  3  
ATOM 4412  H HA3  . GLY A 1 63  ? 5.451   2.696   0.680   1.00 0.00 ? 63  GLY A HA3  3  
ATOM 4413  N N    . ASP A 1 64  ? 2.633   3.844   0.426   1.00 0.00 ? 64  ASP A N    3  
ATOM 4414  C CA   . ASP A 1 64  ? 1.204   3.607   0.308   1.00 0.00 ? 64  ASP A CA   3  
ATOM 4415  C C    . ASP A 1 64  ? 0.724   4.083   -1.064  1.00 0.00 ? 64  ASP A C    3  
ATOM 4416  O O    . ASP A 1 64  ? 0.295   5.226   -1.213  1.00 0.00 ? 64  ASP A O    3  
ATOM 4417  C CB   . ASP A 1 64  ? 0.428   4.380   1.375   1.00 0.00 ? 64  ASP A CB   3  
ATOM 4418  C CG   . ASP A 1 64  ? -0.168  3.520   2.492   1.00 0.00 ? 64  ASP A CG   3  
ATOM 4419  O OD1  . ASP A 1 64  ? 0.017   2.286   2.418   1.00 0.00 ? 64  ASP A OD1  3  
ATOM 4420  O OD2  . ASP A 1 64  ? -0.795  4.116   3.394   1.00 0.00 ? 64  ASP A OD2  3  
ATOM 4421  H H    . ASP A 1 64  ? 2.886   4.630   0.991   1.00 0.00 ? 64  ASP A H    3  
ATOM 4422  H HA   . ASP A 1 64  ? 1.081   2.532   0.443   1.00 0.00 ? 64  ASP A HA   3  
ATOM 4423  H HB2  . ASP A 1 64  ? 1.092   5.120   1.822   1.00 0.00 ? 64  ASP A HB2  3  
ATOM 4424  H HB3  . ASP A 1 64  ? -0.379  4.929   0.890   1.00 0.00 ? 64  ASP A HB3  3  
ATOM 4425  N N    . GLN A 1 65  ? 0.812   3.182   -2.032  1.00 0.00 ? 65  GLN A N    3  
ATOM 4426  C CA   . GLN A 1 65  ? 0.392   3.496   -3.387  1.00 0.00 ? 65  GLN A CA   3  
ATOM 4427  C C    . GLN A 1 65  ? -1.050  4.007   -3.391  1.00 0.00 ? 65  GLN A C    3  
ATOM 4428  O O    . GLN A 1 65  ? -1.966  3.292   -2.987  1.00 0.00 ? 65  GLN A O    3  
ATOM 4429  C CB   . GLN A 1 65  ? 0.546   2.281   -4.304  1.00 0.00 ? 65  GLN A CB   3  
ATOM 4430  C CG   . GLN A 1 65  ? 0.591   2.706   -5.774  1.00 0.00 ? 65  GLN A CG   3  
ATOM 4431  C CD   . GLN A 1 65  ? -0.110  1.676   -6.663  1.00 0.00 ? 65  GLN A CD   3  
ATOM 4432  O OE1  . GLN A 1 65  ? 0.152   0.486   -6.605  1.00 0.00 ? 65  GLN A OE1  3  
ATOM 4433  N NE2  . GLN A 1 65  ? -1.013  2.200   -7.488  1.00 0.00 ? 65  GLN A NE2  3  
ATOM 4434  H H    . GLN A 1 65  ? 1.163   2.255   -1.903  1.00 0.00 ? 65  GLN A H    3  
ATOM 4435  H HA   . GLN A 1 65  ? 1.065   4.285   -3.724  1.00 0.00 ? 65  GLN A HA   3  
ATOM 4436  H HB2  . GLN A 1 65  ? 1.458   1.742   -4.050  1.00 0.00 ? 65  GLN A HB2  3  
ATOM 4437  H HB3  . GLN A 1 65  ? -0.286  1.594   -4.146  1.00 0.00 ? 65  GLN A HB3  3  
ATOM 4438  H HG2  . GLN A 1 65  ? 0.112   3.678   -5.890  1.00 0.00 ? 65  GLN A HG2  3  
ATOM 4439  H HG3  . GLN A 1 65  ? 1.627   2.820   -6.091  1.00 0.00 ? 65  GLN A HG3  3  
ATOM 4440  H HE21 . GLN A 1 65  ? -1.180  3.186   -7.486  1.00 0.00 ? 65  GLN A HE21 3  
ATOM 4441  H HE22 . GLN A 1 65  ? -1.524  1.607   -8.110  1.00 0.00 ? 65  GLN A HE22 3  
ATOM 4442  N N    . LEU A 1 66  ? -1.207  5.240   -3.851  1.00 0.00 ? 66  LEU A N    3  
ATOM 4443  C CA   . LEU A 1 66  ? -2.522  5.854   -3.912  1.00 0.00 ? 66  LEU A CA   3  
ATOM 4444  C C    . LEU A 1 66  ? -3.288  5.291   -5.110  1.00 0.00 ? 66  LEU A C    3  
ATOM 4445  O O    . LEU A 1 66  ? -2.913  5.526   -6.258  1.00 0.00 ? 66  LEU A O    3  
ATOM 4446  C CB   . LEU A 1 66  ? -2.401  7.379   -3.922  1.00 0.00 ? 66  LEU A CB   3  
ATOM 4447  C CG   . LEU A 1 66  ? -1.396  7.979   -2.936  1.00 0.00 ? 66  LEU A CG   3  
ATOM 4448  C CD1  . LEU A 1 66  ? -1.100  9.441   -3.275  1.00 0.00 ? 66  LEU A CD1  3  
ATOM 4449  C CD2  . LEU A 1 66  ? -1.876  7.810   -1.493  1.00 0.00 ? 66  LEU A CD2  3  
ATOM 4450  H H    . LEU A 1 66  ? -0.456  5.814   -4.177  1.00 0.00 ? 66  LEU A H    3  
ATOM 4451  H HA   . LEU A 1 66  ? -3.054  5.579   -3.001  1.00 0.00 ? 66  LEU A HA   3  
ATOM 4452  H HB2  . LEU A 1 66  ? -2.125  7.696   -4.928  1.00 0.00 ? 66  LEU A HB2  3  
ATOM 4453  H HB3  . LEU A 1 66  ? -3.383  7.803   -3.712  1.00 0.00 ? 66  LEU A HB3  3  
ATOM 4454  H HG   . LEU A 1 66  ? -0.458  7.431   -3.029  1.00 0.00 ? 66  LEU A HG   3  
ATOM 4455  H HD11 . LEU A 1 66  ? -0.322  9.818   -2.612  1.00 0.00 ? 66  LEU A HD11 3  
ATOM 4456  H HD12 . LEU A 1 66  ? -0.764  9.514   -4.309  1.00 0.00 ? 66  LEU A HD12 3  
ATOM 4457  H HD13 . LEU A 1 66  ? -2.006  10.034  -3.145  1.00 0.00 ? 66  LEU A HD13 3  
ATOM 4458  H HD21 . LEU A 1 66  ? -1.195  7.149   -0.958  1.00 0.00 ? 66  LEU A HD21 3  
ATOM 4459  H HD22 . LEU A 1 66  ? -1.899  8.783   -1.002  1.00 0.00 ? 66  LEU A HD22 3  
ATOM 4460  H HD23 . LEU A 1 66  ? -2.877  7.379   -1.491  1.00 0.00 ? 66  LEU A HD23 3  
ATOM 4461  N N    . LEU A 1 67  ? -4.348  4.557   -4.803  1.00 0.00 ? 67  LEU A N    3  
ATOM 4462  C CA   . LEU A 1 67  ? -5.170  3.958   -5.840  1.00 0.00 ? 67  LEU A CA   3  
ATOM 4463  C C    . LEU A 1 67  ? -6.185  4.988   -6.339  1.00 0.00 ? 67  LEU A C    3  
ATOM 4464  O O    . LEU A 1 67  ? -6.276  5.245   -7.538  1.00 0.00 ? 67  LEU A O    3  
ATOM 4465  C CB   . LEU A 1 67  ? -5.806  2.661   -5.337  1.00 0.00 ? 67  LEU A CB   3  
ATOM 4466  C CG   . LEU A 1 67  ? -4.857  1.475   -5.155  1.00 0.00 ? 67  LEU A CG   3  
ATOM 4467  C CD1  . LEU A 1 67  ? -5.603  0.253   -4.614  1.00 0.00 ? 67  LEU A CD1  3  
ATOM 4468  C CD2  . LEU A 1 67  ? -4.114  1.162   -6.455  1.00 0.00 ? 67  LEU A CD2  3  
ATOM 4469  H H    . LEU A 1 67  ? -4.646  4.370   -3.867  1.00 0.00 ? 67  LEU A H    3  
ATOM 4470  H HA   . LEU A 1 67  ? -4.511  3.694   -6.668  1.00 0.00 ? 67  LEU A HA   3  
ATOM 4471  H HB2  . LEU A 1 67  ? -6.290  2.863   -4.382  1.00 0.00 ? 67  LEU A HB2  3  
ATOM 4472  H HB3  . LEU A 1 67  ? -6.590  2.369   -6.036  1.00 0.00 ? 67  LEU A HB3  3  
ATOM 4473  H HG   . LEU A 1 67  ? -4.107  1.748   -4.413  1.00 0.00 ? 67  LEU A HG   3  
ATOM 4474  H HD11 . LEU A 1 67  ? -4.885  -0.469  -4.227  1.00 0.00 ? 67  LEU A HD11 3  
ATOM 4475  H HD12 . LEU A 1 67  ? -6.274  0.563   -3.812  1.00 0.00 ? 67  LEU A HD12 3  
ATOM 4476  H HD13 . LEU A 1 67  ? -6.183  -0.203  -5.416  1.00 0.00 ? 67  LEU A HD13 3  
ATOM 4477  H HD21 . LEU A 1 67  ? -4.669  1.572   -7.299  1.00 0.00 ? 67  LEU A HD21 3  
ATOM 4478  H HD22 . LEU A 1 67  ? -3.121  1.609   -6.423  1.00 0.00 ? 67  LEU A HD22 3  
ATOM 4479  H HD23 . LEU A 1 67  ? -4.023  0.082   -6.571  1.00 0.00 ? 67  LEU A HD23 3  
ATOM 4480  N N    . GLU A 1 68  ? -6.923  5.550   -5.393  1.00 0.00 ? 68  GLU A N    3  
ATOM 4481  C CA   . GLU A 1 68  ? -7.928  6.547   -5.721  1.00 0.00 ? 68  GLU A CA   3  
ATOM 4482  C C    . GLU A 1 68  ? -7.983  7.623   -4.635  1.00 0.00 ? 68  GLU A C    3  
ATOM 4483  O O    . GLU A 1 68  ? -7.810  7.327   -3.453  1.00 0.00 ? 68  GLU A O    3  
ATOM 4484  C CB   . GLU A 1 68  ? -9.300  5.898   -5.919  1.00 0.00 ? 68  GLU A CB   3  
ATOM 4485  C CG   . GLU A 1 68  ? -9.278  4.919   -7.095  1.00 0.00 ? 68  GLU A CG   3  
ATOM 4486  C CD   . GLU A 1 68  ? -10.635 4.879   -7.800  1.00 0.00 ? 68  GLU A CD   3  
ATOM 4487  O OE1  . GLU A 1 68  ? -11.647 4.754   -7.076  1.00 0.00 ? 68  GLU A OE1  3  
ATOM 4488  O OE2  . GLU A 1 68  ? -10.631 4.974   -9.046  1.00 0.00 ? 68  GLU A OE2  3  
ATOM 4489  H H    . GLU A 1 68  ? -6.843  5.335   -4.419  1.00 0.00 ? 68  GLU A H    3  
ATOM 4490  H HA   . GLU A 1 68  ? -7.603  6.988   -6.663  1.00 0.00 ? 68  GLU A HA   3  
ATOM 4491  H HB2  . GLU A 1 68  ? -9.592  5.373   -5.010  1.00 0.00 ? 68  GLU A HB2  3  
ATOM 4492  H HB3  . GLU A 1 68  ? -10.049 6.669   -6.097  1.00 0.00 ? 68  GLU A HB3  3  
ATOM 4493  H HG2  . GLU A 1 68  ? -8.504  5.214   -7.804  1.00 0.00 ? 68  GLU A HG2  3  
ATOM 4494  H HG3  . GLU A 1 68  ? -9.020  3.922   -6.738  1.00 0.00 ? 68  GLU A HG3  3  
ATOM 4495  N N    . PHE A 1 69  ? -8.224  8.850   -5.073  1.00 0.00 ? 69  PHE A N    3  
ATOM 4496  C CA   . PHE A 1 69  ? -8.304  9.971   -4.153  1.00 0.00 ? 69  PHE A CA   3  
ATOM 4497  C C    . PHE A 1 69  ? -9.701  10.594  -4.168  1.00 0.00 ? 69  PHE A C    3  
ATOM 4498  O O    . PHE A 1 69  ? -9.978  11.489  -4.966  1.00 0.00 ? 69  PHE A O    3  
ATOM 4499  C CB   . PHE A 1 69  ? -7.289  11.013  -4.629  1.00 0.00 ? 69  PHE A CB   3  
ATOM 4500  C CG   . PHE A 1 69  ? -7.432  12.376  -3.949  1.00 0.00 ? 69  PHE A CG   3  
ATOM 4501  C CD1  . PHE A 1 69  ? -6.819  12.609  -2.757  1.00 0.00 ? 69  PHE A CD1  3  
ATOM 4502  C CD2  . PHE A 1 69  ? -8.171  13.355  -4.536  1.00 0.00 ? 69  PHE A CD2  3  
ATOM 4503  C CE1  . PHE A 1 69  ? -6.951  13.874  -2.126  1.00 0.00 ? 69  PHE A CE1  3  
ATOM 4504  C CE2  . PHE A 1 69  ? -8.303  14.620  -3.905  1.00 0.00 ? 69  PHE A CE2  3  
ATOM 4505  C CZ   . PHE A 1 69  ? -7.690  14.853  -2.713  1.00 0.00 ? 69  PHE A CZ   3  
ATOM 4506  H H    . PHE A 1 69  ? -8.364  9.082   -6.036  1.00 0.00 ? 69  PHE A H    3  
ATOM 4507  H HA   . PHE A 1 69  ? -8.090  9.587   -3.156  1.00 0.00 ? 69  PHE A HA   3  
ATOM 4508  H HB2  . PHE A 1 69  ? -6.283  10.633  -4.451  1.00 0.00 ? 69  PHE A HB2  3  
ATOM 4509  H HB3  . PHE A 1 69  ? -7.395  11.143  -5.706  1.00 0.00 ? 69  PHE A HB3  3  
ATOM 4510  H HD1  . PHE A 1 69  ? -6.227  11.824  -2.286  1.00 0.00 ? 69  PHE A HD1  3  
ATOM 4511  H HD2  . PHE A 1 69  ? -8.661  13.169  -5.491  1.00 0.00 ? 69  PHE A HD2  3  
ATOM 4512  H HE1  . PHE A 1 69  ? -6.460  14.060  -1.171  1.00 0.00 ? 69  PHE A HE1  3  
ATOM 4513  H HE2  . PHE A 1 69  ? -8.895  15.405  -4.375  1.00 0.00 ? 69  PHE A HE2  3  
ATOM 4514  H HZ   . PHE A 1 69  ? -7.792  15.824  -2.229  1.00 0.00 ? 69  PHE A HZ   3  
ATOM 4515  N N    . ASN A 1 70  ? -10.546 10.097  -3.277  1.00 0.00 ? 70  ASN A N    3  
ATOM 4516  C CA   . ASN A 1 70  ? -11.908 10.593  -3.177  1.00 0.00 ? 70  ASN A CA   3  
ATOM 4517  C C    . ASN A 1 70  ? -12.694 10.165  -4.418  1.00 0.00 ? 70  ASN A C    3  
ATOM 4518  O O    . ASN A 1 70  ? -13.822 10.609  -4.626  1.00 0.00 ? 70  ASN A O    3  
ATOM 4519  C CB   . ASN A 1 70  ? -11.933 12.121  -3.106  1.00 0.00 ? 70  ASN A CB   3  
ATOM 4520  C CG   . ASN A 1 70  ? -12.767 12.601  -1.916  1.00 0.00 ? 70  ASN A CG   3  
ATOM 4521  O OD1  . ASN A 1 70  ? -13.415 11.829  -1.228  1.00 0.00 ? 70  ASN A OD1  3  
ATOM 4522  N ND2  . ASN A 1 70  ? -12.714 13.914  -1.713  1.00 0.00 ? 70  ASN A ND2  3  
ATOM 4523  H H    . ASN A 1 70  ? -10.313 9.369   -2.631  1.00 0.00 ? 70  ASN A H    3  
ATOM 4524  H HA   . ASN A 1 70  ? -12.305 10.158  -2.261  1.00 0.00 ? 70  ASN A HA   3  
ATOM 4525  H HB2  . ASN A 1 70  ? -10.915 12.502  -3.018  1.00 0.00 ? 70  ASN A HB2  3  
ATOM 4526  H HB3  . ASN A 1 70  ? -12.346 12.526  -4.030  1.00 0.00 ? 70  ASN A HB3  3  
ATOM 4527  H HD21 . ASN A 1 70  ? -12.162 14.491  -2.314  1.00 0.00 ? 70  ASN A HD21 3  
ATOM 4528  H HD22 . ASN A 1 70  ? -13.226 14.324  -0.958  1.00 0.00 ? 70  ASN A HD22 3  
ATOM 4529  N N    . GLY A 1 71  ? -12.067 9.307   -5.210  1.00 0.00 ? 71  GLY A N    3  
ATOM 4530  C CA   . GLY A 1 71  ? -12.694 8.814   -6.424  1.00 0.00 ? 71  GLY A CA   3  
ATOM 4531  C C    . GLY A 1 71  ? -11.721 8.865   -7.603  1.00 0.00 ? 71  GLY A C    3  
ATOM 4532  O O    . GLY A 1 71  ? -11.634 7.917   -8.382  1.00 0.00 ? 71  GLY A O    3  
ATOM 4533  H H    . GLY A 1 71  ? -11.150 8.951   -5.033  1.00 0.00 ? 71  GLY A H    3  
ATOM 4534  H HA2  . GLY A 1 71  ? -13.034 7.789   -6.272  1.00 0.00 ? 71  GLY A HA2  3  
ATOM 4535  H HA3  . GLY A 1 71  ? -13.577 9.412   -6.650  1.00 0.00 ? 71  GLY A HA3  3  
ATOM 4536  N N    . ILE A 1 72  ? -11.013 9.981   -7.697  1.00 0.00 ? 72  ILE A N    3  
ATOM 4537  C CA   . ILE A 1 72  ? -10.049 10.168  -8.768  1.00 0.00 ? 72  ILE A CA   3  
ATOM 4538  C C    . ILE A 1 72  ? -9.097  8.971   -8.806  1.00 0.00 ? 72  ILE A C    3  
ATOM 4539  O O    . ILE A 1 72  ? -8.455  8.653   -7.806  1.00 0.00 ? 72  ILE A O    3  
ATOM 4540  C CB   . ILE A 1 72  ? -9.339  11.515  -8.620  1.00 0.00 ? 72  ILE A CB   3  
ATOM 4541  C CG1  . ILE A 1 72  ? -10.121 12.627  -9.322  1.00 0.00 ? 72  ILE A CG1  3  
ATOM 4542  C CG2  . ILE A 1 72  ? -7.894  11.430  -9.116  1.00 0.00 ? 72  ILE A CG2  3  
ATOM 4543  C CD1  . ILE A 1 72  ? -10.133 13.904  -8.479  1.00 0.00 ? 72  ILE A CD1  3  
ATOM 4544  H H    . ILE A 1 72  ? -11.090 10.747  -7.059  1.00 0.00 ? 72  ILE A H    3  
ATOM 4545  H HA   . ILE A 1 72  ? -10.604 10.197  -9.706  1.00 0.00 ? 72  ILE A HA   3  
ATOM 4546  H HB   . ILE A 1 72  ? -9.301  11.767  -7.561  1.00 0.00 ? 72  ILE A HB   3  
ATOM 4547  H HG12 . ILE A 1 72  ? -9.674  12.833  -10.294 1.00 0.00 ? 72  ILE A HG12 3  
ATOM 4548  H HG13 . ILE A 1 72  ? -11.144 12.298  -9.505  1.00 0.00 ? 72  ILE A HG13 3  
ATOM 4549  H HG21 . ILE A 1 72  ? -7.586  12.400  -9.507  1.00 0.00 ? 72  ILE A HG21 3  
ATOM 4550  H HG22 . ILE A 1 72  ? -7.242  11.148  -8.289  1.00 0.00 ? 72  ILE A HG22 3  
ATOM 4551  H HG23 . ILE A 1 72  ? -7.824  10.681  -9.905  1.00 0.00 ? 72  ILE A HG23 3  
ATOM 4552  H HD11 . ILE A 1 72  ? -9.289  14.534  -8.761  1.00 0.00 ? 72  ILE A HD11 3  
ATOM 4553  H HD12 . ILE A 1 72  ? -11.063 14.445  -8.653  1.00 0.00 ? 72  ILE A HD12 3  
ATOM 4554  H HD13 . ILE A 1 72  ? -10.056 13.644  -7.424  1.00 0.00 ? 72  ILE A HD13 3  
ATOM 4555  N N    . ASN A 1 73  ? -9.035  8.341   -9.970  1.00 0.00 ? 73  ASN A N    3  
ATOM 4556  C CA   . ASN A 1 73  ? -8.172  7.186   -10.151 1.00 0.00 ? 73  ASN A CA   3  
ATOM 4557  C C    . ASN A 1 73  ? -6.716  7.651   -10.231 1.00 0.00 ? 73  ASN A C    3  
ATOM 4558  O O    . ASN A 1 73  ? -6.335  8.352   -11.167 1.00 0.00 ? 73  ASN A O    3  
ATOM 4559  C CB   . ASN A 1 73  ? -8.504  6.448   -11.449 1.00 0.00 ? 73  ASN A CB   3  
ATOM 4560  C CG   . ASN A 1 73  ? -8.299  4.940   -11.290 1.00 0.00 ? 73  ASN A CG   3  
ATOM 4561  O OD1  . ASN A 1 73  ? -8.348  4.392   -10.201 1.00 0.00 ? 73  ASN A OD1  3  
ATOM 4562  N ND2  . ASN A 1 73  ? -8.067  4.302   -12.433 1.00 0.00 ? 73  ASN A ND2  3  
ATOM 4563  H H    . ASN A 1 73  ? -9.560  8.607   -10.778 1.00 0.00 ? 73  ASN A H    3  
ATOM 4564  H HA   . ASN A 1 73  ? -8.359  6.550   -9.286  1.00 0.00 ? 73  ASN A HA   3  
ATOM 4565  H HB2  . ASN A 1 73  ? -9.537  6.650   -11.732 1.00 0.00 ? 73  ASN A HB2  3  
ATOM 4566  H HB3  . ASN A 1 73  ? -7.874  6.821   -12.256 1.00 0.00 ? 73  ASN A HB3  3  
ATOM 4567  H HD21 . ASN A 1 73  ? -8.040  4.812   -13.293 1.00 0.00 ? 73  ASN A HD21 3  
ATOM 4568  H HD22 . ASN A 1 73  ? -7.920  3.313   -12.433 1.00 0.00 ? 73  ASN A HD22 3  
ATOM 4569  N N    . LEU A 1 74  ? -5.942  7.241   -9.237  1.00 0.00 ? 74  LEU A N    3  
ATOM 4570  C CA   . LEU A 1 74  ? -4.537  7.607   -9.183  1.00 0.00 ? 74  LEU A CA   3  
ATOM 4571  C C    . LEU A 1 74  ? -3.749  6.732   -10.161 1.00 0.00 ? 74  LEU A C    3  
ATOM 4572  O O    . LEU A 1 74  ? -2.715  7.151   -10.680 1.00 0.00 ? 74  LEU A O    3  
ATOM 4573  C CB   . LEU A 1 74  ? -4.020  7.540   -7.745  1.00 0.00 ? 74  LEU A CB   3  
ATOM 4574  C CG   . LEU A 1 74  ? -4.109  8.838   -6.939  1.00 0.00 ? 74  LEU A CG   3  
ATOM 4575  C CD1  . LEU A 1 74  ? -3.321  9.960   -7.618  1.00 0.00 ? 74  LEU A CD1  3  
ATOM 4576  C CD2  . LEU A 1 74  ? -5.567  9.230   -6.691  1.00 0.00 ? 74  LEU A CD2  3  
ATOM 4577  H H    . LEU A 1 74  ? -6.259  6.671   -8.479  1.00 0.00 ? 74  LEU A H    3  
ATOM 4578  H HA   . LEU A 1 74  ? -4.456  8.645   -9.507  1.00 0.00 ? 74  LEU A HA   3  
ATOM 4579  H HB2  . LEU A 1 74  ? -4.578  6.768   -7.215  1.00 0.00 ? 74  LEU A HB2  3  
ATOM 4580  H HB3  . LEU A 1 74  ? -2.978  7.221   -7.768  1.00 0.00 ? 74  LEU A HB3  3  
ATOM 4581  H HG   . LEU A 1 74  ? -3.652  8.667   -5.964  1.00 0.00 ? 74  LEU A HG   3  
ATOM 4582  H HD11 . LEU A 1 74  ? -3.940  10.426  -8.385  1.00 0.00 ? 74  LEU A HD11 3  
ATOM 4583  H HD12 . LEU A 1 74  ? -3.039  10.706  -6.875  1.00 0.00 ? 74  LEU A HD12 3  
ATOM 4584  H HD13 . LEU A 1 74  ? -2.423  9.547   -8.077  1.00 0.00 ? 74  LEU A HD13 3  
ATOM 4585  H HD21 . LEU A 1 74  ? -5.808  9.086   -5.638  1.00 0.00 ? 74  LEU A HD21 3  
ATOM 4586  H HD22 . LEU A 1 74  ? -5.712  10.277  -6.957  1.00 0.00 ? 74  LEU A HD22 3  
ATOM 4587  H HD23 . LEU A 1 74  ? -6.220  8.606   -7.302  1.00 0.00 ? 74  LEU A HD23 3  
ATOM 4588  N N    . ARG A 1 75  ? -4.268  5.533   -10.382 1.00 0.00 ? 75  ARG A N    3  
ATOM 4589  C CA   . ARG A 1 75  ? -3.626  4.596   -11.288 1.00 0.00 ? 75  ARG A CA   3  
ATOM 4590  C C    . ARG A 1 75  ? -3.427  5.238   -12.663 1.00 0.00 ? 75  ARG A C    3  
ATOM 4591  O O    . ARG A 1 75  ? -2.444  4.957   -13.346 1.00 0.00 ? 75  ARG A O    3  
ATOM 4592  C CB   . ARG A 1 75  ? -4.459  3.322   -11.444 1.00 0.00 ? 75  ARG A CB   3  
ATOM 4593  C CG   . ARG A 1 75  ? -3.944  2.214   -10.522 1.00 0.00 ? 75  ARG A CG   3  
ATOM 4594  C CD   . ARG A 1 75  ? -4.692  0.903   -10.770 1.00 0.00 ? 75  ARG A CD   3  
ATOM 4595  N NE   . ARG A 1 75  ? -3.802  -0.068  -11.444 1.00 0.00 ? 75  ARG A NE   3  
ATOM 4596  C CZ   . ARG A 1 75  ? -4.208  -1.250  -11.927 1.00 0.00 ? 75  ARG A CZ   3  
ATOM 4597  N NH1  . ARG A 1 75  ? -5.493  -1.615  -11.813 1.00 0.00 ? 75  ARG A NH1  3  
ATOM 4598  N NH2  . ARG A 1 75  ? -3.330  -2.068  -12.523 1.00 0.00 ? 75  ARG A NH2  3  
ATOM 4599  H H    . ARG A 1 75  ? -5.109  5.200   -9.956  1.00 0.00 ? 75  ARG A H    3  
ATOM 4600  H HA   . ARG A 1 75  ? -2.669  4.367   -10.820 1.00 0.00 ? 75  ARG A HA   3  
ATOM 4601  H HB2  . ARG A 1 75  ? -5.503  3.536   -11.214 1.00 0.00 ? 75  ARG A HB2  3  
ATOM 4602  H HB3  . ARG A 1 75  ? -4.423  2.984   -12.479 1.00 0.00 ? 75  ARG A HB3  3  
ATOM 4603  H HG2  . ARG A 1 75  ? -2.877  2.065   -10.688 1.00 0.00 ? 75  ARG A HG2  3  
ATOM 4604  H HG3  . ARG A 1 75  ? -4.066  2.516   -9.482  1.00 0.00 ? 75  ARG A HG3  3  
ATOM 4605  H HD2  . ARG A 1 75  ? -5.044  0.491   -9.824  1.00 0.00 ? 75  ARG A HD2  3  
ATOM 4606  H HD3  . ARG A 1 75  ? -5.574  1.088   -11.385 1.00 0.00 ? 75  ARG A HD3  3  
ATOM 4607  H HE   . ARG A 1 75  ? -2.837  0.173   -11.545 1.00 0.00 ? 75  ARG A HE   3  
ATOM 4608  H HH11 . ARG A 1 75  ? -6.148  -1.005  -11.368 1.00 0.00 ? 75  ARG A HH11 3  
ATOM 4609  H HH12 . ARG A 1 75  ? -5.796  -2.497  -12.173 1.00 0.00 ? 75  ARG A HH12 3  
ATOM 4610  H HH21 . ARG A 1 75  ? -2.372  -1.796  -12.608 1.00 0.00 ? 75  ARG A HH21 3  
ATOM 4611  H HH22 . ARG A 1 75  ? -3.633  -2.950  -12.883 1.00 0.00 ? 75  ARG A HH22 3  
ATOM 4612  N N    . SER A 1 76  ? -4.375  6.088   -13.026 1.00 0.00 ? 76  SER A N    3  
ATOM 4613  C CA   . SER A 1 76  ? -4.316  6.773   -14.307 1.00 0.00 ? 76  SER A CA   3  
ATOM 4614  C C    . SER A 1 76  ? -3.790  8.196   -14.115 1.00 0.00 ? 76  SER A C    3  
ATOM 4615  O O    . SER A 1 76  ? -3.447  8.871   -15.085 1.00 0.00 ? 76  SER A O    3  
ATOM 4616  C CB   . SER A 1 76  ? -5.690  6.800   -14.980 1.00 0.00 ? 76  SER A CB   3  
ATOM 4617  O OG   . SER A 1 76  ? -5.851  5.731   -15.909 1.00 0.00 ? 76  SER A OG   3  
ATOM 4618  H H    . SER A 1 76  ? -5.172  6.312   -12.464 1.00 0.00 ? 76  SER A H    3  
ATOM 4619  H HA   . SER A 1 76  ? -3.626  6.188   -14.915 1.00 0.00 ? 76  SER A HA   3  
ATOM 4620  H HB2  . SER A 1 76  ? -6.468  6.739   -14.219 1.00 0.00 ? 76  SER A HB2  3  
ATOM 4621  H HB3  . SER A 1 76  ? -5.822  7.751   -15.495 1.00 0.00 ? 76  SER A HB3  3  
ATOM 4622  H HG   . SER A 1 76  ? -4.987  5.556   -16.381 1.00 0.00 ? 76  SER A HG   3  
ATOM 4623  N N    . ALA A 1 77  ? -3.744  8.612   -12.858 1.00 0.00 ? 77  ALA A N    3  
ATOM 4624  C CA   . ALA A 1 77  ? -3.266  9.944   -12.527 1.00 0.00 ? 77  ALA A CA   3  
ATOM 4625  C C    . ALA A 1 77  ? -1.743  9.985   -12.672 1.00 0.00 ? 77  ALA A C    3  
ATOM 4626  O O    . ALA A 1 77  ? -1.085  8.946   -12.636 1.00 0.00 ? 77  ALA A O    3  
ATOM 4627  C CB   . ALA A 1 77  ? -3.728  10.317  -11.117 1.00 0.00 ? 77  ALA A CB   3  
ATOM 4628  H H    . ALA A 1 77  ? -4.025  8.058   -12.075 1.00 0.00 ? 77  ALA A H    3  
ATOM 4629  H HA   . ALA A 1 77  ? -3.709  10.642  -13.238 1.00 0.00 ? 77  ALA A HA   3  
ATOM 4630  H HB1  . ALA A 1 77  ? -4.763  10.005  -10.980 1.00 0.00 ? 77  ALA A HB1  3  
ATOM 4631  H HB2  . ALA A 1 77  ? -3.096  9.815   -10.384 1.00 0.00 ? 77  ALA A HB2  3  
ATOM 4632  H HB3  . ALA A 1 77  ? -3.653  11.396  -10.984 1.00 0.00 ? 77  ALA A HB3  3  
ATOM 4633  N N    . THR A 1 78  ? -1.228  11.195  -12.833 1.00 0.00 ? 78  THR A N    3  
ATOM 4634  C CA   . THR A 1 78  ? 0.205   11.385  -12.983 1.00 0.00 ? 78  THR A CA   3  
ATOM 4635  C C    . THR A 1 78  ? 0.795   12.014  -11.719 1.00 0.00 ? 78  THR A C    3  
ATOM 4636  O O    . THR A 1 78  ? 0.109   12.141  -10.706 1.00 0.00 ? 78  THR A O    3  
ATOM 4637  C CB   . THR A 1 78  ? 0.441   12.217  -14.244 1.00 0.00 ? 78  THR A CB   3  
ATOM 4638  O OG1  . THR A 1 78  ? -0.689  13.083  -14.306 1.00 0.00 ? 78  THR A OG1  3  
ATOM 4639  C CG2  . THR A 1 78  ? 0.343   11.384  -15.523 1.00 0.00 ? 78  THR A CG2  3  
ATOM 4640  H H    . THR A 1 78  ? -1.771  12.034  -12.861 1.00 0.00 ? 78  THR A H    3  
ATOM 4641  H HA   . THR A 1 78  ? 0.670   10.406  -13.100 1.00 0.00 ? 78  THR A HA   3  
ATOM 4642  H HB   . THR A 1 78  ? 1.397   12.739  -14.192 1.00 0.00 ? 78  THR A HB   3  
ATOM 4643  H HG1  . THR A 1 78  ? -1.474  12.593  -14.685 1.00 0.00 ? 78  THR A HG1  3  
ATOM 4644  H HG21 . THR A 1 78  ? 0.402   12.041  -16.391 1.00 0.00 ? 78  THR A HG21 3  
ATOM 4645  H HG22 . THR A 1 78  ? 1.163   10.667  -15.554 1.00 0.00 ? 78  THR A HG22 3  
ATOM 4646  H HG23 . THR A 1 78  ? -0.607  10.850  -15.537 1.00 0.00 ? 78  THR A HG23 3  
ATOM 4647  N N    . GLU A 1 79  ? 2.060   12.392  -11.821 1.00 0.00 ? 79  GLU A N    3  
ATOM 4648  C CA   . GLU A 1 79  ? 2.751   13.005  -10.699 1.00 0.00 ? 79  GLU A CA   3  
ATOM 4649  C C    . GLU A 1 79  ? 2.300   14.457  -10.528 1.00 0.00 ? 79  GLU A C    3  
ATOM 4650  O O    . GLU A 1 79  ? 2.189   14.948  -9.406  1.00 0.00 ? 79  GLU A O    3  
ATOM 4651  C CB   . GLU A 1 79  ? 4.268   12.919  -10.875 1.00 0.00 ? 79  GLU A CB   3  
ATOM 4652  C CG   . GLU A 1 79  ? 4.676   13.293  -12.301 1.00 0.00 ? 79  GLU A CG   3  
ATOM 4653  C CD   . GLU A 1 79  ? 6.146   13.715  -12.358 1.00 0.00 ? 79  GLU A CD   3  
ATOM 4654  O OE1  . GLU A 1 79  ? 6.412   14.891  -12.030 1.00 0.00 ? 79  GLU A OE1  3  
ATOM 4655  O OE2  . GLU A 1 79  ? 6.970   12.851  -12.729 1.00 0.00 ? 79  GLU A OE2  3  
ATOM 4656  H H    . GLU A 1 79  ? 2.611   12.285  -12.649 1.00 0.00 ? 79  GLU A H    3  
ATOM 4657  H HA   . GLU A 1 79  ? 2.459   12.422  -9.825  1.00 0.00 ? 79  GLU A HA   3  
ATOM 4658  H HB2  . GLU A 1 79  ? 4.758   13.586  -10.166 1.00 0.00 ? 79  GLU A HB2  3  
ATOM 4659  H HB3  . GLU A 1 79  ? 4.607   11.908  -10.649 1.00 0.00 ? 79  GLU A HB3  3  
ATOM 4660  H HG2  . GLU A 1 79  ? 4.512   12.444  -12.965 1.00 0.00 ? 79  GLU A HG2  3  
ATOM 4661  H HG3  . GLU A 1 79  ? 4.047   14.106  -12.663 1.00 0.00 ? 79  GLU A HG3  3  
ATOM 4662  N N    . GLN A 1 80  ? 2.052   15.103  -11.658 1.00 0.00 ? 80  GLN A N    3  
ATOM 4663  C CA   . GLN A 1 80  ? 1.616   16.489  -11.647 1.00 0.00 ? 80  GLN A CA   3  
ATOM 4664  C C    . GLN A 1 80  ? 0.144   16.580  -11.240 1.00 0.00 ? 80  GLN A C    3  
ATOM 4665  O O    . GLN A 1 80  ? -0.230  17.430  -10.433 1.00 0.00 ? 80  GLN A O    3  
ATOM 4666  C CB   . GLN A 1 80  ? 1.850   17.148  -13.008 1.00 0.00 ? 80  GLN A CB   3  
ATOM 4667  C CG   . GLN A 1 80  ? 0.973   16.507  -14.085 1.00 0.00 ? 80  GLN A CG   3  
ATOM 4668  C CD   . GLN A 1 80  ? 1.544   16.764  -15.482 1.00 0.00 ? 80  GLN A CD   3  
ATOM 4669  O OE1  . GLN A 1 80  ? 2.738   16.687  -15.716 1.00 0.00 ? 80  GLN A OE1  3  
ATOM 4670  N NE2  . GLN A 1 80  ? 0.625   17.073  -16.393 1.00 0.00 ? 80  GLN A NE2  3  
ATOM 4671  H H    . GLN A 1 80  ? 2.145   14.697  -12.567 1.00 0.00 ? 80  GLN A H    3  
ATOM 4672  H HA   . GLN A 1 80  ? 2.238   16.983  -10.900 1.00 0.00 ? 80  GLN A HA   3  
ATOM 4673  H HB2  . GLN A 1 80  ? 1.631   18.214  -12.943 1.00 0.00 ? 80  GLN A HB2  3  
ATOM 4674  H HB3  . GLN A 1 80  ? 2.900   17.055  -13.286 1.00 0.00 ? 80  GLN A HB3  3  
ATOM 4675  H HG2  . GLN A 1 80  ? 0.901   15.434  -13.910 1.00 0.00 ? 80  GLN A HG2  3  
ATOM 4676  H HG3  . GLN A 1 80  ? -0.039  16.909  -14.022 1.00 0.00 ? 80  GLN A HG3  3  
ATOM 4677  H HE21 . GLN A 1 80  ? -0.340  17.120  -16.134 1.00 0.00 ? 80  GLN A HE21 3  
ATOM 4678  H HE22 . GLN A 1 80  ? 0.900   17.259  -17.336 1.00 0.00 ? 80  GLN A HE22 3  
ATOM 4679  N N    . GLN A 1 81  ? -0.652  15.691  -11.817 1.00 0.00 ? 81  GLN A N    3  
ATOM 4680  C CA   . GLN A 1 81  ? -2.075  15.660  -11.524 1.00 0.00 ? 81  GLN A CA   3  
ATOM 4681  C C    . GLN A 1 81  ? -2.308  15.247  -10.069 1.00 0.00 ? 81  GLN A C    3  
ATOM 4682  O O    . GLN A 1 81  ? -3.128  15.845  -9.375  1.00 0.00 ? 81  GLN A O    3  
ATOM 4683  C CB   . GLN A 1 81  ? -2.812  14.724  -12.484 1.00 0.00 ? 81  GLN A CB   3  
ATOM 4684  C CG   . GLN A 1 81  ? -3.504  15.514  -13.597 1.00 0.00 ? 81  GLN A CG   3  
ATOM 4685  C CD   . GLN A 1 81  ? -3.134  14.960  -14.974 1.00 0.00 ? 81  GLN A CD   3  
ATOM 4686  O OE1  . GLN A 1 81  ? -3.968  14.472  -15.720 1.00 0.00 ? 81  GLN A OE1  3  
ATOM 4687  N NE2  . GLN A 1 81  ? -1.841  15.062  -15.269 1.00 0.00 ? 81  GLN A NE2  3  
ATOM 4688  H H    . GLN A 1 81  ? -0.340  15.003  -12.472 1.00 0.00 ? 81  GLN A H    3  
ATOM 4689  H HA   . GLN A 1 81  ? -2.425  16.680  -11.680 1.00 0.00 ? 81  GLN A HA   3  
ATOM 4690  H HB2  . GLN A 1 81  ? -2.107  14.016  -12.920 1.00 0.00 ? 81  GLN A HB2  3  
ATOM 4691  H HB3  . GLN A 1 81  ? -3.550  14.140  -11.934 1.00 0.00 ? 81  GLN A HB3  3  
ATOM 4692  H HG2  . GLN A 1 81  ? -4.584  15.470  -13.461 1.00 0.00 ? 81  GLN A HG2  3  
ATOM 4693  H HG3  . GLN A 1 81  ? -3.217  16.564  -13.534 1.00 0.00 ? 81  GLN A HG3  3  
ATOM 4694  H HE21 . GLN A 1 81  ? -1.209  15.473  -14.612 1.00 0.00 ? 81  GLN A HE21 3  
ATOM 4695  H HE22 . GLN A 1 81  ? -1.501  14.727  -16.148 1.00 0.00 ? 81  GLN A HE22 3  
ATOM 4696  N N    . ALA A 1 82  ? -1.573  14.228  -9.651  1.00 0.00 ? 82  ALA A N    3  
ATOM 4697  C CA   . ALA A 1 82  ? -1.689  13.728  -8.292  1.00 0.00 ? 82  ALA A CA   3  
ATOM 4698  C C    . ALA A 1 82  ? -1.356  14.853  -7.309  1.00 0.00 ? 82  ALA A C    3  
ATOM 4699  O O    . ALA A 1 82  ? -1.983  14.969  -6.257  1.00 0.00 ? 82  ALA A O    3  
ATOM 4700  C CB   . ALA A 1 82  ? -0.779  12.511  -8.115  1.00 0.00 ? 82  ALA A CB   3  
ATOM 4701  H H    . ALA A 1 82  ? -0.908  13.746  -10.223 1.00 0.00 ? 82  ALA A H    3  
ATOM 4702  H HA   . ALA A 1 82  ? -2.723  13.419  -8.139  1.00 0.00 ? 82  ALA A HA   3  
ATOM 4703  H HB1  . ALA A 1 82  ? 0.184   12.705  -8.587  1.00 0.00 ? 82  ALA A HB1  3  
ATOM 4704  H HB2  . ALA A 1 82  ? -0.632  12.319  -7.052  1.00 0.00 ? 82  ALA A HB2  3  
ATOM 4705  H HB3  . ALA A 1 82  ? -1.243  11.641  -8.580  1.00 0.00 ? 82  ALA A HB3  3  
ATOM 4706  N N    . ARG A 1 83  ? -0.369  15.652  -7.688  1.00 0.00 ? 83  ARG A N    3  
ATOM 4707  C CA   . ARG A 1 83  ? 0.055   16.764  -6.853  1.00 0.00 ? 83  ARG A CA   3  
ATOM 4708  C C    . ARG A 1 83  ? -1.026  17.846  -6.821  1.00 0.00 ? 83  ARG A C    3  
ATOM 4709  O O    . ARG A 1 83  ? -0.983  18.746  -5.984  1.00 0.00 ? 83  ARG A O    3  
ATOM 4710  C CB   . ARG A 1 83  ? 1.361   17.372  -7.368  1.00 0.00 ? 83  ARG A CB   3  
ATOM 4711  C CG   . ARG A 1 83  ? 2.556   16.484  -7.015  1.00 0.00 ? 83  ARG A CG   3  
ATOM 4712  C CD   . ARG A 1 83  ? 3.815   16.937  -7.757  1.00 0.00 ? 83  ARG A CD   3  
ATOM 4713  N NE   . ARG A 1 83  ? 4.548   17.935  -6.948  1.00 0.00 ? 83  ARG A NE   3  
ATOM 4714  C CZ   . ARG A 1 83  ? 5.288   17.633  -5.872  1.00 0.00 ? 83  ARG A CZ   3  
ATOM 4715  N NH1  . ARG A 1 83  ? 5.397   16.359  -5.471  1.00 0.00 ? 83  ARG A NH1  3  
ATOM 4716  N NH2  . ARG A 1 83  ? 5.919   18.604  -5.198  1.00 0.00 ? 83  ARG A NH2  3  
ATOM 4717  H H    . ARG A 1 83  ? 0.135   15.551  -8.545  1.00 0.00 ? 83  ARG A H    3  
ATOM 4718  H HA   . ARG A 1 83  ? 0.204   16.329  -5.865  1.00 0.00 ? 83  ARG A HA   3  
ATOM 4719  H HB2  . ARG A 1 83  ? 1.306   17.500  -8.449  1.00 0.00 ? 83  ARG A HB2  3  
ATOM 4720  H HB3  . ARG A 1 83  ? 1.500   18.363  -6.937  1.00 0.00 ? 83  ARG A HB3  3  
ATOM 4721  H HG2  . ARG A 1 83  ? 2.732   16.516  -5.939  1.00 0.00 ? 83  ARG A HG2  3  
ATOM 4722  H HG3  . ARG A 1 83  ? 2.332   15.448  -7.270  1.00 0.00 ? 83  ARG A HG3  3  
ATOM 4723  H HD2  . ARG A 1 83  ? 4.456   16.079  -7.961  1.00 0.00 ? 83  ARG A HD2  3  
ATOM 4724  H HD3  . ARG A 1 83  ? 3.543   17.368  -8.721  1.00 0.00 ? 83  ARG A HD3  3  
ATOM 4725  H HE   . ARG A 1 83  ? 4.488   18.896  -7.220  1.00 0.00 ? 83  ARG A HE   3  
ATOM 4726  H HH11 . ARG A 1 83  ? 4.926   15.634  -5.974  1.00 0.00 ? 83  ARG A HH11 3  
ATOM 4727  H HH12 . ARG A 1 83  ? 5.949   16.133  -4.668  1.00 0.00 ? 83  ARG A HH12 3  
ATOM 4728  H HH21 . ARG A 1 83  ? 5.838   19.554  -5.498  1.00 0.00 ? 83  ARG A HH21 3  
ATOM 4729  H HH22 . ARG A 1 83  ? 6.471   18.378  -4.396  1.00 0.00 ? 83  ARG A HH22 3  
ATOM 4730  N N    . LEU A 1 84  ? -1.969  17.723  -7.743  1.00 0.00 ? 84  LEU A N    3  
ATOM 4731  C CA   . LEU A 1 84  ? -3.059  18.680  -7.831  1.00 0.00 ? 84  LEU A CA   3  
ATOM 4732  C C    . LEU A 1 84  ? -4.311  18.081  -7.187  1.00 0.00 ? 84  LEU A C    3  
ATOM 4733  O O    . LEU A 1 84  ? -4.901  18.682  -6.290  1.00 0.00 ? 84  LEU A O    3  
ATOM 4734  C CB   . LEU A 1 84  ? -3.266  19.125  -9.280  1.00 0.00 ? 84  LEU A CB   3  
ATOM 4735  C CG   . LEU A 1 84  ? -4.601  18.733  -9.918  1.00 0.00 ? 84  LEU A CG   3  
ATOM 4736  C CD1  . LEU A 1 84  ? -5.773  19.378  -9.177  1.00 0.00 ? 84  LEU A CD1  3  
ATOM 4737  C CD2  . LEU A 1 84  ? -4.613  19.066  -11.411 1.00 0.00 ? 84  LEU A CD2  3  
ATOM 4738  H H    . LEU A 1 84  ? -1.997  16.988  -8.420  1.00 0.00 ? 84  LEU A H    3  
ATOM 4739  H HA   . LEU A 1 84  ? -2.766  19.562  -7.261  1.00 0.00 ? 84  LEU A HA   3  
ATOM 4740  H HB2  . LEU A 1 84  ? -3.170  20.210  -9.323  1.00 0.00 ? 84  LEU A HB2  3  
ATOM 4741  H HB3  . LEU A 1 84  ? -2.461  18.709  -9.885  1.00 0.00 ? 84  LEU A HB3  3  
ATOM 4742  H HG   . LEU A 1 84  ? -4.718  17.653  -9.828  1.00 0.00 ? 84  LEU A HG   3  
ATOM 4743  H HD11 . LEU A 1 84  ? -6.257  18.634  -8.543  1.00 0.00 ? 84  LEU A HD11 3  
ATOM 4744  H HD12 . LEU A 1 84  ? -5.406  20.198  -8.559  1.00 0.00 ? 84  LEU A HD12 3  
ATOM 4745  H HD13 . LEU A 1 84  ? -6.493  19.763  -9.900  1.00 0.00 ? 84  LEU A HD13 3  
ATOM 4746  H HD21 . LEU A 1 84  ? -5.644  19.146  -11.757 1.00 0.00 ? 84  LEU A HD21 3  
ATOM 4747  H HD22 . LEU A 1 84  ? -4.100  20.013  -11.576 1.00 0.00 ? 84  LEU A HD22 3  
ATOM 4748  H HD23 . LEU A 1 84  ? -4.105  18.276  -11.964 1.00 0.00 ? 84  LEU A HD23 3  
ATOM 4749  N N    . ILE A 1 85  ? -4.680  16.903  -7.669  1.00 0.00 ? 85  ILE A N    3  
ATOM 4750  C CA   . ILE A 1 85  ? -5.851  16.216  -7.151  1.00 0.00 ? 85  ILE A CA   3  
ATOM 4751  C C    . ILE A 1 85  ? -5.839  16.277  -5.623  1.00 0.00 ? 85  ILE A C    3  
ATOM 4752  O O    . ILE A 1 85  ? -6.845  16.620  -5.004  1.00 0.00 ? 85  ILE A O    3  
ATOM 4753  C CB   . ILE A 1 85  ? -5.928  14.793  -7.709  1.00 0.00 ? 85  ILE A CB   3  
ATOM 4754  C CG1  . ILE A 1 85  ? -5.981  14.806  -9.238  1.00 0.00 ? 85  ILE A CG1  3  
ATOM 4755  C CG2  . ILE A 1 85  ? -7.106  14.029  -7.102  1.00 0.00 ? 85  ILE A CG2  3  
ATOM 4756  C CD1  . ILE A 1 85  ? -5.309  13.561  -9.821  1.00 0.00 ? 85  ILE A CD1  3  
ATOM 4757  H H    . ILE A 1 85  ? -4.195  16.421  -8.398  1.00 0.00 ? 85  ILE A H    3  
ATOM 4758  H HA   . ILE A 1 85  ? -6.730  16.751  -7.512  1.00 0.00 ? 85  ILE A HA   3  
ATOM 4759  H HB   . ILE A 1 85  ? -5.019  14.265  -7.423  1.00 0.00 ? 85  ILE A HB   3  
ATOM 4760  H HG12 . ILE A 1 85  ? -7.018  14.853  -9.570  1.00 0.00 ? 85  ILE A HG12 3  
ATOM 4761  H HG13 . ILE A 1 85  ? -5.486  15.701  -9.615  1.00 0.00 ? 85  ILE A HG13 3  
ATOM 4762  H HG21 . ILE A 1 85  ? -7.724  13.619  -7.900  1.00 0.00 ? 85  ILE A HG21 3  
ATOM 4763  H HG22 . ILE A 1 85  ? -6.729  13.216  -6.480  1.00 0.00 ? 85  ILE A HG22 3  
ATOM 4764  H HG23 . ILE A 1 85  ? -7.703  14.706  -6.491  1.00 0.00 ? 85  ILE A HG23 3  
ATOM 4765  H HD11 . ILE A 1 85  ? -5.529  12.700  -9.189  1.00 0.00 ? 85  ILE A HD11 3  
ATOM 4766  H HD12 . ILE A 1 85  ? -5.688  13.380  -10.826 1.00 0.00 ? 85  ILE A HD12 3  
ATOM 4767  H HD13 . ILE A 1 85  ? -4.231  13.715  -9.862  1.00 0.00 ? 85  ILE A HD13 3  
ATOM 4768  N N    . ILE A 1 86  ? -4.689  15.939  -5.058  1.00 0.00 ? 86  ILE A N    3  
ATOM 4769  C CA   . ILE A 1 86  ? -4.533  15.952  -3.613  1.00 0.00 ? 86  ILE A CA   3  
ATOM 4770  C C    . ILE A 1 86  ? -4.521  17.399  -3.118  1.00 0.00 ? 86  ILE A C    3  
ATOM 4771  O O    . ILE A 1 86  ? -4.935  17.678  -1.994  1.00 0.00 ? 86  ILE A O    3  
ATOM 4772  C CB   . ILE A 1 86  ? -3.296  15.151  -3.202  1.00 0.00 ? 86  ILE A CB   3  
ATOM 4773  C CG1  . ILE A 1 86  ? -2.012  15.878  -3.607  1.00 0.00 ? 86  ILE A CG1  3  
ATOM 4774  C CG2  . ILE A 1 86  ? -3.351  13.729  -3.763  1.00 0.00 ? 86  ILE A CG2  3  
ATOM 4775  C CD1  . ILE A 1 86  ? -0.834  14.904  -3.692  1.00 0.00 ? 86  ILE A CD1  3  
ATOM 4776  H H    . ILE A 1 86  ? -3.876  15.662  -5.569  1.00 0.00 ? 86  ILE A H    3  
ATOM 4777  H HA   . ILE A 1 86  ? -5.400  15.448  -3.187  1.00 0.00 ? 86  ILE A HA   3  
ATOM 4778  H HB   . ILE A 1 86  ? -3.289  15.068  -2.115  1.00 0.00 ? 86  ILE A HB   3  
ATOM 4779  H HG12 . ILE A 1 86  ? -2.155  16.365  -4.571  1.00 0.00 ? 86  ILE A HG12 3  
ATOM 4780  H HG13 . ILE A 1 86  ? -1.790  16.662  -2.883  1.00 0.00 ? 86  ILE A HG13 3  
ATOM 4781  H HG21 . ILE A 1 86  ? -4.346  13.312  -3.601  1.00 0.00 ? 86  ILE A HG21 3  
ATOM 4782  H HG22 . ILE A 1 86  ? -3.137  13.751  -4.832  1.00 0.00 ? 86  ILE A HG22 3  
ATOM 4783  H HG23 . ILE A 1 86  ? -2.611  13.109  -3.257  1.00 0.00 ? 86  ILE A HG23 3  
ATOM 4784  H HD11 . ILE A 1 86  ? 0.066   15.448  -3.979  1.00 0.00 ? 86  ILE A HD11 3  
ATOM 4785  H HD12 . ILE A 1 86  ? -0.681  14.435  -2.720  1.00 0.00 ? 86  ILE A HD12 3  
ATOM 4786  H HD13 . ILE A 1 86  ? -1.049  14.138  -4.436  1.00 0.00 ? 86  ILE A HD13 3  
ATOM 4787  N N    . GLY A 1 87  ? -4.042  18.282  -3.982  1.00 0.00 ? 87  GLY A N    3  
ATOM 4788  C CA   . GLY A 1 87  ? -3.971  19.694  -3.646  1.00 0.00 ? 87  GLY A CA   3  
ATOM 4789  C C    . GLY A 1 87  ? -5.261  20.417  -4.038  1.00 0.00 ? 87  GLY A C    3  
ATOM 4790  O O    . GLY A 1 87  ? -5.233  21.592  -4.401  1.00 0.00 ? 87  GLY A O    3  
ATOM 4791  H H    . GLY A 1 87  ? -3.707  18.048  -4.894  1.00 0.00 ? 87  GLY A H    3  
ATOM 4792  H HA2  . GLY A 1 87  ? -3.796  19.809  -2.577  1.00 0.00 ? 87  GLY A HA2  3  
ATOM 4793  H HA3  . GLY A 1 87  ? -3.124  20.151  -4.159  1.00 0.00 ? 87  GLY A HA3  3  
ATOM 4794  N N    . GLN A 1 88  ? -6.361  19.684  -3.951  1.00 0.00 ? 88  GLN A N    3  
ATOM 4795  C CA   . GLN A 1 88  ? -7.660  20.240  -4.292  1.00 0.00 ? 88  GLN A CA   3  
ATOM 4796  C C    . GLN A 1 88  ? -8.342  20.799  -3.042  1.00 0.00 ? 88  GLN A C    3  
ATOM 4797  O O    . GLN A 1 88  ? -7.744  20.836  -1.968  1.00 0.00 ? 88  GLN A O    3  
ATOM 4798  C CB   . GLN A 1 88  ? -8.542  19.194  -4.977  1.00 0.00 ? 88  GLN A CB   3  
ATOM 4799  C CG   . GLN A 1 88  ? -8.283  19.160  -6.485  1.00 0.00 ? 88  GLN A CG   3  
ATOM 4800  C CD   . GLN A 1 88  ? -9.579  18.906  -7.258  1.00 0.00 ? 88  GLN A CD   3  
ATOM 4801  O OE1  . GLN A 1 88  ? -10.674 18.977  -6.725  1.00 0.00 ? 88  GLN A OE1  3  
ATOM 4802  N NE2  . GLN A 1 88  ? -9.393  18.606  -8.540  1.00 0.00 ? 88  GLN A NE2  3  
ATOM 4803  H H    . GLN A 1 88  ? -6.375  18.729  -3.655  1.00 0.00 ? 88  GLN A H    3  
ATOM 4804  H HA   . GLN A 1 88  ? -7.454  21.048  -4.994  1.00 0.00 ? 88  GLN A HA   3  
ATOM 4805  H HB2  . GLN A 1 88  ? -8.345  18.211  -4.549  1.00 0.00 ? 88  GLN A HB2  3  
ATOM 4806  H HB3  . GLN A 1 88  ? -9.592  19.419  -4.789  1.00 0.00 ? 88  GLN A HB3  3  
ATOM 4807  H HG2  . GLN A 1 88  ? -7.845  20.107  -6.803  1.00 0.00 ? 88  GLN A HG2  3  
ATOM 4808  H HG3  . GLN A 1 88  ? -7.558  18.380  -6.715  1.00 0.00 ? 88  GLN A HG3  3  
ATOM 4809  H HE21 . GLN A 1 88  ? -8.467  18.564  -8.915  1.00 0.00 ? 88  GLN A HE21 3  
ATOM 4810  H HE22 . GLN A 1 88  ? -10.180 18.422  -9.129  1.00 0.00 ? 88  GLN A HE22 3  
ATOM 4811  N N    . GLN A 1 89  ? -9.586  21.220  -3.224  1.00 0.00 ? 89  GLN A N    3  
ATOM 4812  C CA   . GLN A 1 89  ? -10.356 21.776  -2.125  1.00 0.00 ? 89  GLN A CA   3  
ATOM 4813  C C    . GLN A 1 89  ? -11.505 20.836  -1.753  1.00 0.00 ? 89  GLN A C    3  
ATOM 4814  O O    . GLN A 1 89  ? -12.257 20.396  -2.622  1.00 0.00 ? 89  GLN A O    3  
ATOM 4815  C CB   . GLN A 1 89  ? -10.879 23.171  -2.471  1.00 0.00 ? 89  GLN A CB   3  
ATOM 4816  C CG   . GLN A 1 89  ? -11.136 23.302  -3.974  1.00 0.00 ? 89  GLN A CG   3  
ATOM 4817  C CD   . GLN A 1 89  ? -9.822  23.433  -4.746  1.00 0.00 ? 89  GLN A CD   3  
ATOM 4818  O OE1  . GLN A 1 89  ? -8.950  24.217  -4.410  1.00 0.00 ? 89  GLN A OE1  3  
ATOM 4819  N NE2  . GLN A 1 89  ? -9.729  22.623  -5.797  1.00 0.00 ? 89  GLN A NE2  3  
ATOM 4820  H H    . GLN A 1 89  ? -10.065 21.186  -4.101  1.00 0.00 ? 89  GLN A H    3  
ATOM 4821  H HA   . GLN A 1 89  ? -9.657  21.853  -1.291  1.00 0.00 ? 89  GLN A HA   3  
ATOM 4822  H HB2  . GLN A 1 89  ? -11.800 23.365  -1.923  1.00 0.00 ? 89  GLN A HB2  3  
ATOM 4823  H HB3  . GLN A 1 89  ? -10.156 23.923  -2.156  1.00 0.00 ? 89  GLN A HB3  3  
ATOM 4824  H HG2  . GLN A 1 89  ? -11.686 22.431  -4.330  1.00 0.00 ? 89  GLN A HG2  3  
ATOM 4825  H HG3  . GLN A 1 89  ? -11.762 24.174  -4.164  1.00 0.00 ? 89  GLN A HG3  3  
ATOM 4826  H HE21 . GLN A 1 89  ? -10.482 22.004  -6.019  1.00 0.00 ? 89  GLN A HE21 3  
ATOM 4827  H HE22 . GLN A 1 89  ? -8.907  22.635  -6.366  1.00 0.00 ? 89  GLN A HE22 3  
ATOM 4828  N N    . CYS A 1 90  ? -11.605 20.557  -0.462  1.00 0.00 ? 90  CYS A N    3  
ATOM 4829  C CA   . CYS A 1 90  ? -12.650 19.678  0.035   1.00 0.00 ? 90  CYS A CA   3  
ATOM 4830  C C    . CYS A 1 90  ? -12.481 19.539  1.549   1.00 0.00 ? 90  CYS A C    3  
ATOM 4831  O O    . CYS A 1 90  ? -11.539 18.900  2.016   1.00 0.00 ? 90  CYS A O    3  
ATOM 4832  C CB   . CYS A 1 90  ? -12.628 18.320  -0.670  1.00 0.00 ? 90  CYS A CB   3  
ATOM 4833  S SG   . CYS A 1 90  ? -13.939 18.255  -1.945  1.00 0.00 ? 90  CYS A SG   3  
ATOM 4834  H H    . CYS A 1 90  ? -10.990 20.919  0.238   1.00 0.00 ? 90  CYS A H    3  
ATOM 4835  H HA   . CYS A 1 90  ? -13.600 20.154  -0.207  1.00 0.00 ? 90  CYS A HA   3  
ATOM 4836  H HB2  . CYS A 1 90  ? -11.654 18.154  -1.129  1.00 0.00 ? 90  CYS A HB2  3  
ATOM 4837  H HB3  . CYS A 1 90  ? -12.778 17.521  0.058   1.00 0.00 ? 90  CYS A HB3  3  
ATOM 4838  H HG   . CYS A 1 90  ? -14.177 16.951  -1.834  1.00 0.00 ? 90  CYS A HG   3  
ATOM 4839  N N    . ASP A 1 91  ? -13.408 20.147  2.274   1.00 0.00 ? 91  ASP A N    3  
ATOM 4840  C CA   . ASP A 1 91  ? -13.374 20.099  3.726   1.00 0.00 ? 91  ASP A CA   3  
ATOM 4841  C C    . ASP A 1 91  ? -12.987 18.688  4.176   1.00 0.00 ? 91  ASP A C    3  
ATOM 4842  O O    . ASP A 1 91  ? -12.099 18.521  5.010   1.00 0.00 ? 91  ASP A O    3  
ATOM 4843  C CB   . ASP A 1 91  ? -14.745 20.425  4.320   1.00 0.00 ? 91  ASP A CB   3  
ATOM 4844  C CG   . ASP A 1 91  ? -14.985 21.907  4.617   1.00 0.00 ? 91  ASP A CG   3  
ATOM 4845  O OD1  . ASP A 1 91  ? -14.712 22.720  3.708   1.00 0.00 ? 91  ASP A OD1  3  
ATOM 4846  O OD2  . ASP A 1 91  ? -15.435 22.194  5.748   1.00 0.00 ? 91  ASP A OD2  3  
ATOM 4847  H H    . ASP A 1 91  ? -14.171 20.664  1.886   1.00 0.00 ? 91  ASP A H    3  
ATOM 4848  H HA   . ASP A 1 91  ? -12.638 20.847  4.020   1.00 0.00 ? 91  ASP A HA   3  
ATOM 4849  H HB2  . ASP A 1 91  ? -15.515 20.079  3.631   1.00 0.00 ? 91  ASP A HB2  3  
ATOM 4850  H HB3  . ASP A 1 91  ? -14.867 19.861  5.245   1.00 0.00 ? 91  ASP A HB3  3  
ATOM 4851  N N    . THR A 1 92  ? -13.673 17.710  3.604   1.00 0.00 ? 92  THR A N    3  
ATOM 4852  C CA   . THR A 1 92  ? -13.413 16.320  3.936   1.00 0.00 ? 92  THR A CA   3  
ATOM 4853  C C    . THR A 1 92  ? -13.237 15.491  2.661   1.00 0.00 ? 92  THR A C    3  
ATOM 4854  O O    . THR A 1 92  ? -14.107 15.491  1.792   1.00 0.00 ? 92  THR A O    3  
ATOM 4855  C CB   . THR A 1 92  ? -14.552 15.825  4.829   1.00 0.00 ? 92  THR A CB   3  
ATOM 4856  O OG1  . THR A 1 92  ? -14.711 16.861  5.794   1.00 0.00 ? 92  THR A OG1  3  
ATOM 4857  C CG2  . THR A 1 92  ? -14.158 14.601  5.657   1.00 0.00 ? 92  THR A CG2  3  
ATOM 4858  H H    . THR A 1 92  ? -14.394 17.855  2.926   1.00 0.00 ? 92  THR A H    3  
ATOM 4859  H HA   . THR A 1 92  ? -12.472 16.268  4.483   1.00 0.00 ? 92  THR A HA   3  
ATOM 4860  H HB   . THR A 1 92  ? -15.449 15.626  4.242   1.00 0.00 ? 92  THR A HB   3  
ATOM 4861  H HG1  . THR A 1 92  ? -13.839 17.042  6.249   1.00 0.00 ? 92  THR A HG1  3  
ATOM 4862  H HG21 . THR A 1 92  ? -14.523 13.698  5.168   1.00 0.00 ? 92  THR A HG21 3  
ATOM 4863  H HG22 . THR A 1 92  ? -13.072 14.554  5.742   1.00 0.00 ? 92  THR A HG22 3  
ATOM 4864  H HG23 . THR A 1 92  ? -14.597 14.679  6.652   1.00 0.00 ? 92  THR A HG23 3  
ATOM 4865  N N    . ILE A 1 93  ? -12.105 14.806  2.591   1.00 0.00 ? 93  ILE A N    3  
ATOM 4866  C CA   . ILE A 1 93  ? -11.804 13.975  1.438   1.00 0.00 ? 93  ILE A CA   3  
ATOM 4867  C C    . ILE A 1 93  ? -11.254 12.629  1.915   1.00 0.00 ? 93  ILE A C    3  
ATOM 4868  O O    . ILE A 1 93  ? -10.638 12.546  2.976   1.00 0.00 ? 93  ILE A O    3  
ATOM 4869  C CB   . ILE A 1 93  ? -10.873 14.713  0.474   1.00 0.00 ? 93  ILE A CB   3  
ATOM 4870  C CG1  . ILE A 1 93  ? -9.968  13.732  -0.274  1.00 0.00 ? 93  ILE A CG1  3  
ATOM 4871  C CG2  . ILE A 1 93  ? -10.069 15.790  1.206   1.00 0.00 ? 93  ILE A CG2  3  
ATOM 4872  C CD1  . ILE A 1 93  ? -8.820  13.255  0.617   1.00 0.00 ? 93  ILE A CD1  3  
ATOM 4873  H H    . ILE A 1 93  ? -11.403 14.811  3.303   1.00 0.00 ? 93  ILE A H    3  
ATOM 4874  H HA   . ILE A 1 93  ? -12.740 13.798  0.909   1.00 0.00 ? 93  ILE A HA   3  
ATOM 4875  H HB   . ILE A 1 93  ? -11.485 15.220  -0.271  1.00 0.00 ? 93  ILE A HB   3  
ATOM 4876  H HG12 . ILE A 1 93  ? -10.554 12.876  -0.609  1.00 0.00 ? 93  ILE A HG12 3  
ATOM 4877  H HG13 . ILE A 1 93  ? -9.566  14.211  -1.167  1.00 0.00 ? 93  ILE A HG13 3  
ATOM 4878  H HG21 . ILE A 1 93  ? -9.142  15.981  0.665   1.00 0.00 ? 93  ILE A HG21 3  
ATOM 4879  H HG22 . ILE A 1 93  ? -10.654 16.708  1.258   1.00 0.00 ? 93  ILE A HG22 3  
ATOM 4880  H HG23 . ILE A 1 93  ? -9.837  15.448  2.215   1.00 0.00 ? 93  ILE A HG23 3  
ATOM 4881  H HD11 . ILE A 1 93  ? -8.881  13.752  1.585   1.00 0.00 ? 93  ILE A HD11 3  
ATOM 4882  H HD12 . ILE A 1 93  ? -8.893  12.176  0.757   1.00 0.00 ? 93  ILE A HD12 3  
ATOM 4883  H HD13 . ILE A 1 93  ? -7.868  13.496  0.144   1.00 0.00 ? 93  ILE A HD13 3  
ATOM 4884  N N    . THR A 1 94  ? -11.495 11.607  1.106   1.00 0.00 ? 94  THR A N    3  
ATOM 4885  C CA   . THR A 1 94  ? -11.032 10.269  1.431   1.00 0.00 ? 94  THR A CA   3  
ATOM 4886  C C    . THR A 1 94  ? -9.879  9.865   0.510   1.00 0.00 ? 94  THR A C    3  
ATOM 4887  O O    . THR A 1 94  ? -9.645  10.505  -0.514  1.00 0.00 ? 94  THR A O    3  
ATOM 4888  C CB   . THR A 1 94  ? -12.231 9.322   1.356   1.00 0.00 ? 94  THR A CB   3  
ATOM 4889  O OG1  . THR A 1 94  ? -13.319 10.099  1.848   1.00 0.00 ? 94  THR A OG1  3  
ATOM 4890  C CG2  . THR A 1 94  ? -12.124 8.161   2.346   1.00 0.00 ? 94  THR A CG2  3  
ATOM 4891  H H    . THR A 1 94  ? -11.997 11.683  0.244   1.00 0.00 ? 94  THR A H    3  
ATOM 4892  H HA   . THR A 1 94  ? -10.640 10.279  2.448   1.00 0.00 ? 94  THR A HA   3  
ATOM 4893  H HB   . THR A 1 94  ? -12.373 8.955   0.339   1.00 0.00 ? 94  THR A HB   3  
ATOM 4894  H HG1  . THR A 1 94  ? -13.156 10.349  2.802   1.00 0.00 ? 94  THR A HG1  3  
ATOM 4895  H HG21 . THR A 1 94  ? -12.737 8.373   3.222   1.00 0.00 ? 94  THR A HG21 3  
ATOM 4896  H HG22 . THR A 1 94  ? -12.473 7.245   1.871   1.00 0.00 ? 94  THR A HG22 3  
ATOM 4897  H HG23 . THR A 1 94  ? -11.085 8.039   2.652   1.00 0.00 ? 94  THR A HG23 3  
ATOM 4898  N N    . ILE A 1 95  ? -9.189  8.806   0.908   1.00 0.00 ? 95  ILE A N    3  
ATOM 4899  C CA   . ILE A 1 95  ? -8.066  8.310   0.131   1.00 0.00 ? 95  ILE A CA   3  
ATOM 4900  C C    . ILE A 1 95  ? -8.099  6.780   0.116   1.00 0.00 ? 95  ILE A C    3  
ATOM 4901  O O    . ILE A 1 95  ? -8.402  6.152   1.130   1.00 0.00 ? 95  ILE A O    3  
ATOM 4902  C CB   . ILE A 1 95  ? -6.752  8.892   0.655   1.00 0.00 ? 95  ILE A CB   3  
ATOM 4903  C CG1  . ILE A 1 95  ? -6.548  10.323  0.155   1.00 0.00 ? 95  ILE A CG1  3  
ATOM 4904  C CG2  . ILE A 1 95  ? -5.571  7.987   0.300   1.00 0.00 ? 95  ILE A CG2  3  
ATOM 4905  C CD1  . ILE A 1 95  ? -5.501  11.054  0.997   1.00 0.00 ? 95  ILE A CD1  3  
ATOM 4906  H H    . ILE A 1 95  ? -9.386  8.292   1.743   1.00 0.00 ? 95  ILE A H    3  
ATOM 4907  H HA   . ILE A 1 95  ? -8.192  8.668   -0.891  1.00 0.00 ? 95  ILE A HA   3  
ATOM 4908  H HB   . ILE A 1 95  ? -6.808  8.936   1.743   1.00 0.00 ? 95  ILE A HB   3  
ATOM 4909  H HG12 . ILE A 1 95  ? -6.234  10.306  -0.889  1.00 0.00 ? 95  ILE A HG12 3  
ATOM 4910  H HG13 . ILE A 1 95  ? -7.494  10.864  0.195   1.00 0.00 ? 95  ILE A HG13 3  
ATOM 4911  H HG21 . ILE A 1 95  ? -5.401  7.277   1.109   1.00 0.00 ? 95  ILE A HG21 3  
ATOM 4912  H HG22 . ILE A 1 95  ? -5.793  7.444   -0.619  1.00 0.00 ? 95  ILE A HG22 3  
ATOM 4913  H HG23 . ILE A 1 95  ? -4.678  8.595   0.156   1.00 0.00 ? 95  ILE A HG23 3  
ATOM 4914  H HD11 . ILE A 1 95  ? -5.882  12.035  1.280   1.00 0.00 ? 95  ILE A HD11 3  
ATOM 4915  H HD12 . ILE A 1 95  ? -5.287  10.474  1.895   1.00 0.00 ? 95  ILE A HD12 3  
ATOM 4916  H HD13 . ILE A 1 95  ? -4.586  11.174  0.416   1.00 0.00 ? 95  ILE A HD13 3  
ATOM 4917  N N    . LEU A 1 96  ? -7.783  6.224   -1.044  1.00 0.00 ? 96  LEU A N    3  
ATOM 4918  C CA   . LEU A 1 96  ? -7.772  4.780   -1.204  1.00 0.00 ? 96  LEU A CA   3  
ATOM 4919  C C    . LEU A 1 96  ? -6.333  4.305   -1.412  1.00 0.00 ? 96  LEU A C    3  
ATOM 4920  O O    . LEU A 1 96  ? -5.799  4.395   -2.517  1.00 0.00 ? 96  LEU A O    3  
ATOM 4921  C CB   . LEU A 1 96  ? -8.727  4.358   -2.323  1.00 0.00 ? 96  LEU A CB   3  
ATOM 4922  C CG   . LEU A 1 96  ? -8.715  2.872   -2.689  1.00 0.00 ? 96  LEU A CG   3  
ATOM 4923  C CD1  . LEU A 1 96  ? -9.262  2.020   -1.542  1.00 0.00 ? 96  LEU A CD1  3  
ATOM 4924  C CD2  . LEU A 1 96  ? -9.469  2.625   -3.998  1.00 0.00 ? 96  LEU A CD2  3  
ATOM 4925  H H    . LEU A 1 96  ? -7.538  6.742   -1.864  1.00 0.00 ? 96  LEU A H    3  
ATOM 4926  H HA   . LEU A 1 96  ? -8.149  4.346   -0.278  1.00 0.00 ? 96  LEU A HA   3  
ATOM 4927  H HB2  . LEU A 1 96  ? -9.741  4.632   -2.031  1.00 0.00 ? 96  LEU A HB2  3  
ATOM 4928  H HB3  . LEU A 1 96  ? -8.486  4.934   -3.216  1.00 0.00 ? 96  LEU A HB3  3  
ATOM 4929  H HG   . LEU A 1 96  ? -7.681  2.569   -2.851  1.00 0.00 ? 96  LEU A HG   3  
ATOM 4930  H HD11 . LEU A 1 96  ? -9.917  1.247   -1.944  1.00 0.00 ? 96  LEU A HD11 3  
ATOM 4931  H HD12 . LEU A 1 96  ? -8.433  1.553   -1.009  1.00 0.00 ? 96  LEU A HD12 3  
ATOM 4932  H HD13 . LEU A 1 96  ? -9.825  2.653   -0.856  1.00 0.00 ? 96  LEU A HD13 3  
ATOM 4933  H HD21 . LEU A 1 96  ? -10.298 3.327   -4.078  1.00 0.00 ? 96  LEU A HD21 3  
ATOM 4934  H HD22 . LEU A 1 96  ? -8.791  2.765   -4.840  1.00 0.00 ? 96  LEU A HD22 3  
ATOM 4935  H HD23 . LEU A 1 96  ? -9.854  1.605   -4.007  1.00 0.00 ? 96  LEU A HD23 3  
ATOM 4936  N N    . ALA A 1 97  ? -5.745  3.810   -0.333  1.00 0.00 ? 97  ALA A N    3  
ATOM 4937  C CA   . ALA A 1 97  ? -4.378  3.321   -0.383  1.00 0.00 ? 97  ALA A CA   3  
ATOM 4938  C C    . ALA A 1 97  ? -4.390  1.794   -0.482  1.00 0.00 ? 97  ALA A C    3  
ATOM 4939  O O    . ALA A 1 97  ? -5.438  1.167   -0.331  1.00 0.00 ? 97  ALA A O    3  
ATOM 4940  C CB   . ALA A 1 97  ? -3.611  3.819   0.844   1.00 0.00 ? 97  ALA A CB   3  
ATOM 4941  H H    . ALA A 1 97  ? -6.186  3.741   0.562   1.00 0.00 ? 97  ALA A H    3  
ATOM 4942  H HA   . ALA A 1 97  ? -3.911  3.731   -1.279  1.00 0.00 ? 97  ALA A HA   3  
ATOM 4943  H HB1  . ALA A 1 97  ? -2.817  3.114   1.087   1.00 0.00 ? 97  ALA A HB1  3  
ATOM 4944  H HB2  . ALA A 1 97  ? -3.177  4.796   0.629   1.00 0.00 ? 97  ALA A HB2  3  
ATOM 4945  H HB3  . ALA A 1 97  ? -4.294  3.904   1.689   1.00 0.00 ? 97  ALA A HB3  3  
ATOM 4946  N N    . GLN A 1 98  ? -3.214  1.239   -0.734  1.00 0.00 ? 98  GLN A N    3  
ATOM 4947  C CA   . GLN A 1 98  ? -3.076  -0.202  -0.854  1.00 0.00 ? 98  GLN A CA   3  
ATOM 4948  C C    . GLN A 1 98  ? -1.604  -0.605  -0.749  1.00 0.00 ? 98  GLN A C    3  
ATOM 4949  O O    . GLN A 1 98  ? -0.962  -0.892  -1.758  1.00 0.00 ? 98  GLN A O    3  
ATOM 4950  C CB   . GLN A 1 98  ? -3.690  -0.704  -2.162  1.00 0.00 ? 98  GLN A CB   3  
ATOM 4951  C CG   . GLN A 1 98  ? -3.549  -2.222  -2.288  1.00 0.00 ? 98  GLN A CG   3  
ATOM 4952  C CD   . GLN A 1 98  ? -4.169  -2.725  -3.593  1.00 0.00 ? 98  GLN A CD   3  
ATOM 4953  O OE1  . GLN A 1 98  ? -3.795  -2.325  -4.683  1.00 0.00 ? 98  GLN A OE1  3  
ATOM 4954  N NE2  . GLN A 1 98  ? -5.136  -3.623  -3.421  1.00 0.00 ? 98  GLN A NE2  3  
ATOM 4955  H H    . GLN A 1 98  ? -2.366  1.756   -0.855  1.00 0.00 ? 98  GLN A H    3  
ATOM 4956  H HA   . GLN A 1 98  ? -3.634  -0.617  -0.015  1.00 0.00 ? 98  GLN A HA   3  
ATOM 4957  H HB2  . GLN A 1 98  ? -4.744  -0.429  -2.203  1.00 0.00 ? 98  GLN A HB2  3  
ATOM 4958  H HB3  . GLN A 1 98  ? -3.202  -0.219  -3.007  1.00 0.00 ? 98  GLN A HB3  3  
ATOM 4959  H HG2  . GLN A 1 98  ? -2.494  -2.497  -2.252  1.00 0.00 ? 98  GLN A HG2  3  
ATOM 4960  H HG3  . GLN A 1 98  ? -4.033  -2.707  -1.440  1.00 0.00 ? 98  GLN A HG3  3  
ATOM 4961  H HE21 . GLN A 1 98  ? -5.395  -3.909  -2.499  1.00 0.00 ? 98  GLN A HE21 3  
ATOM 4962  H HE22 . GLN A 1 98  ? -5.603  -4.011  -4.215  1.00 0.00 ? 98  GLN A HE22 3  
ATOM 4963  N N    . TYR A 1 99  ? -1.113  -0.615  0.481   1.00 0.00 ? 99  TYR A N    3  
ATOM 4964  C CA   . TYR A 1 99  ? 0.272   -0.979  0.731   1.00 0.00 ? 99  TYR A CA   3  
ATOM 4965  C C    . TYR A 1 99  ? 0.696   -2.157  -0.148  1.00 0.00 ? 99  TYR A C    3  
ATOM 4966  O O    . TYR A 1 99  ? -0.034  -3.139  -0.271  1.00 0.00 ? 99  TYR A O    3  
ATOM 4967  C CB   . TYR A 1 99  ? 0.338   -1.403  2.199   1.00 0.00 ? 99  TYR A CB   3  
ATOM 4968  C CG   . TYR A 1 99  ? 1.741   -1.786  2.674   1.00 0.00 ? 99  TYR A CG   3  
ATOM 4969  C CD1  . TYR A 1 99  ? 2.310   -2.973  2.258   1.00 0.00 ? 99  TYR A CD1  3  
ATOM 4970  C CD2  . TYR A 1 99  ? 2.438   -0.946  3.518   1.00 0.00 ? 99  TYR A CD2  3  
ATOM 4971  C CE1  . TYR A 1 99  ? 3.631   -3.334  2.704   1.00 0.00 ? 99  TYR A CE1  3  
ATOM 4972  C CE2  . TYR A 1 99  ? 3.759   -1.306  3.964   1.00 0.00 ? 99  TYR A CE2  3  
ATOM 4973  C CZ   . TYR A 1 99  ? 4.290   -2.482  3.536   1.00 0.00 ? 99  TYR A CZ   3  
ATOM 4974  O OH   . TYR A 1 99  ? 5.537   -2.823  3.957   1.00 0.00 ? 99  TYR A OH   3  
ATOM 4975  H H    . TYR A 1 99  ? -1.642  -0.381  1.297   1.00 0.00 ? 99  TYR A H    3  
ATOM 4976  H HA   . TYR A 1 99  ? 0.894   -0.116  0.494   1.00 0.00 ? 99  TYR A HA   3  
ATOM 4977  H HB2  . TYR A 1 99  ? -0.034  -0.588  2.820   1.00 0.00 ? 99  TYR A HB2  3  
ATOM 4978  H HB3  . TYR A 1 99  ? -0.330  -2.251  2.353   1.00 0.00 ? 99  TYR A HB3  3  
ATOM 4979  H HD1  . TYR A 1 99  ? 1.760   -3.637  1.591   1.00 0.00 ? 99  TYR A HD1  3  
ATOM 4980  H HD2  . TYR A 1 99  ? 1.988   -0.009  3.847   1.00 0.00 ? 99  TYR A HD2  3  
ATOM 4981  H HE1  . TYR A 1 99  ? 4.092   -4.268  2.383   1.00 0.00 ? 99  TYR A HE1  3  
ATOM 4982  H HE2  . TYR A 1 99  ? 4.320   -0.651  4.631   1.00 0.00 ? 99  TYR A HE2  3  
ATOM 4983  H HH   . TYR A 1 99  ? 6.205   -2.158  3.622   1.00 0.00 ? 99  TYR A HH   3  
ATOM 4984  N N    . ASN A 1 100 ? 1.876   -2.021  -0.736  1.00 0.00 ? 100 ASN A N    3  
ATOM 4985  C CA   . ASN A 1 100 ? 2.406   -3.062  -1.599  1.00 0.00 ? 100 ASN A CA   3  
ATOM 4986  C C    . ASN A 1 100 ? 3.811   -3.442  -1.128  1.00 0.00 ? 100 ASN A C    3  
ATOM 4987  O O    . ASN A 1 100 ? 4.734   -2.633  -1.199  1.00 0.00 ? 100 ASN A O    3  
ATOM 4988  C CB   . ASN A 1 100 ? 2.508   -2.578  -3.047  1.00 0.00 ? 100 ASN A CB   3  
ATOM 4989  C CG   . ASN A 1 100 ? 2.892   -3.726  -3.983  1.00 0.00 ? 100 ASN A CG   3  
ATOM 4990  O OD1  . ASN A 1 100 ? 2.529   -4.873  -3.782  1.00 0.00 ? 100 ASN A OD1  3  
ATOM 4991  N ND2  . ASN A 1 100 ? 3.644   -3.354  -5.015  1.00 0.00 ? 100 ASN A ND2  3  
ATOM 4992  H H    . ASN A 1 100 ? 2.464   -1.219  -0.630  1.00 0.00 ? 100 ASN A H    3  
ATOM 4993  H HA   . ASN A 1 100 ? 1.701   -3.889  -1.518  1.00 0.00 ? 100 ASN A HA   3  
ATOM 4994  H HB2  . ASN A 1 100 ? 1.555   -2.152  -3.360  1.00 0.00 ? 100 ASN A HB2  3  
ATOM 4995  H HB3  . ASN A 1 100 ? 3.251   -1.783  -3.117  1.00 0.00 ? 100 ASN A HB3  3  
ATOM 4996  H HD21 . ASN A 1 100 ? 3.907   -2.395  -5.122  1.00 0.00 ? 100 ASN A HD21 3  
ATOM 4997  H HD22 . ASN A 1 100 ? 3.946   -4.033  -5.684  1.00 0.00 ? 100 ASN A HD22 3  
ATOM 4998  N N    . PRO A 1 101 ? 3.933   -4.708  -0.646  1.00 0.00 ? 101 PRO A N    3  
ATOM 4999  C CA   . PRO A 1 101 ? 5.210   -5.206  -0.163  1.00 0.00 ? 101 PRO A CA   3  
ATOM 5000  C C    . PRO A 1 101 ? 6.150   -5.523  -1.328  1.00 0.00 ? 101 PRO A C    3  
ATOM 5001  O O    . PRO A 1 101 ? 6.663   -6.636  -1.431  1.00 0.00 ? 101 PRO A O    3  
ATOM 5002  C CB   . PRO A 1 101 ? 4.865   -6.428  0.672   1.00 0.00 ? 101 PRO A CB   3  
ATOM 5003  C CG   . PRO A 1 101 ? 3.465   -6.841  0.248   1.00 0.00 ? 101 PRO A CG   3  
ATOM 5004  C CD   . PRO A 1 101 ? 2.861   -5.695  -0.547  1.00 0.00 ? 101 PRO A CD   3  
ATOM 5005  H HA   . PRO A 1 101 ? 5.673   -4.505  0.379   1.00 0.00 ? 101 PRO A HA   3  
ATOM 5006  H HB2  . PRO A 1 101 ? 5.579   -7.234  0.498   1.00 0.00 ? 101 PRO A HB2  3  
ATOM 5007  H HB3  . PRO A 1 101 ? 4.899   -6.197  1.736   1.00 0.00 ? 101 PRO A HB3  3  
ATOM 5008  H HG2  . PRO A 1 101 ? 3.500   -7.748  -0.355  1.00 0.00 ? 101 PRO A HG2  3  
ATOM 5009  H HG3  . PRO A 1 101 ? 2.852   -7.064  1.122   1.00 0.00 ? 101 PRO A HG3  3  
ATOM 5010  H HD2  . PRO A 1 101 ? 2.536   -6.026  -1.533  1.00 0.00 ? 101 PRO A HD2  3  
ATOM 5011  H HD3  . PRO A 1 101 ? 1.987   -5.282  -0.044  1.00 0.00 ? 101 PRO A HD3  3  
ATOM 5012  N N    . HIS A 1 102 ? 6.348   -4.524  -2.175  1.00 0.00 ? 102 HIS A N    3  
ATOM 5013  C CA   . HIS A 1 102 ? 7.218   -4.682  -3.329  1.00 0.00 ? 102 HIS A CA   3  
ATOM 5014  C C    . HIS A 1 102 ? 7.550   -3.308  -3.913  1.00 0.00 ? 102 HIS A C    3  
ATOM 5015  O O    . HIS A 1 102 ? 7.230   -3.027  -5.067  1.00 0.00 ? 102 HIS A O    3  
ATOM 5016  C CB   . HIS A 1 102 ? 6.592   -5.628  -4.355  1.00 0.00 ? 102 HIS A CB   3  
ATOM 5017  C CG   . HIS A 1 102 ? 7.438   -6.838  -4.673  1.00 0.00 ? 102 HIS A CG   3  
ATOM 5018  N ND1  . HIS A 1 102 ? 8.619   -6.759  -5.390  1.00 0.00 ? 102 HIS A ND1  3  
ATOM 5019  C CD2  . HIS A 1 102 ? 7.263   -8.154  -4.363  1.00 0.00 ? 102 HIS A CD2  3  
ATOM 5020  C CE1  . HIS A 1 102 ? 9.123   -7.979  -5.501  1.00 0.00 ? 102 HIS A CE1  3  
ATOM 5021  N NE2  . HIS A 1 102 ? 8.281   -8.843  -4.864  1.00 0.00 ? 102 HIS A NE2  3  
ATOM 5022  H H    . HIS A 1 102 ? 5.927   -3.622  -2.084  1.00 0.00 ? 102 HIS A H    3  
ATOM 5023  H HA   . HIS A 1 102 ? 8.136   -5.145  -2.967  1.00 0.00 ? 102 HIS A HA   3  
ATOM 5024  H HB2  . HIS A 1 102 ? 5.623   -5.963  -3.983  1.00 0.00 ? 102 HIS A HB2  3  
ATOM 5025  H HB3  . HIS A 1 102 ? 6.405   -5.076  -5.277  1.00 0.00 ? 102 HIS A HB3  3  
ATOM 5026  H HD1  . HIS A 1 102 ? 9.024   -5.923  -5.760  1.00 0.00 ? 102 HIS A HD1  3  
ATOM 5027  H HD2  . HIS A 1 102 ? 6.428   -8.570  -3.799  1.00 0.00 ? 102 HIS A HD2  3  
ATOM 5028  H HE1  . HIS A 1 102 ? 10.049  -8.246  -6.011  1.00 0.00 ? 102 HIS A HE1  3  
ATOM 5029  N N    . VAL A 1 103 ? 8.187   -2.489  -3.090  1.00 0.00 ? 103 VAL A N    3  
ATOM 5030  C CA   . VAL A 1 103 ? 8.566   -1.151  -3.511  1.00 0.00 ? 103 VAL A CA   3  
ATOM 5031  C C    . VAL A 1 103 ? 9.829   -0.723  -2.760  1.00 0.00 ? 103 VAL A C    3  
ATOM 5032  O O    . VAL A 1 103 ? 9.893   -0.826  -1.536  1.00 0.00 ? 103 VAL A O    3  
ATOM 5033  C CB   . VAL A 1 103 ? 7.395   -0.187  -3.309  1.00 0.00 ? 103 VAL A CB   3  
ATOM 5034  C CG1  . VAL A 1 103 ? 7.824   1.259   -3.567  1.00 0.00 ? 103 VAL A CG1  3  
ATOM 5035  C CG2  . VAL A 1 103 ? 6.208   -0.573  -4.194  1.00 0.00 ? 103 VAL A CG2  3  
ATOM 5036  H H    . VAL A 1 103 ? 8.443   -2.725  -2.153  1.00 0.00 ? 103 VAL A H    3  
ATOM 5037  H HA   . VAL A 1 103 ? 8.789   -1.192  -4.577  1.00 0.00 ? 103 VAL A HA   3  
ATOM 5038  H HB   . VAL A 1 103 ? 7.076   -0.261  -2.269  1.00 0.00 ? 103 VAL A HB   3  
ATOM 5039  H HG11 . VAL A 1 103 ? 7.176   1.701   -4.324  1.00 0.00 ? 103 VAL A HG11 3  
ATOM 5040  H HG12 . VAL A 1 103 ? 7.746   1.831   -2.642  1.00 0.00 ? 103 VAL A HG12 3  
ATOM 5041  H HG13 . VAL A 1 103 ? 8.856   1.275   -3.917  1.00 0.00 ? 103 VAL A HG13 3  
ATOM 5042  H HG21 . VAL A 1 103 ? 5.658   -1.390  -3.727  1.00 0.00 ? 103 VAL A HG21 3  
ATOM 5043  H HG22 . VAL A 1 103 ? 5.550   0.287   -4.314  1.00 0.00 ? 103 VAL A HG22 3  
ATOM 5044  H HG23 . VAL A 1 103 ? 6.572   -0.891  -5.171  1.00 0.00 ? 103 VAL A HG23 3  
ATOM 5045  N N    . HIS A 1 104 ? 10.803  -0.252  -3.526  1.00 0.00 ? 104 HIS A N    3  
ATOM 5046  C CA   . HIS A 1 104 ? 12.060  0.192   -2.948  1.00 0.00 ? 104 HIS A CA   3  
ATOM 5047  C C    . HIS A 1 104 ? 12.946  0.787   -4.044  1.00 0.00 ? 104 HIS A C    3  
ATOM 5048  O O    . HIS A 1 104 ? 13.835  0.113   -4.563  1.00 0.00 ? 104 HIS A O    3  
ATOM 5049  C CB   . HIS A 1 104 ? 12.741  -0.948  -2.189  1.00 0.00 ? 104 HIS A CB   3  
ATOM 5050  C CG   . HIS A 1 104 ? 13.782  -0.489  -1.195  1.00 0.00 ? 104 HIS A CG   3  
ATOM 5051  N ND1  . HIS A 1 104 ? 14.663  -1.359  -0.577  1.00 0.00 ? 104 HIS A ND1  3  
ATOM 5052  C CD2  . HIS A 1 104 ? 14.073  0.756   -0.721  1.00 0.00 ? 104 HIS A CD2  3  
ATOM 5053  C CE1  . HIS A 1 104 ? 15.444  -0.657  0.232   1.00 0.00 ? 104 HIS A CE1  3  
ATOM 5054  N NE2  . HIS A 1 104 ? 15.077  0.653   0.141   1.00 0.00 ? 104 HIS A NE2  3  
ATOM 5055  H H    . HIS A 1 104 ? 10.743  -0.171  -4.521  1.00 0.00 ? 104 HIS A H    3  
ATOM 5056  H HA   . HIS A 1 104 ? 11.815  0.972   -2.227  1.00 0.00 ? 104 HIS A HA   3  
ATOM 5057  H HB2  . HIS A 1 104 ? 11.981  -1.526  -1.662  1.00 0.00 ? 104 HIS A HB2  3  
ATOM 5058  H HB3  . HIS A 1 104 ? 13.211  -1.620  -2.907  1.00 0.00 ? 104 HIS A HB3  3  
ATOM 5059  H HD1  . HIS A 1 104 ? 14.703  -2.348  -0.716  1.00 0.00 ? 104 HIS A HD1  3  
ATOM 5060  H HD2  . HIS A 1 104 ? 13.567  1.680   -1.003  1.00 0.00 ? 104 HIS A HD2  3  
ATOM 5061  H HE1  . HIS A 1 104 ? 16.241  -1.057  0.859   1.00 0.00 ? 104 HIS A HE1  3  
ATOM 5062  N N    . GLN A 1 105 ? 12.673  2.043   -4.364  1.00 0.00 ? 105 GLN A N    3  
ATOM 5063  C CA   . GLN A 1 105 ? 13.435  2.737   -5.389  1.00 0.00 ? 105 GLN A CA   3  
ATOM 5064  C C    . GLN A 1 105 ? 14.139  3.957   -4.792  1.00 0.00 ? 105 GLN A C    3  
ATOM 5065  O O    . GLN A 1 105 ? 13.940  4.283   -3.622  1.00 0.00 ? 105 GLN A O    3  
ATOM 5066  C CB   . GLN A 1 105 ? 12.537  3.141   -6.560  1.00 0.00 ? 105 GLN A CB   3  
ATOM 5067  C CG   . GLN A 1 105 ? 12.530  2.060   -7.643  1.00 0.00 ? 105 GLN A CG   3  
ATOM 5068  C CD   . GLN A 1 105 ? 13.361  2.492   -8.853  1.00 0.00 ? 105 GLN A CD   3  
ATOM 5069  O OE1  . GLN A 1 105 ? 14.566  2.307   -8.909  1.00 0.00 ? 105 GLN A OE1  3  
ATOM 5070  N NE2  . GLN A 1 105 ? 12.653  3.075   -9.816  1.00 0.00 ? 105 GLN A NE2  3  
ATOM 5071  H H    . GLN A 1 105 ? 11.949  2.584   -3.937  1.00 0.00 ? 105 GLN A H    3  
ATOM 5072  H HA   . GLN A 1 105 ? 14.175  2.017   -5.737  1.00 0.00 ? 105 GLN A HA   3  
ATOM 5073  H HB2  . GLN A 1 105 ? 11.521  3.309   -6.203  1.00 0.00 ? 105 GLN A HB2  3  
ATOM 5074  H HB3  . GLN A 1 105 ? 12.887  4.083   -6.983  1.00 0.00 ? 105 GLN A HB3  3  
ATOM 5075  H HG2  . GLN A 1 105 ? 12.928  1.130   -7.237  1.00 0.00 ? 105 GLN A HG2  3  
ATOM 5076  H HG3  . GLN A 1 105 ? 11.505  1.860   -7.955  1.00 0.00 ? 105 GLN A HG3  3  
ATOM 5077  H HE21 . GLN A 1 105 ? 11.667  3.196   -9.707  1.00 0.00 ? 105 GLN A HE21 3  
ATOM 5078  H HE22 . GLN A 1 105 ? 13.108  3.392   -10.648 1.00 0.00 ? 105 GLN A HE22 3  
ATOM 5079  N N    . LEU A 1 106 ? 14.948  4.599   -5.622  1.00 0.00 ? 106 LEU A N    3  
ATOM 5080  C CA   . LEU A 1 106 ? 15.683  5.775   -5.191  1.00 0.00 ? 106 LEU A CA   3  
ATOM 5081  C C    . LEU A 1 106 ? 16.566  5.411   -3.996  1.00 0.00 ? 106 LEU A C    3  
ATOM 5082  O O    . LEU A 1 106 ? 16.424  4.333   -3.421  1.00 0.00 ? 106 LEU A O    3  
ATOM 5083  C CB   . LEU A 1 106 ? 14.724  6.935   -4.916  1.00 0.00 ? 106 LEU A CB   3  
ATOM 5084  C CG   . LEU A 1 106 ? 14.732  8.070   -5.941  1.00 0.00 ? 106 LEU A CG   3  
ATOM 5085  C CD1  . LEU A 1 106 ? 13.538  9.004   -5.734  1.00 0.00 ? 106 LEU A CD1  3  
ATOM 5086  C CD2  . LEU A 1 106 ? 16.062  8.826   -5.914  1.00 0.00 ? 106 LEU A CD2  3  
ATOM 5087  H H    . LEU A 1 106 ? 15.104  4.327   -6.572  1.00 0.00 ? 106 LEU A H    3  
ATOM 5088  H HA   . LEU A 1 106 ? 16.327  6.079   -6.017  1.00 0.00 ? 106 LEU A HA   3  
ATOM 5089  H HB2  . LEU A 1 106 ? 13.712  6.536   -4.852  1.00 0.00 ? 106 LEU A HB2  3  
ATOM 5090  H HB3  . LEU A 1 106 ? 14.963  7.354   -3.938  1.00 0.00 ? 106 LEU A HB3  3  
ATOM 5091  H HG   . LEU A 1 106 ? 14.630  7.633   -6.935  1.00 0.00 ? 106 LEU A HG   3  
ATOM 5092  H HD11 . LEU A 1 106 ? 12.927  8.636   -4.910  1.00 0.00 ? 106 LEU A HD11 3  
ATOM 5093  H HD12 . LEU A 1 106 ? 13.897  10.007  -5.501  1.00 0.00 ? 106 LEU A HD12 3  
ATOM 5094  H HD13 . LEU A 1 106 ? 12.939  9.035   -6.644  1.00 0.00 ? 106 LEU A HD13 3  
ATOM 5095  H HD21 . LEU A 1 106 ? 16.226  9.308   -6.877  1.00 0.00 ? 106 LEU A HD21 3  
ATOM 5096  H HD22 . LEU A 1 106 ? 16.034  9.581   -5.129  1.00 0.00 ? 106 LEU A HD22 3  
ATOM 5097  H HD23 . LEU A 1 106 ? 16.873  8.125   -5.715  1.00 0.00 ? 106 LEU A HD23 3  
ATOM 5098  N N    . SER A 1 107 ? 17.459  6.329   -3.659  1.00 0.00 ? 107 SER A N    3  
ATOM 5099  C CA   . SER A 1 107 ? 18.366  6.118   -2.543  1.00 0.00 ? 107 SER A CA   3  
ATOM 5100  C C    . SER A 1 107 ? 18.539  7.418   -1.756  1.00 0.00 ? 107 SER A C    3  
ATOM 5101  O O    . SER A 1 107 ? 18.197  7.484   -0.576  1.00 0.00 ? 107 SER A O    3  
ATOM 5102  C CB   . SER A 1 107 ? 19.724  5.605   -3.026  1.00 0.00 ? 107 SER A CB   3  
ATOM 5103  O OG   . SER A 1 107 ? 19.920  4.230   -2.707  1.00 0.00 ? 107 SER A OG   3  
ATOM 5104  H H    . SER A 1 107 ? 17.569  7.203   -4.132  1.00 0.00 ? 107 SER A H    3  
ATOM 5105  H HA   . SER A 1 107 ? 17.890  5.357   -1.925  1.00 0.00 ? 107 SER A HA   3  
ATOM 5106  H HB2  . SER A 1 107 ? 19.800  5.741   -4.105  1.00 0.00 ? 107 SER A HB2  3  
ATOM 5107  H HB3  . SER A 1 107 ? 20.518  6.199   -2.573  1.00 0.00 ? 107 SER A HB3  3  
ATOM 5108  H HG   . SER A 1 107 ? 20.131  3.714   -3.536  1.00 0.00 ? 107 SER A HG   3  
ATOM 5109  N N    . SER A 1 108 ? 19.068  8.421   -2.440  1.00 0.00 ? 108 SER A N    3  
ATOM 5110  C CA   . SER A 1 108 ? 19.291  9.716   -1.820  1.00 0.00 ? 108 SER A CA   3  
ATOM 5111  C C    . SER A 1 108 ? 19.771  10.723  -2.867  1.00 0.00 ? 108 SER A C    3  
ATOM 5112  O O    . SER A 1 108 ? 20.240  10.336  -3.936  1.00 0.00 ? 108 SER A O    3  
ATOM 5113  C CB   . SER A 1 108 ? 20.305  9.613   -0.678  1.00 0.00 ? 108 SER A CB   3  
ATOM 5114  O OG   . SER A 1 108 ? 20.507  10.866  -0.030  1.00 0.00 ? 108 SER A OG   3  
ATOM 5115  H H    . SER A 1 108 ? 19.343  8.360   -3.400  1.00 0.00 ? 108 SER A H    3  
ATOM 5116  H HA   . SER A 1 108 ? 18.322  10.014  -1.418  1.00 0.00 ? 108 SER A HA   3  
ATOM 5117  H HB2  . SER A 1 108 ? 19.958  8.880   0.050   1.00 0.00 ? 108 SER A HB2  3  
ATOM 5118  H HB3  . SER A 1 108 ? 21.255  9.249   -1.070  1.00 0.00 ? 108 SER A HB3  3  
ATOM 5119  H HG   . SER A 1 108 ? 21.195  10.770  0.690   1.00 0.00 ? 108 SER A HG   3  
ATOM 5120  N N    . HIS A 1 109 ? 19.636  11.995  -2.523  1.00 0.00 ? 109 HIS A N    3  
ATOM 5121  C CA   . HIS A 1 109 ? 20.050  13.061  -3.420  1.00 0.00 ? 109 HIS A CA   3  
ATOM 5122  C C    . HIS A 1 109 ? 19.782  14.417  -2.765  1.00 0.00 ? 109 HIS A C    3  
ATOM 5123  O O    . HIS A 1 109 ? 18.700  14.982  -2.918  1.00 0.00 ? 109 HIS A O    3  
ATOM 5124  C CB   . HIS A 1 109 ? 19.371  12.917  -4.784  1.00 0.00 ? 109 HIS A CB   3  
ATOM 5125  C CG   . HIS A 1 109 ? 17.866  12.824  -4.714  1.00 0.00 ? 109 HIS A CG   3  
ATOM 5126  N ND1  . HIS A 1 109 ? 17.199  11.641  -4.448  1.00 0.00 ? 109 HIS A ND1  3  
ATOM 5127  C CD2  . HIS A 1 109 ? 16.905  13.779  -4.877  1.00 0.00 ? 109 HIS A CD2  3  
ATOM 5128  C CE1  . HIS A 1 109 ? 15.897  11.884  -4.454  1.00 0.00 ? 109 HIS A CE1  3  
ATOM 5129  N NE2  . HIS A 1 109 ? 15.717  13.210  -4.720  1.00 0.00 ? 109 HIS A NE2  3  
ATOM 5130  H H    . HIS A 1 109 ? 19.253  12.302  -1.652  1.00 0.00 ? 109 HIS A H    3  
ATOM 5131  H HA   . HIS A 1 109 ? 21.123  12.944  -3.570  1.00 0.00 ? 109 HIS A HA   3  
ATOM 5132  H HB2  . HIS A 1 109 ? 19.644  13.770  -5.406  1.00 0.00 ? 109 HIS A HB2  3  
ATOM 5133  H HB3  . HIS A 1 109 ? 19.757  12.026  -5.278  1.00 0.00 ? 109 HIS A HB3  3  
ATOM 5134  H HD1  . HIS A 1 109 ? 17.627  10.753  -4.280  1.00 0.00 ? 109 HIS A HD1  3  
ATOM 5135  H HD2  . HIS A 1 109 ? 17.084  14.831  -5.098  1.00 0.00 ? 109 HIS A HD2  3  
ATOM 5136  H HE1  . HIS A 1 109 ? 15.107  11.154  -4.277  1.00 0.00 ? 109 HIS A HE1  3  
ATOM 5137  N N    . SER A 1 110 ? 20.786  14.900  -2.048  1.00 0.00 ? 110 SER A N    3  
ATOM 5138  C CA   . SER A 1 110 ? 20.673  16.180  -1.369  1.00 0.00 ? 110 SER A CA   3  
ATOM 5139  C C    . SER A 1 110 ? 22.046  16.849  -1.281  1.00 0.00 ? 110 SER A C    3  
ATOM 5140  O O    . SER A 1 110 ? 23.073  16.187  -1.421  1.00 0.00 ? 110 SER A O    3  
ATOM 5141  C CB   . SER A 1 110 ? 20.075  16.010  0.029   1.00 0.00 ? 110 SER A CB   3  
ATOM 5142  O OG   . SER A 1 110 ? 18.653  16.100  0.016   1.00 0.00 ? 110 SER A OG   3  
ATOM 5143  H H    . SER A 1 110 ? 21.663  14.435  -1.929  1.00 0.00 ? 110 SER A H    3  
ATOM 5144  H HA   . SER A 1 110 ? 19.996  16.774  -1.983  1.00 0.00 ? 110 SER A HA   3  
ATOM 5145  H HB2  . SER A 1 110 ? 20.373  15.043  0.436   1.00 0.00 ? 110 SER A HB2  3  
ATOM 5146  H HB3  . SER A 1 110 ? 20.481  16.773  0.693   1.00 0.00 ? 110 SER A HB3  3  
ATOM 5147  H HG   . SER A 1 110 ? 18.306  16.169  0.952   1.00 0.00 ? 110 SER A HG   3  
ATOM 5148  N N    . ARG A 1 111 ? 22.019  18.153  -1.050  1.00 0.00 ? 111 ARG A N    3  
ATOM 5149  C CA   . ARG A 1 111 ? 23.249  18.920  -0.942  1.00 0.00 ? 111 ARG A CA   3  
ATOM 5150  C C    . ARG A 1 111 ? 22.987  20.247  -0.227  1.00 0.00 ? 111 ARG A C    3  
ATOM 5151  O O    . ARG A 1 111 ? 22.420  21.169  -0.811  1.00 0.00 ? 111 ARG A O    3  
ATOM 5152  C CB   . ARG A 1 111 ? 23.846  19.201  -2.322  1.00 0.00 ? 111 ARG A CB   3  
ATOM 5153  C CG   . ARG A 1 111 ? 25.335  18.853  -2.358  1.00 0.00 ? 111 ARG A CG   3  
ATOM 5154  C CD   . ARG A 1 111 ? 26.080  19.732  -3.364  1.00 0.00 ? 111 ARG A CD   3  
ATOM 5155  N NE   . ARG A 1 111 ? 26.177  19.039  -4.668  1.00 0.00 ? 111 ARG A NE   3  
ATOM 5156  C CZ   . ARG A 1 111 ? 27.011  19.402  -5.651  1.00 0.00 ? 111 ARG A CZ   3  
ATOM 5157  N NH1  . ARG A 1 111 ? 27.826  20.452  -5.485  1.00 0.00 ? 111 ARG A NH1  3  
ATOM 5158  N NH2  . ARG A 1 111 ? 27.030  18.715  -6.802  1.00 0.00 ? 111 ARG A NH2  3  
ATOM 5159  H H    . ARG A 1 111 ? 21.179  18.684  -0.937  1.00 0.00 ? 111 ARG A H    3  
ATOM 5160  H HA   . ARG A 1 111 ? 23.921  18.288  -0.361  1.00 0.00 ? 111 ARG A HA   3  
ATOM 5161  H HB2  . ARG A 1 111 ? 23.315  18.621  -3.077  1.00 0.00 ? 111 ARG A HB2  3  
ATOM 5162  H HB3  . ARG A 1 111 ? 23.709  20.253  -2.574  1.00 0.00 ? 111 ARG A HB3  3  
ATOM 5163  H HG2  . ARG A 1 111 ? 25.766  18.983  -1.365  1.00 0.00 ? 111 ARG A HG2  3  
ATOM 5164  H HG3  . ARG A 1 111 ? 25.460  17.803  -2.624  1.00 0.00 ? 111 ARG A HG3  3  
ATOM 5165  H HD2  . ARG A 1 111 ? 25.560  20.682  -3.484  1.00 0.00 ? 111 ARG A HD2  3  
ATOM 5166  H HD3  . ARG A 1 111 ? 27.078  19.961  -2.989  1.00 0.00 ? 111 ARG A HD3  3  
ATOM 5167  H HE   . ARG A 1 111 ? 25.582  18.251  -4.825  1.00 0.00 ? 111 ARG A HE   3  
ATOM 5168  H HH11 . ARG A 1 111 ? 27.812  20.966  -4.627  1.00 0.00 ? 111 ARG A HH11 3  
ATOM 5169  H HH12 . ARG A 1 111 ? 28.449  20.723  -6.219  1.00 0.00 ? 111 ARG A HH12 3  
ATOM 5170  H HH21 . ARG A 1 111 ? 26.422  17.931  -6.926  1.00 0.00 ? 111 ARG A HH21 3  
ATOM 5171  H HH22 . ARG A 1 111 ? 27.653  18.986  -7.536  1.00 0.00 ? 111 ARG A HH22 3  
ATOM 5172  N N    . SER A 1 112 ? 23.411  20.301  1.027   1.00 0.00 ? 112 SER A N    3  
ATOM 5173  C CA   . SER A 1 112 ? 23.229  21.499  1.828   1.00 0.00 ? 112 SER A CA   3  
ATOM 5174  C C    . SER A 1 112 ? 24.335  22.509  1.517   1.00 0.00 ? 112 SER A C    3  
ATOM 5175  O O    . SER A 1 112 ? 25.356  22.156  0.929   1.00 0.00 ? 112 SER A O    3  
ATOM 5176  C CB   . SER A 1 112 ? 23.217  21.168  3.321   1.00 0.00 ? 112 SER A CB   3  
ATOM 5177  O OG   . SER A 1 112 ? 21.953  20.668  3.748   1.00 0.00 ? 112 SER A OG   3  
ATOM 5178  H H    . SER A 1 112 ? 23.870  19.546  1.495   1.00 0.00 ? 112 SER A H    3  
ATOM 5179  H HA   . SER A 1 112 ? 22.256  21.896  1.537   1.00 0.00 ? 112 SER A HA   3  
ATOM 5180  H HB2  . SER A 1 112 ? 23.990  20.429  3.534   1.00 0.00 ? 112 SER A HB2  3  
ATOM 5181  H HB3  . SER A 1 112 ? 23.465  22.062  3.893   1.00 0.00 ? 112 SER A HB3  3  
ATOM 5182  H HG   . SER A 1 112 ? 21.531  20.135  3.014   1.00 0.00 ? 112 SER A HG   3  
ATOM 5183  N N    . GLY A 1 113 ? 24.095  23.746  1.926   1.00 0.00 ? 113 GLY A N    3  
ATOM 5184  C CA   . GLY A 1 113 ? 25.058  24.810  1.698   1.00 0.00 ? 113 GLY A CA   3  
ATOM 5185  C C    . GLY A 1 113 ? 25.424  25.508  3.010   1.00 0.00 ? 113 GLY A C    3  
ATOM 5186  O O    . GLY A 1 113 ? 24.792  26.492  3.391   1.00 0.00 ? 113 GLY A O    3  
ATOM 5187  H H    . GLY A 1 113 ? 23.262  24.026  2.404   1.00 0.00 ? 113 GLY A H    3  
ATOM 5188  H HA2  . GLY A 1 113 ? 25.957  24.400  1.237   1.00 0.00 ? 113 GLY A HA2  3  
ATOM 5189  H HA3  . GLY A 1 113 ? 24.645  25.537  0.999   1.00 0.00 ? 113 GLY A HA3  3  
ATOM 5190  N N    . PRO A 1 114 ? 26.471  24.957  3.681   1.00 0.00 ? 114 PRO A N    3  
ATOM 5191  C CA   . PRO A 1 114 ? 26.929  25.516  4.941   1.00 0.00 ? 114 PRO A CA   3  
ATOM 5192  C C    . PRO A 1 114 ? 27.711  26.812  4.715   1.00 0.00 ? 114 PRO A C    3  
ATOM 5193  O O    . PRO A 1 114 ? 28.854  26.780  4.262   1.00 0.00 ? 114 PRO A O    3  
ATOM 5194  C CB   . PRO A 1 114 ? 27.768  24.419  5.576   1.00 0.00 ? 114 PRO A CB   3  
ATOM 5195  C CG   . PRO A 1 114 ? 28.132  23.468  4.449   1.00 0.00 ? 114 PRO A CG   3  
ATOM 5196  C CD   . PRO A 1 114 ? 27.244  23.793  3.259   1.00 0.00 ? 114 PRO A CD   3  
ATOM 5197  H HA   . PRO A 1 114 ? 26.149  25.765  5.515   1.00 0.00 ? 114 PRO A HA   3  
ATOM 5198  H HB2  . PRO A 1 114 ? 28.663  24.832  6.043   1.00 0.00 ? 114 PRO A HB2  3  
ATOM 5199  H HB3  . PRO A 1 114 ? 27.210  23.904  6.358   1.00 0.00 ? 114 PRO A HB3  3  
ATOM 5200  H HG2  . PRO A 1 114 ? 29.183  23.577  4.181   1.00 0.00 ? 114 PRO A HG2  3  
ATOM 5201  H HG3  . PRO A 1 114 ? 27.989  22.433  4.761   1.00 0.00 ? 114 PRO A HG3  3  
ATOM 5202  H HD2  . PRO A 1 114 ? 27.836  24.011  2.370   1.00 0.00 ? 114 PRO A HD2  3  
ATOM 5203  H HD3  . PRO A 1 114 ? 26.593  22.955  3.011   1.00 0.00 ? 114 PRO A HD3  3  
ATOM 5204  N N    . SER A 1 115 ? 27.063  27.921  5.040   1.00 0.00 ? 115 SER A N    3  
ATOM 5205  C CA   . SER A 1 115 ? 27.683  29.225  4.878   1.00 0.00 ? 115 SER A CA   3  
ATOM 5206  C C    . SER A 1 115 ? 28.981  29.291  5.686   1.00 0.00 ? 115 SER A C    3  
ATOM 5207  O O    . SER A 1 115 ? 29.144  28.567  6.667   1.00 0.00 ? 115 SER A O    3  
ATOM 5208  C CB   . SER A 1 115 ? 26.733  30.344  5.308   1.00 0.00 ? 115 SER A CB   3  
ATOM 5209  O OG   . SER A 1 115 ? 26.848  31.493  4.472   1.00 0.00 ? 115 SER A OG   3  
ATOM 5210  H H    . SER A 1 115 ? 26.133  27.938  5.408   1.00 0.00 ? 115 SER A H    3  
ATOM 5211  H HA   . SER A 1 115 ? 27.891  29.315  3.812   1.00 0.00 ? 115 SER A HA   3  
ATOM 5212  H HB2  . SER A 1 115 ? 25.707  29.978  5.282   1.00 0.00 ? 115 SER A HB2  3  
ATOM 5213  H HB3  . SER A 1 115 ? 26.945  30.624  6.340   1.00 0.00 ? 115 SER A HB3  3  
ATOM 5214  H HG   . SER A 1 115 ? 27.464  32.160  4.891   1.00 0.00 ? 115 SER A HG   3  
ATOM 5215  N N    . SER A 1 116 ? 29.872  30.166  5.243   1.00 0.00 ? 116 SER A N    3  
ATOM 5216  C CA   . SER A 1 116 ? 31.150  30.336  5.912   1.00 0.00 ? 116 SER A CA   3  
ATOM 5217  C C    . SER A 1 116 ? 30.932  30.861  7.333   1.00 0.00 ? 116 SER A C    3  
ATOM 5218  O O    . SER A 1 116 ? 29.881  31.425  7.635   1.00 0.00 ? 116 SER A O    3  
ATOM 5219  C CB   . SER A 1 116 ? 32.060  31.286  5.130   1.00 0.00 ? 116 SER A CB   3  
ATOM 5220  O OG   . SER A 1 116 ? 33.243  30.636  4.672   1.00 0.00 ? 116 SER A OG   3  
ATOM 5221  H H    . SER A 1 116 ? 29.732  30.751  4.444   1.00 0.00 ? 116 SER A H    3  
ATOM 5222  H HA   . SER A 1 116 ? 31.598  29.343  5.936   1.00 0.00 ? 116 SER A HA   3  
ATOM 5223  H HB2  . SER A 1 116 ? 31.514  31.689  4.277   1.00 0.00 ? 116 SER A HB2  3  
ATOM 5224  H HB3  . SER A 1 116 ? 32.332  32.131  5.762   1.00 0.00 ? 116 SER A HB3  3  
ATOM 5225  H HG   . SER A 1 116 ? 33.515  29.925  5.320   1.00 0.00 ? 116 SER A HG   3  
ATOM 5226  N N    . GLY A 1 117 ? 31.941  30.658  8.167   1.00 0.00 ? 117 GLY A N    3  
ATOM 5227  C CA   . GLY A 1 117 ? 31.872  31.104  9.548   1.00 0.00 ? 117 GLY A CA   3  
ATOM 5228  C C    . GLY A 1 117 ? 30.715  30.426  10.286  1.00 0.00 ? 117 GLY A C    3  
ATOM 5229  O O    . GLY A 1 117 ? 30.922  29.779  11.311  1.00 0.00 ? 117 GLY A O    3  
ATOM 5230  H H    . GLY A 1 117 ? 32.792  30.199  7.913   1.00 0.00 ? 117 GLY A H    3  
ATOM 5231  H HA2  . GLY A 1 117 ? 32.811  30.879  10.053  1.00 0.00 ? 117 GLY A HA2  3  
ATOM 5232  H HA3  . GLY A 1 117 ? 31.744  32.185  9.579   1.00 0.00 ? 117 GLY A HA3  3  
ATOM 5233  N N    . GLY A 1 1   ? -1.299  -34.042 -5.321  1.00 0.00 ? 1   GLY A N    4  
ATOM 5234  C CA   . GLY A 1 1   ? -1.563  -32.617 -5.219  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5235  C C    . GLY A 1 1   ? -2.803  -32.349 -4.364  1.00 0.00 ? 1   GLY A C    4  
ATOM 5236  O O    . GLY A 1 1   ? -3.432  -33.282 -3.866  1.00 0.00 ? 1   GLY A O    4  
ATOM 5237  H H1   . GLY A 1 1   ? -2.059  -34.633 -5.052  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5238  H HA2  . GLY A 1 1   ? -0.700  -32.114 -4.782  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5239  H HA3  . GLY A 1 1   ? -1.706  -32.198 -6.215  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5240  N N    . SER A 1 2   ? -3.119  -31.070 -4.221  1.00 0.00 ? 2   SER A N    4  
ATOM 5241  C CA   . SER A 1 2   ? -4.273  -30.668 -3.435  1.00 0.00 ? 2   SER A CA   4  
ATOM 5242  C C    . SER A 1 2   ? -4.621  -29.207 -3.726  1.00 0.00 ? 2   SER A C    4  
ATOM 5243  O O    . SER A 1 2   ? -3.766  -28.436 -4.159  1.00 0.00 ? 2   SER A O    4  
ATOM 5244  C CB   . SER A 1 2   ? -4.016  -30.864 -1.939  1.00 0.00 ? 2   SER A CB   4  
ATOM 5245  O OG   . SER A 1 2   ? -2.899  -30.105 -1.485  1.00 0.00 ? 2   SER A OG   4  
ATOM 5246  H H    . SER A 1 2   ? -2.603  -30.317 -4.629  1.00 0.00 ? 2   SER A H    4  
ATOM 5247  H HA   . SER A 1 2   ? -5.082  -31.325 -3.753  1.00 0.00 ? 2   SER A HA   4  
ATOM 5248  H HB2  . SER A 1 2   ? -4.904  -30.574 -1.378  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5249  H HB3  . SER A 1 2   ? -3.843  -31.921 -1.737  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5250  H HG   . SER A 1 2   ? -2.750  -29.322 -2.088  1.00 0.00 ? 2   SER A HG   4  
ATOM 5251  N N    . SER A 1 3   ? -5.877  -28.870 -3.476  1.00 0.00 ? 3   SER A N    4  
ATOM 5252  C CA   . SER A 1 3   ? -6.349  -27.515 -3.706  1.00 0.00 ? 3   SER A CA   4  
ATOM 5253  C C    . SER A 1 3   ? -7.474  -27.179 -2.726  1.00 0.00 ? 3   SER A C    4  
ATOM 5254  O O    . SER A 1 3   ? -8.017  -28.067 -2.070  1.00 0.00 ? 3   SER A O    4  
ATOM 5255  C CB   . SER A 1 3   ? -6.829  -27.336 -5.148  1.00 0.00 ? 3   SER A CB   4  
ATOM 5256  O OG   . SER A 1 3   ? -5.816  -26.784 -5.984  1.00 0.00 ? 3   SER A OG   4  
ATOM 5257  H H    . SER A 1 3   ? -6.567  -29.503 -3.124  1.00 0.00 ? 3   SER A H    4  
ATOM 5258  H HA   . SER A 1 3   ? -5.484  -26.875 -3.530  1.00 0.00 ? 3   SER A HA   4  
ATOM 5259  H HB2  . SER A 1 3   ? -7.143  -28.300 -5.548  1.00 0.00 ? 3   SER A HB2  4  
ATOM 5260  H HB3  . SER A 1 3   ? -7.704  -26.686 -5.161  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5261  H HG   . SER A 1 3   ? -4.954  -26.723 -5.482  1.00 0.00 ? 3   SER A HG   4  
ATOM 5262  N N    . GLY A 1 4   ? -7.792  -25.894 -2.657  1.00 0.00 ? 4   GLY A N    4  
ATOM 5263  C CA   . GLY A 1 4   ? -8.843  -25.430 -1.768  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5264  C C    . GLY A 1 4   ? -10.065 -24.961 -2.561  1.00 0.00 ? 4   GLY A C    4  
ATOM 5265  O O    . GLY A 1 4   ? -10.050 -24.966 -3.791  1.00 0.00 ? 4   GLY A O    4  
ATOM 5266  H H    . GLY A 1 4   ? -7.346  -25.178 -3.194  1.00 0.00 ? 4   GLY A H    4  
ATOM 5267  H HA2  . GLY A 1 4   ? -9.132  -26.233 -1.090  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5268  H HA3  . GLY A 1 4   ? -8.469  -24.612 -1.153  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5269  N N    . SER A 1 5   ? -11.094 -24.568 -1.825  1.00 0.00 ? 5   SER A N    4  
ATOM 5270  C CA   . SER A 1 5   ? -12.321 -24.097 -2.444  1.00 0.00 ? 5   SER A CA   4  
ATOM 5271  C C    . SER A 1 5   ? -13.132 -23.276 -1.439  1.00 0.00 ? 5   SER A C    4  
ATOM 5272  O O    . SER A 1 5   ? -12.996 -23.457 -0.230  1.00 0.00 ? 5   SER A O    4  
ATOM 5273  C CB   . SER A 1 5   ? -13.156 -25.266 -2.971  1.00 0.00 ? 5   SER A CB   4  
ATOM 5274  O OG   . SER A 1 5   ? -13.427 -26.229 -1.956  1.00 0.00 ? 5   SER A OG   4  
ATOM 5275  H H    . SER A 1 5   ? -11.098 -24.568 -0.825  1.00 0.00 ? 5   SER A H    4  
ATOM 5276  H HA   . SER A 1 5   ? -12.002 -23.474 -3.279  1.00 0.00 ? 5   SER A HA   4  
ATOM 5277  H HB2  . SER A 1 5   ? -14.096 -24.888 -3.373  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5278  H HB3  . SER A 1 5   ? -12.627 -25.747 -3.794  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5279  H HG   . SER A 1 5   ? -13.886 -25.791 -1.183  1.00 0.00 ? 5   SER A HG   4  
ATOM 5280  N N    . SER A 1 6   ? -13.959 -22.392 -1.977  1.00 0.00 ? 6   SER A N    4  
ATOM 5281  C CA   . SER A 1 6   ? -14.793 -21.543 -1.143  1.00 0.00 ? 6   SER A CA   4  
ATOM 5282  C C    . SER A 1 6   ? -15.749 -20.728 -2.017  1.00 0.00 ? 6   SER A C    4  
ATOM 5283  O O    . SER A 1 6   ? -15.606 -20.697 -3.238  1.00 0.00 ? 6   SER A O    4  
ATOM 5284  C CB   . SER A 1 6   ? -13.939 -20.612 -0.279  1.00 0.00 ? 6   SER A CB   4  
ATOM 5285  O OG   . SER A 1 6   ? -13.527 -21.237 0.933   1.00 0.00 ? 6   SER A OG   4  
ATOM 5286  H H    . SER A 1 6   ? -14.065 -22.251 -2.962  1.00 0.00 ? 6   SER A H    4  
ATOM 5287  H HA   . SER A 1 6   ? -15.348 -22.225 -0.501  1.00 0.00 ? 6   SER A HA   4  
ATOM 5288  H HB2  . SER A 1 6   ? -13.060 -20.298 -0.843  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5289  H HB3  . SER A 1 6   ? -14.507 -19.710 -0.048  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5290  H HG   . SER A 1 6   ? -13.719 -22.217 0.894   1.00 0.00 ? 6   SER A HG   4  
ATOM 5291  N N    . GLY A 1 7   ? -16.703 -20.089 -1.356  1.00 0.00 ? 7   GLY A N    4  
ATOM 5292  C CA   . GLY A 1 7   ? -17.683 -19.276 -2.057  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5293  C C    . GLY A 1 7   ? -18.204 -18.151 -1.161  1.00 0.00 ? 7   GLY A C    4  
ATOM 5294  O O    . GLY A 1 7   ? -17.558 -17.783 -0.181  1.00 0.00 ? 7   GLY A O    4  
ATOM 5295  H H    . GLY A 1 7   ? -16.813 -20.119 -0.363  1.00 0.00 ? 7   GLY A H    4  
ATOM 5296  H HA2  . GLY A 1 7   ? -17.234 -18.852 -2.955  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5297  H HA3  . GLY A 1 7   ? -18.514 -19.902 -2.382  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5298  N N    . GLY A 1 8   ? -19.368 -17.635 -1.529  1.00 0.00 ? 8   GLY A N    4  
ATOM 5299  C CA   . GLY A 1 8   ? -19.983 -16.560 -0.771  1.00 0.00 ? 8   GLY A CA   4  
ATOM 5300  C C    . GLY A 1 8   ? -19.854 -16.806 0.734   1.00 0.00 ? 8   GLY A C    4  
ATOM 5301  O O    . GLY A 1 8   ? -20.538 -17.666 1.287   1.00 0.00 ? 8   GLY A O    4  
ATOM 5302  H H    . GLY A 1 8   ? -19.887 -17.940 -2.327  1.00 0.00 ? 8   GLY A H    4  
ATOM 5303  H HA2  . GLY A 1 8   ? -19.512 -15.612 -1.029  1.00 0.00 ? 8   GLY A HA2  4  
ATOM 5304  H HA3  . GLY A 1 8   ? -21.036 -16.476 -1.040  1.00 0.00 ? 8   GLY A HA3  4  
ATOM 5305  N N    . GLU A 1 9   ? -18.972 -16.035 1.354   1.00 0.00 ? 9   GLU A N    4  
ATOM 5306  C CA   . GLU A 1 9   ? -18.745 -16.159 2.783   1.00 0.00 ? 9   GLU A CA   4  
ATOM 5307  C C    . GLU A 1 9   ? -17.956 -14.954 3.302   1.00 0.00 ? 9   GLU A C    4  
ATOM 5308  O O    . GLU A 1 9   ? -17.014 -14.500 2.655   1.00 0.00 ? 9   GLU A O    4  
ATOM 5309  C CB   . GLU A 1 9   ? -18.025 -17.468 3.113   1.00 0.00 ? 9   GLU A CB   4  
ATOM 5310  C CG   . GLU A 1 9   ? -18.571 -18.085 4.402   1.00 0.00 ? 9   GLU A CG   4  
ATOM 5311  C CD   . GLU A 1 9   ? -17.579 -17.916 5.554   1.00 0.00 ? 9   GLU A CD   4  
ATOM 5312  O OE1  . GLU A 1 9   ? -16.729 -18.820 5.708   1.00 0.00 ? 9   GLU A OE1  4  
ATOM 5313  O OE2  . GLU A 1 9   ? -17.693 -16.888 6.255   1.00 0.00 ? 9   GLU A OE2  4  
ATOM 5314  H H    . GLU A 1 9   ? -18.420 -15.338 0.897   1.00 0.00 ? 9   GLU A H    4  
ATOM 5315  H HA   . GLU A 1 9   ? -19.737 -16.173 3.235   1.00 0.00 ? 9   GLU A HA   4  
ATOM 5316  H HB2  . GLU A 1 9   ? -18.146 -18.171 2.289   1.00 0.00 ? 9   GLU A HB2  4  
ATOM 5317  H HB3  . GLU A 1 9   ? -16.956 -17.282 3.219   1.00 0.00 ? 9   GLU A HB3  4  
ATOM 5318  H HG2  . GLU A 1 9   ? -19.519 -17.613 4.662   1.00 0.00 ? 9   GLU A HG2  4  
ATOM 5319  H HG3  . GLU A 1 9   ? -18.775 -19.144 4.244   1.00 0.00 ? 9   GLU A HG3  4  
ATOM 5320  N N    . ARG A 1 10  ? -18.372 -14.471 4.463   1.00 0.00 ? 10  ARG A N    4  
ATOM 5321  C CA   . ARG A 1 10  ? -17.716 -13.328 5.076   1.00 0.00 ? 10  ARG A CA   4  
ATOM 5322  C C    . ARG A 1 10  ? -16.196 -13.487 5.006   1.00 0.00 ? 10  ARG A C    4  
ATOM 5323  O O    . ARG A 1 10  ? -15.624 -14.326 5.701   1.00 0.00 ? 10  ARG A O    4  
ATOM 5324  C CB   . ARG A 1 10  ? -18.139 -13.168 6.537   1.00 0.00 ? 10  ARG A CB   4  
ATOM 5325  C CG   . ARG A 1 10  ? -19.629 -12.833 6.643   1.00 0.00 ? 10  ARG A CG   4  
ATOM 5326  C CD   . ARG A 1 10  ? -20.457 -14.094 6.900   1.00 0.00 ? 10  ARG A CD   4  
ATOM 5327  N NE   . ARG A 1 10  ? -21.426 -14.295 5.800   1.00 0.00 ? 10  ARG A NE   4  
ATOM 5328  C CZ   . ARG A 1 10  ? -22.038 -15.459 5.541   1.00 0.00 ? 10  ARG A CZ   4  
ATOM 5329  N NH1  . ARG A 1 10  ? -21.785 -16.533 6.302   1.00 0.00 ? 10  ARG A NH1  4  
ATOM 5330  N NH2  . ARG A 1 10  ? -22.904 -15.549 4.522   1.00 0.00 ? 10  ARG A NH2  4  
ATOM 5331  H H    . ARG A 1 10  ? -19.139 -14.846 4.983   1.00 0.00 ? 10  ARG A H    4  
ATOM 5332  H HA   . ARG A 1 10  ? -18.047 -12.470 4.490   1.00 0.00 ? 10  ARG A HA   4  
ATOM 5333  H HB2  . ARG A 1 10  ? -17.930 -14.088 7.083   1.00 0.00 ? 10  ARG A HB2  4  
ATOM 5334  H HB3  . ARG A 1 10  ? -17.551 -12.378 7.005   1.00 0.00 ? 10  ARG A HB3  4  
ATOM 5335  H HG2  . ARG A 1 10  ? -19.788 -12.119 7.451   1.00 0.00 ? 10  ARG A HG2  4  
ATOM 5336  H HG3  . ARG A 1 10  ? -19.964 -12.355 5.723   1.00 0.00 ? 10  ARG A HG3  4  
ATOM 5337  H HD2  . ARG A 1 10  ? -19.800 -14.960 6.979   1.00 0.00 ? 10  ARG A HD2  4  
ATOM 5338  H HD3  . ARG A 1 10  ? -20.984 -14.006 7.849   1.00 0.00 ? 10  ARG A HD3  4  
ATOM 5339  H HE   . ARG A 1 10  ? -21.638 -13.514 5.213   1.00 0.00 ? 10  ARG A HE   4  
ATOM 5340  H HH11 . ARG A 1 10  ? -21.139 -16.465 7.062   1.00 0.00 ? 10  ARG A HH11 4  
ATOM 5341  H HH12 . ARG A 1 10  ? -22.242 -17.401 6.109   1.00 0.00 ? 10  ARG A HH12 4  
ATOM 5342  H HH21 . ARG A 1 10  ? -23.093 -14.747 3.954   1.00 0.00 ? 10  ARG A HH21 4  
ATOM 5343  H HH22 . ARG A 1 10  ? -23.360 -16.417 4.329   1.00 0.00 ? 10  ARG A HH22 4  
ATOM 5344  N N    . ARG A 1 11  ? -15.585 -12.669 4.162   1.00 0.00 ? 11  ARG A N    4  
ATOM 5345  C CA   . ARG A 1 11  ? -14.142 -12.710 3.994   1.00 0.00 ? 11  ARG A CA   4  
ATOM 5346  C C    . ARG A 1 11  ? -13.444 -12.354 5.308   1.00 0.00 ? 11  ARG A C    4  
ATOM 5347  O O    . ARG A 1 11  ? -14.070 -11.822 6.223   1.00 0.00 ? 11  ARG A O    4  
ATOM 5348  C CB   . ARG A 1 11  ? -13.688 -11.737 2.903   1.00 0.00 ? 11  ARG A CB   4  
ATOM 5349  C CG   . ARG A 1 11  ? -14.028 -10.294 3.279   1.00 0.00 ? 11  ARG A CG   4  
ATOM 5350  C CD   . ARG A 1 11  ? -13.735 -9.341  2.118   1.00 0.00 ? 11  ARG A CD   4  
ATOM 5351  N NE   . ARG A 1 11  ? -14.289 -8.001  2.411   1.00 0.00 ? 11  ARG A NE   4  
ATOM 5352  C CZ   . ARG A 1 11  ? -14.287 -6.981  1.542   1.00 0.00 ? 11  ARG A CZ   4  
ATOM 5353  N NH1  . ARG A 1 11  ? -13.760 -7.142  0.321   1.00 0.00 ? 11  ARG A NH1  4  
ATOM 5354  N NH2  . ARG A 1 11  ? -14.812 -5.799  1.895   1.00 0.00 ? 11  ARG A NH2  4  
ATOM 5355  H H    . ARG A 1 11  ? -16.057 -11.990 3.601   1.00 0.00 ? 11  ARG A H    4  
ATOM 5356  H HA   . ARG A 1 11  ? -13.924 -13.736 3.699   1.00 0.00 ? 11  ARG A HA   4  
ATOM 5357  H HB2  . ARG A 1 11  ? -12.613 -11.833 2.750   1.00 0.00 ? 11  ARG A HB2  4  
ATOM 5358  H HB3  . ARG A 1 11  ? -14.168 -11.994 1.959   1.00 0.00 ? 11  ARG A HB3  4  
ATOM 5359  H HG2  . ARG A 1 11  ? -15.080 -10.224 3.554   1.00 0.00 ? 11  ARG A HG2  4  
ATOM 5360  H HG3  . ARG A 1 11  ? -13.449 -9.996  4.153   1.00 0.00 ? 11  ARG A HG3  4  
ATOM 5361  H HD2  . ARG A 1 11  ? -12.659 -9.272  1.956   1.00 0.00 ? 11  ARG A HD2  4  
ATOM 5362  H HD3  . ARG A 1 11  ? -14.171 -9.731  1.198   1.00 0.00 ? 11  ARG A HD3  4  
ATOM 5363  H HE   . ARG A 1 11  ? -14.690 -7.846  3.314   1.00 0.00 ? 11  ARG A HE   4  
ATOM 5364  H HH11 . ARG A 1 11  ? -13.368 -8.024  0.058   1.00 0.00 ? 11  ARG A HH11 4  
ATOM 5365  H HH12 . ARG A 1 11  ? -13.758 -6.381  -0.328  1.00 0.00 ? 11  ARG A HH12 4  
ATOM 5366  H HH21 . ARG A 1 11  ? -15.205 -5.679  2.806   1.00 0.00 ? 11  ARG A HH21 4  
ATOM 5367  H HH22 . ARG A 1 11  ? -14.810 -5.038  1.246   1.00 0.00 ? 11  ARG A HH22 4  
ATOM 5368  N N    . LYS A 1 12  ? -12.156 -12.661 5.359   1.00 0.00 ? 12  LYS A N    4  
ATOM 5369  C CA   . LYS A 1 12  ? -11.366 -12.381 6.545   1.00 0.00 ? 12  LYS A CA   4  
ATOM 5370  C C    . LYS A 1 12  ? -9.883  -12.580 6.224   1.00 0.00 ? 12  LYS A C    4  
ATOM 5371  O O    . LYS A 1 12  ? -9.536  -13.344 5.325   1.00 0.00 ? 12  LYS A O    4  
ATOM 5372  C CB   . LYS A 1 12  ? -11.857 -13.219 7.727   1.00 0.00 ? 12  LYS A CB   4  
ATOM 5373  C CG   . LYS A 1 12  ? -12.141 -12.338 8.945   1.00 0.00 ? 12  LYS A CG   4  
ATOM 5374  C CD   . LYS A 1 12  ? -13.046 -13.059 9.945   1.00 0.00 ? 12  LYS A CD   4  
ATOM 5375  C CE   . LYS A 1 12  ? -12.297 -13.361 11.244  1.00 0.00 ? 12  LYS A CE   4  
ATOM 5376  N NZ   . LYS A 1 12  ? -13.017 -14.386 12.032  1.00 0.00 ? 12  LYS A NZ   4  
ATOM 5377  H H    . LYS A 1 12  ? -11.654 -13.094 4.610   1.00 0.00 ? 12  LYS A H    4  
ATOM 5378  H HA   . LYS A 1 12  ? -11.526 -11.334 6.804   1.00 0.00 ? 12  LYS A HA   4  
ATOM 5379  H HB2  . LYS A 1 12  ? -12.762 -13.758 7.445   1.00 0.00 ? 12  LYS A HB2  4  
ATOM 5380  H HB3  . LYS A 1 12  ? -11.108 -13.968 7.982   1.00 0.00 ? 12  LYS A HB3  4  
ATOM 5381  H HG2  . LYS A 1 12  ? -11.202 -12.066 9.428   1.00 0.00 ? 12  LYS A HG2  4  
ATOM 5382  H HG3  . LYS A 1 12  ? -12.614 -11.410 8.624   1.00 0.00 ? 12  LYS A HG3  4  
ATOM 5383  H HD2  . LYS A 1 12  ? -13.920 -12.444 10.159  1.00 0.00 ? 12  LYS A HD2  4  
ATOM 5384  H HD3  . LYS A 1 12  ? -13.410 -13.989 9.507   1.00 0.00 ? 12  LYS A HD3  4  
ATOM 5385  H HE2  . LYS A 1 12  ? -11.289 -13.709 11.018  1.00 0.00 ? 12  LYS A HE2  4  
ATOM 5386  H HE3  . LYS A 1 12  ? -12.194 -12.448 11.832  1.00 0.00 ? 12  LYS A HE3  4  
ATOM 5387  H HZ1  . LYS A 1 12  ? -12.359 -14.929 12.554  1.00 0.00 ? 12  LYS A HZ1  4  
ATOM 5388  H HZ2  . LYS A 1 12  ? -13.652 -13.938 12.662  1.00 0.00 ? 12  LYS A HZ2  4  
ATOM 5389  H HZ3  . LYS A 1 12  ? -13.527 -14.984 11.414  1.00 0.00 ? 12  LYS A HZ3  4  
ATOM 5390  N N    . ASP A 1 13  ? -9.049  -11.878 6.977   1.00 0.00 ? 13  ASP A N    4  
ATOM 5391  C CA   . ASP A 1 13  ? -7.611  -11.968 6.784   1.00 0.00 ? 13  ASP A CA   4  
ATOM 5392  C C    . ASP A 1 13  ? -7.263  -11.522 5.363   1.00 0.00 ? 13  ASP A C    4  
ATOM 5393  O O    . ASP A 1 13  ? -8.135  -11.457 4.498   1.00 0.00 ? 13  ASP A O    4  
ATOM 5394  C CB   . ASP A 1 13  ? -7.120  -13.406 6.962   1.00 0.00 ? 13  ASP A CB   4  
ATOM 5395  C CG   . ASP A 1 13  ? -5.836  -13.555 7.781   1.00 0.00 ? 13  ASP A CG   4  
ATOM 5396  O OD1  . ASP A 1 13  ? -5.740  -12.862 8.816   1.00 0.00 ? 13  ASP A OD1  4  
ATOM 5397  O OD2  . ASP A 1 13  ? -4.980  -14.358 7.352   1.00 0.00 ? 13  ASP A OD2  4  
ATOM 5398  H H    . ASP A 1 13  ? -9.339  -11.259 7.707   1.00 0.00 ? 13  ASP A H    4  
ATOM 5399  H HA   . ASP A 1 13  ? -7.179  -11.317 7.544   1.00 0.00 ? 13  ASP A HA   4  
ATOM 5400  H HB2  . ASP A 1 13  ? -7.909  -13.987 7.443   1.00 0.00 ? 13  ASP A HB2  4  
ATOM 5401  H HB3  . ASP A 1 13  ? -6.958  -13.844 5.977   1.00 0.00 ? 13  ASP A HB3  4  
ATOM 5402  N N    . ARG A 1 14  ? -5.987  -11.227 5.166   1.00 0.00 ? 14  ARG A N    4  
ATOM 5403  C CA   . ARG A 1 14  ? -5.512  -10.789 3.864   1.00 0.00 ? 14  ARG A CA   4  
ATOM 5404  C C    . ARG A 1 14  ? -5.279  -11.994 2.951   1.00 0.00 ? 14  ARG A C    4  
ATOM 5405  O O    . ARG A 1 14  ? -4.840  -13.048 3.408   1.00 0.00 ? 14  ARG A O    4  
ATOM 5406  C CB   . ARG A 1 14  ? -4.211  -9.995  3.990   1.00 0.00 ? 14  ARG A CB   4  
ATOM 5407  C CG   . ARG A 1 14  ? -4.493  -8.533  4.343   1.00 0.00 ? 14  ARG A CG   4  
ATOM 5408  C CD   . ARG A 1 14  ? -3.437  -7.988  5.308   1.00 0.00 ? 14  ARG A CD   4  
ATOM 5409  N NE   . ARG A 1 14  ? -4.068  -7.067  6.280   1.00 0.00 ? 14  ARG A NE   4  
ATOM 5410  C CZ   . ARG A 1 14  ? -4.961  -7.446  7.204   1.00 0.00 ? 14  ARG A CZ   4  
ATOM 5411  N NH1  . ARG A 1 14  ? -5.334  -8.731  7.287   1.00 0.00 ? 14  ARG A NH1  4  
ATOM 5412  N NH2  . ARG A 1 14  ? -5.481  -6.542  8.044   1.00 0.00 ? 14  ARG A NH2  4  
ATOM 5413  H H    . ARG A 1 14  ? -5.284  -11.282 5.875   1.00 0.00 ? 14  ARG A H    4  
ATOM 5414  H HA   . ARG A 1 14  ? -6.308  -10.152 3.477   1.00 0.00 ? 14  ARG A HA   4  
ATOM 5415  H HB2  . ARG A 1 14  ? -3.580  -10.443 4.759   1.00 0.00 ? 14  ARG A HB2  4  
ATOM 5416  H HB3  . ARG A 1 14  ? -3.656  -10.046 3.053   1.00 0.00 ? 14  ARG A HB3  4  
ATOM 5417  H HG2  . ARG A 1 14  ? -4.504  -7.932  3.434   1.00 0.00 ? 14  ARG A HG2  4  
ATOM 5418  H HG3  . ARG A 1 14  ? -5.481  -8.448  4.794   1.00 0.00 ? 14  ARG A HG3  4  
ATOM 5419  H HD2  . ARG A 1 14  ? -2.955  -8.812  5.835   1.00 0.00 ? 14  ARG A HD2  4  
ATOM 5420  H HD3  . ARG A 1 14  ? -2.659  -7.466  4.752   1.00 0.00 ? 14  ARG A HD3  4  
ATOM 5421  H HE   . ARG A 1 14  ? -3.811  -6.101  6.244   1.00 0.00 ? 14  ARG A HE   4  
ATOM 5422  H HH11 . ARG A 1 14  ? -4.946  -9.406  6.660   1.00 0.00 ? 14  ARG A HH11 4  
ATOM 5423  H HH12 . ARG A 1 14  ? -6.001  -9.014  7.977   1.00 0.00 ? 14  ARG A HH12 4  
ATOM 5424  H HH21 . ARG A 1 14  ? -5.202  -5.583  7.982   1.00 0.00 ? 14  ARG A HH21 4  
ATOM 5425  H HH22 . ARG A 1 14  ? -6.147  -6.825  8.734   1.00 0.00 ? 14  ARG A HH22 4  
ATOM 5426  N N    . PRO A 1 15  ? -5.593  -11.794 1.643   1.00 0.00 ? 15  PRO A N    4  
ATOM 5427  C CA   . PRO A 1 15  ? -5.423  -12.852 0.661   1.00 0.00 ? 15  PRO A CA   4  
ATOM 5428  C C    . PRO A 1 15  ? -3.945  -13.044 0.313   1.00 0.00 ? 15  PRO A C    4  
ATOM 5429  O O    . PRO A 1 15  ? -3.497  -14.168 0.092   1.00 0.00 ? 15  PRO A O    4  
ATOM 5430  C CB   . PRO A 1 15  ? -6.262  -12.422 -0.530  1.00 0.00 ? 15  PRO A CB   4  
ATOM 5431  C CG   . PRO A 1 15  ? -6.497  -10.930 -0.359  1.00 0.00 ? 15  PRO A CG   4  
ATOM 5432  C CD   . PRO A 1 15  ? -6.116  -10.559 1.065   1.00 0.00 ? 15  PRO A CD   4  
ATOM 5433  H HA   . PRO A 1 15  ? -5.731  -13.726 1.036   1.00 0.00 ? 15  PRO A HA   4  
ATOM 5434  H HB2  . PRO A 1 15  ? -5.746  -12.631 -1.467  1.00 0.00 ? 15  PRO A HB2  4  
ATOM 5435  H HB3  . PRO A 1 15  ? -7.207  -12.965 -0.559  1.00 0.00 ? 15  PRO A HB3  4  
ATOM 5436  H HG2  . PRO A 1 15  ? -5.898  -10.364 -1.073  1.00 0.00 ? 15  PRO A HG2  4  
ATOM 5437  H HG3  . PRO A 1 15  ? -7.541  -10.683 -0.551  1.00 0.00 ? 15  PRO A HG3  4  
ATOM 5438  H HD2  . PRO A 1 15  ? -5.368  -9.766  1.082   1.00 0.00 ? 15  PRO A HD2  4  
ATOM 5439  H HD3  . PRO A 1 15  ? -6.979  -10.195 1.624   1.00 0.00 ? 15  PRO A HD3  4  
ATOM 5440  N N    . TYR A 1 16  ? -3.229  -11.930 0.276   1.00 0.00 ? 16  TYR A N    4  
ATOM 5441  C CA   . TYR A 1 16  ? -1.812  -11.961 -0.041  1.00 0.00 ? 16  TYR A CA   4  
ATOM 5442  C C    . TYR A 1 16  ? -1.133  -10.646 0.346   1.00 0.00 ? 16  TYR A C    4  
ATOM 5443  O O    . TYR A 1 16  ? -0.093  -10.649 1.002   1.00 0.00 ? 16  TYR A O    4  
ATOM 5444  C CB   . TYR A 1 16  ? -1.723  -12.140 -1.558  1.00 0.00 ? 16  TYR A CB   4  
ATOM 5445  C CG   . TYR A 1 16  ? -0.300  -12.355 -2.077  1.00 0.00 ? 16  TYR A CG   4  
ATOM 5446  C CD1  . TYR A 1 16  ? 0.638   -11.349 -1.959  1.00 0.00 ? 16  TYR A CD1  4  
ATOM 5447  C CD2  . TYR A 1 16  ? 0.047   -13.555 -2.664  1.00 0.00 ? 16  TYR A CD2  4  
ATOM 5448  C CE1  . TYR A 1 16  ? 1.977   -11.551 -2.447  1.00 0.00 ? 16  TYR A CE1  4  
ATOM 5449  C CE2  . TYR A 1 16  ? 1.386   -13.757 -3.153  1.00 0.00 ? 16  TYR A CE2  4  
ATOM 5450  C CZ   . TYR A 1 16  ? 2.285   -12.745 -3.020  1.00 0.00 ? 16  TYR A CZ   4  
ATOM 5451  O OH   . TYR A 1 16  ? 3.550   -12.936 -3.481  1.00 0.00 ? 16  TYR A OH   4  
ATOM 5452  H H    . TYR A 1 16  ? -3.601  -11.019 0.457   1.00 0.00 ? 16  TYR A H    4  
ATOM 5453  H HA   . TYR A 1 16  ? -1.358  -12.776 0.524   1.00 0.00 ? 16  TYR A HA   4  
ATOM 5454  H HB2  . TYR A 1 16  ? -2.338  -12.991 -1.850  1.00 0.00 ? 16  TYR A HB2  4  
ATOM 5455  H HB3  . TYR A 1 16  ? -2.146  -11.260 -2.043  1.00 0.00 ? 16  TYR A HB3  4  
ATOM 5456  H HD1  . TYR A 1 16  ? 0.364   -10.401 -1.495  1.00 0.00 ? 16  TYR A HD1  4  
ATOM 5457  H HD2  . TYR A 1 16  ? -0.693  -14.349 -2.758  1.00 0.00 ? 16  TYR A HD2  4  
ATOM 5458  H HE1  . TYR A 1 16  ? 2.727   -10.765 -2.360  1.00 0.00 ? 16  TYR A HE1  4  
ATOM 5459  H HE2  . TYR A 1 16  ? 1.673   -14.700 -3.618  1.00 0.00 ? 16  TYR A HE2  4  
ATOM 5460  H HH   . TYR A 1 16  ? 3.553   -13.643 -4.189  1.00 0.00 ? 16  TYR A HH   4  
ATOM 5461  N N    . VAL A 1 17  ? -1.751  -9.552  -0.076  1.00 0.00 ? 17  VAL A N    4  
ATOM 5462  C CA   . VAL A 1 17  ? -1.220  -8.232  0.219   1.00 0.00 ? 17  VAL A CA   4  
ATOM 5463  C C    . VAL A 1 17  ? -2.160  -7.514  1.188   1.00 0.00 ? 17  VAL A C    4  
ATOM 5464  O O    . VAL A 1 17  ? -3.185  -8.064  1.587   1.00 0.00 ? 17  VAL A O    4  
ATOM 5465  C CB   . VAL A 1 17  ? -0.994  -7.457  -1.081  1.00 0.00 ? 17  VAL A CB   4  
ATOM 5466  C CG1  . VAL A 1 17  ? 0.365   -7.799  -1.695  1.00 0.00 ? 17  VAL A CG1  4  
ATOM 5467  C CG2  . VAL A 1 17  ? -2.127  -7.715  -2.077  1.00 0.00 ? 17  VAL A CG2  4  
ATOM 5468  H H    . VAL A 1 17  ? -2.597  -9.558  -0.609  1.00 0.00 ? 17  VAL A H    4  
ATOM 5469  H HA   . VAL A 1 17  ? -0.253  -8.367  0.703   1.00 0.00 ? 17  VAL A HA   4  
ATOM 5470  H HB   . VAL A 1 17  ? -0.995  -6.393  -0.841  1.00 0.00 ? 17  VAL A HB   4  
ATOM 5471  H HG11 . VAL A 1 17  ? 0.965   -6.893  -1.775  1.00 0.00 ? 17  VAL A HG11 4  
ATOM 5472  H HG12 . VAL A 1 17  ? 0.879   -8.520  -1.060  1.00 0.00 ? 17  VAL A HG12 4  
ATOM 5473  H HG13 . VAL A 1 17  ? 0.218   -8.227  -2.686  1.00 0.00 ? 17  VAL A HG13 4  
ATOM 5474  H HG21 . VAL A 1 17  ? -1.880  -8.582  -2.690  1.00 0.00 ? 17  VAL A HG21 4  
ATOM 5475  H HG22 . VAL A 1 17  ? -3.052  -7.905  -1.533  1.00 0.00 ? 17  VAL A HG22 4  
ATOM 5476  H HG23 . VAL A 1 17  ? -2.254  -6.841  -2.716  1.00 0.00 ? 17  VAL A HG23 4  
ATOM 5477  N N    . GLU A 1 18  ? -1.778  -6.295  1.539   1.00 0.00 ? 18  GLU A N    4  
ATOM 5478  C CA   . GLU A 1 18  ? -2.574  -5.495  2.455   1.00 0.00 ? 18  GLU A CA   4  
ATOM 5479  C C    . GLU A 1 18  ? -3.769  -4.882  1.722   1.00 0.00 ? 18  GLU A C    4  
ATOM 5480  O O    . GLU A 1 18  ? -3.624  -3.888  1.013   1.00 0.00 ? 18  GLU A O    4  
ATOM 5481  C CB   . GLU A 1 18  ? -1.723  -4.411  3.119   1.00 0.00 ? 18  GLU A CB   4  
ATOM 5482  C CG   . GLU A 1 18  ? -0.391  -4.982  3.607   1.00 0.00 ? 18  GLU A CG   4  
ATOM 5483  C CD   . GLU A 1 18  ? -0.316  -4.968  5.135   1.00 0.00 ? 18  GLU A CD   4  
ATOM 5484  O OE1  . GLU A 1 18  ? -1.251  -5.520  5.755   1.00 0.00 ? 18  GLU A OE1  4  
ATOM 5485  O OE2  . GLU A 1 18  ? 0.675   -4.406  5.650   1.00 0.00 ? 18  GLU A OE2  4  
ATOM 5486  H H    . GLU A 1 18  ? -0.943  -5.854  1.210   1.00 0.00 ? 18  GLU A H    4  
ATOM 5487  H HA   . GLU A 1 18  ? -2.925  -6.190  3.217   1.00 0.00 ? 18  GLU A HA   4  
ATOM 5488  H HB2  . GLU A 1 18  ? -1.538  -3.603  2.410   1.00 0.00 ? 18  GLU A HB2  4  
ATOM 5489  H HB3  . GLU A 1 18  ? -2.268  -3.979  3.958   1.00 0.00 ? 18  GLU A HB3  4  
ATOM 5490  H HG2  . GLU A 1 18  ? -0.273  -6.003  3.243   1.00 0.00 ? 18  GLU A HG2  4  
ATOM 5491  H HG3  . GLU A 1 18  ? 0.433   -4.399  3.194   1.00 0.00 ? 18  GLU A HG3  4  
ATOM 5492  N N    . GLU A 1 19  ? -4.924  -5.501  1.918   1.00 0.00 ? 19  GLU A N    4  
ATOM 5493  C CA   . GLU A 1 19  ? -6.144  -5.028  1.285   1.00 0.00 ? 19  GLU A CA   4  
ATOM 5494  C C    . GLU A 1 19  ? -6.177  -3.499  1.272   1.00 0.00 ? 19  GLU A C    4  
ATOM 5495  O O    . GLU A 1 19  ? -5.510  -2.853  2.079   1.00 0.00 ? 19  GLU A O    4  
ATOM 5496  C CB   . GLU A 1 19  ? -7.380  -5.597  1.983   1.00 0.00 ? 19  GLU A CB   4  
ATOM 5497  C CG   . GLU A 1 19  ? -7.990  -6.742  1.172   1.00 0.00 ? 19  GLU A CG   4  
ATOM 5498  C CD   . GLU A 1 19  ? -9.518  -6.717  1.250   1.00 0.00 ? 19  GLU A CD   4  
ATOM 5499  O OE1  . GLU A 1 19  ? -10.049 -7.345  2.191   1.00 0.00 ? 19  GLU A OE1  4  
ATOM 5500  O OE2  . GLU A 1 19  ? -10.120 -6.069  0.366   1.00 0.00 ? 19  GLU A OE2  4  
ATOM 5501  H H    . GLU A 1 19  ? -5.034  -6.309  2.497   1.00 0.00 ? 19  GLU A H    4  
ATOM 5502  H HA   . GLU A 1 19  ? -6.105  -5.406  0.263   1.00 0.00 ? 19  GLU A HA   4  
ATOM 5503  H HB2  . GLU A 1 19  ? -7.109  -5.955  2.977   1.00 0.00 ? 19  GLU A HB2  4  
ATOM 5504  H HB3  . GLU A 1 19  ? -8.120  -4.809  2.120   1.00 0.00 ? 19  GLU A HB3  4  
ATOM 5505  H HG2  . GLU A 1 19  ? -7.674  -6.664  0.132   1.00 0.00 ? 19  GLU A HG2  4  
ATOM 5506  H HG3  . GLU A 1 19  ? -7.619  -7.696  1.547   1.00 0.00 ? 19  GLU A HG3  4  
ATOM 5507  N N    . PRO A 1 20  ? -6.981  -2.949  0.323   1.00 0.00 ? 20  PRO A N    4  
ATOM 5508  C CA   . PRO A 1 20  ? -7.110  -1.508  0.194   1.00 0.00 ? 20  PRO A CA   4  
ATOM 5509  C C    . PRO A 1 20  ? -7.980  -0.933  1.313   1.00 0.00 ? 20  PRO A C    4  
ATOM 5510  O O    . PRO A 1 20  ? -9.007  -1.511  1.665   1.00 0.00 ? 20  PRO A O    4  
ATOM 5511  C CB   . PRO A 1 20  ? -7.699  -1.288  -1.190  1.00 0.00 ? 20  PRO A CB   4  
ATOM 5512  C CG   . PRO A 1 20  ? -8.309  -2.618  -1.600  1.00 0.00 ? 20  PRO A CG   4  
ATOM 5513  C CD   . PRO A 1 20  ? -7.786  -3.683  -0.650  1.00 0.00 ? 20  PRO A CD   4  
ATOM 5514  H HA   . PRO A 1 20  ? -6.216  -1.069  0.290   1.00 0.00 ? 20  PRO A HA   4  
ATOM 5515  H HB2  . PRO A 1 20  ? -8.454  -0.501  -1.172  1.00 0.00 ? 20  PRO A HB2  4  
ATOM 5516  H HB3  . PRO A 1 20  ? -6.931  -0.976  -1.897  1.00 0.00 ? 20  PRO A HB3  4  
ATOM 5517  H HG2  . PRO A 1 20  ? -9.397  -2.569  -1.556  1.00 0.00 ? 20  PRO A HG2  4  
ATOM 5518  H HG3  . PRO A 1 20  ? -8.042  -2.860  -2.628  1.00 0.00 ? 20  PRO A HG3  4  
ATOM 5519  H HD2  . PRO A 1 20  ? -8.603  -4.217  -0.165  1.00 0.00 ? 20  PRO A HD2  4  
ATOM 5520  H HD3  . PRO A 1 20  ? -7.188  -4.426  -1.178  1.00 0.00 ? 20  PRO A HD3  4  
ATOM 5521  N N    . ARG A 1 21  ? -7.538  0.199   1.841   1.00 0.00 ? 21  ARG A N    4  
ATOM 5522  C CA   . ARG A 1 21  ? -8.263  0.858   2.914   1.00 0.00 ? 21  ARG A CA   4  
ATOM 5523  C C    . ARG A 1 21  ? -8.837  2.190   2.426   1.00 0.00 ? 21  ARG A C    4  
ATOM 5524  O O    . ARG A 1 21  ? -8.502  2.652   1.336   1.00 0.00 ? 21  ARG A O    4  
ATOM 5525  C CB   . ARG A 1 21  ? -7.355  1.112   4.118   1.00 0.00 ? 21  ARG A CB   4  
ATOM 5526  C CG   . ARG A 1 21  ? -6.262  2.126   3.777   1.00 0.00 ? 21  ARG A CG   4  
ATOM 5527  C CD   . ARG A 1 21  ? -4.888  1.454   3.726   1.00 0.00 ? 21  ARG A CD   4  
ATOM 5528  N NE   . ARG A 1 21  ? -4.436  1.121   5.095   1.00 0.00 ? 21  ARG A NE   4  
ATOM 5529  C CZ   . ARG A 1 21  ? -3.375  0.351   5.370   1.00 0.00 ? 21  ARG A CZ   4  
ATOM 5530  N NH1  . ARG A 1 21  ? -2.649  -0.171  4.371   1.00 0.00 ? 21  ARG A NH1  4  
ATOM 5531  N NH2  . ARG A 1 21  ? -3.039  0.102   6.643   1.00 0.00 ? 21  ARG A NH2  4  
ATOM 5532  H H    . ARG A 1 21  ? -6.701  0.663   1.549   1.00 0.00 ? 21  ARG A H    4  
ATOM 5533  H HA   . ARG A 1 21  ? -9.059  0.163   3.180   1.00 0.00 ? 21  ARG A HA   4  
ATOM 5534  H HB2  . ARG A 1 21  ? -7.949  1.481   4.955   1.00 0.00 ? 21  ARG A HB2  4  
ATOM 5535  H HB3  . ARG A 1 21  ? -6.901  0.175   4.440   1.00 0.00 ? 21  ARG A HB3  4  
ATOM 5536  H HG2  . ARG A 1 21  ? -6.479  2.590   2.815   1.00 0.00 ? 21  ARG A HG2  4  
ATOM 5537  H HG3  . ARG A 1 21  ? -6.253  2.922   4.521   1.00 0.00 ? 21  ARG A HG3  4  
ATOM 5538  H HD2  . ARG A 1 21  ? -4.939  0.549   3.120   1.00 0.00 ? 21  ARG A HD2  4  
ATOM 5539  H HD3  . ARG A 1 21  ? -4.167  2.117   3.248   1.00 0.00 ? 21  ARG A HD3  4  
ATOM 5540  H HE   . ARG A 1 21  ? -4.956  1.494   5.864   1.00 0.00 ? 21  ARG A HE   4  
ATOM 5541  H HH11 . ARG A 1 21  ? -2.900  0.015   3.421   1.00 0.00 ? 21  ARG A HH11 4  
ATOM 5542  H HH12 . ARG A 1 21  ? -1.857  -0.746  4.576   1.00 0.00 ? 21  ARG A HH12 4  
ATOM 5543  H HH21 . ARG A 1 21  ? -3.580  0.491   7.388   1.00 0.00 ? 21  ARG A HH21 4  
ATOM 5544  H HH22 . ARG A 1 21  ? -2.247  -0.473  6.848   1.00 0.00 ? 21  ARG A HH22 4  
ATOM 5545  N N    . HIS A 1 22  ? -9.690  2.771   3.257   1.00 0.00 ? 22  HIS A N    4  
ATOM 5546  C CA   . HIS A 1 22  ? -10.312 4.041   2.924   1.00 0.00 ? 22  HIS A CA   4  
ATOM 5547  C C    . HIS A 1 22  ? -10.040 5.054   4.037   1.00 0.00 ? 22  HIS A C    4  
ATOM 5548  O O    . HIS A 1 22  ? -10.882 5.266   4.908   1.00 0.00 ? 22  HIS A O    4  
ATOM 5549  C CB   . HIS A 1 22  ? -11.805 3.857   2.642   1.00 0.00 ? 22  HIS A CB   4  
ATOM 5550  C CG   . HIS A 1 22  ? -12.101 2.977   1.451   1.00 0.00 ? 22  HIS A CG   4  
ATOM 5551  N ND1  . HIS A 1 22  ? -11.564 1.710   1.302   1.00 0.00 ? 22  HIS A ND1  4  
ATOM 5552  C CD2  . HIS A 1 22  ? -12.885 3.194   0.356   1.00 0.00 ? 22  HIS A CD2  4  
ATOM 5553  C CE1  . HIS A 1 22  ? -12.009 1.198   0.165   1.00 0.00 ? 22  HIS A CE1  4  
ATOM 5554  N NE2  . HIS A 1 22  ? -12.828 2.119   -0.421  1.00 0.00 ? 22  HIS A NE2  4  
ATOM 5555  H H    . HIS A 1 22  ? -9.956  2.389   4.142   1.00 0.00 ? 22  HIS A H    4  
ATOM 5556  H HA   . HIS A 1 22  ? -9.841  4.388   2.004   1.00 0.00 ? 22  HIS A HA   4  
ATOM 5557  H HB2  . HIS A 1 22  ? -12.281 3.428   3.524   1.00 0.00 ? 22  HIS A HB2  4  
ATOM 5558  H HB3  . HIS A 1 22  ? -12.257 4.835   2.479   1.00 0.00 ? 22  HIS A HB3  4  
ATOM 5559  H HD1  . HIS A 1 22  ? -10.944 1.259   1.944   1.00 0.00 ? 22  HIS A HD1  4  
ATOM 5560  H HD2  . HIS A 1 22  ? -13.460 4.097   0.153   1.00 0.00 ? 22  HIS A HD2  4  
ATOM 5561  H HE1  . HIS A 1 22  ? -11.765 0.213   -0.233  1.00 0.00 ? 22  HIS A HE1  4  
ATOM 5562  N N    . VAL A 1 23  ? -8.860  5.653   3.972   1.00 0.00 ? 23  VAL A N    4  
ATOM 5563  C CA   . VAL A 1 23  ? -8.465  6.638   4.964   1.00 0.00 ? 23  VAL A CA   4  
ATOM 5564  C C    . VAL A 1 23  ? -9.154  7.969   4.656   1.00 0.00 ? 23  VAL A C    4  
ATOM 5565  O O    . VAL A 1 23  ? -9.117  8.444   3.522   1.00 0.00 ? 23  VAL A O    4  
ATOM 5566  C CB   . VAL A 1 23  ? -6.940  6.751   5.013   1.00 0.00 ? 23  VAL A CB   4  
ATOM 5567  C CG1  . VAL A 1 23  ? -6.502  7.857   5.975   1.00 0.00 ? 23  VAL A CG1  4  
ATOM 5568  C CG2  . VAL A 1 23  ? -6.303  5.412   5.389   1.00 0.00 ? 23  VAL A CG2  4  
ATOM 5569  H H    . VAL A 1 23  ? -8.180  5.474   3.260   1.00 0.00 ? 23  VAL A H    4  
ATOM 5570  H HA   . VAL A 1 23  ? -8.808  6.283   5.936   1.00 0.00 ? 23  VAL A HA   4  
ATOM 5571  H HB   . VAL A 1 23  ? -6.592  7.018   4.015   1.00 0.00 ? 23  VAL A HB   4  
ATOM 5572  H HG11 . VAL A 1 23  ? -5.428  7.788   6.143   1.00 0.00 ? 23  VAL A HG11 4  
ATOM 5573  H HG12 . VAL A 1 23  ? -6.741  8.829   5.544   1.00 0.00 ? 23  VAL A HG12 4  
ATOM 5574  H HG13 . VAL A 1 23  ? -7.027  7.742   6.924   1.00 0.00 ? 23  VAL A HG13 4  
ATOM 5575  H HG21 . VAL A 1 23  ? -7.072  4.737   5.764   1.00 0.00 ? 23  VAL A HG21 4  
ATOM 5576  H HG22 . VAL A 1 23  ? -5.831  4.974   4.510   1.00 0.00 ? 23  VAL A HG22 4  
ATOM 5577  H HG23 . VAL A 1 23  ? -5.552  5.572   6.163   1.00 0.00 ? 23  VAL A HG23 4  
ATOM 5578  N N    . LYS A 1 24  ? -9.766  8.535   5.686   1.00 0.00 ? 24  LYS A N    4  
ATOM 5579  C CA   . LYS A 1 24  ? -10.462 9.802   5.539   1.00 0.00 ? 24  LYS A CA   4  
ATOM 5580  C C    . LYS A 1 24  ? -9.511  10.946  5.899   1.00 0.00 ? 24  LYS A C    4  
ATOM 5581  O O    . LYS A 1 24  ? -8.517  10.736  6.592   1.00 0.00 ? 24  LYS A O    4  
ATOM 5582  C CB   . LYS A 1 24  ? -11.757 9.800   6.354   1.00 0.00 ? 24  LYS A CB   4  
ATOM 5583  C CG   . LYS A 1 24  ? -12.950 9.396   5.486   1.00 0.00 ? 24  LYS A CG   4  
ATOM 5584  C CD   . LYS A 1 24  ? -14.263 9.531   6.261   1.00 0.00 ? 24  LYS A CD   4  
ATOM 5585  C CE   . LYS A 1 24  ? -15.420 9.879   5.323   1.00 0.00 ? 24  LYS A CE   4  
ATOM 5586  N NZ   . LYS A 1 24  ? -16.676 10.046  6.089   1.00 0.00 ? 24  LYS A NZ   4  
ATOM 5587  H H    . LYS A 1 24  ? -9.792  8.143   6.605   1.00 0.00 ? 24  LYS A H    4  
ATOM 5588  H HA   . LYS A 1 24  ? -10.741 9.902   4.490   1.00 0.00 ? 24  LYS A HA   4  
ATOM 5589  H HB2  . LYS A 1 24  ? -11.662 9.110   7.193   1.00 0.00 ? 24  LYS A HB2  4  
ATOM 5590  H HB3  . LYS A 1 24  ? -11.927 10.791  6.775   1.00 0.00 ? 24  LYS A HB3  4  
ATOM 5591  H HG2  . LYS A 1 24  ? -12.984 10.023  4.595   1.00 0.00 ? 24  LYS A HG2  4  
ATOM 5592  H HG3  . LYS A 1 24  ? -12.827 8.367   5.148   1.00 0.00 ? 24  LYS A HG3  4  
ATOM 5593  H HD2  . LYS A 1 24  ? -14.479 8.598   6.781   1.00 0.00 ? 24  LYS A HD2  4  
ATOM 5594  H HD3  . LYS A 1 24  ? -14.162 10.304  7.023   1.00 0.00 ? 24  LYS A HD3  4  
ATOM 5595  H HE2  . LYS A 1 24  ? -15.193 10.797  4.781   1.00 0.00 ? 24  LYS A HE2  4  
ATOM 5596  H HE3  . LYS A 1 24  ? -15.543 9.092   4.580   1.00 0.00 ? 24  LYS A HE3  4  
ATOM 5597  H HZ1  . LYS A 1 24  ? -17.020 10.976  5.965   1.00 0.00 ? 24  LYS A HZ1  4  
ATOM 5598  H HZ2  . LYS A 1 24  ? -17.356 9.392   5.760   1.00 0.00 ? 24  LYS A HZ2  4  
ATOM 5599  H HZ3  . LYS A 1 24  ? -16.498 9.883   7.059   1.00 0.00 ? 24  LYS A HZ3  4  
ATOM 5600  N N    . VAL A 1 25  ? -9.850  12.130  5.411   1.00 0.00 ? 25  VAL A N    4  
ATOM 5601  C CA   . VAL A 1 25  ? -9.039  13.307  5.672   1.00 0.00 ? 25  VAL A CA   4  
ATOM 5602  C C    . VAL A 1 25  ? -9.948  14.466  6.084   1.00 0.00 ? 25  VAL A C    4  
ATOM 5603  O O    . VAL A 1 25  ? -10.973 14.713  5.450   1.00 0.00 ? 25  VAL A O    4  
ATOM 5604  C CB   . VAL A 1 25  ? -8.176  13.629  4.450   1.00 0.00 ? 25  VAL A CB   4  
ATOM 5605  C CG1  . VAL A 1 25  ? -7.194  14.761  4.756   1.00 0.00 ? 25  VAL A CG1  4  
ATOM 5606  C CG2  . VAL A 1 25  ? -7.440  12.383  3.955   1.00 0.00 ? 25  VAL A CG2  4  
ATOM 5607  H H    . VAL A 1 25  ? -10.661 12.292  4.848   1.00 0.00 ? 25  VAL A H    4  
ATOM 5608  H HA   . VAL A 1 25  ? -8.374  13.070  6.502   1.00 0.00 ? 25  VAL A HA   4  
ATOM 5609  H HB   . VAL A 1 25  ? -8.838  13.967  3.652   1.00 0.00 ? 25  VAL A HB   4  
ATOM 5610  H HG11 . VAL A 1 25  ? -7.244  15.510  3.965   1.00 0.00 ? 25  VAL A HG11 4  
ATOM 5611  H HG12 . VAL A 1 25  ? -7.455  15.222  5.709   1.00 0.00 ? 25  VAL A HG12 4  
ATOM 5612  H HG13 . VAL A 1 25  ? -6.182  14.359  4.813   1.00 0.00 ? 25  VAL A HG13 4  
ATOM 5613  H HG21 . VAL A 1 25  ? -7.426  11.632  4.744   1.00 0.00 ? 25  VAL A HG21 4  
ATOM 5614  H HG22 . VAL A 1 25  ? -7.952  11.982  3.080   1.00 0.00 ? 25  VAL A HG22 4  
ATOM 5615  H HG23 . VAL A 1 25  ? -6.417  12.648  3.687   1.00 0.00 ? 25  VAL A HG23 4  
ATOM 5616  N N    . GLN A 1 26  ? -9.540  15.148  7.145   1.00 0.00 ? 26  GLN A N    4  
ATOM 5617  C CA   . GLN A 1 26  ? -10.305 16.275  7.650   1.00 0.00 ? 26  GLN A CA   4  
ATOM 5618  C C    . GLN A 1 26  ? -9.573  17.587  7.358   1.00 0.00 ? 26  GLN A C    4  
ATOM 5619  O O    . GLN A 1 26  ? -9.100  18.255  8.276   1.00 0.00 ? 26  GLN A O    4  
ATOM 5620  C CB   . GLN A 1 26  ? -10.583 16.123  9.147   1.00 0.00 ? 26  GLN A CB   4  
ATOM 5621  C CG   . GLN A 1 26  ? -12.067 15.855  9.404   1.00 0.00 ? 26  GLN A CG   4  
ATOM 5622  C CD   . GLN A 1 26  ? -12.546 16.585  10.661  1.00 0.00 ? 26  GLN A CD   4  
ATOM 5623  O OE1  . GLN A 1 26  ? -11.777 16.918  11.548  1.00 0.00 ? 26  GLN A OE1  4  
ATOM 5624  N NE2  . GLN A 1 26  ? -13.856 16.813  10.688  1.00 0.00 ? 26  GLN A NE2  4  
ATOM 5625  H H    . GLN A 1 26  ? -8.706  14.941  7.656   1.00 0.00 ? 26  GLN A H    4  
ATOM 5626  H HA   . GLN A 1 26  ? -11.250 16.250  7.107   1.00 0.00 ? 26  GLN A HA   4  
ATOM 5627  H HB2  . GLN A 1 26  ? -9.986  15.305  9.550   1.00 0.00 ? 26  GLN A HB2  4  
ATOM 5628  H HB3  . GLN A 1 26  ? -10.277 17.029  9.671   1.00 0.00 ? 26  GLN A HB3  4  
ATOM 5629  H HG2  . GLN A 1 26  ? -12.654 16.180  8.545   1.00 0.00 ? 26  GLN A HG2  4  
ATOM 5630  H HG3  . GLN A 1 26  ? -12.232 14.783  9.517   1.00 0.00 ? 26  GLN A HG3  4  
ATOM 5631  H HE21 . GLN A 1 26  ? -14.431 16.513  9.927   1.00 0.00 ? 26  GLN A HE21 4  
ATOM 5632  H HE22 . GLN A 1 26  ? -14.265 17.285  11.469  1.00 0.00 ? 26  GLN A HE22 4  
ATOM 5633  N N    . LYS A 1 27  ? -9.503  17.916  6.077   1.00 0.00 ? 27  LYS A N    4  
ATOM 5634  C CA   . LYS A 1 27  ? -8.836  19.135  5.653   1.00 0.00 ? 27  LYS A CA   4  
ATOM 5635  C C    . LYS A 1 27  ? -9.437  20.326  6.402   1.00 0.00 ? 27  LYS A C    4  
ATOM 5636  O O    . LYS A 1 27  ? -8.866  20.797  7.385   1.00 0.00 ? 27  LYS A O    4  
ATOM 5637  C CB   . LYS A 1 27  ? -8.893  19.275  4.130   1.00 0.00 ? 27  LYS A CB   4  
ATOM 5638  C CG   . LYS A 1 27  ? -7.512  19.602  3.558   1.00 0.00 ? 27  LYS A CG   4  
ATOM 5639  C CD   . LYS A 1 27  ? -6.782  18.329  3.125   1.00 0.00 ? 27  LYS A CD   4  
ATOM 5640  C CE   . LYS A 1 27  ? -6.573  18.306  1.609   1.00 0.00 ? 27  LYS A CE   4  
ATOM 5641  N NZ   . LYS A 1 27  ? -7.100  17.048  1.033   1.00 0.00 ? 27  LYS A NZ   4  
ATOM 5642  H H    . LYS A 1 27  ? -9.891  17.367  5.336   1.00 0.00 ? 27  LYS A H    4  
ATOM 5643  H HA   . LYS A 1 27  ? -7.786  19.047  5.929   1.00 0.00 ? 27  LYS A HA   4  
ATOM 5644  H HB2  . LYS A 1 27  ? -9.263  18.349  3.689   1.00 0.00 ? 27  LYS A HB2  4  
ATOM 5645  H HB3  . LYS A 1 27  ? -9.598  20.061  3.859   1.00 0.00 ? 27  LYS A HB3  4  
ATOM 5646  H HG2  . LYS A 1 27  ? -7.617  20.273  2.706   1.00 0.00 ? 27  LYS A HG2  4  
ATOM 5647  H HG3  . LYS A 1 27  ? -6.920  20.128  4.307   1.00 0.00 ? 27  LYS A HG3  4  
ATOM 5648  H HD2  . LYS A 1 27  ? -5.818  18.269  3.629   1.00 0.00 ? 27  LYS A HD2  4  
ATOM 5649  H HD3  . LYS A 1 27  ? -7.357  17.455  3.430   1.00 0.00 ? 27  LYS A HD3  4  
ATOM 5650  H HE2  . LYS A 1 27  ? -7.075  19.159  1.154   1.00 0.00 ? 27  LYS A HE2  4  
ATOM 5651  H HE3  . LYS A 1 27  ? -5.512  18.401  1.381   1.00 0.00 ? 27  LYS A HE3  4  
ATOM 5652  H HZ1  . LYS A 1 27  ? -7.680  17.259  0.247   1.00 0.00 ? 27  LYS A HZ1  4  
ATOM 5653  H HZ2  . LYS A 1 27  ? -6.337  16.471  0.740   1.00 0.00 ? 27  LYS A HZ2  4  
ATOM 5654  H HZ3  . LYS A 1 27  ? -7.637  16.564  1.724   1.00 0.00 ? 27  LYS A HZ3  4  
ATOM 5655  N N    . GLY A 1 28  ? -10.580 20.779  5.910   1.00 0.00 ? 28  GLY A N    4  
ATOM 5656  C CA   . GLY A 1 28  ? -11.264 21.907  6.521   1.00 0.00 ? 28  GLY A CA   4  
ATOM 5657  C C    . GLY A 1 28  ? -10.801 23.228  5.904   1.00 0.00 ? 28  GLY A C    4  
ATOM 5658  O O    . GLY A 1 28  ? -11.565 23.892  5.205   1.00 0.00 ? 28  GLY A O    4  
ATOM 5659  H H    . GLY A 1 28  ? -11.038 20.391  5.110   1.00 0.00 ? 28  GLY A H    4  
ATOM 5660  H HA2  . GLY A 1 28  ? -12.340 21.798  6.390   1.00 0.00 ? 28  GLY A HA2  4  
ATOM 5661  H HA3  . GLY A 1 28  ? -11.072 21.915  7.594   1.00 0.00 ? 28  GLY A HA3  4  
ATOM 5662  N N    . SER A 1 29  ? -9.552  23.570  6.185   1.00 0.00 ? 29  SER A N    4  
ATOM 5663  C CA   . SER A 1 29  ? -8.979  24.801  5.667   1.00 0.00 ? 29  SER A CA   4  
ATOM 5664  C C    . SER A 1 29  ? -7.455  24.767  5.806   1.00 0.00 ? 29  SER A C    4  
ATOM 5665  O O    . SER A 1 29  ? -6.836  25.778  6.131   1.00 0.00 ? 29  SER A O    4  
ATOM 5666  C CB   . SER A 1 29  ? -9.550  26.022  6.390   1.00 0.00 ? 29  SER A CB   4  
ATOM 5667  O OG   . SER A 1 29  ? -10.937 26.205  6.114   1.00 0.00 ? 29  SER A OG   4  
ATOM 5668  H H    . SER A 1 29  ? -8.938  23.024  6.755   1.00 0.00 ? 29  SER A H    4  
ATOM 5669  H HA   . SER A 1 29  ? -9.267  24.833  4.616   1.00 0.00 ? 29  SER A HA   4  
ATOM 5670  H HB2  . SER A 1 29  ? -9.406  25.908  7.464   1.00 0.00 ? 29  SER A HB2  4  
ATOM 5671  H HB3  . SER A 1 29  ? -9.000  26.913  6.087   1.00 0.00 ? 29  SER A HB3  4  
ATOM 5672  H HG   . SER A 1 29  ? -11.481 25.942  6.910   1.00 0.00 ? 29  SER A HG   4  
ATOM 5673  N N    . GLU A 1 30  ? -6.896  23.593  5.552   1.00 0.00 ? 30  GLU A N    4  
ATOM 5674  C CA   . GLU A 1 30  ? -5.457  23.414  5.644   1.00 0.00 ? 30  GLU A CA   4  
ATOM 5675  C C    . GLU A 1 30  ? -4.950  22.571  4.472   1.00 0.00 ? 30  GLU A C    4  
ATOM 5676  O O    . GLU A 1 30  ? -5.730  21.883  3.815   1.00 0.00 ? 30  GLU A O    4  
ATOM 5677  C CB   . GLU A 1 30  ? -5.068  22.783  6.982   1.00 0.00 ? 30  GLU A CB   4  
ATOM 5678  C CG   . GLU A 1 30  ? -4.911  23.850  8.067   1.00 0.00 ? 30  GLU A CG   4  
ATOM 5679  C CD   . GLU A 1 30  ? -5.698  23.473  9.325   1.00 0.00 ? 30  GLU A CD   4  
ATOM 5680  O OE1  . GLU A 1 30  ? -6.933  23.662  9.299   1.00 0.00 ? 30  GLU A OE1  4  
ATOM 5681  O OE2  . GLU A 1 30  ? -5.045  23.005  10.283  1.00 0.00 ? 30  GLU A OE2  4  
ATOM 5682  H H    . GLU A 1 30  ? -7.407  22.775  5.287   1.00 0.00 ? 30  GLU A H    4  
ATOM 5683  H HA   . GLU A 1 30  ? -5.036  24.418  5.587   1.00 0.00 ? 30  GLU A HA   4  
ATOM 5684  H HB2  . GLU A 1 30  ? -5.828  22.062  7.283   1.00 0.00 ? 30  GLU A HB2  4  
ATOM 5685  H HB3  . GLU A 1 30  ? -4.133  22.233  6.871   1.00 0.00 ? 30  GLU A HB3  4  
ATOM 5686  H HG2  . GLU A 1 30  ? -3.857  23.969  8.316   1.00 0.00 ? 30  GLU A HG2  4  
ATOM 5687  H HG3  . GLU A 1 30  ? -5.261  24.811  7.690   1.00 0.00 ? 30  GLU A HG3  4  
ATOM 5688  N N    . PRO A 1 31  ? -3.613  22.654  4.240   1.00 0.00 ? 31  PRO A N    4  
ATOM 5689  C CA   . PRO A 1 31  ? -2.993  21.907  3.159   1.00 0.00 ? 31  PRO A CA   4  
ATOM 5690  C C    . PRO A 1 31  ? -2.875  20.424  3.515   1.00 0.00 ? 31  PRO A C    4  
ATOM 5691  O O    . PRO A 1 31  ? -3.165  20.027  4.642   1.00 0.00 ? 31  PRO A O    4  
ATOM 5692  C CB   . PRO A 1 31  ? -1.646  22.575  2.941   1.00 0.00 ? 31  PRO A CB   4  
ATOM 5693  C CG   . PRO A 1 31  ? -1.364  23.369  4.207   1.00 0.00 ? 31  PRO A CG   4  
ATOM 5694  C CD   . PRO A 1 31  ? -2.659  23.458  4.998   1.00 0.00 ? 31  PRO A CD   4  
ATOM 5695  H HA   . PRO A 1 31  ? -3.564  21.946  2.338   1.00 0.00 ? 31  PRO A HA   4  
ATOM 5696  H HB2  . PRO A 1 31  ? -0.866  21.834  2.763   1.00 0.00 ? 31  PRO A HB2  4  
ATOM 5697  H HB3  . PRO A 1 31  ? -1.670  23.228  2.068   1.00 0.00 ? 31  PRO A HB3  4  
ATOM 5698  H HG2  . PRO A 1 31  ? -0.588  22.882  4.798   1.00 0.00 ? 31  PRO A HG2  4  
ATOM 5699  H HG3  . PRO A 1 31  ? -0.999  24.365  3.959   1.00 0.00 ? 31  PRO A HG3  4  
ATOM 5700  H HD2  . PRO A 1 31  ? -2.532  23.073  6.010   1.00 0.00 ? 31  PRO A HD2  4  
ATOM 5701  H HD3  . PRO A 1 31  ? -2.996  24.491  5.090   1.00 0.00 ? 31  PRO A HD3  4  
ATOM 5702  N N    . LEU A 1 32  ? -2.446  19.645  2.532   1.00 0.00 ? 32  LEU A N    4  
ATOM 5703  C CA   . LEU A 1 32  ? -2.286  18.214  2.728   1.00 0.00 ? 32  LEU A CA   4  
ATOM 5704  C C    . LEU A 1 32  ? -0.874  17.930  3.245   1.00 0.00 ? 32  LEU A C    4  
ATOM 5705  O O    . LEU A 1 32  ? -0.707  17.284  4.279   1.00 0.00 ? 32  LEU A O    4  
ATOM 5706  C CB   . LEU A 1 32  ? -2.635  17.455  1.446   1.00 0.00 ? 32  LEU A CB   4  
ATOM 5707  C CG   . LEU A 1 32  ? -3.088  16.005  1.626   1.00 0.00 ? 32  LEU A CG   4  
ATOM 5708  C CD1  . LEU A 1 32  ? -4.413  15.936  2.389   1.00 0.00 ? 32  LEU A CD1  4  
ATOM 5709  C CD2  . LEU A 1 32  ? -3.163  15.283  0.280   1.00 0.00 ? 32  LEU A CD2  4  
ATOM 5710  H H    . LEU A 1 32  ? -2.212  19.975  1.618   1.00 0.00 ? 32  LEU A H    4  
ATOM 5711  H HA   . LEU A 1 32  ? -3.002  17.906  3.489   1.00 0.00 ? 32  LEU A HA   4  
ATOM 5712  H HB2  . LEU A 1 32  ? -3.424  18.000  0.928   1.00 0.00 ? 32  LEU A HB2  4  
ATOM 5713  H HB3  . LEU A 1 32  ? -1.761  17.464  0.793   1.00 0.00 ? 32  LEU A HB3  4  
ATOM 5714  H HG   . LEU A 1 32  ? -2.342  15.487  2.229   1.00 0.00 ? 32  LEU A HG   4  
ATOM 5715  H HD11 . LEU A 1 32  ? -4.788  16.946  2.557   1.00 0.00 ? 32  LEU A HD11 4  
ATOM 5716  H HD12 . LEU A 1 32  ? -5.139  15.371  1.805   1.00 0.00 ? 32  LEU A HD12 4  
ATOM 5717  H HD13 . LEU A 1 32  ? -4.255  15.443  3.348   1.00 0.00 ? 32  LEU A HD13 4  
ATOM 5718  H HD21 . LEU A 1 32  ? -2.458  15.737  -0.416  1.00 0.00 ? 32  LEU A HD21 4  
ATOM 5719  H HD22 . LEU A 1 32  ? -2.912  14.231  0.418   1.00 0.00 ? 32  LEU A HD22 4  
ATOM 5720  H HD23 . LEU A 1 32  ? -4.174  15.365  -0.121  1.00 0.00 ? 32  LEU A HD23 4  
ATOM 5721  N N    . GLY A 1 33  ? 0.105   18.426  2.503   1.00 0.00 ? 33  GLY A N    4  
ATOM 5722  C CA   . GLY A 1 33  ? 1.496   18.233  2.874   1.00 0.00 ? 33  GLY A CA   4  
ATOM 5723  C C    . GLY A 1 33  ? 1.926   16.781  2.659   1.00 0.00 ? 33  GLY A C    4  
ATOM 5724  O O    . GLY A 1 33  ? 2.287   16.089  3.609   1.00 0.00 ? 33  GLY A O    4  
ATOM 5725  H H    . GLY A 1 33  ? -0.040  18.950  1.664   1.00 0.00 ? 33  GLY A H    4  
ATOM 5726  H HA2  . GLY A 1 33  ? 2.129   18.895  2.283   1.00 0.00 ? 33  GLY A HA2  4  
ATOM 5727  H HA3  . GLY A 1 33  ? 1.639   18.507  3.920   1.00 0.00 ? 33  GLY A HA3  4  
ATOM 5728  N N    . ILE A 1 34  ? 1.871   16.361  1.403   1.00 0.00 ? 34  ILE A N    4  
ATOM 5729  C CA   . ILE A 1 34  ? 2.250   15.004  1.050   1.00 0.00 ? 34  ILE A CA   4  
ATOM 5730  C C    . ILE A 1 34  ? 2.984   15.016  -0.292  1.00 0.00 ? 34  ILE A C    4  
ATOM 5731  O O    . ILE A 1 34  ? 2.663   15.814  -1.172  1.00 0.00 ? 34  ILE A O    4  
ATOM 5732  C CB   . ILE A 1 34  ? 1.028   14.083  1.075   1.00 0.00 ? 34  ILE A CB   4  
ATOM 5733  C CG1  . ILE A 1 34  ? -0.127  14.683  0.270   1.00 0.00 ? 34  ILE A CG1  4  
ATOM 5734  C CG2  . ILE A 1 34  ? 0.616   13.756  2.512   1.00 0.00 ? 34  ILE A CG2  4  
ATOM 5735  C CD1  . ILE A 1 34  ? -0.775  13.629  -0.629  1.00 0.00 ? 34  ILE A CD1  4  
ATOM 5736  H H    . ILE A 1 34  ? 1.576   16.931  0.636   1.00 0.00 ? 34  ILE A H    4  
ATOM 5737  H HA   . ILE A 1 34  ? 2.938   14.647  1.817   1.00 0.00 ? 34  ILE A HA   4  
ATOM 5738  H HB   . ILE A 1 34  ? 1.299   13.143  0.596   1.00 0.00 ? 34  ILE A HB   4  
ATOM 5739  H HG12 . ILE A 1 34  ? -0.873  15.095  0.950   1.00 0.00 ? 34  ILE A HG12 4  
ATOM 5740  H HG13 . ILE A 1 34  ? 0.240   15.510  -0.339  1.00 0.00 ? 34  ILE A HG13 4  
ATOM 5741  H HG21 . ILE A 1 34  ? 1.250   12.958  2.898   1.00 0.00 ? 34  ILE A HG21 4  
ATOM 5742  H HG22 . ILE A 1 34  ? 0.731   14.644  3.133   1.00 0.00 ? 34  ILE A HG22 4  
ATOM 5743  H HG23 . ILE A 1 34  ? -0.425  13.434  2.527   1.00 0.00 ? 34  ILE A HG23 4  
ATOM 5744  H HD11 . ILE A 1 34  ? -1.082  12.775  -0.025  1.00 0.00 ? 34  ILE A HD11 4  
ATOM 5745  H HD12 . ILE A 1 34  ? -1.648  14.058  -1.122  1.00 0.00 ? 34  ILE A HD12 4  
ATOM 5746  H HD13 . ILE A 1 34  ? -0.057  13.302  -1.382  1.00 0.00 ? 34  ILE A HD13 4  
ATOM 5747  N N    . SER A 1 35  ? 3.955   14.122  -0.408  1.00 0.00 ? 35  SER A N    4  
ATOM 5748  C CA   . SER A 1 35  ? 4.737   14.020  -1.628  1.00 0.00 ? 35  SER A CA   4  
ATOM 5749  C C    . SER A 1 35  ? 4.360   12.746  -2.386  1.00 0.00 ? 35  SER A C    4  
ATOM 5750  O O    . SER A 1 35  ? 4.112   11.707  -1.776  1.00 0.00 ? 35  SER A O    4  
ATOM 5751  C CB   . SER A 1 35  ? 6.237   14.033  -1.324  1.00 0.00 ? 35  SER A CB   4  
ATOM 5752  O OG   . SER A 1 35  ? 7.009   14.399  -2.464  1.00 0.00 ? 35  SER A OG   4  
ATOM 5753  H H    . SER A 1 35  ? 4.210   13.477  0.313   1.00 0.00 ? 35  SER A H    4  
ATOM 5754  H HA   . SER A 1 35  ? 4.478   14.904  -2.211  1.00 0.00 ? 35  SER A HA   4  
ATOM 5755  H HB2  . SER A 1 35  ? 6.436   14.732  -0.512  1.00 0.00 ? 35  SER A HB2  4  
ATOM 5756  H HB3  . SER A 1 35  ? 6.545   13.046  -0.978  1.00 0.00 ? 35  SER A HB3  4  
ATOM 5757  H HG   . SER A 1 35  ? 6.422   14.458  -3.271  1.00 0.00 ? 35  SER A HG   4  
ATOM 5758  N N    . ILE A 1 36  ? 4.328   12.868  -3.705  1.00 0.00 ? 36  ILE A N    4  
ATOM 5759  C CA   . ILE A 1 36  ? 3.985   11.739  -4.553  1.00 0.00 ? 36  ILE A CA   4  
ATOM 5760  C C    . ILE A 1 36  ? 4.978   11.659  -5.714  1.00 0.00 ? 36  ILE A C    4  
ATOM 5761  O O    . ILE A 1 36  ? 5.593   12.659  -6.080  1.00 0.00 ? 36  ILE A O    4  
ATOM 5762  C CB   . ILE A 1 36  ? 2.524   11.827  -4.998  1.00 0.00 ? 36  ILE A CB   4  
ATOM 5763  C CG1  . ILE A 1 36  ? 2.291   13.059  -5.875  1.00 0.00 ? 36  ILE A CG1  4  
ATOM 5764  C CG2  . ILE A 1 36  ? 1.581   11.795  -3.793  1.00 0.00 ? 36  ILE A CG2  4  
ATOM 5765  C CD1  . ILE A 1 36  ? 2.429   12.709  -7.358  1.00 0.00 ? 36  ILE A CD1  4  
ATOM 5766  H H    . ILE A 1 36  ? 4.531   13.717  -4.193  1.00 0.00 ? 36  ILE A H    4  
ATOM 5767  H HA   . ILE A 1 36  ? 4.085   10.836  -3.950  1.00 0.00 ? 36  ILE A HA   4  
ATOM 5768  H HB   . ILE A 1 36  ? 2.299   10.951  -5.606  1.00 0.00 ? 36  ILE A HB   4  
ATOM 5769  H HG12 . ILE A 1 36  ? 1.298   13.463  -5.683  1.00 0.00 ? 36  ILE A HG12 4  
ATOM 5770  H HG13 . ILE A 1 36  ? 3.008   13.837  -5.613  1.00 0.00 ? 36  ILE A HG13 4  
ATOM 5771  H HG21 . ILE A 1 36  ? 1.946   12.480  -3.028  1.00 0.00 ? 36  ILE A HG21 4  
ATOM 5772  H HG22 . ILE A 1 36  ? 0.582   12.097  -4.106  1.00 0.00 ? 36  ILE A HG22 4  
ATOM 5773  H HG23 . ILE A 1 36  ? 1.544   10.784  -3.388  1.00 0.00 ? 36  ILE A HG23 4  
ATOM 5774  H HD11 . ILE A 1 36  ? 1.535   12.182  -7.692  1.00 0.00 ? 36  ILE A HD11 4  
ATOM 5775  H HD12 . ILE A 1 36  ? 2.548   13.625  -7.938  1.00 0.00 ? 36  ILE A HD12 4  
ATOM 5776  H HD13 . ILE A 1 36  ? 3.301   12.072  -7.502  1.00 0.00 ? 36  ILE A HD13 4  
ATOM 5777  N N    . VAL A 1 37  ? 5.104   10.459  -6.262  1.00 0.00 ? 37  VAL A N    4  
ATOM 5778  C CA   . VAL A 1 37  ? 6.011   10.235  -7.375  1.00 0.00 ? 37  VAL A CA   4  
ATOM 5779  C C    . VAL A 1 37  ? 5.356   9.284   -8.378  1.00 0.00 ? 37  VAL A C    4  
ATOM 5780  O O    . VAL A 1 37  ? 4.469   8.512   -8.019  1.00 0.00 ? 37  VAL A O    4  
ATOM 5781  C CB   . VAL A 1 37  ? 7.357   9.724   -6.857  1.00 0.00 ? 37  VAL A CB   4  
ATOM 5782  C CG1  . VAL A 1 37  ? 7.898   10.629  -5.749  1.00 0.00 ? 37  VAL A CG1  4  
ATOM 5783  C CG2  . VAL A 1 37  ? 7.245   8.275   -6.377  1.00 0.00 ? 37  VAL A CG2  4  
ATOM 5784  H H    . VAL A 1 37  ? 4.600   9.650   -5.959  1.00 0.00 ? 37  VAL A H    4  
ATOM 5785  H HA   . VAL A 1 37  ? 6.179   11.196  -7.860  1.00 0.00 ? 37  VAL A HA   4  
ATOM 5786  H HB   . VAL A 1 37  ? 8.065   9.748   -7.685  1.00 0.00 ? 37  VAL A HB   4  
ATOM 5787  H HG11 . VAL A 1 37  ? 8.745   10.143  -5.264  1.00 0.00 ? 37  VAL A HG11 4  
ATOM 5788  H HG12 . VAL A 1 37  ? 8.221   11.577  -6.179  1.00 0.00 ? 37  VAL A HG12 4  
ATOM 5789  H HG13 . VAL A 1 37  ? 7.115   10.811  -5.014  1.00 0.00 ? 37  VAL A HG13 4  
ATOM 5790  H HG21 . VAL A 1 37  ? 6.563   7.728   -7.027  1.00 0.00 ? 37  VAL A HG21 4  
ATOM 5791  H HG22 . VAL A 1 37  ? 8.229   7.806   -6.405  1.00 0.00 ? 37  VAL A HG22 4  
ATOM 5792  H HG23 . VAL A 1 37  ? 6.864   8.260   -5.355  1.00 0.00 ? 37  VAL A HG23 4  
ATOM 5793  N N    . SER A 1 38  ? 5.818   9.372   -9.617  1.00 0.00 ? 38  SER A N    4  
ATOM 5794  C CA   . SER A 1 38  ? 5.289   8.529   -10.675 1.00 0.00 ? 38  SER A CA   4  
ATOM 5795  C C    . SER A 1 38  ? 6.329   7.483   -11.081 1.00 0.00 ? 38  SER A C    4  
ATOM 5796  O O    . SER A 1 38  ? 7.529   7.751   -11.050 1.00 0.00 ? 38  SER A O    4  
ATOM 5797  C CB   . SER A 1 38  ? 4.873   9.364   -11.888 1.00 0.00 ? 38  SER A CB   4  
ATOM 5798  O OG   . SER A 1 38  ? 4.354   8.555   -12.940 1.00 0.00 ? 38  SER A OG   4  
ATOM 5799  H H    . SER A 1 38  ? 6.540   10.003  -9.901  1.00 0.00 ? 38  SER A H    4  
ATOM 5800  H HA   . SER A 1 38  ? 4.409   8.048   -10.247 1.00 0.00 ? 38  SER A HA   4  
ATOM 5801  H HB2  . SER A 1 38  ? 4.121   10.092  -11.586 1.00 0.00 ? 38  SER A HB2  4  
ATOM 5802  H HB3  . SER A 1 38  ? 5.732   9.926   -12.253 1.00 0.00 ? 38  SER A HB3  4  
ATOM 5803  H HG   . SER A 1 38  ? 3.811   7.806   -12.560 1.00 0.00 ? 38  SER A HG   4  
ATOM 5804  N N    . GLY A 1 39  ? 5.831   6.313   -11.453 1.00 0.00 ? 39  GLY A N    4  
ATOM 5805  C CA   . GLY A 1 39  ? 6.702   5.226   -11.866 1.00 0.00 ? 39  GLY A CA   4  
ATOM 5806  C C    . GLY A 1 39  ? 6.719   5.084   -13.389 1.00 0.00 ? 39  GLY A C    4  
ATOM 5807  O O    . GLY A 1 39  ? 5.790   5.520   -14.067 1.00 0.00 ? 39  GLY A O    4  
ATOM 5808  H H    . GLY A 1 39  ? 4.853   6.103   -11.476 1.00 0.00 ? 39  GLY A H    4  
ATOM 5809  H HA2  . GLY A 1 39  ? 7.713   5.408   -11.502 1.00 0.00 ? 39  GLY A HA2  4  
ATOM 5810  H HA3  . GLY A 1 39  ? 6.364   4.293   -11.414 1.00 0.00 ? 39  GLY A HA3  4  
ATOM 5811  N N    . GLU A 1 40  ? 7.786   4.473   -13.882 1.00 0.00 ? 40  GLU A N    4  
ATOM 5812  C CA   . GLU A 1 40  ? 7.936   4.269   -15.313 1.00 0.00 ? 40  GLU A CA   4  
ATOM 5813  C C    . GLU A 1 40  ? 6.593   3.887   -15.939 1.00 0.00 ? 40  GLU A C    4  
ATOM 5814  O O    . GLU A 1 40  ? 6.101   4.577   -16.829 1.00 0.00 ? 40  GLU A O    4  
ATOM 5815  C CB   . GLU A 1 40  ? 9.000   3.208   -15.607 1.00 0.00 ? 40  GLU A CB   4  
ATOM 5816  C CG   . GLU A 1 40  ? 10.405  3.808   -15.541 1.00 0.00 ? 40  GLU A CG   4  
ATOM 5817  C CD   . GLU A 1 40  ? 11.472  2.727   -15.724 1.00 0.00 ? 40  GLU A CD   4  
ATOM 5818  O OE1  . GLU A 1 40  ? 11.435  2.067   -16.785 1.00 0.00 ? 40  GLU A OE1  4  
ATOM 5819  O OE2  . GLU A 1 40  ? 12.301  2.585   -14.799 1.00 0.00 ? 40  GLU A OE2  4  
ATOM 5820  H H    . GLU A 1 40  ? 8.537   4.122   -13.324 1.00 0.00 ? 40  GLU A H    4  
ATOM 5821  H HA   . GLU A 1 40  ? 8.270   5.228   -15.709 1.00 0.00 ? 40  GLU A HA   4  
ATOM 5822  H HB2  . GLU A 1 40  ? 8.914   2.394   -14.887 1.00 0.00 ? 40  GLU A HB2  4  
ATOM 5823  H HB3  . GLU A 1 40  ? 8.829   2.780   -16.594 1.00 0.00 ? 40  GLU A HB3  4  
ATOM 5824  H HG2  . GLU A 1 40  ? 10.516  4.569   -16.315 1.00 0.00 ? 40  GLU A HG2  4  
ATOM 5825  H HG3  . GLU A 1 40  ? 10.548  4.306   -14.582 1.00 0.00 ? 40  GLU A HG3  4  
ATOM 5826  N N    . LYS A 1 41  ? 6.040   2.788   -15.448 1.00 0.00 ? 41  LYS A N    4  
ATOM 5827  C CA   . LYS A 1 41  ? 4.763   2.305   -15.948 1.00 0.00 ? 41  LYS A CA   4  
ATOM 5828  C C    . LYS A 1 41  ? 3.674   3.332   -15.628 1.00 0.00 ? 41  LYS A C    4  
ATOM 5829  O O    . LYS A 1 41  ? 2.861   3.667   -16.487 1.00 0.00 ? 41  LYS A O    4  
ATOM 5830  C CB   . LYS A 1 41  ? 4.469   0.906   -15.404 1.00 0.00 ? 41  LYS A CB   4  
ATOM 5831  C CG   . LYS A 1 41  ? 4.395   -0.119  -16.537 1.00 0.00 ? 41  LYS A CG   4  
ATOM 5832  C CD   . LYS A 1 41  ? 5.766   -0.746  -16.799 1.00 0.00 ? 41  LYS A CD   4  
ATOM 5833  C CE   . LYS A 1 41  ? 6.109   -0.713  -18.289 1.00 0.00 ? 41  LYS A CE   4  
ATOM 5834  N NZ   . LYS A 1 41  ? 7.575   -0.662  -18.483 1.00 0.00 ? 41  LYS A NZ   4  
ATOM 5835  H H    . LYS A 1 41  ? 6.447   2.232   -14.724 1.00 0.00 ? 41  LYS A H    4  
ATOM 5836  H HA   . LYS A 1 41  ? 4.848   2.219   -17.031 1.00 0.00 ? 41  LYS A HA   4  
ATOM 5837  H HB2  . LYS A 1 41  ? 5.245   0.616   -14.696 1.00 0.00 ? 41  LYS A HB2  4  
ATOM 5838  H HB3  . LYS A 1 41  ? 3.526   0.916   -14.856 1.00 0.00 ? 41  LYS A HB3  4  
ATOM 5839  H HG2  . LYS A 1 41  ? 3.678   -0.898  -16.282 1.00 0.00 ? 41  LYS A HG2  4  
ATOM 5840  H HG3  . LYS A 1 41  ? 4.033   0.363   -17.445 1.00 0.00 ? 41  LYS A HG3  4  
ATOM 5841  H HD2  . LYS A 1 41  ? 6.529   -0.210  -16.234 1.00 0.00 ? 41  LYS A HD2  4  
ATOM 5842  H HD3  . LYS A 1 41  ? 5.772   -1.777  -16.443 1.00 0.00 ? 41  LYS A HD3  4  
ATOM 5843  H HE2  . LYS A 1 41  ? 5.702   -1.596  -18.782 1.00 0.00 ? 41  LYS A HE2  4  
ATOM 5844  H HE3  . LYS A 1 41  ? 5.644   0.155   -18.756 1.00 0.00 ? 41  LYS A HE3  4  
ATOM 5845  H HZ1  . LYS A 1 41  ? 7.892   -1.530  -18.865 1.00 0.00 ? 41  LYS A HZ1  4  
ATOM 5846  H HZ2  . LYS A 1 41  ? 7.803   0.082   -19.111 1.00 0.00 ? 41  LYS A HZ2  4  
ATOM 5847  H HZ3  . LYS A 1 41  ? 8.022   -0.502  -17.602 1.00 0.00 ? 41  LYS A HZ3  4  
ATOM 5848  N N    . GLY A 1 42  ? 3.695   3.801   -14.389 1.00 0.00 ? 42  GLY A N    4  
ATOM 5849  C CA   . GLY A 1 42  ? 2.719   4.782   -13.945 1.00 0.00 ? 42  GLY A CA   4  
ATOM 5850  C C    . GLY A 1 42  ? 2.512   4.703   -12.431 1.00 0.00 ? 42  GLY A C    4  
ATOM 5851  O O    . GLY A 1 42  ? 3.477   4.624   -11.672 1.00 0.00 ? 42  GLY A O    4  
ATOM 5852  H H    . GLY A 1 42  ? 4.360   3.523   -13.696 1.00 0.00 ? 42  GLY A H    4  
ATOM 5853  H HA2  . GLY A 1 42  ? 3.055   5.783   -14.217 1.00 0.00 ? 42  GLY A HA2  4  
ATOM 5854  H HA3  . GLY A 1 42  ? 1.771   4.614   -14.455 1.00 0.00 ? 42  GLY A HA3  4  
ATOM 5855  N N    . GLY A 1 43  ? 1.247   4.726   -12.037 1.00 0.00 ? 43  GLY A N    4  
ATOM 5856  C CA   . GLY A 1 43  ? 0.901   4.658   -10.628 1.00 0.00 ? 43  GLY A CA   4  
ATOM 5857  C C    . GLY A 1 43  ? 1.558   5.797   -9.846  1.00 0.00 ? 43  GLY A C    4  
ATOM 5858  O O    . GLY A 1 43  ? 2.548   6.373   -10.295 1.00 0.00 ? 43  GLY A O    4  
ATOM 5859  H H    . GLY A 1 43  ? 0.468   4.791   -12.661 1.00 0.00 ? 43  GLY A H    4  
ATOM 5860  H HA2  . GLY A 1 43  ? -0.182  4.711   -10.513 1.00 0.00 ? 43  GLY A HA2  4  
ATOM 5861  H HA3  . GLY A 1 43  ? 1.219   3.699   -10.218 1.00 0.00 ? 43  GLY A HA3  4  
ATOM 5862  N N    . ILE A 1 44  ? 0.982   6.087   -8.688  1.00 0.00 ? 44  ILE A N    4  
ATOM 5863  C CA   . ILE A 1 44  ? 1.499   7.147   -7.839  1.00 0.00 ? 44  ILE A CA   4  
ATOM 5864  C C    . ILE A 1 44  ? 1.878   6.563   -6.476  1.00 0.00 ? 44  ILE A C    4  
ATOM 5865  O O    . ILE A 1 44  ? 1.102   5.819   -5.879  1.00 0.00 ? 44  ILE A O    4  
ATOM 5866  C CB   . ILE A 1 44  ? 0.501   8.303   -7.758  1.00 0.00 ? 44  ILE A CB   4  
ATOM 5867  C CG1  . ILE A 1 44  ? 0.310   8.960   -9.126  1.00 0.00 ? 44  ILE A CG1  4  
ATOM 5868  C CG2  . ILE A 1 44  ? 0.922   9.316   -6.690  1.00 0.00 ? 44  ILE A CG2  4  
ATOM 5869  C CD1  . ILE A 1 44  ? 1.517   9.825   -9.493  1.00 0.00 ? 44  ILE A CD1  4  
ATOM 5870  H H    . ILE A 1 44  ? 0.177   5.613   -8.330  1.00 0.00 ? 44  ILE A H    4  
ATOM 5871  H HA   . ILE A 1 44  ? 2.402   7.533   -8.313  1.00 0.00 ? 44  ILE A HA   4  
ATOM 5872  H HB   . ILE A 1 44  ? -0.465  7.900   -7.456  1.00 0.00 ? 44  ILE A HB   4  
ATOM 5873  H HG12 . ILE A 1 44  ? 0.164   8.191   -9.885  1.00 0.00 ? 44  ILE A HG12 4  
ATOM 5874  H HG13 . ILE A 1 44  ? -0.592  9.573   -9.117  1.00 0.00 ? 44  ILE A HG13 4  
ATOM 5875  H HG21 . ILE A 1 44  ? 1.154   10.269  -7.165  1.00 0.00 ? 44  ILE A HG21 4  
ATOM 5876  H HG22 . ILE A 1 44  ? 0.107   9.453   -5.979  1.00 0.00 ? 44  ILE A HG22 4  
ATOM 5877  H HG23 . ILE A 1 44  ? 1.803   8.946   -6.166  1.00 0.00 ? 44  ILE A HG23 4  
ATOM 5878  H HD11 . ILE A 1 44  ? 1.321   10.860  -9.215  1.00 0.00 ? 44  ILE A HD11 4  
ATOM 5879  H HD12 . ILE A 1 44  ? 2.397   9.466   -8.959  1.00 0.00 ? 44  ILE A HD12 4  
ATOM 5880  H HD13 . ILE A 1 44  ? 1.694   9.764   -10.567 1.00 0.00 ? 44  ILE A HD13 4  
ATOM 5881  N N    . TYR A 1 45  ? 3.070   6.923   -6.025  1.00 0.00 ? 45  TYR A N    4  
ATOM 5882  C CA   . TYR A 1 45  ? 3.561   6.445   -4.744  1.00 0.00 ? 45  TYR A CA   4  
ATOM 5883  C C    . TYR A 1 45  ? 3.954   7.613   -3.836  1.00 0.00 ? 45  TYR A C    4  
ATOM 5884  O O    . TYR A 1 45  ? 4.557   8.582   -4.293  1.00 0.00 ? 45  TYR A O    4  
ATOM 5885  C CB   . TYR A 1 45  ? 4.807   5.613   -5.053  1.00 0.00 ? 45  TYR A CB   4  
ATOM 5886  C CG   . TYR A 1 45  ? 4.535   4.383   -5.921  1.00 0.00 ? 45  TYR A CG   4  
ATOM 5887  C CD1  . TYR A 1 45  ? 4.561   4.490   -7.297  1.00 0.00 ? 45  TYR A CD1  4  
ATOM 5888  C CD2  . TYR A 1 45  ? 4.262   3.167   -5.328  1.00 0.00 ? 45  TYR A CD2  4  
ATOM 5889  C CE1  . TYR A 1 45  ? 4.305   3.332   -8.113  1.00 0.00 ? 45  TYR A CE1  4  
ATOM 5890  C CE2  . TYR A 1 45  ? 4.006   2.009   -6.145  1.00 0.00 ? 45  TYR A CE2  4  
ATOM 5891  C CZ   . TYR A 1 45  ? 4.040   2.149   -7.497  1.00 0.00 ? 45  TYR A CZ   4  
ATOM 5892  O OH   . TYR A 1 45  ? 3.798   1.055   -8.269  1.00 0.00 ? 45  TYR A OH   4  
ATOM 5893  H H    . TYR A 1 45  ? 3.695   7.529   -6.517  1.00 0.00 ? 45  TYR A H    4  
ATOM 5894  H HA   . TYR A 1 45  ? 2.761   5.878   -4.268  1.00 0.00 ? 45  TYR A HA   4  
ATOM 5895  H HB2  . TYR A 1 45  ? 5.538   6.246   -5.557  1.00 0.00 ? 45  TYR A HB2  4  
ATOM 5896  H HB3  . TYR A 1 45  ? 5.258   5.291   -4.115  1.00 0.00 ? 45  TYR A HB3  4  
ATOM 5897  H HD1  . TYR A 1 45  ? 4.777   5.450   -7.765  1.00 0.00 ? 45  TYR A HD1  4  
ATOM 5898  H HD2  . TYR A 1 45  ? 4.241   3.083   -4.241  1.00 0.00 ? 45  TYR A HD2  4  
ATOM 5899  H HE1  . TYR A 1 45  ? 4.323   3.402   -9.201  1.00 0.00 ? 45  TYR A HE1  4  
ATOM 5900  H HE2  . TYR A 1 45  ? 3.789   1.043   -5.690  1.00 0.00 ? 45  TYR A HE2  4  
ATOM 5901  H HH   . TYR A 1 45  ? 4.535   0.389   -8.159  1.00 0.00 ? 45  TYR A HH   4  
ATOM 5902  N N    . VAL A 1 46  ? 3.596   7.481   -2.567  1.00 0.00 ? 46  VAL A N    4  
ATOM 5903  C CA   . VAL A 1 46  ? 3.903   8.513   -1.592  1.00 0.00 ? 46  VAL A CA   4  
ATOM 5904  C C    . VAL A 1 46  ? 5.418   8.582   -1.390  1.00 0.00 ? 46  VAL A C    4  
ATOM 5905  O O    . VAL A 1 46  ? 6.052   7.579   -1.067  1.00 0.00 ? 46  VAL A O    4  
ATOM 5906  C CB   . VAL A 1 46  ? 3.138   8.250   -0.293  1.00 0.00 ? 46  VAL A CB   4  
ATOM 5907  C CG1  . VAL A 1 46  ? 3.678   9.117   0.846   1.00 0.00 ? 46  VAL A CG1  4  
ATOM 5908  C CG2  . VAL A 1 46  ? 1.637   8.471   -0.487  1.00 0.00 ? 46  VAL A CG2  4  
ATOM 5909  H H    . VAL A 1 46  ? 3.105   6.689   -2.204  1.00 0.00 ? 46  VAL A H    4  
ATOM 5910  H HA   . VAL A 1 46  ? 3.559   9.464   -2.000  1.00 0.00 ? 46  VAL A HA   4  
ATOM 5911  H HB   . VAL A 1 46  ? 3.290   7.206   -0.020  1.00 0.00 ? 46  VAL A HB   4  
ATOM 5912  H HG11 . VAL A 1 46  ? 3.234   8.796   1.789   1.00 0.00 ? 46  VAL A HG11 4  
ATOM 5913  H HG12 . VAL A 1 46  ? 4.762   9.013   0.900   1.00 0.00 ? 46  VAL A HG12 4  
ATOM 5914  H HG13 . VAL A 1 46  ? 3.422   10.160  0.661   1.00 0.00 ? 46  VAL A HG13 4  
ATOM 5915  H HG21 . VAL A 1 46  ? 1.156   7.520   -0.715  1.00 0.00 ? 46  VAL A HG21 4  
ATOM 5916  H HG22 . VAL A 1 46  ? 1.210   8.884   0.427   1.00 0.00 ? 46  VAL A HG22 4  
ATOM 5917  H HG23 . VAL A 1 46  ? 1.475   9.166   -1.310  1.00 0.00 ? 46  VAL A HG23 4  
ATOM 5918  N N    . SER A 1 47  ? 5.955   9.777   -1.588  1.00 0.00 ? 47  SER A N    4  
ATOM 5919  C CA   . SER A 1 47  ? 7.384   9.991   -1.432  1.00 0.00 ? 47  SER A CA   4  
ATOM 5920  C C    . SER A 1 47  ? 7.684   10.510  -0.024  1.00 0.00 ? 47  SER A C    4  
ATOM 5921  O O    . SER A 1 47  ? 8.794   10.343  0.479   1.00 0.00 ? 47  SER A O    4  
ATOM 5922  C CB   . SER A 1 47  ? 7.913   10.969  -2.483  1.00 0.00 ? 47  SER A CB   4  
ATOM 5923  O OG   . SER A 1 47  ? 9.046   11.695  -2.014  1.00 0.00 ? 47  SER A OG   4  
ATOM 5924  H H    . SER A 1 47  ? 5.433   10.589  -1.850  1.00 0.00 ? 47  SER A H    4  
ATOM 5925  H HA   . SER A 1 47  ? 7.840   9.013   -1.584  1.00 0.00 ? 47  SER A HA   4  
ATOM 5926  H HB2  . SER A 1 47  ? 8.182   10.420  -3.386  1.00 0.00 ? 47  SER A HB2  4  
ATOM 5927  H HB3  . SER A 1 47  ? 7.123   11.668  -2.758  1.00 0.00 ? 47  SER A HB3  4  
ATOM 5928  H HG   . SER A 1 47  ? 9.805   11.068  -1.839  1.00 0.00 ? 47  SER A HG   4  
ATOM 5929  N N    . LYS A 1 48  ? 6.676   11.131  0.571   1.00 0.00 ? 48  LYS A N    4  
ATOM 5930  C CA   . LYS A 1 48  ? 6.818   11.676  1.910   1.00 0.00 ? 48  LYS A CA   4  
ATOM 5931  C C    . LYS A 1 48  ? 5.479   12.260  2.363   1.00 0.00 ? 48  LYS A C    4  
ATOM 5932  O O    . LYS A 1 48  ? 4.535   12.340  1.578   1.00 0.00 ? 48  LYS A O    4  
ATOM 5933  C CB   . LYS A 1 48  ? 7.975   12.677  1.961   1.00 0.00 ? 48  LYS A CB   4  
ATOM 5934  C CG   . LYS A 1 48  ? 8.616   12.703  3.350   1.00 0.00 ? 48  LYS A CG   4  
ATOM 5935  C CD   . LYS A 1 48  ? 10.080  12.263  3.286   1.00 0.00 ? 48  LYS A CD   4  
ATOM 5936  C CE   . LYS A 1 48  ? 10.382  11.207  4.352   1.00 0.00 ? 48  LYS A CE   4  
ATOM 5937  N NZ   . LYS A 1 48  ? 11.215  11.783  5.431   1.00 0.00 ? 48  LYS A NZ   4  
ATOM 5938  H H    . LYS A 1 48  ? 5.777   11.263  0.154   1.00 0.00 ? 48  LYS A H    4  
ATOM 5939  H HA   . LYS A 1 48  ? 7.077   10.850  2.573   1.00 0.00 ? 48  LYS A HA   4  
ATOM 5940  H HB2  . LYS A 1 48  ? 8.724   12.411  1.215   1.00 0.00 ? 48  LYS A HB2  4  
ATOM 5941  H HB3  . LYS A 1 48  ? 7.610   13.672  1.705   1.00 0.00 ? 48  LYS A HB3  4  
ATOM 5942  H HG2  . LYS A 1 48  ? 8.553   13.709  3.764   1.00 0.00 ? 48  LYS A HG2  4  
ATOM 5943  H HG3  . LYS A 1 48  ? 8.064   12.046  4.022   1.00 0.00 ? 48  LYS A HG3  4  
ATOM 5944  H HD2  . LYS A 1 48  ? 10.300  11.860  2.297   1.00 0.00 ? 48  LYS A HD2  4  
ATOM 5945  H HD3  . LYS A 1 48  ? 10.730  13.126  3.430   1.00 0.00 ? 48  LYS A HD3  4  
ATOM 5946  H HE2  . LYS A 1 48  ? 9.449   10.826  4.768   1.00 0.00 ? 48  LYS A HE2  4  
ATOM 5947  H HE3  . LYS A 1 48  ? 10.898  10.361  3.898   1.00 0.00 ? 48  LYS A HE3  4  
ATOM 5948  H HZ1  . LYS A 1 48  ? 10.821  12.653  5.728   1.00 0.00 ? 48  LYS A HZ1  4  
ATOM 5949  H HZ2  . LYS A 1 48  ? 11.244  11.149  6.204   1.00 0.00 ? 48  LYS A HZ2  4  
ATOM 5950  H HZ3  . LYS A 1 48  ? 12.143  11.936  5.090   1.00 0.00 ? 48  LYS A HZ3  4  
ATOM 5951  N N    . VAL A 1 49  ? 5.439   12.653  3.628   1.00 0.00 ? 49  VAL A N    4  
ATOM 5952  C CA   . VAL A 1 49  ? 4.231   13.227  4.195   1.00 0.00 ? 49  VAL A CA   4  
ATOM 5953  C C    . VAL A 1 49  ? 4.605   14.140  5.364   1.00 0.00 ? 49  VAL A C    4  
ATOM 5954  O O    . VAL A 1 49  ? 5.215   13.694  6.335   1.00 0.00 ? 49  VAL A O    4  
ATOM 5955  C CB   . VAL A 1 49  ? 3.259   12.114  4.594   1.00 0.00 ? 49  VAL A CB   4  
ATOM 5956  C CG1  . VAL A 1 49  ? 3.976   11.019  5.386   1.00 0.00 ? 49  VAL A CG1  4  
ATOM 5957  C CG2  . VAL A 1 49  ? 2.075   12.676  5.383   1.00 0.00 ? 49  VAL A CG2  4  
ATOM 5958  H H    . VAL A 1 49  ? 6.211   12.584  4.260   1.00 0.00 ? 49  VAL A H    4  
ATOM 5959  H HA   . VAL A 1 49  ? 3.756   13.827  3.419   1.00 0.00 ? 49  VAL A HA   4  
ATOM 5960  H HB   . VAL A 1 49  ? 2.870   11.666  3.679   1.00 0.00 ? 49  VAL A HB   4  
ATOM 5961  H HG11 . VAL A 1 49  ? 4.160   10.162  4.737   1.00 0.00 ? 49  VAL A HG11 4  
ATOM 5962  H HG12 . VAL A 1 49  ? 4.925   11.402  5.759   1.00 0.00 ? 49  VAL A HG12 4  
ATOM 5963  H HG13 . VAL A 1 49  ? 3.352   10.711  6.225   1.00 0.00 ? 49  VAL A HG13 4  
ATOM 5964  H HG21 . VAL A 1 49  ? 1.357   11.880  5.577   1.00 0.00 ? 49  VAL A HG21 4  
ATOM 5965  H HG22 . VAL A 1 49  ? 2.430   13.084  6.329   1.00 0.00 ? 49  VAL A HG22 4  
ATOM 5966  H HG23 . VAL A 1 49  ? 1.595   13.466  4.805   1.00 0.00 ? 49  VAL A HG23 4  
ATOM 5967  N N    . THR A 1 50  ? 4.225   15.403  5.232   1.00 0.00 ? 50  THR A N    4  
ATOM 5968  C CA   . THR A 1 50  ? 4.513   16.383  6.266   1.00 0.00 ? 50  THR A CA   4  
ATOM 5969  C C    . THR A 1 50  ? 3.913   15.941  7.602   1.00 0.00 ? 50  THR A C    4  
ATOM 5970  O O    . THR A 1 50  ? 2.889   15.261  7.632   1.00 0.00 ? 50  THR A O    4  
ATOM 5971  C CB   . THR A 1 50  ? 3.996   17.741  5.787   1.00 0.00 ? 50  THR A CB   4  
ATOM 5972  O OG1  . THR A 1 50  ? 4.889   18.101  4.736   1.00 0.00 ? 50  THR A OG1  4  
ATOM 5973  C CG2  . THR A 1 50  ? 4.187   18.842  6.832   1.00 0.00 ? 50  THR A CG2  4  
ATOM 5974  H H    . THR A 1 50  ? 3.729   15.758  4.440   1.00 0.00 ? 50  THR A H    4  
ATOM 5975  H HA   . THR A 1 50  ? 5.594   16.432  6.401   1.00 0.00 ? 50  THR A HA   4  
ATOM 5976  H HB   . THR A 1 50  ? 2.953   17.673  5.478   1.00 0.00 ? 50  THR A HB   4  
ATOM 5977  H HG1  . THR A 1 50  ? 4.471   17.903  3.850   1.00 0.00 ? 50  THR A HG1  4  
ATOM 5978  H HG21 . THR A 1 50  ? 4.810   19.634  6.416   1.00 0.00 ? 50  THR A HG21 4  
ATOM 5979  H HG22 . THR A 1 50  ? 3.216   19.251  7.110   1.00 0.00 ? 50  THR A HG22 4  
ATOM 5980  H HG23 . THR A 1 50  ? 4.672   18.425  7.715   1.00 0.00 ? 50  THR A HG23 4  
ATOM 5981  N N    . VAL A 1 51  ? 4.578   16.345  8.675   1.00 0.00 ? 51  VAL A N    4  
ATOM 5982  C CA   . VAL A 1 51  ? 4.123   16.000  10.011  1.00 0.00 ? 51  VAL A CA   4  
ATOM 5983  C C    . VAL A 1 51  ? 3.241   17.127  10.552  1.00 0.00 ? 51  VAL A C    4  
ATOM 5984  O O    . VAL A 1 51  ? 3.585   18.301  10.431  1.00 0.00 ? 51  VAL A O    4  
ATOM 5985  C CB   . VAL A 1 51  ? 5.323   15.695  10.910  1.00 0.00 ? 51  VAL A CB   4  
ATOM 5986  C CG1  . VAL A 1 51  ? 6.009   16.985  11.364  1.00 0.00 ? 51  VAL A CG1  4  
ATOM 5987  C CG2  . VAL A 1 51  ? 4.907   14.844  12.111  1.00 0.00 ? 51  VAL A CG2  4  
ATOM 5988  H H    . VAL A 1 51  ? 5.410   16.898  8.642   1.00 0.00 ? 51  VAL A H    4  
ATOM 5989  H HA   . VAL A 1 51  ? 3.523   15.093  9.930   1.00 0.00 ? 51  VAL A HA   4  
ATOM 5990  H HB   . VAL A 1 51  ? 6.042   15.121  10.326  1.00 0.00 ? 51  VAL A HB   4  
ATOM 5991  H HG11 . VAL A 1 51  ? 6.418   17.504  10.497  1.00 0.00 ? 51  VAL A HG11 4  
ATOM 5992  H HG12 . VAL A 1 51  ? 5.282   17.628  11.861  1.00 0.00 ? 51  VAL A HG12 4  
ATOM 5993  H HG13 . VAL A 1 51  ? 6.815   16.744  12.057  1.00 0.00 ? 51  VAL A HG13 4  
ATOM 5994  H HG21 . VAL A 1 51  ? 4.994   13.788  11.855  1.00 0.00 ? 51  VAL A HG21 4  
ATOM 5995  H HG22 . VAL A 1 51  ? 5.556   15.068  12.957  1.00 0.00 ? 51  VAL A HG22 4  
ATOM 5996  H HG23 . VAL A 1 51  ? 3.874   15.069  12.375  1.00 0.00 ? 51  VAL A HG23 4  
ATOM 5997  N N    . GLY A 1 52  ? 2.121   16.729  11.138  1.00 0.00 ? 52  GLY A N    4  
ATOM 5998  C CA   . GLY A 1 52  ? 1.188   17.691  11.699  1.00 0.00 ? 52  GLY A CA   4  
ATOM 5999  C C    . GLY A 1 52  ? 0.167   18.139  10.651  1.00 0.00 ? 52  GLY A C    4  
ATOM 6000  O O    . GLY A 1 52  ? -0.977  18.444  10.984  1.00 0.00 ? 52  GLY A O    4  
ATOM 6001  H H    . GLY A 1 52  ? 1.849   15.771  11.233  1.00 0.00 ? 52  GLY A H    4  
ATOM 6002  H HA2  . GLY A 1 52  ? 0.670   17.248  12.550  1.00 0.00 ? 52  GLY A HA2  4  
ATOM 6003  H HA3  . GLY A 1 52  ? 1.733   18.557  12.073  1.00 0.00 ? 52  GLY A HA3  4  
ATOM 6004  N N    . SER A 1 53  ? 0.617   18.164  9.405   1.00 0.00 ? 53  SER A N    4  
ATOM 6005  C CA   . SER A 1 53  ? -0.243  18.569  8.306   1.00 0.00 ? 53  SER A CA   4  
ATOM 6006  C C    . SER A 1 53  ? -1.446  17.630  8.210   1.00 0.00 ? 53  SER A C    4  
ATOM 6007  O O    . SER A 1 53  ? -1.433  16.538  8.776   1.00 0.00 ? 53  SER A O    4  
ATOM 6008  C CB   . SER A 1 53  ? 0.525   18.585  6.983   1.00 0.00 ? 53  SER A CB   4  
ATOM 6009  O OG   . SER A 1 53  ? 0.936   19.900  6.620   1.00 0.00 ? 53  SER A OG   4  
ATOM 6010  H H    . SER A 1 53  ? 1.549   17.914  9.142   1.00 0.00 ? 53  SER A H    4  
ATOM 6011  H HA   . SER A 1 53  ? -0.565  19.581  8.551   1.00 0.00 ? 53  SER A HA   4  
ATOM 6012  H HB2  . SER A 1 53  ? 1.401   17.941  7.064   1.00 0.00 ? 53  SER A HB2  4  
ATOM 6013  H HB3  . SER A 1 53  ? -0.103  18.171  6.194   1.00 0.00 ? 53  SER A HB3  4  
ATOM 6014  H HG   . SER A 1 53  ? 1.124   19.941  5.639   1.00 0.00 ? 53  SER A HG   4  
ATOM 6015  N N    . ILE A 1 54  ? -2.459  18.089  7.489   1.00 0.00 ? 54  ILE A N    4  
ATOM 6016  C CA   . ILE A 1 54  ? -3.668  17.304  7.311   1.00 0.00 ? 54  ILE A CA   4  
ATOM 6017  C C    . ILE A 1 54  ? -3.293  15.833  7.122   1.00 0.00 ? 54  ILE A C    4  
ATOM 6018  O O    . ILE A 1 54  ? -3.731  14.973  7.884   1.00 0.00 ? 54  ILE A O    4  
ATOM 6019  C CB   . ILE A 1 54  ? -4.515  17.874  6.172   1.00 0.00 ? 54  ILE A CB   4  
ATOM 6020  C CG1  . ILE A 1 54  ? -4.962  19.304  6.483   1.00 0.00 ? 54  ILE A CG1  4  
ATOM 6021  C CG2  . ILE A 1 54  ? -5.700  16.959  5.858   1.00 0.00 ? 54  ILE A CG2  4  
ATOM 6022  C CD1  . ILE A 1 54  ? -5.882  19.337  7.705   1.00 0.00 ? 54  ILE A CD1  4  
ATOM 6023  H H    . ILE A 1 54  ? -2.462  18.979  7.032   1.00 0.00 ? 54  ILE A H    4  
ATOM 6024  H HA   . ILE A 1 54  ? -4.255  17.396  8.226   1.00 0.00 ? 54  ILE A HA   4  
ATOM 6025  H HB   . ILE A 1 54  ? -3.896  17.918  5.276   1.00 0.00 ? 54  ILE A HB   4  
ATOM 6026  H HG12 . ILE A 1 54  ? -4.089  19.930  6.664   1.00 0.00 ? 54  ILE A HG12 4  
ATOM 6027  H HG13 . ILE A 1 54  ? -5.481  19.722  5.621   1.00 0.00 ? 54  ILE A HG13 4  
ATOM 6028  H HG21 . ILE A 1 54  ? -5.372  16.152  5.202   1.00 0.00 ? 54  ILE A HG21 4  
ATOM 6029  H HG22 . ILE A 1 54  ? -6.089  16.538  6.785   1.00 0.00 ? 54  ILE A HG22 4  
ATOM 6030  H HG23 . ILE A 1 54  ? -6.482  17.534  5.363   1.00 0.00 ? 54  ILE A HG23 4  
ATOM 6031  H HD11 . ILE A 1 54  ? -6.390  18.377  7.804   1.00 0.00 ? 54  ILE A HD11 4  
ATOM 6032  H HD12 . ILE A 1 54  ? -5.291  19.529  8.600   1.00 0.00 ? 54  ILE A HD12 4  
ATOM 6033  H HD13 . ILE A 1 54  ? -6.622  20.128  7.581   1.00 0.00 ? 54  ILE A HD13 4  
ATOM 6034  N N    . ALA A 1 55  ? -2.485  15.589  6.100   1.00 0.00 ? 55  ALA A N    4  
ATOM 6035  C CA   . ALA A 1 55  ? -2.045  14.236  5.801   1.00 0.00 ? 55  ALA A CA   4  
ATOM 6036  C C    . ALA A 1 55  ? -1.774  13.491  7.109   1.00 0.00 ? 55  ALA A C    4  
ATOM 6037  O O    . ALA A 1 55  ? -2.504  12.567  7.464   1.00 0.00 ? 55  ALA A O    4  
ATOM 6038  C CB   . ALA A 1 55  ? -0.814  14.289  4.894   1.00 0.00 ? 55  ALA A CB   4  
ATOM 6039  H H    . ALA A 1 55  ? -2.133  16.294  5.485   1.00 0.00 ? 55  ALA A H    4  
ATOM 6040  H HA   . ALA A 1 55  ? -2.853  13.735  5.267   1.00 0.00 ? 55  ALA A HA   4  
ATOM 6041  H HB1  . ALA A 1 55  ? -0.572  13.283  4.551   1.00 0.00 ? 55  ALA A HB1  4  
ATOM 6042  H HB2  . ALA A 1 55  ? -1.022  14.926  4.035   1.00 0.00 ? 55  ALA A HB2  4  
ATOM 6043  H HB3  . ALA A 1 55  ? 0.031   14.695  5.451   1.00 0.00 ? 55  ALA A HB3  4  
ATOM 6044  N N    . HIS A 1 56  ? -0.723  13.921  7.791   1.00 0.00 ? 56  HIS A N    4  
ATOM 6045  C CA   . HIS A 1 56  ? -0.347  13.306  9.053   1.00 0.00 ? 56  HIS A CA   4  
ATOM 6046  C C    . HIS A 1 56  ? -1.606  12.964  9.852   1.00 0.00 ? 56  HIS A C    4  
ATOM 6047  O O    . HIS A 1 56  ? -1.832  11.804  10.195  1.00 0.00 ? 56  HIS A O    4  
ATOM 6048  C CB   . HIS A 1 56  ? 0.622   14.203  9.827   1.00 0.00 ? 56  HIS A CB   4  
ATOM 6049  C CG   . HIS A 1 56  ? 1.629   13.445  10.658  1.00 0.00 ? 56  HIS A CG   4  
ATOM 6050  N ND1  . HIS A 1 56  ? 1.504   13.286  12.027  1.00 0.00 ? 56  HIS A ND1  4  
ATOM 6051  C CD2  . HIS A 1 56  ? 2.778   12.803  10.300  1.00 0.00 ? 56  HIS A CD2  4  
ATOM 6052  C CE1  . HIS A 1 56  ? 2.537   12.580  12.463  1.00 0.00 ? 56  HIS A CE1  4  
ATOM 6053  N NE2  . HIS A 1 56  ? 3.326   12.282  11.391  1.00 0.00 ? 56  HIS A NE2  4  
ATOM 6054  H H    . HIS A 1 56  ? -0.135  14.674  7.496   1.00 0.00 ? 56  HIS A H    4  
ATOM 6055  H HA   . HIS A 1 56  ? 0.179   12.384  8.807   1.00 0.00 ? 56  HIS A HA   4  
ATOM 6056  H HB2  . HIS A 1 56  ? 1.154   14.840  9.121   1.00 0.00 ? 56  HIS A HB2  4  
ATOM 6057  H HB3  . HIS A 1 56  ? 0.048   14.861  10.480  1.00 0.00 ? 56  HIS A HB3  4  
ATOM 6058  H HD1  . HIS A 1 56  ? 0.760   13.644  12.592  1.00 0.00 ? 56  HIS A HD1  4  
ATOM 6059  H HD2  . HIS A 1 56  ? 3.178   12.731  9.289   1.00 0.00 ? 56  HIS A HD2  4  
ATOM 6060  H HE1  . HIS A 1 56  ? 2.724   12.289  13.497  1.00 0.00 ? 56  HIS A HE1  4  
ATOM 6061  N N    . GLN A 1 57  ? -2.392  13.994  10.127  1.00 0.00 ? 57  GLN A N    4  
ATOM 6062  C CA   . GLN A 1 57  ? -3.622  13.817  10.880  1.00 0.00 ? 57  GLN A CA   4  
ATOM 6063  C C    . GLN A 1 57  ? -4.421  12.638  10.322  1.00 0.00 ? 57  GLN A C    4  
ATOM 6064  O O    . GLN A 1 57  ? -4.927  11.812  11.080  1.00 0.00 ? 57  GLN A O    4  
ATOM 6065  C CB   . GLN A 1 57  ? -4.458  15.098  10.873  1.00 0.00 ? 57  GLN A CB   4  
ATOM 6066  C CG   . GLN A 1 57  ? -3.585  16.325  11.147  1.00 0.00 ? 57  GLN A CG   4  
ATOM 6067  C CD   . GLN A 1 57  ? -4.427  17.491  11.671  1.00 0.00 ? 57  GLN A CD   4  
ATOM 6068  O OE1  . GLN A 1 57  ? -5.546  17.723  11.245  1.00 0.00 ? 57  GLN A OE1  4  
ATOM 6069  N NE2  . GLN A 1 57  ? -3.827  18.209  12.616  1.00 0.00 ? 57  GLN A NE2  4  
ATOM 6070  H H    . GLN A 1 57  ? -2.201  14.935  9.845   1.00 0.00 ? 57  GLN A H    4  
ATOM 6071  H HA   . GLN A 1 57  ? -3.308  13.601  11.901  1.00 0.00 ? 57  GLN A HA   4  
ATOM 6072  H HB2  . GLN A 1 57  ? -4.953  15.209  9.908   1.00 0.00 ? 57  GLN A HB2  4  
ATOM 6073  H HB3  . GLN A 1 57  ? -5.242  15.030  11.627  1.00 0.00 ? 57  GLN A HB3  4  
ATOM 6074  H HG2  . GLN A 1 57  ? -2.815  16.072  11.876  1.00 0.00 ? 57  GLN A HG2  4  
ATOM 6075  H HG3  . GLN A 1 57  ? -3.073  16.623  10.233  1.00 0.00 ? 57  GLN A HG3  4  
ATOM 6076  H HE21 . GLN A 1 57  ? -2.906  17.965  12.921  1.00 0.00 ? 57  GLN A HE21 4  
ATOM 6077  H HE22 . GLN A 1 57  ? -4.297  18.993  13.021  1.00 0.00 ? 57  GLN A HE22 4  
ATOM 6078  N N    . ALA A 1 58  ? -4.510  12.597  9.001   1.00 0.00 ? 58  ALA A N    4  
ATOM 6079  C CA   . ALA A 1 58  ? -5.238  11.532  8.332   1.00 0.00 ? 58  ALA A CA   4  
ATOM 6080  C C    . ALA A 1 58  ? -4.584  10.189  8.659   1.00 0.00 ? 58  ALA A C    4  
ATOM 6081  O O    . ALA A 1 58  ? -5.275  9.203   8.913   1.00 0.00 ? 58  ALA A O    4  
ATOM 6082  C CB   . ALA A 1 58  ? -5.281  11.809  6.828   1.00 0.00 ? 58  ALA A CB   4  
ATOM 6083  H H    . ALA A 1 58  ? -4.095  13.273  8.391   1.00 0.00 ? 58  ALA A H    4  
ATOM 6084  H HA   . ALA A 1 58  ? -6.258  11.534  8.719   1.00 0.00 ? 58  ALA A HA   4  
ATOM 6085  H HB1  . ALA A 1 58  ? -4.673  12.685  6.602   1.00 0.00 ? 58  ALA A HB1  4  
ATOM 6086  H HB2  . ALA A 1 58  ? -4.891  10.946  6.288   1.00 0.00 ? 58  ALA A HB2  4  
ATOM 6087  H HB3  . ALA A 1 58  ? -6.311  11.994  6.522   1.00 0.00 ? 58  ALA A HB3  4  
ATOM 6088  N N    . GLY A 1 59  ? -3.259  10.192  8.643   1.00 0.00 ? 59  GLY A N    4  
ATOM 6089  C CA   . GLY A 1 59  ? -2.504  8.986   8.935   1.00 0.00 ? 59  GLY A CA   4  
ATOM 6090  C C    . GLY A 1 59  ? -1.945  8.366   7.652   1.00 0.00 ? 59  GLY A C    4  
ATOM 6091  O O    . GLY A 1 59  ? -2.020  7.153   7.461   1.00 0.00 ? 59  GLY A O    4  
ATOM 6092  H H    . GLY A 1 59  ? -2.705  10.999  8.436   1.00 0.00 ? 59  GLY A H    4  
ATOM 6093  H HA2  . GLY A 1 59  ? -1.686  9.221   9.616   1.00 0.00 ? 59  GLY A HA2  4  
ATOM 6094  H HA3  . GLY A 1 59  ? -3.144  8.265   9.442   1.00 0.00 ? 59  GLY A HA3  4  
ATOM 6095  N N    . LEU A 1 60  ? -1.397  9.226   6.807   1.00 0.00 ? 60  LEU A N    4  
ATOM 6096  C CA   . LEU A 1 60  ? -0.826  8.778   5.548   1.00 0.00 ? 60  LEU A CA   4  
ATOM 6097  C C    . LEU A 1 60  ? 0.609   8.301   5.785   1.00 0.00 ? 60  LEU A C    4  
ATOM 6098  O O    . LEU A 1 60  ? 1.241   8.688   6.767   1.00 0.00 ? 60  LEU A O    4  
ATOM 6099  C CB   . LEU A 1 60  ? -0.942  9.873   4.486   1.00 0.00 ? 60  LEU A CB   4  
ATOM 6100  C CG   . LEU A 1 60  ? -2.275  9.943   3.738   1.00 0.00 ? 60  LEU A CG   4  
ATOM 6101  C CD1  . LEU A 1 60  ? -2.324  11.164  2.818   1.00 0.00 ? 60  LEU A CD1  4  
ATOM 6102  C CD2  . LEU A 1 60  ? -2.547  8.642   2.980   1.00 0.00 ? 60  LEU A CD2  4  
ATOM 6103  H H    . LEU A 1 60  ? -1.340  10.211  6.970   1.00 0.00 ? 60  LEU A H    4  
ATOM 6104  H HA   . LEU A 1 60  ? -1.419  7.930   5.204   1.00 0.00 ? 60  LEU A HA   4  
ATOM 6105  H HB2  . LEU A 1 60  ? -0.766  10.836  4.966   1.00 0.00 ? 60  LEU A HB2  4  
ATOM 6106  H HB3  . LEU A 1 60  ? -0.146  9.730   3.756   1.00 0.00 ? 60  LEU A HB3  4  
ATOM 6107  H HG   . LEU A 1 60  ? -3.073  10.061  4.472   1.00 0.00 ? 60  LEU A HG   4  
ATOM 6108  H HD11 . LEU A 1 60  ? -2.414  12.068  3.419   1.00 0.00 ? 60  LEU A HD11 4  
ATOM 6109  H HD12 . LEU A 1 60  ? -1.409  11.210  2.226   1.00 0.00 ? 60  LEU A HD12 4  
ATOM 6110  H HD13 . LEU A 1 60  ? -3.183  11.083  2.152   1.00 0.00 ? 60  LEU A HD13 4  
ATOM 6111  H HD21 . LEU A 1 60  ? -1.704  7.963   3.110   1.00 0.00 ? 60  LEU A HD21 4  
ATOM 6112  H HD22 . LEU A 1 60  ? -3.452  8.176   3.370   1.00 0.00 ? 60  LEU A HD22 4  
ATOM 6113  H HD23 . LEU A 1 60  ? -2.679  8.860   1.920   1.00 0.00 ? 60  LEU A HD23 4  
ATOM 6114  N N    . GLU A 1 61  ? 1.081   7.468   4.869   1.00 0.00 ? 61  GLU A N    4  
ATOM 6115  C CA   . GLU A 1 61  ? 2.429   6.935   4.966   1.00 0.00 ? 61  GLU A CA   4  
ATOM 6116  C C    . GLU A 1 61  ? 3.029   6.752   3.571   1.00 0.00 ? 61  GLU A C    4  
ATOM 6117  O O    . GLU A 1 61  ? 2.315   6.818   2.571   1.00 0.00 ? 61  GLU A O    4  
ATOM 6118  C CB   . GLU A 1 61  ? 2.443   5.618   5.746   1.00 0.00 ? 61  GLU A CB   4  
ATOM 6119  C CG   . GLU A 1 61  ? 1.540   4.578   5.081   1.00 0.00 ? 61  GLU A CG   4  
ATOM 6120  C CD   . GLU A 1 61  ? 1.381   3.342   5.969   1.00 0.00 ? 61  GLU A CD   4  
ATOM 6121  O OE1  . GLU A 1 61  ? 1.292   3.536   7.201   1.00 0.00 ? 61  GLU A OE1  4  
ATOM 6122  O OE2  . GLU A 1 61  ? 1.351   2.231   5.397   1.00 0.00 ? 61  GLU A OE2  4  
ATOM 6123  H H    . GLU A 1 61  ? 0.560   7.158   4.074   1.00 0.00 ? 61  GLU A H    4  
ATOM 6124  H HA   . GLU A 1 61  ? 2.997   7.683   5.518   1.00 0.00 ? 61  GLU A HA   4  
ATOM 6125  H HB2  . GLU A 1 61  ? 3.462   5.237   5.804   1.00 0.00 ? 61  GLU A HB2  4  
ATOM 6126  H HB3  . GLU A 1 61  ? 2.110   5.794   6.769   1.00 0.00 ? 61  GLU A HB3  4  
ATOM 6127  H HG2  . GLU A 1 61  ? 0.562   5.014   4.880   1.00 0.00 ? 61  GLU A HG2  4  
ATOM 6128  H HG3  . GLU A 1 61  ? 1.962   4.286   4.119   1.00 0.00 ? 61  GLU A HG3  4  
ATOM 6129  N N    . TYR A 1 62  ? 4.334   6.526   3.548   1.00 0.00 ? 62  TYR A N    4  
ATOM 6130  C CA   . TYR A 1 62  ? 5.038   6.333   2.291   1.00 0.00 ? 62  TYR A CA   4  
ATOM 6131  C C    . TYR A 1 62  ? 4.875   4.898   1.786   1.00 0.00 ? 62  TYR A C    4  
ATOM 6132  O O    . TYR A 1 62  ? 4.651   3.980   2.574   1.00 0.00 ? 62  TYR A O    4  
ATOM 6133  C CB   . TYR A 1 62  ? 6.516   6.590   2.592   1.00 0.00 ? 62  TYR A CB   4  
ATOM 6134  C CG   . TYR A 1 62  ? 7.439   6.395   1.388   1.00 0.00 ? 62  TYR A CG   4  
ATOM 6135  C CD1  . TYR A 1 62  ? 7.640   5.132   0.869   1.00 0.00 ? 62  TYR A CD1  4  
ATOM 6136  C CD2  . TYR A 1 62  ? 8.072   7.483   0.821   1.00 0.00 ? 62  TYR A CD2  4  
ATOM 6137  C CE1  . TYR A 1 62  ? 8.509   4.949   -0.264  1.00 0.00 ? 62  TYR A CE1  4  
ATOM 6138  C CE2  . TYR A 1 62  ? 8.941   7.299   -0.312  1.00 0.00 ? 62  TYR A CE2  4  
ATOM 6139  C CZ   . TYR A 1 62  ? 9.117   6.042   -0.799  1.00 0.00 ? 62  TYR A CZ   4  
ATOM 6140  O OH   . TYR A 1 62  ? 9.937   5.869   -1.870  1.00 0.00 ? 62  TYR A OH   4  
ATOM 6141  H H    . TYR A 1 62  ? 4.907   6.473   4.366   1.00 0.00 ? 62  TYR A H    4  
ATOM 6142  H HA   . TYR A 1 62  ? 4.613   7.018   1.559   1.00 0.00 ? 62  TYR A HA   4  
ATOM 6143  H HB2  . TYR A 1 62  ? 6.629   7.609   2.963   1.00 0.00 ? 62  TYR A HB2  4  
ATOM 6144  H HB3  . TYR A 1 62  ? 6.835   5.923   3.393   1.00 0.00 ? 62  TYR A HB3  4  
ATOM 6145  H HD1  . TYR A 1 62  ? 7.140   4.273   1.317   1.00 0.00 ? 62  TYR A HD1  4  
ATOM 6146  H HD2  . TYR A 1 62  ? 7.914   8.480   1.231   1.00 0.00 ? 62  TYR A HD2  4  
ATOM 6147  H HE1  . TYR A 1 62  ? 8.675   3.957   -0.684  1.00 0.00 ? 62  TYR A HE1  4  
ATOM 6148  H HE2  . TYR A 1 62  ? 9.447   8.150   -0.770  1.00 0.00 ? 62  TYR A HE2  4  
ATOM 6149  H HH   . TYR A 1 62  ? 9.445   6.077   -2.715  1.00 0.00 ? 62  TYR A HH   4  
ATOM 6150  N N    . GLY A 1 63  ? 4.994   4.749   0.475   1.00 0.00 ? 63  GLY A N    4  
ATOM 6151  C CA   . GLY A 1 63  ? 4.863   3.441   -0.145  1.00 0.00 ? 63  GLY A CA   4  
ATOM 6152  C C    . GLY A 1 63  ? 3.390   3.058   -0.309  1.00 0.00 ? 63  GLY A C    4  
ATOM 6153  O O    . GLY A 1 63  ? 3.076   2.028   -0.905  1.00 0.00 ? 63  GLY A O    4  
ATOM 6154  H H    . GLY A 1 63  ? 5.176   5.500   -0.159  1.00 0.00 ? 63  GLY A H    4  
ATOM 6155  H HA2  . GLY A 1 63  ? 5.352   3.445   -1.118  1.00 0.00 ? 63  GLY A HA2  4  
ATOM 6156  H HA3  . GLY A 1 63  ? 5.371   2.694   0.464   1.00 0.00 ? 63  GLY A HA3  4  
ATOM 6157  N N    . ASP A 1 64  ? 2.527   3.907   0.229   1.00 0.00 ? 64  ASP A N    4  
ATOM 6158  C CA   . ASP A 1 64  ? 1.096   3.670   0.149   1.00 0.00 ? 64  ASP A CA   4  
ATOM 6159  C C    . ASP A 1 64  ? 0.587   4.107   -1.226  1.00 0.00 ? 64  ASP A C    4  
ATOM 6160  O O    . ASP A 1 64  ? 0.268   5.277   -1.431  1.00 0.00 ? 64  ASP A O    4  
ATOM 6161  C CB   . ASP A 1 64  ? 0.344   4.477   1.209   1.00 0.00 ? 64  ASP A CB   4  
ATOM 6162  C CG   . ASP A 1 64  ? -0.405  3.640   2.248   1.00 0.00 ? 64  ASP A CG   4  
ATOM 6163  O OD1  . ASP A 1 64  ? -0.022  2.461   2.410   1.00 0.00 ? 64  ASP A OD1  4  
ATOM 6164  O OD2  . ASP A 1 64  ? -1.343  4.198   2.857   1.00 0.00 ? 64  ASP A OD2  4  
ATOM 6165  H H    . ASP A 1 64  ? 2.791   4.742   0.711   1.00 0.00 ? 64  ASP A H    4  
ATOM 6166  H HA   . ASP A 1 64  ? 0.973   2.600   0.319   1.00 0.00 ? 64  ASP A HA   4  
ATOM 6167  H HB2  . ASP A 1 64  ? 1.056   5.120   1.727   1.00 0.00 ? 64  ASP A HB2  4  
ATOM 6168  H HB3  . ASP A 1 64  ? -0.370  5.130   0.708   1.00 0.00 ? 64  ASP A HB3  4  
ATOM 6169  N N    . GLN A 1 65  ? 0.527   3.143   -2.133  1.00 0.00 ? 65  GLN A N    4  
ATOM 6170  C CA   . GLN A 1 65  ? 0.062   3.413   -3.483  1.00 0.00 ? 65  GLN A CA   4  
ATOM 6171  C C    . GLN A 1 65  ? -1.371  3.948   -3.454  1.00 0.00 ? 65  GLN A C    4  
ATOM 6172  O O    . GLN A 1 65  ? -2.277  3.278   -2.961  1.00 0.00 ? 65  GLN A O    4  
ATOM 6173  C CB   . GLN A 1 65  ? 0.163   2.163   -4.359  1.00 0.00 ? 65  GLN A CB   4  
ATOM 6174  C CG   . GLN A 1 65  ? 0.446   2.535   -5.816  1.00 0.00 ? 65  GLN A CG   4  
ATOM 6175  C CD   . GLN A 1 65  ? -0.154  1.501   -6.772  1.00 0.00 ? 65  GLN A CD   4  
ATOM 6176  O OE1  . GLN A 1 65  ? -0.016  0.302   -6.596  1.00 0.00 ? 65  GLN A OE1  4  
ATOM 6177  N NE2  . GLN A 1 65  ? -0.826  2.032   -7.790  1.00 0.00 ? 65  GLN A NE2  4  
ATOM 6178  H H    . GLN A 1 65  ? 0.788   2.194   -1.959  1.00 0.00 ? 65  GLN A H    4  
ATOM 6179  H HA   . GLN A 1 65  ? 0.735   4.178   -3.873  1.00 0.00 ? 65  GLN A HA   4  
ATOM 6180  H HB2  . GLN A 1 65  ? 0.957   1.516   -3.985  1.00 0.00 ? 65  GLN A HB2  4  
ATOM 6181  H HB3  . GLN A 1 65  ? -0.766  1.596   -4.298  1.00 0.00 ? 65  GLN A HB3  4  
ATOM 6182  H HG2  . GLN A 1 65  ? 0.029   3.519   -6.031  1.00 0.00 ? 65  GLN A HG2  4  
ATOM 6183  H HG3  . GLN A 1 65  ? 1.522   2.602   -5.976  1.00 0.00 ? 65  GLN A HG3  4  
ATOM 6184  H HE21 . GLN A 1 65  ? -0.902  3.025   -7.875  1.00 0.00 ? 65  GLN A HE21 4  
ATOM 6185  H HE22 . GLN A 1 65  ? -1.256  1.437   -8.469  1.00 0.00 ? 65  GLN A HE22 4  
ATOM 6186  N N    . LEU A 1 66  ? -1.531  5.150   -3.989  1.00 0.00 ? 66  LEU A N    4  
ATOM 6187  C CA   . LEU A 1 66  ? -2.839  5.782   -4.030  1.00 0.00 ? 66  LEU A CA   4  
ATOM 6188  C C    . LEU A 1 66  ? -3.658  5.175   -5.171  1.00 0.00 ? 66  LEU A C    4  
ATOM 6189  O O    . LEU A 1 66  ? -3.452  5.512   -6.336  1.00 0.00 ? 66  LEU A O    4  
ATOM 6190  C CB   . LEU A 1 66  ? -2.696  7.303   -4.117  1.00 0.00 ? 66  LEU A CB   4  
ATOM 6191  C CG   . LEU A 1 66  ? -1.654  7.933   -3.191  1.00 0.00 ? 66  LEU A CG   4  
ATOM 6192  C CD1  . LEU A 1 66  ? -1.434  9.407   -3.535  1.00 0.00 ? 66  LEU A CD1  4  
ATOM 6193  C CD2  . LEU A 1 66  ? -2.036  7.738   -1.722  1.00 0.00 ? 66  LEU A CD2  4  
ATOM 6194  H H    . LEU A 1 66  ? -0.789  5.688   -4.388  1.00 0.00 ? 66  LEU A H    4  
ATOM 6195  H HA   . LEU A 1 66  ? -3.340  5.558   -3.088  1.00 0.00 ? 66  LEU A HA   4  
ATOM 6196  H HB2  . LEU A 1 66  ? -2.447  7.566   -5.145  1.00 0.00 ? 66  LEU A HB2  4  
ATOM 6197  H HB3  . LEU A 1 66  ? -3.665  7.752   -3.899  1.00 0.00 ? 66  LEU A HB3  4  
ATOM 6198  H HG   . LEU A 1 66  ? -0.704  7.420   -3.347  1.00 0.00 ? 66  LEU A HG   4  
ATOM 6199  H HD11 . LEU A 1 66  ? -2.279  9.994   -3.175  1.00 0.00 ? 66  LEU A HD11 4  
ATOM 6200  H HD12 . LEU A 1 66  ? -0.518  9.758   -3.060  1.00 0.00 ? 66  LEU A HD12 4  
ATOM 6201  H HD13 . LEU A 1 66  ? -1.348  9.519   -4.616  1.00 0.00 ? 66  LEU A HD13 4  
ATOM 6202  H HD21 . LEU A 1 66  ? -1.324  7.062   -1.248  1.00 0.00 ? 66  LEU A HD21 4  
ATOM 6203  H HD22 . LEU A 1 66  ? -2.018  8.700   -1.212  1.00 0.00 ? 66  LEU A HD22 4  
ATOM 6204  H HD23 . LEU A 1 66  ? -3.037  7.312   -1.661  1.00 0.00 ? 66  LEU A HD23 4  
ATOM 6205  N N    . LEU A 1 67  ? -4.570  4.290   -4.796  1.00 0.00 ? 67  LEU A N    4  
ATOM 6206  C CA   . LEU A 1 67  ? -5.422  3.633   -5.774  1.00 0.00 ? 67  LEU A CA   4  
ATOM 6207  C C    . LEU A 1 67  ? -6.491  4.616   -6.255  1.00 0.00 ? 67  LEU A C    4  
ATOM 6208  O O    . LEU A 1 67  ? -6.722  4.749   -7.456  1.00 0.00 ? 67  LEU A O    4  
ATOM 6209  C CB   . LEU A 1 67  ? -5.993  2.335   -5.200  1.00 0.00 ? 67  LEU A CB   4  
ATOM 6210  C CG   . LEU A 1 67  ? -5.026  1.152   -5.126  1.00 0.00 ? 67  LEU A CG   4  
ATOM 6211  C CD1  . LEU A 1 67  ? -5.720  -0.088  -4.559  1.00 0.00 ? 67  LEU A CD1  4  
ATOM 6212  C CD2  . LEU A 1 67  ? -4.390  0.878   -6.491  1.00 0.00 ? 67  LEU A CD2  4  
ATOM 6213  H H    . LEU A 1 67  ? -4.732  4.022   -3.847  1.00 0.00 ? 67  LEU A H    4  
ATOM 6214  H HA   . LEU A 1 67  ? -4.795  3.362   -6.623  1.00 0.00 ? 67  LEU A HA   4  
ATOM 6215  H HB2  . LEU A 1 67  ? -6.365  2.538   -4.195  1.00 0.00 ? 67  LEU A HB2  4  
ATOM 6216  H HB3  . LEU A 1 67  ? -6.851  2.041   -5.804  1.00 0.00 ? 67  LEU A HB3  4  
ATOM 6217  H HG   . LEU A 1 67  ? -4.220  1.411   -4.441  1.00 0.00 ? 67  LEU A HG   4  
ATOM 6218  H HD11 . LEU A 1 67  ? -6.758  -0.109  -4.892  1.00 0.00 ? 67  LEU A HD11 4  
ATOM 6219  H HD12 . LEU A 1 67  ? -5.208  -0.984  -4.911  1.00 0.00 ? 67  LEU A HD12 4  
ATOM 6220  H HD13 . LEU A 1 67  ? -5.688  -0.056  -3.470  1.00 0.00 ? 67  LEU A HD13 4  
ATOM 6221  H HD21 . LEU A 1 67  ? -5.003  1.325   -7.274  1.00 0.00 ? 67  LEU A HD21 4  
ATOM 6222  H HD22 . LEU A 1 67  ? -3.391  1.313   -6.519  1.00 0.00 ? 67  LEU A HD22 4  
ATOM 6223  H HD23 . LEU A 1 67  ? -4.322  -0.198  -6.651  1.00 0.00 ? 67  LEU A HD23 4  
ATOM 6224  N N    . GLU A 1 68  ? -7.115  5.280   -5.293  1.00 0.00 ? 68  GLU A N    4  
ATOM 6225  C CA   . GLU A 1 68  ? -8.154  6.247   -5.603  1.00 0.00 ? 68  GLU A CA   4  
ATOM 6226  C C    . GLU A 1 68  ? -8.170  7.363   -4.557  1.00 0.00 ? 68  GLU A C    4  
ATOM 6227  O O    . GLU A 1 68  ? -7.895  7.122   -3.383  1.00 0.00 ? 68  GLU A O    4  
ATOM 6228  C CB   . GLU A 1 68  ? -9.522  5.568   -5.703  1.00 0.00 ? 68  GLU A CB   4  
ATOM 6229  C CG   . GLU A 1 68  ? -9.624  4.723   -6.974  1.00 0.00 ? 68  GLU A CG   4  
ATOM 6230  C CD   . GLU A 1 68  ? -11.086 4.481   -7.356  1.00 0.00 ? 68  GLU A CD   4  
ATOM 6231  O OE1  . GLU A 1 68  ? -11.697 5.432   -7.890  1.00 0.00 ? 68  GLU A OE1  4  
ATOM 6232  O OE2  . GLU A 1 68  ? -11.559 3.352   -7.105  1.00 0.00 ? 68  GLU A OE2  4  
ATOM 6233  H H    . GLU A 1 68  ? -6.921  5.166   -4.318  1.00 0.00 ? 68  GLU A H    4  
ATOM 6234  H HA   . GLU A 1 68  ? -7.887  6.656   -6.578  1.00 0.00 ? 68  GLU A HA   4  
ATOM 6235  H HB2  . GLU A 1 68  ? -9.683  4.938   -4.828  1.00 0.00 ? 68  GLU A HB2  4  
ATOM 6236  H HB3  . GLU A 1 68  ? -10.308 6.324   -5.700  1.00 0.00 ? 68  GLU A HB3  4  
ATOM 6237  H HG2  . GLU A 1 68  ? -9.109  5.226   -7.792  1.00 0.00 ? 68  GLU A HG2  4  
ATOM 6238  H HG3  . GLU A 1 68  ? -9.122  3.768   -6.821  1.00 0.00 ? 68  GLU A HG3  4  
ATOM 6239  N N    . PHE A 1 69  ? -8.496  8.561   -5.022  1.00 0.00 ? 69  PHE A N    4  
ATOM 6240  C CA   . PHE A 1 69  ? -8.552  9.715   -4.141  1.00 0.00 ? 69  PHE A CA   4  
ATOM 6241  C C    . PHE A 1 69  ? -9.896  10.434  -4.264  1.00 0.00 ? 69  PHE A C    4  
ATOM 6242  O O    . PHE A 1 69  ? -10.164 11.089  -5.271  1.00 0.00 ? 69  PHE A O    4  
ATOM 6243  C CB   . PHE A 1 69  ? -7.436  10.666  -4.578  1.00 0.00 ? 69  PHE A CB   4  
ATOM 6244  C CG   . PHE A 1 69  ? -7.510  12.051  -3.933  1.00 0.00 ? 69  PHE A CG   4  
ATOM 6245  C CD1  . PHE A 1 69  ? -8.277  13.023  -4.495  1.00 0.00 ? 69  PHE A CD1  4  
ATOM 6246  C CD2  . PHE A 1 69  ? -6.809  12.310  -2.796  1.00 0.00 ? 69  PHE A CD2  4  
ATOM 6247  C CE1  . PHE A 1 69  ? -8.345  14.309  -3.896  1.00 0.00 ? 69  PHE A CE1  4  
ATOM 6248  C CE2  . PHE A 1 69  ? -6.877  13.595  -2.197  1.00 0.00 ? 69  PHE A CE2  4  
ATOM 6249  C CZ   . PHE A 1 69  ? -7.644  14.568  -2.760  1.00 0.00 ? 69  PHE A CZ   4  
ATOM 6250  H H    . PHE A 1 69  ? -8.719  8.748   -5.978  1.00 0.00 ? 69  PHE A H    4  
ATOM 6251  H HA   . PHE A 1 69  ? -8.429  9.350   -3.121  1.00 0.00 ? 69  PHE A HA   4  
ATOM 6252  H HB2  . PHE A 1 69  ? -6.473  10.215  -4.338  1.00 0.00 ? 69  PHE A HB2  4  
ATOM 6253  H HB3  . PHE A 1 69  ? -7.473  10.779  -5.662  1.00 0.00 ? 69  PHE A HB3  4  
ATOM 6254  H HD1  . PHE A 1 69  ? -8.839  12.816  -5.406  1.00 0.00 ? 69  PHE A HD1  4  
ATOM 6255  H HD2  . PHE A 1 69  ? -6.194  11.531  -2.346  1.00 0.00 ? 69  PHE A HD2  4  
ATOM 6256  H HE1  . PHE A 1 69  ? -8.960  15.088  -4.347  1.00 0.00 ? 69  PHE A HE1  4  
ATOM 6257  H HE2  . PHE A 1 69  ? -6.316  13.803  -1.287  1.00 0.00 ? 69  PHE A HE2  4  
ATOM 6258  H HZ   . PHE A 1 69  ? -7.697  15.555  -2.300  1.00 0.00 ? 69  PHE A HZ   4  
ATOM 6259  N N    . ASN A 1 70  ? -10.707 10.289  -3.226  1.00 0.00 ? 70  ASN A N    4  
ATOM 6260  C CA   . ASN A 1 70  ? -12.017 10.917  -3.206  1.00 0.00 ? 70  ASN A CA   4  
ATOM 6261  C C    . ASN A 1 70  ? -12.873 10.337  -4.333  1.00 0.00 ? 70  ASN A C    4  
ATOM 6262  O O    . ASN A 1 70  ? -13.929 10.879  -4.657  1.00 0.00 ? 70  ASN A O    4  
ATOM 6263  C CB   . ASN A 1 70  ? -11.907 12.427  -3.424  1.00 0.00 ? 70  ASN A CB   4  
ATOM 6264  C CG   . ASN A 1 70  ? -12.626 13.196  -2.314  1.00 0.00 ? 70  ASN A CG   4  
ATOM 6265  O OD1  . ASN A 1 70  ? -13.340 12.636  -1.498  1.00 0.00 ? 70  ASN A OD1  4  
ATOM 6266  N ND2  . ASN A 1 70  ? -12.400 14.506  -2.329  1.00 0.00 ? 70  ASN A ND2  4  
ATOM 6267  H H    . ASN A 1 70  ? -10.481 9.755   -2.411  1.00 0.00 ? 70  ASN A H    4  
ATOM 6268  H HA   . ASN A 1 70  ? -12.424 10.699  -2.218  1.00 0.00 ? 70  ASN A HA   4  
ATOM 6269  H HB2  . ASN A 1 70  ? -10.857 12.719  -3.452  1.00 0.00 ? 70  ASN A HB2  4  
ATOM 6270  H HB3  . ASN A 1 70  ? -12.337 12.691  -4.391  1.00 0.00 ? 70  ASN A HB3  4  
ATOM 6271  H HD21 . ASN A 1 70  ? -11.803 14.903  -3.027  1.00 0.00 ? 70  ASN A HD21 4  
ATOM 6272  H HD22 . ASN A 1 70  ? -12.826 15.095  -1.642  1.00 0.00 ? 70  ASN A HD22 4  
ATOM 6273  N N    . GLY A 1 71  ? -12.386 9.243   -4.900  1.00 0.00 ? 71  GLY A N    4  
ATOM 6274  C CA   . GLY A 1 71  ? -13.094 8.584   -5.984  1.00 0.00 ? 71  GLY A CA   4  
ATOM 6275  C C    . GLY A 1 71  ? -12.482 8.946   -7.339  1.00 0.00 ? 71  GLY A C    4  
ATOM 6276  O O    . GLY A 1 71  ? -13.192 9.049   -8.338  1.00 0.00 ? 71  GLY A O    4  
ATOM 6277  H H    . GLY A 1 71  ? -11.527 8.809   -4.631  1.00 0.00 ? 71  GLY A H    4  
ATOM 6278  H HA2  . GLY A 1 71  ? -13.059 7.503   -5.843  1.00 0.00 ? 71  GLY A HA2  4  
ATOM 6279  H HA3  . GLY A 1 71  ? -14.144 8.873   -5.967  1.00 0.00 ? 71  GLY A HA3  4  
ATOM 6280  N N    . ILE A 1 72  ? -11.169 9.129   -7.329  1.00 0.00 ? 72  ILE A N    4  
ATOM 6281  C CA   . ILE A 1 72  ? -10.453 9.478   -8.545  1.00 0.00 ? 72  ILE A CA   4  
ATOM 6282  C C    . ILE A 1 72  ? -9.494  8.343   -8.909  1.00 0.00 ? 72  ILE A C    4  
ATOM 6283  O O    . ILE A 1 72  ? -8.597  8.012   -8.136  1.00 0.00 ? 72  ILE A O    4  
ATOM 6284  C CB   . ILE A 1 72  ? -9.769  10.837  -8.392  1.00 0.00 ? 72  ILE A CB   4  
ATOM 6285  C CG1  . ILE A 1 72  ? -10.721 11.976  -8.762  1.00 0.00 ? 72  ILE A CG1  4  
ATOM 6286  C CG2  . ILE A 1 72  ? -8.470  10.891  -9.199  1.00 0.00 ? 72  ILE A CG2  4  
ATOM 6287  C CD1  . ILE A 1 72  ? -10.641 13.112  -7.740  1.00 0.00 ? 72  ILE A CD1  4  
ATOM 6288  H H    . ILE A 1 72  ? -10.599 9.043   -6.513  1.00 0.00 ? 72  ILE A H    4  
ATOM 6289  H HA   . ILE A 1 72  ? -11.191 9.576   -9.341  1.00 0.00 ? 72  ILE A HA   4  
ATOM 6290  H HB   . ILE A 1 72  ? -9.501  10.969  -7.343  1.00 0.00 ? 72  ILE A HB   4  
ATOM 6291  H HG12 . ILE A 1 72  ? -10.473 12.355  -9.753  1.00 0.00 ? 72  ILE A HG12 4  
ATOM 6292  H HG13 . ILE A 1 72  ? -11.743 11.599  -8.812  1.00 0.00 ? 72  ILE A HG13 4  
ATOM 6293  H HG21 . ILE A 1 72  ? -8.695  10.757  -10.257 1.00 0.00 ? 72  ILE A HG21 4  
ATOM 6294  H HG22 . ILE A 1 72  ? -7.989  11.858  -9.049  1.00 0.00 ? 72  ILE A HG22 4  
ATOM 6295  H HG23 . ILE A 1 72  ? -7.802  10.097  -8.866  1.00 0.00 ? 72  ILE A HG23 4  
ATOM 6296  H HD11 . ILE A 1 72  ? -10.668 14.070  -8.259  1.00 0.00 ? 72  ILE A HD11 4  
ATOM 6297  H HD12 . ILE A 1 72  ? -11.487 13.046  -7.056  1.00 0.00 ? 72  ILE A HD12 4  
ATOM 6298  H HD13 . ILE A 1 72  ? -9.711  13.029  -7.177  1.00 0.00 ? 72  ILE A HD13 4  
ATOM 6299  N N    . ASN A 1 73  ? -9.715  7.780   -10.088 1.00 0.00 ? 73  ASN A N    4  
ATOM 6300  C CA   . ASN A 1 73  ? -8.882  6.689   -10.565 1.00 0.00 ? 73  ASN A CA   4  
ATOM 6301  C C    . ASN A 1 73  ? -7.432  7.168   -10.664 1.00 0.00 ? 73  ASN A C    4  
ATOM 6302  O O    . ASN A 1 73  ? -6.993  7.615   -11.723 1.00 0.00 ? 73  ASN A O    4  
ATOM 6303  C CB   . ASN A 1 73  ? -9.323  6.226   -11.954 1.00 0.00 ? 73  ASN A CB   4  
ATOM 6304  C CG   . ASN A 1 73  ? -9.914  4.815   -11.899 1.00 0.00 ? 73  ASN A CG   4  
ATOM 6305  O OD1  . ASN A 1 73  ? -9.226  3.820   -12.052 1.00 0.00 ? 73  ASN A OD1  4  
ATOM 6306  N ND2  . ASN A 1 73  ? -11.224 4.786   -11.673 1.00 0.00 ? 73  ASN A ND2  4  
ATOM 6307  H H    . ASN A 1 73  ? -10.447 8.056   -10.711 1.00 0.00 ? 73  ASN A H    4  
ATOM 6308  H HA   . ASN A 1 73  ? -9.008  5.891   -9.833  1.00 0.00 ? 73  ASN A HA   4  
ATOM 6309  H HB2  . ASN A 1 73  ? -10.062 6.919   -12.355 1.00 0.00 ? 73  ASN A HB2  4  
ATOM 6310  H HB3  . ASN A 1 73  ? -8.471  6.241   -12.634 1.00 0.00 ? 73  ASN A HB3  4  
ATOM 6311  H HD21 . ASN A 1 73  ? -11.730 5.641   -11.557 1.00 0.00 ? 73  ASN A HD21 4  
ATOM 6312  H HD22 . ASN A 1 73  ? -11.703 3.910   -11.620 1.00 0.00 ? 73  ASN A HD22 4  
ATOM 6313  N N    . LEU A 1 74  ? -6.728  7.058   -9.547  1.00 0.00 ? 74  LEU A N    4  
ATOM 6314  C CA   . LEU A 1 74  ? -5.337  7.474   -9.495  1.00 0.00 ? 74  LEU A CA   4  
ATOM 6315  C C    . LEU A 1 74  ? -4.525  6.652   -10.498 1.00 0.00 ? 74  LEU A C    4  
ATOM 6316  O O    . LEU A 1 74  ? -3.738  7.203   -11.265 1.00 0.00 ? 74  LEU A O    4  
ATOM 6317  C CB   . LEU A 1 74  ? -4.806  7.393   -8.062  1.00 0.00 ? 74  LEU A CB   4  
ATOM 6318  C CG   . LEU A 1 74  ? -4.606  8.730   -7.345  1.00 0.00 ? 74  LEU A CG   4  
ATOM 6319  C CD1  . LEU A 1 74  ? -3.813  9.706   -8.216  1.00 0.00 ? 74  LEU A CD1  4  
ATOM 6320  C CD2  . LEU A 1 74  ? -5.946  9.319   -6.898  1.00 0.00 ? 74  LEU A CD2  4  
ATOM 6321  H H    . LEU A 1 74  ? -7.092  6.694   -8.690  1.00 0.00 ? 74  LEU A H    4  
ATOM 6322  H HA   . LEU A 1 74  ? -5.297  8.521   -9.795  1.00 0.00 ? 74  LEU A HA   4  
ATOM 6323  H HB2  . LEU A 1 74  ? -5.496  6.788   -7.474  1.00 0.00 ? 74  LEU A HB2  4  
ATOM 6324  H HB3  . LEU A 1 74  ? -3.853  6.866   -8.078  1.00 0.00 ? 74  LEU A HB3  4  
ATOM 6325  H HG   . LEU A 1 74  ? -4.018  8.550   -6.445  1.00 0.00 ? 74  LEU A HG   4  
ATOM 6326  H HD11 . LEU A 1 74  ? -3.027  9.166   -8.743  1.00 0.00 ? 74  LEU A HD11 4  
ATOM 6327  H HD12 . LEU A 1 74  ? -4.482  10.173  -8.940  1.00 0.00 ? 74  LEU A HD12 4  
ATOM 6328  H HD13 . LEU A 1 74  ? -3.367  10.475  -7.586  1.00 0.00 ? 74  LEU A HD13 4  
ATOM 6329  H HD21 . LEU A 1 74  ? -6.182  8.963   -5.895  1.00 0.00 ? 74  LEU A HD21 4  
ATOM 6330  H HD22 . LEU A 1 74  ? -5.881  10.407  -6.892  1.00 0.00 ? 74  LEU A HD22 4  
ATOM 6331  H HD23 . LEU A 1 74  ? -6.729  9.005   -7.588  1.00 0.00 ? 74  LEU A HD23 4  
ATOM 6332  N N    . ARG A 1 75  ? -4.746  5.346   -10.460 1.00 0.00 ? 75  ARG A N    4  
ATOM 6333  C CA   . ARG A 1 75  ? -4.045  4.442   -11.356 1.00 0.00 ? 75  ARG A CA   4  
ATOM 6334  C C    . ARG A 1 75  ? -3.888  5.080   -12.738 1.00 0.00 ? 75  ARG A C    4  
ATOM 6335  O O    . ARG A 1 75  ? -4.877  5.348   -13.418 1.00 0.00 ? 75  ARG A O    4  
ATOM 6336  C CB   . ARG A 1 75  ? -4.793  3.115   -11.496 1.00 0.00 ? 75  ARG A CB   4  
ATOM 6337  C CG   . ARG A 1 75  ? -5.223  2.580   -10.129 1.00 0.00 ? 75  ARG A CG   4  
ATOM 6338  C CD   . ARG A 1 75  ? -5.481  1.073   -10.186 1.00 0.00 ? 75  ARG A CD   4  
ATOM 6339  N NE   . ARG A 1 75  ? -4.314  0.339   -9.649  1.00 0.00 ? 75  ARG A NE   4  
ATOM 6340  C CZ   . ARG A 1 75  ? -4.364  -0.919  -9.190  1.00 0.00 ? 75  ARG A CZ   4  
ATOM 6341  N NH1  . ARG A 1 75  ? -5.524  -1.590  -9.200  1.00 0.00 ? 75  ARG A NH1  4  
ATOM 6342  N NH2  . ARG A 1 75  ? -3.254  -1.506  -8.722  1.00 0.00 ? 75  ARG A NH2  4  
ATOM 6343  H H    . ARG A 1 75  ? -5.388  4.905   -9.833  1.00 0.00 ? 75  ARG A H    4  
ATOM 6344  H HA   . ARG A 1 75  ? -3.074  4.280   -10.886 1.00 0.00 ? 75  ARG A HA   4  
ATOM 6345  H HB2  . ARG A 1 75  ? -5.671  3.254   -12.128 1.00 0.00 ? 75  ARG A HB2  4  
ATOM 6346  H HB3  . ARG A 1 75  ? -4.155  2.384   -11.993 1.00 0.00 ? 75  ARG A HB3  4  
ATOM 6347  H HG2  . ARG A 1 75  ? -4.448  2.792   -9.392  1.00 0.00 ? 75  ARG A HG2  4  
ATOM 6348  H HG3  . ARG A 1 75  ? -6.125  3.095   -9.800  1.00 0.00 ? 75  ARG A HG3  4  
ATOM 6349  H HD2  . ARG A 1 75  ? -6.373  0.827   -9.610  1.00 0.00 ? 75  ARG A HD2  4  
ATOM 6350  H HD3  . ARG A 1 75  ? -5.672  0.767   -11.215 1.00 0.00 ? 75  ARG A HD3  4  
ATOM 6351  H HE   . ARG A 1 75  ? -3.432  0.810   -9.628  1.00 0.00 ? 75  ARG A HE   4  
ATOM 6352  H HH11 . ARG A 1 75  ? -6.352  -1.152  -9.549  1.00 0.00 ? 75  ARG A HH11 4  
ATOM 6353  H HH12 . ARG A 1 75  ? -5.562  -2.529  -8.857  1.00 0.00 ? 75  ARG A HH12 4  
ATOM 6354  H HH21 . ARG A 1 75  ? -2.389  -1.006  -8.714  1.00 0.00 ? 75  ARG A HH21 4  
ATOM 6355  H HH22 . ARG A 1 75  ? -3.292  -2.445  -8.379  1.00 0.00 ? 75  ARG A HH22 4  
ATOM 6356  N N    . SER A 1 76  ? -2.637  5.306   -13.111 1.00 0.00 ? 76  SER A N    4  
ATOM 6357  C CA   . SER A 1 76  ? -2.338  5.907   -14.400 1.00 0.00 ? 76  SER A CA   4  
ATOM 6358  C C    . SER A 1 76  ? -2.386  7.433   -14.289 1.00 0.00 ? 76  SER A C    4  
ATOM 6359  O O    . SER A 1 76  ? -2.656  8.122   -15.271 1.00 0.00 ? 76  SER A O    4  
ATOM 6360  C CB   . SER A 1 76  ? -3.313  5.422   -15.474 1.00 0.00 ? 76  SER A CB   4  
ATOM 6361  O OG   . SER A 1 76  ? -2.675  5.253   -16.737 1.00 0.00 ? 76  SER A OG   4  
ATOM 6362  H H    . SER A 1 76  ? -1.838  5.085   -12.552 1.00 0.00 ? 76  SER A H    4  
ATOM 6363  H HA   . SER A 1 76  ? -1.330  5.574   -14.647 1.00 0.00 ? 76  SER A HA   4  
ATOM 6364  H HB2  . SER A 1 76  ? -3.755  4.476   -15.162 1.00 0.00 ? 76  SER A HB2  4  
ATOM 6365  H HB3  . SER A 1 76  ? -4.129  6.138   -15.573 1.00 0.00 ? 76  SER A HB3  4  
ATOM 6366  H HG   . SER A 1 76  ? -2.681  6.117   -17.241 1.00 0.00 ? 76  SER A HG   4  
ATOM 6367  N N    . ALA A 1 77  ? -2.121  7.915   -13.084 1.00 0.00 ? 77  ALA A N    4  
ATOM 6368  C CA   . ALA A 1 77  ? -2.131  9.346   -12.832 1.00 0.00 ? 77  ALA A CA   4  
ATOM 6369  C C    . ALA A 1 77  ? -0.693  9.867   -12.814 1.00 0.00 ? 77  ALA A C    4  
ATOM 6370  O O    . ALA A 1 77  ? 0.194   9.232   -12.244 1.00 0.00 ? 77  ALA A O    4  
ATOM 6371  C CB   . ALA A 1 77  ? -2.870  9.629   -11.522 1.00 0.00 ? 77  ALA A CB   4  
ATOM 6372  H H    . ALA A 1 77  ? -1.903  7.348   -12.290 1.00 0.00 ? 77  ALA A H    4  
ATOM 6373  H HA   . ALA A 1 77  ? -2.672  9.823   -13.649 1.00 0.00 ? 77  ALA A HA   4  
ATOM 6374  H HB1  . ALA A 1 77  ? -3.929  9.401   -11.645 1.00 0.00 ? 77  ALA A HB1  4  
ATOM 6375  H HB2  . ALA A 1 77  ? -2.454  9.007   -10.729 1.00 0.00 ? 77  ALA A HB2  4  
ATOM 6376  H HB3  . ALA A 1 77  ? -2.752  10.680  -11.258 1.00 0.00 ? 77  ALA A HB3  4  
ATOM 6377  N N    . THR A 1 78  ? -0.506  11.017  -13.445 1.00 0.00 ? 78  THR A N    4  
ATOM 6378  C CA   . THR A 1 78  ? 0.810   11.629  -13.509 1.00 0.00 ? 78  THR A CA   4  
ATOM 6379  C C    . THR A 1 78  ? 1.089   12.428  -12.234 1.00 0.00 ? 78  THR A C    4  
ATOM 6380  O O    . THR A 1 78  ? 0.193   13.075  -11.694 1.00 0.00 ? 78  THR A O    4  
ATOM 6381  C CB   . THR A 1 78  ? 0.877   12.475  -14.783 1.00 0.00 ? 78  THR A CB   4  
ATOM 6382  O OG1  . THR A 1 78  ? -0.434  13.021  -14.906 1.00 0.00 ? 78  THR A OG1  4  
ATOM 6383  C CG2  . THR A 1 78  ? 1.045   11.623  -16.042 1.00 0.00 ? 78  THR A CG2  4  
ATOM 6384  H H    . THR A 1 78  ? -1.232  11.526  -13.906 1.00 0.00 ? 78  THR A H    4  
ATOM 6385  H HA   . THR A 1 78  ? 1.556   10.837  -13.559 1.00 0.00 ? 78  THR A HA   4  
ATOM 6386  H HB   . THR A 1 78  ? 1.664   13.225  -14.711 1.00 0.00 ? 78  THR A HB   4  
ATOM 6387  H HG1  . THR A 1 78  ? -0.552  13.426  -15.812 1.00 0.00 ? 78  THR A HG1  4  
ATOM 6388  H HG21 . THR A 1 78  ? 1.143   12.274  -16.911 1.00 0.00 ? 78  THR A HG21 4  
ATOM 6389  H HG22 . THR A 1 78  ? 1.940   11.007  -15.948 1.00 0.00 ? 78  THR A HG22 4  
ATOM 6390  H HG23 . THR A 1 78  ? 0.173   10.981  -16.166 1.00 0.00 ? 78  THR A HG23 4  
ATOM 6391  N N    . GLU A 1 79  ? 2.335   12.358  -11.791 1.00 0.00 ? 79  GLU A N    4  
ATOM 6392  C CA   . GLU A 1 79  ? 2.743   13.067  -10.590 1.00 0.00 ? 79  GLU A CA   4  
ATOM 6393  C C    . GLU A 1 79  ? 2.109   14.459  -10.553 1.00 0.00 ? 79  GLU A C    4  
ATOM 6394  O O    . GLU A 1 79  ? 1.748   14.952  -9.486  1.00 0.00 ? 79  GLU A O    4  
ATOM 6395  C CB   . GLU A 1 79  ? 4.268   13.156  -10.497 1.00 0.00 ? 79  GLU A CB   4  
ATOM 6396  C CG   . GLU A 1 79  ? 4.890   13.365  -11.879 1.00 0.00 ? 79  GLU A CG   4  
ATOM 6397  C CD   . GLU A 1 79  ? 6.316   13.906  -11.763 1.00 0.00 ? 79  GLU A CD   4  
ATOM 6398  O OE1  . GLU A 1 79  ? 6.442   15.121  -11.495 1.00 0.00 ? 79  GLU A OE1  4  
ATOM 6399  O OE2  . GLU A 1 79  ? 7.248   13.093  -11.945 1.00 0.00 ? 79  GLU A OE2  4  
ATOM 6400  H H    . GLU A 1 79  ? 3.058   11.830  -12.236 1.00 0.00 ? 79  GLU A H    4  
ATOM 6401  H HA   . GLU A 1 79  ? 2.370   12.468  -9.759  1.00 0.00 ? 79  GLU A HA   4  
ATOM 6402  H HB2  . GLU A 1 79  ? 4.548   13.980  -9.840  1.00 0.00 ? 79  GLU A HB2  4  
ATOM 6403  H HB3  . GLU A 1 79  ? 4.663   12.244  -10.051 1.00 0.00 ? 79  GLU A HB3  4  
ATOM 6404  H HG2  . GLU A 1 79  ? 4.899   12.421  -12.424 1.00 0.00 ? 79  GLU A HG2  4  
ATOM 6405  H HG3  . GLU A 1 79  ? 4.279   14.060  -12.456 1.00 0.00 ? 79  GLU A HG3  4  
ATOM 6406  N N    . GLN A 1 80  ? 1.993   15.052  -11.732 1.00 0.00 ? 80  GLN A N    4  
ATOM 6407  C CA   . GLN A 1 80  ? 1.409   16.377  -11.849 1.00 0.00 ? 80  GLN A CA   4  
ATOM 6408  C C    . GLN A 1 80  ? -0.078  16.335  -11.491 1.00 0.00 ? 80  GLN A C    4  
ATOM 6409  O O    . GLN A 1 80  ? -0.561  17.172  -10.730 1.00 0.00 ? 80  GLN A O    4  
ATOM 6410  C CB   . GLN A 1 80  ? 1.619   16.948  -13.253 1.00 0.00 ? 80  GLN A CB   4  
ATOM 6411  C CG   . GLN A 1 80  ? 2.962   16.498  -13.832 1.00 0.00 ? 80  GLN A CG   4  
ATOM 6412  C CD   . GLN A 1 80  ? 3.471   17.495  -14.875 1.00 0.00 ? 80  GLN A CD   4  
ATOM 6413  O OE1  . GLN A 1 80  ? 4.161   18.454  -14.570 1.00 0.00 ? 80  GLN A OE1  4  
ATOM 6414  N NE2  . GLN A 1 80  ? 3.093   17.216  -16.119 1.00 0.00 ? 80  GLN A NE2  4  
ATOM 6415  H H    . GLN A 1 80  ? 2.290   14.644  -12.595 1.00 0.00 ? 80  GLN A H    4  
ATOM 6416  H HA   . GLN A 1 80  ? 1.945   16.995  -11.128 1.00 0.00 ? 80  GLN A HA   4  
ATOM 6417  H HB2  . GLN A 1 80  ? 0.810   16.623  -13.906 1.00 0.00 ? 80  GLN A HB2  4  
ATOM 6418  H HB3  . GLN A 1 80  ? 1.581   18.037  -13.216 1.00 0.00 ? 80  GLN A HB3  4  
ATOM 6419  H HG2  . GLN A 1 80  ? 3.694   16.400  -13.030 1.00 0.00 ? 80  GLN A HG2  4  
ATOM 6420  H HG3  . GLN A 1 80  ? 2.855   15.513  -14.287 1.00 0.00 ? 80  GLN A HG3  4  
ATOM 6421  H HE21 . GLN A 1 80  ? 2.527   16.412  -16.302 1.00 0.00 ? 80  GLN A HE21 4  
ATOM 6422  H HE22 . GLN A 1 80  ? 3.376   17.809  -16.873 1.00 0.00 ? 80  GLN A HE22 4  
ATOM 6423  N N    . GLN A 1 81  ? -0.762  15.352  -12.058 1.00 0.00 ? 81  GLN A N    4  
ATOM 6424  C CA   . GLN A 1 81  ? -2.185  15.190  -11.808 1.00 0.00 ? 81  GLN A CA   4  
ATOM 6425  C C    . GLN A 1 81  ? -2.442  14.993  -10.313 1.00 0.00 ? 81  GLN A C    4  
ATOM 6426  O O    . GLN A 1 81  ? -3.225  15.727  -9.712  1.00 0.00 ? 81  GLN A O    4  
ATOM 6427  C CB   . GLN A 1 81  ? -2.755  14.025  -12.621 1.00 0.00 ? 81  GLN A CB   4  
ATOM 6428  C CG   . GLN A 1 81  ? -3.584  14.535  -13.801 1.00 0.00 ? 81  GLN A CG   4  
ATOM 6429  C CD   . GLN A 1 81  ? -2.869  15.681  -14.520 1.00 0.00 ? 81  GLN A CD   4  
ATOM 6430  O OE1  . GLN A 1 81  ? -3.458  16.689  -14.873 1.00 0.00 ? 81  GLN A OE1  4  
ATOM 6431  N NE2  . GLN A 1 81  ? -1.571  15.470  -14.716 1.00 0.00 ? 81  GLN A NE2  4  
ATOM 6432  H H    . GLN A 1 81  ? -0.362  14.676  -12.676 1.00 0.00 ? 81  GLN A H    4  
ATOM 6433  H HA   . GLN A 1 81  ? -2.645  16.119  -12.144 1.00 0.00 ? 81  GLN A HA   4  
ATOM 6434  H HB2  . GLN A 1 81  ? -1.940  13.400  -12.987 1.00 0.00 ? 81  GLN A HB2  4  
ATOM 6435  H HB3  . GLN A 1 81  ? -3.374  13.399  -11.979 1.00 0.00 ? 81  GLN A HB3  4  
ATOM 6436  H HG2  . GLN A 1 81  ? -3.766  13.719  -14.501 1.00 0.00 ? 81  GLN A HG2  4  
ATOM 6437  H HG3  . GLN A 1 81  ? -4.557  14.874  -13.446 1.00 0.00 ? 81  GLN A HG3  4  
ATOM 6438  H HE21 . GLN A 1 81  ? -1.149  14.620  -14.400 1.00 0.00 ? 81  GLN A HE21 4  
ATOM 6439  H HE22 . GLN A 1 81  ? -1.016  16.162  -15.178 1.00 0.00 ? 81  GLN A HE22 4  
ATOM 6440  N N    . ALA A 1 82  ? -1.769  13.998  -9.755  1.00 0.00 ? 82  ALA A N    4  
ATOM 6441  C CA   . ALA A 1 82  ? -1.915  13.695  -8.341  1.00 0.00 ? 82  ALA A CA   4  
ATOM 6442  C C    . ALA A 1 82  ? -1.759  14.982  -7.530  1.00 0.00 ? 82  ALA A C    4  
ATOM 6443  O O    . ALA A 1 82  ? -2.705  15.432  -6.884  1.00 0.00 ? 82  ALA A O    4  
ATOM 6444  C CB   . ALA A 1 82  ? -0.896  12.626  -7.940  1.00 0.00 ? 82  ALA A CB   4  
ATOM 6445  H H    . ALA A 1 82  ? -1.134  13.405  -10.251 1.00 0.00 ? 82  ALA A H    4  
ATOM 6446  H HA   . ALA A 1 82  ? -2.918  13.298  -8.189  1.00 0.00 ? 82  ALA A HA   4  
ATOM 6447  H HB1  . ALA A 1 82  ? -0.212  12.447  -8.769  1.00 0.00 ? 82  ALA A HB1  4  
ATOM 6448  H HB2  . ALA A 1 82  ? -0.333  12.968  -7.072  1.00 0.00 ? 82  ALA A HB2  4  
ATOM 6449  H HB3  . ALA A 1 82  ? -1.418  11.701  -7.694  1.00 0.00 ? 82  ALA A HB3  4  
ATOM 6450  N N    . ARG A 1 83  ? -0.558  15.540  -7.589  1.00 0.00 ? 83  ARG A N    4  
ATOM 6451  C CA   . ARG A 1 83  ? -0.266  16.767  -6.867  1.00 0.00 ? 83  ARG A CA   4  
ATOM 6452  C C    . ARG A 1 83  ? -1.467  17.713  -6.922  1.00 0.00 ? 83  ARG A C    4  
ATOM 6453  O O    . ARG A 1 83  ? -1.690  18.493  -5.997  1.00 0.00 ? 83  ARG A O    4  
ATOM 6454  C CB   . ARG A 1 83  ? 0.958   17.472  -7.453  1.00 0.00 ? 83  ARG A CB   4  
ATOM 6455  C CG   . ARG A 1 83  ? 2.249   16.760  -7.046  1.00 0.00 ? 83  ARG A CG   4  
ATOM 6456  C CD   . ARG A 1 83  ? 3.477   17.584  -7.437  1.00 0.00 ? 83  ARG A CD   4  
ATOM 6457  N NE   . ARG A 1 83  ? 3.325   18.098  -8.816  1.00 0.00 ? 83  ARG A NE   4  
ATOM 6458  C CZ   . ARG A 1 83  ? 3.963   19.176  -9.291  1.00 0.00 ? 83  ARG A CZ   4  
ATOM 6459  N NH1  . ARG A 1 83  ? 4.801   19.861  -8.501  1.00 0.00 ? 83  ARG A NH1  4  
ATOM 6460  N NH2  . ARG A 1 83  ? 3.763   19.570  -10.557 1.00 0.00 ? 83  ARG A NH2  4  
ATOM 6461  H H    . ARG A 1 83  ? 0.206   15.168  -8.116  1.00 0.00 ? 83  ARG A H    4  
ATOM 6462  H HA   . ARG A 1 83  ? -0.065  16.447  -5.845  1.00 0.00 ? 83  ARG A HA   4  
ATOM 6463  H HB2  . ARG A 1 83  ? 0.881   17.500  -8.540  1.00 0.00 ? 83  ARG A HB2  4  
ATOM 6464  H HB3  . ARG A 1 83  ? 0.985   18.506  -7.110  1.00 0.00 ? 83  ARG A HB3  4  
ATOM 6465  H HG2  . ARG A 1 83  ? 2.250   16.587  -5.970  1.00 0.00 ? 83  ARG A HG2  4  
ATOM 6466  H HG3  . ARG A 1 83  ? 2.296   15.782  -7.526  1.00 0.00 ? 83  ARG A HG3  4  
ATOM 6467  H HD2  . ARG A 1 83  ? 3.603   18.415  -6.742  1.00 0.00 ? 83  ARG A HD2  4  
ATOM 6468  H HD3  . ARG A 1 83  ? 4.375   16.971  -7.366  1.00 0.00 ? 83  ARG A HD3  4  
ATOM 6469  H HE   . ARG A 1 83  ? 2.706   17.610  -9.432  1.00 0.00 ? 83  ARG A HE   4  
ATOM 6470  H HH11 . ARG A 1 83  ? 4.950   19.568  -7.557  1.00 0.00 ? 83  ARG A HH11 4  
ATOM 6471  H HH12 . ARG A 1 83  ? 5.277   20.666  -8.856  1.00 0.00 ? 83  ARG A HH12 4  
ATOM 6472  H HH21 . ARG A 1 83  ? 3.138   19.058  -11.146 1.00 0.00 ? 83  ARG A HH21 4  
ATOM 6473  H HH22 . ARG A 1 83  ? 4.239   20.374  -10.911 1.00 0.00 ? 83  ARG A HH22 4  
ATOM 6474  N N    . LEU A 1 84  ? -2.209  17.614  -8.015  1.00 0.00 ? 84  LEU A N    4  
ATOM 6475  C CA   . LEU A 1 84  ? -3.381  18.451  -8.203  1.00 0.00 ? 84  LEU A CA   4  
ATOM 6476  C C    . LEU A 1 84  ? -4.591  17.783  -7.546  1.00 0.00 ? 84  LEU A C    4  
ATOM 6477  O O    . LEU A 1 84  ? -5.249  18.380  -6.696  1.00 0.00 ? 84  LEU A O    4  
ATOM 6478  C CB   . LEU A 1 84  ? -3.583  18.766  -9.686  1.00 0.00 ? 84  LEU A CB   4  
ATOM 6479  C CG   . LEU A 1 84  ? -2.543  19.691  -10.323 1.00 0.00 ? 84  LEU A CG   4  
ATOM 6480  C CD1  . LEU A 1 84  ? -2.250  19.275  -11.766 1.00 0.00 ? 84  LEU A CD1  4  
ATOM 6481  C CD2  . LEU A 1 84  ? -2.979  21.154  -10.226 1.00 0.00 ? 84  LEU A CD2  4  
ATOM 6482  H H    . LEU A 1 84  ? -2.021  16.977  -8.763  1.00 0.00 ? 84  LEU A H    4  
ATOM 6483  H HA   . LEU A 1 84  ? -3.192  19.397  -7.695  1.00 0.00 ? 84  LEU A HA   4  
ATOM 6484  H HB2  . LEU A 1 84  ? -3.592  17.827  -10.239 1.00 0.00 ? 84  LEU A HB2  4  
ATOM 6485  H HB3  . LEU A 1 84  ? -4.567  19.218  -9.811  1.00 0.00 ? 84  LEU A HB3  4  
ATOM 6486  H HG   . LEU A 1 84  ? -1.613  19.594  -9.764  1.00 0.00 ? 84  LEU A HG   4  
ATOM 6487  H HD11 . LEU A 1 84  ? -2.678  20.008  -12.449 1.00 0.00 ? 84  LEU A HD11 4  
ATOM 6488  H HD12 . LEU A 1 84  ? -1.172  19.223  -11.917 1.00 0.00 ? 84  LEU A HD12 4  
ATOM 6489  H HD13 . LEU A 1 84  ? -2.691  18.297  -11.959 1.00 0.00 ? 84  LEU A HD13 4  
ATOM 6490  H HD21 . LEU A 1 84  ? -2.109  21.801  -10.339 1.00 0.00 ? 84  LEU A HD21 4  
ATOM 6491  H HD22 . LEU A 1 84  ? -3.699  21.372  -11.015 1.00 0.00 ? 84  LEU A HD22 4  
ATOM 6492  H HD23 . LEU A 1 84  ? -3.439  21.333  -9.254  1.00 0.00 ? 84  LEU A HD23 4  
ATOM 6493  N N    . ILE A 1 85  ? -4.846  16.552  -7.965  1.00 0.00 ? 85  ILE A N    4  
ATOM 6494  C CA   . ILE A 1 85  ? -5.965  15.796  -7.428  1.00 0.00 ? 85  ILE A CA   4  
ATOM 6495  C C    . ILE A 1 85  ? -5.887  15.794  -5.900  1.00 0.00 ? 85  ILE A C    4  
ATOM 6496  O O    . ILE A 1 85  ? -6.868  16.101  -5.225  1.00 0.00 ? 85  ILE A O    4  
ATOM 6497  C CB   . ILE A 1 85  ? -6.010  14.396  -8.044  1.00 0.00 ? 85  ILE A CB   4  
ATOM 6498  C CG1  . ILE A 1 85  ? -6.133  14.470  -9.567  1.00 0.00 ? 85  ILE A CG1  4  
ATOM 6499  C CG2  . ILE A 1 85  ? -7.127  13.557  -7.418  1.00 0.00 ? 85  ILE A CG2  4  
ATOM 6500  C CD1  . ILE A 1 85  ? -6.150  13.071  -10.185 1.00 0.00 ? 85  ILE A CD1  4  
ATOM 6501  H H    . ILE A 1 85  ? -4.306  16.073  -8.657  1.00 0.00 ? 85  ILE A H    4  
ATOM 6502  H HA   . ILE A 1 85  ? -6.879  16.309  -7.727  1.00 0.00 ? 85  ILE A HA   4  
ATOM 6503  H HB   . ILE A 1 85  ? -5.068  13.894  -7.821  1.00 0.00 ? 85  ILE A HB   4  
ATOM 6504  H HG12 . ILE A 1 85  ? -7.047  15.001  -9.836  1.00 0.00 ? 85  ILE A HG12 4  
ATOM 6505  H HG13 . ILE A 1 85  ? -5.300  15.042  -9.975  1.00 0.00 ? 85  ILE A HG13 4  
ATOM 6506  H HG21 . ILE A 1 85  ? -6.789  12.527  -7.308  1.00 0.00 ? 85  ILE A HG21 4  
ATOM 6507  H HG22 . ILE A 1 85  ? -7.381  13.963  -6.439  1.00 0.00 ? 85  ILE A HG22 4  
ATOM 6508  H HG23 . ILE A 1 85  ? -8.006  13.585  -8.063  1.00 0.00 ? 85  ILE A HG23 4  
ATOM 6509  H HD11 . ILE A 1 85  ? -5.310  12.967  -10.872 1.00 0.00 ? 85  ILE A HD11 4  
ATOM 6510  H HD12 . ILE A 1 85  ? -6.067  12.324  -9.395  1.00 0.00 ? 85  ILE A HD12 4  
ATOM 6511  H HD13 . ILE A 1 85  ? -7.084  12.924  -10.727 1.00 0.00 ? 85  ILE A HD13 4  
ATOM 6512  N N    . ILE A 1 86  ? -4.711  15.443  -5.400  1.00 0.00 ? 86  ILE A N    4  
ATOM 6513  C CA   . ILE A 1 86  ? -4.493  15.397  -3.964  1.00 0.00 ? 86  ILE A CA   4  
ATOM 6514  C C    . ILE A 1 86  ? -4.457  16.823  -3.412  1.00 0.00 ? 86  ILE A C    4  
ATOM 6515  O O    . ILE A 1 86  ? -5.009  17.094  -2.346  1.00 0.00 ? 86  ILE A O    4  
ATOM 6516  C CB   . ILE A 1 86  ? -3.240  14.580  -3.639  1.00 0.00 ? 86  ILE A CB   4  
ATOM 6517  C CG1  . ILE A 1 86  ? -1.971  15.392  -3.906  1.00 0.00 ? 86  ILE A CG1  4  
ATOM 6518  C CG2  . ILE A 1 86  ? -3.241  13.251  -4.397  1.00 0.00 ? 86  ILE A CG2  4  
ATOM 6519  C CD1  . ILE A 1 86  ? -0.743  14.483  -3.973  1.00 0.00 ? 86  ILE A CD1  4  
ATOM 6520  H H    . ILE A 1 86  ? -3.919  15.194  -5.956  1.00 0.00 ? 86  ILE A H    4  
ATOM 6521  H HA   . ILE A 1 86  ? -5.341  14.875  -3.521  1.00 0.00 ? 86  ILE A HA   4  
ATOM 6522  H HB   . ILE A 1 86  ? -3.254  14.343  -2.575  1.00 0.00 ? 86  ILE A HB   4  
ATOM 6523  H HG12 . ILE A 1 86  ? -2.075  15.938  -4.843  1.00 0.00 ? 86  ILE A HG12 4  
ATOM 6524  H HG13 . ILE A 1 86  ? -1.837  16.133  -3.118  1.00 0.00 ? 86  ILE A HG13 4  
ATOM 6525  H HG21 . ILE A 1 86  ? -2.888  12.457  -3.739  1.00 0.00 ? 86  ILE A HG21 4  
ATOM 6526  H HG22 . ILE A 1 86  ? -4.253  13.023  -4.731  1.00 0.00 ? 86  ILE A HG22 4  
ATOM 6527  H HG23 . ILE A 1 86  ? -2.581  13.326  -5.262  1.00 0.00 ? 86  ILE A HG23 4  
ATOM 6528  H HD11 . ILE A 1 86  ? -1.000  13.495  -3.589  1.00 0.00 ? 86  ILE A HD11 4  
ATOM 6529  H HD12 . ILE A 1 86  ? -0.411  14.395  -5.008  1.00 0.00 ? 86  ILE A HD12 4  
ATOM 6530  H HD13 . ILE A 1 86  ? 0.059   14.910  -3.370  1.00 0.00 ? 86  ILE A HD13 4  
ATOM 6531  N N    . GLY A 1 87  ? -3.802  17.697  -4.162  1.00 0.00 ? 87  GLY A N    4  
ATOM 6532  C CA   . GLY A 1 87  ? -3.688  19.089  -3.760  1.00 0.00 ? 87  GLY A CA   4  
ATOM 6533  C C    . GLY A 1 87  ? -4.912  19.891  -4.206  1.00 0.00 ? 87  GLY A C    4  
ATOM 6534  O O    . GLY A 1 87  ? -4.778  20.999  -4.724  1.00 0.00 ? 87  GLY A O    4  
ATOM 6535  H H    . GLY A 1 87  ? -3.356  17.469  -5.027  1.00 0.00 ? 87  GLY A H    4  
ATOM 6536  H HA2  . GLY A 1 87  ? -3.582  19.152  -2.677  1.00 0.00 ? 87  GLY A HA2  4  
ATOM 6537  H HA3  . GLY A 1 87  ? -2.787  19.523  -4.194  1.00 0.00 ? 87  GLY A HA3  4  
ATOM 6538  N N    . GLN A 1 88  ? -6.078  19.300  -3.988  1.00 0.00 ? 88  GLN A N    4  
ATOM 6539  C CA   . GLN A 1 88  ? -7.325  19.946  -4.361  1.00 0.00 ? 88  GLN A CA   4  
ATOM 6540  C C    . GLN A 1 88  ? -8.015  20.523  -3.123  1.00 0.00 ? 88  GLN A C    4  
ATOM 6541  O O    . GLN A 1 88  ? -7.449  20.512  -2.031  1.00 0.00 ? 88  GLN A O    4  
ATOM 6542  C CB   . GLN A 1 88  ? -8.247  18.973  -5.099  1.00 0.00 ? 88  GLN A CB   4  
ATOM 6543  C CG   . GLN A 1 88  ? -7.941  18.957  -6.598  1.00 0.00 ? 88  GLN A CG   4  
ATOM 6544  C CD   . GLN A 1 88  ? -9.210  19.195  -7.419  1.00 0.00 ? 88  GLN A CD   4  
ATOM 6545  O OE1  . GLN A 1 88  ? -9.870  20.216  -7.308  1.00 0.00 ? 88  GLN A OE1  4  
ATOM 6546  N NE2  . GLN A 1 88  ? -9.514  18.199  -8.246  1.00 0.00 ? 88  GLN A NE2  4  
ATOM 6547  H H    . GLN A 1 88  ? -6.178  18.399  -3.567  1.00 0.00 ? 88  GLN A H    4  
ATOM 6548  H HA   . GLN A 1 88  ? -7.043  20.753  -5.037  1.00 0.00 ? 88  GLN A HA   4  
ATOM 6549  H HB2  . GLN A 1 88  ? -8.126  17.970  -4.689  1.00 0.00 ? 88  GLN A HB2  4  
ATOM 6550  H HB3  . GLN A 1 88  ? -9.287  19.259  -4.939  1.00 0.00 ? 88  GLN A HB3  4  
ATOM 6551  H HG2  . GLN A 1 88  ? -7.204  19.726  -6.830  1.00 0.00 ? 88  GLN A HG2  4  
ATOM 6552  H HG3  . GLN A 1 88  ? -7.500  17.999  -6.873  1.00 0.00 ? 88  GLN A HG3  4  
ATOM 6553  H HE21 . GLN A 1 88  ? -8.930  17.388  -8.288  1.00 0.00 ? 88  GLN A HE21 4  
ATOM 6554  H HE22 . GLN A 1 88  ? -10.327 18.261  -8.825  1.00 0.00 ? 88  GLN A HE22 4  
ATOM 6555  N N    . GLN A 1 89  ? -9.227  21.014  -3.335  1.00 0.00 ? 89  GLN A N    4  
ATOM 6556  C CA   . GLN A 1 89  ? -9.999  21.595  -2.250  1.00 0.00 ? 89  GLN A CA   4  
ATOM 6557  C C    . GLN A 1 89  ? -11.131 20.650  -1.840  1.00 0.00 ? 89  GLN A C    4  
ATOM 6558  O O    . GLN A 1 89  ? -11.681 19.935  -2.675  1.00 0.00 ? 89  GLN A O    4  
ATOM 6559  C CB   . GLN A 1 89  ? -10.547 22.969  -2.641  1.00 0.00 ? 89  GLN A CB   4  
ATOM 6560  C CG   . GLN A 1 89  ? -10.859 23.029  -4.138  1.00 0.00 ? 89  GLN A CG   4  
ATOM 6561  C CD   . GLN A 1 89  ? -11.845 21.929  -4.537  1.00 0.00 ? 89  GLN A CD   4  
ATOM 6562  O OE1  . GLN A 1 89  ? -12.931 21.806  -3.996  1.00 0.00 ? 89  GLN A OE1  4  
ATOM 6563  N NE2  . GLN A 1 89  ? -11.406 21.137  -5.512  1.00 0.00 ? 89  GLN A NE2  4  
ATOM 6564  H H    . GLN A 1 89  ? -9.680  21.019  -4.227  1.00 0.00 ? 89  GLN A H    4  
ATOM 6565  H HA   . GLN A 1 89  ? -9.297  21.712  -1.425  1.00 0.00 ? 89  GLN A HA   4  
ATOM 6566  H HB2  . GLN A 1 89  ? -11.450 23.180  -2.069  1.00 0.00 ? 89  GLN A HB2  4  
ATOM 6567  H HB3  . GLN A 1 89  ? -9.820  23.740  -2.387  1.00 0.00 ? 89  GLN A HB3  4  
ATOM 6568  H HG2  . GLN A 1 89  ? -11.277 24.004  -4.387  1.00 0.00 ? 89  GLN A HG2  4  
ATOM 6569  H HG3  . GLN A 1 89  ? -9.938  22.922  -4.710  1.00 0.00 ? 89  GLN A HG3  4  
ATOM 6570  H HE21 . GLN A 1 89  ? -10.504 21.292  -5.914  1.00 0.00 ? 89  GLN A HE21 4  
ATOM 6571  H HE22 . GLN A 1 89  ? -11.979 20.388  -5.843  1.00 0.00 ? 89  GLN A HE22 4  
ATOM 6572  N N    . CYS A 1 90  ? -11.444 20.678  -0.553  1.00 0.00 ? 90  CYS A N    4  
ATOM 6573  C CA   . CYS A 1 90  ? -12.500 19.833  -0.021  1.00 0.00 ? 90  CYS A CA   4  
ATOM 6574  C C    . CYS A 1 90  ? -12.311 19.723  1.493   1.00 0.00 ? 90  CYS A C    4  
ATOM 6575  O O    . CYS A 1 90  ? -11.340 19.130  1.960   1.00 0.00 ? 90  CYS A O    4  
ATOM 6576  C CB   . CYS A 1 90  ? -12.519 18.459  -0.695  1.00 0.00 ? 90  CYS A CB   4  
ATOM 6577  S SG   . CYS A 1 90  ? -13.878 18.380  -1.917  1.00 0.00 ? 90  CYS A SG   4  
ATOM 6578  H H    . CYS A 1 90  ? -10.992 21.263  0.120   1.00 0.00 ? 90  CYS A H    4  
ATOM 6579  H HA   . CYS A 1 90  ? -13.444 20.324  -0.259  1.00 0.00 ? 90  CYS A HA   4  
ATOM 6580  H HB2  . CYS A 1 90  ? -11.564 18.274  -1.188  1.00 0.00 ? 90  CYS A HB2  4  
ATOM 6581  H HB3  . CYS A 1 90  ? -12.647 17.679  0.055   1.00 0.00 ? 90  CYS A HB3  4  
ATOM 6582  H HG   . CYS A 1 90  ? -14.857 18.636  -1.053  1.00 0.00 ? 90  CYS A HG   4  
ATOM 6583  N N    . ASP A 1 91  ? -13.255 20.305  2.219   1.00 0.00 ? 91  ASP A N    4  
ATOM 6584  C CA   . ASP A 1 91  ? -13.204 20.280  3.671   1.00 0.00 ? 91  ASP A CA   4  
ATOM 6585  C C    . ASP A 1 91  ? -12.835 18.871  4.140   1.00 0.00 ? 91  ASP A C    4  
ATOM 6586  O O    . ASP A 1 91  ? -11.944 18.704  4.971   1.00 0.00 ? 91  ASP A O    4  
ATOM 6587  C CB   . ASP A 1 91  ? -14.563 20.639  4.276   1.00 0.00 ? 91  ASP A CB   4  
ATOM 6588  C CG   . ASP A 1 91  ? -14.776 22.129  4.549   1.00 0.00 ? 91  ASP A CG   4  
ATOM 6589  O OD1  . ASP A 1 91  ? -13.831 22.898  4.270   1.00 0.00 ? 91  ASP A OD1  4  
ATOM 6590  O OD2  . ASP A 1 91  ? -15.879 22.465  5.032   1.00 0.00 ? 91  ASP A OD2  4  
ATOM 6591  H H    . ASP A 1 91  ? -14.041 20.786  1.832   1.00 0.00 ? 91  ASP A H    4  
ATOM 6592  H HA   . ASP A 1 91  ? -12.453 21.021  3.944   1.00 0.00 ? 91  ASP A HA   4  
ATOM 6593  H HB2  . ASP A 1 91  ? -15.346 20.293  3.601   1.00 0.00 ? 91  ASP A HB2  4  
ATOM 6594  H HB3  . ASP A 1 91  ? -14.683 20.092  5.211   1.00 0.00 ? 91  ASP A HB3  4  
ATOM 6595  N N    . THR A 1 92  ? -13.538 17.895  3.586   1.00 0.00 ? 92  THR A N    4  
ATOM 6596  C CA   . THR A 1 92  ? -13.296 16.506  3.937   1.00 0.00 ? 92  THR A CA   4  
ATOM 6597  C C    . THR A 1 92  ? -13.165 15.651  2.675   1.00 0.00 ? 92  THR A C    4  
ATOM 6598  O O    . THR A 1 92  ? -14.047 15.666  1.817   1.00 0.00 ? 92  THR A O    4  
ATOM 6599  C CB   . THR A 1 92  ? -14.422 16.049  4.867   1.00 0.00 ? 92  THR A CB   4  
ATOM 6600  O OG1  . THR A 1 92  ? -14.325 16.925  5.987   1.00 0.00 ? 92  THR A OG1  4  
ATOM 6601  C CG2  . THR A 1 92  ? -14.168 14.660  5.456   1.00 0.00 ? 92  THR A CG2  4  
ATOM 6602  H H    . THR A 1 92  ? -14.261 18.040  2.911   1.00 0.00 ? 92  THR A H    4  
ATOM 6603  H HA   . THR A 1 92  ? -12.343 16.446  4.464   1.00 0.00 ? 92  THR A HA   4  
ATOM 6604  H HB   . THR A 1 92  ? -15.385 16.086  4.358   1.00 0.00 ? 92  THR A HB   4  
ATOM 6605  H HG1  . THR A 1 92  ? -15.153 16.862  6.543   1.00 0.00 ? 92  THR A HG1  4  
ATOM 6606  H HG21 . THR A 1 92  ? -14.894 13.955  5.051   1.00 0.00 ? 92  THR A HG21 4  
ATOM 6607  H HG22 . THR A 1 92  ? -13.161 14.334  5.197   1.00 0.00 ? 92  THR A HG22 4  
ATOM 6608  H HG23 . THR A 1 92  ? -14.269 14.702  6.541   1.00 0.00 ? 92  THR A HG23 4  
ATOM 6609  N N    . ILE A 1 93  ? -12.058 14.927  2.601   1.00 0.00 ? 93  ILE A N    4  
ATOM 6610  C CA   . ILE A 1 93  ? -11.801 14.068  1.457   1.00 0.00 ? 93  ILE A CA   4  
ATOM 6611  C C    . ILE A 1 93  ? -11.266 12.721  1.947   1.00 0.00 ? 93  ILE A C    4  
ATOM 6612  O O    . ILE A 1 93  ? -10.597 12.652  2.977   1.00 0.00 ? 93  ILE A O    4  
ATOM 6613  C CB   . ILE A 1 93  ? -10.880 14.769  0.457   1.00 0.00 ? 93  ILE A CB   4  
ATOM 6614  C CG1  . ILE A 1 93  ? -10.074 13.751  -0.352  1.00 0.00 ? 93  ILE A CG1  4  
ATOM 6615  C CG2  . ILE A 1 93  ? -9.979  15.785  1.160   1.00 0.00 ? 93  ILE A CG2  4  
ATOM 6616  C CD1  . ILE A 1 93  ? -8.844  13.281  0.428   1.00 0.00 ? 93  ILE A CD1  4  
ATOM 6617  H H    . ILE A 1 93  ? -11.346 14.921  3.303   1.00 0.00 ? 93  ILE A H    4  
ATOM 6618  H HA   . ILE A 1 93  ? -12.754 13.899  0.955   1.00 0.00 ? 93  ILE A HA   4  
ATOM 6619  H HB   . ILE A 1 93  ? -11.500 15.322  -0.248  1.00 0.00 ? 93  ILE A HB   4  
ATOM 6620  H HG12 . ILE A 1 93  ? -10.703 12.895  -0.597  1.00 0.00 ? 93  ILE A HG12 4  
ATOM 6621  H HG13 . ILE A 1 93  ? -9.762  14.197  -1.296  1.00 0.00 ? 93  ILE A HG13 4  
ATOM 6622  H HG21 . ILE A 1 93  ? -9.710  15.410  2.148   1.00 0.00 ? 93  ILE A HG21 4  
ATOM 6623  H HG22 . ILE A 1 93  ? -9.075  15.938  0.571   1.00 0.00 ? 93  ILE A HG22 4  
ATOM 6624  H HG23 . ILE A 1 93  ? -10.510 16.732  1.264   1.00 0.00 ? 93  ILE A HG23 4  
ATOM 6625  H HD11 . ILE A 1 93  ? -8.843  12.192  0.482   1.00 0.00 ? 93  ILE A HD11 4  
ATOM 6626  H HD12 . ILE A 1 93  ? -7.941  13.621  -0.079  1.00 0.00 ? 93  ILE A HD12 4  
ATOM 6627  H HD13 . ILE A 1 93  ? -8.873  13.695  1.436   1.00 0.00 ? 93  ILE A HD13 4  
ATOM 6628  N N    . THR A 1 94  ? -11.581 11.683  1.186   1.00 0.00 ? 94  THR A N    4  
ATOM 6629  C CA   . THR A 1 94  ? -11.140 10.342  1.530   1.00 0.00 ? 94  THR A CA   4  
ATOM 6630  C C    . THR A 1 94  ? -10.040 9.880   0.571   1.00 0.00 ? 94  THR A C    4  
ATOM 6631  O O    . THR A 1 94  ? -9.833  10.485  -0.480  1.00 0.00 ? 94  THR A O    4  
ATOM 6632  C CB   . THR A 1 94  ? -12.366 9.427   1.533   1.00 0.00 ? 94  THR A CB   4  
ATOM 6633  O OG1  . THR A 1 94  ? -13.294 10.095  2.384   1.00 0.00 ? 94  THR A OG1  4  
ATOM 6634  C CG2  . THR A 1 94  ? -12.102 8.097   2.241   1.00 0.00 ? 94  THR A CG2  4  
ATOM 6635  H H    . THR A 1 94  ? -12.125 11.747  0.350   1.00 0.00 ? 94  THR A H    4  
ATOM 6636  H HA   . THR A 1 94  ? -10.703 10.369  2.528   1.00 0.00 ? 94  THR A HA   4  
ATOM 6637  H HB   . THR A 1 94  ? -12.732 9.263   0.520   1.00 0.00 ? 94  THR A HB   4  
ATOM 6638  H HG1  . THR A 1 94  ? -13.398 11.047  2.097   1.00 0.00 ? 94  THR A HG1  4  
ATOM 6639  H HG21 . THR A 1 94  ? -12.947 7.854   2.885   1.00 0.00 ? 94  THR A HG21 4  
ATOM 6640  H HG22 . THR A 1 94  ? -11.973 7.309   1.499   1.00 0.00 ? 94  THR A HG22 4  
ATOM 6641  H HG23 . THR A 1 94  ? -11.198 8.179   2.844   1.00 0.00 ? 94  THR A HG23 4  
ATOM 6642  N N    . ILE A 1 95  ? -9.363  8.813   0.968   1.00 0.00 ? 95  ILE A N    4  
ATOM 6643  C CA   . ILE A 1 95  ? -8.290  8.263   0.158   1.00 0.00 ? 95  ILE A CA   4  
ATOM 6644  C C    . ILE A 1 95  ? -8.379  6.735   0.170   1.00 0.00 ? 95  ILE A C    4  
ATOM 6645  O O    . ILE A 1 95  ? -8.805  6.143   1.160   1.00 0.00 ? 95  ILE A O    4  
ATOM 6646  C CB   . ILE A 1 95  ? -6.936  8.804   0.622   1.00 0.00 ? 95  ILE A CB   4  
ATOM 6647  C CG1  . ILE A 1 95  ? -6.656  10.178  0.011   1.00 0.00 ? 95  ILE A CG1  4  
ATOM 6648  C CG2  . ILE A 1 95  ? -5.816  7.805   0.326   1.00 0.00 ? 95  ILE A CG2  4  
ATOM 6649  C CD1  . ILE A 1 95  ? -5.654  10.962  0.860   1.00 0.00 ? 95  ILE A CD1  4  
ATOM 6650  H H    . ILE A 1 95  ? -9.537  8.327   1.825   1.00 0.00 ? 95  ILE A H    4  
ATOM 6651  H HA   . ILE A 1 95  ? -8.442  8.609   -0.864  1.00 0.00 ? 95  ILE A HA   4  
ATOM 6652  H HB   . ILE A 1 95  ? -6.974  8.935   1.704   1.00 0.00 ? 95  ILE A HB   4  
ATOM 6653  H HG12 . ILE A 1 95  ? -6.266  10.057  -1.000  1.00 0.00 ? 95  ILE A HG12 4  
ATOM 6654  H HG13 . ILE A 1 95  ? -7.586  10.740  -0.072  1.00 0.00 ? 95  ILE A HG13 4  
ATOM 6655  H HG21 . ILE A 1 95  ? -5.929  6.931   0.968   1.00 0.00 ? 95  ILE A HG21 4  
ATOM 6656  H HG22 . ILE A 1 95  ? -5.869  7.499   -0.718  1.00 0.00 ? 95  ILE A HG22 4  
ATOM 6657  H HG23 . ILE A 1 95  ? -4.851  8.274   0.519   1.00 0.00 ? 95  ILE A HG23 4  
ATOM 6658  H HD11 . ILE A 1 95  ? -5.467  10.425  1.790   1.00 0.00 ? 95  ILE A HD11 4  
ATOM 6659  H HD12 . ILE A 1 95  ? -4.719  11.072  0.310   1.00 0.00 ? 95  ILE A HD12 4  
ATOM 6660  H HD13 . ILE A 1 95  ? -6.061  11.948  1.085   1.00 0.00 ? 95  ILE A HD13 4  
ATOM 6661  N N    . LEU A 1 96  ? -7.968  6.142   -0.941  1.00 0.00 ? 96  LEU A N    4  
ATOM 6662  C CA   . LEU A 1 96  ? -7.996  4.695   -1.071  1.00 0.00 ? 96  LEU A CA   4  
ATOM 6663  C C    . LEU A 1 96  ? -6.579  4.184   -1.340  1.00 0.00 ? 96  LEU A C    4  
ATOM 6664  O O    . LEU A 1 96  ? -6.155  4.098   -2.491  1.00 0.00 ? 96  LEU A O    4  
ATOM 6665  C CB   . LEU A 1 96  ? -9.014  4.271   -2.131  1.00 0.00 ? 96  LEU A CB   4  
ATOM 6666  C CG   . LEU A 1 96  ? -8.923  2.820   -2.607  1.00 0.00 ? 96  LEU A CG   4  
ATOM 6667  C CD1  . LEU A 1 96  ? -9.602  1.874   -1.614  1.00 0.00 ? 96  LEU A CD1  4  
ATOM 6668  C CD2  . LEU A 1 96  ? -9.490  2.669   -4.020  1.00 0.00 ? 96  LEU A CD2  4  
ATOM 6669  H H    . LEU A 1 96  ? -7.623  6.631   -1.742  1.00 0.00 ? 96  LEU A H    4  
ATOM 6670  H HA   . LEU A 1 96  ? -8.335  4.288   -0.118  1.00 0.00 ? 96  LEU A HA   4  
ATOM 6671  H HB2  . LEU A 1 96  ? -10.015 4.440   -1.734  1.00 0.00 ? 96  LEU A HB2  4  
ATOM 6672  H HB3  . LEU A 1 96  ? -8.901  4.924   -2.997  1.00 0.00 ? 96  LEU A HB3  4  
ATOM 6673  H HG   . LEU A 1 96  ? -7.871  2.540   -2.650  1.00 0.00 ? 96  LEU A HG   4  
ATOM 6674  H HD11 . LEU A 1 96  ? -10.620 2.215   -1.425  1.00 0.00 ? 96  LEU A HD11 4  
ATOM 6675  H HD12 . LEU A 1 96  ? -9.626  0.867   -2.030  1.00 0.00 ? 96  LEU A HD12 4  
ATOM 6676  H HD13 . LEU A 1 96  ? -9.042  1.867   -0.678  1.00 0.00 ? 96  LEU A HD13 4  
ATOM 6677  H HD21 . LEU A 1 96  ? -9.607  1.611   -4.253  1.00 0.00 ? 96  LEU A HD21 4  
ATOM 6678  H HD22 . LEU A 1 96  ? -10.459 3.164   -4.078  1.00 0.00 ? 96  LEU A HD22 4  
ATOM 6679  H HD23 . LEU A 1 96  ? -8.806  3.125   -4.736  1.00 0.00 ? 96  LEU A HD23 4  
ATOM 6680  N N    . ALA A 1 97  ? -5.887  3.858   -0.259  1.00 0.00 ? 97  ALA A N    4  
ATOM 6681  C CA   . ALA A 1 97  ? -4.527  3.358   -0.363  1.00 0.00 ? 97  ALA A CA   4  
ATOM 6682  C C    . ALA A 1 97  ? -4.541  1.830   -0.276  1.00 0.00 ? 97  ALA A C    4  
ATOM 6683  O O    . ALA A 1 97  ? -5.597  1.226   -0.094  1.00 0.00 ? 97  ALA A O    4  
ATOM 6684  C CB   . ALA A 1 97  ? -3.662  3.996   0.726   1.00 0.00 ? 97  ALA A CB   4  
ATOM 6685  H H    . ALA A 1 97  ? -6.240  3.930   0.674   1.00 0.00 ? 97  ALA A H    4  
ATOM 6686  H HA   . ALA A 1 97  ? -4.138  3.654   -1.338  1.00 0.00 ? 97  ALA A HA   4  
ATOM 6687  H HB1  . ALA A 1 97  ? -2.707  3.474   0.784   1.00 0.00 ? 97  ALA A HB1  4  
ATOM 6688  H HB2  . ALA A 1 97  ? -3.489  5.045   0.484   1.00 0.00 ? 97  ALA A HB2  4  
ATOM 6689  H HB3  . ALA A 1 97  ? -4.175  3.924   1.685   1.00 0.00 ? 97  ALA A HB3  4  
ATOM 6690  N N    . GLN A 1 98  ? -3.357  1.251   -0.409  1.00 0.00 ? 98  GLN A N    4  
ATOM 6691  C CA   . GLN A 1 98  ? -3.221  -0.195  -0.348  1.00 0.00 ? 98  GLN A CA   4  
ATOM 6692  C C    . GLN A 1 98  ? -1.742  -0.588  -0.336  1.00 0.00 ? 98  GLN A C    4  
ATOM 6693  O O    . GLN A 1 98  ? -1.202  -1.018  -1.354  1.00 0.00 ? 98  GLN A O    4  
ATOM 6694  C CB   . GLN A 1 98  ? -3.957  -0.865  -1.509  1.00 0.00 ? 98  GLN A CB   4  
ATOM 6695  C CG   . GLN A 1 98  ? -3.992  -2.384  -1.332  1.00 0.00 ? 98  GLN A CG   4  
ATOM 6696  C CD   . GLN A 1 98  ? -4.499  -3.073  -2.601  1.00 0.00 ? 98  GLN A CD   4  
ATOM 6697  O OE1  . GLN A 1 98  ? -4.319  -2.598  -3.710  1.00 0.00 ? 98  GLN A OE1  4  
ATOM 6698  N NE2  . GLN A 1 98  ? -5.142  -4.215  -2.376  1.00 0.00 ? 98  GLN A NE2  4  
ATOM 6699  H H    . GLN A 1 98  ? -2.504  1.750   -0.557  1.00 0.00 ? 98  GLN A H    4  
ATOM 6700  H HA   . GLN A 1 98  ? -3.690  -0.490  0.591   1.00 0.00 ? 98  GLN A HA   4  
ATOM 6701  H HB2  . GLN A 1 98  ? -4.975  -0.479  -1.570  1.00 0.00 ? 98  GLN A HB2  4  
ATOM 6702  H HB3  . GLN A 1 98  ? -3.465  -0.616  -2.449  1.00 0.00 ? 98  GLN A HB3  4  
ATOM 6703  H HG2  . GLN A 1 98  ? -2.994  -2.749  -1.090  1.00 0.00 ? 98  GLN A HG2  4  
ATOM 6704  H HG3  . GLN A 1 98  ? -4.638  -2.641  -0.492  1.00 0.00 ? 98  GLN A HG3  4  
ATOM 6705  H HE21 . GLN A 1 98  ? -5.256  -4.550  -1.441  1.00 0.00 ? 98  GLN A HE21 4  
ATOM 6706  H HE22 . GLN A 1 98  ? -5.511  -4.740  -3.143  1.00 0.00 ? 98  GLN A HE22 4  
ATOM 6707  N N    . TYR A 1 99  ? -1.129  -0.427  0.828   1.00 0.00 ? 99  TYR A N    4  
ATOM 6708  C CA   . TYR A 1 99  ? 0.277   -0.760  0.985   1.00 0.00 ? 99  TYR A CA   4  
ATOM 6709  C C    . TYR A 1 99  ? 0.638   -2.010  0.179   1.00 0.00 ? 99  TYR A C    4  
ATOM 6710  O O    . TYR A 1 99  ? -0.140  -2.961  0.120   1.00 0.00 ? 99  TYR A O    4  
ATOM 6711  C CB   . TYR A 1 99  ? 0.476   -1.052  2.474   1.00 0.00 ? 99  TYR A CB   4  
ATOM 6712  C CG   . TYR A 1 99  ? 1.912   -1.426  2.847   1.00 0.00 ? 99  TYR A CG   4  
ATOM 6713  C CD1  . TYR A 1 99  ? 2.425   -2.652  2.475   1.00 0.00 ? 99  TYR A CD1  4  
ATOM 6714  C CD2  . TYR A 1 99  ? 2.694   -0.536  3.556   1.00 0.00 ? 99  TYR A CD2  4  
ATOM 6715  C CE1  . TYR A 1 99  ? 3.777   -3.003  2.827   1.00 0.00 ? 99  TYR A CE1  4  
ATOM 6716  C CE2  . TYR A 1 99  ? 4.046   -0.888  3.907   1.00 0.00 ? 99  TYR A CE2  4  
ATOM 6717  C CZ   . TYR A 1 99  ? 4.520   -2.104  3.525   1.00 0.00 ? 99  TYR A CZ   4  
ATOM 6718  O OH   . TYR A 1 99  ? 5.797   -2.436  3.857   1.00 0.00 ? 99  TYR A OH   4  
ATOM 6719  H H    . TYR A 1 99  ? -1.575  -0.077  1.651   1.00 0.00 ? 99  TYR A H    4  
ATOM 6720  H HA   . TYR A 1 99  ? 0.865   0.082   0.619   1.00 0.00 ? 99  TYR A HA   4  
ATOM 6721  H HB2  . TYR A 1 99  ? 0.179   -0.175  3.049   1.00 0.00 ? 99  TYR A HB2  4  
ATOM 6722  H HB3  . TYR A 1 99  ? -0.188  -1.866  2.766   1.00 0.00 ? 99  TYR A HB3  4  
ATOM 6723  H HD1  . TYR A 1 99  ? 1.807   -3.354  1.916   1.00 0.00 ? 99  TYR A HD1  4  
ATOM 6724  H HD2  . TYR A 1 99  ? 2.289   0.432   3.849   1.00 0.00 ? 99  TYR A HD2  4  
ATOM 6725  H HE1  . TYR A 1 99  ? 4.194   -3.968  2.540   1.00 0.00 ? 99  TYR A HE1  4  
ATOM 6726  H HE2  . TYR A 1 99  ? 4.675   -0.195  4.466   1.00 0.00 ? 99  TYR A HE2  4  
ATOM 6727  H HH   . TYR A 1 99  ? 6.139   -1.815  4.562   1.00 0.00 ? 99  TYR A HH   4  
ATOM 6728  N N    . ASN A 1 100 ? 1.818   -1.967  -0.421  1.00 0.00 ? 100 ASN A N    4  
ATOM 6729  C CA   . ASN A 1 100 ? 2.292   -3.084  -1.220  1.00 0.00 ? 100 ASN A CA   4  
ATOM 6730  C C    . ASN A 1 100 ? 3.763   -3.351  -0.895  1.00 0.00 ? 100 ASN A C    4  
ATOM 6731  O O    . ASN A 1 100 ? 4.611   -2.480  -1.080  1.00 0.00 ? 100 ASN A O    4  
ATOM 6732  C CB   . ASN A 1 100 ? 2.187   -2.775  -2.715  1.00 0.00 ? 100 ASN A CB   4  
ATOM 6733  C CG   . ASN A 1 100 ? 0.881   -3.319  -3.297  1.00 0.00 ? 100 ASN A CG   4  
ATOM 6734  O OD1  . ASN A 1 100 ? 0.558   -4.489  -3.178  1.00 0.00 ? 100 ASN A OD1  4  
ATOM 6735  N ND2  . ASN A 1 100 ? 0.150   -2.406  -3.931  1.00 0.00 ? 100 ASN A ND2  4  
ATOM 6736  H H    . ASN A 1 100 ? 2.445   -1.190  -0.368  1.00 0.00 ? 100 ASN A H    4  
ATOM 6737  H HA   . ASN A 1 100 ? 1.647   -3.921  -0.953  1.00 0.00 ? 100 ASN A HA   4  
ATOM 6738  H HB2  . ASN A 1 100 ? 2.238   -1.697  -2.872  1.00 0.00 ? 100 ASN A HB2  4  
ATOM 6739  H HB3  . ASN A 1 100 ? 3.034   -3.214  -3.241  1.00 0.00 ? 100 ASN A HB3  4  
ATOM 6740  H HD21 . ASN A 1 100 ? 0.472   -1.462  -3.993  1.00 0.00 ? 100 ASN A HD21 4  
ATOM 6741  H HD22 . ASN A 1 100 ? -0.723  -2.665  -4.346  1.00 0.00 ? 100 ASN A HD22 4  
ATOM 6742  N N    . PRO A 1 101 ? 4.027   -4.591  -0.403  1.00 0.00 ? 101 PRO A N    4  
ATOM 6743  C CA   . PRO A 1 101 ? 5.380   -4.984  -0.050  1.00 0.00 ? 101 PRO A CA   4  
ATOM 6744  C C    . PRO A 1 101 ? 6.214   -5.265  -1.302  1.00 0.00 ? 101 PRO A C    4  
ATOM 6745  O O    . PRO A 1 101 ? 6.795   -6.341  -1.437  1.00 0.00 ? 101 PRO A O    4  
ATOM 6746  C CB   . PRO A 1 101 ? 5.216   -6.205  0.840   1.00 0.00 ? 101 PRO A CB   4  
ATOM 6747  C CG   . PRO A 1 101 ? 3.813   -6.727  0.577   1.00 0.00 ? 101 PRO A CG   4  
ATOM 6748  C CD   . PRO A 1 101 ? 3.047   -5.649  -0.171  1.00 0.00 ? 101 PRO A CD   4  
ATOM 6749  H HA   . PRO A 1 101 ? 5.845   -4.237  0.426   1.00 0.00 ? 101 PRO A HA   4  
ATOM 6750  H HB2  . PRO A 1 101 ? 5.965   -6.962  0.607   1.00 0.00 ? 101 PRO A HB2  4  
ATOM 6751  H HB3  . PRO A 1 101 ? 5.345   -5.942  1.890   1.00 0.00 ? 101 PRO A HB3  4  
ATOM 6752  H HG2  . PRO A 1 101 ? 3.851   -7.645  -0.009  1.00 0.00 ? 101 PRO A HG2  4  
ATOM 6753  H HG3  . PRO A 1 101 ? 3.314   -6.969  1.516   1.00 0.00 ? 101 PRO A HG3  4  
ATOM 6754  H HD2  . PRO A 1 101 ? 2.644   -6.028  -1.110  1.00 0.00 ? 101 PRO A HD2  4  
ATOM 6755  H HD3  . PRO A 1 101 ? 2.202   -5.285  0.414   1.00 0.00 ? 101 PRO A HD3  4  
ATOM 6756  N N    . HIS A 1 102 ? 6.246   -4.279  -2.187  1.00 0.00 ? 102 HIS A N    4  
ATOM 6757  C CA   . HIS A 1 102 ? 6.998   -4.407  -3.423  1.00 0.00 ? 102 HIS A CA   4  
ATOM 6758  C C    . HIS A 1 102 ? 7.340   -3.016  -3.962  1.00 0.00 ? 102 HIS A C    4  
ATOM 6759  O O    . HIS A 1 102 ? 7.059   -2.709  -5.119  1.00 0.00 ? 102 HIS A O    4  
ATOM 6760  C CB   . HIS A 1 102 ? 6.237   -5.265  -4.436  1.00 0.00 ? 102 HIS A CB   4  
ATOM 6761  C CG   . HIS A 1 102 ? 6.800   -6.655  -4.609  1.00 0.00 ? 102 HIS A CG   4  
ATOM 6762  N ND1  . HIS A 1 102 ? 6.110   -7.669  -5.250  1.00 0.00 ? 102 HIS A ND1  4  
ATOM 6763  C CD2  . HIS A 1 102 ? 7.994   -7.189  -4.219  1.00 0.00 ? 102 HIS A CD2  4  
ATOM 6764  C CE1  . HIS A 1 102 ? 6.863   -8.759  -5.239  1.00 0.00 ? 102 HIS A CE1  4  
ATOM 6765  N NE2  . HIS A 1 102 ? 8.030   -8.459  -4.600  1.00 0.00 ? 102 HIS A NE2  4  
ATOM 6766  H H    . HIS A 1 102 ? 5.770   -3.407  -2.070  1.00 0.00 ? 102 HIS A H    4  
ATOM 6767  H HA   . HIS A 1 102 ? 7.923   -4.928  -3.174  1.00 0.00 ? 102 HIS A HA   4  
ATOM 6768  H HB2  . HIS A 1 102 ? 5.196   -5.342  -4.122  1.00 0.00 ? 102 HIS A HB2  4  
ATOM 6769  H HB3  . HIS A 1 102 ? 6.243   -4.759  -5.402  1.00 0.00 ? 102 HIS A HB3  4  
ATOM 6770  H HD1  . HIS A 1 102 ? 5.198   -7.592  -5.652  1.00 0.00 ? 102 HIS A HD1  4  
ATOM 6771  H HD2  . HIS A 1 102 ? 8.784   -6.660  -3.685  1.00 0.00 ? 102 HIS A HD2  4  
ATOM 6772  H HE1  . HIS A 1 102 ? 6.597   -9.726  -5.667  1.00 0.00 ? 102 HIS A HE1  4  
ATOM 6773  N N    . VAL A 1 103 ? 7.941   -2.213  -3.097  1.00 0.00 ? 103 VAL A N    4  
ATOM 6774  C CA   . VAL A 1 103 ? 8.324   -0.862  -3.471  1.00 0.00 ? 103 VAL A CA   4  
ATOM 6775  C C    . VAL A 1 103 ? 9.253   -0.285  -2.402  1.00 0.00 ? 103 VAL A C    4  
ATOM 6776  O O    . VAL A 1 103 ? 8.840   -0.078  -1.262  1.00 0.00 ? 103 VAL A O    4  
ATOM 6777  C CB   . VAL A 1 103 ? 7.075   -0.009  -3.702  1.00 0.00 ? 103 VAL A CB   4  
ATOM 6778  C CG1  . VAL A 1 103 ? 6.103   -0.132  -2.527  1.00 0.00 ? 103 VAL A CG1  4  
ATOM 6779  C CG2  . VAL A 1 103 ? 7.449   1.453   -3.954  1.00 0.00 ? 103 VAL A CG2  4  
ATOM 6780  H H    . VAL A 1 103 ? 8.166   -2.471  -2.157  1.00 0.00 ? 103 VAL A H    4  
ATOM 6781  H HA   . VAL A 1 103 ? 8.869   -0.924  -4.413  1.00 0.00 ? 103 VAL A HA   4  
ATOM 6782  H HB   . VAL A 1 103 ? 6.573   -0.384  -4.594  1.00 0.00 ? 103 VAL A HB   4  
ATOM 6783  H HG11 . VAL A 1 103 ? 6.301   0.662   -1.807  1.00 0.00 ? 103 VAL A HG11 4  
ATOM 6784  H HG12 . VAL A 1 103 ? 5.079   -0.045  -2.892  1.00 0.00 ? 103 VAL A HG12 4  
ATOM 6785  H HG13 . VAL A 1 103 ? 6.235   -1.101  -2.046  1.00 0.00 ? 103 VAL A HG13 4  
ATOM 6786  H HG21 . VAL A 1 103 ? 8.457   1.505   -4.365  1.00 0.00 ? 103 VAL A HG21 4  
ATOM 6787  H HG22 . VAL A 1 103 ? 6.745   1.891   -4.661  1.00 0.00 ? 103 VAL A HG22 4  
ATOM 6788  H HG23 . VAL A 1 103 ? 7.411   2.005   -3.014  1.00 0.00 ? 103 VAL A HG23 4  
ATOM 6789  N N    . HIS A 1 104 ? 10.491  -0.042  -2.807  1.00 0.00 ? 104 HIS A N    4  
ATOM 6790  C CA   . HIS A 1 104 ? 11.482  0.507   -1.898  1.00 0.00 ? 104 HIS A CA   4  
ATOM 6791  C C    . HIS A 1 104 ? 12.699  0.986   -2.692  1.00 0.00 ? 104 HIS A C    4  
ATOM 6792  O O    . HIS A 1 104 ? 13.028  2.171   -2.676  1.00 0.00 ? 104 HIS A O    4  
ATOM 6793  C CB   . HIS A 1 104 ? 11.845  -0.508  -0.812  1.00 0.00 ? 104 HIS A CB   4  
ATOM 6794  C CG   . HIS A 1 104 ? 12.798  0.023   0.232   1.00 0.00 ? 104 HIS A CG   4  
ATOM 6795  N ND1  . HIS A 1 104 ? 12.522  1.143   0.998   1.00 0.00 ? 104 HIS A ND1  4  
ATOM 6796  C CD2  . HIS A 1 104 ? 14.024  -0.423  0.630   1.00 0.00 ? 104 HIS A CD2  4  
ATOM 6797  C CE1  . HIS A 1 104 ? 13.543  1.352   1.815   1.00 0.00 ? 104 HIS A CE1  4  
ATOM 6798  N NE2  . HIS A 1 104 ? 14.473  0.381   1.585   1.00 0.00 ? 104 HIS A NE2  4  
ATOM 6799  H H    . HIS A 1 104 ? 10.819  -0.214  -3.736  1.00 0.00 ? 104 HIS A H    4  
ATOM 6800  H HA   . HIS A 1 104 ? 11.018  1.364   -1.409  1.00 0.00 ? 104 HIS A HA   4  
ATOM 6801  H HB2  . HIS A 1 104 ? 10.931  -0.841  -0.320  1.00 0.00 ? 104 HIS A HB2  4  
ATOM 6802  H HB3  . HIS A 1 104 ? 12.291  -1.384  -1.283  1.00 0.00 ? 104 HIS A HB3  4  
ATOM 6803  H HD1  . HIS A 1 104 ? 11.693  1.699   0.943   1.00 0.00 ? 104 HIS A HD1  4  
ATOM 6804  H HD2  . HIS A 1 104 ? 14.545  -1.293  0.230   1.00 0.00 ? 104 HIS A HD2  4  
ATOM 6805  H HE1  . HIS A 1 104 ? 13.626  2.159   2.544   1.00 0.00 ? 104 HIS A HE1  4  
ATOM 6806  N N    . GLN A 1 105 ? 13.333  0.040   -3.369  1.00 0.00 ? 105 GLN A N    4  
ATOM 6807  C CA   . GLN A 1 105 ? 14.506  0.350   -4.169  1.00 0.00 ? 105 GLN A CA   4  
ATOM 6808  C C    . GLN A 1 105 ? 14.225  1.545   -5.082  1.00 0.00 ? 105 GLN A C    4  
ATOM 6809  O O    . GLN A 1 105 ? 13.114  2.074   -5.094  1.00 0.00 ? 105 GLN A O    4  
ATOM 6810  C CB   . GLN A 1 105 ? 14.954  -0.867  -4.981  1.00 0.00 ? 105 GLN A CB   4  
ATOM 6811  C CG   . GLN A 1 105 ? 16.289  -1.408  -4.466  1.00 0.00 ? 105 GLN A CG   4  
ATOM 6812  C CD   . GLN A 1 105 ? 16.595  -2.779  -5.072  1.00 0.00 ? 105 GLN A CD   4  
ATOM 6813  O OE1  . GLN A 1 105 ? 15.980  -3.214  -6.032  1.00 0.00 ? 105 GLN A OE1  4  
ATOM 6814  N NE2  . GLN A 1 105 ? 17.577  -3.435  -4.459  1.00 0.00 ? 105 GLN A NE2  4  
ATOM 6815  H H    . GLN A 1 105 ? 13.058  -0.922  -3.377  1.00 0.00 ? 105 GLN A H    4  
ATOM 6816  H HA   . GLN A 1 105 ? 15.285  0.608   -3.452  1.00 0.00 ? 105 GLN A HA   4  
ATOM 6817  H HB2  . GLN A 1 105 ? 14.194  -1.647  -4.922  1.00 0.00 ? 105 GLN A HB2  4  
ATOM 6818  H HB3  . GLN A 1 105 ? 15.049  -0.593  -6.031  1.00 0.00 ? 105 GLN A HB3  4  
ATOM 6819  H HG2  . GLN A 1 105 ? 17.088  -0.710  -4.715  1.00 0.00 ? 105 GLN A HG2  4  
ATOM 6820  H HG3  . GLN A 1 105 ? 16.260  -1.485  -3.379  1.00 0.00 ? 105 GLN A HG3  4  
ATOM 6821  H HE21 . GLN A 1 105 ? 18.041  -3.021  -3.675  1.00 0.00 ? 105 GLN A HE21 4  
ATOM 6822  H HE22 . GLN A 1 105 ? 17.851  -4.341  -4.781  1.00 0.00 ? 105 GLN A HE22 4  
ATOM 6823  N N    . LEU A 1 106 ? 15.250  1.935   -5.825  1.00 0.00 ? 106 LEU A N    4  
ATOM 6824  C CA   . LEU A 1 106 ? 15.127  3.058   -6.740  1.00 0.00 ? 106 LEU A CA   4  
ATOM 6825  C C    . LEU A 1 106 ? 14.924  4.344   -5.937  1.00 0.00 ? 106 LEU A C    4  
ATOM 6826  O O    . LEU A 1 106 ? 14.622  4.295   -4.745  1.00 0.00 ? 106 LEU A O    4  
ATOM 6827  C CB   . LEU A 1 106 ? 14.024  2.794   -7.767  1.00 0.00 ? 106 LEU A CB   4  
ATOM 6828  C CG   . LEU A 1 106 ? 14.473  2.719   -9.228  1.00 0.00 ? 106 LEU A CG   4  
ATOM 6829  C CD1  . LEU A 1 106 ? 13.398  2.066   -10.099 1.00 0.00 ? 106 LEU A CD1  4  
ATOM 6830  C CD2  . LEU A 1 106 ? 14.872  4.101   -9.750  1.00 0.00 ? 106 LEU A CD2  4  
ATOM 6831  H H    . LEU A 1 106 ? 16.150  1.500   -5.810  1.00 0.00 ? 106 LEU A H    4  
ATOM 6832  H HA   . LEU A 1 106 ? 16.066  3.137   -7.288  1.00 0.00 ? 106 LEU A HA   4  
ATOM 6833  H HB2  . LEU A 1 106 ? 13.533  1.855   -7.510  1.00 0.00 ? 106 LEU A HB2  4  
ATOM 6834  H HB3  . LEU A 1 106 ? 13.275  3.581   -7.677  1.00 0.00 ? 106 LEU A HB3  4  
ATOM 6835  H HG   . LEU A 1 106 ? 15.359  2.087   -9.282  1.00 0.00 ? 106 LEU A HG   4  
ATOM 6836  H HD11 . LEU A 1 106 ? 12.904  1.275   -9.534  1.00 0.00 ? 106 LEU A HD11 4  
ATOM 6837  H HD12 . LEU A 1 106 ? 12.664  2.815   -10.393 1.00 0.00 ? 106 LEU A HD12 4  
ATOM 6838  H HD13 . LEU A 1 106 ? 13.861  1.641   -10.990 1.00 0.00 ? 106 LEU A HD13 4  
ATOM 6839  H HD21 . LEU A 1 106 ? 15.812  4.406   -9.290  1.00 0.00 ? 106 LEU A HD21 4  
ATOM 6840  H HD22 . LEU A 1 106 ? 14.994  4.059   -10.833 1.00 0.00 ? 106 LEU A HD22 4  
ATOM 6841  H HD23 . LEU A 1 106 ? 14.094  4.822   -9.500  1.00 0.00 ? 106 LEU A HD23 4  
ATOM 6842  N N    . SER A 1 107 ? 15.098  5.465   -6.621  1.00 0.00 ? 107 SER A N    4  
ATOM 6843  C CA   . SER A 1 107 ? 14.937  6.762   -5.987  1.00 0.00 ? 107 SER A CA   4  
ATOM 6844  C C    . SER A 1 107 ? 15.959  6.923   -4.859  1.00 0.00 ? 107 SER A C    4  
ATOM 6845  O O    . SER A 1 107 ? 17.019  7.513   -5.057  1.00 0.00 ? 107 SER A O    4  
ATOM 6846  C CB   . SER A 1 107 ? 13.517  6.939   -5.446  1.00 0.00 ? 107 SER A CB   4  
ATOM 6847  O OG   . SER A 1 107 ? 13.453  7.938   -4.431  1.00 0.00 ? 107 SER A OG   4  
ATOM 6848  H H    . SER A 1 107 ? 15.344  5.496   -7.590  1.00 0.00 ? 107 SER A H    4  
ATOM 6849  H HA   . SER A 1 107 ? 15.119  7.493   -6.774  1.00 0.00 ? 107 SER A HA   4  
ATOM 6850  H HB2  . SER A 1 107 ? 12.849  7.209   -6.264  1.00 0.00 ? 107 SER A HB2  4  
ATOM 6851  H HB3  . SER A 1 107 ? 13.161  5.990   -5.044  1.00 0.00 ? 107 SER A HB3  4  
ATOM 6852  H HG   . SER A 1 107 ? 13.418  8.846   -4.847  1.00 0.00 ? 107 SER A HG   4  
ATOM 6853  N N    . SER A 1 108 ? 15.603  6.387   -3.701  1.00 0.00 ? 108 SER A N    4  
ATOM 6854  C CA   . SER A 1 108 ? 16.475  6.464   -2.541  1.00 0.00 ? 108 SER A CA   4  
ATOM 6855  C C    . SER A 1 108 ? 16.265  7.794   -1.815  1.00 0.00 ? 108 SER A C    4  
ATOM 6856  O O    . SER A 1 108 ? 15.804  8.765   -2.413  1.00 0.00 ? 108 SER A O    4  
ATOM 6857  C CB   . SER A 1 108 ? 17.942  6.305   -2.944  1.00 0.00 ? 108 SER A CB   4  
ATOM 6858  O OG   . SER A 1 108 ? 18.705  5.648   -1.935  1.00 0.00 ? 108 SER A OG   4  
ATOM 6859  H H    . SER A 1 108 ? 14.738  5.909   -3.548  1.00 0.00 ? 108 SER A H    4  
ATOM 6860  H HA   . SER A 1 108 ? 16.181  5.630   -1.904  1.00 0.00 ? 108 SER A HA   4  
ATOM 6861  H HB2  . SER A 1 108 ? 18.004  5.736   -3.872  1.00 0.00 ? 108 SER A HB2  4  
ATOM 6862  H HB3  . SER A 1 108 ? 18.372  7.286   -3.143  1.00 0.00 ? 108 SER A HB3  4  
ATOM 6863  H HG   . SER A 1 108 ? 18.277  5.783   -1.041  1.00 0.00 ? 108 SER A HG   4  
ATOM 6864  N N    . HIS A 1 109 ? 16.614  7.796   -0.537  1.00 0.00 ? 109 HIS A N    4  
ATOM 6865  C CA   . HIS A 1 109 ? 16.469  8.991   0.277   1.00 0.00 ? 109 HIS A CA   4  
ATOM 6866  C C    . HIS A 1 109 ? 17.850  9.479   0.721   1.00 0.00 ? 109 HIS A C    4  
ATOM 6867  O O    . HIS A 1 109 ? 18.596  8.742   1.363   1.00 0.00 ? 109 HIS A O    4  
ATOM 6868  C CB   . HIS A 1 109 ? 15.524  8.737   1.452   1.00 0.00 ? 109 HIS A CB   4  
ATOM 6869  C CG   . HIS A 1 109 ? 14.339  9.672   1.500   1.00 0.00 ? 109 HIS A CG   4  
ATOM 6870  N ND1  . HIS A 1 109 ? 14.377  10.898  2.140   1.00 0.00 ? 109 HIS A ND1  4  
ATOM 6871  C CD2  . HIS A 1 109 ? 13.084  9.547   0.981   1.00 0.00 ? 109 HIS A CD2  4  
ATOM 6872  C CE1  . HIS A 1 109 ? 13.192  11.477  2.007   1.00 0.00 ? 109 HIS A CE1  4  
ATOM 6873  N NE2  . HIS A 1 109 ? 12.392  10.637  1.288   1.00 0.00 ? 109 HIS A NE2  4  
ATOM 6874  H H    . HIS A 1 109 ? 16.988  7.002   -0.058  1.00 0.00 ? 109 HIS A H    4  
ATOM 6875  H HA   . HIS A 1 109 ? 16.013  9.749   -0.360  1.00 0.00 ? 109 HIS A HA   4  
ATOM 6876  H HB2  . HIS A 1 109 ? 15.162  7.710   1.399   1.00 0.00 ? 109 HIS A HB2  4  
ATOM 6877  H HB3  . HIS A 1 109 ? 16.084  8.829   2.383   1.00 0.00 ? 109 HIS A HB3  4  
ATOM 6878  H HD1  . HIS A 1 109 ? 15.164  11.283  2.622   1.00 0.00 ? 109 HIS A HD1  4  
ATOM 6879  H HD2  . HIS A 1 109 ? 12.712  8.696   0.411   1.00 0.00 ? 109 HIS A HD2  4  
ATOM 6880  H HE1  . HIS A 1 109 ? 12.907  12.452  2.401   1.00 0.00 ? 109 HIS A HE1  4  
ATOM 6881  N N    . SER A 1 110 ? 18.147  10.719  0.361   1.00 0.00 ? 110 SER A N    4  
ATOM 6882  C CA   . SER A 1 110 ? 19.425  11.315  0.714   1.00 0.00 ? 110 SER A CA   4  
ATOM 6883  C C    . SER A 1 110 ? 19.733  11.055  2.190   1.00 0.00 ? 110 SER A C    4  
ATOM 6884  O O    . SER A 1 110 ? 19.234  11.759  3.066   1.00 0.00 ? 110 SER A O    4  
ATOM 6885  C CB   . SER A 1 110 ? 19.429  12.818  0.428   1.00 0.00 ? 110 SER A CB   4  
ATOM 6886  O OG   . SER A 1 110 ? 20.531  13.202  -0.390  1.00 0.00 ? 110 SER A OG   4  
ATOM 6887  H H    . SER A 1 110 ? 17.534  11.312  -0.161  1.00 0.00 ? 110 SER A H    4  
ATOM 6888  H HA   . SER A 1 110 ? 20.159  10.822  0.077   1.00 0.00 ? 110 SER A HA   4  
ATOM 6889  H HB2  . SER A 1 110 ? 18.498  13.096  -0.065  1.00 0.00 ? 110 SER A HB2  4  
ATOM 6890  H HB3  . SER A 1 110 ? 19.468  13.366  1.369   1.00 0.00 ? 110 SER A HB3  4  
ATOM 6891  H HG   . SER A 1 110 ? 21.341  13.354  0.177   1.00 0.00 ? 110 SER A HG   4  
ATOM 6892  N N    . ARG A 1 111 ? 20.554  10.040  2.420   1.00 0.00 ? 111 ARG A N    4  
ATOM 6893  C CA   . ARG A 1 111 ? 20.935  9.678   3.774   1.00 0.00 ? 111 ARG A CA   4  
ATOM 6894  C C    . ARG A 1 111 ? 22.324  10.229  4.100   1.00 0.00 ? 111 ARG A C    4  
ATOM 6895  O O    . ARG A 1 111 ? 23.290  9.944   3.394   1.00 0.00 ? 111 ARG A O    4  
ATOM 6896  C CB   . ARG A 1 111 ? 20.940  8.159   3.958   1.00 0.00 ? 111 ARG A CB   4  
ATOM 6897  C CG   . ARG A 1 111 ? 19.766  7.708   4.828   1.00 0.00 ? 111 ARG A CG   4  
ATOM 6898  C CD   . ARG A 1 111 ? 20.187  6.584   5.778   1.00 0.00 ? 111 ARG A CD   4  
ATOM 6899  N NE   . ARG A 1 111 ? 19.307  5.408   5.593   1.00 0.00 ? 111 ARG A NE   4  
ATOM 6900  C CZ   . ARG A 1 111 ? 19.573  4.188   6.077   1.00 0.00 ? 111 ARG A CZ   4  
ATOM 6901  N NH1  . ARG A 1 111 ? 20.695  3.975   6.778   1.00 0.00 ? 111 ARG A NH1  4  
ATOM 6902  N NH2  . ARG A 1 111 ? 18.717  3.180   5.860   1.00 0.00 ? 111 ARG A NH2  4  
ATOM 6903  H H    . ARG A 1 111 ? 20.955  9.472   1.702   1.00 0.00 ? 111 ARG A H    4  
ATOM 6904  H HA   . ARG A 1 111 ? 20.174  10.133  4.409   1.00 0.00 ? 111 ARG A HA   4  
ATOM 6905  H HB2  . ARG A 1 111 ? 20.884  7.671   2.984   1.00 0.00 ? 111 ARG A HB2  4  
ATOM 6906  H HB3  . ARG A 1 111 ? 21.878  7.848   4.417   1.00 0.00 ? 111 ARG A HB3  4  
ATOM 6907  H HG2  . ARG A 1 111 ? 19.389  8.553   5.404   1.00 0.00 ? 111 ARG A HG2  4  
ATOM 6908  H HG3  . ARG A 1 111 ? 18.948  7.365   4.194   1.00 0.00 ? 111 ARG A HG3  4  
ATOM 6909  H HD2  . ARG A 1 111 ? 21.224  6.306   5.588   1.00 0.00 ? 111 ARG A HD2  4  
ATOM 6910  H HD3  . ARG A 1 111 ? 20.133  6.930   6.810   1.00 0.00 ? 111 ARG A HD3  4  
ATOM 6911  H HE   . ARG A 1 111 ? 18.462  5.533   5.074   1.00 0.00 ? 111 ARG A HE   4  
ATOM 6912  H HH11 . ARG A 1 111 ? 21.334  4.727   6.940   1.00 0.00 ? 111 ARG A HH11 4  
ATOM 6913  H HH12 . ARG A 1 111 ? 20.894  3.064   7.139   1.00 0.00 ? 111 ARG A HH12 4  
ATOM 6914  H HH21 . ARG A 1 111 ? 17.880  3.339   5.336   1.00 0.00 ? 111 ARG A HH21 4  
ATOM 6915  H HH22 . ARG A 1 111 ? 18.916  2.269   6.221   1.00 0.00 ? 111 ARG A HH22 4  
ATOM 6916  N N    . SER A 1 112 ? 22.381  11.008  5.170   1.00 0.00 ? 112 SER A N    4  
ATOM 6917  C CA   . SER A 1 112 ? 23.636  11.602  5.598   1.00 0.00 ? 112 SER A CA   4  
ATOM 6918  C C    . SER A 1 112 ? 24.492  10.556  6.316   1.00 0.00 ? 112 SER A C    4  
ATOM 6919  O O    . SER A 1 112 ? 23.966  9.590   6.866   1.00 0.00 ? 112 SER A O    4  
ATOM 6920  C CB   . SER A 1 112 ? 23.394  12.806  6.511   1.00 0.00 ? 112 SER A CB   4  
ATOM 6921  O OG   . SER A 1 112 ? 23.202  12.417  7.868   1.00 0.00 ? 112 SER A OG   4  
ATOM 6922  H H    . SER A 1 112 ? 21.590  11.236  5.739   1.00 0.00 ? 112 SER A H    4  
ATOM 6923  H HA   . SER A 1 112 ? 24.126  11.934  4.683   1.00 0.00 ? 112 SER A HA   4  
ATOM 6924  H HB2  . SER A 1 112 ? 24.242  13.487  6.445   1.00 0.00 ? 112 SER A HB2  4  
ATOM 6925  H HB3  . SER A 1 112 ? 22.517  13.353  6.164   1.00 0.00 ? 112 SER A HB3  4  
ATOM 6926  H HG   . SER A 1 112 ? 22.569  13.046  8.318   1.00 0.00 ? 112 SER A HG   4  
ATOM 6927  N N    . GLY A 1 113 ? 25.797  10.784  6.286   1.00 0.00 ? 113 GLY A N    4  
ATOM 6928  C CA   . GLY A 1 113 ? 26.730  9.873   6.927   1.00 0.00 ? 113 GLY A CA   4  
ATOM 6929  C C    . GLY A 1 113 ? 26.877  10.196  8.416   1.00 0.00 ? 113 GLY A C    4  
ATOM 6930  O O    . GLY A 1 113 ? 26.286  9.526   9.261   1.00 0.00 ? 113 GLY A O    4  
ATOM 6931  H H    . GLY A 1 113 ? 26.217  11.572  5.837   1.00 0.00 ? 113 GLY A H    4  
ATOM 6932  H HA2  . GLY A 1 113 ? 26.383  8.847   6.806   1.00 0.00 ? 113 GLY A HA2  4  
ATOM 6933  H HA3  . GLY A 1 113 ? 27.702  9.941   6.439   1.00 0.00 ? 113 GLY A HA3  4  
ATOM 6934  N N    . PRO A 1 114 ? 27.688  11.250  8.698   1.00 0.00 ? 114 PRO A N    4  
ATOM 6935  C CA   . PRO A 1 114 ? 27.920  11.670  10.070  1.00 0.00 ? 114 PRO A CA   4  
ATOM 6936  C C    . PRO A 1 114 ? 26.705  12.412  10.629  1.00 0.00 ? 114 PRO A C    4  
ATOM 6937  O O    . PRO A 1 114 ? 26.654  13.641  10.596  1.00 0.00 ? 114 PRO A O    4  
ATOM 6938  C CB   . PRO A 1 114 ? 29.169  12.535  10.011  1.00 0.00 ? 114 PRO A CB   4  
ATOM 6939  C CG   . PRO A 1 114 ? 29.322  12.947  8.556   1.00 0.00 ? 114 PRO A CG   4  
ATOM 6940  C CD   . PRO A 1 114 ? 28.405  12.067  7.723   1.00 0.00 ? 114 PRO A CD   4  
ATOM 6941  H HA   . PRO A 1 114 ? 28.049  10.873  10.660  1.00 0.00 ? 114 PRO A HA   4  
ATOM 6942  H HB2  . PRO A 1 114 ? 29.070  13.408  10.656  1.00 0.00 ? 114 PRO A HB2  4  
ATOM 6943  H HB3  . PRO A 1 114 ? 30.043  11.982  10.354  1.00 0.00 ? 114 PRO A HB3  4  
ATOM 6944  H HG2  . PRO A 1 114 ? 29.062  13.998  8.428   1.00 0.00 ? 114 PRO A HG2  4  
ATOM 6945  H HG3  . PRO A 1 114 ? 30.357  12.834  8.233   1.00 0.00 ? 114 PRO A HG3  4  
ATOM 6946  H HD2  . PRO A 1 114 ? 27.716  12.665  7.126   1.00 0.00 ? 114 PRO A HD2  4  
ATOM 6947  H HD3  . PRO A 1 114 ? 28.973  11.448  7.029   1.00 0.00 ? 114 PRO A HD3  4  
ATOM 6948  N N    . SER A 1 115 ? 25.755  11.635  11.129  1.00 0.00 ? 115 SER A N    4  
ATOM 6949  C CA   . SER A 1 115 ? 24.543  12.203  11.694  1.00 0.00 ? 115 SER A CA   4  
ATOM 6950  C C    . SER A 1 115 ? 24.735  12.462  13.190  1.00 0.00 ? 115 SER A C    4  
ATOM 6951  O O    . SER A 1 115 ? 23.810  12.899  13.872  1.00 0.00 ? 115 SER A O    4  
ATOM 6952  C CB   . SER A 1 115 ? 23.344  11.281  11.465  1.00 0.00 ? 115 SER A CB   4  
ATOM 6953  O OG   . SER A 1 115 ? 23.741  9.927   11.270  1.00 0.00 ? 115 SER A OG   4  
ATOM 6954  H H    . SER A 1 115 ? 25.805  10.636  11.152  1.00 0.00 ? 115 SER A H    4  
ATOM 6955  H HA   . SER A 1 115 ? 24.388  13.140  11.160  1.00 0.00 ? 115 SER A HA   4  
ATOM 6956  H HB2  . SER A 1 115 ? 22.671  11.342  12.321  1.00 0.00 ? 115 SER A HB2  4  
ATOM 6957  H HB3  . SER A 1 115 ? 22.784  11.624  10.595  1.00 0.00 ? 115 SER A HB3  4  
ATOM 6958  H HG   . SER A 1 115 ? 23.794  9.455   12.151  1.00 0.00 ? 115 SER A HG   4  
ATOM 6959  N N    . SER A 1 116 ? 25.944  12.182  13.656  1.00 0.00 ? 116 SER A N    4  
ATOM 6960  C CA   . SER A 1 116 ? 26.269  12.380  15.059  1.00 0.00 ? 116 SER A CA   4  
ATOM 6961  C C    . SER A 1 116 ? 27.737  12.783  15.203  1.00 0.00 ? 116 SER A C    4  
ATOM 6962  O O    . SER A 1 116 ? 28.577  12.381  14.400  1.00 0.00 ? 116 SER A O    4  
ATOM 6963  C CB   . SER A 1 116 ? 25.983  11.117  15.874  1.00 0.00 ? 116 SER A CB   4  
ATOM 6964  O OG   . SER A 1 116 ? 24.593  10.803  15.902  1.00 0.00 ? 116 SER A OG   4  
ATOM 6965  H H    . SER A 1 116 ? 26.691  11.827  13.095  1.00 0.00 ? 116 SER A H    4  
ATOM 6966  H HA   . SER A 1 116 ? 25.616  13.185  15.396  1.00 0.00 ? 116 SER A HA   4  
ATOM 6967  H HB2  . SER A 1 116 ? 26.535  10.278  15.449  1.00 0.00 ? 116 SER A HB2  4  
ATOM 6968  H HB3  . SER A 1 116 ? 26.345  11.253  16.893  1.00 0.00 ? 116 SER A HB3  4  
ATOM 6969  H HG   . SER A 1 116 ? 24.450  9.855   15.619  1.00 0.00 ? 116 SER A HG   4  
ATOM 6970  N N    . GLY A 1 117 ? 28.002  13.573  16.234  1.00 0.00 ? 117 GLY A N    4  
ATOM 6971  C CA   . GLY A 1 117 ? 29.355  14.036  16.494  1.00 0.00 ? 117 GLY A CA   4  
ATOM 6972  C C    . GLY A 1 117 ? 29.776  15.099  15.477  1.00 0.00 ? 117 GLY A C    4  
ATOM 6973  O O    . GLY A 1 117 ? 28.987  15.488  14.617  1.00 0.00 ? 117 GLY A O    4  
ATOM 6974  H H    . GLY A 1 117 ? 27.313  13.896  16.882  1.00 0.00 ? 117 GLY A H    4  
ATOM 6975  H HA2  . GLY A 1 117 ? 29.414  14.448  17.501  1.00 0.00 ? 117 GLY A HA2  4  
ATOM 6976  H HA3  . GLY A 1 117 ? 30.045  13.194  16.452  1.00 0.00 ? 117 GLY A HA3  4  
ATOM 6977  N N    . GLY A 1 1   ? -8.501  -11.566 -21.598 1.00 0.00 ? 1   GLY A N    5  
ATOM 6978  C CA   . GLY A 1 1   ? -9.491  -10.512 -21.453 1.00 0.00 ? 1   GLY A CA   5  
ATOM 6979  C C    . GLY A 1 1   ? -10.129 -10.547 -20.063 1.00 0.00 ? 1   GLY A C    5  
ATOM 6980  O O    . GLY A 1 1   ? -9.602  -9.960  -19.119 1.00 0.00 ? 1   GLY A O    5  
ATOM 6981  H H1   . GLY A 1 1   ? -7.581  -11.327 -21.287 1.00 0.00 ? 1   GLY A H1   5  
ATOM 6982  H HA2  . GLY A 1 1   ? -9.022  -9.543  -21.618 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6983  H HA3  . GLY A 1 1   ? -10.263 -10.627 -22.214 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6984  N N    . SER A 1 2   ? -11.254 -11.241 -19.980 1.00 0.00 ? 2   SER A N    5  
ATOM 6985  C CA   . SER A 1 2   ? -11.969 -11.360 -18.721 1.00 0.00 ? 2   SER A CA   5  
ATOM 6986  C C    . SER A 1 2   ? -11.189 -12.258 -17.759 1.00 0.00 ? 2   SER A C    5  
ATOM 6987  O O    . SER A 1 2   ? -10.279 -12.975 -18.173 1.00 0.00 ? 2   SER A O    5  
ATOM 6988  C CB   . SER A 1 2   ? -13.379 -11.914 -18.938 1.00 0.00 ? 2   SER A CB   5  
ATOM 6989  O OG   . SER A 1 2   ? -14.326 -10.879 -19.188 1.00 0.00 ? 2   SER A OG   5  
ATOM 6990  H H    . SER A 1 2   ? -11.676 -11.716 -20.752 1.00 0.00 ? 2   SER A H    5  
ATOM 6991  H HA   . SER A 1 2   ? -12.035 -10.345 -18.329 1.00 0.00 ? 2   SER A HA   5  
ATOM 6992  H HB2  . SER A 1 2   ? -13.371 -12.608 -19.779 1.00 0.00 ? 2   SER A HB2  5  
ATOM 6993  H HB3  . SER A 1 2   ? -13.685 -12.481 -18.059 1.00 0.00 ? 2   SER A HB3  5  
ATOM 6994  H HG   . SER A 1 2   ? -15.251 -11.207 -18.993 1.00 0.00 ? 2   SER A HG   5  
ATOM 6995  N N    . SER A 1 3   ? -11.574 -12.190 -16.493 1.00 0.00 ? 3   SER A N    5  
ATOM 6996  C CA   . SER A 1 3   ? -10.922 -12.989 -15.468 1.00 0.00 ? 3   SER A CA   5  
ATOM 6997  C C    . SER A 1 3   ? -11.967 -13.568 -14.513 1.00 0.00 ? 3   SER A C    5  
ATOM 6998  O O    . SER A 1 3   ? -12.063 -14.785 -14.357 1.00 0.00 ? 3   SER A O    5  
ATOM 6999  C CB   . SER A 1 3   ? -9.896  -12.159 -14.694 1.00 0.00 ? 3   SER A CB   5  
ATOM 7000  O OG   . SER A 1 3   ? -8.637  -12.819 -14.599 1.00 0.00 ? 3   SER A OG   5  
ATOM 7001  H H    . SER A 1 3   ? -12.315 -11.605 -16.164 1.00 0.00 ? 3   SER A H    5  
ATOM 7002  H HA   . SER A 1 3   ? -10.411 -13.787 -16.006 1.00 0.00 ? 3   SER A HA   5  
ATOM 7003  H HB2  . SER A 1 3   ? -9.764  -11.195 -15.185 1.00 0.00 ? 3   SER A HB2  5  
ATOM 7004  H HB3  . SER A 1 3   ? -10.275 -11.957 -13.692 1.00 0.00 ? 3   SER A HB3  5  
ATOM 7005  H HG   . SER A 1 3   ? -7.992  -12.420 -15.251 1.00 0.00 ? 3   SER A HG   5  
ATOM 7006  N N    . GLY A 1 4   ? -12.722 -12.670 -13.898 1.00 0.00 ? 4   GLY A N    5  
ATOM 7007  C CA   . GLY A 1 4   ? -13.756 -13.078 -12.962 1.00 0.00 ? 4   GLY A CA   5  
ATOM 7008  C C    . GLY A 1 4   ? -14.644 -11.893 -12.575 1.00 0.00 ? 4   GLY A C    5  
ATOM 7009  O O    . GLY A 1 4   ? -14.143 -10.840 -12.182 1.00 0.00 ? 4   GLY A O    5  
ATOM 7010  H H    . GLY A 1 4   ? -12.638 -11.683 -14.030 1.00 0.00 ? 4   GLY A H    5  
ATOM 7011  H HA2  . GLY A 1 4   ? -14.367 -13.863 -13.407 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7012  H HA3  . GLY A 1 4   ? -13.297 -13.499 -12.068 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7013  N N    . SER A 1 5   ? -15.946 -12.104 -12.700 1.00 0.00 ? 5   SER A N    5  
ATOM 7014  C CA   . SER A 1 5   ? -16.907 -11.066 -12.369 1.00 0.00 ? 5   SER A CA   5  
ATOM 7015  C C    . SER A 1 5   ? -18.053 -11.658 -11.545 1.00 0.00 ? 5   SER A C    5  
ATOM 7016  O O    . SER A 1 5   ? -18.306 -11.220 -10.423 1.00 0.00 ? 5   SER A O    5  
ATOM 7017  C CB   . SER A 1 5   ? -17.453 -10.397 -13.632 1.00 0.00 ? 5   SER A CB   5  
ATOM 7018  O OG   . SER A 1 5   ? -16.967 -9.066  -13.783 1.00 0.00 ? 5   SER A OG   5  
ATOM 7019  H H    . SER A 1 5   ? -16.345 -12.963 -13.021 1.00 0.00 ? 5   SER A H    5  
ATOM 7020  H HA   . SER A 1 5   ? -16.352 -10.335 -11.782 1.00 0.00 ? 5   SER A HA   5  
ATOM 7021  H HB2  . SER A 1 5   ? -17.172 -10.987 -14.505 1.00 0.00 ? 5   SER A HB2  5  
ATOM 7022  H HB3  . SER A 1 5   ? -18.542 -10.383 -13.593 1.00 0.00 ? 5   SER A HB3  5  
ATOM 7023  H HG   . SER A 1 5   ? -17.556 -8.428  -13.288 1.00 0.00 ? 5   SER A HG   5  
ATOM 7024  N N    . SER A 1 6   ? -18.714 -12.643 -12.133 1.00 0.00 ? 6   SER A N    5  
ATOM 7025  C CA   . SER A 1 6   ? -19.827 -13.300 -11.467 1.00 0.00 ? 6   SER A CA   5  
ATOM 7026  C C    . SER A 1 6   ? -19.739 -14.814 -11.670 1.00 0.00 ? 6   SER A C    5  
ATOM 7027  O O    . SER A 1 6   ? -20.169 -15.331 -12.699 1.00 0.00 ? 6   SER A O    5  
ATOM 7028  C CB   . SER A 1 6   ? -21.167 -12.772 -11.984 1.00 0.00 ? 6   SER A CB   5  
ATOM 7029  O OG   . SER A 1 6   ? -22.063 -12.458 -10.921 1.00 0.00 ? 6   SER A OG   5  
ATOM 7030  H H    . SER A 1 6   ? -18.502 -12.993 -13.045 1.00 0.00 ? 6   SER A H    5  
ATOM 7031  H HA   . SER A 1 6   ? -19.721 -13.048 -10.412 1.00 0.00 ? 6   SER A HA   5  
ATOM 7032  H HB2  . SER A 1 6   ? -20.997 -11.881 -12.589 1.00 0.00 ? 6   SER A HB2  5  
ATOM 7033  H HB3  . SER A 1 6   ? -21.623 -13.517 -12.635 1.00 0.00 ? 6   SER A HB3  5  
ATOM 7034  H HG   . SER A 1 6   ? -22.519 -13.289 -10.602 1.00 0.00 ? 6   SER A HG   5  
ATOM 7035  N N    . GLY A 1 7   ? -19.178 -15.481 -10.672 1.00 0.00 ? 7   GLY A N    5  
ATOM 7036  C CA   . GLY A 1 7   ? -19.028 -16.925 -10.728 1.00 0.00 ? 7   GLY A CA   5  
ATOM 7037  C C    . GLY A 1 7   ? -19.958 -17.612 -9.725  1.00 0.00 ? 7   GLY A C    5  
ATOM 7038  O O    . GLY A 1 7   ? -20.962 -18.207 -10.112 1.00 0.00 ? 7   GLY A O    5  
ATOM 7039  H H    . GLY A 1 7   ? -18.831 -15.052 -9.838  1.00 0.00 ? 7   GLY A H    5  
ATOM 7040  H HA2  . GLY A 1 7   ? -19.249 -17.278 -11.735 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7041  H HA3  . GLY A 1 7   ? -17.994 -17.195 -10.515 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7042  N N    . GLY A 1 8   ? -19.589 -17.506 -8.457  1.00 0.00 ? 8   GLY A N    5  
ATOM 7043  C CA   . GLY A 1 8   ? -20.377 -18.110 -7.396  1.00 0.00 ? 8   GLY A CA   5  
ATOM 7044  C C    . GLY A 1 8   ? -19.549 -18.268 -6.120  1.00 0.00 ? 8   GLY A C    5  
ATOM 7045  O O    . GLY A 1 8   ? -19.519 -17.371 -5.279  1.00 0.00 ? 8   GLY A O    5  
ATOM 7046  H H    . GLY A 1 8   ? -18.771 -17.020 -8.151  1.00 0.00 ? 8   GLY A H    5  
ATOM 7047  H HA2  . GLY A 1 8   ? -21.252 -17.493 -7.192  1.00 0.00 ? 8   GLY A HA2  5  
ATOM 7048  H HA3  . GLY A 1 8   ? -20.743 -19.085 -7.720  1.00 0.00 ? 8   GLY A HA3  5  
ATOM 7049  N N    . GLU A 1 9   ? -18.896 -19.417 -6.015  1.00 0.00 ? 9   GLU A N    5  
ATOM 7050  C CA   . GLU A 1 9   ? -18.069 -19.704 -4.855  1.00 0.00 ? 9   GLU A CA   5  
ATOM 7051  C C    . GLU A 1 9   ? -16.591 -19.502 -5.194  1.00 0.00 ? 9   GLU A C    5  
ATOM 7052  O O    . GLU A 1 9   ? -16.176 -19.721 -6.331  1.00 0.00 ? 9   GLU A O    5  
ATOM 7053  C CB   . GLU A 1 9   ? -18.325 -21.121 -4.337  1.00 0.00 ? 9   GLU A CB   5  
ATOM 7054  C CG   . GLU A 1 9   ? -19.644 -21.194 -3.566  1.00 0.00 ? 9   GLU A CG   5  
ATOM 7055  C CD   . GLU A 1 9   ? -20.430 -22.451 -3.941  1.00 0.00 ? 9   GLU A CD   5  
ATOM 7056  O OE1  . GLU A 1 9   ? -20.635 -22.651 -5.158  1.00 0.00 ? 9   GLU A OE1  5  
ATOM 7057  O OE2  . GLU A 1 9   ? -20.808 -23.185 -3.002  1.00 0.00 ? 9   GLU A OE2  5  
ATOM 7058  H H    . GLU A 1 9   ? -18.926 -20.142 -6.703  1.00 0.00 ? 9   GLU A H    5  
ATOM 7059  H HA   . GLU A 1 9   ? -18.376 -18.985 -4.095  1.00 0.00 ? 9   GLU A HA   5  
ATOM 7060  H HB2  . GLU A 1 9   ? -18.350 -21.819 -5.174  1.00 0.00 ? 9   GLU A HB2  5  
ATOM 7061  H HB3  . GLU A 1 9   ? -17.503 -21.429 -3.690  1.00 0.00 ? 9   GLU A HB3  5  
ATOM 7062  H HG2  . GLU A 1 9   ? -19.444 -21.192 -2.494  1.00 0.00 ? 9   GLU A HG2  5  
ATOM 7063  H HG3  . GLU A 1 9   ? -20.243 -20.309 -3.779  1.00 0.00 ? 9   GLU A HG3  5  
ATOM 7064  N N    . ARG A 1 10  ? -15.837 -19.087 -4.186  1.00 0.00 ? 10  ARG A N    5  
ATOM 7065  C CA   . ARG A 1 10  ? -14.414 -18.853 -4.363  1.00 0.00 ? 10  ARG A CA   5  
ATOM 7066  C C    . ARG A 1 10  ? -13.636 -19.377 -3.155  1.00 0.00 ? 10  ARG A C    5  
ATOM 7067  O O    . ARG A 1 10  ? -14.132 -19.344 -2.030  1.00 0.00 ? 10  ARG A O    5  
ATOM 7068  C CB   . ARG A 1 10  ? -14.119 -17.362 -4.544  1.00 0.00 ? 10  ARG A CB   5  
ATOM 7069  C CG   . ARG A 1 10  ? -14.537 -16.885 -5.936  1.00 0.00 ? 10  ARG A CG   5  
ATOM 7070  C CD   . ARG A 1 10  ? -13.313 -16.609 -6.811  1.00 0.00 ? 10  ARG A CD   5  
ATOM 7071  N NE   . ARG A 1 10  ? -13.701 -15.786 -7.978  1.00 0.00 ? 10  ARG A NE   5  
ATOM 7072  C CZ   . ARG A 1 10  ? -12.849 -15.023 -8.677  1.00 0.00 ? 10  ARG A CZ   5  
ATOM 7073  N NH1  . ARG A 1 10  ? -11.555 -14.975 -8.330  1.00 0.00 ? 10  ARG A NH1  5  
ATOM 7074  N NH2  . ARG A 1 10  ? -13.290 -14.310 -9.722  1.00 0.00 ? 10  ARG A NH2  5  
ATOM 7075  H H    . ARG A 1 10  ? -16.183 -18.911 -3.265  1.00 0.00 ? 10  ARG A H    5  
ATOM 7076  H HA   . ARG A 1 10  ? -14.152 -19.402 -5.268  1.00 0.00 ? 10  ARG A HA   5  
ATOM 7077  H HB2  . ARG A 1 10  ? -14.650 -16.789 -3.784  1.00 0.00 ? 10  ARG A HB2  5  
ATOM 7078  H HB3  . ARG A 1 10  ? -13.055 -17.178 -4.396  1.00 0.00 ? 10  ARG A HB3  5  
ATOM 7079  H HG2  . ARG A 1 10  ? -15.165 -17.640 -6.410  1.00 0.00 ? 10  ARG A HG2  5  
ATOM 7080  H HG3  . ARG A 1 10  ? -15.138 -15.980 -5.849  1.00 0.00 ? 10  ARG A HG3  5  
ATOM 7081  H HD2  . ARG A 1 10  ? -12.549 -16.093 -6.230  1.00 0.00 ? 10  ARG A HD2  5  
ATOM 7082  H HD3  . ARG A 1 10  ? -12.877 -17.549 -7.148  1.00 0.00 ? 10  ARG A HD3  5  
ATOM 7083  H HE   . ARG A 1 10  ? -14.660 -15.799 -8.264  1.00 0.00 ? 10  ARG A HE   5  
ATOM 7084  H HH11 . ARG A 1 10  ? -11.226 -15.507 -7.550  1.00 0.00 ? 10  ARG A HH11 5  
ATOM 7085  H HH12 . ARG A 1 10  ? -10.919 -14.406 -8.851  1.00 0.00 ? 10  ARG A HH12 5  
ATOM 7086  H HH21 . ARG A 1 10  ? -14.255 -14.346 -9.980  1.00 0.00 ? 10  ARG A HH21 5  
ATOM 7087  H HH22 . ARG A 1 10  ? -12.653 -13.741 -10.243 1.00 0.00 ? 10  ARG A HH22 5  
ATOM 7088  N N    . ARG A 1 11  ? -12.429 -19.850 -3.429  1.00 0.00 ? 11  ARG A N    5  
ATOM 7089  C CA   . ARG A 1 11  ? -11.577 -20.380 -2.378  1.00 0.00 ? 11  ARG A CA   5  
ATOM 7090  C C    . ARG A 1 11  ? -10.396 -19.440 -2.126  1.00 0.00 ? 11  ARG A C    5  
ATOM 7091  O O    . ARG A 1 11  ? -9.323  -19.618 -2.699  1.00 0.00 ? 11  ARG A O    5  
ATOM 7092  C CB   . ARG A 1 11  ? -11.046 -21.767 -2.748  1.00 0.00 ? 11  ARG A CB   5  
ATOM 7093  C CG   . ARG A 1 11  ? -12.186 -22.781 -2.853  1.00 0.00 ? 11  ARG A CG   5  
ATOM 7094  C CD   . ARG A 1 11  ? -12.347 -23.277 -4.291  1.00 0.00 ? 11  ARG A CD   5  
ATOM 7095  N NE   . ARG A 1 11  ? -12.146 -24.742 -4.347  1.00 0.00 ? 11  ARG A NE   5  
ATOM 7096  C CZ   . ARG A 1 11  ? -12.134 -25.457 -5.480  1.00 0.00 ? 11  ARG A CZ   5  
ATOM 7097  N NH1  . ARG A 1 11  ? -12.313 -24.846 -6.659  1.00 0.00 ? 11  ARG A NH1  5  
ATOM 7098  N NH2  . ARG A 1 11  ? -11.944 -26.782 -5.435  1.00 0.00 ? 11  ARG A NH2  5  
ATOM 7099  H H    . ARG A 1 11  ? -12.032 -19.873 -4.347  1.00 0.00 ? 11  ARG A H    5  
ATOM 7100  H HA   . ARG A 1 11  ? -12.222 -20.444 -1.502  1.00 0.00 ? 11  ARG A HA   5  
ATOM 7101  H HB2  . ARG A 1 11  ? -10.512 -21.715 -3.696  1.00 0.00 ? 11  ARG A HB2  5  
ATOM 7102  H HB3  . ARG A 1 11  ? -10.328 -22.098 -1.996  1.00 0.00 ? 11  ARG A HB3  5  
ATOM 7103  H HG2  . ARG A 1 11  ? -11.989 -23.626 -2.193  1.00 0.00 ? 11  ARG A HG2  5  
ATOM 7104  H HG3  . ARG A 1 11  ? -13.117 -22.323 -2.516  1.00 0.00 ? 11  ARG A HG3  5  
ATOM 7105  H HD2  . ARG A 1 11  ? -13.340 -23.024 -4.663  1.00 0.00 ? 11  ARG A HD2  5  
ATOM 7106  H HD3  . ARG A 1 11  ? -11.627 -22.778 -4.940  1.00 0.00 ? 11  ARG A HD3  5  
ATOM 7107  H HE   . ARG A 1 11  ? -12.009 -25.230 -3.484  1.00 0.00 ? 11  ARG A HE   5  
ATOM 7108  H HH11 . ARG A 1 11  ? -12.455 -23.856 -6.693  1.00 0.00 ? 11  ARG A HH11 5  
ATOM 7109  H HH12 . ARG A 1 11  ? -12.305 -25.379 -7.505  1.00 0.00 ? 11  ARG A HH12 5  
ATOM 7110  H HH21 . ARG A 1 11  ? -11.811 -27.239 -4.555  1.00 0.00 ? 11  ARG A HH21 5  
ATOM 7111  H HH22 . ARG A 1 11  ? -11.936 -27.316 -6.281  1.00 0.00 ? 11  ARG A HH22 5  
ATOM 7112  N N    . LYS A 1 12  ? -10.635 -18.459 -1.268  1.00 0.00 ? 12  LYS A N    5  
ATOM 7113  C CA   . LYS A 1 12  ? -9.605  -17.491 -0.933  1.00 0.00 ? 12  LYS A CA   5  
ATOM 7114  C C    . LYS A 1 12  ? -8.277  -18.219 -0.719  1.00 0.00 ? 12  LYS A C    5  
ATOM 7115  O O    . LYS A 1 12  ? -8.234  -19.263 -0.071  1.00 0.00 ? 12  LYS A O    5  
ATOM 7116  C CB   . LYS A 1 12  ? -10.039 -16.639 0.262   1.00 0.00 ? 12  LYS A CB   5  
ATOM 7117  C CG   . LYS A 1 12  ? -11.119 -15.635 -0.143  1.00 0.00 ? 12  LYS A CG   5  
ATOM 7118  C CD   . LYS A 1 12  ? -12.428 -15.906 0.601   1.00 0.00 ? 12  LYS A CD   5  
ATOM 7119  C CE   . LYS A 1 12  ? -13.574 -15.079 0.015   1.00 0.00 ? 12  LYS A CE   5  
ATOM 7120  N NZ   . LYS A 1 12  ? -13.538 -13.697 0.542   1.00 0.00 ? 12  LYS A NZ   5  
ATOM 7121  H H    . LYS A 1 12  ? -11.511 -18.321 -0.806  1.00 0.00 ? 12  LYS A H    5  
ATOM 7122  H HA   . LYS A 1 12  ? -9.499  -16.819 -1.785  1.00 0.00 ? 12  LYS A HA   5  
ATOM 7123  H HB2  . LYS A 1 12  ? -10.417 -17.284 1.056   1.00 0.00 ? 12  LYS A HB2  5  
ATOM 7124  H HB3  . LYS A 1 12  ? -9.177  -16.109 0.667   1.00 0.00 ? 12  LYS A HB3  5  
ATOM 7125  H HG2  . LYS A 1 12  ? -10.778 -14.622 0.071   1.00 0.00 ? 12  LYS A HG2  5  
ATOM 7126  H HG3  . LYS A 1 12  ? -11.289 -15.692 -1.218  1.00 0.00 ? 12  LYS A HG3  5  
ATOM 7127  H HD2  . LYS A 1 12  ? -12.672 -16.967 0.540   1.00 0.00 ? 12  LYS A HD2  5  
ATOM 7128  H HD3  . LYS A 1 12  ? -12.306 -15.668 1.657   1.00 0.00 ? 12  LYS A HD3  5  
ATOM 7129  H HE2  . LYS A 1 12  ? -13.499 -15.062 -1.073  1.00 0.00 ? 12  LYS A HE2  5  
ATOM 7130  H HE3  . LYS A 1 12  ? -14.529 -15.544 0.261   1.00 0.00 ? 12  LYS A HE3  5  
ATOM 7131  H HZ1  . LYS A 1 12  ? -12.592 -13.441 0.741   1.00 0.00 ? 12  LYS A HZ1  5  
ATOM 7132  H HZ2  . LYS A 1 12  ? -13.917 -13.070 -0.139  1.00 0.00 ? 12  LYS A HZ2  5  
ATOM 7133  H HZ3  . LYS A 1 12  ? -14.081 -13.646 1.381   1.00 0.00 ? 12  LYS A HZ3  5  
ATOM 7134  N N    . ASP A 1 13  ? -7.224  -17.638 -1.277  1.00 0.00 ? 13  ASP A N    5  
ATOM 7135  C CA   . ASP A 1 13  ? -5.898  -18.219 -1.156  1.00 0.00 ? 13  ASP A CA   5  
ATOM 7136  C C    . ASP A 1 13  ? -4.849  -17.110 -1.260  1.00 0.00 ? 13  ASP A C    5  
ATOM 7137  O O    . ASP A 1 13  ? -4.838  -16.349 -2.227  1.00 0.00 ? 13  ASP A O    5  
ATOM 7138  C CB   . ASP A 1 13  ? -5.633  -19.226 -2.276  1.00 0.00 ? 13  ASP A CB   5  
ATOM 7139  C CG   . ASP A 1 13  ? -5.134  -20.595 -1.810  1.00 0.00 ? 13  ASP A CG   5  
ATOM 7140  O OD1  . ASP A 1 13  ? -4.526  -20.636 -0.719  1.00 0.00 ? 13  ASP A OD1  5  
ATOM 7141  O OD2  . ASP A 1 13  ? -5.372  -21.570 -2.556  1.00 0.00 ? 13  ASP A OD2  5  
ATOM 7142  H H    . ASP A 1 13  ? -7.267  -16.789 -1.803  1.00 0.00 ? 13  ASP A H    5  
ATOM 7143  H HA   . ASP A 1 13  ? -5.888  -18.711 -0.184  1.00 0.00 ? 13  ASP A HA   5  
ATOM 7144  H HB2  . ASP A 1 13  ? -6.553  -19.366 -2.844  1.00 0.00 ? 13  ASP A HB2  5  
ATOM 7145  H HB3  . ASP A 1 13  ? -4.898  -18.802 -2.960  1.00 0.00 ? 13  ASP A HB3  5  
ATOM 7146  N N    . ARG A 1 14  ? -3.993  -17.052 -0.251  1.00 0.00 ? 14  ARG A N    5  
ATOM 7147  C CA   . ARG A 1 14  ? -2.942  -16.049 -0.217  1.00 0.00 ? 14  ARG A CA   5  
ATOM 7148  C C    . ARG A 1 14  ? -3.550  -14.646 -0.162  1.00 0.00 ? 14  ARG A C    5  
ATOM 7149  O O    . ARG A 1 14  ? -4.504  -14.350 -0.880  1.00 0.00 ? 14  ARG A O    5  
ATOM 7150  C CB   . ARG A 1 14  ? -2.037  -16.157 -1.445  1.00 0.00 ? 14  ARG A CB   5  
ATOM 7151  C CG   . ARG A 1 14  ? -0.856  -17.091 -1.175  1.00 0.00 ? 14  ARG A CG   5  
ATOM 7152  C CD   . ARG A 1 14  ? 0.457   -16.468 -1.655  1.00 0.00 ? 14  ARG A CD   5  
ATOM 7153  N NE   . ARG A 1 14  ? 1.605   -17.257 -1.155  1.00 0.00 ? 14  ARG A NE   5  
ATOM 7154  C CZ   . ARG A 1 14  ? 2.083   -17.178 0.094   1.00 0.00 ? 14  ARG A CZ   5  
ATOM 7155  N NH1  . ARG A 1 14  ? 1.517   -16.344 0.977   1.00 0.00 ? 14  ARG A NH1  5  
ATOM 7156  N NH2  . ARG A 1 14  ? 3.129   -17.932 0.460   1.00 0.00 ? 14  ARG A NH2  5  
ATOM 7157  H H    . ARG A 1 14  ? -4.008  -17.674 0.532   1.00 0.00 ? 14  ARG A H    5  
ATOM 7158  H HA   . ARG A 1 14  ? -2.377  -16.267 0.689   1.00 0.00 ? 14  ARG A HA   5  
ATOM 7159  H HB2  . ARG A 1 14  ? -2.612  -16.528 -2.294  1.00 0.00 ? 14  ARG A HB2  5  
ATOM 7160  H HB3  . ARG A 1 14  ? -1.668  -15.168 -1.718  1.00 0.00 ? 14  ARG A HB3  5  
ATOM 7161  H HG2  . ARG A 1 14  ? -0.792  -17.304 -0.108  1.00 0.00 ? 14  ARG A HG2  5  
ATOM 7162  H HG3  . ARG A 1 14  ? -1.017  -18.043 -1.682  1.00 0.00 ? 14  ARG A HG3  5  
ATOM 7163  H HD2  . ARG A 1 14  ? 0.476   -16.433 -2.744  1.00 0.00 ? 14  ARG A HD2  5  
ATOM 7164  H HD3  . ARG A 1 14  ? 0.531   -15.439 -1.302  1.00 0.00 ? 14  ARG A HD3  5  
ATOM 7165  H HE   . ARG A 1 14  ? 2.051   -17.889 -1.789  1.00 0.00 ? 14  ARG A HE   5  
ATOM 7166  H HH11 . ARG A 1 14  ? 0.736   -15.781 0.704   1.00 0.00 ? 14  ARG A HH11 5  
ATOM 7167  H HH12 . ARG A 1 14  ? 1.874   -16.285 1.909   1.00 0.00 ? 14  ARG A HH12 5  
ATOM 7168  H HH21 . ARG A 1 14  ? 3.552   -18.554 -0.199  1.00 0.00 ? 14  ARG A HH21 5  
ATOM 7169  H HH22 . ARG A 1 14  ? 3.486   -17.873 1.392   1.00 0.00 ? 14  ARG A HH22 5  
ATOM 7170  N N    . PRO A 1 15  ? -2.958  -13.797 0.721   1.00 0.00 ? 15  PRO A N    5  
ATOM 7171  C CA   . PRO A 1 15  ? -3.431  -12.432 0.879   1.00 0.00 ? 15  PRO A CA   5  
ATOM 7172  C C    . PRO A 1 15  ? -2.998  -11.561 -0.302  1.00 0.00 ? 15  PRO A C    5  
ATOM 7173  O O    . PRO A 1 15  ? -3.587  -10.511 -0.552  1.00 0.00 ? 15  PRO A O    5  
ATOM 7174  C CB   . PRO A 1 15  ? -2.851  -11.966 2.204   1.00 0.00 ? 15  PRO A CB   5  
ATOM 7175  C CG   . PRO A 1 15  ? -1.704  -12.913 2.514   1.00 0.00 ? 15  PRO A CG   5  
ATOM 7176  C CD   . PRO A 1 15  ? -1.827  -14.113 1.588   1.00 0.00 ? 15  PRO A CD   5  
ATOM 7177  H HA   . PRO A 1 15  ? -4.431  -12.410 0.883   1.00 0.00 ? 15  PRO A HA   5  
ATOM 7178  H HB2  . PRO A 1 15  ? -2.500  -10.936 2.137   1.00 0.00 ? 15  PRO A HB2  5  
ATOM 7179  H HB3  . PRO A 1 15  ? -3.605  -11.995 2.992   1.00 0.00 ? 15  PRO A HB3  5  
ATOM 7180  H HG2  . PRO A 1 15  ? -0.746  -12.414 2.366   1.00 0.00 ? 15  PRO A HG2  5  
ATOM 7181  H HG3  . PRO A 1 15  ? -1.740  -13.230 3.556   1.00 0.00 ? 15  PRO A HG3  5  
ATOM 7182  H HD2  . PRO A 1 15  ? -0.915  -14.263 1.010   1.00 0.00 ? 15  PRO A HD2  5  
ATOM 7183  H HD3  . PRO A 1 15  ? -2.003  -15.030 2.150   1.00 0.00 ? 15  PRO A HD3  5  
ATOM 7184  N N    . TYR A 1 16  ? -1.972  -12.031 -0.998  1.00 0.00 ? 16  TYR A N    5  
ATOM 7185  C CA   . TYR A 1 16  ? -1.454  -11.308 -2.146  1.00 0.00 ? 16  TYR A CA   5  
ATOM 7186  C C    . TYR A 1 16  ? -0.776  -10.006 -1.715  1.00 0.00 ? 16  TYR A C    5  
ATOM 7187  O O    . TYR A 1 16  ? 0.418   -9.819  -1.941  1.00 0.00 ? 16  TYR A O    5  
ATOM 7188  C CB   . TYR A 1 16  ? -2.667  -10.974 -3.017  1.00 0.00 ? 16  TYR A CB   5  
ATOM 7189  C CG   . TYR A 1 16  ? -2.362  -10.925 -4.516  1.00 0.00 ? 16  TYR A CG   5  
ATOM 7190  C CD1  . TYR A 1 16  ? -1.879  -12.047 -5.159  1.00 0.00 ? 16  TYR A CD1  5  
ATOM 7191  C CD2  . TYR A 1 16  ? -2.571  -9.760  -5.225  1.00 0.00 ? 16  TYR A CD2  5  
ATOM 7192  C CE1  . TYR A 1 16  ? -1.592  -12.001 -6.569  1.00 0.00 ? 16  TYR A CE1  5  
ATOM 7193  C CE2  . TYR A 1 16  ? -2.284  -9.714  -6.635  1.00 0.00 ? 16  TYR A CE2  5  
ATOM 7194  C CZ   . TYR A 1 16  ? -1.809  -10.837 -7.238  1.00 0.00 ? 16  TYR A CZ   5  
ATOM 7195  O OH   . TYR A 1 16  ? -1.539  -10.793 -8.570  1.00 0.00 ? 16  TYR A OH   5  
ATOM 7196  H H    . TYR A 1 16  ? -1.499  -12.886 -0.788  1.00 0.00 ? 16  TYR A H    5  
ATOM 7197  H HA   . TYR A 1 16  ? -0.720  -11.944 -2.641  1.00 0.00 ? 16  TYR A HA   5  
ATOM 7198  H HB2  . TYR A 1 16  ? -3.445  -11.716 -2.839  1.00 0.00 ? 16  TYR A HB2  5  
ATOM 7199  H HB3  . TYR A 1 16  ? -3.069  -10.010 -2.707  1.00 0.00 ? 16  TYR A HB3  5  
ATOM 7200  H HD1  . TYR A 1 16  ? -1.714  -12.967 -4.599  1.00 0.00 ? 16  TYR A HD1  5  
ATOM 7201  H HD2  . TYR A 1 16  ? -2.953  -8.874  -4.717  1.00 0.00 ? 16  TYR A HD2  5  
ATOM 7202  H HE1  . TYR A 1 16  ? -1.210  -12.880 -7.089  1.00 0.00 ? 16  TYR A HE1  5  
ATOM 7203  H HE2  . TYR A 1 16  ? -2.445  -8.800  -7.207  1.00 0.00 ? 16  TYR A HE2  5  
ATOM 7204  H HH   . TYR A 1 16  ? -1.275  -11.702 -8.895  1.00 0.00 ? 16  TYR A HH   5  
ATOM 7205  N N    . VAL A 1 17  ? -1.569  -9.139  -1.102  1.00 0.00 ? 17  VAL A N    5  
ATOM 7206  C CA   . VAL A 1 17  ? -1.061  -7.860  -0.636  1.00 0.00 ? 17  VAL A CA   5  
ATOM 7207  C C    . VAL A 1 17  ? -2.081  -7.224  0.310   1.00 0.00 ? 17  VAL A C    5  
ATOM 7208  O O    . VAL A 1 17  ? -3.279  -7.480  0.199   1.00 0.00 ? 17  VAL A O    5  
ATOM 7209  C CB   . VAL A 1 17  ? -0.717  -6.968  -1.831  1.00 0.00 ? 17  VAL A CB   5  
ATOM 7210  C CG1  . VAL A 1 17  ? -1.979  -6.567  -2.598  1.00 0.00 ? 17  VAL A CG1  5  
ATOM 7211  C CG2  . VAL A 1 17  ? 0.068   -5.733  -1.385  1.00 0.00 ? 17  VAL A CG2  5  
ATOM 7212  H H    . VAL A 1 17  ? -2.540  -9.299  -0.922  1.00 0.00 ? 17  VAL A H    5  
ATOM 7213  H HA   . VAL A 1 17  ? -0.142  -8.052  -0.083  1.00 0.00 ? 17  VAL A HA   5  
ATOM 7214  H HB   . VAL A 1 17  ? -0.083  -7.542  -2.506  1.00 0.00 ? 17  VAL A HB   5  
ATOM 7215  H HG11 . VAL A 1 17  ? -2.811  -6.468  -1.900  1.00 0.00 ? 17  VAL A HG11 5  
ATOM 7216  H HG12 . VAL A 1 17  ? -1.812  -5.615  -3.102  1.00 0.00 ? 17  VAL A HG12 5  
ATOM 7217  H HG13 . VAL A 1 17  ? -2.214  -7.333  -3.336  1.00 0.00 ? 17  VAL A HG13 5  
ATOM 7218  H HG21 . VAL A 1 17  ? 0.804   -6.022  -0.634  1.00 0.00 ? 17  VAL A HG21 5  
ATOM 7219  H HG22 . VAL A 1 17  ? 0.578   -5.297  -2.244  1.00 0.00 ? 17  VAL A HG22 5  
ATOM 7220  H HG23 . VAL A 1 17  ? -0.617  -5.000  -0.959  1.00 0.00 ? 17  VAL A HG23 5  
ATOM 7221  N N    . GLU A 1 18  ? -1.569  -6.408  1.220   1.00 0.00 ? 18  GLU A N    5  
ATOM 7222  C CA   . GLU A 1 18  ? -2.421  -5.734  2.185   1.00 0.00 ? 18  GLU A CA   5  
ATOM 7223  C C    . GLU A 1 18  ? -3.616  -5.090  1.479   1.00 0.00 ? 18  GLU A C    5  
ATOM 7224  O O    . GLU A 1 18  ? -3.462  -4.093  0.775   1.00 0.00 ? 18  GLU A O    5  
ATOM 7225  C CB   . GLU A 1 18  ? -1.630  -4.696  2.983   1.00 0.00 ? 18  GLU A CB   5  
ATOM 7226  C CG   . GLU A 1 18  ? -0.417  -5.334  3.663   1.00 0.00 ? 18  GLU A CG   5  
ATOM 7227  C CD   . GLU A 1 18  ? -0.662  -5.519  5.162   1.00 0.00 ? 18  GLU A CD   5  
ATOM 7228  O OE1  . GLU A 1 18  ? -1.161  -4.553  5.778   1.00 0.00 ? 18  GLU A OE1  5  
ATOM 7229  O OE2  . GLU A 1 18  ? -0.345  -6.622  5.657   1.00 0.00 ? 18  GLU A OE2  5  
ATOM 7230  H H    . GLU A 1 18  ? -0.593  -6.206  1.303   1.00 0.00 ? 18  GLU A H    5  
ATOM 7231  H HA   . GLU A 1 18  ? -2.768  -6.516  2.861   1.00 0.00 ? 18  GLU A HA   5  
ATOM 7232  H HB2  . GLU A 1 18  ? -1.301  -3.896  2.320   1.00 0.00 ? 18  GLU A HB2  5  
ATOM 7233  H HB3  . GLU A 1 18  ? -2.275  -4.241  3.735   1.00 0.00 ? 18  GLU A HB3  5  
ATOM 7234  H HG2  . GLU A 1 18  ? -0.205  -6.300  3.203   1.00 0.00 ? 18  GLU A HG2  5  
ATOM 7235  H HG3  . GLU A 1 18  ? 0.462   -4.708  3.509   1.00 0.00 ? 18  GLU A HG3  5  
ATOM 7236  N N    . GLU A 1 19  ? -4.780  -5.686  1.693   1.00 0.00 ? 19  GLU A N    5  
ATOM 7237  C CA   . GLU A 1 19  ? -6.001  -5.183  1.086   1.00 0.00 ? 19  GLU A CA   5  
ATOM 7238  C C    . GLU A 1 19  ? -6.031  -3.654  1.145   1.00 0.00 ? 19  GLU A C    5  
ATOM 7239  O O    . GLU A 1 19  ? -5.335  -3.046  1.957   1.00 0.00 ? 19  GLU A O    5  
ATOM 7240  C CB   . GLU A 1 19  ? -7.236  -5.782  1.761   1.00 0.00 ? 19  GLU A CB   5  
ATOM 7241  C CG   . GLU A 1 19  ? -7.872  -6.860  0.881   1.00 0.00 ? 19  GLU A CG   5  
ATOM 7242  C CD   . GLU A 1 19  ? -9.286  -7.195  1.359   1.00 0.00 ? 19  GLU A CD   5  
ATOM 7243  O OE1  . GLU A 1 19  ? -10.221 -6.512  0.887   1.00 0.00 ? 19  GLU A OE1  5  
ATOM 7244  O OE2  . GLU A 1 19  ? -9.401  -8.125  2.186   1.00 0.00 ? 19  GLU A OE2  5  
ATOM 7245  H H    . GLU A 1 19  ? -4.896  -6.496  2.267   1.00 0.00 ? 19  GLU A H    5  
ATOM 7246  H HA   . GLU A 1 19  ? -5.965  -5.512  0.048   1.00 0.00 ? 19  GLU A HA   5  
ATOM 7247  H HB2  . GLU A 1 19  ? -6.957  -6.211  2.723   1.00 0.00 ? 19  GLU A HB2  5  
ATOM 7248  H HB3  . GLU A 1 19  ? -7.963  -4.996  1.961   1.00 0.00 ? 19  GLU A HB3  5  
ATOM 7249  H HG2  . GLU A 1 19  ? -7.905  -6.517  -0.154  1.00 0.00 ? 19  GLU A HG2  5  
ATOM 7250  H HG3  . GLU A 1 19  ? -7.256  -7.760  0.898   1.00 0.00 ? 19  GLU A HG3  5  
ATOM 7251  N N    . PRO A 1 20  ? -6.867  -3.061  0.251   1.00 0.00 ? 20  PRO A N    5  
ATOM 7252  C CA   . PRO A 1 20  ? -6.998  -1.615  0.195   1.00 0.00 ? 20  PRO A CA   5  
ATOM 7253  C C    . PRO A 1 20  ? -7.828  -1.093  1.369   1.00 0.00 ? 20  PRO A C    5  
ATOM 7254  O O    . PRO A 1 20  ? -8.729  -1.778  1.851   1.00 0.00 ? 20  PRO A O    5  
ATOM 7255  C CB   . PRO A 1 20  ? -7.635  -1.330  -1.156  1.00 0.00 ? 20  PRO A CB   5  
ATOM 7256  C CG   . PRO A 1 20  ? -8.261  -2.640  -1.605  1.00 0.00 ? 20  PRO A CG   5  
ATOM 7257  C CD   . PRO A 1 20  ? -7.707  -3.748  -0.725  1.00 0.00 ? 20  PRO A CD   5  
ATOM 7258  H HA   . PRO A 1 20  ? -6.101  -1.181  0.280   1.00 0.00 ? 20  PRO A HA   5  
ATOM 7259  H HB2  . PRO A 1 20  ? -8.388  -0.545  -1.075  1.00 0.00 ? 20  PRO A HB2  5  
ATOM 7260  H HB3  . PRO A 1 20  ? -6.891  -0.986  -1.874  1.00 0.00 ? 20  PRO A HB3  5  
ATOM 7261  H HG2  . PRO A 1 20  ? -9.347  -2.593  -1.522  1.00 0.00 ? 20  PRO A HG2  5  
ATOM 7262  H HG3  . PRO A 1 20  ? -8.031  -2.834  -2.653  1.00 0.00 ? 20  PRO A HG3  5  
ATOM 7263  H HD2  . PRO A 1 20  ? -8.507  -4.305  -0.237  1.00 0.00 ? 20  PRO A HD2  5  
ATOM 7264  H HD3  . PRO A 1 20  ? -7.130  -4.466  -1.308  1.00 0.00 ? 20  PRO A HD3  5  
ATOM 7265  N N    . ARG A 1 21  ? -7.495  0.116   1.797   1.00 0.00 ? 21  ARG A N    5  
ATOM 7266  C CA   . ARG A 1 21  ? -8.198  0.738   2.906   1.00 0.00 ? 21  ARG A CA   5  
ATOM 7267  C C    . ARG A 1 21  ? -8.704  2.125   2.503   1.00 0.00 ? 21  ARG A C    5  
ATOM 7268  O O    . ARG A 1 21  ? -8.256  2.687   1.505   1.00 0.00 ? 21  ARG A O    5  
ATOM 7269  C CB   . ARG A 1 21  ? -7.289  0.870   4.129   1.00 0.00 ? 21  ARG A CB   5  
ATOM 7270  C CG   . ARG A 1 21  ? -6.273  1.998   3.939   1.00 0.00 ? 21  ARG A CG   5  
ATOM 7271  C CD   . ARG A 1 21  ? -4.854  1.516   4.246   1.00 0.00 ? 21  ARG A CD   5  
ATOM 7272  N NE   . ARG A 1 21  ? -4.596  0.231   3.559   1.00 0.00 ? 21  ARG A NE   5  
ATOM 7273  C CZ   . ARG A 1 21  ? -3.582  -0.592  3.860   1.00 0.00 ? 21  ARG A CZ   5  
ATOM 7274  N NH1  . ARG A 1 21  ? -2.725  -0.269  4.838   1.00 0.00 ? 21  ARG A NH1  5  
ATOM 7275  N NH2  . ARG A 1 21  ? -3.426  -1.738  3.183   1.00 0.00 ? 21  ARG A NH2  5  
ATOM 7276  H H    . ARG A 1 21  ? -6.761  0.667   1.399   1.00 0.00 ? 21  ARG A H    5  
ATOM 7277  H HA   . ARG A 1 21  ? -9.028  0.065   3.122   1.00 0.00 ? 21  ARG A HA   5  
ATOM 7278  H HB2  . ARG A 1 21  ? -7.893  1.066   5.016   1.00 0.00 ? 21  ARG A HB2  5  
ATOM 7279  H HB3  . ARG A 1 21  ? -6.766  -0.070  4.301   1.00 0.00 ? 21  ARG A HB3  5  
ATOM 7280  H HG2  . ARG A 1 21  ? -6.321  2.367   2.914   1.00 0.00 ? 21  ARG A HG2  5  
ATOM 7281  H HG3  . ARG A 1 21  ? -6.526  2.834   4.590   1.00 0.00 ? 21  ARG A HG3  5  
ATOM 7282  H HD2  . ARG A 1 21  ? -4.129  2.262   3.923   1.00 0.00 ? 21  ARG A HD2  5  
ATOM 7283  H HD3  . ARG A 1 21  ? -4.728  1.394   5.322   1.00 0.00 ? 21  ARG A HD3  5  
ATOM 7284  H HE   . ARG A 1 21  ? -5.217  -0.041  2.824   1.00 0.00 ? 21  ARG A HE   5  
ATOM 7285  H HH11 . ARG A 1 21  ? -2.842  0.586   5.343   1.00 0.00 ? 21  ARG A HH11 5  
ATOM 7286  H HH12 . ARG A 1 21  ? -1.968  -0.883  5.062   1.00 0.00 ? 21  ARG A HH12 5  
ATOM 7287  H HH21 . ARG A 1 21  ? -4.065  -1.979  2.453   1.00 0.00 ? 21  ARG A HH21 5  
ATOM 7288  H HH22 . ARG A 1 21  ? -2.669  -2.352  3.408   1.00 0.00 ? 21  ARG A HH22 5  
ATOM 7289  N N    . HIS A 1 22  ? -9.630  2.636   3.300   1.00 0.00 ? 22  HIS A N    5  
ATOM 7290  C CA   . HIS A 1 22  ? -10.202 3.946   3.039   1.00 0.00 ? 22  HIS A CA   5  
ATOM 7291  C C    . HIS A 1 22  ? -9.876  4.889   4.199   1.00 0.00 ? 22  HIS A C    5  
ATOM 7292  O O    . HIS A 1 22  ? -10.491 4.807   5.261   1.00 0.00 ? 22  HIS A O    5  
ATOM 7293  C CB   . HIS A 1 22  ? -11.704 3.839   2.766   1.00 0.00 ? 22  HIS A CB   5  
ATOM 7294  C CG   . HIS A 1 22  ? -12.061 2.858   1.674   1.00 0.00 ? 22  HIS A CG   5  
ATOM 7295  N ND1  . HIS A 1 22  ? -11.518 1.587   1.602   1.00 0.00 ? 22  HIS A ND1  5  
ATOM 7296  C CD2  . HIS A 1 22  ? -12.912 2.974   0.615   1.00 0.00 ? 22  HIS A CD2  5  
ATOM 7297  C CE1  . HIS A 1 22  ? -12.026 0.976   0.542   1.00 0.00 ? 22  HIS A CE1  5  
ATOM 7298  N NE2  . HIS A 1 22  ? -12.889 1.837   -0.069  1.00 0.00 ? 22  HIS A NE2  5  
ATOM 7299  H H    . HIS A 1 22  ? -9.989  2.172   4.109   1.00 0.00 ? 22  HIS A H    5  
ATOM 7300  H HA   . HIS A 1 22  ? -9.725  4.321   2.133   1.00 0.00 ? 22  HIS A HA   5  
ATOM 7301  H HB2  . HIS A 1 22  ? -12.210 3.545   3.685   1.00 0.00 ? 22  HIS A HB2  5  
ATOM 7302  H HB3  . HIS A 1 22  ? -12.084 4.824   2.494   1.00 0.00 ? 22  HIS A HB3  5  
ATOM 7303  H HD1  . HIS A 1 22  ? -10.855 1.197   2.240   1.00 0.00 ? 22  HIS A HD1  5  
ATOM 7304  H HD2  . HIS A 1 22  ? -13.510 3.853   0.371   1.00 0.00 ? 22  HIS A HD2  5  
ATOM 7305  H HE1  . HIS A 1 22  ? -11.794 -0.038  0.215   1.00 0.00 ? 22  HIS A HE1  5  
ATOM 7306  N N    . VAL A 1 23  ? -8.910  5.762   3.956   1.00 0.00 ? 23  VAL A N    5  
ATOM 7307  C CA   . VAL A 1 23  ? -8.495  6.719   4.968   1.00 0.00 ? 23  VAL A CA   5  
ATOM 7308  C C    . VAL A 1 23  ? -9.142  8.075   4.676   1.00 0.00 ? 23  VAL A C    5  
ATOM 7309  O O    . VAL A 1 23  ? -8.925  8.655   3.613   1.00 0.00 ? 23  VAL A O    5  
ATOM 7310  C CB   . VAL A 1 23  ? -6.968  6.786   5.029   1.00 0.00 ? 23  VAL A CB   5  
ATOM 7311  C CG1  . VAL A 1 23  ? -6.505  7.995   5.845   1.00 0.00 ? 23  VAL A CG1  5  
ATOM 7312  C CG2  . VAL A 1 23  ? -6.384  5.489   5.592   1.00 0.00 ? 23  VAL A CG2  5  
ATOM 7313  H H    . VAL A 1 23  ? -8.415  5.822   3.089   1.00 0.00 ? 23  VAL A H    5  
ATOM 7314  H HA   . VAL A 1 23  ? -8.856  6.358   5.930   1.00 0.00 ? 23  VAL A HA   5  
ATOM 7315  H HB   . VAL A 1 23  ? -6.596  6.907   4.012   1.00 0.00 ? 23  VAL A HB   5  
ATOM 7316  H HG11 . VAL A 1 23  ? -6.239  8.809   5.170   1.00 0.00 ? 23  VAL A HG11 5  
ATOM 7317  H HG12 . VAL A 1 23  ? -7.310  8.318   6.505   1.00 0.00 ? 23  VAL A HG12 5  
ATOM 7318  H HG13 . VAL A 1 23  ? -5.635  7.719   6.441   1.00 0.00 ? 23  VAL A HG13 5  
ATOM 7319  H HG21 . VAL A 1 23  ? -5.738  5.028   4.845   1.00 0.00 ? 23  VAL A HG21 5  
ATOM 7320  H HG22 . VAL A 1 23  ? -5.804  5.710   6.488   1.00 0.00 ? 23  VAL A HG22 5  
ATOM 7321  H HG23 . VAL A 1 23  ? -7.195  4.805   5.843   1.00 0.00 ? 23  VAL A HG23 5  
ATOM 7322  N N    . LYS A 1 24  ? -9.923  8.541   5.640   1.00 0.00 ? 24  LYS A N    5  
ATOM 7323  C CA   . LYS A 1 24  ? -10.603 9.818   5.500   1.00 0.00 ? 24  LYS A CA   5  
ATOM 7324  C C    . LYS A 1 24  ? -9.631  10.948  5.843   1.00 0.00 ? 24  LYS A C    5  
ATOM 7325  O O    . LYS A 1 24  ? -8.656  10.736  6.562   1.00 0.00 ? 24  LYS A O    5  
ATOM 7326  C CB   . LYS A 1 24  ? -11.886 9.836   6.333   1.00 0.00 ? 24  LYS A CB   5  
ATOM 7327  C CG   . LYS A 1 24  ? -13.064 9.268   5.538   1.00 0.00 ? 24  LYS A CG   5  
ATOM 7328  C CD   . LYS A 1 24  ? -14.331 9.223   6.393   1.00 0.00 ? 24  LYS A CD   5  
ATOM 7329  C CE   . LYS A 1 24  ? -15.584 9.341   5.523   1.00 0.00 ? 24  LYS A CE   5  
ATOM 7330  N NZ   . LYS A 1 24  ? -16.769 8.829   6.248   1.00 0.00 ? 24  LYS A NZ   5  
ATOM 7331  H H    . LYS A 1 24  ? -10.094 8.063   6.501   1.00 0.00 ? 24  LYS A H    5  
ATOM 7332  H HA   . LYS A 1 24  ? -10.895 9.919   4.455   1.00 0.00 ? 24  LYS A HA   5  
ATOM 7333  H HB2  . LYS A 1 24  ? -11.742 9.253   7.243   1.00 0.00 ? 24  LYS A HB2  5  
ATOM 7334  H HB3  . LYS A 1 24  ? -12.109 10.857  6.641   1.00 0.00 ? 24  LYS A HB3  5  
ATOM 7335  H HG2  . LYS A 1 24  ? -13.239 9.880   4.653   1.00 0.00 ? 24  LYS A HG2  5  
ATOM 7336  H HG3  . LYS A 1 24  ? -12.821 8.265   5.188   1.00 0.00 ? 24  LYS A HG3  5  
ATOM 7337  H HD2  . LYS A 1 24  ? -14.362 8.290   6.956   1.00 0.00 ? 24  LYS A HD2  5  
ATOM 7338  H HD3  . LYS A 1 24  ? -14.312 10.034  7.121   1.00 0.00 ? 24  LYS A HD3  5  
ATOM 7339  H HE2  . LYS A 1 24  ? -15.743 10.382  5.243   1.00 0.00 ? 24  LYS A HE2  5  
ATOM 7340  H HE3  . LYS A 1 24  ? -15.446 8.780   4.598   1.00 0.00 ? 24  LYS A HE3  5  
ATOM 7341  H HZ1  . LYS A 1 24  ? -16.590 8.844   7.231   1.00 0.00 ? 24  LYS A HZ1  5  
ATOM 7342  H HZ2  . LYS A 1 24  ? -17.559 9.406   6.044   1.00 0.00 ? 24  LYS A HZ2  5  
ATOM 7343  H HZ3  . LYS A 1 24  ? -16.957 7.891   5.958   1.00 0.00 ? 24  LYS A HZ3  5  
ATOM 7344  N N    . VAL A 1 25  ? -9.931  12.125  5.313   1.00 0.00 ? 25  VAL A N    5  
ATOM 7345  C CA   . VAL A 1 25  ? -9.095  13.289  5.555   1.00 0.00 ? 25  VAL A CA   5  
ATOM 7346  C C    . VAL A 1 25  ? -9.985  14.490  5.884   1.00 0.00 ? 25  VAL A C    5  
ATOM 7347  O O    . VAL A 1 25  ? -11.013 14.700  5.242   1.00 0.00 ? 25  VAL A O    5  
ATOM 7348  C CB   . VAL A 1 25  ? -8.180  13.535  4.353   1.00 0.00 ? 25  VAL A CB   5  
ATOM 7349  C CG1  . VAL A 1 25  ? -7.176  14.651  4.649   1.00 0.00 ? 25  VAL A CG1  5  
ATOM 7350  C CG2  . VAL A 1 25  ? -7.464  12.249  3.938   1.00 0.00 ? 25  VAL A CG2  5  
ATOM 7351  H H    . VAL A 1 25  ? -10.726 12.289  4.729   1.00 0.00 ? 25  VAL A H    5  
ATOM 7352  H HA   . VAL A 1 25  ? -8.468  13.070  6.418   1.00 0.00 ? 25  VAL A HA   5  
ATOM 7353  H HB   . VAL A 1 25  ? -8.803  13.857  3.518   1.00 0.00 ? 25  VAL A HB   5  
ATOM 7354  H HG11 . VAL A 1 25  ? -7.015  14.720  5.725   1.00 0.00 ? 25  VAL A HG11 5  
ATOM 7355  H HG12 . VAL A 1 25  ? -6.231  14.430  4.153   1.00 0.00 ? 25  VAL A HG12 5  
ATOM 7356  H HG13 . VAL A 1 25  ? -7.567  15.599  4.279   1.00 0.00 ? 25  VAL A HG13 5  
ATOM 7357  H HG21 . VAL A 1 25  ? -7.909  11.866  3.019   1.00 0.00 ? 25  VAL A HG21 5  
ATOM 7358  H HG22 . VAL A 1 25  ? -6.408  12.459  3.769   1.00 0.00 ? 25  VAL A HG22 5  
ATOM 7359  H HG23 . VAL A 1 25  ? -7.565  11.505  4.728   1.00 0.00 ? 25  VAL A HG23 5  
ATOM 7360  N N    . GLN A 1 26  ? -9.557  15.246  6.885   1.00 0.00 ? 26  GLN A N    5  
ATOM 7361  C CA   . GLN A 1 26  ? -10.302 16.420  7.307   1.00 0.00 ? 26  GLN A CA   5  
ATOM 7362  C C    . GLN A 1 26  ? -9.516  17.692  6.983   1.00 0.00 ? 26  GLN A C    5  
ATOM 7363  O O    . GLN A 1 26  ? -8.986  18.344  7.881   1.00 0.00 ? 26  GLN A O    5  
ATOM 7364  C CB   . GLN A 1 26  ? -10.638 16.348  8.798   1.00 0.00 ? 26  GLN A CB   5  
ATOM 7365  C CG   . GLN A 1 26  ? -12.127 16.067  9.011   1.00 0.00 ? 26  GLN A CG   5  
ATOM 7366  C CD   . GLN A 1 26  ? -12.656 16.812  10.239  1.00 0.00 ? 26  GLN A CD   5  
ATOM 7367  O OE1  . GLN A 1 26  ? -11.990 16.940  11.253  1.00 0.00 ? 26  GLN A OE1  5  
ATOM 7368  N NE2  . GLN A 1 26  ? -13.886 17.294  10.090  1.00 0.00 ? 26  GLN A NE2  5  
ATOM 7369  H H    . GLN A 1 26  ? -8.720  15.068  7.402   1.00 0.00 ? 26  GLN A H    5  
ATOM 7370  H HA   . GLN A 1 26  ? -11.227 16.399  6.731   1.00 0.00 ? 26  GLN A HA   5  
ATOM 7371  H HB2  . GLN A 1 26  ? -10.045 15.566  9.271   1.00 0.00 ? 26  GLN A HB2  5  
ATOM 7372  H HB3  . GLN A 1 26  ? -10.369 17.288  9.281   1.00 0.00 ? 26  GLN A HB3  5  
ATOM 7373  H HG2  . GLN A 1 26  ? -12.688 16.370  8.127   1.00 0.00 ? 26  GLN A HG2  5  
ATOM 7374  H HG3  . GLN A 1 26  ? -12.284 14.995  9.136   1.00 0.00 ? 26  GLN A HG3  5  
ATOM 7375  H HE21 . GLN A 1 26  ? -14.378 17.153  9.231   1.00 0.00 ? 26  GLN A HE21 5  
ATOM 7376  H HE22 . GLN A 1 26  ? -14.320 17.797  10.838  1.00 0.00 ? 26  GLN A HE22 5  
ATOM 7377  N N    . LYS A 1 27  ? -9.466  18.007  5.697   1.00 0.00 ? 27  LYS A N    5  
ATOM 7378  C CA   . LYS A 1 27  ? -8.754  19.189  5.243   1.00 0.00 ? 27  LYS A CA   5  
ATOM 7379  C C    . LYS A 1 27  ? -9.357  20.428  5.907   1.00 0.00 ? 27  LYS A C    5  
ATOM 7380  O O    . LYS A 1 27  ? -8.845  20.906  6.918   1.00 0.00 ? 27  LYS A O    5  
ATOM 7381  C CB   . LYS A 1 27  ? -8.743  19.254  3.714   1.00 0.00 ? 27  LYS A CB   5  
ATOM 7382  C CG   . LYS A 1 27  ? -7.312  19.324  3.178   1.00 0.00 ? 27  LYS A CG   5  
ATOM 7383  C CD   . LYS A 1 27  ? -6.820  17.941  2.746   1.00 0.00 ? 27  LYS A CD   5  
ATOM 7384  C CE   . LYS A 1 27  ? -6.405  17.941  1.274   1.00 0.00 ? 27  LYS A CE   5  
ATOM 7385  N NZ   . LYS A 1 27  ? -7.011  16.792  0.564   1.00 0.00 ? 27  LYS A NZ   5  
ATOM 7386  H H    . LYS A 1 27  ? -9.900  17.471  4.973   1.00 0.00 ? 27  LYS A H    5  
ATOM 7387  H HA   . LYS A 1 27  ? -7.718  19.092  5.568   1.00 0.00 ? 27  LYS A HA   5  
ATOM 7388  H HB2  . LYS A 1 27  ? -9.246  18.378  3.305   1.00 0.00 ? 27  LYS A HB2  5  
ATOM 7389  H HB3  . LYS A 1 27  ? -9.303  20.127  3.380   1.00 0.00 ? 27  LYS A HB3  5  
ATOM 7390  H HG2  . LYS A 1 27  ? -7.269  20.009  2.332   1.00 0.00 ? 27  LYS A HG2  5  
ATOM 7391  H HG3  . LYS A 1 27  ? -6.651  19.725  3.947   1.00 0.00 ? 27  LYS A HG3  5  
ATOM 7392  H HD2  . LYS A 1 27  ? -5.974  17.642  3.366   1.00 0.00 ? 27  LYS A HD2  5  
ATOM 7393  H HD3  . LYS A 1 27  ? -7.608  17.204  2.906   1.00 0.00 ? 27  LYS A HD3  5  
ATOM 7394  H HE2  . LYS A 1 27  ? -6.718  18.873  0.802   1.00 0.00 ? 27  LYS A HE2  5  
ATOM 7395  H HE3  . LYS A 1 27  ? -5.319  17.893  1.195   1.00 0.00 ? 27  LYS A HE3  5  
ATOM 7396  H HZ1  . LYS A 1 27  ? -6.336  16.388  -0.053  1.00 0.00 ? 27  LYS A HZ1  5  
ATOM 7397  H HZ2  . LYS A 1 27  ? -7.307  16.108  1.230   1.00 0.00 ? 27  LYS A HZ2  5  
ATOM 7398  H HZ3  . LYS A 1 27  ? -7.800  17.106  0.035   1.00 0.00 ? 27  LYS A HZ3  5  
ATOM 7399  N N    . GLY A 1 28  ? -10.436 20.914  5.311   1.00 0.00 ? 28  GLY A N    5  
ATOM 7400  C CA   . GLY A 1 28  ? -11.114 22.089  5.832   1.00 0.00 ? 28  GLY A CA   5  
ATOM 7401  C C    . GLY A 1 28  ? -10.704 23.346  5.061   1.00 0.00 ? 28  GLY A C    5  
ATOM 7402  O O    . GLY A 1 28  ? -11.543 24.001  4.445   1.00 0.00 ? 28  GLY A O    5  
ATOM 7403  H H    . GLY A 1 28  ? -10.845 20.520  4.488   1.00 0.00 ? 28  GLY A H    5  
ATOM 7404  H HA2  . GLY A 1 28  ? -12.192 21.951  5.763   1.00 0.00 ? 28  GLY A HA2  5  
ATOM 7405  H HA3  . GLY A 1 28  ? -10.875 22.212  6.888   1.00 0.00 ? 28  GLY A HA3  5  
ATOM 7406  N N    . SER A 1 29  ? -9.414  23.643  5.120   1.00 0.00 ? 29  SER A N    5  
ATOM 7407  C CA   . SER A 1 29  ? -8.883  24.809  4.435   1.00 0.00 ? 29  SER A CA   5  
ATOM 7408  C C    . SER A 1 29  ? -7.354  24.788  4.474   1.00 0.00 ? 29  SER A C    5  
ATOM 7409  O O    . SER A 1 29  ? -6.717  25.837  4.563   1.00 0.00 ? 29  SER A O    5  
ATOM 7410  C CB   . SER A 1 29  ? -9.412  26.102  5.058   1.00 0.00 ? 29  SER A CB   5  
ATOM 7411  O OG   . SER A 1 29  ? -9.209  26.138  6.468   1.00 0.00 ? 29  SER A OG   5  
ATOM 7412  H H    . SER A 1 29  ? -8.738  23.104  5.623   1.00 0.00 ? 29  SER A H    5  
ATOM 7413  H HA   . SER A 1 29  ? -9.241  24.729  3.408   1.00 0.00 ? 29  SER A HA   5  
ATOM 7414  H HB2  . SER A 1 29  ? -8.914  26.956  4.599   1.00 0.00 ? 29  SER A HB2  5  
ATOM 7415  H HB3  . SER A 1 29  ? -10.476 26.200  4.842   1.00 0.00 ? 29  SER A HB3  5  
ATOM 7416  H HG   . SER A 1 29  ? -8.999  25.220  6.806   1.00 0.00 ? 29  SER A HG   5  
ATOM 7417  N N    . GLU A 1 30  ? -6.809  23.582  4.406   1.00 0.00 ? 30  GLU A N    5  
ATOM 7418  C CA   . GLU A 1 30  ? -5.366  23.411  4.433   1.00 0.00 ? 30  GLU A CA   5  
ATOM 7419  C C    . GLU A 1 30  ? -4.940  22.341  3.426   1.00 0.00 ? 30  GLU A C    5  
ATOM 7420  O O    . GLU A 1 30  ? -5.749  21.508  3.021   1.00 0.00 ? 30  GLU A O    5  
ATOM 7421  C CB   . GLU A 1 30  ? -4.881  23.062  5.842   1.00 0.00 ? 30  GLU A CB   5  
ATOM 7422  C CG   . GLU A 1 30  ? -4.540  24.327  6.633   1.00 0.00 ? 30  GLU A CG   5  
ATOM 7423  C CD   . GLU A 1 30  ? -3.059  24.682  6.486   1.00 0.00 ? 30  GLU A CD   5  
ATOM 7424  O OE1  . GLU A 1 30  ? -2.234  23.910  7.022   1.00 0.00 ? 30  GLU A OE1  5  
ATOM 7425  O OE2  . GLU A 1 30  ? -2.785  25.717  5.842   1.00 0.00 ? 30  GLU A OE2  5  
ATOM 7426  H H    . GLU A 1 30  ? -7.334  22.734  4.335   1.00 0.00 ? 30  GLU A H    5  
ATOM 7427  H HA   . GLU A 1 30  ? -4.954  24.377  4.143   1.00 0.00 ? 30  GLU A HA   5  
ATOM 7428  H HB2  . GLU A 1 30  ? -5.653  22.498  6.367   1.00 0.00 ? 30  GLU A HB2  5  
ATOM 7429  H HB3  . GLU A 1 30  ? -4.003  22.420  5.780   1.00 0.00 ? 30  GLU A HB3  5  
ATOM 7430  H HG2  . GLU A 1 30  ? -5.153  25.156  6.282   1.00 0.00 ? 30  GLU A HG2  5  
ATOM 7431  H HG3  . GLU A 1 30  ? -4.779  24.177  7.686   1.00 0.00 ? 30  GLU A HG3  5  
ATOM 7432  N N    . PRO A 1 31  ? -3.637  22.399  3.042   1.00 0.00 ? 31  PRO A N    5  
ATOM 7433  C CA   . PRO A 1 31  ? -3.093  21.446  2.090   1.00 0.00 ? 31  PRO A CA   5  
ATOM 7434  C C    . PRO A 1 31  ? -2.874  20.081  2.746   1.00 0.00 ? 31  PRO A C    5  
ATOM 7435  O O    . PRO A 1 31  ? -2.888  19.967  3.971   1.00 0.00 ? 31  PRO A O    5  
ATOM 7436  C CB   . PRO A 1 31  ? -1.805  22.078  1.591   1.00 0.00 ? 31  PRO A CB   5  
ATOM 7437  C CG   . PRO A 1 31  ? -1.436  23.138  2.617   1.00 0.00 ? 31  PRO A CG   5  
ATOM 7438  C CD   . PRO A 1 31  ? -2.650  23.372  3.502   1.00 0.00 ? 31  PRO A CD   5  
ATOM 7439  H HA   . PRO A 1 31  ? -3.743  21.290  1.346   1.00 0.00 ? 31  PRO A HA   5  
ATOM 7440  H HB2  . PRO A 1 31  ? -1.014  21.334  1.498   1.00 0.00 ? 31  PRO A HB2  5  
ATOM 7441  H HB3  . PRO A 1 31  ? -1.943  22.521  0.605   1.00 0.00 ? 31  PRO A HB3  5  
ATOM 7442  H HG2  . PRO A 1 31  ? -0.585  22.812  3.214   1.00 0.00 ? 31  PRO A HG2  5  
ATOM 7443  H HG3  . PRO A 1 31  ? -1.141  24.063  2.120   1.00 0.00 ? 31  PRO A HG3  5  
ATOM 7444  H HD2  . PRO A 1 31  ? -2.407  23.223  4.554   1.00 0.00 ? 31  PRO A HD2  5  
ATOM 7445  H HD3  . PRO A 1 31  ? -3.022  24.392  3.402   1.00 0.00 ? 31  PRO A HD3  5  
ATOM 7446  N N    . LEU A 1 32  ? -2.677  19.079  1.902   1.00 0.00 ? 32  LEU A N    5  
ATOM 7447  C CA   . LEU A 1 32  ? -2.455  17.726  2.384   1.00 0.00 ? 32  LEU A CA   5  
ATOM 7448  C C    . LEU A 1 32  ? -1.109  17.662  3.109   1.00 0.00 ? 32  LEU A C    5  
ATOM 7449  O O    . LEU A 1 32  ? -1.052  17.331  4.292   1.00 0.00 ? 32  LEU A O    5  
ATOM 7450  C CB   . LEU A 1 32  ? -2.585  16.721  1.238   1.00 0.00 ? 32  LEU A CB   5  
ATOM 7451  C CG   . LEU A 1 32  ? -2.915  15.283  1.642   1.00 0.00 ? 32  LEU A CG   5  
ATOM 7452  C CD1  . LEU A 1 32  ? -4.285  15.204  2.319   1.00 0.00 ? 32  LEU A CD1  5  
ATOM 7453  C CD2  . LEU A 1 32  ? -2.813  14.339  0.443   1.00 0.00 ? 32  LEU A CD2  5  
ATOM 7454  H H    . LEU A 1 32  ? -2.667  19.180  0.907   1.00 0.00 ? 32  LEU A H    5  
ATOM 7455  H HA   . LEU A 1 32  ? -3.245  17.502  3.101   1.00 0.00 ? 32  LEU A HA   5  
ATOM 7456  H HB2  . LEU A 1 32  ? -3.360  17.073  0.558   1.00 0.00 ? 32  LEU A HB2  5  
ATOM 7457  H HB3  . LEU A 1 32  ? -1.649  16.714  0.679   1.00 0.00 ? 32  LEU A HB3  5  
ATOM 7458  H HG   . LEU A 1 32  ? -2.176  14.955  2.374   1.00 0.00 ? 32  LEU A HG   5  
ATOM 7459  H HD11 . LEU A 1 32  ? -4.979  15.877  1.814   1.00 0.00 ? 32  LEU A HD11 5  
ATOM 7460  H HD12 . LEU A 1 32  ? -4.662  14.183  2.259   1.00 0.00 ? 32  LEU A HD12 5  
ATOM 7461  H HD13 . LEU A 1 32  ? -4.192  15.496  3.364   1.00 0.00 ? 32  LEU A HD13 5  
ATOM 7462  H HD21 . LEU A 1 32  ? -2.450  13.366  0.775   1.00 0.00 ? 32  LEU A HD21 5  
ATOM 7463  H HD22 . LEU A 1 32  ? -3.796  14.223  -0.014  1.00 0.00 ? 32  LEU A HD22 5  
ATOM 7464  H HD23 . LEU A 1 32  ? -2.120  14.754  -0.289  1.00 0.00 ? 32  LEU A HD23 5  
ATOM 7465  N N    . GLY A 1 33  ? -0.059  17.984  2.369   1.00 0.00 ? 33  GLY A N    5  
ATOM 7466  C CA   . GLY A 1 33  ? 1.283   17.968  2.926   1.00 0.00 ? 33  GLY A CA   5  
ATOM 7467  C C    . GLY A 1 33  ? 1.915   16.580  2.793   1.00 0.00 ? 33  GLY A C    5  
ATOM 7468  O O    . GLY A 1 33  ? 2.317   15.979  3.788   1.00 0.00 ? 33  GLY A O    5  
ATOM 7469  H H    . GLY A 1 33  ? -0.113  18.253  1.407   1.00 0.00 ? 33  GLY A H    5  
ATOM 7470  H HA2  . GLY A 1 33  ? 1.903   18.704  2.414   1.00 0.00 ? 33  GLY A HA2  5  
ATOM 7471  H HA3  . GLY A 1 33  ? 1.248   18.256  3.977   1.00 0.00 ? 33  GLY A HA3  5  
ATOM 7472  N N    . ILE A 1 34  ? 1.983   16.112  1.556   1.00 0.00 ? 34  ILE A N    5  
ATOM 7473  C CA   . ILE A 1 34  ? 2.559   14.807  1.280   1.00 0.00 ? 34  ILE A CA   5  
ATOM 7474  C C    . ILE A 1 34  ? 3.158   14.806  -0.128  1.00 0.00 ? 34  ILE A C    5  
ATOM 7475  O O    . ILE A 1 34  ? 2.631   15.455  -1.031  1.00 0.00 ? 34  ILE A O    5  
ATOM 7476  C CB   . ILE A 1 34  ? 1.522   13.705  1.508   1.00 0.00 ? 34  ILE A CB   5  
ATOM 7477  C CG1  . ILE A 1 34  ? 0.250   13.973  0.701   1.00 0.00 ? 34  ILE A CG1  5  
ATOM 7478  C CG2  . ILE A 1 34  ? 1.229   13.529  2.999   1.00 0.00 ? 34  ILE A CG2  5  
ATOM 7479  C CD1  . ILE A 1 34  ? -0.080  12.790  -0.211  1.00 0.00 ? 34  ILE A CD1  5  
ATOM 7480  H H    . ILE A 1 34  ? 1.654   16.608  0.752   1.00 0.00 ? 34  ILE A H    5  
ATOM 7481  H HA   . ILE A 1 34  ? 3.363   14.647  1.997   1.00 0.00 ? 34  ILE A HA   5  
ATOM 7482  H HB   . ILE A 1 34  ? 1.939   12.765  1.148   1.00 0.00 ? 34  ILE A HB   5  
ATOM 7483  H HG12 . ILE A 1 34  ? -0.583  14.157  1.380   1.00 0.00 ? 34  ILE A HG12 5  
ATOM 7484  H HG13 . ILE A 1 34  ? 0.379   14.875  0.102   1.00 0.00 ? 34  ILE A HG13 5  
ATOM 7485  H HG21 . ILE A 1 34  ? 2.155   13.300  3.527   1.00 0.00 ? 34  ILE A HG21 5  
ATOM 7486  H HG22 . ILE A 1 34  ? 0.802   14.449  3.397   1.00 0.00 ? 34  ILE A HG22 5  
ATOM 7487  H HG23 . ILE A 1 34  ? 0.522   12.711  3.136   1.00 0.00 ? 34  ILE A HG23 5  
ATOM 7488  H HD11 . ILE A 1 34  ? -1.037  12.966  -0.702  1.00 0.00 ? 34  ILE A HD11 5  
ATOM 7489  H HD12 . ILE A 1 34  ? 0.700   12.684  -0.965  1.00 0.00 ? 34  ILE A HD12 5  
ATOM 7490  H HD13 . ILE A 1 34  ? -0.138  11.878  0.383   1.00 0.00 ? 34  ILE A HD13 5  
ATOM 7491  N N    . SER A 1 35  ? 4.250   14.071  -0.272  1.00 0.00 ? 35  SER A N    5  
ATOM 7492  C CA   . SER A 1 35  ? 4.926   13.977  -1.554  1.00 0.00 ? 35  SER A CA   5  
ATOM 7493  C C    . SER A 1 35  ? 4.563   12.659  -2.242  1.00 0.00 ? 35  SER A C    5  
ATOM 7494  O O    . SER A 1 35  ? 4.383   11.638  -1.580  1.00 0.00 ? 35  SER A O    5  
ATOM 7495  C CB   . SER A 1 35  ? 6.443   14.088  -1.387  1.00 0.00 ? 35  SER A CB   5  
ATOM 7496  O OG   . SER A 1 35  ? 7.080   14.536  -2.580  1.00 0.00 ? 35  SER A OG   5  
ATOM 7497  H H    . SER A 1 35  ? 4.672   13.546  0.468   1.00 0.00 ? 35  SER A H    5  
ATOM 7498  H HA   . SER A 1 35  ? 4.562   14.824  -2.135  1.00 0.00 ? 35  SER A HA   5  
ATOM 7499  H HB2  . SER A 1 35  ? 6.668   14.779  -0.575  1.00 0.00 ? 35  SER A HB2  5  
ATOM 7500  H HB3  . SER A 1 35  ? 6.849   13.117  -1.102  1.00 0.00 ? 35  SER A HB3  5  
ATOM 7501  H HG   . SER A 1 35  ? 6.744   14.014  -3.364  1.00 0.00 ? 35  SER A HG   5  
ATOM 7502  N N    . ILE A 1 36  ? 4.467   12.724  -3.562  1.00 0.00 ? 36  ILE A N    5  
ATOM 7503  C CA   . ILE A 1 36  ? 4.129   11.549  -4.346  1.00 0.00 ? 36  ILE A CA   5  
ATOM 7504  C C    . ILE A 1 36  ? 5.031   11.487  -5.580  1.00 0.00 ? 36  ILE A C    5  
ATOM 7505  O O    . ILE A 1 36  ? 5.525   12.514  -6.044  1.00 0.00 ? 36  ILE A O    5  
ATOM 7506  C CB   . ILE A 1 36  ? 2.635   11.536  -4.676  1.00 0.00 ? 36  ILE A CB   5  
ATOM 7507  C CG1  . ILE A 1 36  ? 2.242   12.771  -5.489  1.00 0.00 ? 36  ILE A CG1  5  
ATOM 7508  C CG2  . ILE A 1 36  ? 1.794   11.395  -3.405  1.00 0.00 ? 36  ILE A CG2  5  
ATOM 7509  C CD1  . ILE A 1 36  ? 2.407   12.516  -6.988  1.00 0.00 ? 36  ILE A CD1  5  
ATOM 7510  H H    . ILE A 1 36  ? 4.615   13.558  -4.093  1.00 0.00 ? 36  ILE A H    5  
ATOM 7511  H HA   . ILE A 1 36  ? 4.330   10.674  -3.727  1.00 0.00 ? 36  ILE A HA   5  
ATOM 7512  H HB   . ILE A 1 36  ? 2.429   10.664  -5.296  1.00 0.00 ? 36  ILE A HB   5  
ATOM 7513  H HG12 . ILE A 1 36  ? 1.208   13.039  -5.273  1.00 0.00 ? 36  ILE A HG12 5  
ATOM 7514  H HG13 . ILE A 1 36  ? 2.860   13.619  -5.191  1.00 0.00 ? 36  ILE A HG13 5  
ATOM 7515  H HG21 . ILE A 1 36  ? 1.489   12.383  -3.061  1.00 0.00 ? 36  ILE A HG21 5  
ATOM 7516  H HG22 . ILE A 1 36  ? 0.910   10.795  -3.620  1.00 0.00 ? 36  ILE A HG22 5  
ATOM 7517  H HG23 . ILE A 1 36  ? 2.385   10.907  -2.631  1.00 0.00 ? 36  ILE A HG23 5  
ATOM 7518  H HD11 . ILE A 1 36  ? 1.496   12.067  -7.383  1.00 0.00 ? 36  ILE A HD11 5  
ATOM 7519  H HD12 . ILE A 1 36  ? 2.598   13.460  -7.499  1.00 0.00 ? 36  ILE A HD12 5  
ATOM 7520  H HD13 . ILE A 1 36  ? 3.246   11.839  -7.152  1.00 0.00 ? 36  ILE A HD13 5  
ATOM 7521  N N    . VAL A 1 37  ? 5.220   10.273  -6.076  1.00 0.00 ? 37  VAL A N    5  
ATOM 7522  C CA   . VAL A 1 37  ? 6.054   10.065  -7.247  1.00 0.00 ? 37  VAL A CA   5  
ATOM 7523  C C    . VAL A 1 37  ? 5.336   9.127   -8.219  1.00 0.00 ? 37  VAL A C    5  
ATOM 7524  O O    . VAL A 1 37  ? 4.529   8.296   -7.804  1.00 0.00 ? 37  VAL A O    5  
ATOM 7525  C CB   . VAL A 1 37  ? 7.431   9.548   -6.824  1.00 0.00 ? 37  VAL A CB   5  
ATOM 7526  C CG1  . VAL A 1 37  ? 8.004   10.388  -5.682  1.00 0.00 ? 37  VAL A CG1  5  
ATOM 7527  C CG2  . VAL A 1 37  ? 7.365   8.069   -6.437  1.00 0.00 ? 37  VAL A CG2  5  
ATOM 7528  H H    . VAL A 1 37  ? 4.815   9.443   -5.693  1.00 0.00 ? 37  VAL A H    5  
ATOM 7529  H HA   . VAL A 1 37  ? 6.191   11.032  -7.730  1.00 0.00 ? 37  VAL A HA   5  
ATOM 7530  H HB   . VAL A 1 37  ? 8.101   9.641   -7.678  1.00 0.00 ? 37  VAL A HB   5  
ATOM 7531  H HG11 . VAL A 1 37  ? 7.279   10.441  -4.870  1.00 0.00 ? 37  VAL A HG11 5  
ATOM 7532  H HG12 . VAL A 1 37  ? 8.924   9.929   -5.318  1.00 0.00 ? 37  VAL A HG12 5  
ATOM 7533  H HG13 . VAL A 1 37  ? 8.219   11.394  -6.043  1.00 0.00 ? 37  VAL A HG13 5  
ATOM 7534  H HG21 . VAL A 1 37  ? 8.376   7.667   -6.364  1.00 0.00 ? 37  VAL A HG21 5  
ATOM 7535  H HG22 . VAL A 1 37  ? 6.863   7.967   -5.475  1.00 0.00 ? 37  VAL A HG22 5  
ATOM 7536  H HG23 . VAL A 1 37  ? 6.810   7.519   -7.197  1.00 0.00 ? 37  VAL A HG23 5  
ATOM 7537  N N    . SER A 1 38  ? 5.656   9.290   -9.495  1.00 0.00 ? 38  SER A N    5  
ATOM 7538  C CA   . SER A 1 38  ? 5.051   8.468   -10.529 1.00 0.00 ? 38  SER A CA   5  
ATOM 7539  C C    . SER A 1 38  ? 6.033   7.383   -10.975 1.00 0.00 ? 38  SER A C    5  
ATOM 7540  O O    . SER A 1 38  ? 7.243   7.602   -10.986 1.00 0.00 ? 38  SER A O    5  
ATOM 7541  C CB   . SER A 1 38  ? 4.620   9.318   -11.726 1.00 0.00 ? 38  SER A CB   5  
ATOM 7542  O OG   . SER A 1 38  ? 4.048   8.527   -12.764 1.00 0.00 ? 38  SER A OG   5  
ATOM 7543  H H    . SER A 1 38  ? 6.313   9.968   -9.824  1.00 0.00 ? 38  SER A H    5  
ATOM 7544  H HA   . SER A 1 38  ? 4.172   8.022   -10.066 1.00 0.00 ? 38  SER A HA   5  
ATOM 7545  H HB2  . SER A 1 38  ? 3.896   10.064  -11.399 1.00 0.00 ? 38  SER A HB2  5  
ATOM 7546  H HB3  . SER A 1 38  ? 5.482   9.859   -12.116 1.00 0.00 ? 38  SER A HB3  5  
ATOM 7547  H HG   . SER A 1 38  ? 3.051   8.526   -12.685 1.00 0.00 ? 38  SER A HG   5  
ATOM 7548  N N    . GLY A 1 39  ? 5.475   6.235   -11.332 1.00 0.00 ? 39  GLY A N    5  
ATOM 7549  C CA   . GLY A 1 39  ? 6.286   5.115   -11.778 1.00 0.00 ? 39  GLY A CA   5  
ATOM 7550  C C    . GLY A 1 39  ? 6.098   4.864   -13.276 1.00 0.00 ? 39  GLY A C    5  
ATOM 7551  O O    . GLY A 1 39  ? 5.199   5.429   -13.896 1.00 0.00 ? 39  GLY A O    5  
ATOM 7552  H H    . GLY A 1 39  ? 4.489   6.065   -11.320 1.00 0.00 ? 39  GLY A H    5  
ATOM 7553  H HA2  . GLY A 1 39  ? 7.336   5.316   -11.568 1.00 0.00 ? 39  GLY A HA2  5  
ATOM 7554  H HA3  . GLY A 1 39  ? 6.014   4.220   -11.219 1.00 0.00 ? 39  GLY A HA3  5  
ATOM 7555  N N    . GLU A 1 40  ? 6.963   4.017   -13.814 1.00 0.00 ? 40  GLU A N    5  
ATOM 7556  C CA   . GLU A 1 40  ? 6.904   3.684   -15.227 1.00 0.00 ? 40  GLU A CA   5  
ATOM 7557  C C    . GLU A 1 40  ? 5.630   2.895   -15.534 1.00 0.00 ? 40  GLU A C    5  
ATOM 7558  O O    . GLU A 1 40  ? 5.690   1.702   -15.829 1.00 0.00 ? 40  GLU A O    5  
ATOM 7559  C CB   . GLU A 1 40  ? 8.149   2.906   -15.659 1.00 0.00 ? 40  GLU A CB   5  
ATOM 7560  C CG   . GLU A 1 40  ? 8.634   3.369   -17.035 1.00 0.00 ? 40  GLU A CG   5  
ATOM 7561  C CD   . GLU A 1 40  ? 9.426   2.264   -17.737 1.00 0.00 ? 40  GLU A CD   5  
ATOM 7562  O OE1  . GLU A 1 40  ? 8.818   1.201   -17.988 1.00 0.00 ? 40  GLU A OE1  5  
ATOM 7563  O OE2  . GLU A 1 40  ? 10.622  2.507   -18.006 1.00 0.00 ? 40  GLU A OE2  5  
ATOM 7564  H H    . GLU A 1 40  ? 7.692   3.561   -13.302 1.00 0.00 ? 40  GLU A H    5  
ATOM 7565  H HA   . GLU A 1 40  ? 6.882   4.641   -15.749 1.00 0.00 ? 40  GLU A HA   5  
ATOM 7566  H HB2  . GLU A 1 40  ? 8.942   3.045   -14.925 1.00 0.00 ? 40  GLU A HB2  5  
ATOM 7567  H HB3  . GLU A 1 40  ? 7.924   1.840   -15.689 1.00 0.00 ? 40  GLU A HB3  5  
ATOM 7568  H HG2  . GLU A 1 40  ? 7.780   3.655   -17.649 1.00 0.00 ? 40  GLU A HG2  5  
ATOM 7569  H HG3  . GLU A 1 40  ? 9.258   4.255   -16.925 1.00 0.00 ? 40  GLU A HG3  5  
ATOM 7570  N N    . LYS A 1 41  ? 4.506   3.592   -15.454 1.00 0.00 ? 41  LYS A N    5  
ATOM 7571  C CA   . LYS A 1 41  ? 3.220   2.972   -15.720 1.00 0.00 ? 41  LYS A CA   5  
ATOM 7572  C C    . LYS A 1 41  ? 2.115   4.022   -15.590 1.00 0.00 ? 41  LYS A C    5  
ATOM 7573  O O    . LYS A 1 41  ? 1.160   4.023   -16.366 1.00 0.00 ? 41  LYS A O    5  
ATOM 7574  C CB   . LYS A 1 41  ? 3.017   1.752   -14.819 1.00 0.00 ? 41  LYS A CB   5  
ATOM 7575  C CG   . LYS A 1 41  ? 2.715   0.502   -15.649 1.00 0.00 ? 41  LYS A CG   5  
ATOM 7576  C CD   . LYS A 1 41  ? 1.620   -0.340  -14.992 1.00 0.00 ? 41  LYS A CD   5  
ATOM 7577  C CE   . LYS A 1 41  ? 1.484   -1.699  -15.682 1.00 0.00 ? 41  LYS A CE   5  
ATOM 7578  N NZ   . LYS A 1 41  ? 0.408   -1.660  -16.697 1.00 0.00 ? 41  LYS A NZ   5  
ATOM 7579  H H    . LYS A 1 41  ? 4.466   4.562   -15.214 1.00 0.00 ? 41  LYS A H    5  
ATOM 7580  H HA   . LYS A 1 41  ? 3.237   2.613   -16.749 1.00 0.00 ? 41  LYS A HA   5  
ATOM 7581  H HB2  . LYS A 1 41  ? 3.911   1.586   -14.218 1.00 0.00 ? 41  LYS A HB2  5  
ATOM 7582  H HB3  . LYS A 1 41  ? 2.198   1.939   -14.126 1.00 0.00 ? 41  LYS A HB3  5  
ATOM 7583  H HG2  . LYS A 1 41  ? 2.403   0.793   -16.651 1.00 0.00 ? 41  LYS A HG2  5  
ATOM 7584  H HG3  . LYS A 1 41  ? 3.621   -0.094  -15.758 1.00 0.00 ? 41  LYS A HG3  5  
ATOM 7585  H HD2  . LYS A 1 41  ? 1.851   -0.486  -13.937 1.00 0.00 ? 41  LYS A HD2  5  
ATOM 7586  H HD3  . LYS A 1 41  ? 0.669   0.192   -15.039 1.00 0.00 ? 41  LYS A HD3  5  
ATOM 7587  H HE2  . LYS A 1 41  ? 2.429   -1.969  -16.155 1.00 0.00 ? 41  LYS A HE2  5  
ATOM 7588  H HE3  . LYS A 1 41  ? 1.267   -2.469  -14.942 1.00 0.00 ? 41  LYS A HE3  5  
ATOM 7589  H HZ1  . LYS A 1 41  ? 0.750   -2.033  -17.560 1.00 0.00 ? 41  LYS A HZ1  5  
ATOM 7590  H HZ2  . LYS A 1 41  ? -0.368  -2.206  -16.382 1.00 0.00 ? 41  LYS A HZ2  5  
ATOM 7591  H HZ3  . LYS A 1 41  ? 0.115   -0.714  -16.836 1.00 0.00 ? 41  LYS A HZ3  5  
ATOM 7592  N N    . GLY A 1 42  ? 2.282   4.891   -14.605 1.00 0.00 ? 42  GLY A N    5  
ATOM 7593  C CA   . GLY A 1 42  ? 1.311   5.945   -14.363 1.00 0.00 ? 42  GLY A CA   5  
ATOM 7594  C C    . GLY A 1 42  ? 0.827   5.923   -12.912 1.00 0.00 ? 42  GLY A C    5  
ATOM 7595  O O    . GLY A 1 42  ? 0.002   6.745   -12.516 1.00 0.00 ? 42  GLY A O    5  
ATOM 7596  H H    . GLY A 1 42  ? 3.061   4.884   -13.978 1.00 0.00 ? 42  GLY A H    5  
ATOM 7597  H HA2  . GLY A 1 42  ? 1.757   6.914   -14.588 1.00 0.00 ? 42  GLY A HA2  5  
ATOM 7598  H HA3  . GLY A 1 42  ? 0.461   5.822   -15.035 1.00 0.00 ? 42  GLY A HA3  5  
ATOM 7599  N N    . GLY A 1 43  ? 1.362   4.974   -12.158 1.00 0.00 ? 43  GLY A N    5  
ATOM 7600  C CA   . GLY A 1 43  ? 0.996   4.834   -10.759 1.00 0.00 ? 43  GLY A CA   5  
ATOM 7601  C C    . GLY A 1 43  ? 1.532   6.005   -9.932  1.00 0.00 ? 43  GLY A C    5  
ATOM 7602  O O    . GLY A 1 43  ? 2.259   6.853   -10.448 1.00 0.00 ? 43  GLY A O    5  
ATOM 7603  H H    . GLY A 1 43  ? 2.033   4.309   -12.487 1.00 0.00 ? 43  GLY A H    5  
ATOM 7604  H HA2  . GLY A 1 43  ? -0.089  4.786   -10.666 1.00 0.00 ? 43  GLY A HA2  5  
ATOM 7605  H HA3  . GLY A 1 43  ? 1.391   3.897   -10.367 1.00 0.00 ? 43  GLY A HA3  5  
ATOM 7606  N N    . ILE A 1 44  ? 1.153   6.014   -8.662  1.00 0.00 ? 44  ILE A N    5  
ATOM 7607  C CA   . ILE A 1 44  ? 1.587   7.066   -7.759  1.00 0.00 ? 44  ILE A CA   5  
ATOM 7608  C C    . ILE A 1 44  ? 1.968   6.451   -6.411  1.00 0.00 ? 44  ILE A C    5  
ATOM 7609  O O    . ILE A 1 44  ? 1.252   5.598   -5.890  1.00 0.00 ? 44  ILE A O    5  
ATOM 7610  C CB   . ILE A 1 44  ? 0.521   8.158   -7.657  1.00 0.00 ? 44  ILE A CB   5  
ATOM 7611  C CG1  . ILE A 1 44  ? 0.281   8.819   -9.016  1.00 0.00 ? 44  ILE A CG1  5  
ATOM 7612  C CG2  . ILE A 1 44  ? 0.884   9.181   -6.579  1.00 0.00 ? 44  ILE A CG2  5  
ATOM 7613  C CD1  . ILE A 1 44  ? 1.453   9.723   -9.401  1.00 0.00 ? 44  ILE A CD1  5  
ATOM 7614  H H    . ILE A 1 44  ? 0.562   5.320   -8.250  1.00 0.00 ? 44  ILE A H    5  
ATOM 7615  H HA   . ILE A 1 44  ? 2.476   7.523   -8.194  1.00 0.00 ? 44  ILE A HA   5  
ATOM 7616  H HB   . ILE A 1 44  ? -0.417  7.692   -7.356  1.00 0.00 ? 44  ILE A HB   5  
ATOM 7617  H HG12 . ILE A 1 44  ? 0.144   8.052   -9.778  1.00 0.00 ? 44  ILE A HG12 5  
ATOM 7618  H HG13 . ILE A 1 44  ? -0.638  9.403   -8.983  1.00 0.00 ? 44  ILE A HG13 5  
ATOM 7619  H HG21 . ILE A 1 44  ? 1.152   10.126  -7.051  1.00 0.00 ? 44  ILE A HG21 5  
ATOM 7620  H HG22 . ILE A 1 44  ? 0.030   9.333   -5.919  1.00 0.00 ? 44  ILE A HG22 5  
ATOM 7621  H HG23 . ILE A 1 44  ? 1.730   8.812   -5.999  1.00 0.00 ? 44  ILE A HG23 5  
ATOM 7622  H HD11 . ILE A 1 44  ? 1.727   9.542   -10.440 1.00 0.00 ? 44  ILE A HD11 5  
ATOM 7623  H HD12 . ILE A 1 44  ? 1.163   10.767  -9.278  1.00 0.00 ? 44  ILE A HD12 5  
ATOM 7624  H HD13 . ILE A 1 44  ? 2.306   9.506   -8.758  1.00 0.00 ? 44  ILE A HD13 5  
ATOM 7625  N N    . TYR A 1 45  ? 3.096   6.907   -5.886  1.00 0.00 ? 45  TYR A N    5  
ATOM 7626  C CA   . TYR A 1 45  ? 3.580   6.412   -4.609  1.00 0.00 ? 45  TYR A CA   5  
ATOM 7627  C C    . TYR A 1 45  ? 4.116   7.556   -3.745  1.00 0.00 ? 45  TYR A C    5  
ATOM 7628  O O    . TYR A 1 45  ? 4.875   8.396   -4.223  1.00 0.00 ? 45  TYR A O    5  
ATOM 7629  C CB   . TYR A 1 45  ? 4.728   5.455   -4.935  1.00 0.00 ? 45  TYR A CB   5  
ATOM 7630  C CG   . TYR A 1 45  ? 4.359   4.361   -5.939  1.00 0.00 ? 45  TYR A CG   5  
ATOM 7631  C CD1  . TYR A 1 45  ? 4.479   4.598   -7.294  1.00 0.00 ? 45  TYR A CD1  5  
ATOM 7632  C CD2  . TYR A 1 45  ? 3.907   3.137   -5.491  1.00 0.00 ? 45  TYR A CD2  5  
ATOM 7633  C CE1  . TYR A 1 45  ? 4.132   3.568   -8.238  1.00 0.00 ? 45  TYR A CE1  5  
ATOM 7634  C CE2  . TYR A 1 45  ? 3.560   2.107   -6.435  1.00 0.00 ? 45  TYR A CE2  5  
ATOM 7635  C CZ   . TYR A 1 45  ? 3.690   2.373   -7.763  1.00 0.00 ? 45  TYR A CZ   5  
ATOM 7636  O OH   . TYR A 1 45  ? 3.362   1.401   -8.655  1.00 0.00 ? 45  TYR A OH   5  
ATOM 7637  H H    . TYR A 1 45  ? 3.673   7.601   -6.317  1.00 0.00 ? 45  TYR A H    5  
ATOM 7638  H HA   . TYR A 1 45  ? 2.745   5.937   -4.093  1.00 0.00 ? 45  TYR A HA   5  
ATOM 7639  H HB2  . TYR A 1 45  ? 5.565   6.030   -5.331  1.00 0.00 ? 45  TYR A HB2  5  
ATOM 7640  H HB3  . TYR A 1 45  ? 5.071   4.987   -4.013  1.00 0.00 ? 45  TYR A HB3  5  
ATOM 7641  H HD1  . TYR A 1 45  ? 4.836   5.565   -7.648  1.00 0.00 ? 45  TYR A HD1  5  
ATOM 7642  H HD2  . TYR A 1 45  ? 3.813   2.949   -4.421  1.00 0.00 ? 45  TYR A HD2  5  
ATOM 7643  H HE1  . TYR A 1 45  ? 4.222   3.742   -9.311  1.00 0.00 ? 45  TYR A HE1  5  
ATOM 7644  H HE2  . TYR A 1 45  ? 3.202   1.135   -6.095  1.00 0.00 ? 45  TYR A HE2  5  
ATOM 7645  H HH   . TYR A 1 45  ? 3.088   1.812   -9.524  1.00 0.00 ? 45  TYR A HH   5  
ATOM 7646  N N    . VAL A 1 46  ? 3.699   7.550   -2.487  1.00 0.00 ? 46  VAL A N    5  
ATOM 7647  C CA   . VAL A 1 46  ? 4.127   8.577   -1.552  1.00 0.00 ? 46  VAL A CA   5  
ATOM 7648  C C    . VAL A 1 46  ? 5.656   8.602   -1.495  1.00 0.00 ? 46  VAL A C    5  
ATOM 7649  O O    . VAL A 1 46  ? 6.295   7.555   -1.415  1.00 0.00 ? 46  VAL A O    5  
ATOM 7650  C CB   . VAL A 1 46  ? 3.481   8.342   -0.185  1.00 0.00 ? 46  VAL A CB   5  
ATOM 7651  C CG1  . VAL A 1 46  ? 4.024   9.325   0.854   1.00 0.00 ? 46  VAL A CG1  5  
ATOM 7652  C CG2  . VAL A 1 46  ? 1.956   8.427   -0.277  1.00 0.00 ? 46  VAL A CG2  5  
ATOM 7653  H H    . VAL A 1 46  ? 3.081   6.863   -2.106  1.00 0.00 ? 46  VAL A H    5  
ATOM 7654  H HA   . VAL A 1 46  ? 3.774   9.535   -1.932  1.00 0.00 ? 46  VAL A HA   5  
ATOM 7655  H HB   . VAL A 1 46  ? 3.741   7.334   0.139   1.00 0.00 ? 46  VAL A HB   5  
ATOM 7656  H HG11 . VAL A 1 46  ? 5.106   9.216   0.926   1.00 0.00 ? 46  VAL A HG11 5  
ATOM 7657  H HG12 . VAL A 1 46  ? 3.780   10.344  0.552   1.00 0.00 ? 46  VAL A HG12 5  
ATOM 7658  H HG13 . VAL A 1 46  ? 3.572   9.115   1.823   1.00 0.00 ? 46  VAL A HG13 5  
ATOM 7659  H HG21 . VAL A 1 46  ? 1.661   8.537   -1.320  1.00 0.00 ? 46  VAL A HG21 5  
ATOM 7660  H HG22 . VAL A 1 46  ? 1.517   7.517   0.131   1.00 0.00 ? 46  VAL A HG22 5  
ATOM 7661  H HG23 . VAL A 1 46  ? 1.606   9.287   0.293   1.00 0.00 ? 46  VAL A HG23 5  
ATOM 7662  N N    . SER A 1 47  ? 6.197   9.811   -1.539  1.00 0.00 ? 47  SER A N    5  
ATOM 7663  C CA   . SER A 1 47  ? 7.639   9.987   -1.493  1.00 0.00 ? 47  SER A CA   5  
ATOM 7664  C C    . SER A 1 47  ? 8.053   10.565  -0.138  1.00 0.00 ? 47  SER A C    5  
ATOM 7665  O O    . SER A 1 47  ? 9.211   10.454  0.261   1.00 0.00 ? 47  SER A O    5  
ATOM 7666  C CB   . SER A 1 47  ? 8.119   10.895  -2.626  1.00 0.00 ? 47  SER A CB   5  
ATOM 7667  O OG   . SER A 1 47  ? 9.017   11.899  -2.162  1.00 0.00 ? 47  SER A OG   5  
ATOM 7668  H H    . SER A 1 47  ? 5.670   10.658  -1.604  1.00 0.00 ? 47  SER A H    5  
ATOM 7669  H HA   . SER A 1 47  ? 8.056   8.989   -1.626  1.00 0.00 ? 47  SER A HA   5  
ATOM 7670  H HB2  . SER A 1 47  ? 8.612   10.293  -3.389  1.00 0.00 ? 47  SER A HB2  5  
ATOM 7671  H HB3  . SER A 1 47  ? 7.260   11.369  -3.101  1.00 0.00 ? 47  SER A HB3  5  
ATOM 7672  H HG   . SER A 1 47  ? 8.646   12.807  -2.358  1.00 0.00 ? 47  SER A HG   5  
ATOM 7673  N N    . LYS A 1 48  ? 7.083   11.170  0.532   1.00 0.00 ? 48  LYS A N    5  
ATOM 7674  C CA   . LYS A 1 48  ? 7.332   11.766  1.834   1.00 0.00 ? 48  LYS A CA   5  
ATOM 7675  C C    . LYS A 1 48  ? 6.022   12.324  2.394   1.00 0.00 ? 48  LYS A C    5  
ATOM 7676  O O    . LYS A 1 48  ? 5.058   12.516  1.654   1.00 0.00 ? 48  LYS A O    5  
ATOM 7677  C CB   . LYS A 1 48  ? 8.453   12.803  1.743   1.00 0.00 ? 48  LYS A CB   5  
ATOM 7678  C CG   . LYS A 1 48  ? 9.231   12.887  3.058   1.00 0.00 ? 48  LYS A CG   5  
ATOM 7679  C CD   . LYS A 1 48  ? 10.711  12.565  2.841   1.00 0.00 ? 48  LYS A CD   5  
ATOM 7680  C CE   . LYS A 1 48  ? 11.541  12.945  4.068   1.00 0.00 ? 48  LYS A CE   5  
ATOM 7681  N NZ   . LYS A 1 48  ? 12.374  11.802  4.505   1.00 0.00 ? 48  LYS A NZ   5  
ATOM 7682  H H    . LYS A 1 48  ? 6.143   11.256  0.201   1.00 0.00 ? 48  LYS A H    5  
ATOM 7683  H HA   . LYS A 1 48  ? 7.680   10.972  2.495   1.00 0.00 ? 48  LYS A HA   5  
ATOM 7684  H HB2  . LYS A 1 48  ? 9.131   12.541  0.931   1.00 0.00 ? 48  LYS A HB2  5  
ATOM 7685  H HB3  . LYS A 1 48  ? 8.031   13.779  1.503   1.00 0.00 ? 48  LYS A HB3  5  
ATOM 7686  H HG2  . LYS A 1 48  ? 9.131   13.886  3.481   1.00 0.00 ? 48  LYS A HG2  5  
ATOM 7687  H HG3  . LYS A 1 48  ? 8.806   12.191  3.781   1.00 0.00 ? 48  LYS A HG3  5  
ATOM 7688  H HD2  . LYS A 1 48  ? 10.828  11.501  2.633   1.00 0.00 ? 48  LYS A HD2  5  
ATOM 7689  H HD3  . LYS A 1 48  ? 11.079  13.103  1.967   1.00 0.00 ? 48  LYS A HD3  5  
ATOM 7690  H HE2  . LYS A 1 48  ? 12.177  13.798  3.835   1.00 0.00 ? 48  LYS A HE2  5  
ATOM 7691  H HE3  . LYS A 1 48  ? 10.881  13.251  4.880   1.00 0.00 ? 48  LYS A HE3  5  
ATOM 7692  H HZ1  . LYS A 1 48  ? 11.938  11.348  5.281   1.00 0.00 ? 48  LYS A HZ1  5  
ATOM 7693  H HZ2  . LYS A 1 48  ? 12.471  11.153  3.750   1.00 0.00 ? 48  LYS A HZ2  5  
ATOM 7694  H HZ3  . LYS A 1 48  ? 13.278  12.133  4.777   1.00 0.00 ? 48  LYS A HZ3  5  
ATOM 7695  N N    . VAL A 1 49  ? 6.028   12.569  3.696   1.00 0.00 ? 49  VAL A N    5  
ATOM 7696  C CA   . VAL A 1 49  ? 4.853   13.101  4.363   1.00 0.00 ? 49  VAL A CA   5  
ATOM 7697  C C    . VAL A 1 49  ? 5.243   14.349  5.157   1.00 0.00 ? 49  VAL A C    5  
ATOM 7698  O O    . VAL A 1 49  ? 6.420   14.567  5.439   1.00 0.00 ? 49  VAL A O    5  
ATOM 7699  C CB   . VAL A 1 49  ? 4.209   12.018  5.231   1.00 0.00 ? 49  VAL A CB   5  
ATOM 7700  C CG1  . VAL A 1 49  ? 3.700   12.603  6.551   1.00 0.00 ? 49  VAL A CG1  5  
ATOM 7701  C CG2  . VAL A 1 49  ? 3.083   11.308  4.477   1.00 0.00 ? 49  VAL A CG2  5  
ATOM 7702  H H    . VAL A 1 49  ? 6.816   12.410  4.291   1.00 0.00 ? 49  VAL A H    5  
ATOM 7703  H HA   . VAL A 1 49  ? 4.137   13.385  3.592   1.00 0.00 ? 49  VAL A HA   5  
ATOM 7704  H HB   . VAL A 1 49  ? 4.974   11.278  5.466   1.00 0.00 ? 49  VAL A HB   5  
ATOM 7705  H HG11 . VAL A 1 49  ? 3.257   11.810  7.153   1.00 0.00 ? 49  VAL A HG11 5  
ATOM 7706  H HG12 . VAL A 1 49  ? 4.533   13.050  7.094   1.00 0.00 ? 49  VAL A HG12 5  
ATOM 7707  H HG13 . VAL A 1 49  ? 2.949   13.365  6.344   1.00 0.00 ? 49  VAL A HG13 5  
ATOM 7708  H HG21 . VAL A 1 49  ? 3.223   11.443  3.404   1.00 0.00 ? 49  VAL A HG21 5  
ATOM 7709  H HG22 . VAL A 1 49  ? 3.101   10.244  4.714   1.00 0.00 ? 49  VAL A HG22 5  
ATOM 7710  H HG23 . VAL A 1 49  ? 2.123   11.730  4.774   1.00 0.00 ? 49  VAL A HG23 5  
ATOM 7711  N N    . THR A 1 50  ? 4.233   15.137  5.494   1.00 0.00 ? 50  THR A N    5  
ATOM 7712  C CA   . THR A 1 50  ? 4.455   16.358  6.249   1.00 0.00 ? 50  THR A CA   5  
ATOM 7713  C C    . THR A 1 50  ? 3.952   16.197  7.685   1.00 0.00 ? 50  THR A C    5  
ATOM 7714  O O    . THR A 1 50  ? 2.840   15.720  7.906   1.00 0.00 ? 50  THR A O    5  
ATOM 7715  C CB   . THR A 1 50  ? 3.786   17.509  5.496   1.00 0.00 ? 50  THR A CB   5  
ATOM 7716  O OG1  . THR A 1 50  ? 4.433   17.517  4.226   1.00 0.00 ? 50  THR A OG1  5  
ATOM 7717  C CG2  . THR A 1 50  ? 4.123   18.876  6.094   1.00 0.00 ? 50  THR A CG2  5  
ATOM 7718  H H    . THR A 1 50  ? 3.278   14.953  5.260   1.00 0.00 ? 50  THR A H    5  
ATOM 7719  H HA   . THR A 1 50  ? 5.529   16.536  6.305   1.00 0.00 ? 50  THR A HA   5  
ATOM 7720  H HB   . THR A 1 50  ? 2.707   17.363  5.442   1.00 0.00 ? 50  THR A HB   5  
ATOM 7721  H HG1  . THR A 1 50  ? 4.461   16.590  3.852   1.00 0.00 ? 50  THR A HG1  5  
ATOM 7722  H HG21 . THR A 1 50  ? 4.361   18.761  7.152   1.00 0.00 ? 50  THR A HG21 5  
ATOM 7723  H HG22 . THR A 1 50  ? 4.982   19.299  5.573   1.00 0.00 ? 50  THR A HG22 5  
ATOM 7724  H HG23 . THR A 1 50  ? 3.268   19.542  5.985   1.00 0.00 ? 50  THR A HG23 5  
ATOM 7725  N N    . VAL A 1 51  ? 4.794   16.603  8.623   1.00 0.00 ? 51  VAL A N    5  
ATOM 7726  C CA   . VAL A 1 51  ? 4.448   16.510  10.031  1.00 0.00 ? 51  VAL A CA   5  
ATOM 7727  C C    . VAL A 1 51  ? 3.437   17.604  10.377  1.00 0.00 ? 51  VAL A C    5  
ATOM 7728  O O    . VAL A 1 51  ? 3.588   18.750  9.955   1.00 0.00 ? 51  VAL A O    5  
ATOM 7729  C CB   . VAL A 1 51  ? 5.715   16.574  10.887  1.00 0.00 ? 51  VAL A CB   5  
ATOM 7730  C CG1  . VAL A 1 51  ? 5.387   16.988  12.322  1.00 0.00 ? 51  VAL A CG1  5  
ATOM 7731  C CG2  . VAL A 1 51  ? 6.464   15.240  10.858  1.00 0.00 ? 51  VAL A CG2  5  
ATOM 7732  H H    . VAL A 1 51  ? 5.697   16.990  8.434   1.00 0.00 ? 51  VAL A H    5  
ATOM 7733  H HA   . VAL A 1 51  ? 3.982   15.538  10.191  1.00 0.00 ? 51  VAL A HA   5  
ATOM 7734  H HB   . VAL A 1 51  ? 6.369   17.334  10.460  1.00 0.00 ? 51  VAL A HB   5  
ATOM 7735  H HG11 . VAL A 1 51  ? 5.450   18.072  12.411  1.00 0.00 ? 51  VAL A HG11 5  
ATOM 7736  H HG12 . VAL A 1 51  ? 4.378   16.661  12.573  1.00 0.00 ? 51  VAL A HG12 5  
ATOM 7737  H HG13 . VAL A 1 51  ? 6.099   16.525  13.006  1.00 0.00 ? 51  VAL A HG13 5  
ATOM 7738  H HG21 . VAL A 1 51  ? 6.726   14.992  9.829   1.00 0.00 ? 51  VAL A HG21 5  
ATOM 7739  H HG22 . VAL A 1 51  ? 7.373   15.321  11.454  1.00 0.00 ? 51  VAL A HG22 5  
ATOM 7740  H HG23 . VAL A 1 51  ? 5.828   14.457  11.270  1.00 0.00 ? 51  VAL A HG23 5  
ATOM 7741  N N    . GLY A 1 52  ? 2.428   17.213  11.142  1.00 0.00 ? 52  GLY A N    5  
ATOM 7742  C CA   . GLY A 1 52  ? 1.392   18.147  11.550  1.00 0.00 ? 52  GLY A CA   5  
ATOM 7743  C C    . GLY A 1 52  ? 0.583   18.628  10.344  1.00 0.00 ? 52  GLY A C    5  
ATOM 7744  O O    . GLY A 1 52  ? -0.007  19.707  10.378  1.00 0.00 ? 52  GLY A O    5  
ATOM 7745  H H    . GLY A 1 52  ? 2.313   16.279  11.481  1.00 0.00 ? 52  GLY A H    5  
ATOM 7746  H HA2  . GLY A 1 52  ? 0.729   17.668  12.270  1.00 0.00 ? 52  GLY A HA2  5  
ATOM 7747  H HA3  . GLY A 1 52  ? 1.845   19.001  12.053  1.00 0.00 ? 52  GLY A HA3  5  
ATOM 7748  N N    . SER A 1 53  ? 0.581   17.805  9.306   1.00 0.00 ? 53  SER A N    5  
ATOM 7749  C CA   . SER A 1 53  ? -0.146  18.133  8.092   1.00 0.00 ? 53  SER A CA   5  
ATOM 7750  C C    . SER A 1 53  ? -1.408  17.274  7.989   1.00 0.00 ? 53  SER A C    5  
ATOM 7751  O O    . SER A 1 53  ? -1.471  16.187  8.561   1.00 0.00 ? 53  SER A O    5  
ATOM 7752  C CB   . SER A 1 53  ? 0.731   17.938  6.854   1.00 0.00 ? 53  SER A CB   5  
ATOM 7753  O OG   . SER A 1 53  ? 1.122   19.180  6.274   1.00 0.00 ? 53  SER A OG   5  
ATOM 7754  H H    . SER A 1 53  ? 1.063   16.929  9.286   1.00 0.00 ? 53  SER A H    5  
ATOM 7755  H HA   . SER A 1 53  ? -0.408  19.187  8.188   1.00 0.00 ? 53  SER A HA   5  
ATOM 7756  H HB2  . SER A 1 53  ? 1.621   17.370  7.126   1.00 0.00 ? 53  SER A HB2  5  
ATOM 7757  H HB3  . SER A 1 53  ? 0.190   17.347  6.115   1.00 0.00 ? 53  SER A HB3  5  
ATOM 7758  H HG   . SER A 1 53  ? 0.473   19.442  5.560   1.00 0.00 ? 53  SER A HG   5  
ATOM 7759  N N    . ILE A 1 54  ? -2.381  17.793  7.255   1.00 0.00 ? 54  ILE A N    5  
ATOM 7760  C CA   . ILE A 1 54  ? -3.637  17.087  7.070   1.00 0.00 ? 54  ILE A CA   5  
ATOM 7761  C C    . ILE A 1 54  ? -3.355  15.595  6.879   1.00 0.00 ? 54  ILE A C    5  
ATOM 7762  O O    . ILE A 1 54  ? -3.720  14.778  7.722   1.00 0.00 ? 54  ILE A O    5  
ATOM 7763  C CB   . ILE A 1 54  ? -4.440  17.712  5.927   1.00 0.00 ? 54  ILE A CB   5  
ATOM 7764  C CG1  . ILE A 1 54  ? -4.812  19.161  6.247   1.00 0.00 ? 54  ILE A CG1  5  
ATOM 7765  C CG2  . ILE A 1 54  ? -5.670  16.865  5.594   1.00 0.00 ? 54  ILE A CG2  5  
ATOM 7766  C CD1  . ILE A 1 54  ? -5.801  19.230  7.412   1.00 0.00 ? 54  ILE A CD1  5  
ATOM 7767  H H    . ILE A 1 54  ? -2.322  18.678  6.793   1.00 0.00 ? 54  ILE A H    5  
ATOM 7768  H HA   . ILE A 1 54  ? -4.221  17.214  7.981   1.00 0.00 ? 54  ILE A HA   5  
ATOM 7769  H HB   . ILE A 1 54  ? -3.811  17.730  5.037   1.00 0.00 ? 54  ILE A HB   5  
ATOM 7770  H HG12 . ILE A 1 54  ? -3.912  19.725  6.496   1.00 0.00 ? 54  ILE A HG12 5  
ATOM 7771  H HG13 . ILE A 1 54  ? -5.248  19.632  5.366   1.00 0.00 ? 54  ILE A HG13 5  
ATOM 7772  H HG21 . ILE A 1 54  ? -6.519  17.520  5.395   1.00 0.00 ? 54  ILE A HG21 5  
ATOM 7773  H HG22 . ILE A 1 54  ? -5.465  16.258  4.712   1.00 0.00 ? 54  ILE A HG22 5  
ATOM 7774  H HG23 . ILE A 1 54  ? -5.903  16.215  6.437   1.00 0.00 ? 54  ILE A HG23 5  
ATOM 7775  H HD11 . ILE A 1 54  ? -6.347  18.289  7.481   1.00 0.00 ? 54  ILE A HD11 5  
ATOM 7776  H HD12 . ILE A 1 54  ? -5.258  19.403  8.341   1.00 0.00 ? 54  ILE A HD12 5  
ATOM 7777  H HD13 . ILE A 1 54  ? -6.504  20.046  7.244   1.00 0.00 ? 54  ILE A HD13 5  
ATOM 7778  N N    . ALA A 1 55  ? -2.708  15.286  5.765   1.00 0.00 ? 55  ALA A N    5  
ATOM 7779  C CA   . ALA A 1 55  ? -2.373  13.907  5.452   1.00 0.00 ? 55  ALA A CA   5  
ATOM 7780  C C    . ALA A 1 55  ? -1.930  13.192  6.730   1.00 0.00 ? 55  ALA A C    5  
ATOM 7781  O O    . ALA A 1 55  ? -2.508  12.176  7.110   1.00 0.00 ? 55  ALA A O    5  
ATOM 7782  C CB   . ALA A 1 55  ? -1.298  13.876  4.364   1.00 0.00 ? 55  ALA A CB   5  
ATOM 7783  H H    . ALA A 1 55  ? -2.415  15.957  5.084   1.00 0.00 ? 55  ALA A H    5  
ATOM 7784  H HA   . ALA A 1 55  ? -3.273  13.425  5.070   1.00 0.00 ? 55  ALA A HA   5  
ATOM 7785  H HB1  . ALA A 1 55  ? -1.058  14.896  4.062   1.00 0.00 ? 55  ALA A HB1  5  
ATOM 7786  H HB2  . ALA A 1 55  ? -0.402  13.392  4.752   1.00 0.00 ? 55  ALA A HB2  5  
ATOM 7787  H HB3  . ALA A 1 55  ? -1.669  13.320  3.503   1.00 0.00 ? 55  ALA A HB3  5  
ATOM 7788  N N    . HIS A 1 56  ? -0.906  13.752  7.358   1.00 0.00 ? 56  HIS A N    5  
ATOM 7789  C CA   . HIS A 1 56  ? -0.378  13.181  8.585   1.00 0.00 ? 56  HIS A CA   5  
ATOM 7790  C C    . HIS A 1 56  ? -1.529  12.875  9.546   1.00 0.00 ? 56  HIS A C    5  
ATOM 7791  O O    . HIS A 1 56  ? -1.556  11.815  10.169  1.00 0.00 ? 56  HIS A O    5  
ATOM 7792  C CB   . HIS A 1 56  ? 0.680   14.100  9.201   1.00 0.00 ? 56  HIS A CB   5  
ATOM 7793  C CG   . HIS A 1 56  ? 0.704   14.083  10.711  1.00 0.00 ? 56  HIS A CG   5  
ATOM 7794  N ND1  . HIS A 1 56  ? -0.010  14.983  11.482  1.00 0.00 ? 56  HIS A ND1  5  
ATOM 7795  C CD2  . HIS A 1 56  ? 1.363   13.266  11.582  1.00 0.00 ? 56  HIS A CD2  5  
ATOM 7796  C CE1  . HIS A 1 56  ? 0.217   14.711  12.759  1.00 0.00 ? 56  HIS A CE1  5  
ATOM 7797  N NE2  . HIS A 1 56  ? 1.068   13.647  12.819  1.00 0.00 ? 56  HIS A NE2  5  
ATOM 7798  H H    . HIS A 1 56  ? -0.441  14.579  7.042   1.00 0.00 ? 56  HIS A H    5  
ATOM 7799  H HA   . HIS A 1 56  ? 0.113   12.247  8.310   1.00 0.00 ? 56  HIS A HA   5  
ATOM 7800  H HB2  . HIS A 1 56  ? 1.662   13.807  8.828   1.00 0.00 ? 56  HIS A HB2  5  
ATOM 7801  H HB3  . HIS A 1 56  ? 0.502   15.120  8.862   1.00 0.00 ? 56  HIS A HB3  5  
ATOM 7802  H HD1  . HIS A 1 56  ? -0.597  15.714  11.135  1.00 0.00 ? 56  HIS A HD1  5  
ATOM 7803  H HD2  . HIS A 1 56  ? 2.019   12.440  11.309  1.00 0.00 ? 56  HIS A HD2  5  
ATOM 7804  H HE1  . HIS A 1 56  ? -0.203  15.244  13.612  1.00 0.00 ? 56  HIS A HE1  5  
ATOM 7805  N N    . GLN A 1 57  ? -2.451  13.822  9.635   1.00 0.00 ? 57  GLN A N    5  
ATOM 7806  C CA   . GLN A 1 57  ? -3.601  13.668  10.509  1.00 0.00 ? 57  GLN A CA   5  
ATOM 7807  C C    . GLN A 1 57  ? -4.441  12.466  10.072  1.00 0.00 ? 57  GLN A C    5  
ATOM 7808  O O    . GLN A 1 57  ? -4.912  11.696  10.908  1.00 0.00 ? 57  GLN A O    5  
ATOM 7809  C CB   . GLN A 1 57  ? -4.444  14.944  10.538  1.00 0.00 ? 57  GLN A CB   5  
ATOM 7810  C CG   . GLN A 1 57  ? -3.590  16.156  10.915  1.00 0.00 ? 57  GLN A CG   5  
ATOM 7811  C CD   . GLN A 1 57  ? -4.462  17.303  11.431  1.00 0.00 ? 57  GLN A CD   5  
ATOM 7812  O OE1  . GLN A 1 57  ? -5.118  17.205  12.455  1.00 0.00 ? 57  GLN A OE1  5  
ATOM 7813  N NE2  . GLN A 1 57  ? -4.433  18.391  10.667  1.00 0.00 ? 57  GLN A NE2  5  
ATOM 7814  H H    . GLN A 1 57  ? -2.420  14.682  9.124   1.00 0.00 ? 57  GLN A H    5  
ATOM 7815  H HA   . GLN A 1 57  ? -3.188  13.489  11.502  1.00 0.00 ? 57  GLN A HA   5  
ATOM 7816  H HB2  . GLN A 1 57  ? -4.899  15.106  9.561   1.00 0.00 ? 57  GLN A HB2  5  
ATOM 7817  H HB3  . GLN A 1 57  ? -5.257  14.831  11.254  1.00 0.00 ? 57  GLN A HB3  5  
ATOM 7818  H HG2  . GLN A 1 57  ? -2.867  15.872  11.680  1.00 0.00 ? 57  GLN A HG2  5  
ATOM 7819  H HG3  . GLN A 1 57  ? -3.021  16.490  10.047  1.00 0.00 ? 57  GLN A HG3  5  
ATOM 7820  H HE21 . GLN A 1 57  ? -3.873  18.405  9.838   1.00 0.00 ? 57  GLN A HE21 5  
ATOM 7821  H HE22 . GLN A 1 57  ? -4.971  19.194  10.920  1.00 0.00 ? 57  GLN A HE22 5  
ATOM 7822  N N    . ALA A 1 58  ? -4.605  12.343  8.763   1.00 0.00 ? 58  ALA A N    5  
ATOM 7823  C CA   . ALA A 1 58  ? -5.380  11.248  8.205   1.00 0.00 ? 58  ALA A CA   5  
ATOM 7824  C C    . ALA A 1 58  ? -4.738  9.918   8.606   1.00 0.00 ? 58  ALA A C    5  
ATOM 7825  O O    . ALA A 1 58  ? -5.432  8.918   8.782   1.00 0.00 ? 58  ALA A O    5  
ATOM 7826  C CB   . ALA A 1 58  ? -5.479  11.413  6.687   1.00 0.00 ? 58  ALA A CB   5  
ATOM 7827  H H    . ALA A 1 58  ? -4.219  12.973  8.089   1.00 0.00 ? 58  ALA A H    5  
ATOM 7828  H HA   . ALA A 1 58  ? -6.382  11.301  8.630   1.00 0.00 ? 58  ALA A HA   5  
ATOM 7829  H HB1  . ALA A 1 58  ? -5.448  12.473  6.435   1.00 0.00 ? 58  ALA A HB1  5  
ATOM 7830  H HB2  . ALA A 1 58  ? -4.643  10.902  6.211   1.00 0.00 ? 58  ALA A HB2  5  
ATOM 7831  H HB3  . ALA A 1 58  ? -6.416  10.983  6.335   1.00 0.00 ? 58  ALA A HB3  5  
ATOM 7832  N N    . GLY A 1 59  ? -3.420  9.950   8.738   1.00 0.00 ? 59  GLY A N    5  
ATOM 7833  C CA   . GLY A 1 59  ? -2.677  8.759   9.115   1.00 0.00 ? 59  GLY A CA   5  
ATOM 7834  C C    . GLY A 1 59  ? -2.045  8.097   7.890   1.00 0.00 ? 59  GLY A C    5  
ATOM 7835  O O    . GLY A 1 59  ? -2.049  6.873   7.770   1.00 0.00 ? 59  GLY A O    5  
ATOM 7836  H H    . GLY A 1 59  ? -2.863  10.767  8.594   1.00 0.00 ? 59  GLY A H    5  
ATOM 7837  H HA2  . GLY A 1 59  ? -1.900  9.023   9.832   1.00 0.00 ? 59  GLY A HA2  5  
ATOM 7838  H HA3  . GLY A 1 59  ? -3.343  8.053   9.612   1.00 0.00 ? 59  GLY A HA3  5  
ATOM 7839  N N    . LEU A 1 60  ? -1.516  8.935   7.011   1.00 0.00 ? 60  LEU A N    5  
ATOM 7840  C CA   . LEU A 1 60  ? -0.881  8.446   5.799   1.00 0.00 ? 60  LEU A CA   5  
ATOM 7841  C C    . LEU A 1 60  ? 0.571   8.073   6.104   1.00 0.00 ? 60  LEU A C    5  
ATOM 7842  O O    . LEU A 1 60  ? 1.011   8.159   7.250   1.00 0.00 ? 60  LEU A O    5  
ATOM 7843  C CB   . LEU A 1 60  ? -1.028  9.466   4.668   1.00 0.00 ? 60  LEU A CB   5  
ATOM 7844  C CG   . LEU A 1 60  ? -2.437  9.633   4.094   1.00 0.00 ? 60  LEU A CG   5  
ATOM 7845  C CD1  . LEU A 1 60  ? -2.422  10.529  2.855   1.00 0.00 ? 60  LEU A CD1  5  
ATOM 7846  C CD2  . LEU A 1 60  ? -3.077  8.273   3.810   1.00 0.00 ? 60  LEU A CD2  5  
ATOM 7847  H H    . LEU A 1 60  ? -1.516  9.930   7.116   1.00 0.00 ? 60  LEU A H    5  
ATOM 7848  H HA   . LEU A 1 60  ? -1.412  7.546   5.492   1.00 0.00 ? 60  LEU A HA   5  
ATOM 7849  H HB2  . LEU A 1 60  ? -0.689  10.436  5.033   1.00 0.00 ? 60  LEU A HB2  5  
ATOM 7850  H HB3  . LEU A 1 60  ? -0.359  9.179   3.857   1.00 0.00 ? 60  LEU A HB3  5  
ATOM 7851  H HG   . LEU A 1 60  ? -3.054  10.129  4.843   1.00 0.00 ? 60  LEU A HG   5  
ATOM 7852  H HD11 . LEU A 1 60  ? -3.386  11.029  2.756   1.00 0.00 ? 60  LEU A HD11 5  
ATOM 7853  H HD12 . LEU A 1 60  ? -1.634  11.276  2.956   1.00 0.00 ? 60  LEU A HD12 5  
ATOM 7854  H HD13 . LEU A 1 60  ? -2.235  9.922   1.969   1.00 0.00 ? 60  LEU A HD13 5  
ATOM 7855  H HD21 . LEU A 1 60  ? -3.709  8.346   2.924   1.00 0.00 ? 60  LEU A HD21 5  
ATOM 7856  H HD22 . LEU A 1 60  ? -2.296  7.532   3.639   1.00 0.00 ? 60  LEU A HD22 5  
ATOM 7857  H HD23 . LEU A 1 60  ? -3.684  7.971   4.664   1.00 0.00 ? 60  LEU A HD23 5  
ATOM 7858  N N    . GLU A 1 61  ? 1.276   7.665   5.059   1.00 0.00 ? 61  GLU A N    5  
ATOM 7859  C CA   . GLU A 1 61  ? 2.669   7.277   5.201   1.00 0.00 ? 61  GLU A CA   5  
ATOM 7860  C C    . GLU A 1 61  ? 3.276   6.966   3.831   1.00 0.00 ? 61  GLU A C    5  
ATOM 7861  O O    . GLU A 1 61  ? 2.552   6.810   2.849   1.00 0.00 ? 61  GLU A O    5  
ATOM 7862  C CB   . GLU A 1 61  ? 2.813   6.084   6.148   1.00 0.00 ? 61  GLU A CB   5  
ATOM 7863  C CG   . GLU A 1 61  ? 2.165   4.832   5.554   1.00 0.00 ? 61  GLU A CG   5  
ATOM 7864  C CD   . GLU A 1 61  ? 3.129   3.645   5.591   1.00 0.00 ? 61  GLU A CD   5  
ATOM 7865  O OE1  . GLU A 1 61  ? 4.350   3.903   5.520   1.00 0.00 ? 61  GLU A OE1  5  
ATOM 7866  O OE2  . GLU A 1 61  ? 2.624   2.506   5.690   1.00 0.00 ? 61  GLU A OE2  5  
ATOM 7867  H H    . GLU A 1 61  ? 0.911   7.597   4.130   1.00 0.00 ? 61  GLU A H    5  
ATOM 7868  H HA   . GLU A 1 61  ? 3.167   8.142   5.639   1.00 0.00 ? 61  GLU A HA   5  
ATOM 7869  H HB2  . GLU A 1 61  ? 3.868   5.894   6.342   1.00 0.00 ? 61  GLU A HB2  5  
ATOM 7870  H HB3  . GLU A 1 61  ? 2.349   6.317   7.106   1.00 0.00 ? 61  GLU A HB3  5  
ATOM 7871  H HG2  . GLU A 1 61  ? 1.260   4.587   6.110   1.00 0.00 ? 61  GLU A HG2  5  
ATOM 7872  H HG3  . GLU A 1 61  ? 1.863   5.027   4.525   1.00 0.00 ? 61  GLU A HG3  5  
ATOM 7873  N N    . TYR A 1 62  ? 4.598   6.886   3.810   1.00 0.00 ? 62  TYR A N    5  
ATOM 7874  C CA   . TYR A 1 62  ? 5.311   6.597   2.577   1.00 0.00 ? 62  TYR A CA   5  
ATOM 7875  C C    . TYR A 1 62  ? 5.196   5.115   2.212   1.00 0.00 ? 62  TYR A C    5  
ATOM 7876  O O    . TYR A 1 62  ? 5.053   4.266   3.089   1.00 0.00 ? 62  TYR A O    5  
ATOM 7877  C CB   . TYR A 1 62  ? 6.779   6.930   2.850   1.00 0.00 ? 62  TYR A CB   5  
ATOM 7878  C CG   . TYR A 1 62  ? 7.719   6.592   1.691   1.00 0.00 ? 62  TYR A CG   5  
ATOM 7879  C CD1  . TYR A 1 62  ? 7.955   5.275   1.356   1.00 0.00 ? 62  TYR A CD1  5  
ATOM 7880  C CD2  . TYR A 1 62  ? 8.332   7.605   0.982   1.00 0.00 ? 62  TYR A CD2  5  
ATOM 7881  C CE1  . TYR A 1 62  ? 8.840   4.956   0.266   1.00 0.00 ? 62  TYR A CE1  5  
ATOM 7882  C CE2  . TYR A 1 62  ? 9.217   7.287   -0.108  1.00 0.00 ? 62  TYR A CE2  5  
ATOM 7883  C CZ   . TYR A 1 62  ? 9.428   5.978   -0.413  1.00 0.00 ? 62  TYR A CZ   5  
ATOM 7884  O OH   . TYR A 1 62  ? 10.264  5.678   -1.442  1.00 0.00 ? 62  TYR A OH   5  
ATOM 7885  H H    . TYR A 1 62  ? 5.179   7.015   4.613   1.00 0.00 ? 62  TYR A H    5  
ATOM 7886  H HA   . TYR A 1 62  ? 4.864   7.195   1.782   1.00 0.00 ? 62  TYR A HA   5  
ATOM 7887  H HB2  . TYR A 1 62  ? 6.863   7.994   3.074   1.00 0.00 ? 62  TYR A HB2  5  
ATOM 7888  H HB3  . TYR A 1 62  ? 7.104   6.390   3.738   1.00 0.00 ? 62  TYR A HB3  5  
ATOM 7889  H HD1  . TYR A 1 62  ? 7.471   4.475   1.916   1.00 0.00 ? 62  TYR A HD1  5  
ATOM 7890  H HD2  . TYR A 1 62  ? 8.146   8.646   1.247   1.00 0.00 ? 62  TYR A HD2  5  
ATOM 7891  H HE1  . TYR A 1 62  ? 9.035   3.920   -0.010  1.00 0.00 ? 62  TYR A HE1  5  
ATOM 7892  H HE2  . TYR A 1 62  ? 9.708   8.077   -0.677  1.00 0.00 ? 62  TYR A HE2  5  
ATOM 7893  H HH   . TYR A 1 62  ? 9.883   4.929   -1.985  1.00 0.00 ? 62  TYR A HH   5  
ATOM 7894  N N    . GLY A 1 63  ? 5.262   4.852   0.915   1.00 0.00 ? 63  GLY A N    5  
ATOM 7895  C CA   . GLY A 1 63  ? 5.167   3.488   0.423   1.00 0.00 ? 63  GLY A CA   5  
ATOM 7896  C C    . GLY A 1 63  ? 3.708   3.082   0.208   1.00 0.00 ? 63  GLY A C    5  
ATOM 7897  O O    . GLY A 1 63  ? 3.428   2.072   -0.435  1.00 0.00 ? 63  GLY A O    5  
ATOM 7898  H H    . GLY A 1 63  ? 5.378   5.549   0.208   1.00 0.00 ? 63  GLY A H    5  
ATOM 7899  H HA2  . GLY A 1 63  ? 5.715   3.397   -0.514  1.00 0.00 ? 63  GLY A HA2  5  
ATOM 7900  H HA3  . GLY A 1 63  ? 5.636   2.807   1.134   1.00 0.00 ? 63  GLY A HA3  5  
ATOM 7901  N N    . ASP A 1 64  ? 2.815   3.891   0.760   1.00 0.00 ? 64  ASP A N    5  
ATOM 7902  C CA   . ASP A 1 64  ? 1.391   3.630   0.637   1.00 0.00 ? 64  ASP A CA   5  
ATOM 7903  C C    . ASP A 1 64  ? 0.928   4.003   -0.773  1.00 0.00 ? 64  ASP A C    5  
ATOM 7904  O O    . ASP A 1 64  ? 0.766   5.182   -1.085  1.00 0.00 ? 64  ASP A O    5  
ATOM 7905  C CB   . ASP A 1 64  ? 0.589   4.467   1.635   1.00 0.00 ? 64  ASP A CB   5  
ATOM 7906  C CG   . ASP A 1 64  ? -0.105  3.667   2.739   1.00 0.00 ? 64  ASP A CG   5  
ATOM 7907  O OD1  . ASP A 1 64  ? -0.686  2.615   2.398   1.00 0.00 ? 64  ASP A OD1  5  
ATOM 7908  O OD2  . ASP A 1 64  ? -0.039  4.127   3.900   1.00 0.00 ? 64  ASP A OD2  5  
ATOM 7909  H H    . ASP A 1 64  ? 3.050   4.711   1.282   1.00 0.00 ? 64  ASP A H    5  
ATOM 7910  H HA   . ASP A 1 64  ? 1.276   2.566   0.845   1.00 0.00 ? 64  ASP A HA   5  
ATOM 7911  H HB2  . ASP A 1 64  ? 1.258   5.193   2.098   1.00 0.00 ? 64  ASP A HB2  5  
ATOM 7912  H HB3  . ASP A 1 64  ? -0.166  5.033   1.088   1.00 0.00 ? 64  ASP A HB3  5  
ATOM 7913  N N    . GLN A 1 65  ? 0.728   2.977   -1.587  1.00 0.00 ? 65  GLN A N    5  
ATOM 7914  C CA   . GLN A 1 65  ? 0.288   3.183   -2.956  1.00 0.00 ? 65  GLN A CA   5  
ATOM 7915  C C    . GLN A 1 65  ? -1.141  3.730   -2.977  1.00 0.00 ? 65  GLN A C    5  
ATOM 7916  O O    . GLN A 1 65  ? -2.025  3.194   -2.310  1.00 0.00 ? 65  GLN A O    5  
ATOM 7917  C CB   . GLN A 1 65  ? 0.391   1.889   -3.766  1.00 0.00 ? 65  GLN A CB   5  
ATOM 7918  C CG   . GLN A 1 65  ? 0.268   2.168   -5.265  1.00 0.00 ? 65  GLN A CG   5  
ATOM 7919  C CD   . GLN A 1 65  ? -0.579  1.097   -5.955  1.00 0.00 ? 65  GLN A CD   5  
ATOM 7920  O OE1  . GLN A 1 65  ? -0.567  -0.068  -5.594  1.00 0.00 ? 65  GLN A OE1  5  
ATOM 7921  N NE2  . GLN A 1 65  ? -1.312  1.555   -6.966  1.00 0.00 ? 65  GLN A NE2  5  
ATOM 7922  H H    . GLN A 1 65  ? 0.862   2.021   -1.325  1.00 0.00 ? 65  GLN A H    5  
ATOM 7923  H HA   . GLN A 1 65  ? 0.973   3.921   -3.373  1.00 0.00 ? 65  GLN A HA   5  
ATOM 7924  H HB2  . GLN A 1 65  ? 1.345   1.402   -3.560  1.00 0.00 ? 65  GLN A HB2  5  
ATOM 7925  H HB3  . GLN A 1 65  ? -0.393  1.198   -3.456  1.00 0.00 ? 65  GLN A HB3  5  
ATOM 7926  H HG2  . GLN A 1 65  ? -0.182  3.149   -5.420  1.00 0.00 ? 65  GLN A HG2  5  
ATOM 7927  H HG3  . GLN A 1 65  ? 1.260   2.199   -5.716  1.00 0.00 ? 65  GLN A HG3  5  
ATOM 7928  H HE21 . GLN A 1 65  ? -1.276  2.524   -7.211  1.00 0.00 ? 65  GLN A HE21 5  
ATOM 7929  H HE22 . GLN A 1 65  ? -1.900  0.931   -7.480  1.00 0.00 ? 65  GLN A HE22 5  
ATOM 7930  N N    . LEU A 1 66  ? -1.324  4.790   -3.751  1.00 0.00 ? 66  LEU A N    5  
ATOM 7931  C CA   . LEU A 1 66  ? -2.630  5.415   -3.867  1.00 0.00 ? 66  LEU A CA   5  
ATOM 7932  C C    . LEU A 1 66  ? -3.378  4.806   -5.055  1.00 0.00 ? 66  LEU A C    5  
ATOM 7933  O O    . LEU A 1 66  ? -2.883  4.825   -6.181  1.00 0.00 ? 66  LEU A O    5  
ATOM 7934  C CB   . LEU A 1 66  ? -2.491  6.937   -3.944  1.00 0.00 ? 66  LEU A CB   5  
ATOM 7935  C CG   . LEU A 1 66  ? -1.722  7.599   -2.798  1.00 0.00 ? 66  LEU A CG   5  
ATOM 7936  C CD1  . LEU A 1 66  ? -1.566  9.102   -3.038  1.00 0.00 ? 66  LEU A CD1  5  
ATOM 7937  C CD2  . LEU A 1 66  ? -2.382  7.299   -1.451  1.00 0.00 ? 66  LEU A CD2  5  
ATOM 7938  H H    . LEU A 1 66  ? -0.599  5.220   -4.290  1.00 0.00 ? 66  LEU A H    5  
ATOM 7939  H HA   . LEU A 1 66  ? -3.184  5.188   -2.957  1.00 0.00 ? 66  LEU A HA   5  
ATOM 7940  H HB2  . LEU A 1 66  ? -1.995  7.190   -4.881  1.00 0.00 ? 66  LEU A HB2  5  
ATOM 7941  H HB3  . LEU A 1 66  ? -3.489  7.372   -3.984  1.00 0.00 ? 66  LEU A HB3  5  
ATOM 7942  H HG   . LEU A 1 66  ? -0.720  7.172   -2.767  1.00 0.00 ? 66  LEU A HG   5  
ATOM 7943  H HD11 . LEU A 1 66  ? -0.846  9.510   -2.329  1.00 0.00 ? 66  LEU A HD11 5  
ATOM 7944  H HD12 . LEU A 1 66  ? -1.211  9.272   -4.055  1.00 0.00 ? 66  LEU A HD12 5  
ATOM 7945  H HD13 . LEU A 1 66  ? -2.529  9.593   -2.903  1.00 0.00 ? 66  LEU A HD13 5  
ATOM 7946  H HD21 . LEU A 1 66  ? -1.752  6.616   -0.881  1.00 0.00 ? 66  LEU A HD21 5  
ATOM 7947  H HD22 . LEU A 1 66  ? -2.507  8.228   -0.893  1.00 0.00 ? 66  LEU A HD22 5  
ATOM 7948  H HD23 . LEU A 1 66  ? -3.357  6.842   -1.617  1.00 0.00 ? 66  LEU A HD23 5  
ATOM 7949  N N    . LEU A 1 67  ? -4.558  4.280   -4.763  1.00 0.00 ? 67  LEU A N    5  
ATOM 7950  C CA   . LEU A 1 67  ? -5.380  3.666   -5.792  1.00 0.00 ? 67  LEU A CA   5  
ATOM 7951  C C    . LEU A 1 67  ? -6.342  4.711   -6.361  1.00 0.00 ? 67  LEU A C    5  
ATOM 7952  O O    . LEU A 1 67  ? -6.340  4.973   -7.562  1.00 0.00 ? 67  LEU A O    5  
ATOM 7953  C CB   . LEU A 1 67  ? -6.078  2.418   -5.247  1.00 0.00 ? 67  LEU A CB   5  
ATOM 7954  C CG   . LEU A 1 67  ? -5.165  1.249   -4.873  1.00 0.00 ? 67  LEU A CG   5  
ATOM 7955  C CD1  . LEU A 1 67  ? -5.952  0.143   -4.166  1.00 0.00 ? 67  LEU A CD1  5  
ATOM 7956  C CD2  . LEU A 1 67  ? -4.415  0.724   -6.100  1.00 0.00 ? 67  LEU A CD2  5  
ATOM 7957  H H    . LEU A 1 67  ? -4.954  4.269   -3.844  1.00 0.00 ? 67  LEU A H    5  
ATOM 7958  H HA   . LEU A 1 67  ? -4.713  3.340   -6.590  1.00 0.00 ? 67  LEU A HA   5  
ATOM 7959  H HB2  . LEU A 1 67  ? -6.651  2.703   -4.365  1.00 0.00 ? 67  LEU A HB2  5  
ATOM 7960  H HB3  . LEU A 1 67  ? -6.793  2.071   -5.993  1.00 0.00 ? 67  LEU A HB3  5  
ATOM 7961  H HG   . LEU A 1 67  ? -4.416  1.611   -4.169  1.00 0.00 ? 67  LEU A HG   5  
ATOM 7962  H HD11 . LEU A 1 67  ? -5.338  -0.755  -4.100  1.00 0.00 ? 67  LEU A HD11 5  
ATOM 7963  H HD12 . LEU A 1 67  ? -6.221  0.474   -3.163  1.00 0.00 ? 67  LEU A HD12 5  
ATOM 7964  H HD13 . LEU A 1 67  ? -6.858  -0.076  -4.732  1.00 0.00 ? 67  LEU A HD13 5  
ATOM 7965  H HD21 . LEU A 1 67  ? -4.551  -0.355  -6.174  1.00 0.00 ? 67  LEU A HD21 5  
ATOM 7966  H HD22 . LEU A 1 67  ? -4.807  1.203   -6.997  1.00 0.00 ? 67  LEU A HD22 5  
ATOM 7967  H HD23 . LEU A 1 67  ? -3.354  0.951   -6.001  1.00 0.00 ? 67  LEU A HD23 5  
ATOM 7968  N N    . GLU A 1 68  ? -7.142  5.278   -5.470  1.00 0.00 ? 68  GLU A N    5  
ATOM 7969  C CA   . GLU A 1 68  ? -8.108  6.288   -5.868  1.00 0.00 ? 68  GLU A CA   5  
ATOM 7970  C C    . GLU A 1 68  ? -8.210  7.377   -4.797  1.00 0.00 ? 68  GLU A C    5  
ATOM 7971  O O    . GLU A 1 68  ? -8.102  7.092   -3.605  1.00 0.00 ? 68  GLU A O    5  
ATOM 7972  C CB   . GLU A 1 68  ? -9.476  5.660   -6.143  1.00 0.00 ? 68  GLU A CB   5  
ATOM 7973  C CG   . GLU A 1 68  ? -9.573  5.170   -7.589  1.00 0.00 ? 68  GLU A CG   5  
ATOM 7974  C CD   . GLU A 1 68  ? -10.181 3.768   -7.653  1.00 0.00 ? 68  GLU A CD   5  
ATOM 7975  O OE1  . GLU A 1 68  ? -11.374 3.650   -7.298  1.00 0.00 ? 68  GLU A OE1  5  
ATOM 7976  O OE2  . GLU A 1 68  ? -9.440  2.846   -8.055  1.00 0.00 ? 68  GLU A OE2  5  
ATOM 7977  H H    . GLU A 1 68  ? -7.138  5.059   -4.494  1.00 0.00 ? 68  GLU A H    5  
ATOM 7978  H HA   . GLU A 1 68  ? -7.718  6.714   -6.792  1.00 0.00 ? 68  GLU A HA   5  
ATOM 7979  H HB2  . GLU A 1 68  ? -9.641  4.826   -5.461  1.00 0.00 ? 68  GLU A HB2  5  
ATOM 7980  H HB3  . GLU A 1 68  ? -10.261 6.391   -5.949  1.00 0.00 ? 68  GLU A HB3  5  
ATOM 7981  H HG2  . GLU A 1 68  ? -10.183 5.862   -8.171  1.00 0.00 ? 68  GLU A HG2  5  
ATOM 7982  H HG3  . GLU A 1 68  ? -8.582  5.162   -8.042  1.00 0.00 ? 68  GLU A HG3  5  
ATOM 7983  N N    . PHE A 1 69  ? -8.417  8.600   -5.261  1.00 0.00 ? 69  PHE A N    5  
ATOM 7984  C CA   . PHE A 1 69  ? -8.534  9.733   -4.358  1.00 0.00 ? 69  PHE A CA   5  
ATOM 7985  C C    . PHE A 1 69  ? -9.939  10.337  -4.417  1.00 0.00 ? 69  PHE A C    5  
ATOM 7986  O O    . PHE A 1 69  ? -10.290 11.006  -5.387  1.00 0.00 ? 69  PHE A O    5  
ATOM 7987  C CB   . PHE A 1 69  ? -7.521  10.781  -4.821  1.00 0.00 ? 69  PHE A CB   5  
ATOM 7988  C CG   . PHE A 1 69  ? -7.557  12.080  -4.013  1.00 0.00 ? 69  PHE A CG   5  
ATOM 7989  C CD1  . PHE A 1 69  ? -8.469  13.043  -4.314  1.00 0.00 ? 69  PHE A CD1  5  
ATOM 7990  C CD2  . PHE A 1 69  ? -6.676  12.272  -2.995  1.00 0.00 ? 69  PHE A CD2  5  
ATOM 7991  C CE1  . PHE A 1 69  ? -8.502  14.249  -3.565  1.00 0.00 ? 69  PHE A CE1  5  
ATOM 7992  C CE2  . PHE A 1 69  ? -6.709  13.478  -2.246  1.00 0.00 ? 69  PHE A CE2  5  
ATOM 7993  C CZ   . PHE A 1 69  ? -7.622  14.441  -2.546  1.00 0.00 ? 69  PHE A CZ   5  
ATOM 7994  H H    . PHE A 1 69  ? -8.504  8.823   -6.232  1.00 0.00 ? 69  PHE A H    5  
ATOM 7995  H HA   . PHE A 1 69  ? -8.341  9.364   -3.350  1.00 0.00 ? 69  PHE A HA   5  
ATOM 7996  H HB2  . PHE A 1 69  ? -6.519  10.355  -4.760  1.00 0.00 ? 69  PHE A HB2  5  
ATOM 7997  H HB3  . PHE A 1 69  ? -7.706  11.012  -5.870  1.00 0.00 ? 69  PHE A HB3  5  
ATOM 7998  H HD1  . PHE A 1 69  ? -9.175  12.889  -5.131  1.00 0.00 ? 69  PHE A HD1  5  
ATOM 7999  H HD2  . PHE A 1 69  ? -5.945  11.501  -2.754  1.00 0.00 ? 69  PHE A HD2  5  
ATOM 8000  H HE1  . PHE A 1 69  ? -9.233  15.020  -3.806  1.00 0.00 ? 69  PHE A HE1  5  
ATOM 8001  H HE2  . PHE A 1 69  ? -6.004  13.632  -1.429  1.00 0.00 ? 69  PHE A HE2  5  
ATOM 8002  H HZ   . PHE A 1 69  ? -7.647  15.366  -1.971  1.00 0.00 ? 69  PHE A HZ   5  
ATOM 8003  N N    . ASN A 1 70  ? -10.703 10.081  -3.365  1.00 0.00 ? 70  ASN A N    5  
ATOM 8004  C CA   . ASN A 1 70  ? -12.061 10.592  -3.285  1.00 0.00 ? 70  ASN A CA   5  
ATOM 8005  C C    . ASN A 1 70  ? -12.849 10.128  -4.512  1.00 0.00 ? 70  ASN A C    5  
ATOM 8006  O O    . ASN A 1 70  ? -13.884 10.705  -4.843  1.00 0.00 ? 70  ASN A O    5  
ATOM 8007  C CB   . ASN A 1 70  ? -12.074 12.121  -3.265  1.00 0.00 ? 70  ASN A CB   5  
ATOM 8008  C CG   . ASN A 1 70  ? -12.721 12.648  -1.982  1.00 0.00 ? 70  ASN A CG   5  
ATOM 8009  O OD1  . ASN A 1 70  ? -13.193 11.899  -1.142  1.00 0.00 ? 70  ASN A OD1  5  
ATOM 8010  N ND2  . ASN A 1 70  ? -12.717 13.973  -1.879  1.00 0.00 ? 70  ASN A ND2  5  
ATOM 8011  H H    . ASN A 1 70  ? -10.409 9.536   -2.580  1.00 0.00 ? 70  ASN A H    5  
ATOM 8012  H HA   . ASN A 1 70  ? -12.463 10.190  -2.355  1.00 0.00 ? 70  ASN A HA   5  
ATOM 8013  H HB2  . ASN A 1 70  ? -11.054 12.498  -3.343  1.00 0.00 ? 70  ASN A HB2  5  
ATOM 8014  H HB3  . ASN A 1 70  ? -12.619 12.495  -4.131  1.00 0.00 ? 70  ASN A HB3  5  
ATOM 8015  H HD21 . ASN A 1 70  ? -12.313 14.530  -2.605  1.00 0.00 ? 70  ASN A HD21 5  
ATOM 8016  H HD22 . ASN A 1 70  ? -13.118 14.414  -1.075  1.00 0.00 ? 70  ASN A HD22 5  
ATOM 8017  N N    . GLY A 1 71  ? -12.329 9.091   -5.152  1.00 0.00 ? 71  GLY A N    5  
ATOM 8018  C CA   . GLY A 1 71  ? -12.971 8.544   -6.335  1.00 0.00 ? 71  GLY A CA   5  
ATOM 8019  C C    . GLY A 1 71  ? -12.037 8.610   -7.546  1.00 0.00 ? 71  GLY A C    5  
ATOM 8020  O O    . GLY A 1 71  ? -12.032 7.706   -8.380  1.00 0.00 ? 71  GLY A O    5  
ATOM 8021  H H    . GLY A 1 71  ? -11.487 8.628   -4.876  1.00 0.00 ? 71  GLY A H    5  
ATOM 8022  H HA2  . GLY A 1 71  ? -13.260 7.510   -6.151  1.00 0.00 ? 71  GLY A HA2  5  
ATOM 8023  H HA3  . GLY A 1 71  ? -13.886 9.098   -6.546  1.00 0.00 ? 71  GLY A HA3  5  
ATOM 8024  N N    . ILE A 1 72  ? -11.270 9.688   -7.603  1.00 0.00 ? 72  ILE A N    5  
ATOM 8025  C CA   . ILE A 1 72  ? -10.334 9.884   -8.697  1.00 0.00 ? 72  ILE A CA   5  
ATOM 8026  C C    . ILE A 1 72  ? -9.519  8.605   -8.901  1.00 0.00 ? 72  ILE A C    5  
ATOM 8027  O O    . ILE A 1 72  ? -9.272  7.864   -7.950  1.00 0.00 ? 72  ILE A O    5  
ATOM 8028  C CB   . ILE A 1 72  ? -9.476  11.127  -8.453  1.00 0.00 ? 72  ILE A CB   5  
ATOM 8029  C CG1  . ILE A 1 72  ? -10.163 12.382  -8.995  1.00 0.00 ? 72  ILE A CG1  5  
ATOM 8030  C CG2  . ILE A 1 72  ? -8.072  10.947  -9.033  1.00 0.00 ? 72  ILE A CG2  5  
ATOM 8031  C CD1  . ILE A 1 72  ? -10.138 13.510  -7.962  1.00 0.00 ? 72  ILE A CD1  5  
ATOM 8032  H H    . ILE A 1 72  ? -11.280 10.419  -6.920  1.00 0.00 ? 72  ILE A H    5  
ATOM 8033  H HA   . ILE A 1 72  ? -10.919 10.068  -9.598  1.00 0.00 ? 72  ILE A HA   5  
ATOM 8034  H HB   . ILE A 1 72  ? -9.366  11.260  -7.377  1.00 0.00 ? 72  ILE A HB   5  
ATOM 8035  H HG12 . ILE A 1 72  ? -9.665  12.708  -9.908  1.00 0.00 ? 72  ILE A HG12 5  
ATOM 8036  H HG13 . ILE A 1 72  ? -11.195 12.150  -9.261  1.00 0.00 ? 72  ILE A HG13 5  
ATOM 8037  H HG21 . ILE A 1 72  ? -7.572  11.914  -9.080  1.00 0.00 ? 72  ILE A HG21 5  
ATOM 8038  H HG22 . ILE A 1 72  ? -7.500  10.272  -8.396  1.00 0.00 ? 72  ILE A HG22 5  
ATOM 8039  H HG23 . ILE A 1 72  ? -8.144  10.525  -10.035 1.00 0.00 ? 72  ILE A HG23 5  
ATOM 8040  H HD11 . ILE A 1 72  ? -11.149 13.692  -7.598  1.00 0.00 ? 72  ILE A HD11 5  
ATOM 8041  H HD12 . ILE A 1 72  ? -9.497  13.225  -7.129  1.00 0.00 ? 72  ILE A HD12 5  
ATOM 8042  H HD13 . ILE A 1 72  ? -9.750  14.418  -8.425  1.00 0.00 ? 72  ILE A HD13 5  
ATOM 8043  N N    . ASN A 1 73  ? -9.125  8.384   -10.146 1.00 0.00 ? 73  ASN A N    5  
ATOM 8044  C CA   . ASN A 1 73  ? -8.343  7.208   -10.486 1.00 0.00 ? 73  ASN A CA   5  
ATOM 8045  C C    . ASN A 1 73  ? -6.863  7.588   -10.562 1.00 0.00 ? 73  ASN A C    5  
ATOM 8046  O O    . ASN A 1 73  ? -6.381  8.015   -11.610 1.00 0.00 ? 73  ASN A O    5  
ATOM 8047  C CB   . ASN A 1 73  ? -8.757  6.646   -11.848 1.00 0.00 ? 73  ASN A CB   5  
ATOM 8048  C CG   . ASN A 1 73  ? -8.597  5.125   -11.885 1.00 0.00 ? 73  ASN A CG   5  
ATOM 8049  O OD1  . ASN A 1 73  ? -8.993  4.411   -10.979 1.00 0.00 ? 73  ASN A OD1  5  
ATOM 8050  N ND2  . ASN A 1 73  ? -7.995  4.671   -12.981 1.00 0.00 ? 73  ASN A ND2  5  
ATOM 8051  H H    . ASN A 1 73  ? -9.330  8.992   -10.913 1.00 0.00 ? 73  ASN A H    5  
ATOM 8052  H HA   . ASN A 1 73  ? -8.548  6.488   -9.693  1.00 0.00 ? 73  ASN A HA   5  
ATOM 8053  H HB2  . ASN A 1 73  ? -9.794  6.911   -12.054 1.00 0.00 ? 73  ASN A HB2  5  
ATOM 8054  H HB3  . ASN A 1 73  ? -8.150  7.098   -12.632 1.00 0.00 ? 73  ASN A HB3  5  
ATOM 8055  H HD21 . ASN A 1 73  ? -7.694  5.311   -13.687 1.00 0.00 ? 73  ASN A HD21 5  
ATOM 8056  H HD22 . ASN A 1 73  ? -7.844  3.689   -13.098 1.00 0.00 ? 73  ASN A HD22 5  
ATOM 8057  N N    . LEU A 1 74  ? -6.183  7.420   -9.437  1.00 0.00 ? 74  LEU A N    5  
ATOM 8058  C CA   . LEU A 1 74  ? -4.768  7.741   -9.364  1.00 0.00 ? 74  LEU A CA   5  
ATOM 8059  C C    . LEU A 1 74  ? -3.963  6.643   -10.063 1.00 0.00 ? 74  LEU A C    5  
ATOM 8060  O O    . LEU A 1 74  ? -2.849  6.884   -10.524 1.00 0.00 ? 74  LEU A O    5  
ATOM 8061  C CB   . LEU A 1 74  ? -4.348  7.981   -7.912  1.00 0.00 ? 74  LEU A CB   5  
ATOM 8062  C CG   . LEU A 1 74  ? -4.665  9.365   -7.342  1.00 0.00 ? 74  LEU A CG   5  
ATOM 8063  C CD1  . LEU A 1 74  ? -4.305  9.443   -5.857  1.00 0.00 ? 74  LEU A CD1  5  
ATOM 8064  C CD2  . LEU A 1 74  ? -3.979  10.464  -8.157  1.00 0.00 ? 74  LEU A CD2  5  
ATOM 8065  H H    . LEU A 1 74  ? -6.582  7.073   -8.589  1.00 0.00 ? 74  LEU A H    5  
ATOM 8066  H HA   . LEU A 1 74  ? -4.616  8.677   -9.902  1.00 0.00 ? 74  LEU A HA   5  
ATOM 8067  H HB2  . LEU A 1 74  ? -4.833  7.232   -7.286  1.00 0.00 ? 74  LEU A HB2  5  
ATOM 8068  H HB3  . LEU A 1 74  ? -3.274  7.815   -7.833  1.00 0.00 ? 74  LEU A HB3  5  
ATOM 8069  H HG   . LEU A 1 74  ? -5.740  9.529   -7.422  1.00 0.00 ? 74  LEU A HG   5  
ATOM 8070  H HD11 . LEU A 1 74  ? -4.637  10.399  -5.452  1.00 0.00 ? 74  LEU A HD11 5  
ATOM 8071  H HD12 . LEU A 1 74  ? -4.797  8.631   -5.321  1.00 0.00 ? 74  LEU A HD12 5  
ATOM 8072  H HD13 . LEU A 1 74  ? -3.225  9.354   -5.740  1.00 0.00 ? 74  LEU A HD13 5  
ATOM 8073  H HD21 . LEU A 1 74  ? -3.854  11.352  -7.537  1.00 0.00 ? 74  LEU A HD21 5  
ATOM 8074  H HD22 . LEU A 1 74  ? -3.002  10.113  -8.489  1.00 0.00 ? 74  LEU A HD22 5  
ATOM 8075  H HD23 . LEU A 1 74  ? -4.592  10.710  -9.024  1.00 0.00 ? 74  LEU A HD23 5  
ATOM 8076  N N    . ARG A 1 75  ? -4.560  5.462   -10.119 1.00 0.00 ? 75  ARG A N    5  
ATOM 8077  C CA   . ARG A 1 75  ? -3.913  4.326   -10.754 1.00 0.00 ? 75  ARG A CA   5  
ATOM 8078  C C    . ARG A 1 75  ? -3.391  4.718   -12.138 1.00 0.00 ? 75  ARG A C    5  
ATOM 8079  O O    . ARG A 1 75  ? -2.479  4.083   -12.665 1.00 0.00 ? 75  ARG A O    5  
ATOM 8080  C CB   . ARG A 1 75  ? -4.880  3.149   -10.896 1.00 0.00 ? 75  ARG A CB   5  
ATOM 8081  C CG   . ARG A 1 75  ? -4.712  2.160   -9.740  1.00 0.00 ? 75  ARG A CG   5  
ATOM 8082  C CD   . ARG A 1 75  ? -5.745  1.034   -9.828  1.00 0.00 ? 75  ARG A CD   5  
ATOM 8083  N NE   . ARG A 1 75  ? -5.066  -0.258  -10.070 1.00 0.00 ? 75  ARG A NE   5  
ATOM 8084  C CZ   . ARG A 1 75  ? -4.729  -0.714  -11.285 1.00 0.00 ? 75  ARG A CZ   5  
ATOM 8085  N NH1  . ARG A 1 75  ? -5.006  0.015   -12.374 1.00 0.00 ? 75  ARG A NH1  5  
ATOM 8086  N NH2  . ARG A 1 75  ? -4.114  -1.898  -11.409 1.00 0.00 ? 75  ARG A NH2  5  
ATOM 8087  H H    . ARG A 1 75  ? -5.466  5.274   -9.741  1.00 0.00 ? 75  ARG A H    5  
ATOM 8088  H HA   . ARG A 1 75  ? -3.092  4.063   -10.086 1.00 0.00 ? 75  ARG A HA   5  
ATOM 8089  H HB2  . ARG A 1 75  ? -5.906  3.517   -10.918 1.00 0.00 ? 75  ARG A HB2  5  
ATOM 8090  H HB3  . ARG A 1 75  ? -4.703  2.640   -11.843 1.00 0.00 ? 75  ARG A HB3  5  
ATOM 8091  H HG2  . ARG A 1 75  ? -3.707  1.739   -9.760  1.00 0.00 ? 75  ARG A HG2  5  
ATOM 8092  H HG3  . ARG A 1 75  ? -4.820  2.684   -8.790  1.00 0.00 ? 75  ARG A HG3  5  
ATOM 8093  H HD2  . ARG A 1 75  ? -6.321  0.985   -8.904  1.00 0.00 ? 75  ARG A HD2  5  
ATOM 8094  H HD3  . ARG A 1 75  ? -6.451  1.240   -10.633 1.00 0.00 ? 75  ARG A HD3  5  
ATOM 8095  H HE   . ARG A 1 75  ? -4.844  -0.827  -9.278  1.00 0.00 ? 75  ARG A HE   5  
ATOM 8096  H HH11 . ARG A 1 75  ? -5.464  0.899   -12.282 1.00 0.00 ? 75  ARG A HH11 5  
ATOM 8097  H HH12 . ARG A 1 75  ? -4.755  -0.325  -13.281 1.00 0.00 ? 75  ARG A HH12 5  
ATOM 8098  H HH21 . ARG A 1 75  ? -3.907  -2.442  -10.596 1.00 0.00 ? 75  ARG A HH21 5  
ATOM 8099  H HH22 . ARG A 1 75  ? -3.863  -2.238  -12.315 1.00 0.00 ? 75  ARG A HH22 5  
ATOM 8100  N N    . SER A 1 76  ? -3.993  5.763   -12.688 1.00 0.00 ? 76  SER A N    5  
ATOM 8101  C CA   . SER A 1 76  ? -3.601  6.247   -14.000 1.00 0.00 ? 76  SER A CA   5  
ATOM 8102  C C    . SER A 1 76  ? -3.461  7.771   -13.976 1.00 0.00 ? 76  SER A C    5  
ATOM 8103  O O    . SER A 1 76  ? -4.030  8.464   -14.818 1.00 0.00 ? 76  SER A O    5  
ATOM 8104  C CB   . SER A 1 76  ? -4.612  5.824   -15.068 1.00 0.00 ? 76  SER A CB   5  
ATOM 8105  O OG   . SER A 1 76  ? -3.987  5.566   -16.323 1.00 0.00 ? 76  SER A OG   5  
ATOM 8106  H H    . SER A 1 76  ? -4.734  6.275   -12.253 1.00 0.00 ? 76  SER A H    5  
ATOM 8107  H HA   . SER A 1 76  ? -2.639  5.778   -14.206 1.00 0.00 ? 76  SER A HA   5  
ATOM 8108  H HB2  . SER A 1 76  ? -5.138  4.930   -14.735 1.00 0.00 ? 76  SER A HB2  5  
ATOM 8109  H HB3  . SER A 1 76  ? -5.360  6.608   -15.190 1.00 0.00 ? 76  SER A HB3  5  
ATOM 8110  H HG   . SER A 1 76  ? -3.140  6.094   -16.398 1.00 0.00 ? 76  SER A HG   5  
ATOM 8111  N N    . ALA A 1 77  ? -2.701  8.248   -13.001 1.00 0.00 ? 77  ALA A N    5  
ATOM 8112  C CA   . ALA A 1 77  ? -2.480  9.676   -12.856 1.00 0.00 ? 77  ALA A CA   5  
ATOM 8113  C C    . ALA A 1 77  ? -0.982  9.941   -12.683 1.00 0.00 ? 77  ALA A C    5  
ATOM 8114  O O    . ALA A 1 77  ? -0.257  9.100   -12.155 1.00 0.00 ? 77  ALA A O    5  
ATOM 8115  C CB   . ALA A 1 77  ? -3.304  10.204  -11.680 1.00 0.00 ? 77  ALA A CB   5  
ATOM 8116  H H    . ALA A 1 77  ? -2.242  7.678   -12.320 1.00 0.00 ? 77  ALA A H    5  
ATOM 8117  H HA   . ALA A 1 77  ? -2.822  10.160  -13.770 1.00 0.00 ? 77  ALA A HA   5  
ATOM 8118  H HB1  . ALA A 1 77  ? -4.358  9.980   -11.846 1.00 0.00 ? 77  ALA A HB1  5  
ATOM 8119  H HB2  . ALA A 1 77  ? -2.971  9.726   -10.759 1.00 0.00 ? 77  ALA A HB2  5  
ATOM 8120  H HB3  . ALA A 1 77  ? -3.171  11.283  -11.598 1.00 0.00 ? 77  ALA A HB3  5  
ATOM 8121  N N    . THR A 1 78  ? -0.565  11.113  -13.138 1.00 0.00 ? 78  THR A N    5  
ATOM 8122  C CA   . THR A 1 78  ? 0.833   11.499  -13.040 1.00 0.00 ? 78  THR A CA   5  
ATOM 8123  C C    . THR A 1 78  ? 1.127   12.091  -11.661 1.00 0.00 ? 78  THR A C    5  
ATOM 8124  O O    . THR A 1 78  ? 0.237   12.180  -10.816 1.00 0.00 ? 78  THR A O    5  
ATOM 8125  C CB   . THR A 1 78  ? 1.140   12.459  -14.192 1.00 0.00 ? 78  THR A CB   5  
ATOM 8126  O OG1  . THR A 1 78  ? 0.214   13.527  -14.010 1.00 0.00 ? 78  THR A OG1  5  
ATOM 8127  C CG2  . THR A 1 78  ? 0.770   11.873  -15.556 1.00 0.00 ? 78  THR A CG2  5  
ATOM 8128  H H    . THR A 1 78  ? -1.162  11.792  -13.566 1.00 0.00 ? 78  THR A H    5  
ATOM 8129  H HA   . THR A 1 78  ? 1.444   10.602  -13.141 1.00 0.00 ? 78  THR A HA   5  
ATOM 8130  H HB   . THR A 1 78  ? 2.184   12.769  -14.171 1.00 0.00 ? 78  THR A HB   5  
ATOM 8131  H HG1  . THR A 1 78  ? 0.281   14.170  -14.772 1.00 0.00 ? 78  THR A HG1  5  
ATOM 8132  H HG21 . THR A 1 78  ? 0.358   12.659  -16.189 1.00 0.00 ? 78  THR A HG21 5  
ATOM 8133  H HG22 . THR A 1 78  ? 1.661   11.458  -16.027 1.00 0.00 ? 78  THR A HG22 5  
ATOM 8134  H HG23 . THR A 1 78  ? 0.028   11.086  -15.425 1.00 0.00 ? 78  THR A HG23 5  
ATOM 8135  N N    . GLU A 1 79  ? 2.380   12.481  -11.475 1.00 0.00 ? 79  GLU A N    5  
ATOM 8136  C CA   . GLU A 1 79  ? 2.803   13.063  -10.212 1.00 0.00 ? 79  GLU A CA   5  
ATOM 8137  C C    . GLU A 1 79  ? 2.277   14.494  -10.084 1.00 0.00 ? 79  GLU A C    5  
ATOM 8138  O O    . GLU A 1 79  ? 1.887   14.921  -8.999  1.00 0.00 ? 79  GLU A O    5  
ATOM 8139  C CB   . GLU A 1 79  ? 4.326   13.023  -10.074 1.00 0.00 ? 79  GLU A CB   5  
ATOM 8140  C CG   . GLU A 1 79  ? 5.006   13.378  -11.397 1.00 0.00 ? 79  GLU A CG   5  
ATOM 8141  C CD   . GLU A 1 79  ? 6.403   13.955  -11.158 1.00 0.00 ? 79  GLU A CD   5  
ATOM 8142  O OE1  . GLU A 1 79  ? 6.492   14.920  -10.369 1.00 0.00 ? 79  GLU A OE1  5  
ATOM 8143  O OE2  . GLU A 1 79  ? 7.351   13.417  -11.771 1.00 0.00 ? 79  GLU A OE2  5  
ATOM 8144  H H    . GLU A 1 79  ? 3.098   12.406  -12.167 1.00 0.00 ? 79  GLU A H    5  
ATOM 8145  H HA   . GLU A 1 79  ? 2.358   12.435  -9.441  1.00 0.00 ? 79  GLU A HA   5  
ATOM 8146  H HB2  . GLU A 1 79  ? 4.642   13.722  -9.299  1.00 0.00 ? 79  GLU A HB2  5  
ATOM 8147  H HB3  . GLU A 1 79  ? 4.640   12.030  -9.754  1.00 0.00 ? 79  GLU A HB3  5  
ATOM 8148  H HG2  . GLU A 1 79  ? 5.078   12.488  -12.023 1.00 0.00 ? 79  GLU A HG2  5  
ATOM 8149  H HG3  . GLU A 1 79  ? 4.398   14.101  -11.940 1.00 0.00 ? 79  GLU A HG3  5  
ATOM 8150  N N    . GLN A 1 80  ? 2.284   15.196  -11.208 1.00 0.00 ? 80  GLN A N    5  
ATOM 8151  C CA   . GLN A 1 80  ? 1.813   16.570  -11.235 1.00 0.00 ? 80  GLN A CA   5  
ATOM 8152  C C    . GLN A 1 80  ? 0.306   16.620  -10.973 1.00 0.00 ? 80  GLN A C    5  
ATOM 8153  O O    . GLN A 1 80  ? -0.165  17.447  -10.194 1.00 0.00 ? 80  GLN A O    5  
ATOM 8154  C CB   . GLN A 1 80  ? 2.161   17.242  -12.565 1.00 0.00 ? 80  GLN A CB   5  
ATOM 8155  C CG   . GLN A 1 80  ? 1.429   16.569  -13.728 1.00 0.00 ? 80  GLN A CG   5  
ATOM 8156  C CD   . GLN A 1 80  ? 2.122   16.870  -15.059 1.00 0.00 ? 80  GLN A CD   5  
ATOM 8157  O OE1  . GLN A 1 80  ? 2.333   18.011  -15.434 1.00 0.00 ? 80  GLN A OE1  5  
ATOM 8158  N NE2  . GLN A 1 80  ? 2.462   15.785  -15.749 1.00 0.00 ? 80  GLN A NE2  5  
ATOM 8159  H H    . GLN A 1 80  ? 2.603   14.841  -12.087 1.00 0.00 ? 80  GLN A H    5  
ATOM 8160  H HA   . GLN A 1 80  ? 2.346   17.075  -10.430 1.00 0.00 ? 80  GLN A HA   5  
ATOM 8161  H HB2  . GLN A 1 80  ? 1.892   18.298  -12.524 1.00 0.00 ? 80  GLN A HB2  5  
ATOM 8162  H HB3  . GLN A 1 80  ? 3.237   17.194  -12.731 1.00 0.00 ? 80  GLN A HB3  5  
ATOM 8163  H HG2  . GLN A 1 80  ? 1.396   15.492  -13.566 1.00 0.00 ? 80  GLN A HG2  5  
ATOM 8164  H HG3  . GLN A 1 80  ? 0.397   16.918  -13.764 1.00 0.00 ? 80  GLN A HG3  5  
ATOM 8165  H HE21 . GLN A 1 80  ? 2.259   14.876  -15.384 1.00 0.00 ? 80  GLN A HE21 5  
ATOM 8166  H HE22 . GLN A 1 80  ? 2.920   15.878  -16.633 1.00 0.00 ? 80  GLN A HE22 5  
ATOM 8167  N N    . GLN A 1 81  ? -0.408  15.724  -11.639 1.00 0.00 ? 81  GLN A N    5  
ATOM 8168  C CA   . GLN A 1 81  ? -1.851  15.656  -11.488 1.00 0.00 ? 81  GLN A CA   5  
ATOM 8169  C C    . GLN A 1 81  ? -2.216  15.228  -10.065 1.00 0.00 ? 81  GLN A C    5  
ATOM 8170  O O    . GLN A 1 81  ? -3.146  15.770  -9.470  1.00 0.00 ? 81  GLN A O    5  
ATOM 8171  C CB   . GLN A 1 81  ? -2.467  14.709  -12.520 1.00 0.00 ? 81  GLN A CB   5  
ATOM 8172  C CG   . GLN A 1 81  ? -2.928  15.475  -13.761 1.00 0.00 ? 81  GLN A CG   5  
ATOM 8173  C CD   . GLN A 1 81  ? -1.899  15.365  -14.888 1.00 0.00 ? 81  GLN A CD   5  
ATOM 8174  O OE1  . GLN A 1 81  ? -1.266  16.331  -15.282 1.00 0.00 ? 81  GLN A OE1  5  
ATOM 8175  N NE2  . GLN A 1 81  ? -1.767  14.138  -15.383 1.00 0.00 ? 81  GLN A NE2  5  
ATOM 8176  H H    . GLN A 1 81  ? -0.017  15.055  -12.271 1.00 0.00 ? 81  GLN A H    5  
ATOM 8177  H HA   . GLN A 1 81  ? -2.210  16.668  -11.674 1.00 0.00 ? 81  GLN A HA   5  
ATOM 8178  H HB2  . GLN A 1 81  ? -1.736  13.953  -12.806 1.00 0.00 ? 81  GLN A HB2  5  
ATOM 8179  H HB3  . GLN A 1 81  ? -3.313  14.183  -12.078 1.00 0.00 ? 81  GLN A HB3  5  
ATOM 8180  H HG2  . GLN A 1 81  ? -3.887  15.083  -14.100 1.00 0.00 ? 81  GLN A HG2  5  
ATOM 8181  H HG3  . GLN A 1 81  ? -3.085  16.524  -13.508 1.00 0.00 ? 81  GLN A HG3  5  
ATOM 8182  H HE21 . GLN A 1 81  ? -2.318  13.389  -15.014 1.00 0.00 ? 81  GLN A HE21 5  
ATOM 8183  H HE22 . GLN A 1 81  ? -1.118  13.964  -16.123 1.00 0.00 ? 81  GLN A HE22 5  
ATOM 8184  N N    . ALA A 1 82  ? -1.465  14.260  -9.561  1.00 0.00 ? 82  ALA A N    5  
ATOM 8185  C CA   . ALA A 1 82  ? -1.698  13.753  -8.220  1.00 0.00 ? 82  ALA A CA   5  
ATOM 8186  C C    . ALA A 1 82  ? -1.423  14.865  -7.205  1.00 0.00 ? 82  ALA A C    5  
ATOM 8187  O O    . ALA A 1 82  ? -2.161  15.018  -6.232  1.00 0.00 ? 82  ALA A O    5  
ATOM 8188  C CB   . ALA A 1 82  ? -0.826  12.519  -7.982  1.00 0.00 ? 82  ALA A CB   5  
ATOM 8189  H H    . ALA A 1 82  ? -0.710  13.825  -10.052 1.00 0.00 ? 82  ALA A H    5  
ATOM 8190  H HA   . ALA A 1 82  ? -2.746  13.462  -8.152  1.00 0.00 ? 82  ALA A HA   5  
ATOM 8191  H HB1  . ALA A 1 82  ? 0.034   12.546  -8.651  1.00 0.00 ? 82  ALA A HB1  5  
ATOM 8192  H HB2  . ALA A 1 82  ? -0.481  12.511  -6.948  1.00 0.00 ? 82  ALA A HB2  5  
ATOM 8193  H HB3  . ALA A 1 82  ? -1.410  11.619  -8.177  1.00 0.00 ? 82  ALA A HB3  5  
ATOM 8194  N N    . ARG A 1 83  ? -0.361  15.612  -7.466  1.00 0.00 ? 83  ARG A N    5  
ATOM 8195  C CA   . ARG A 1 83  ? 0.020   16.705  -6.587  1.00 0.00 ? 83  ARG A CA   5  
ATOM 8196  C C    . ARG A 1 83  ? -1.054  17.794  -6.598  1.00 0.00 ? 83  ARG A C    5  
ATOM 8197  O O    . ARG A 1 83  ? -1.024  18.709  -5.777  1.00 0.00 ? 83  ARG A O    5  
ATOM 8198  C CB   . ARG A 1 83  ? 1.358   17.313  -7.013  1.00 0.00 ? 83  ARG A CB   5  
ATOM 8199  C CG   . ARG A 1 83  ? 2.524   16.407  -6.614  1.00 0.00 ? 83  ARG A CG   5  
ATOM 8200  C CD   . ARG A 1 83  ? 3.821   16.850  -7.295  1.00 0.00 ? 83  ARG A CD   5  
ATOM 8201  N NE   . ARG A 1 83  ? 4.506   17.866  -6.466  1.00 0.00 ? 83  ARG A NE   5  
ATOM 8202  C CZ   . ARG A 1 83  ? 5.478   18.671  -6.915  1.00 0.00 ? 83  ARG A CZ   5  
ATOM 8203  N NH1  . ARG A 1 83  ? 5.884   18.585  -8.189  1.00 0.00 ? 83  ARG A NH1  5  
ATOM 8204  N NH2  . ARG A 1 83  ? 6.044   19.564  -6.091  1.00 0.00 ? 83  ARG A NH2  5  
ATOM 8205  H H    . ARG A 1 83  ? 0.234   15.480  -8.259  1.00 0.00 ? 83  ARG A H    5  
ATOM 8206  H HA   . ARG A 1 83  ? 0.108   16.251  -5.600  1.00 0.00 ? 83  ARG A HA   5  
ATOM 8207  H HB2  . ARG A 1 83  ? 1.364   17.467  -8.092  1.00 0.00 ? 83  ARG A HB2  5  
ATOM 8208  H HB3  . ARG A 1 83  ? 1.480   18.293  -6.550  1.00 0.00 ? 83  ARG A HB3  5  
ATOM 8209  H HG2  . ARG A 1 83  ? 2.652   16.427  -5.532  1.00 0.00 ? 83  ARG A HG2  5  
ATOM 8210  H HG3  . ARG A 1 83  ? 2.299   15.376  -6.889  1.00 0.00 ? 83  ARG A HG3  5  
ATOM 8211  H HD2  . ARG A 1 83  ? 4.474   15.991  -7.447  1.00 0.00 ? 83  ARG A HD2  5  
ATOM 8212  H HD3  . ARG A 1 83  ? 3.601   17.261  -8.281  1.00 0.00 ? 83  ARG A HD3  5  
ATOM 8213  H HE   . ARG A 1 83  ? 4.227   17.956  -5.510  1.00 0.00 ? 83  ARG A HE   5  
ATOM 8214  H HH11 . ARG A 1 83  ? 5.462   17.919  -8.805  1.00 0.00 ? 83  ARG A HH11 5  
ATOM 8215  H HH12 . ARG A 1 83  ? 6.610   19.186  -8.525  1.00 0.00 ? 83  ARG A HH12 5  
ATOM 8216  H HH21 . ARG A 1 83  ? 5.741   19.628  -5.140  1.00 0.00 ? 83  ARG A HH21 5  
ATOM 8217  H HH22 . ARG A 1 83  ? 6.769   20.165  -6.426  1.00 0.00 ? 83  ARG A HH22 5  
ATOM 8218  N N    . LEU A 1 84  ? -1.979  17.659  -7.538  1.00 0.00 ? 84  LEU A N    5  
ATOM 8219  C CA   . LEU A 1 84  ? -3.061  18.620  -7.667  1.00 0.00 ? 84  LEU A CA   5  
ATOM 8220  C C    . LEU A 1 84  ? -4.324  18.049  -7.019  1.00 0.00 ? 84  LEU A C    5  
ATOM 8221  O O    . LEU A 1 84  ? -4.926  18.687  -6.157  1.00 0.00 ? 84  LEU A O    5  
ATOM 8222  C CB   . LEU A 1 84  ? -3.249  19.022  -9.131  1.00 0.00 ? 84  LEU A CB   5  
ATOM 8223  C CG   . LEU A 1 84  ? -4.554  18.570  -9.788  1.00 0.00 ? 84  LEU A CG   5  
ATOM 8224  C CD1  . LEU A 1 84  ? -5.763  19.212  -9.105  1.00 0.00 ? 84  LEU A CD1  5  
ATOM 8225  C CD2  . LEU A 1 84  ? -4.533  18.844  -11.294 1.00 0.00 ? 84  LEU A CD2  5  
ATOM 8226  H H    . LEU A 1 84  ? -1.996  16.911  -8.202  1.00 0.00 ? 84  LEU A H    5  
ATOM 8227  H HA   . LEU A 1 84  ? -2.768  19.517  -7.121  1.00 0.00 ? 84  LEU A HA   5  
ATOM 8228  H HB2  . LEU A 1 84  ? -3.188  20.108  -9.199  1.00 0.00 ? 84  LEU A HB2  5  
ATOM 8229  H HB3  . LEU A 1 84  ? -2.416  18.619  -9.707  1.00 0.00 ? 84  LEU A HB3  5  
ATOM 8230  H HG   . LEU A 1 84  ? -4.646  17.492  -9.659  1.00 0.00 ? 84  LEU A HG   5  
ATOM 8231  H HD11 . LEU A 1 84  ? -5.425  20.009  -8.443  1.00 0.00 ? 84  LEU A HD11 5  
ATOM 8232  H HD12 . LEU A 1 84  ? -6.430  19.626  -9.862  1.00 0.00 ? 84  LEU A HD12 5  
ATOM 8233  H HD13 . LEU A 1 84  ? -6.295  18.458  -8.525  1.00 0.00 ? 84  LEU A HD13 5  
ATOM 8234  H HD21 . LEU A 1 84  ? -4.945  19.835  -11.488 1.00 0.00 ? 84  LEU A HD21 5  
ATOM 8235  H HD22 . LEU A 1 84  ? -3.507  18.799  -11.657 1.00 0.00 ? 84  LEU A HD22 5  
ATOM 8236  H HD23 . LEU A 1 84  ? -5.134  18.094  -11.808 1.00 0.00 ? 84  LEU A HD23 5  
ATOM 8237  N N    . ILE A 1 85  ? -4.688  16.854  -7.459  1.00 0.00 ? 85  ILE A N    5  
ATOM 8238  C CA   . ILE A 1 85  ? -5.868  16.190  -6.932  1.00 0.00 ? 85  ILE A CA   5  
ATOM 8239  C C    . ILE A 1 85  ? -5.823  16.214  -5.403  1.00 0.00 ? 85  ILE A C    5  
ATOM 8240  O O    . ILE A 1 85  ? -6.847  16.410  -4.751  1.00 0.00 ? 85  ILE A O    5  
ATOM 8241  C CB   . ILE A 1 85  ? -5.999  14.784  -7.521  1.00 0.00 ? 85  ILE A CB   5  
ATOM 8242  C CG1  . ILE A 1 85  ? -6.044  14.831  -9.050  1.00 0.00 ? 85  ILE A CG1  5  
ATOM 8243  C CG2  . ILE A 1 85  ? -7.210  14.055  -6.935  1.00 0.00 ? 85  ILE A CG2  5  
ATOM 8244  C CD1  . ILE A 1 85  ? -5.430  13.567  -9.656  1.00 0.00 ? 85  ILE A CD1  5  
ATOM 8245  H H    . ILE A 1 85  ? -4.192  16.341  -8.160  1.00 0.00 ? 85  ILE A H    5  
ATOM 8246  H HA   . ILE A 1 85  ? -6.737  16.759  -7.262  1.00 0.00 ? 85  ILE A HA   5  
ATOM 8247  H HB   . ILE A 1 85  ? -5.114  14.213  -7.242  1.00 0.00 ? 85  ILE A HB   5  
ATOM 8248  H HG12 . ILE A 1 85  ? -7.076  14.935  -9.384  1.00 0.00 ? 85  ILE A HG12 5  
ATOM 8249  H HG13 . ILE A 1 85  ? -5.503  15.708  -9.406  1.00 0.00 ? 85  ILE A HG13 5  
ATOM 8250  H HG21 . ILE A 1 85  ? -7.574  13.320  -7.653  1.00 0.00 ? 85  ILE A HG21 5  
ATOM 8251  H HG22 . ILE A 1 85  ? -6.919  13.550  -6.014  1.00 0.00 ? 85  ILE A HG22 5  
ATOM 8252  H HG23 . ILE A 1 85  ? -7.999  14.775  -6.721  1.00 0.00 ? 85  ILE A HG23 5  
ATOM 8253  H HD11 . ILE A 1 85  ? -4.346  13.670  -9.691  1.00 0.00 ? 85  ILE A HD11 5  
ATOM 8254  H HD12 . ILE A 1 85  ? -5.694  12.706  -9.042  1.00 0.00 ? 85  ILE A HD12 5  
ATOM 8255  H HD13 . ILE A 1 85  ? -5.815  13.425  -10.666 1.00 0.00 ? 85  ILE A HD13 5  
ATOM 8256  N N    . ILE A 1 86  ? -4.624  16.013  -4.875  1.00 0.00 ? 86  ILE A N    5  
ATOM 8257  C CA   . ILE A 1 86  ? -4.432  16.009  -3.435  1.00 0.00 ? 86  ILE A CA   5  
ATOM 8258  C C    . ILE A 1 86  ? -4.412  17.451  -2.924  1.00 0.00 ? 86  ILE A C    5  
ATOM 8259  O O    . ILE A 1 86  ? -4.827  17.721  -1.798  1.00 0.00 ? 86  ILE A O    5  
ATOM 8260  C CB   . ILE A 1 86  ? -3.183  15.207  -3.063  1.00 0.00 ? 86  ILE A CB   5  
ATOM 8261  C CG1  . ILE A 1 86  ? -1.911  15.953  -3.471  1.00 0.00 ? 86  ILE A CG1  5  
ATOM 8262  C CG2  . ILE A 1 86  ? -3.238  13.799  -3.659  1.00 0.00 ? 86  ILE A CG2  5  
ATOM 8263  C CD1  . ILE A 1 86  ? -0.691  15.031  -3.410  1.00 0.00 ? 86  ILE A CD1  5  
ATOM 8264  H H    . ILE A 1 86  ? -3.796  15.854  -5.413  1.00 0.00 ? 86  ILE A H    5  
ATOM 8265  H HA   . ILE A 1 86  ? -5.287  15.498  -2.993  1.00 0.00 ? 86  ILE A HA   5  
ATOM 8266  H HB   . ILE A 1 86  ? -3.158  15.097  -1.979  1.00 0.00 ? 86  ILE A HB   5  
ATOM 8267  H HG12 . ILE A 1 86  ? -2.024  16.347  -4.481  1.00 0.00 ? 86  ILE A HG12 5  
ATOM 8268  H HG13 . ILE A 1 86  ? -1.759  16.808  -2.811  1.00 0.00 ? 86  ILE A HG13 5  
ATOM 8269  H HG21 . ILE A 1 86  ? -4.199  13.650  -4.152  1.00 0.00 ? 86  ILE A HG21 5  
ATOM 8270  H HG22 . ILE A 1 86  ? -2.435  13.681  -4.387  1.00 0.00 ? 86  ILE A HG22 5  
ATOM 8271  H HG23 . ILE A 1 86  ? -3.119  13.063  -2.865  1.00 0.00 ? 86  ILE A HG23 5  
ATOM 8272  H HD11 . ILE A 1 86  ? -0.932  14.150  -2.816  1.00 0.00 ? 86  ILE A HD11 5  
ATOM 8273  H HD12 . ILE A 1 86  ? -0.416  14.726  -4.419  1.00 0.00 ? 86  ILE A HD12 5  
ATOM 8274  H HD13 . ILE A 1 86  ? 0.143   15.562  -2.951  1.00 0.00 ? 86  ILE A HD13 5  
ATOM 8275  N N    . GLY A 1 87  ? -3.923  18.340  -3.777  1.00 0.00 ? 87  GLY A N    5  
ATOM 8276  C CA   . GLY A 1 87  ? -3.843  19.748  -3.426  1.00 0.00 ? 87  GLY A CA   5  
ATOM 8277  C C    . GLY A 1 87  ? -5.127  20.484  -3.815  1.00 0.00 ? 87  GLY A C    5  
ATOM 8278  O O    . GLY A 1 87  ? -5.108  21.692  -4.048  1.00 0.00 ? 87  GLY A O    5  
ATOM 8279  H H    . GLY A 1 87  ? -3.587  18.113  -4.691  1.00 0.00 ? 87  GLY A H    5  
ATOM 8280  H HA2  . GLY A 1 87  ? -3.672  19.850  -2.354  1.00 0.00 ? 87  GLY A HA2  5  
ATOM 8281  H HA3  . GLY A 1 87  ? -2.991  20.204  -3.929  1.00 0.00 ? 87  GLY A HA3  5  
ATOM 8282  N N    . GLN A 1 88  ? -6.211  19.726  -3.874  1.00 0.00 ? 88  GLN A N    5  
ATOM 8283  C CA   . GLN A 1 88  ? -7.501  20.291  -4.232  1.00 0.00 ? 88  GLN A CA   5  
ATOM 8284  C C    . GLN A 1 88  ? -8.256  20.727  -2.974  1.00 0.00 ? 88  GLN A C    5  
ATOM 8285  O O    . GLN A 1 88  ? -7.709  20.693  -1.874  1.00 0.00 ? 88  GLN A O    5  
ATOM 8286  C CB   . GLN A 1 88  ? -8.327  19.297  -5.050  1.00 0.00 ? 88  GLN A CB   5  
ATOM 8287  C CG   . GLN A 1 88  ? -8.017  19.425  -6.543  1.00 0.00 ? 88  GLN A CG   5  
ATOM 8288  C CD   . GLN A 1 88  ? -9.302  19.408  -7.374  1.00 0.00 ? 88  GLN A CD   5  
ATOM 8289  O OE1  . GLN A 1 88  ? -10.048 20.372  -7.430  1.00 0.00 ? 88  GLN A OE1  5  
ATOM 8290  N NE2  . GLN A 1 88  ? -9.518  18.262  -8.014  1.00 0.00 ? 88  GLN A NE2  5  
ATOM 8291  H H    . GLN A 1 88  ? -6.218  18.744  -3.683  1.00 0.00 ? 88  GLN A H    5  
ATOM 8292  H HA   . GLN A 1 88  ? -7.276  21.161  -4.848  1.00 0.00 ? 88  GLN A HA   5  
ATOM 8293  H HB2  . GLN A 1 88  ? -8.116  18.281  -4.717  1.00 0.00 ? 88  GLN A HB2  5  
ATOM 8294  H HB3  . GLN A 1 88  ? -9.390  19.474  -4.880  1.00 0.00 ? 88  GLN A HB3  5  
ATOM 8295  H HG2  . GLN A 1 88  ? -7.473  20.351  -6.727  1.00 0.00 ? 88  GLN A HG2  5  
ATOM 8296  H HG3  . GLN A 1 88  ? -7.368  18.607  -6.855  1.00 0.00 ? 88  GLN A HG3  5  
ATOM 8297  H HE21 . GLN A 1 88  ? -8.865  17.510  -7.925  1.00 0.00 ? 88  GLN A HE21 5  
ATOM 8298  H HE22 . GLN A 1 88  ? -10.333 18.153  -8.583  1.00 0.00 ? 88  GLN A HE22 5  
ATOM 8299  N N    . GLN A 1 89  ? -9.503  21.127  -3.180  1.00 0.00 ? 89  GLN A N    5  
ATOM 8300  C CA   . GLN A 1 89  ? -10.339 21.569  -2.077  1.00 0.00 ? 89  GLN A CA   5  
ATOM 8301  C C    . GLN A 1 89  ? -11.384 20.503  -1.743  1.00 0.00 ? 89  GLN A C    5  
ATOM 8302  O O    . GLN A 1 89  ? -11.879 19.813  -2.633  1.00 0.00 ? 89  GLN A O    5  
ATOM 8303  C CB   . GLN A 1 89  ? -11.004 22.909  -2.396  1.00 0.00 ? 89  GLN A CB   5  
ATOM 8304  C CG   . GLN A 1 89  ? -11.310 23.027  -3.891  1.00 0.00 ? 89  GLN A CG   5  
ATOM 8305  C CD   . GLN A 1 89  ? -12.153 21.844  -4.373  1.00 0.00 ? 89  GLN A CD   5  
ATOM 8306  O OE1  . GLN A 1 89  ? -13.209 21.544  -3.842  1.00 0.00 ? 89  GLN A OE1  5  
ATOM 8307  N NE2  . GLN A 1 89  ? -11.628 21.192  -5.406  1.00 0.00 ? 89  GLN A NE2  5  
ATOM 8308  H H    . GLN A 1 89  ? -9.941  21.152  -4.079  1.00 0.00 ? 89  GLN A H    5  
ATOM 8309  H HA   . GLN A 1 89  ? -9.660  21.699  -1.234  1.00 0.00 ? 89  GLN A HA   5  
ATOM 8310  H HB2  . GLN A 1 89  ? -11.927 23.006  -1.824  1.00 0.00 ? 89  GLN A HB2  5  
ATOM 8311  H HB3  . GLN A 1 89  ? -10.351 23.726  -2.089  1.00 0.00 ? 89  GLN A HB3  5  
ATOM 8312  H HG2  . GLN A 1 89  ? -11.841 23.959  -4.084  1.00 0.00 ? 89  GLN A HG2  5  
ATOM 8313  H HG3  . GLN A 1 89  ? -10.378 23.068  -4.454  1.00 0.00 ? 89  GLN A HG3  5  
ATOM 8314  H HE21 . GLN A 1 89  ? -10.756 21.490  -5.795  1.00 0.00 ? 89  GLN A HE21 5  
ATOM 8315  H HE22 . GLN A 1 89  ? -12.105 20.403  -5.794  1.00 0.00 ? 89  GLN A HE22 5  
ATOM 8316  N N    . CYS A 1 90  ? -11.690 20.402  -0.457  1.00 0.00 ? 90  CYS A N    5  
ATOM 8317  C CA   . CYS A 1 90  ? -12.668 19.432  0.005   1.00 0.00 ? 90  CYS A CA   5  
ATOM 8318  C C    . CYS A 1 90  ? -12.525 19.292  1.522   1.00 0.00 ? 90  CYS A C    5  
ATOM 8319  O O    . CYS A 1 90  ? -11.584 18.665  2.006   1.00 0.00 ? 90  CYS A O    5  
ATOM 8320  C CB   . CYS A 1 90  ? -12.512 18.087  -0.709  1.00 0.00 ? 90  CYS A CB   5  
ATOM 8321  S SG   . CYS A 1 90  ? -13.815 17.900  -1.981  1.00 0.00 ? 90  CYS A SG   5  
ATOM 8322  H H    . CYS A 1 90  ? -11.283 20.967  0.260   1.00 0.00 ? 90  CYS A H    5  
ATOM 8323  H HA   . CYS A 1 90  ? -13.649 19.827  -0.257  1.00 0.00 ? 90  CYS A HA   5  
ATOM 8324  H HB2  . CYS A 1 90  ? -11.528 18.024  -1.173  1.00 0.00 ? 90  CYS A HB2  5  
ATOM 8325  H HB3  . CYS A 1 90  ? -12.577 17.273  0.013   1.00 0.00 ? 90  CYS A HB3  5  
ATOM 8326  H HG   . CYS A 1 90  ? -14.818 17.719  -1.127  1.00 0.00 ? 90  CYS A HG   5  
ATOM 8327  N N    . ASP A 1 91  ? -13.474 19.887  2.231   1.00 0.00 ? 91  ASP A N    5  
ATOM 8328  C CA   . ASP A 1 91  ? -13.466 19.837  3.683   1.00 0.00 ? 91  ASP A CA   5  
ATOM 8329  C C    . ASP A 1 91  ? -13.116 18.418  4.138   1.00 0.00 ? 91  ASP A C    5  
ATOM 8330  O O    . ASP A 1 91  ? -12.327 18.236  5.063   1.00 0.00 ? 91  ASP A O    5  
ATOM 8331  C CB   . ASP A 1 91  ? -14.840 20.191  4.254   1.00 0.00 ? 91  ASP A CB   5  
ATOM 8332  C CG   . ASP A 1 91  ? -15.115 21.689  4.395   1.00 0.00 ? 91  ASP A CG   5  
ATOM 8333  O OD1  . ASP A 1 91  ? -15.476 22.300  3.366   1.00 0.00 ? 91  ASP A OD1  5  
ATOM 8334  O OD2  . ASP A 1 91  ? -14.957 22.191  5.529   1.00 0.00 ? 91  ASP A OD2  5  
ATOM 8335  H H    . ASP A 1 91  ? -14.236 20.395  1.830   1.00 0.00 ? 91  ASP A H    5  
ATOM 8336  H HA   . ASP A 1 91  ? -12.719 20.569  3.991   1.00 0.00 ? 91  ASP A HA   5  
ATOM 8337  H HB2  . ASP A 1 91  ? -15.607 19.755  3.613   1.00 0.00 ? 91  ASP A HB2  5  
ATOM 8338  H HB3  . ASP A 1 91  ? -14.941 19.724  5.233   1.00 0.00 ? 91  ASP A HB3  5  
ATOM 8339  N N    . THR A 1 92  ? -13.721 17.450  3.466   1.00 0.00 ? 92  THR A N    5  
ATOM 8340  C CA   . THR A 1 92  ? -13.483 16.053  3.789   1.00 0.00 ? 92  THR A CA   5  
ATOM 8341  C C    . THR A 1 92  ? -13.294 15.234  2.511   1.00 0.00 ? 92  THR A C    5  
ATOM 8342  O O    . THR A 1 92  ? -14.173 15.206  1.651   1.00 0.00 ? 92  THR A O    5  
ATOM 8343  C CB   . THR A 1 92  ? -14.645 15.565  4.657   1.00 0.00 ? 92  THR A CB   5  
ATOM 8344  O OG1  . THR A 1 92  ? -14.776 16.569  5.659   1.00 0.00 ? 92  THR A OG1  5  
ATOM 8345  C CG2  . THR A 1 92  ? -14.297 14.298  5.442   1.00 0.00 ? 92  THR A CG2  5  
ATOM 8346  H H    . THR A 1 92  ? -14.362 17.606  2.714   1.00 0.00 ? 92  THR A H    5  
ATOM 8347  H HA   . THR A 1 92  ? -12.554 15.985  4.354   1.00 0.00 ? 92  THR A HA   5  
ATOM 8348  H HB   . THR A 1 92  ? -15.543 15.417  4.058   1.00 0.00 ? 92  THR A HB   5  
ATOM 8349  H HG1  . THR A 1 92  ? -14.004 16.523  6.293   1.00 0.00 ? 92  THR A HG1  5  
ATOM 8350  H HG21 . THR A 1 92  ? -14.674 13.426  4.910   1.00 0.00 ? 92  THR A HG21 5  
ATOM 8351  H HG22 . THR A 1 92  ? -13.215 14.221  5.546   1.00 0.00 ? 92  THR A HG22 5  
ATOM 8352  H HG23 . THR A 1 92  ? -14.755 14.347  6.431   1.00 0.00 ? 92  THR A HG23 5  
ATOM 8353  N N    . ILE A 1 93  ? -12.141 14.588  2.426   1.00 0.00 ? 93  ILE A N    5  
ATOM 8354  C CA   . ILE A 1 93  ? -11.824 13.770  1.267   1.00 0.00 ? 93  ILE A CA   5  
ATOM 8355  C C    . ILE A 1 93  ? -11.327 12.401  1.735   1.00 0.00 ? 93  ILE A C    5  
ATOM 8356  O O    . ILE A 1 93  ? -10.654 12.297  2.759   1.00 0.00 ? 93  ILE A O    5  
ATOM 8357  C CB   . ILE A 1 93  ? -10.843 14.500  0.348   1.00 0.00 ? 93  ILE A CB   5  
ATOM 8358  C CG1  . ILE A 1 93  ? -10.018 13.507  -0.473  1.00 0.00 ? 93  ILE A CG1  5  
ATOM 8359  C CG2  . ILE A 1 93  ? -9.957  15.460  1.145   1.00 0.00 ? 93  ILE A CG2  5  
ATOM 8360  C CD1  . ILE A 1 93  ? -8.741  13.109  0.269   1.00 0.00 ? 93  ILE A CD1  5  
ATOM 8361  H H    . ILE A 1 93  ? -11.431 14.616  3.130   1.00 0.00 ? 93  ILE A H    5  
ATOM 8362  H HA   . ILE A 1 93  ? -12.748 13.629  0.705   1.00 0.00 ? 93  ILE A HA   5  
ATOM 8363  H HB   . ILE A 1 93  ? -11.417 15.102  -0.356  1.00 0.00 ? 93  ILE A HB   5  
ATOM 8364  H HG12 . ILE A 1 93  ? -10.614 12.618  -0.680  1.00 0.00 ? 93  ILE A HG12 5  
ATOM 8365  H HG13 . ILE A 1 93  ? -9.762  13.950  -1.435  1.00 0.00 ? 93  ILE A HG13 5  
ATOM 8366  H HG21 . ILE A 1 93  ? -9.089  15.736  0.545   1.00 0.00 ? 93  ILE A HG21 5  
ATOM 8367  H HG22 . ILE A 1 93  ? -10.525 16.356  1.396   1.00 0.00 ? 93  ILE A HG22 5  
ATOM 8368  H HG23 . ILE A 1 93  ? -9.624  14.972  2.061   1.00 0.00 ? 93  ILE A HG23 5  
ATOM 8369  H HD11 . ILE A 1 93  ? -8.208  12.351  -0.305  1.00 0.00 ? 93  ILE A HD11 5  
ATOM 8370  H HD12 . ILE A 1 93  ? -8.104  13.986  0.391   1.00 0.00 ? 93  ILE A HD12 5  
ATOM 8371  H HD13 . ILE A 1 93  ? -8.999  12.708  1.249   1.00 0.00 ? 93  ILE A HD13 5  
ATOM 8372  N N    . THR A 1 94  ? -11.678 11.384  0.961   1.00 0.00 ? 94  THR A N    5  
ATOM 8373  C CA   . THR A 1 94  ? -11.276 10.025  1.283   1.00 0.00 ? 94  THR A CA   5  
ATOM 8374  C C    . THR A 1 94  ? -10.171 9.557   0.335   1.00 0.00 ? 94  THR A C    5  
ATOM 8375  O O    . THR A 1 94  ? -10.056 10.055  -0.785  1.00 0.00 ? 94  THR A O    5  
ATOM 8376  C CB   . THR A 1 94  ? -12.524 9.141   1.246   1.00 0.00 ? 94  THR A CB   5  
ATOM 8377  O OG1  . THR A 1 94  ? -13.541 9.952   1.827   1.00 0.00 ? 94  THR A OG1  5  
ATOM 8378  C CG2  . THR A 1 94  ? -12.419 7.941   2.189   1.00 0.00 ? 94  THR A CG2  5  
ATOM 8379  H H    . THR A 1 94  ? -12.226 11.476  0.130   1.00 0.00 ? 94  THR A H    5  
ATOM 8380  H HA   . THR A 1 94  ? -10.856 10.020  2.290   1.00 0.00 ? 94  THR A HA   5  
ATOM 8381  H HB   . THR A 1 94  ? -12.742 8.819   0.228   1.00 0.00 ? 94  THR A HB   5  
ATOM 8382  H HG1  . THR A 1 94  ? -13.824 10.661  1.181   1.00 0.00 ? 94  THR A HG1  5  
ATOM 8383  H HG21 . THR A 1 94  ? -11.487 7.409   1.999   1.00 0.00 ? 94  THR A HG21 5  
ATOM 8384  H HG22 . THR A 1 94  ? -12.435 8.288   3.222   1.00 0.00 ? 94  THR A HG22 5  
ATOM 8385  H HG23 . THR A 1 94  ? -13.262 7.270   2.018   1.00 0.00 ? 94  THR A HG23 5  
ATOM 8386  N N    . ILE A 1 95  ? -9.385  8.606   0.816   1.00 0.00 ? 95  ILE A N    5  
ATOM 8387  C CA   . ILE A 1 95  ? -8.293  8.065   0.025   1.00 0.00 ? 95  ILE A CA   5  
ATOM 8388  C C    . ILE A 1 95  ? -8.329  6.537   0.091   1.00 0.00 ? 95  ILE A C    5  
ATOM 8389  O O    . ILE A 1 95  ? -8.608  5.964   1.143   1.00 0.00 ? 95  ILE A O    5  
ATOM 8390  C CB   . ILE A 1 95  ? -6.959  8.668   0.470   1.00 0.00 ? 95  ILE A CB   5  
ATOM 8391  C CG1  . ILE A 1 95  ? -6.958  10.188  0.292   1.00 0.00 ? 95  ILE A CG1  5  
ATOM 8392  C CG2  . ILE A 1 95  ? -5.787  8.006   -0.259  1.00 0.00 ? 95  ILE A CG2  5  
ATOM 8393  C CD1  . ILE A 1 95  ? -5.680  10.806  0.863   1.00 0.00 ? 95  ILE A CD1  5  
ATOM 8394  H H    . ILE A 1 95  ? -9.484  8.206   1.728   1.00 0.00 ? 95  ILE A H    5  
ATOM 8395  H HA   . ILE A 1 95  ? -8.456  8.370   -1.009  1.00 0.00 ? 95  ILE A HA   5  
ATOM 8396  H HB   . ILE A 1 95  ? -6.831  8.468   1.533   1.00 0.00 ? 95  ILE A HB   5  
ATOM 8397  H HG12 . ILE A 1 95  ? -7.045  10.434  -0.766  1.00 0.00 ? 95  ILE A HG12 5  
ATOM 8398  H HG13 . ILE A 1 95  ? -7.828  10.616  0.791   1.00 0.00 ? 95  ILE A HG13 5  
ATOM 8399  H HG21 . ILE A 1 95  ? -6.127  7.626   -1.222  1.00 0.00 ? 95  ILE A HG21 5  
ATOM 8400  H HG22 . ILE A 1 95  ? -4.996  8.739   -0.415  1.00 0.00 ? 95  ILE A HG22 5  
ATOM 8401  H HG23 . ILE A 1 95  ? -5.405  7.181   0.343   1.00 0.00 ? 95  ILE A HG23 5  
ATOM 8402  H HD11 . ILE A 1 95  ? -5.864  11.849  1.120   1.00 0.00 ? 95  ILE A HD11 5  
ATOM 8403  H HD12 . ILE A 1 95  ? -5.380  10.259  1.757   1.00 0.00 ? 95  ILE A HD12 5  
ATOM 8404  H HD13 . ILE A 1 95  ? -4.886  10.750  0.119   1.00 0.00 ? 95  ILE A HD13 5  
ATOM 8405  N N    . LEU A 1 96  ? -8.042  5.920   -1.046  1.00 0.00 ? 96  LEU A N    5  
ATOM 8406  C CA   . LEU A 1 96  ? -8.039  4.470   -1.131  1.00 0.00 ? 96  LEU A CA   5  
ATOM 8407  C C    . LEU A 1 96  ? -6.603  3.978   -1.322  1.00 0.00 ? 96  LEU A C    5  
ATOM 8408  O O    . LEU A 1 96  ? -6.161  3.762   -2.450  1.00 0.00 ? 96  LEU A O    5  
ATOM 8409  C CB   . LEU A 1 96  ? -9.002  3.994   -2.220  1.00 0.00 ? 96  LEU A CB   5  
ATOM 8410  C CG   . LEU A 1 96  ? -9.041  2.485   -2.468  1.00 0.00 ? 96  LEU A CG   5  
ATOM 8411  C CD1  . LEU A 1 96  ? -9.433  1.730   -1.197  1.00 0.00 ? 96  LEU A CD1  5  
ATOM 8412  C CD2  . LEU A 1 96  ? -9.961  2.146   -3.643  1.00 0.00 ? 96  LEU A CD2  5  
ATOM 8413  H H    . LEU A 1 96  ? -7.817  6.394   -1.897  1.00 0.00 ? 96  LEU A H    5  
ATOM 8414  H HA   . LEU A 1 96  ? -8.411  4.086   -0.181  1.00 0.00 ? 96  LEU A HA   5  
ATOM 8415  H HB2  . LEU A 1 96  ? -10.007 4.325   -1.959  1.00 0.00 ? 96  LEU A HB2  5  
ATOM 8416  H HB3  . LEU A 1 96  ? -8.736  4.489   -3.154  1.00 0.00 ? 96  LEU A HB3  5  
ATOM 8417  H HG   . LEU A 1 96  ? -8.038  2.157   -2.740  1.00 0.00 ? 96  LEU A HG   5  
ATOM 8418  H HD11 . LEU A 1 96  ? -8.536  1.476   -0.633  1.00 0.00 ? 96  LEU A HD11 5  
ATOM 8419  H HD12 . LEU A 1 96  ? -10.080 2.359   -0.586  1.00 0.00 ? 96  LEU A HD12 5  
ATOM 8420  H HD13 . LEU A 1 96  ? -9.964  0.816   -1.466  1.00 0.00 ? 96  LEU A HD13 5  
ATOM 8421  H HD21 . LEU A 1 96  ? -9.367  1.751   -4.467  1.00 0.00 ? 96  LEU A HD21 5  
ATOM 8422  H HD22 . LEU A 1 96  ? -10.690 1.399   -3.330  1.00 0.00 ? 96  LEU A HD22 5  
ATOM 8423  H HD23 . LEU A 1 96  ? -10.481 3.047   -3.969  1.00 0.00 ? 96  LEU A HD23 5  
ATOM 8424  N N    . ALA A 1 97  ? -5.913  3.815   -0.203  1.00 0.00 ? 97  ALA A N    5  
ATOM 8425  C CA   . ALA A 1 97  ? -4.535  3.353   -0.233  1.00 0.00 ? 97  ALA A CA   5  
ATOM 8426  C C    . ALA A 1 97  ? -4.515  1.823   -0.225  1.00 0.00 ? 97  ALA A C    5  
ATOM 8427  O O    . ALA A 1 97  ? -5.543  1.186   0.000   1.00 0.00 ? 97  ALA A O    5  
ATOM 8428  C CB   . ALA A 1 97  ? -3.770  3.952   0.948   1.00 0.00 ? 97  ALA A CB   5  
ATOM 8429  H H    . ALA A 1 97  ? -6.279  3.992   0.711   1.00 0.00 ? 97  ALA A H    5  
ATOM 8430  H HA   . ALA A 1 97  ? -4.086  3.709   -1.160  1.00 0.00 ? 97  ALA A HA   5  
ATOM 8431  H HB1  . ALA A 1 97  ? -3.439  4.959   0.694   1.00 0.00 ? 97  ALA A HB1  5  
ATOM 8432  H HB2  . ALA A 1 97  ? -4.422  3.993   1.821   1.00 0.00 ? 97  ALA A HB2  5  
ATOM 8433  H HB3  . ALA A 1 97  ? -2.903  3.330   1.172   1.00 0.00 ? 97  ALA A HB3  5  
ATOM 8434  N N    . GLN A 1 98  ? -3.334  1.277   -0.475  1.00 0.00 ? 98  GLN A N    5  
ATOM 8435  C CA   . GLN A 1 98  ? -3.166  -0.166  -0.500  1.00 0.00 ? 98  GLN A CA   5  
ATOM 8436  C C    . GLN A 1 98  ? -1.690  -0.532  -0.335  1.00 0.00 ? 98  GLN A C    5  
ATOM 8437  O O    . GLN A 1 98  ? -1.008  -0.833  -1.314  1.00 0.00 ? 98  GLN A O    5  
ATOM 8438  C CB   . GLN A 1 98  ? -3.739  -0.762  -1.787  1.00 0.00 ? 98  GLN A CB   5  
ATOM 8439  C CG   . GLN A 1 98  ? -3.808  -2.288  -1.701  1.00 0.00 ? 98  GLN A CG   5  
ATOM 8440  C CD   . GLN A 1 98  ? -4.226  -2.895  -3.042  1.00 0.00 ? 98  GLN A CD   5  
ATOM 8441  O OE1  . GLN A 1 98  ? -3.882  -2.408  -4.107  1.00 0.00 ? 98  GLN A OE1  5  
ATOM 8442  N NE2  . GLN A 1 98  ? -4.985  -3.981  -2.931  1.00 0.00 ? 98  GLN A NE2  5  
ATOM 8443  H H    . GLN A 1 98  ? -2.503  1.802   -0.658  1.00 0.00 ? 98  GLN A H    5  
ATOM 8444  H HA   . GLN A 1 98  ? -3.737  -0.538  0.351   1.00 0.00 ? 98  GLN A HA   5  
ATOM 8445  H HB2  . GLN A 1 98  ? -4.736  -0.359  -1.967  1.00 0.00 ? 98  GLN A HB2  5  
ATOM 8446  H HB3  . GLN A 1 98  ? -3.119  -0.470  -2.635  1.00 0.00 ? 98  GLN A HB3  5  
ATOM 8447  H HG2  . GLN A 1 98  ? -2.836  -2.684  -1.406  1.00 0.00 ? 98  GLN A HG2  5  
ATOM 8448  H HG3  . GLN A 1 98  ? -4.519  -2.581  -0.928  1.00 0.00 ? 98  GLN A HG3  5  
ATOM 8449  H HE21 . GLN A 1 98  ? -5.231  -4.329  -2.027  1.00 0.00 ? 98  GLN A HE21 5  
ATOM 8450  H HE22 . GLN A 1 98  ? -5.309  -4.450  -3.753  1.00 0.00 ? 98  GLN A HE22 5  
ATOM 8451  N N    . TYR A 1 99  ? -1.239  -0.494  0.910   1.00 0.00 ? 99  TYR A N    5  
ATOM 8452  C CA   . TYR A 1 99  ? 0.145   -0.817  1.215   1.00 0.00 ? 99  TYR A CA   5  
ATOM 8453  C C    . TYR A 1 99  ? 0.642   -1.973  0.344   1.00 0.00 ? 99  TYR A C    5  
ATOM 8454  O O    . TYR A 1 99  ? 0.022   -3.034  0.301   1.00 0.00 ? 99  TYR A O    5  
ATOM 8455  C CB   . TYR A 1 99  ? 0.162   -1.255  2.681   1.00 0.00 ? 99  TYR A CB   5  
ATOM 8456  C CG   . TYR A 1 99  ? 1.544   -1.670  3.190   1.00 0.00 ? 99  TYR A CG   5  
ATOM 8457  C CD1  . TYR A 1 99  ? 2.098   -2.867  2.784   1.00 0.00 ? 99  TYR A CD1  5  
ATOM 8458  C CD2  . TYR A 1 99  ? 2.236   -0.847  4.055   1.00 0.00 ? 99  TYR A CD2  5  
ATOM 8459  C CE1  . TYR A 1 99  ? 3.399   -3.257  3.264   1.00 0.00 ? 99  TYR A CE1  5  
ATOM 8460  C CE2  . TYR A 1 99  ? 3.536   -1.237  4.535   1.00 0.00 ? 99  TYR A CE2  5  
ATOM 8461  C CZ   . TYR A 1 99  ? 4.054   -2.423  4.115   1.00 0.00 ? 99  TYR A CZ   5  
ATOM 8462  O OH   . TYR A 1 99  ? 5.282   -2.792  4.568   1.00 0.00 ? 99  TYR A OH   5  
ATOM 8463  H H    . TYR A 1 99  ? -1.799  -0.248  1.700   1.00 0.00 ? 99  TYR A H    5  
ATOM 8464  H HA   . TYR A 1 99  ? 0.749   0.067   1.013   1.00 0.00 ? 99  TYR A HA   5  
ATOM 8465  H HB2  . TYR A 1 99  ? -0.211  -0.438  3.298   1.00 0.00 ? 99  TYR A HB2  5  
ATOM 8466  H HB3  . TYR A 1 99  ? -0.527  -2.091  2.808   1.00 0.00 ? 99  TYR A HB3  5  
ATOM 8467  H HD1  . TYR A 1 99  ? 1.552   -3.517  2.101   1.00 0.00 ? 99  TYR A HD1  5  
ATOM 8468  H HD2  . TYR A 1 99  ? 1.798   0.098   4.376   1.00 0.00 ? 99  TYR A HD2  5  
ATOM 8469  H HE1  . TYR A 1 99  ? 3.848   -4.200  2.951   1.00 0.00 ? 99  TYR A HE1  5  
ATOM 8470  H HE2  . TYR A 1 99  ? 4.094   -0.597  5.218   1.00 0.00 ? 99  TYR A HE2  5  
ATOM 8471  H HH   . TYR A 1 99  ? 5.991   -2.259  4.105   1.00 0.00 ? 99  TYR A HH   5  
ATOM 8472  N N    . ASN A 1 100 ? 1.757   -1.727  -0.328  1.00 0.00 ? 100 ASN A N    5  
ATOM 8473  C CA   . ASN A 1 100 ? 2.345   -2.734  -1.196  1.00 0.00 ? 100 ASN A CA   5  
ATOM 8474  C C    . ASN A 1 100 ? 3.850   -2.814  -0.929  1.00 0.00 ? 100 ASN A C    5  
ATOM 8475  O O    . ASN A 1 100 ? 4.578   -1.852  -1.166  1.00 0.00 ? 100 ASN A O    5  
ATOM 8476  C CB   . ASN A 1 100 ? 2.144   -2.377  -2.670  1.00 0.00 ? 100 ASN A CB   5  
ATOM 8477  C CG   . ASN A 1 100 ? 2.102   -3.635  -3.538  1.00 0.00 ? 100 ASN A CG   5  
ATOM 8478  O OD1  . ASN A 1 100 ? 2.602   -4.688  -3.177  1.00 0.00 ? 100 ASN A OD1  5  
ATOM 8479  N ND2  . ASN A 1 100 ? 1.478   -3.469  -4.701  1.00 0.00 ? 100 ASN A ND2  5  
ATOM 8480  H H    . ASN A 1 100 ? 2.256   -0.861  -0.288  1.00 0.00 ? 100 ASN A H    5  
ATOM 8481  H HA   . ASN A 1 100 ? 1.828   -3.661  -0.950  1.00 0.00 ? 100 ASN A HA   5  
ATOM 8482  H HB2  . ASN A 1 100 ? 1.217   -1.817  -2.789  1.00 0.00 ? 100 ASN A HB2  5  
ATOM 8483  H HB3  . ASN A 1 100 ? 2.953   -1.727  -3.004  1.00 0.00 ? 100 ASN A HB3  5  
ATOM 8484  H HD21 . ASN A 1 100 ? 1.089   -2.579  -4.937  1.00 0.00 ? 100 ASN A HD21 5  
ATOM 8485  H HD22 . ASN A 1 100 ? 1.398   -4.235  -5.339  1.00 0.00 ? 100 ASN A HD22 5  
ATOM 8486  N N    . PRO A 1 101 ? 4.282   -4.002  -0.428  1.00 0.00 ? 101 PRO A N    5  
ATOM 8487  C CA   . PRO A 1 101 ? 5.687   -4.221  -0.127  1.00 0.00 ? 101 PRO A CA   5  
ATOM 8488  C C    . PRO A 1 101 ? 6.496   -4.428  -1.409  1.00 0.00 ? 101 PRO A C    5  
ATOM 8489  O O    . PRO A 1 101 ? 7.193   -5.432  -1.553  1.00 0.00 ? 101 PRO A O    5  
ATOM 8490  C CB   . PRO A 1 101 ? 5.709   -5.432  0.791   1.00 0.00 ? 101 PRO A CB   5  
ATOM 8491  C CG   . PRO A 1 101 ? 4.370   -6.126  0.598   1.00 0.00 ? 101 PRO A CG   5  
ATOM 8492  C CD   . PRO A 1 101 ? 3.448   -5.165  -0.136  1.00 0.00 ? 101 PRO A CD   5  
ATOM 8493  H HA   . PRO A 1 101 ? 6.077   -3.413  0.315   1.00 0.00 ? 101 PRO A HA   5  
ATOM 8494  H HB2  . PRO A 1 101 ? 6.534   -6.098  0.539   1.00 0.00 ? 101 PRO A HB2  5  
ATOM 8495  H HB3  . PRO A 1 101 ? 5.847   -5.132  1.829   1.00 0.00 ? 101 PRO A HB3  5  
ATOM 8496  H HG2  . PRO A 1 101 ? 4.495   -7.045  0.026   1.00 0.00 ? 101 PRO A HG2  5  
ATOM 8497  H HG3  . PRO A 1 101 ? 3.942   -6.405  1.561   1.00 0.00 ? 101 PRO A HG3  5  
ATOM 8498  H HD2  . PRO A 1 101 ? 3.057   -5.611  -1.050  1.00 0.00 ? 101 PRO A HD2  5  
ATOM 8499  H HD3  . PRO A 1 101 ? 2.591   -4.892  0.479   1.00 0.00 ? 101 PRO A HD3  5  
ATOM 8500  N N    . HIS A 1 102 ? 6.378   -3.462  -2.308  1.00 0.00 ? 102 HIS A N    5  
ATOM 8501  C CA   . HIS A 1 102 ? 7.090   -3.525  -3.573  1.00 0.00 ? 102 HIS A CA   5  
ATOM 8502  C C    . HIS A 1 102 ? 6.849   -2.237  -4.363  1.00 0.00 ? 102 HIS A C    5  
ATOM 8503  O O    . HIS A 1 102 ? 6.520   -2.283  -5.547  1.00 0.00 ? 102 HIS A O    5  
ATOM 8504  C CB   . HIS A 1 102 ? 6.699   -4.781  -4.354  1.00 0.00 ? 102 HIS A CB   5  
ATOM 8505  C CG   . HIS A 1 102 ? 7.665   -5.930  -4.194  1.00 0.00 ? 102 HIS A CG   5  
ATOM 8506  N ND1  . HIS A 1 102 ? 7.251   -7.234  -3.985  1.00 0.00 ? 102 HIS A ND1  5  
ATOM 8507  C CD2  . HIS A 1 102 ? 9.029   -5.958  -4.214  1.00 0.00 ? 102 HIS A CD2  5  
ATOM 8508  C CE1  . HIS A 1 102 ? 8.326   -8.003  -3.885  1.00 0.00 ? 102 HIS A CE1  5  
ATOM 8509  N NE2  . HIS A 1 102 ? 9.426   -7.210  -4.027  1.00 0.00 ? 102 HIS A NE2  5  
ATOM 8510  H H    . HIS A 1 102 ? 5.809   -2.648  -2.184  1.00 0.00 ? 102 HIS A H    5  
ATOM 8511  H HA   . HIS A 1 102 ? 8.150   -3.601  -3.332  1.00 0.00 ? 102 HIS A HA   5  
ATOM 8512  H HB2  . HIS A 1 102 ? 5.709   -5.104  -4.031  1.00 0.00 ? 102 HIS A HB2  5  
ATOM 8513  H HB3  . HIS A 1 102 ? 6.622   -4.530  -5.412  1.00 0.00 ? 102 HIS A HB3  5  
ATOM 8514  H HD1  . HIS A 1 102 ? 6.302   -7.544  -3.920  1.00 0.00 ? 102 HIS A HD1  5  
ATOM 8515  H HD2  . HIS A 1 102 ? 9.681   -5.097  -4.360  1.00 0.00 ? 102 HIS A HD2  5  
ATOM 8516  H HE1  . HIS A 1 102 ? 8.329   -9.080  -3.718  1.00 0.00 ? 102 HIS A HE1  5  
ATOM 8517  N N    . VAL A 1 103 ? 7.023   -1.118  -3.675  1.00 0.00 ? 103 VAL A N    5  
ATOM 8518  C CA   . VAL A 1 103 ? 6.829   0.181   -4.297  1.00 0.00 ? 103 VAL A CA   5  
ATOM 8519  C C    . VAL A 1 103 ? 8.158   0.938   -4.311  1.00 0.00 ? 103 VAL A C    5  
ATOM 8520  O O    . VAL A 1 103 ? 8.239   2.065   -3.823  1.00 0.00 ? 103 VAL A O    5  
ATOM 8521  C CB   . VAL A 1 103 ? 5.713   0.943   -3.579  1.00 0.00 ? 103 VAL A CB   5  
ATOM 8522  C CG1  . VAL A 1 103 ? 4.445   0.093   -3.479  1.00 0.00 ? 103 VAL A CG1  5  
ATOM 8523  C CG2  . VAL A 1 103 ? 6.171   1.411   -2.196  1.00 0.00 ? 103 VAL A CG2  5  
ATOM 8524  H H    . VAL A 1 103 ? 7.291   -1.089  -2.712  1.00 0.00 ? 103 VAL A H    5  
ATOM 8525  H HA   . VAL A 1 103 ? 6.512   0.009   -5.326  1.00 0.00 ? 103 VAL A HA   5  
ATOM 8526  H HB   . VAL A 1 103 ? 5.478   1.828   -4.171  1.00 0.00 ? 103 VAL A HB   5  
ATOM 8527  H HG11 . VAL A 1 103 ? 4.706   -0.961  -3.573  1.00 0.00 ? 103 VAL A HG11 5  
ATOM 8528  H HG12 . VAL A 1 103 ? 3.968   0.265   -2.514  1.00 0.00 ? 103 VAL A HG12 5  
ATOM 8529  H HG13 . VAL A 1 103 ? 3.758   0.370   -4.279  1.00 0.00 ? 103 VAL A HG13 5  
ATOM 8530  H HG21 . VAL A 1 103 ? 6.289   2.495   -2.200  1.00 0.00 ? 103 VAL A HG21 5  
ATOM 8531  H HG22 . VAL A 1 103 ? 5.425   1.129   -1.452  1.00 0.00 ? 103 VAL A HG22 5  
ATOM 8532  H HG23 . VAL A 1 103 ? 7.124   0.942   -1.951  1.00 0.00 ? 103 VAL A HG23 5  
ATOM 8533  N N    . HIS A 1 104 ? 9.167   0.290   -4.874  1.00 0.00 ? 104 HIS A N    5  
ATOM 8534  C CA   . HIS A 1 104 ? 10.488  0.888   -4.958  1.00 0.00 ? 104 HIS A CA   5  
ATOM 8535  C C    . HIS A 1 104 ? 10.651  1.584   -6.311  1.00 0.00 ? 104 HIS A C    5  
ATOM 8536  O O    . HIS A 1 104 ? 9.718   1.621   -7.111  1.00 0.00 ? 104 HIS A O    5  
ATOM 8537  C CB   . HIS A 1 104 ? 11.575  -0.155  -4.693  1.00 0.00 ? 104 HIS A CB   5  
ATOM 8538  C CG   . HIS A 1 104 ? 12.033  -0.213  -3.255  1.00 0.00 ? 104 HIS A CG   5  
ATOM 8539  N ND1  . HIS A 1 104 ? 11.391  -0.975  -2.294  1.00 0.00 ? 104 HIS A ND1  5  
ATOM 8540  C CD2  . HIS A 1 104 ? 13.075  0.402   -2.626  1.00 0.00 ? 104 HIS A CD2  5  
ATOM 8541  C CE1  . HIS A 1 104 ? 12.026  -0.817  -1.142  1.00 0.00 ? 104 HIS A CE1  5  
ATOM 8542  N NE2  . HIS A 1 104 ? 13.069  0.037   -1.350  1.00 0.00 ? 104 HIS A NE2  5  
ATOM 8543  H H    . HIS A 1 104 ? 9.092   -0.626  -5.268  1.00 0.00 ? 104 HIS A H    5  
ATOM 8544  H HA   . HIS A 1 104 ? 10.544  1.635   -4.166  1.00 0.00 ? 104 HIS A HA   5  
ATOM 8545  H HB2  . HIS A 1 104 ? 11.201  -1.136  -4.984  1.00 0.00 ? 104 HIS A HB2  5  
ATOM 8546  H HB3  . HIS A 1 104 ? 12.434  0.060   -5.328  1.00 0.00 ? 104 HIS A HB3  5  
ATOM 8547  H HD1  . HIS A 1 104 ? 10.585  -1.548  -2.444  1.00 0.00 ? 104 HIS A HD1  5  
ATOM 8548  H HD2  . HIS A 1 104 ? 13.791  1.079   -3.092  1.00 0.00 ? 104 HIS A HD2  5  
ATOM 8549  H HE1  . HIS A 1 104 ? 11.761  -1.287  -0.195  1.00 0.00 ? 104 HIS A HE1  5  
ATOM 8550  N N    . GLN A 1 105 ? 11.844  2.120   -6.524  1.00 0.00 ? 105 GLN A N    5  
ATOM 8551  C CA   . GLN A 1 105 ? 12.142  2.812   -7.766  1.00 0.00 ? 105 GLN A CA   5  
ATOM 8552  C C    . GLN A 1 105 ? 13.527  2.411   -8.279  1.00 0.00 ? 105 GLN A C    5  
ATOM 8553  O O    . GLN A 1 105 ? 14.389  2.009   -7.499  1.00 0.00 ? 105 GLN A O    5  
ATOM 8554  C CB   . GLN A 1 105 ? 12.042  4.328   -7.586  1.00 0.00 ? 105 GLN A CB   5  
ATOM 8555  C CG   . GLN A 1 105 ? 10.594  4.757   -7.341  1.00 0.00 ? 105 GLN A CG   5  
ATOM 8556  C CD   . GLN A 1 105 ? 9.747   4.575   -8.602  1.00 0.00 ? 105 GLN A CD   5  
ATOM 8557  O OE1  . GLN A 1 105 ? 10.127  4.956   -9.697  1.00 0.00 ? 105 GLN A OE1  5  
ATOM 8558  N NE2  . GLN A 1 105 ? 8.581   3.972   -8.388  1.00 0.00 ? 105 GLN A NE2  5  
ATOM 8559  H H    . GLN A 1 105 ? 12.598  2.086   -5.868  1.00 0.00 ? 105 GLN A H    5  
ATOM 8560  H HA   . GLN A 1 105 ? 11.378  2.485   -8.471  1.00 0.00 ? 105 GLN A HA   5  
ATOM 8561  H HB2  . GLN A 1 105 ? 12.664  4.640   -6.748  1.00 0.00 ? 105 GLN A HB2  5  
ATOM 8562  H HB3  . GLN A 1 105 ? 12.428  4.830   -8.474  1.00 0.00 ? 105 GLN A HB3  5  
ATOM 8563  H HG2  . GLN A 1 105 ? 10.170  4.169   -6.526  1.00 0.00 ? 105 GLN A HG2  5  
ATOM 8564  H HG3  . GLN A 1 105 ? 10.568  5.801   -7.029  1.00 0.00 ? 105 GLN A HG3  5  
ATOM 8565  H HE21 . GLN A 1 105 ? 8.329   3.683   -7.465  1.00 0.00 ? 105 GLN A HE21 5  
ATOM 8566  H HE22 . GLN A 1 105 ? 7.956   3.807   -9.152  1.00 0.00 ? 105 GLN A HE22 5  
ATOM 8567  N N    . LEU A 1 106 ? 13.698  2.536   -9.587  1.00 0.00 ? 106 LEU A N    5  
ATOM 8568  C CA   . LEU A 1 106 ? 14.963  2.191   -10.212 1.00 0.00 ? 106 LEU A CA   5  
ATOM 8569  C C    . LEU A 1 106 ? 15.386  3.321   -11.153 1.00 0.00 ? 106 LEU A C    5  
ATOM 8570  O O    . LEU A 1 106 ? 14.540  4.026   -11.703 1.00 0.00 ? 106 LEU A O    5  
ATOM 8571  C CB   . LEU A 1 106 ? 14.869  0.825   -10.895 1.00 0.00 ? 106 LEU A CB   5  
ATOM 8572  C CG   . LEU A 1 106 ? 16.175  0.271   -11.468 1.00 0.00 ? 106 LEU A CG   5  
ATOM 8573  C CD1  . LEU A 1 106 ? 16.778  -0.783  -10.538 1.00 0.00 ? 106 LEU A CD1  5  
ATOM 8574  C CD2  . LEU A 1 106 ? 15.966  -0.268  -12.885 1.00 0.00 ? 106 LEU A CD2  5  
ATOM 8575  H H    . LEU A 1 106 ? 12.992  2.864   -10.214 1.00 0.00 ? 106 LEU A H    5  
ATOM 8576  H HA   . LEU A 1 106 ? 15.706  2.105   -9.420  1.00 0.00 ? 106 LEU A HA   5  
ATOM 8577  H HB2  . LEU A 1 106 ? 14.477  0.107   -10.175 1.00 0.00 ? 106 LEU A HB2  5  
ATOM 8578  H HB3  . LEU A 1 106 ? 14.141  0.895   -11.704 1.00 0.00 ? 106 LEU A HB3  5  
ATOM 8579  H HG   . LEU A 1 106 ? 16.892  1.088   -11.537 1.00 0.00 ? 106 LEU A HG   5  
ATOM 8580  H HD11 . LEU A 1 106 ? 17.866  -0.718  -10.572 1.00 0.00 ? 106 LEU A HD11 5  
ATOM 8581  H HD12 . LEU A 1 106 ? 16.435  -0.606  -9.518  1.00 0.00 ? 106 LEU A HD12 5  
ATOM 8582  H HD13 . LEU A 1 106 ? 16.463  -1.776  -10.859 1.00 0.00 ? 106 LEU A HD13 5  
ATOM 8583  H HD21 . LEU A 1 106 ? 14.935  -0.602  -12.999 1.00 0.00 ? 106 LEU A HD21 5  
ATOM 8584  H HD22 . LEU A 1 106 ? 16.175  0.521   -13.608 1.00 0.00 ? 106 LEU A HD22 5  
ATOM 8585  H HD23 . LEU A 1 106 ? 16.641  -1.107  -13.058 1.00 0.00 ? 106 LEU A HD23 5  
ATOM 8586  N N    . SER A 1 107 ? 16.694  3.459   -11.310 1.00 0.00 ? 107 SER A N    5  
ATOM 8587  C CA   . SER A 1 107 ? 17.240  4.492   -12.175 1.00 0.00 ? 107 SER A CA   5  
ATOM 8588  C C    . SER A 1 107 ? 16.765  5.869   -11.708 1.00 0.00 ? 107 SER A C    5  
ATOM 8589  O O    . SER A 1 107 ? 15.592  6.208   -11.854 1.00 0.00 ? 107 SER A O    5  
ATOM 8590  C CB   . SER A 1 107 ? 16.839  4.258   -13.633 1.00 0.00 ? 107 SER A CB   5  
ATOM 8591  O OG   . SER A 1 107 ? 17.854  4.679   -14.540 1.00 0.00 ? 107 SER A OG   5  
ATOM 8592  H H    . SER A 1 107 ? 17.375  2.882   -10.859 1.00 0.00 ? 107 SER A H    5  
ATOM 8593  H HA   . SER A 1 107 ? 18.322  4.407   -12.078 1.00 0.00 ? 107 SER A HA   5  
ATOM 8594  H HB2  . SER A 1 107 ? 16.632  3.198   -13.786 1.00 0.00 ? 107 SER A HB2  5  
ATOM 8595  H HB3  . SER A 1 107 ? 15.915  4.796   -13.846 1.00 0.00 ? 107 SER A HB3  5  
ATOM 8596  H HG   . SER A 1 107 ? 17.920  5.677   -14.540 1.00 0.00 ? 107 SER A HG   5  
ATOM 8597  N N    . SER A 1 108 ? 17.702  6.627   -11.157 1.00 0.00 ? 108 SER A N    5  
ATOM 8598  C CA   . SER A 1 108 ? 17.394  7.961   -10.669 1.00 0.00 ? 108 SER A CA   5  
ATOM 8599  C C    . SER A 1 108 ? 18.663  8.627   -10.131 1.00 0.00 ? 108 SER A C    5  
ATOM 8600  O O    . SER A 1 108 ? 19.046  8.405   -8.984  1.00 0.00 ? 108 SER A O    5  
ATOM 8601  C CB   . SER A 1 108 ? 16.318  7.914   -9.582  1.00 0.00 ? 108 SER A CB   5  
ATOM 8602  O OG   . SER A 1 108 ? 15.008  8.064   -10.122 1.00 0.00 ? 108 SER A OG   5  
ATOM 8603  H H    . SER A 1 108 ? 18.654  6.344   -11.043 1.00 0.00 ? 108 SER A H    5  
ATOM 8604  H HA   . SER A 1 108 ? 17.014  8.504   -11.533 1.00 0.00 ? 108 SER A HA   5  
ATOM 8605  H HB2  . SER A 1 108 ? 16.384  6.967   -9.047  1.00 0.00 ? 108 SER A HB2  5  
ATOM 8606  H HB3  . SER A 1 108 ? 16.503  8.705   -8.855  1.00 0.00 ? 108 SER A HB3  5  
ATOM 8607  H HG   . SER A 1 108 ? 15.063  8.353   -11.078 1.00 0.00 ? 108 SER A HG   5  
ATOM 8608  N N    . HIS A 1 109 ? 19.279  9.430   -10.987 1.00 0.00 ? 109 HIS A N    5  
ATOM 8609  C CA   . HIS A 1 109 ? 20.496  10.129  -10.612 1.00 0.00 ? 109 HIS A CA   5  
ATOM 8610  C C    . HIS A 1 109 ? 20.227  11.635  -10.559 1.00 0.00 ? 109 HIS A C    5  
ATOM 8611  O O    . HIS A 1 109 ? 19.743  12.217  -11.529 1.00 0.00 ? 109 HIS A O    5  
ATOM 8612  C CB   . HIS A 1 109 ? 21.644  9.765   -11.555 1.00 0.00 ? 109 HIS A CB   5  
ATOM 8613  C CG   . HIS A 1 109 ? 22.634  8.788   -10.968 1.00 0.00 ? 109 HIS A CG   5  
ATOM 8614  N ND1  . HIS A 1 109 ? 23.536  9.137   -9.978  1.00 0.00 ? 109 HIS A ND1  5  
ATOM 8615  C CD2  . HIS A 1 109 ? 22.855  7.470   -11.242 1.00 0.00 ? 109 HIS A CD2  5  
ATOM 8616  C CE1  . HIS A 1 109 ? 24.261  8.070   -9.677  1.00 0.00 ? 109 HIS A CE1  5  
ATOM 8617  N NE2  . HIS A 1 109 ? 23.838  7.038   -10.462 1.00 0.00 ? 109 HIS A NE2  5  
ATOM 8618  H H    . HIS A 1 109 ? 18.960  9.605   -11.918 1.00 0.00 ? 109 HIS A H    5  
ATOM 8619  H HA   . HIS A 1 109 ? 20.762  9.782   -9.614  1.00 0.00 ? 109 HIS A HA   5  
ATOM 8620  H HB2  . HIS A 1 109 ? 21.229  9.341   -12.470 1.00 0.00 ? 109 HIS A HB2  5  
ATOM 8621  H HB3  . HIS A 1 109 ? 22.172  10.676  -11.837 1.00 0.00 ? 109 HIS A HB3  5  
ATOM 8622  H HD1  . HIS A 1 109 ? 23.624  10.042  -9.560  1.00 0.00 ? 109 HIS A HD1  5  
ATOM 8623  H HD2  . HIS A 1 109 ? 22.314  6.872   -11.976 1.00 0.00 ? 109 HIS A HD2  5  
ATOM 8624  H HE1  . HIS A 1 109 ? 25.057  8.025   -8.933  1.00 0.00 ? 109 HIS A HE1  5  
ATOM 8625  N N    . SER A 1 110 ? 20.552  12.222  -9.417  1.00 0.00 ? 110 SER A N    5  
ATOM 8626  C CA   . SER A 1 110 ? 20.351  13.648  -9.225  1.00 0.00 ? 110 SER A CA   5  
ATOM 8627  C C    . SER A 1 110 ? 21.670  14.313  -8.827  1.00 0.00 ? 110 SER A C    5  
ATOM 8628  O O    . SER A 1 110 ? 22.102  15.273  -9.463  1.00 0.00 ? 110 SER A O    5  
ATOM 8629  C CB   . SER A 1 110 ? 19.281  13.916  -8.165  1.00 0.00 ? 110 SER A CB   5  
ATOM 8630  O OG   . SER A 1 110 ? 17.963  13.789  -8.693  1.00 0.00 ? 110 SER A OG   5  
ATOM 8631  H H    . SER A 1 110 ? 20.944  11.741  -8.633  1.00 0.00 ? 110 SER A H    5  
ATOM 8632  H HA   . SER A 1 110 ? 20.009  14.024  -10.189 1.00 0.00 ? 110 SER A HA   5  
ATOM 8633  H HB2  . SER A 1 110 ? 19.408  13.219  -7.337  1.00 0.00 ? 110 SER A HB2  5  
ATOM 8634  H HB3  . SER A 1 110 ? 19.414  14.919  -7.761  1.00 0.00 ? 110 SER A HB3  5  
ATOM 8635  H HG   . SER A 1 110 ? 17.835  14.428  -9.451  1.00 0.00 ? 110 SER A HG   5  
ATOM 8636  N N    . ARG A 1 111 ? 22.274  13.776  -7.777  1.00 0.00 ? 111 ARG A N    5  
ATOM 8637  C CA   . ARG A 1 111 ? 23.535  14.305  -7.286  1.00 0.00 ? 111 ARG A CA   5  
ATOM 8638  C C    . ARG A 1 111 ? 23.399  15.797  -6.974  1.00 0.00 ? 111 ARG A C    5  
ATOM 8639  O O    . ARG A 1 111 ? 23.510  16.635  -7.867  1.00 0.00 ? 111 ARG A O    5  
ATOM 8640  C CB   . ARG A 1 111 ? 24.652  14.106  -8.313  1.00 0.00 ? 111 ARG A CB   5  
ATOM 8641  C CG   . ARG A 1 111 ? 25.917  14.862  -7.899  1.00 0.00 ? 111 ARG A CG   5  
ATOM 8642  C CD   . ARG A 1 111 ? 27.114  13.914  -7.803  1.00 0.00 ? 111 ARG A CD   5  
ATOM 8643  N NE   . ARG A 1 111 ? 26.877  12.905  -6.747  1.00 0.00 ? 111 ARG A NE   5  
ATOM 8644  C CZ   . ARG A 1 111 ? 27.682  11.859  -6.512  1.00 0.00 ? 111 ARG A CZ   5  
ATOM 8645  N NH1  . ARG A 1 111 ? 28.781  11.680  -7.257  1.00 0.00 ? 111 ARG A NH1  5  
ATOM 8646  N NH2  . ARG A 1 111 ? 27.388  10.994  -5.532  1.00 0.00 ? 111 ARG A NH2  5  
ATOM 8647  H H    . ARG A 1 111 ? 21.915  12.995  -7.265  1.00 0.00 ? 111 ARG A H    5  
ATOM 8648  H HA   . ARG A 1 111 ? 23.745  13.733  -6.383  1.00 0.00 ? 111 ARG A HA   5  
ATOM 8649  H HB2  . ARG A 1 111 ? 24.874  13.044  -8.412  1.00 0.00 ? 111 ARG A HB2  5  
ATOM 8650  H HB3  . ARG A 1 111 ? 24.319  14.455  -9.290  1.00 0.00 ? 111 ARG A HB3  5  
ATOM 8651  H HG2  . ARG A 1 111 ? 26.128  15.648  -8.624  1.00 0.00 ? 111 ARG A HG2  5  
ATOM 8652  H HG3  . ARG A 1 111 ? 25.756  15.349  -6.938  1.00 0.00 ? 111 ARG A HG3  5  
ATOM 8653  H HD2  . ARG A 1 111 ? 27.275  13.419  -8.761  1.00 0.00 ? 111 ARG A HD2  5  
ATOM 8654  H HD3  . ARG A 1 111 ? 28.019  14.479  -7.580  1.00 0.00 ? 111 ARG A HD3  5  
ATOM 8655  H HE   . ARG A 1 111 ? 26.065  13.009  -6.173  1.00 0.00 ? 111 ARG A HE   5  
ATOM 8656  H HH11 . ARG A 1 111 ? 29.001  12.326  -7.988  1.00 0.00 ? 111 ARG A HH11 5  
ATOM 8657  H HH12 . ARG A 1 111 ? 29.382  10.900  -7.082  1.00 0.00 ? 111 ARG A HH12 5  
ATOM 8658  H HH21 . ARG A 1 111 ? 26.567  11.128  -4.976  1.00 0.00 ? 111 ARG A HH21 5  
ATOM 8659  H HH22 . ARG A 1 111 ? 27.988  10.214  -5.357  1.00 0.00 ? 111 ARG A HH22 5  
ATOM 8660  N N    . SER A 1 112 ? 23.159  16.083  -5.702  1.00 0.00 ? 112 SER A N    5  
ATOM 8661  C CA   . SER A 1 112 ? 23.007  17.459  -5.260  1.00 0.00 ? 112 SER A CA   5  
ATOM 8662  C C    . SER A 1 112 ? 23.608  17.630  -3.864  1.00 0.00 ? 112 SER A C    5  
ATOM 8663  O O    . SER A 1 112 ? 23.303  16.861  -2.954  1.00 0.00 ? 112 SER A O    5  
ATOM 8664  C CB   . SER A 1 112 ? 21.535  17.877  -5.259  1.00 0.00 ? 112 SER A CB   5  
ATOM 8665  O OG   . SER A 1 112 ? 21.351  19.180  -4.712  1.00 0.00 ? 112 SER A OG   5  
ATOM 8666  H H    . SER A 1 112 ? 23.070  15.395  -4.982  1.00 0.00 ? 112 SER A H    5  
ATOM 8667  H HA   . SER A 1 112 ? 23.553  18.058  -5.988  1.00 0.00 ? 112 SER A HA   5  
ATOM 8668  H HB2  . SER A 1 112 ? 21.150  17.853  -6.279  1.00 0.00 ? 112 SER A HB2  5  
ATOM 8669  H HB3  . SER A 1 112 ? 20.954  17.156  -4.683  1.00 0.00 ? 112 SER A HB3  5  
ATOM 8670  H HG   . SER A 1 112 ? 22.142  19.754  -4.923  1.00 0.00 ? 112 SER A HG   5  
ATOM 8671  N N    . GLY A 1 113 ? 24.453  18.643  -3.739  1.00 0.00 ? 113 GLY A N    5  
ATOM 8672  C CA   . GLY A 1 113 ? 25.100  18.924  -2.469  1.00 0.00 ? 113 GLY A CA   5  
ATOM 8673  C C    . GLY A 1 113 ? 26.563  19.322  -2.675  1.00 0.00 ? 113 GLY A C    5  
ATOM 8674  O O    . GLY A 1 113 ? 27.390  18.489  -3.043  1.00 0.00 ? 113 GLY A O    5  
ATOM 8675  H H    . GLY A 1 113 ? 24.696  19.264  -4.484  1.00 0.00 ? 113 GLY A H    5  
ATOM 8676  H HA2  . GLY A 1 113 ? 24.570  19.728  -1.957  1.00 0.00 ? 113 GLY A HA2  5  
ATOM 8677  H HA3  . GLY A 1 113 ? 25.046  18.046  -1.826  1.00 0.00 ? 113 GLY A HA3  5  
ATOM 8678  N N    . PRO A 1 114 ? 26.845  20.628  -2.423  1.00 0.00 ? 114 PRO A N    5  
ATOM 8679  C CA   . PRO A 1 114 ? 28.194  21.146  -2.577  1.00 0.00 ? 114 PRO A CA   5  
ATOM 8680  C C    . PRO A 1 114 ? 29.090  20.694  -1.423  1.00 0.00 ? 114 PRO A C    5  
ATOM 8681  O O    . PRO A 1 114 ? 28.654  19.946  -0.549  1.00 0.00 ? 114 PRO A O    5  
ATOM 8682  C CB   . PRO A 1 114 ? 28.030  22.656  -2.646  1.00 0.00 ? 114 PRO A CB   5  
ATOM 8683  C CG   . PRO A 1 114 ? 26.658  22.953  -2.064  1.00 0.00 ? 114 PRO A CG   5  
ATOM 8684  C CD   . PRO A 1 114 ? 25.891  21.643  -1.985  1.00 0.00 ? 114 PRO A CD   5  
ATOM 8685  H HA   . PRO A 1 114 ? 28.613  20.780  -3.408  1.00 0.00 ? 114 PRO A HA   5  
ATOM 8686  H HB2  . PRO A 1 114 ? 28.813  23.159  -2.078  1.00 0.00 ? 114 PRO A HB2  5  
ATOM 8687  H HB3  . PRO A 1 114 ? 28.104  23.010  -3.674  1.00 0.00 ? 114 PRO A HB3  5  
ATOM 8688  H HG2  . PRO A 1 114 ? 26.752  23.400  -1.074  1.00 0.00 ? 114 PRO A HG2  5  
ATOM 8689  H HG3  . PRO A 1 114 ? 26.126  23.670  -2.688  1.00 0.00 ? 114 PRO A HG3  5  
ATOM 8690  H HD2  . PRO A 1 114 ? 25.543  21.448  -0.971  1.00 0.00 ? 114 PRO A HD2  5  
ATOM 8691  H HD3  . PRO A 1 114 ? 25.010  21.661  -2.627  1.00 0.00 ? 114 PRO A HD3  5  
ATOM 8692  N N    . SER A 1 115 ? 30.328  21.166  -1.457  1.00 0.00 ? 115 SER A N    5  
ATOM 8693  C CA   . SER A 1 115 ? 31.290  20.819  -0.424  1.00 0.00 ? 115 SER A CA   5  
ATOM 8694  C C    . SER A 1 115 ? 31.105  21.731  0.791   1.00 0.00 ? 115 SER A C    5  
ATOM 8695  O O    . SER A 1 115 ? 31.884  21.672  1.740   1.00 0.00 ? 115 SER A O    5  
ATOM 8696  C CB   . SER A 1 115 ? 32.723  20.920  -0.950  1.00 0.00 ? 115 SER A CB   5  
ATOM 8697  O OG   . SER A 1 115 ? 32.801  21.698  -2.141  1.00 0.00 ? 115 SER A OG   5  
ATOM 8698  H H    . SER A 1 115 ? 30.675  21.774  -2.171  1.00 0.00 ? 115 SER A H    5  
ATOM 8699  H HA   . SER A 1 115 ? 31.071  19.784  -0.162  1.00 0.00 ? 115 SER A HA   5  
ATOM 8700  H HB2  . SER A 1 115 ? 33.360  21.364  -0.185  1.00 0.00 ? 115 SER A HB2  5  
ATOM 8701  H HB3  . SER A 1 115 ? 33.109  19.919  -1.144  1.00 0.00 ? 115 SER A HB3  5  
ATOM 8702  H HG   . SER A 1 115 ? 33.196  22.594  -1.939  1.00 0.00 ? 115 SER A HG   5  
ATOM 8703  N N    . SER A 1 116 ? 30.069  22.554  0.721   1.00 0.00 ? 116 SER A N    5  
ATOM 8704  C CA   . SER A 1 116 ? 29.772  23.477  1.803   1.00 0.00 ? 116 SER A CA   5  
ATOM 8705  C C    . SER A 1 116 ? 28.257  23.608  1.978   1.00 0.00 ? 116 SER A C    5  
ATOM 8706  O O    . SER A 1 116 ? 27.558  24.043  1.064   1.00 0.00 ? 116 SER A O    5  
ATOM 8707  C CB   . SER A 1 116 ? 30.397  24.849  1.544   1.00 0.00 ? 116 SER A CB   5  
ATOM 8708  O OG   . SER A 1 116 ? 29.994  25.391  0.288   1.00 0.00 ? 116 SER A OG   5  
ATOM 8709  H H    . SER A 1 116 ? 29.439  22.596  -0.055  1.00 0.00 ? 116 SER A H    5  
ATOM 8710  H HA   . SER A 1 116 ? 30.223  23.035  2.691   1.00 0.00 ? 116 SER A HA   5  
ATOM 8711  H HB2  . SER A 1 116 ? 30.111  25.534  2.342   1.00 0.00 ? 116 SER A HB2  5  
ATOM 8712  H HB3  . SER A 1 116 ? 31.483  24.763  1.570   1.00 0.00 ? 116 SER A HB3  5  
ATOM 8713  H HG   . SER A 1 116 ? 30.607  25.072  -0.434  1.00 0.00 ? 116 SER A HG   5  
ATOM 8714  N N    . GLY A 1 117 ? 27.795  23.223  3.159   1.00 0.00 ? 117 GLY A N    5  
ATOM 8715  C CA   . GLY A 1 117 ? 26.376  23.293  3.465   1.00 0.00 ? 117 GLY A CA   5  
ATOM 8716  C C    . GLY A 1 117 ? 25.862  21.949  3.988   1.00 0.00 ? 117 GLY A C    5  
ATOM 8717  O O    . GLY A 1 117 ? 25.406  21.111  3.212   1.00 0.00 ? 117 GLY A O    5  
ATOM 8718  H H    . GLY A 1 117 ? 28.370  22.871  3.897   1.00 0.00 ? 117 GLY A H    5  
ATOM 8719  H HA2  . GLY A 1 117 ? 26.199  24.068  4.210   1.00 0.00 ? 117 GLY A HA2  5  
ATOM 8720  H HA3  . GLY A 1 117 ? 25.821  23.576  2.571   1.00 0.00 ? 117 GLY A HA3  5  
ATOM 8721  N N    . GLY A 1 1   ? -17.255 17.613  -6.255  1.00 0.00 ? 1   GLY A N    6  
ATOM 8722  C CA   . GLY A 1 1   ? -17.865 16.857  -5.173  1.00 0.00 ? 1   GLY A CA   6  
ATOM 8723  C C    . GLY A 1 1   ? -18.207 15.435  -5.623  1.00 0.00 ? 1   GLY A C    6  
ATOM 8724  O O    . GLY A 1 1   ? -18.574 15.217  -6.777  1.00 0.00 ? 1   GLY A O    6  
ATOM 8725  H H1   . GLY A 1 1   ? -16.273 17.468  -6.370  1.00 0.00 ? 1   GLY A H1   6  
ATOM 8726  H HA2  . GLY A 1 1   ? -17.184 16.819  -4.323  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8727  H HA3  . GLY A 1 1   ? -18.769 17.363  -4.836  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8728  N N    . SER A 1 2   ? -18.075 14.505  -4.689  1.00 0.00 ? 2   SER A N    6  
ATOM 8729  C CA   . SER A 1 2   ? -18.366 13.111  -4.974  1.00 0.00 ? 2   SER A CA   6  
ATOM 8730  C C    . SER A 1 2   ? -18.118 12.259  -3.728  1.00 0.00 ? 2   SER A C    6  
ATOM 8731  O O    . SER A 1 2   ? -17.358 12.651  -2.845  1.00 0.00 ? 2   SER A O    6  
ATOM 8732  C CB   . SER A 1 2   ? -17.521 12.600  -6.143  1.00 0.00 ? 2   SER A CB   6  
ATOM 8733  O OG   . SER A 1 2   ? -18.305 12.379  -7.313  1.00 0.00 ? 2   SER A OG   6  
ATOM 8734  H H    . SER A 1 2   ? -17.776 14.691  -3.753  1.00 0.00 ? 2   SER A H    6  
ATOM 8735  H HA   . SER A 1 2   ? -19.420 13.087  -5.251  1.00 0.00 ? 2   SER A HA   6  
ATOM 8736  H HB2  . SER A 1 2   ? -16.735 13.322  -6.365  1.00 0.00 ? 2   SER A HB2  6  
ATOM 8737  H HB3  . SER A 1 2   ? -17.028 11.671  -5.856  1.00 0.00 ? 2   SER A HB3  6  
ATOM 8738  H HG   . SER A 1 2   ? -18.784 11.504  -7.243  1.00 0.00 ? 2   SER A HG   6  
ATOM 8739  N N    . SER A 1 3   ? -18.775 11.108  -3.697  1.00 0.00 ? 3   SER A N    6  
ATOM 8740  C CA   . SER A 1 3   ? -18.635 10.197  -2.574  1.00 0.00 ? 3   SER A CA   6  
ATOM 8741  C C    . SER A 1 3   ? -19.229 8.833   -2.930  1.00 0.00 ? 3   SER A C    6  
ATOM 8742  O O    . SER A 1 3   ? -20.276 8.755   -3.571  1.00 0.00 ? 3   SER A O    6  
ATOM 8743  C CB   . SER A 1 3   ? -19.311 10.760  -1.322  1.00 0.00 ? 3   SER A CB   6  
ATOM 8744  O OG   . SER A 1 3   ? -20.661 11.143  -1.570  1.00 0.00 ? 3   SER A OG   6  
ATOM 8745  H H    . SER A 1 3   ? -19.391 10.796  -4.420  1.00 0.00 ? 3   SER A H    6  
ATOM 8746  H HA   . SER A 1 3   ? -17.562 10.114  -2.401  1.00 0.00 ? 3   SER A HA   6  
ATOM 8747  H HB2  . SER A 1 3   ? -19.287 10.011  -0.529  1.00 0.00 ? 3   SER A HB2  6  
ATOM 8748  H HB3  . SER A 1 3   ? -18.749 11.621  -0.962  1.00 0.00 ? 3   SER A HB3  6  
ATOM 8749  H HG   . SER A 1 3   ? -21.286 10.513  -1.110  1.00 0.00 ? 3   SER A HG   6  
ATOM 8750  N N    . GLY A 1 4   ? -18.535 7.790   -2.498  1.00 0.00 ? 4   GLY A N    6  
ATOM 8751  C CA   . GLY A 1 4   ? -18.980 6.433   -2.763  1.00 0.00 ? 4   GLY A CA   6  
ATOM 8752  C C    . GLY A 1 4   ? -18.872 5.565   -1.508  1.00 0.00 ? 4   GLY A C    6  
ATOM 8753  O O    . GLY A 1 4   ? -19.876 5.286   -0.853  1.00 0.00 ? 4   GLY A O    6  
ATOM 8754  H H    . GLY A 1 4   ? -17.684 7.862   -1.977  1.00 0.00 ? 4   GLY A H    6  
ATOM 8755  H HA2  . GLY A 1 4   ? -20.013 6.447   -3.112  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8756  H HA3  . GLY A 1 4   ? -18.380 5.999   -3.562  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8757  N N    . SER A 1 5   ? -17.646 5.163   -1.209  1.00 0.00 ? 5   SER A N    6  
ATOM 8758  C CA   . SER A 1 5   ? -17.393 4.333   -0.043  1.00 0.00 ? 5   SER A CA   6  
ATOM 8759  C C    . SER A 1 5   ? -18.111 2.990   -0.192  1.00 0.00 ? 5   SER A C    6  
ATOM 8760  O O    . SER A 1 5   ? -19.316 2.950   -0.436  1.00 0.00 ? 5   SER A O    6  
ATOM 8761  C CB   . SER A 1 5   ? -17.841 5.035   1.240   1.00 0.00 ? 5   SER A CB   6  
ATOM 8762  O OG   . SER A 1 5   ? -16.956 6.089   1.609   1.00 0.00 ? 5   SER A OG   6  
ATOM 8763  H H    . SER A 1 5   ? -16.835 5.394   -1.746  1.00 0.00 ? 5   SER A H    6  
ATOM 8764  H HA   . SER A 1 5   ? -16.313 4.188   -0.020  1.00 0.00 ? 5   SER A HA   6  
ATOM 8765  H HB2  . SER A 1 5   ? -18.845 5.436   1.103   1.00 0.00 ? 5   SER A HB2  6  
ATOM 8766  H HB3  . SER A 1 5   ? -17.896 4.308   2.051   1.00 0.00 ? 5   SER A HB3  6  
ATOM 8767  H HG   . SER A 1 5   ? -16.191 6.134   0.966   1.00 0.00 ? 5   SER A HG   6  
ATOM 8768  N N    . SER A 1 6   ? -17.341 1.923   -0.039  1.00 0.00 ? 6   SER A N    6  
ATOM 8769  C CA   . SER A 1 6   ? -17.888 0.582   -0.153  1.00 0.00 ? 6   SER A CA   6  
ATOM 8770  C C    . SER A 1 6   ? -17.898 -0.098  1.218   1.00 0.00 ? 6   SER A C    6  
ATOM 8771  O O    . SER A 1 6   ? -17.039 0.173   2.055   1.00 0.00 ? 6   SER A O    6  
ATOM 8772  C CB   . SER A 1 6   ? -17.090 -0.255  -1.155  1.00 0.00 ? 6   SER A CB   6  
ATOM 8773  O OG   . SER A 1 6   ? -17.920 -1.167  -1.869  1.00 0.00 ? 6   SER A OG   6  
ATOM 8774  H H    . SER A 1 6   ? -16.361 1.964   0.159   1.00 0.00 ? 6   SER A H    6  
ATOM 8775  H HA   . SER A 1 6   ? -18.905 0.716   -0.521  1.00 0.00 ? 6   SER A HA   6  
ATOM 8776  H HB2  . SER A 1 6   ? -16.587 0.406   -1.861  1.00 0.00 ? 6   SER A HB2  6  
ATOM 8777  H HB3  . SER A 1 6   ? -16.314 -0.809  -0.627  1.00 0.00 ? 6   SER A HB3  6  
ATOM 8778  H HG   . SER A 1 6   ? -18.880 -1.014  -1.632  1.00 0.00 ? 6   SER A HG   6  
ATOM 8779  N N    . GLY A 1 7   ? -18.880 -0.968  1.404   1.00 0.00 ? 7   GLY A N    6  
ATOM 8780  C CA   . GLY A 1 7   ? -19.013 -1.688  2.659   1.00 0.00 ? 7   GLY A CA   6  
ATOM 8781  C C    . GLY A 1 7   ? -19.899 -2.924  2.490   1.00 0.00 ? 7   GLY A C    6  
ATOM 8782  O O    . GLY A 1 7   ? -20.988 -2.839  1.926   1.00 0.00 ? 7   GLY A O    6  
ATOM 8783  H H    . GLY A 1 7   ? -19.575 -1.183  0.718   1.00 0.00 ? 7   GLY A H    6  
ATOM 8784  H HA2  . GLY A 1 7   ? -18.028 -1.989  3.016   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8785  H HA3  . GLY A 1 7   ? -19.440 -1.031  3.416   1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8786  N N    . GLY A 1 8   ? -19.398 -4.045  2.990   1.00 0.00 ? 8   GLY A N    6  
ATOM 8787  C CA   . GLY A 1 8   ? -20.131 -5.296  2.902   1.00 0.00 ? 8   GLY A CA   6  
ATOM 8788  C C    . GLY A 1 8   ? -19.991 -6.106  4.193   1.00 0.00 ? 8   GLY A C    6  
ATOM 8789  O O    . GLY A 1 8   ? -20.097 -5.556  5.288   1.00 0.00 ? 8   GLY A O    6  
ATOM 8790  H H    . GLY A 1 8   ? -18.511 -4.105  3.448   1.00 0.00 ? 8   GLY A H    6  
ATOM 8791  H HA2  . GLY A 1 8   ? -21.184 -5.093  2.708   1.00 0.00 ? 8   GLY A HA2  6  
ATOM 8792  H HA3  . GLY A 1 8   ? -19.759 -5.881  2.060   1.00 0.00 ? 8   GLY A HA3  6  
ATOM 8793  N N    . GLU A 1 9   ? -19.755 -7.398  4.021   1.00 0.00 ? 9   GLU A N    6  
ATOM 8794  C CA   . GLU A 1 9   ? -19.600 -8.288  5.159   1.00 0.00 ? 9   GLU A CA   6  
ATOM 8795  C C    . GLU A 1 9   ? -18.159 -8.248  5.672   1.00 0.00 ? 9   GLU A C    6  
ATOM 8796  O O    . GLU A 1 9   ? -17.225 -8.567  4.937   1.00 0.00 ? 9   GLU A O    6  
ATOM 8797  C CB   . GLU A 1 9   ? -20.013 -9.716  4.798   1.00 0.00 ? 9   GLU A CB   6  
ATOM 8798  C CG   . GLU A 1 9   ? -19.046 -10.328 3.783   1.00 0.00 ? 9   GLU A CG   6  
ATOM 8799  C CD   . GLU A 1 9   ? -19.799 -11.138 2.726   1.00 0.00 ? 9   GLU A CD   6  
ATOM 8800  O OE1  . GLU A 1 9   ? -20.767 -11.824 3.121   1.00 0.00 ? 9   GLU A OE1  6  
ATOM 8801  O OE2  . GLU A 1 9   ? -19.390 -11.053 1.548   1.00 0.00 ? 9   GLU A OE2  6  
ATOM 8802  H H    . GLU A 1 9   ? -19.670 -7.837  3.126   1.00 0.00 ? 9   GLU A H    6  
ATOM 8803  H HA   . GLU A 1 9   ? -20.275 -7.903  5.922   1.00 0.00 ? 9   GLU A HA   6  
ATOM 8804  H HB2  . GLU A 1 9   ? -20.037 -10.330 5.698   1.00 0.00 ? 9   GLU A HB2  6  
ATOM 8805  H HB3  . GLU A 1 9   ? -21.023 -9.713  4.387   1.00 0.00 ? 9   GLU A HB3  6  
ATOM 8806  H HG2  . GLU A 1 9   ? -18.473 -9.537  3.299   1.00 0.00 ? 9   GLU A HG2  6  
ATOM 8807  H HG3  . GLU A 1 9   ? -18.331 -10.970 4.298   1.00 0.00 ? 9   GLU A HG3  6  
ATOM 8808  N N    . ARG A 1 10  ? -18.023 -7.853  6.929   1.00 0.00 ? 10  ARG A N    6  
ATOM 8809  C CA   . ARG A 1 10  ? -16.711 -7.767  7.549   1.00 0.00 ? 10  ARG A CA   6  
ATOM 8810  C C    . ARG A 1 10  ? -16.100 -9.162  7.693   1.00 0.00 ? 10  ARG A C    6  
ATOM 8811  O O    . ARG A 1 10  ? -16.799 -10.166 7.569   1.00 0.00 ? 10  ARG A O    6  
ATOM 8812  C CB   . ARG A 1 10  ? -16.796 -7.109  8.927   1.00 0.00 ? 10  ARG A CB   6  
ATOM 8813  C CG   . ARG A 1 10  ? -15.522 -6.319  9.237   1.00 0.00 ? 10  ARG A CG   6  
ATOM 8814  C CD   . ARG A 1 10  ? -15.828 -4.830  9.407   1.00 0.00 ? 10  ARG A CD   6  
ATOM 8815  N NE   . ARG A 1 10  ? -14.587 -4.092  9.731   1.00 0.00 ? 10  ARG A NE   6  
ATOM 8816  C CZ   . ARG A 1 10  ? -14.417 -2.779  9.522   1.00 0.00 ? 10  ARG A CZ   6  
ATOM 8817  N NH1  . ARG A 1 10  ? -15.408 -2.052  8.989   1.00 0.00 ? 10  ARG A NH1  6  
ATOM 8818  N NH2  . ARG A 1 10  ? -13.257 -2.194  9.847   1.00 0.00 ? 10  ARG A NH2  6  
ATOM 8819  H H    . ARG A 1 10  ? -18.787 -7.595  7.520   1.00 0.00 ? 10  ARG A H    6  
ATOM 8820  H HA   . ARG A 1 10  ? -16.123 -7.149  6.870   1.00 0.00 ? 10  ARG A HA   6  
ATOM 8821  H HB2  . ARG A 1 10  ? -17.658 -6.444  8.965   1.00 0.00 ? 10  ARG A HB2  6  
ATOM 8822  H HB3  . ARG A 1 10  ? -16.949 -7.872  9.690   1.00 0.00 ? 10  ARG A HB3  6  
ATOM 8823  H HG2  . ARG A 1 10  ? -15.062 -6.706  10.146  1.00 0.00 ? 10  ARG A HG2  6  
ATOM 8824  H HG3  . ARG A 1 10  ? -14.800 -6.456  8.432   1.00 0.00 ? 10  ARG A HG3  6  
ATOM 8825  H HD2  . ARG A 1 10  ? -16.269 -4.434  8.492   1.00 0.00 ? 10  ARG A HD2  6  
ATOM 8826  H HD3  . ARG A 1 10  ? -16.562 -4.689  10.201  1.00 0.00 ? 10  ARG A HD3  6  
ATOM 8827  H HE   . ARG A 1 10  ? -13.827 -4.605  10.131  1.00 0.00 ? 10  ARG A HE   6  
ATOM 8828  H HH11 . ARG A 1 10  ? -16.275 -2.489  8.746   1.00 0.00 ? 10  ARG A HH11 6  
ATOM 8829  H HH12 . ARG A 1 10  ? -15.282 -1.072  8.833   1.00 0.00 ? 10  ARG A HH12 6  
ATOM 8830  H HH21 . ARG A 1 10  ? -12.517 -2.736  10.245  1.00 0.00 ? 10  ARG A HH21 6  
ATOM 8831  H HH22 . ARG A 1 10  ? -13.130 -1.214  9.691   1.00 0.00 ? 10  ARG A HH22 6  
ATOM 8832  N N    . ARG A 1 11  ? -14.801 -9.180  7.954   1.00 0.00 ? 11  ARG A N    6  
ATOM 8833  C CA   . ARG A 1 11  ? -14.088 -10.435 8.117   1.00 0.00 ? 11  ARG A CA   6  
ATOM 8834  C C    . ARG A 1 11  ? -12.662 -10.176 8.610   1.00 0.00 ? 11  ARG A C    6  
ATOM 8835  O O    . ARG A 1 11  ? -12.176 -10.865 9.504   1.00 0.00 ? 11  ARG A O    6  
ATOM 8836  C CB   . ARG A 1 11  ? -14.032 -11.212 6.800   1.00 0.00 ? 11  ARG A CB   6  
ATOM 8837  C CG   . ARG A 1 11  ? -13.869 -10.263 5.611   1.00 0.00 ? 11  ARG A CG   6  
ATOM 8838  C CD   . ARG A 1 11  ? -13.932 -11.028 4.287   1.00 0.00 ? 11  ARG A CD   6  
ATOM 8839  N NE   . ARG A 1 11  ? -14.314 -10.110 3.191   1.00 0.00 ? 11  ARG A NE   6  
ATOM 8840  C CZ   . ARG A 1 11  ? -13.445 -9.357  2.504   1.00 0.00 ? 11  ARG A CZ   6  
ATOM 8841  N NH1  . ARG A 1 11  ? -12.138 -9.407  2.797   1.00 0.00 ? 11  ARG A NH1  6  
ATOM 8842  N NH2  . ARG A 1 11  ? -13.882 -8.553  1.525   1.00 0.00 ? 11  ARG A NH2  6  
ATOM 8843  H H    . ARG A 1 11  ? -14.239 -8.358  8.054   1.00 0.00 ? 11  ARG A H    6  
ATOM 8844  H HA   . ARG A 1 11  ? -14.664 -10.989 8.859   1.00 0.00 ? 11  ARG A HA   6  
ATOM 8845  H HB2  . ARG A 1 11  ? -13.200 -11.916 6.825   1.00 0.00 ? 11  ARG A HB2  6  
ATOM 8846  H HB3  . ARG A 1 11  ? -14.943 -11.798 6.681   1.00 0.00 ? 11  ARG A HB3  6  
ATOM 8847  H HG2  . ARG A 1 11  ? -14.652 -9.506  5.636   1.00 0.00 ? 11  ARG A HG2  6  
ATOM 8848  H HG3  . ARG A 1 11  ? -12.916 -9.739  5.687   1.00 0.00 ? 11  ARG A HG3  6  
ATOM 8849  H HD2  . ARG A 1 11  ? -12.964 -11.481 4.073   1.00 0.00 ? 11  ARG A HD2  6  
ATOM 8850  H HD3  . ARG A 1 11  ? -14.655 -11.840 4.362   1.00 0.00 ? 11  ARG A HD3  6  
ATOM 8851  H HE   . ARG A 1 11  ? -15.282 -10.049 2.947   1.00 0.00 ? 11  ARG A HE   6  
ATOM 8852  H HH11 . ARG A 1 11  ? -11.812 -10.006 3.528   1.00 0.00 ? 11  ARG A HH11 6  
ATOM 8853  H HH12 . ARG A 1 11  ? -11.489 -8.844  2.285   1.00 0.00 ? 11  ARG A HH12 6  
ATOM 8854  H HH21 . ARG A 1 11  ? -14.857 -8.516  1.307   1.00 0.00 ? 11  ARG A HH21 6  
ATOM 8855  H HH22 . ARG A 1 11  ? -13.233 -7.990  1.013   1.00 0.00 ? 11  ARG A HH22 6  
ATOM 8856  N N    . LYS A 1 12  ? -12.033 -9.179  8.004   1.00 0.00 ? 12  LYS A N    6  
ATOM 8857  C CA   . LYS A 1 12  ? -10.674 -8.820  8.369   1.00 0.00 ? 12  LYS A CA   6  
ATOM 8858  C C    . LYS A 1 12  ? -9.735  -9.979  8.027   1.00 0.00 ? 12  LYS A C    6  
ATOM 8859  O O    . LYS A 1 12  ? -9.405  -10.791 8.891   1.00 0.00 ? 12  LYS A O    6  
ATOM 8860  C CB   . LYS A 1 12  ? -10.609 -8.389  9.835   1.00 0.00 ? 12  LYS A CB   6  
ATOM 8861  C CG   . LYS A 1 12  ? -9.512  -7.345  10.052  1.00 0.00 ? 12  LYS A CG   6  
ATOM 8862  C CD   . LYS A 1 12  ? -8.306  -7.957  10.769  1.00 0.00 ? 12  LYS A CD   6  
ATOM 8863  C CE   . LYS A 1 12  ? -7.862  -7.080  11.941  1.00 0.00 ? 12  LYS A CE   6  
ATOM 8864  N NZ   . LYS A 1 12  ? -7.463  -7.919  13.093  1.00 0.00 ? 12  LYS A NZ   6  
ATOM 8865  H H    . LYS A 1 12  ? -12.436 -8.623  7.277   1.00 0.00 ? 12  LYS A H    6  
ATOM 8866  H HA   . LYS A 1 12  ? -10.391 -7.957  7.766   1.00 0.00 ? 12  LYS A HA   6  
ATOM 8867  H HB2  . LYS A 1 12  ? -11.572 -7.978  10.141  1.00 0.00 ? 12  LYS A HB2  6  
ATOM 8868  H HB3  . LYS A 1 12  ? -10.419 -9.257  10.466  1.00 0.00 ? 12  LYS A HB3  6  
ATOM 8869  H HG2  . LYS A 1 12  ? -9.199  -6.936  9.091   1.00 0.00 ? 12  LYS A HG2  6  
ATOM 8870  H HG3  . LYS A 1 12  ? -9.905  -6.515  10.639  1.00 0.00 ? 12  LYS A HG3  6  
ATOM 8871  H HD2  . LYS A 1 12  ? -8.561  -8.953  11.131  1.00 0.00 ? 12  LYS A HD2  6  
ATOM 8872  H HD3  . LYS A 1 12  ? -7.482  -8.075  10.065  1.00 0.00 ? 12  LYS A HD3  6  
ATOM 8873  H HE2  . LYS A 1 12  ? -7.027  -6.450  11.636  1.00 0.00 ? 12  LYS A HE2  6  
ATOM 8874  H HE3  . LYS A 1 12  ? -8.674  -6.414  12.233  1.00 0.00 ? 12  LYS A HE3  6  
ATOM 8875  H HZ1  . LYS A 1 12  ? -6.513  -7.721  13.336  1.00 0.00 ? 12  LYS A HZ1  6  
ATOM 8876  H HZ2  . LYS A 1 12  ? -8.055  -7.718  13.873  1.00 0.00 ? 12  LYS A HZ2  6  
ATOM 8877  H HZ3  . LYS A 1 12  ? -7.550  -8.885  12.849  1.00 0.00 ? 12  LYS A HZ3  6  
ATOM 8878  N N    . ASP A 1 13  ? -9.332  -10.020 6.766   1.00 0.00 ? 13  ASP A N    6  
ATOM 8879  C CA   . ASP A 1 13  ? -8.438  -11.066 6.299   1.00 0.00 ? 13  ASP A CA   6  
ATOM 8880  C C    . ASP A 1 13  ? -7.748  -10.606 5.014   1.00 0.00 ? 13  ASP A C    6  
ATOM 8881  O O    . ASP A 1 13  ? -8.389  -10.039 4.130   1.00 0.00 ? 13  ASP A O    6  
ATOM 8882  C CB   . ASP A 1 13  ? -9.209  -12.351 5.988   1.00 0.00 ? 13  ASP A CB   6  
ATOM 8883  C CG   . ASP A 1 13  ? -8.822  -13.560 6.841   1.00 0.00 ? 13  ASP A CG   6  
ATOM 8884  O OD1  . ASP A 1 13  ? -8.669  -13.365 8.066   1.00 0.00 ? 13  ASP A OD1  6  
ATOM 8885  O OD2  . ASP A 1 13  ? -8.687  -14.653 6.248   1.00 0.00 ? 13  ASP A OD2  6  
ATOM 8886  H H    . ASP A 1 13  ? -9.606  -9.356  6.070   1.00 0.00 ? 13  ASP A H    6  
ATOM 8887  H HA   . ASP A 1 13  ? -7.735  -11.227 7.116   1.00 0.00 ? 13  ASP A HA   6  
ATOM 8888  H HB2  . ASP A 1 13  ? -10.274 -12.159 6.119   1.00 0.00 ? 13  ASP A HB2  6  
ATOM 8889  H HB3  . ASP A 1 13  ? -9.058  -12.602 4.938   1.00 0.00 ? 13  ASP A HB3  6  
ATOM 8890  N N    . ARG A 1 14  ? -6.450  -10.866 4.951   1.00 0.00 ? 14  ARG A N    6  
ATOM 8891  C CA   . ARG A 1 14  ? -5.666  -10.485 3.789   1.00 0.00 ? 14  ARG A CA   6  
ATOM 8892  C C    . ARG A 1 14  ? -5.453  -11.693 2.873   1.00 0.00 ? 14  ARG A C    6  
ATOM 8893  O O    . ARG A 1 14  ? -5.003  -12.745 3.323   1.00 0.00 ? 14  ARG A O    6  
ATOM 8894  C CB   . ARG A 1 14  ? -4.306  -9.922  4.203   1.00 0.00 ? 14  ARG A CB   6  
ATOM 8895  C CG   . ARG A 1 14  ? -4.461  -8.561  4.886   1.00 0.00 ? 14  ARG A CG   6  
ATOM 8896  C CD   . ARG A 1 14  ? -3.115  -8.054  5.409   1.00 0.00 ? 14  ARG A CD   6  
ATOM 8897  N NE   . ARG A 1 14  ? -3.280  -7.494  6.769   1.00 0.00 ? 14  ARG A NE   6  
ATOM 8898  C CZ   . ARG A 1 14  ? -3.373  -8.236  7.881   1.00 0.00 ? 14  ARG A CZ   6  
ATOM 8899  N NH1  . ARG A 1 14  ? -3.319  -9.572  7.802   1.00 0.00 ? 14  ARG A NH1  6  
ATOM 8900  N NH2  . ARG A 1 14  ? -3.521  -7.641  9.073   1.00 0.00 ? 14  ARG A NH2  6  
ATOM 8901  H H    . ARG A 1 14  ? -5.937  -11.327 5.675   1.00 0.00 ? 14  ARG A H    6  
ATOM 8902  H HA   . ARG A 1 14  ? -6.259  -9.717  3.292   1.00 0.00 ? 14  ARG A HA   6  
ATOM 8903  H HB2  . ARG A 1 14  ? -3.810  -10.618 4.879   1.00 0.00 ? 14  ARG A HB2  6  
ATOM 8904  H HB3  . ARG A 1 14  ? -3.667  -9.821  3.325   1.00 0.00 ? 14  ARG A HB3  6  
ATOM 8905  H HG2  . ARG A 1 14  ? -4.876  -7.841  4.181   1.00 0.00 ? 14  ARG A HG2  6  
ATOM 8906  H HG3  . ARG A 1 14  ? -5.168  -8.644  5.711   1.00 0.00 ? 14  ARG A HG3  6  
ATOM 8907  H HD2  . ARG A 1 14  ? -2.392  -8.870  5.428   1.00 0.00 ? 14  ARG A HD2  6  
ATOM 8908  H HD3  . ARG A 1 14  ? -2.719  -7.292  4.739   1.00 0.00 ? 14  ARG A HD3  6  
ATOM 8909  H HE   . ARG A 1 14  ? -3.324  -6.499  6.864   1.00 0.00 ? 14  ARG A HE   6  
ATOM 8910  H HH11 . ARG A 1 14  ? -3.209  -10.016 6.912   1.00 0.00 ? 14  ARG A HH11 6  
ATOM 8911  H HH12 . ARG A 1 14  ? -3.389  -10.126 8.631   1.00 0.00 ? 14  ARG A HH12 6  
ATOM 8912  H HH21 . ARG A 1 14  ? -3.562  -6.644  9.133   1.00 0.00 ? 14  ARG A HH21 6  
ATOM 8913  H HH22 . ARG A 1 14  ? -3.591  -8.195  9.903   1.00 0.00 ? 14  ARG A HH22 6  
ATOM 8914  N N    . PRO A 1 15  ? -5.795  -11.495 1.572   1.00 0.00 ? 15  PRO A N    6  
ATOM 8915  C CA   . PRO A 1 15  ? -5.646  -12.555 0.589   1.00 0.00 ? 15  PRO A CA   6  
ATOM 8916  C C    . PRO A 1 15  ? -4.177  -12.748 0.210   1.00 0.00 ? 15  PRO A C    6  
ATOM 8917  O O    . PRO A 1 15  ? -3.769  -13.844 -0.172  1.00 0.00 ? 15  PRO A O    6  
ATOM 8918  C CB   . PRO A 1 15  ? -6.512  -12.128 -0.585  1.00 0.00 ? 15  PRO A CB   6  
ATOM 8919  C CG   . PRO A 1 15  ? -6.743  -10.636 -0.411  1.00 0.00 ? 15  PRO A CG   6  
ATOM 8920  C CD   . PRO A 1 15  ? -6.331  -10.262 1.004   1.00 0.00 ? 15  PRO A CD   6  
ATOM 8921  H HA   . PRO A 1 15  ? -5.946  -13.428 0.973   1.00 0.00 ? 15  PRO A HA   6  
ATOM 8922  H HB2  . PRO A 1 15  ? -6.016  -12.339 -1.532  1.00 0.00 ? 15  PRO A HB2  6  
ATOM 8923  H HB3  . PRO A 1 15  ? -7.457  -12.671 -0.591  1.00 0.00 ? 15  PRO A HB3  6  
ATOM 8924  H HG2  . PRO A 1 15  ? -6.160  -10.072 -1.140  1.00 0.00 ? 15  PRO A HG2  6  
ATOM 8925  H HG3  . PRO A 1 15  ? -7.791  -10.389 -0.582  1.00 0.00 ? 15  PRO A HG3  6  
ATOM 8926  H HD2  . PRO A 1 15  ? -5.583  -9.469  1.002   1.00 0.00 ? 15  PRO A HD2  6  
ATOM 8927  H HD3  . PRO A 1 15  ? -7.181  -9.897  1.580   1.00 0.00 ? 15  PRO A HD3  6  
ATOM 8928  N N    . TYR A 1 16  ? -3.421  -11.666 0.328   1.00 0.00 ? 16  TYR A N    6  
ATOM 8929  C CA   . TYR A 1 16  ? -2.006  -11.702 0.001   1.00 0.00 ? 16  TYR A CA   6  
ATOM 8930  C C    . TYR A 1 16  ? -1.323  -10.384 0.373   1.00 0.00 ? 16  TYR A C    6  
ATOM 8931  O O    . TYR A 1 16  ? -0.296  -10.382 1.050   1.00 0.00 ? 16  TYR A O    6  
ATOM 8932  C CB   . TYR A 1 16  ? -1.927  -11.893 -1.514  1.00 0.00 ? 16  TYR A CB   6  
ATOM 8933  C CG   . TYR A 1 16  ? -1.942  -13.357 -1.959  1.00 0.00 ? 16  TYR A CG   6  
ATOM 8934  C CD1  . TYR A 1 16  ? -0.948  -14.216 -1.537  1.00 0.00 ? 16  TYR A CD1  6  
ATOM 8935  C CD2  . TYR A 1 16  ? -2.950  -13.818 -2.780  1.00 0.00 ? 16  TYR A CD2  6  
ATOM 8936  C CE1  . TYR A 1 16  ? -0.962  -15.594 -1.955  1.00 0.00 ? 16  TYR A CE1  6  
ATOM 8937  C CE2  . TYR A 1 16  ? -2.965  -15.196 -3.198  1.00 0.00 ? 16  TYR A CE2  6  
ATOM 8938  C CZ   . TYR A 1 16  ? -1.970  -16.016 -2.765  1.00 0.00 ? 16  TYR A CZ   6  
ATOM 8939  O OH   . TYR A 1 16  ? -1.984  -17.318 -3.160  1.00 0.00 ? 16  TYR A OH   6  
ATOM 8940  H H    . TYR A 1 16  ? -3.761  -10.778 0.639   1.00 0.00 ? 16  TYR A H    6  
ATOM 8941  H HA   . TYR A 1 16  ? -1.550  -12.512 0.571   1.00 0.00 ? 16  TYR A HA   6  
ATOM 8942  H HB2  . TYR A 1 16  ? -2.765  -11.374 -1.980  1.00 0.00 ? 16  TYR A HB2  6  
ATOM 8943  H HB3  . TYR A 1 16  ? -1.016  -11.422 -1.883  1.00 0.00 ? 16  TYR A HB3  6  
ATOM 8944  H HD1  . TYR A 1 16  ? -0.151  -13.852 -0.888  1.00 0.00 ? 16  TYR A HD1  6  
ATOM 8945  H HD2  . TYR A 1 16  ? -3.736  -13.140 -3.113  1.00 0.00 ? 16  TYR A HD2  6  
ATOM 8946  H HE1  . TYR A 1 16  ? -0.183  -16.284 -1.630  1.00 0.00 ? 16  TYR A HE1  6  
ATOM 8947  H HE2  . TYR A 1 16  ? -3.755  -15.574 -3.847  1.00 0.00 ? 16  TYR A HE2  6  
ATOM 8948  H HH   . TYR A 1 16  ? -1.173  -17.517 -3.710  1.00 0.00 ? 16  TYR A HH   6  
ATOM 8949  N N    . VAL A 1 17  ? -1.922  -9.295  -0.085  1.00 0.00 ? 17  VAL A N    6  
ATOM 8950  C CA   . VAL A 1 17  ? -1.386  -7.973  0.191   1.00 0.00 ? 17  VAL A CA   6  
ATOM 8951  C C    . VAL A 1 17  ? -2.318  -7.240  1.158   1.00 0.00 ? 17  VAL A C    6  
ATOM 8952  O O    . VAL A 1 17  ? -3.299  -7.810  1.632   1.00 0.00 ? 17  VAL A O    6  
ATOM 8953  C CB   . VAL A 1 17  ? -1.165  -7.213  -1.119  1.00 0.00 ? 17  VAL A CB   6  
ATOM 8954  C CG1  . VAL A 1 17  ? 0.210   -7.529  -1.711  1.00 0.00 ? 17  VAL A CG1  6  
ATOM 8955  C CG2  . VAL A 1 17  ? -2.278  -7.519  -2.123  1.00 0.00 ? 17  VAL A CG2  6  
ATOM 8956  H H    . VAL A 1 17  ? -2.758  -9.305  -0.634  1.00 0.00 ? 17  VAL A H    6  
ATOM 8957  H HA   . VAL A 1 17  ? -0.416  -8.105  0.672   1.00 0.00 ? 17  VAL A HA   6  
ATOM 8958  H HB   . VAL A 1 17  ? -1.198  -6.147  -0.897  1.00 0.00 ? 17  VAL A HB   6  
ATOM 8959  H HG11 . VAL A 1 17  ? 0.372   -8.607  -1.698  1.00 0.00 ? 17  VAL A HG11 6  
ATOM 8960  H HG12 . VAL A 1 17  ? 0.255   -7.167  -2.738  1.00 0.00 ? 17  VAL A HG12 6  
ATOM 8961  H HG13 . VAL A 1 17  ? 0.982   -7.038  -1.118  1.00 0.00 ? 17  VAL A HG13 6  
ATOM 8962  H HG21 . VAL A 1 17  ? -3.236  -7.554  -1.604  1.00 0.00 ? 17  VAL A HG21 6  
ATOM 8963  H HG22 . VAL A 1 17  ? -2.305  -6.738  -2.884  1.00 0.00 ? 17  VAL A HG22 6  
ATOM 8964  H HG23 . VAL A 1 17  ? -2.086  -8.481  -2.597  1.00 0.00 ? 17  VAL A HG23 6  
ATOM 8965  N N    . GLU A 1 18  ? -1.979  -5.987  1.421   1.00 0.00 ? 18  GLU A N    6  
ATOM 8966  C CA   . GLU A 1 18  ? -2.773  -5.170  2.323   1.00 0.00 ? 18  GLU A CA   6  
ATOM 8967  C C    . GLU A 1 18  ? -3.994  -4.607  1.592   1.00 0.00 ? 18  GLU A C    6  
ATOM 8968  O O    . GLU A 1 18  ? -3.883  -3.632  0.850   1.00 0.00 ? 18  GLU A O    6  
ATOM 8969  C CB   . GLU A 1 18  ? -1.931  -4.046  2.930   1.00 0.00 ? 18  GLU A CB   6  
ATOM 8970  C CG   . GLU A 1 18  ? -0.605  -4.585  3.471   1.00 0.00 ? 18  GLU A CG   6  
ATOM 8971  C CD   . GLU A 1 18  ? -0.711  -4.905  4.963   1.00 0.00 ? 18  GLU A CD   6  
ATOM 8972  O OE1  . GLU A 1 18  ? -0.822  -3.935  5.745   1.00 0.00 ? 18  GLU A OE1  6  
ATOM 8973  O OE2  . GLU A 1 18  ? -0.679  -6.111  5.289   1.00 0.00 ? 18  GLU A OE2  6  
ATOM 8974  H H    . GLU A 1 18  ? -1.179  -5.530  1.031   1.00 0.00 ? 18  GLU A H    6  
ATOM 8975  H HA   . GLU A 1 18  ? -3.095  -5.844  3.116   1.00 0.00 ? 18  GLU A HA   6  
ATOM 8976  H HB2  . GLU A 1 18  ? -1.737  -3.283  2.176   1.00 0.00 ? 18  GLU A HB2  6  
ATOM 8977  H HB3  . GLU A 1 18  ? -2.487  -3.564  3.735   1.00 0.00 ? 18  GLU A HB3  6  
ATOM 8978  H HG2  . GLU A 1 18  ? -0.323  -5.484  2.922   1.00 0.00 ? 18  GLU A HG2  6  
ATOM 8979  H HG3  . GLU A 1 18  ? 0.184   -3.851  3.307   1.00 0.00 ? 18  GLU A HG3  6  
ATOM 8980  N N    . GLU A 1 19  ? -5.131  -5.244  1.827   1.00 0.00 ? 19  GLU A N    6  
ATOM 8981  C CA   . GLU A 1 19  ? -6.371  -4.819  1.201   1.00 0.00 ? 19  GLU A CA   6  
ATOM 8982  C C    . GLU A 1 19  ? -6.438  -3.292  1.138   1.00 0.00 ? 19  GLU A C    6  
ATOM 8983  O O    . GLU A 1 19  ? -5.786  -2.606  1.924   1.00 0.00 ? 19  GLU A O    6  
ATOM 8984  C CB   . GLU A 1 19  ? -7.583  -5.391  1.940   1.00 0.00 ? 19  GLU A CB   6  
ATOM 8985  C CG   . GLU A 1 19  ? -7.790  -6.867  1.594   1.00 0.00 ? 19  GLU A CG   6  
ATOM 8986  C CD   . GLU A 1 19  ? -8.639  -7.020  0.331   1.00 0.00 ? 19  GLU A CD   6  
ATOM 8987  O OE1  . GLU A 1 19  ? -8.187  -6.519  -0.721  1.00 0.00 ? 19  GLU A OE1  6  
ATOM 8988  O OE2  . GLU A 1 19  ? -9.722  -7.634  0.446   1.00 0.00 ? 19  GLU A OE2  6  
ATOM 8989  H H    . GLU A 1 19  ? -5.213  -6.036  2.432   1.00 0.00 ? 19  GLU A H    6  
ATOM 8990  H HA   . GLU A 1 19  ? -6.342  -5.231  0.192   1.00 0.00 ? 19  GLU A HA   6  
ATOM 8991  H HB2  . GLU A 1 19  ? -7.442  -5.282  3.015   1.00 0.00 ? 19  GLU A HB2  6  
ATOM 8992  H HB3  . GLU A 1 19  ? -8.475  -4.823  1.677   1.00 0.00 ? 19  GLU A HB3  6  
ATOM 8993  H HG2  . GLU A 1 19  ? -6.824  -7.349  1.448   1.00 0.00 ? 19  GLU A HG2  6  
ATOM 8994  H HG3  . GLU A 1 19  ? -8.276  -7.374  2.427   1.00 0.00 ? 19  GLU A HG3  6  
ATOM 8995  N N    . PRO A 1 20  ? -7.252  -2.792  0.170   1.00 0.00 ? 20  PRO A N    6  
ATOM 8996  C CA   . PRO A 1 20  ? -7.412  -1.358  -0.006  1.00 0.00 ? 20  PRO A CA   6  
ATOM 8997  C C    . PRO A 1 20  ? -8.296  -0.766  1.093   1.00 0.00 ? 20  PRO A C    6  
ATOM 8998  O O    . PRO A 1 20  ? -9.427  -1.209  1.289   1.00 0.00 ? 20  PRO A O    6  
ATOM 8999  C CB   . PRO A 1 20  ? -8.003  -1.196  -1.397  1.00 0.00 ? 20  PRO A CB   6  
ATOM 9000  C CG   . PRO A 1 20  ? -8.583  -2.553  -1.764  1.00 0.00 ? 20  PRO A CG   6  
ATOM 9001  C CD   . PRO A 1 20  ? -8.038  -3.574  -0.779  1.00 0.00 ? 20  PRO A CD   6  
ATOM 9002  H HA   . PRO A 1 20  ? -6.528  -0.898  0.077   1.00 0.00 ? 20  PRO A HA   6  
ATOM 9003  H HB2  . PRO A 1 20  ? -8.774  -0.426  -1.406  1.00 0.00 ? 20  PRO A HB2  6  
ATOM 9004  H HB3  . PRO A 1 20  ? -7.240  -0.891  -2.113  1.00 0.00 ? 20  PRO A HB3  6  
ATOM 9005  H HG2  . PRO A 1 20  ? -9.672  -2.526  -1.723  1.00 0.00 ? 20  PRO A HG2  6  
ATOM 9006  H HG3  . PRO A 1 20  ? -8.308  -2.822  -2.784  1.00 0.00 ? 20  PRO A HG3  6  
ATOM 9007  H HD2  . PRO A 1 20  ? -8.844  -4.110  -0.278  1.00 0.00 ? 20  PRO A HD2  6  
ATOM 9008  H HD3  . PRO A 1 20  ? -7.424  -4.321  -1.282  1.00 0.00 ? 20  PRO A HD3  6  
ATOM 9009  N N    . ARG A 1 21  ? -7.748  0.225   1.779   1.00 0.00 ? 21  ARG A N    6  
ATOM 9010  C CA   . ARG A 1 21  ? -8.474  0.882   2.853   1.00 0.00 ? 21  ARG A CA   6  
ATOM 9011  C C    . ARG A 1 21  ? -8.981  2.250   2.392   1.00 0.00 ? 21  ARG A C    6  
ATOM 9012  O O    . ARG A 1 21  ? -8.629  2.713   1.308   1.00 0.00 ? 21  ARG A O    6  
ATOM 9013  C CB   . ARG A 1 21  ? -7.587  1.065   4.086   1.00 0.00 ? 21  ARG A CB   6  
ATOM 9014  C CG   . ARG A 1 21  ? -6.453  2.053   3.805   1.00 0.00 ? 21  ARG A CG   6  
ATOM 9015  C CD   . ARG A 1 21  ? -5.093  1.353   3.843   1.00 0.00 ? 21  ARG A CD   6  
ATOM 9016  N NE   . ARG A 1 21  ? -4.667  1.152   5.246   1.00 0.00 ? 21  ARG A NE   6  
ATOM 9017  C CZ   . ARG A 1 21  ? -3.626  0.392   5.613   1.00 0.00 ? 21  ARG A CZ   6  
ATOM 9018  N NH1  . ARG A 1 21  ? -2.899  -0.242  4.684   1.00 0.00 ? 21  ARG A NH1  6  
ATOM 9019  N NH2  . ARG A 1 21  ? -3.312  0.267   6.910   1.00 0.00 ? 21  ARG A NH2  6  
ATOM 9020  H H    . ARG A 1 21  ? -6.828  0.579   1.613   1.00 0.00 ? 21  ARG A H    6  
ATOM 9021  H HA   . ARG A 1 21  ? -9.303  0.212   3.080   1.00 0.00 ? 21  ARG A HA   6  
ATOM 9022  H HB2  . ARG A 1 21  ? -8.188  1.424   4.922   1.00 0.00 ? 21  ARG A HB2  6  
ATOM 9023  H HB3  . ARG A 1 21  ? -7.170  0.103   4.384   1.00 0.00 ? 21  ARG A HB3  6  
ATOM 9024  H HG2  . ARG A 1 21  ? -6.602  2.514   2.829   1.00 0.00 ? 21  ARG A HG2  6  
ATOM 9025  H HG3  . ARG A 1 21  ? -6.474  2.856   4.543   1.00 0.00 ? 21  ARG A HG3  6  
ATOM 9026  H HD2  . ARG A 1 21  ? -5.155  0.393   3.332   1.00 0.00 ? 21  ARG A HD2  6  
ATOM 9027  H HD3  . ARG A 1 21  ? -4.353  1.951   3.312   1.00 0.00 ? 21  ARG A HD3  6  
ATOM 9028  H HE   . ARG A 1 21  ? -5.189  1.611   5.965   1.00 0.00 ? 21  ARG A HE   6  
ATOM 9029  H HH11 . ARG A 1 21  ? -3.133  -0.149  3.716   1.00 0.00 ? 21  ARG A HH11 6  
ATOM 9030  H HH12 . ARG A 1 21  ? -2.122  -0.809  4.958   1.00 0.00 ? 21  ARG A HH12 6  
ATOM 9031  H HH21 . ARG A 1 21  ? -3.855  0.740   7.604   1.00 0.00 ? 21  ARG A HH21 6  
ATOM 9032  H HH22 . ARG A 1 21  ? -2.536  -0.300  7.184   1.00 0.00 ? 21  ARG A HH22 6  
ATOM 9033  N N    . HIS A 1 22  ? -9.800  2.858   3.237   1.00 0.00 ? 22  HIS A N    6  
ATOM 9034  C CA   . HIS A 1 22  ? -10.360 4.163   2.930   1.00 0.00 ? 22  HIS A CA   6  
ATOM 9035  C C    . HIS A 1 22  ? -10.011 5.148   4.048   1.00 0.00 ? 22  HIS A C    6  
ATOM 9036  O O    . HIS A 1 22  ? -10.799 5.350   4.970   1.00 0.00 ? 22  HIS A O    6  
ATOM 9037  C CB   . HIS A 1 22  ? -11.865 4.063   2.676   1.00 0.00 ? 22  HIS A CB   6  
ATOM 9038  C CG   . HIS A 1 22  ? -12.239 3.108   1.568   1.00 0.00 ? 22  HIS A CG   6  
ATOM 9039  N ND1  . HIS A 1 22  ? -11.768 1.807   1.509   1.00 0.00 ? 22  HIS A ND1  6  
ATOM 9040  C CD2  . HIS A 1 22  ? -13.043 3.276   0.480   1.00 0.00 ? 22  HIS A CD2  6  
ATOM 9041  C CE1  . HIS A 1 22  ? -12.272 1.229   0.429   1.00 0.00 ? 22  HIS A CE1  6  
ATOM 9042  N NE2  . HIS A 1 22  ? -13.061 2.141   -0.208  1.00 0.00 ? 22  HIS A NE2  6  
ATOM 9043  H H    . HIS A 1 22  ? -10.081 2.474   4.117   1.00 0.00 ? 22  HIS A H    6  
ATOM 9044  H HA   . HIS A 1 22  ? -9.888  4.496   2.005   1.00 0.00 ? 22  HIS A HA   6  
ATOM 9045  H HB2  . HIS A 1 22  ? -12.358 3.748   3.596   1.00 0.00 ? 22  HIS A HB2  6  
ATOM 9046  H HB3  . HIS A 1 22  ? -12.249 5.054   2.432   1.00 0.00 ? 22  HIS A HB3  6  
ATOM 9047  H HD1  . HIS A 1 22  ? -11.153 1.378   2.170   1.00 0.00 ? 22  HIS A HD1  6  
ATOM 9048  H HD2  . HIS A 1 22  ? -13.579 4.189   0.219   1.00 0.00 ? 22  HIS A HD2  6  
ATOM 9049  H HE1  . HIS A 1 22  ? -12.088 0.204   0.106   1.00 0.00 ? 22  HIS A HE1  6  
ATOM 9050  N N    . VAL A 1 23  ? -8.829  5.734   3.929   1.00 0.00 ? 23  VAL A N    6  
ATOM 9051  C CA   . VAL A 1 23  ? -8.366  6.692   4.918   1.00 0.00 ? 23  VAL A CA   6  
ATOM 9052  C C    . VAL A 1 23  ? -9.028  8.047   4.659   1.00 0.00 ? 23  VAL A C    6  
ATOM 9053  O O    . VAL A 1 23  ? -8.856  8.631   3.590   1.00 0.00 ? 23  VAL A O    6  
ATOM 9054  C CB   . VAL A 1 23  ? -6.837  6.762   4.905   1.00 0.00 ? 23  VAL A CB   6  
ATOM 9055  C CG1  . VAL A 1 23  ? -6.335  7.956   5.719   1.00 0.00 ? 23  VAL A CG1  6  
ATOM 9056  C CG2  . VAL A 1 23  ? -6.225  5.455   5.413   1.00 0.00 ? 23  VAL A CG2  6  
ATOM 9057  H H    . VAL A 1 23  ? -8.193  5.564   3.176   1.00 0.00 ? 23  VAL A H    6  
ATOM 9058  H HA   . VAL A 1 23  ? -8.679  6.331   5.898   1.00 0.00 ? 23  VAL A HA   6  
ATOM 9059  H HB   . VAL A 1 23  ? -6.518  6.902   3.872   1.00 0.00 ? 23  VAL A HB   6  
ATOM 9060  H HG11 . VAL A 1 23  ? -6.140  8.795   5.050   1.00 0.00 ? 23  VAL A HG11 6  
ATOM 9061  H HG12 . VAL A 1 23  ? -7.093  8.242   6.448   1.00 0.00 ? 23  VAL A HG12 6  
ATOM 9062  H HG13 . VAL A 1 23  ? -5.417  7.682   6.237   1.00 0.00 ? 23  VAL A HG13 6  
ATOM 9063  H HG21 . VAL A 1 23  ? -5.855  4.874   4.568   1.00 0.00 ? 23  VAL A HG21 6  
ATOM 9064  H HG22 . VAL A 1 23  ? -5.399  5.680   6.089   1.00 0.00 ? 23  VAL A HG22 6  
ATOM 9065  H HG23 . VAL A 1 23  ? -6.983  4.881   5.945   1.00 0.00 ? 23  VAL A HG23 6  
ATOM 9066  N N    . LYS A 1 24  ? -9.772  8.507   5.655   1.00 0.00 ? 24  LYS A N    6  
ATOM 9067  C CA   . LYS A 1 24  ? -10.460 9.781   5.547   1.00 0.00 ? 24  LYS A CA   6  
ATOM 9068  C C    . LYS A 1 24  ? -9.481  10.913  5.865   1.00 0.00 ? 24  LYS A C    6  
ATOM 9069  O O    . LYS A 1 24  ? -8.442  10.685  6.482   1.00 0.00 ? 24  LYS A O    6  
ATOM 9070  C CB   . LYS A 1 24  ? -11.714 9.788   6.424   1.00 0.00 ? 24  LYS A CB   6  
ATOM 9071  C CG   . LYS A 1 24  ? -12.921 9.239   5.660   1.00 0.00 ? 24  LYS A CG   6  
ATOM 9072  C CD   . LYS A 1 24  ? -14.122 9.057   6.590   1.00 0.00 ? 24  LYS A CD   6  
ATOM 9073  C CE   . LYS A 1 24  ? -15.436 9.129   5.809   1.00 0.00 ? 24  LYS A CE   6  
ATOM 9074  N NZ   . LYS A 1 24  ? -16.554 8.609   6.627   1.00 0.00 ? 24  LYS A NZ   6  
ATOM 9075  H H    . LYS A 1 24  ? -9.906  8.025   6.521   1.00 0.00 ? 24  LYS A H    6  
ATOM 9076  H HA   . LYS A 1 24  ? -10.789 9.889   4.514   1.00 0.00 ? 24  LYS A HA   6  
ATOM 9077  H HB2  . LYS A 1 24  ? -11.541 9.188   7.318   1.00 0.00 ? 24  LYS A HB2  6  
ATOM 9078  H HB3  . LYS A 1 24  ? -11.923 10.805  6.759   1.00 0.00 ? 24  LYS A HB3  6  
ATOM 9079  H HG2  . LYS A 1 24  ? -13.183 9.920   4.850   1.00 0.00 ? 24  LYS A HG2  6  
ATOM 9080  H HG3  . LYS A 1 24  ? -12.662 8.284   5.203   1.00 0.00 ? 24  LYS A HG3  6  
ATOM 9081  H HD2  . LYS A 1 24  ? -14.050 8.096   7.099   1.00 0.00 ? 24  LYS A HD2  6  
ATOM 9082  H HD3  . LYS A 1 24  ? -14.110 9.827   7.361   1.00 0.00 ? 24  LYS A HD3  6  
ATOM 9083  H HE2  . LYS A 1 24  ? -15.637 10.161  5.521   1.00 0.00 ? 24  LYS A HE2  6  
ATOM 9084  H HE3  . LYS A 1 24  ? -15.351 8.552   4.889   1.00 0.00 ? 24  LYS A HE3  6  
ATOM 9085  H HZ1  . LYS A 1 24  ? -17.179 9.357   6.851   1.00 0.00 ? 24  LYS A HZ1  6  
ATOM 9086  H HZ2  . LYS A 1 24  ? -17.045 7.907   6.112   1.00 0.00 ? 24  LYS A HZ2  6  
ATOM 9087  H HZ3  . LYS A 1 24  ? -16.193 8.213   7.472   1.00 0.00 ? 24  LYS A HZ3  6  
ATOM 9088  N N    . VAL A 1 25  ? -9.848  12.110  5.430   1.00 0.00 ? 25  VAL A N    6  
ATOM 9089  C CA   . VAL A 1 25  ? -9.016  13.278  5.660   1.00 0.00 ? 25  VAL A CA   6  
ATOM 9090  C C    . VAL A 1 25  ? -9.894  14.441  6.127   1.00 0.00 ? 25  VAL A C    6  
ATOM 9091  O O    . VAL A 1 25  ? -10.967 14.674  5.573   1.00 0.00 ? 25  VAL A O    6  
ATOM 9092  C CB   . VAL A 1 25  ? -8.211  13.604  4.400   1.00 0.00 ? 25  VAL A CB   6  
ATOM 9093  C CG1  . VAL A 1 25  ? -7.211  14.731  4.665   1.00 0.00 ? 25  VAL A CG1  6  
ATOM 9094  C CG2  . VAL A 1 25  ? -7.504  12.358  3.864   1.00 0.00 ? 25  VAL A CG2  6  
ATOM 9095  H H    . VAL A 1 25  ? -10.696 12.287  4.929   1.00 0.00 ? 25  VAL A H    6  
ATOM 9096  H HA   . VAL A 1 25  ? -8.312  13.029  6.455   1.00 0.00 ? 25  VAL A HA   6  
ATOM 9097  H HB   . VAL A 1 25  ? -8.909  13.948  3.637   1.00 0.00 ? 25  VAL A HB   6  
ATOM 9098  H HG11 . VAL A 1 25  ? -7.450  15.214  5.612   1.00 0.00 ? 25  VAL A HG11 6  
ATOM 9099  H HG12 . VAL A 1 25  ? -6.203  14.319  4.711   1.00 0.00 ? 25  VAL A HG12 6  
ATOM 9100  H HG13 . VAL A 1 25  ? -7.268  15.463  3.859   1.00 0.00 ? 25  VAL A HG13 6  
ATOM 9101  H HG21 . VAL A 1 25  ? -7.526  11.573  4.620   1.00 0.00 ? 25  VAL A HG21 6  
ATOM 9102  H HG22 . VAL A 1 25  ? -8.013  12.010  2.965   1.00 0.00 ? 25  VAL A HG22 6  
ATOM 9103  H HG23 . VAL A 1 25  ? -6.469  12.602  3.623   1.00 0.00 ? 25  VAL A HG23 6  
ATOM 9104  N N    . GLN A 1 26  ? -9.405  15.140  7.140   1.00 0.00 ? 26  GLN A N    6  
ATOM 9105  C CA   . GLN A 1 26  ? -10.131 16.273  7.687   1.00 0.00 ? 26  GLN A CA   6  
ATOM 9106  C C    . GLN A 1 26  ? -9.390  17.577  7.383   1.00 0.00 ? 26  GLN A C    6  
ATOM 9107  O O    . GLN A 1 26  ? -8.855  18.216  8.288   1.00 0.00 ? 26  GLN A O    6  
ATOM 9108  C CB   . GLN A 1 26  ? -10.354 16.107  9.192   1.00 0.00 ? 26  GLN A CB   6  
ATOM 9109  C CG   . GLN A 1 26  ? -11.824 15.814  9.500   1.00 0.00 ? 26  GLN A CG   6  
ATOM 9110  C CD   . GLN A 1 26  ? -12.260 16.502  10.795  1.00 0.00 ? 26  GLN A CD   6  
ATOM 9111  O OE1  . GLN A 1 26  ? -11.478 16.723  11.705  1.00 0.00 ? 26  GLN A OE1  6  
ATOM 9112  N NE2  . GLN A 1 26  ? -13.550 16.826  10.828  1.00 0.00 ? 26  GLN A NE2  6  
ATOM 9113  H H    . GLN A 1 26  ? -8.531  14.944  7.585   1.00 0.00 ? 26  GLN A H    6  
ATOM 9114  H HA   . GLN A 1 26  ? -11.097 16.270  7.181   1.00 0.00 ? 26  GLN A HA   6  
ATOM 9115  H HB2  . GLN A 1 26  ? -9.731  15.296  9.568   1.00 0.00 ? 26  GLN A HB2  6  
ATOM 9116  H HB3  . GLN A 1 26  ? -10.044 17.014  9.711   1.00 0.00 ? 26  GLN A HB3  6  
ATOM 9117  H HG2  . GLN A 1 26  ? -12.447 16.157  8.674   1.00 0.00 ? 26  GLN A HG2  6  
ATOM 9118  H HG3  . GLN A 1 26  ? -11.973 14.738  9.586   1.00 0.00 ? 26  GLN A HG3  6  
ATOM 9119  H HE21 . GLN A 1 26  ? -14.138 16.616  10.047  1.00 0.00 ? 26  GLN A HE21 6  
ATOM 9120  H HE22 . GLN A 1 26  ? -13.931 17.280  11.633  1.00 0.00 ? 26  GLN A HE22 6  
ATOM 9121  N N    . LYS A 1 27  ? -9.381  17.931  6.107   1.00 0.00 ? 27  LYS A N    6  
ATOM 9122  C CA   . LYS A 1 27  ? -8.714  19.147  5.672   1.00 0.00 ? 27  LYS A CA   6  
ATOM 9123  C C    . LYS A 1 27  ? -9.288  20.340  6.438   1.00 0.00 ? 27  LYS A C    6  
ATOM 9124  O O    . LYS A 1 27  ? -8.696  20.800  7.413   1.00 0.00 ? 27  LYS A O    6  
ATOM 9125  C CB   . LYS A 1 27  ? -8.801  19.292  4.152   1.00 0.00 ? 27  LYS A CB   6  
ATOM 9126  C CG   . LYS A 1 27  ? -7.413  19.486  3.538   1.00 0.00 ? 27  LYS A CG   6  
ATOM 9127  C CD   . LYS A 1 27  ? -6.832  18.152  3.065   1.00 0.00 ? 27  LYS A CD   6  
ATOM 9128  C CE   . LYS A 1 27  ? -6.522  18.191  1.567   1.00 0.00 ? 27  LYS A CE   6  
ATOM 9129  N NZ   . LYS A 1 27  ? -7.314  17.169  0.847   1.00 0.00 ? 27  LYS A NZ   6  
ATOM 9130  H H    . LYS A 1 27  ? -9.819  17.406  5.377   1.00 0.00 ? 27  LYS A H    6  
ATOM 9131  H HA   . LYS A 1 27  ? -7.658  19.049  5.926   1.00 0.00 ? 27  LYS A HA   6  
ATOM 9132  H HB2  . LYS A 1 27  ? -9.271  18.406  3.724   1.00 0.00 ? 27  LYS A HB2  6  
ATOM 9133  H HB3  . LYS A 1 27  ? -9.436  20.142  3.900   1.00 0.00 ? 27  LYS A HB3  6  
ATOM 9134  H HG2  . LYS A 1 27  ? -7.476  20.178  2.699   1.00 0.00 ? 27  LYS A HG2  6  
ATOM 9135  H HG3  . LYS A 1 27  ? -6.747  19.936  4.274   1.00 0.00 ? 27  LYS A HG3  6  
ATOM 9136  H HD2  . LYS A 1 27  ? -5.923  17.929  3.622   1.00 0.00 ? 27  LYS A HD2  6  
ATOM 9137  H HD3  . LYS A 1 27  ? -7.539  17.349  3.272   1.00 0.00 ? 27  LYS A HD3  6  
ATOM 9138  H HE2  . LYS A 1 27  ? -6.745  19.180  1.168   1.00 0.00 ? 27  LYS A HE2  6  
ATOM 9139  H HE3  . LYS A 1 27  ? -5.458  18.015  1.405   1.00 0.00 ? 27  LYS A HE3  6  
ATOM 9140  H HZ1  . LYS A 1 27  ? -6.771  16.795  0.095   1.00 0.00 ? 27  LYS A HZ1  6  
ATOM 9141  H HZ2  . LYS A 1 27  ? -7.561  16.433  1.478   1.00 0.00 ? 27  LYS A HZ2  6  
ATOM 9142  H HZ3  . LYS A 1 27  ? -8.145  17.588  0.481   1.00 0.00 ? 27  LYS A HZ3  6  
ATOM 9143  N N    . GLY A 1 28  ? -10.435 20.808  5.968   1.00 0.00 ? 28  GLY A N    6  
ATOM 9144  C CA   . GLY A 1 28  ? -11.095 21.940  6.596   1.00 0.00 ? 28  GLY A CA   6  
ATOM 9145  C C    . GLY A 1 28  ? -10.728 23.249  5.894   1.00 0.00 ? 28  GLY A C    6  
ATOM 9146  O O    . GLY A 1 28  ? -11.566 23.859  5.233   1.00 0.00 ? 28  GLY A O    6  
ATOM 9147  H H    . GLY A 1 28  ? -10.910 20.429  5.174   1.00 0.00 ? 28  GLY A H    6  
ATOM 9148  H HA2  . GLY A 1 28  ? -12.176 21.797  6.565   1.00 0.00 ? 28  GLY A HA2  6  
ATOM 9149  H HA3  . GLY A 1 28  ? -10.811 21.994  7.647   1.00 0.00 ? 28  GLY A HA3  6  
ATOM 9150  N N    . SER A 1 29  ? -9.473  23.640  6.061   1.00 0.00 ? 29  SER A N    6  
ATOM 9151  C CA   . SER A 1 29  ? -8.984  24.866  5.452   1.00 0.00 ? 29  SER A CA   6  
ATOM 9152  C C    . SER A 1 29  ? -7.454  24.866  5.433   1.00 0.00 ? 29  SER A C    6  
ATOM 9153  O O    . SER A 1 29  ? -6.828  25.910  5.611   1.00 0.00 ? 29  SER A O    6  
ATOM 9154  C CB   . SER A 1 29  ? -9.507  26.097  6.195   1.00 0.00 ? 29  SER A CB   6  
ATOM 9155  O OG   . SER A 1 29  ? -10.599 26.708  5.514   1.00 0.00 ? 29  SER A OG   6  
ATOM 9156  H H    . SER A 1 29  ? -8.797  23.138  6.601   1.00 0.00 ? 29  SER A H    6  
ATOM 9157  H HA   . SER A 1 29  ? -9.379  24.860  4.436   1.00 0.00 ? 29  SER A HA   6  
ATOM 9158  H HB2  . SER A 1 29  ? -9.820  25.809  7.199   1.00 0.00 ? 29  SER A HB2  6  
ATOM 9159  H HB3  . SER A 1 29  ? -8.700  26.821  6.309   1.00 0.00 ? 29  SER A HB3  6  
ATOM 9160  H HG   . SER A 1 29  ? -11.435 26.612  6.055   1.00 0.00 ? 29  SER A HG   6  
ATOM 9161  N N    . GLU A 1 30  ? -6.896  23.684  5.216   1.00 0.00 ? 30  GLU A N    6  
ATOM 9162  C CA   . GLU A 1 30  ? -5.452  23.536  5.172   1.00 0.00 ? 30  GLU A CA   6  
ATOM 9163  C C    . GLU A 1 30  ? -5.051  22.583  4.045   1.00 0.00 ? 30  GLU A C    6  
ATOM 9164  O O    . GLU A 1 30  ? -5.878  21.821  3.547   1.00 0.00 ? 30  GLU A O    6  
ATOM 9165  C CB   . GLU A 1 30  ? -4.909  23.052  6.518   1.00 0.00 ? 30  GLU A CB   6  
ATOM 9166  C CG   . GLU A 1 30  ? -4.599  24.232  7.441   1.00 0.00 ? 30  GLU A CG   6  
ATOM 9167  C CD   . GLU A 1 30  ? -3.116  24.605  7.374   1.00 0.00 ? 30  GLU A CD   6  
ATOM 9168  O OE1  . GLU A 1 30  ? -2.322  23.893  8.026   1.00 0.00 ? 30  GLU A OE1  6  
ATOM 9169  O OE2  . GLU A 1 30  ? -2.811  25.594  6.673   1.00 0.00 ? 30  GLU A OE2  6  
ATOM 9170  H H    . GLU A 1 30  ? -7.413  22.840  5.073   1.00 0.00 ? 30  GLU A H    6  
ATOM 9171  H HA   . GLU A 1 30  ? -5.064  24.534  4.969   1.00 0.00 ? 30  GLU A HA   6  
ATOM 9172  H HB2  . GLU A 1 30  ? -5.638  22.396  6.994   1.00 0.00 ? 30  GLU A HB2  6  
ATOM 9173  H HB3  . GLU A 1 30  ? -4.006  22.462  6.360   1.00 0.00 ? 30  GLU A HB3  6  
ATOM 9174  H HG2  . GLU A 1 30  ? -5.206  25.091  7.156   1.00 0.00 ? 30  GLU A HG2  6  
ATOM 9175  H HG3  . GLU A 1 30  ? -4.867  23.978  8.466   1.00 0.00 ? 30  GLU A HG3  6  
ATOM 9176  N N    . PRO A 1 31  ? -3.747  22.658  3.665   1.00 0.00 ? 31  PRO A N    6  
ATOM 9177  C CA   . PRO A 1 31  ? -3.226  21.811  2.605   1.00 0.00 ? 31  PRO A CA   6  
ATOM 9178  C C    . PRO A 1 31  ? -3.036  20.374  3.095   1.00 0.00 ? 31  PRO A C    6  
ATOM 9179  O O    . PRO A 1 31  ? -3.239  20.084  4.273   1.00 0.00 ? 31  PRO A O    6  
ATOM 9180  C CB   . PRO A 1 31  ? -1.924  22.470  2.180   1.00 0.00 ? 31  PRO A CB   6  
ATOM 9181  C CG   . PRO A 1 31  ? -1.531  23.393  3.321   1.00 0.00 ? 31  PRO A CG   6  
ATOM 9182  C CD   . PRO A 1 31  ? -2.738  23.548  4.232   1.00 0.00 ? 31  PRO A CD   6  
ATOM 9183  H HA   . PRO A 1 31  ? -3.879  21.758  1.850   1.00 0.00 ? 31  PRO A HA   6  
ATOM 9184  H HB2  . PRO A 1 31  ? -1.150  21.724  1.996   1.00 0.00 ? 31  PRO A HB2  6  
ATOM 9185  H HB3  . PRO A 1 31  ? -2.054  23.028  1.252   1.00 0.00 ? 31  PRO A HB3  6  
ATOM 9186  H HG2  . PRO A 1 31  ? -0.687  22.980  3.873   1.00 0.00 ? 31  PRO A HG2  6  
ATOM 9187  H HG3  . PRO A 1 31  ? -1.216  24.363  2.937   1.00 0.00 ? 31  PRO A HG3  6  
ATOM 9188  H HD2  . PRO A 1 31  ? -2.497  23.270  5.259   1.00 0.00 ? 31  PRO A HD2  6  
ATOM 9189  H HD3  . PRO A 1 31  ? -3.088  24.580  4.255   1.00 0.00 ? 31  PRO A HD3  6  
ATOM 9190  N N    . LEU A 1 32  ? -2.650  19.512  2.166   1.00 0.00 ? 32  LEU A N    6  
ATOM 9191  C CA   . LEU A 1 32  ? -2.430  18.112  2.488   1.00 0.00 ? 32  LEU A CA   6  
ATOM 9192  C C    . LEU A 1 32  ? -1.053  17.952  3.134   1.00 0.00 ? 32  LEU A C    6  
ATOM 9193  O O    . LEU A 1 32  ? -0.938  17.413  4.234   1.00 0.00 ? 32  LEU A O    6  
ATOM 9194  C CB   . LEU A 1 32  ? -2.634  17.239  1.249   1.00 0.00 ? 32  LEU A CB   6  
ATOM 9195  C CG   . LEU A 1 32  ? -2.859  15.748  1.509   1.00 0.00 ? 32  LEU A CG   6  
ATOM 9196  C CD1  . LEU A 1 32  ? -4.120  15.522  2.345   1.00 0.00 ? 32  LEU A CD1  6  
ATOM 9197  C CD2  . LEU A 1 32  ? -2.892  14.962  0.197   1.00 0.00 ? 32  LEU A CD2  6  
ATOM 9198  H H    . LEU A 1 32  ? -2.487  19.756  1.210   1.00 0.00 ? 32  LEU A H    6  
ATOM 9199  H HA   . LEU A 1 32  ? -3.189  17.822  3.215   1.00 0.00 ? 32  LEU A HA   6  
ATOM 9200  H HB2  . LEU A 1 32  ? -3.489  17.624  0.694   1.00 0.00 ? 32  LEU A HB2  6  
ATOM 9201  H HB3  . LEU A 1 32  ? -1.761  17.347  0.605   1.00 0.00 ? 32  LEU A HB3  6  
ATOM 9202  H HG   . LEU A 1 32  ? -2.017  15.371  2.089   1.00 0.00 ? 32  LEU A HG   6  
ATOM 9203  H HD11 . LEU A 1 32  ? -4.569  16.483  2.593   1.00 0.00 ? 32  LEU A HD11 6  
ATOM 9204  H HD12 . LEU A 1 32  ? -4.832  14.925  1.774   1.00 0.00 ? 32  LEU A HD12 6  
ATOM 9205  H HD13 . LEU A 1 32  ? -3.858  14.995  3.263   1.00 0.00 ? 32  LEU A HD13 6  
ATOM 9206  H HD21 . LEU A 1 32  ? -3.906  14.968  -0.205  1.00 0.00 ? 32  LEU A HD21 6  
ATOM 9207  H HD22 . LEU A 1 32  ? -2.214  15.423  -0.521  1.00 0.00 ? 32  LEU A HD22 6  
ATOM 9208  H HD23 . LEU A 1 32  ? -2.581  13.933  0.381   1.00 0.00 ? 32  LEU A HD23 6  
ATOM 9209  N N    . GLY A 1 33  ? -0.042  18.429  2.423   1.00 0.00 ? 33  GLY A N    6  
ATOM 9210  C CA   . GLY A 1 33  ? 1.323   18.345  2.914   1.00 0.00 ? 33  GLY A CA   6  
ATOM 9211  C C    . GLY A 1 33  ? 1.874   16.926  2.762   1.00 0.00 ? 33  GLY A C    6  
ATOM 9212  O O    . GLY A 1 33  ? 2.112   16.239  3.754   1.00 0.00 ? 33  GLY A O    6  
ATOM 9213  H H    . GLY A 1 33  ? -0.144  18.866  1.529   1.00 0.00 ? 33  GLY A H    6  
ATOM 9214  H HA2  . GLY A 1 33  ? 1.954   19.045  2.365   1.00 0.00 ? 33  GLY A HA2  6  
ATOM 9215  H HA3  . GLY A 1 33  ? 1.356   18.642  3.962   1.00 0.00 ? 33  GLY A HA3  6  
ATOM 9216  N N    . ILE A 1 34  ? 2.061   16.528  1.512   1.00 0.00 ? 34  ILE A N    6  
ATOM 9217  C CA   . ILE A 1 34  ? 2.579   15.203  1.218   1.00 0.00 ? 34  ILE A CA   6  
ATOM 9218  C C    . ILE A 1 34  ? 3.317   15.235  -0.122  1.00 0.00 ? 34  ILE A C    6  
ATOM 9219  O O    . ILE A 1 34  ? 3.123   16.151  -0.920  1.00 0.00 ? 34  ILE A O    6  
ATOM 9220  C CB   . ILE A 1 34  ? 1.458   14.164  1.278   1.00 0.00 ? 34  ILE A CB   6  
ATOM 9221  C CG1  . ILE A 1 34  ? 0.367   14.474  0.251   1.00 0.00 ? 34  ILE A CG1  6  
ATOM 9222  C CG2  . ILE A 1 34  ? 0.895   14.046  2.695   1.00 0.00 ? 34  ILE A CG2  6  
ATOM 9223  C CD1  . ILE A 1 34  ? 0.188   13.312  -0.727  1.00 0.00 ? 34  ILE A CD1  6  
ATOM 9224  H H    . ILE A 1 34  ? 1.865   17.093  0.710   1.00 0.00 ? 34  ILE A H    6  
ATOM 9225  H HA   . ILE A 1 34  ? 3.295   14.951  2.000   1.00 0.00 ? 34  ILE A HA   6  
ATOM 9226  H HB   . ILE A 1 34  ? 1.879   13.193  1.017   1.00 0.00 ? 34  ILE A HB   6  
ATOM 9227  H HG12 . ILE A 1 34  ? -0.574  14.671  0.765   1.00 0.00 ? 34  ILE A HG12 6  
ATOM 9228  H HG13 . ILE A 1 34  ? 0.626   15.380  -0.297  1.00 0.00 ? 34  ILE A HG13 6  
ATOM 9229  H HG21 . ILE A 1 34  ? 0.124   13.276  2.717   1.00 0.00 ? 34  ILE A HG21 6  
ATOM 9230  H HG22 . ILE A 1 34  ? 1.697   13.778  3.384   1.00 0.00 ? 34  ILE A HG22 6  
ATOM 9231  H HG23 . ILE A 1 34  ? 0.463   15.001  2.995   1.00 0.00 ? 34  ILE A HG23 6  
ATOM 9232  H HD11 . ILE A 1 34  ? -0.023  12.398  -0.172  1.00 0.00 ? 34  ILE A HD11 6  
ATOM 9233  H HD12 . ILE A 1 34  ? -0.642  13.528  -1.400  1.00 0.00 ? 34  ILE A HD12 6  
ATOM 9234  H HD13 . ILE A 1 34  ? 1.101   13.182  -1.308  1.00 0.00 ? 34  ILE A HD13 6  
ATOM 9235  N N    . SER A 1 35  ? 4.148   14.224  -0.328  1.00 0.00 ? 35  SER A N    6  
ATOM 9236  C CA   . SER A 1 35  ? 4.916   14.125  -1.557  1.00 0.00 ? 35  SER A CA   6  
ATOM 9237  C C    . SER A 1 35  ? 4.491   12.881  -2.341  1.00 0.00 ? 35  SER A C    6  
ATOM 9238  O O    . SER A 1 35  ? 4.197   11.842  -1.752  1.00 0.00 ? 35  SER A O    6  
ATOM 9239  C CB   . SER A 1 35  ? 6.418   14.081  -1.267  1.00 0.00 ? 35  SER A CB   6  
ATOM 9240  O OG   . SER A 1 35  ? 7.194   14.410  -2.416  1.00 0.00 ? 35  SER A OG   6  
ATOM 9241  H H    . SER A 1 35  ? 4.300   13.483  0.326   1.00 0.00 ? 35  SER A H    6  
ATOM 9242  H HA   . SER A 1 35  ? 4.682   15.029  -2.118  1.00 0.00 ? 35  SER A HA   6  
ATOM 9243  H HB2  . SER A 1 35  ? 6.652   14.776  -0.460  1.00 0.00 ? 35  SER A HB2  6  
ATOM 9244  H HB3  . SER A 1 35  ? 6.691   13.085  -0.918  1.00 0.00 ? 35  SER A HB3  6  
ATOM 9245  H HG   . SER A 1 35  ? 6.760   15.157  -2.919  1.00 0.00 ? 35  SER A HG   6  
ATOM 9246  N N    . ILE A 1 36  ? 4.471   13.029  -3.658  1.00 0.00 ? 36  ILE A N    6  
ATOM 9247  C CA   . ILE A 1 36  ? 4.086   11.931  -4.528  1.00 0.00 ? 36  ILE A CA   6  
ATOM 9248  C C    . ILE A 1 36  ? 5.091   11.820  -5.677  1.00 0.00 ? 36  ILE A C    6  
ATOM 9249  O O    . ILE A 1 36  ? 5.664   12.822  -6.104  1.00 0.00 ? 36  ILE A O    6  
ATOM 9250  C CB   . ILE A 1 36  ? 2.638   12.098  -4.992  1.00 0.00 ? 36  ILE A CB   6  
ATOM 9251  C CG1  . ILE A 1 36  ? 2.467   13.380  -5.809  1.00 0.00 ? 36  ILE A CG1  6  
ATOM 9252  C CG2  . ILE A 1 36  ? 1.672   12.040  -3.807  1.00 0.00 ? 36  ILE A CG2  6  
ATOM 9253  C CD1  . ILE A 1 36  ? 2.677   13.113  -7.301  1.00 0.00 ? 36  ILE A CD1  6  
ATOM 9254  H H    . ILE A 1 36  ? 4.711   13.878  -4.129  1.00 0.00 ? 36  ILE A H    6  
ATOM 9255  H HA   . ILE A 1 36  ? 4.132   11.015  -3.939  1.00 0.00 ? 36  ILE A HA   6  
ATOM 9256  H HB   . ILE A 1 36  ? 2.391   11.263  -5.649  1.00 0.00 ? 36  ILE A HB   6  
ATOM 9257  H HG12 . ILE A 1 36  ? 1.471   13.790  -5.646  1.00 0.00 ? 36  ILE A HG12 6  
ATOM 9258  H HG13 . ILE A 1 36  ? 3.180   14.131  -5.467  1.00 0.00 ? 36  ILE A HG13 6  
ATOM 9259  H HG21 . ILE A 1 36  ? 1.348   13.050  -3.554  1.00 0.00 ? 36  ILE A HG21 6  
ATOM 9260  H HG22 . ILE A 1 36  ? 0.805   11.436  -4.074  1.00 0.00 ? 36  ILE A HG22 6  
ATOM 9261  H HG23 . ILE A 1 36  ? 2.176   11.595  -2.949  1.00 0.00 ? 36  ILE A HG23 6  
ATOM 9262  H HD11 . ILE A 1 36  ? 1.865   12.490  -7.676  1.00 0.00 ? 36  ILE A HD11 6  
ATOM 9263  H HD12 . ILE A 1 36  ? 2.689   14.059  -7.842  1.00 0.00 ? 36  ILE A HD12 6  
ATOM 9264  H HD13 . ILE A 1 36  ? 3.627   12.598  -7.448  1.00 0.00 ? 36  ILE A HD13 6  
ATOM 9265  N N    . VAL A 1 37  ? 5.274   10.594  -6.144  1.00 0.00 ? 37  VAL A N    6  
ATOM 9266  C CA   . VAL A 1 37  ? 6.200   10.340  -7.234  1.00 0.00 ? 37  VAL A CA   6  
ATOM 9267  C C    . VAL A 1 37  ? 5.545   9.394   -8.243  1.00 0.00 ? 37  VAL A C    6  
ATOM 9268  O O    . VAL A 1 37  ? 4.737   8.545   -7.869  1.00 0.00 ? 37  VAL A O    6  
ATOM 9269  C CB   . VAL A 1 37  ? 7.523   9.803   -6.683  1.00 0.00 ? 37  VAL A CB   6  
ATOM 9270  C CG1  . VAL A 1 37  ? 7.978   10.611  -5.466  1.00 0.00 ? 37  VAL A CG1  6  
ATOM 9271  C CG2  . VAL A 1 37  ? 7.413   8.316   -6.344  1.00 0.00 ? 37  VAL A CG2  6  
ATOM 9272  H H    . VAL A 1 37  ? 4.804   9.785   -5.791  1.00 0.00 ? 37  VAL A H    6  
ATOM 9273  H HA   . VAL A 1 37  ? 6.400   11.292  -7.725  1.00 0.00 ? 37  VAL A HA   6  
ATOM 9274  H HB   . VAL A 1 37  ? 8.279   9.914   -7.461  1.00 0.00 ? 37  VAL A HB   6  
ATOM 9275  H HG11 . VAL A 1 37  ? 8.854   10.138  -5.023  1.00 0.00 ? 37  VAL A HG11 6  
ATOM 9276  H HG12 . VAL A 1 37  ? 8.230   11.625  -5.777  1.00 0.00 ? 37  VAL A HG12 6  
ATOM 9277  H HG13 . VAL A 1 37  ? 7.173   10.646  -4.732  1.00 0.00 ? 37  VAL A HG13 6  
ATOM 9278  H HG21 . VAL A 1 37  ? 6.774   8.189   -5.470  1.00 0.00 ? 37  VAL A HG21 6  
ATOM 9279  H HG22 . VAL A 1 37  ? 6.981   7.781   -7.190  1.00 0.00 ? 37  VAL A HG22 6  
ATOM 9280  H HG23 . VAL A 1 37  ? 8.405   7.917   -6.131  1.00 0.00 ? 37  VAL A HG23 6  
ATOM 9281  N N    . SER A 1 38  ? 5.919   9.572   -9.502  1.00 0.00 ? 38  SER A N    6  
ATOM 9282  C CA   . SER A 1 38  ? 5.378   8.745   -10.567 1.00 0.00 ? 38  SER A CA   6  
ATOM 9283  C C    . SER A 1 38  ? 6.384   7.656   -10.947 1.00 0.00 ? 38  SER A C    6  
ATOM 9284  O O    . SER A 1 38  ? 7.593   7.874   -10.882 1.00 0.00 ? 38  SER A O    6  
ATOM 9285  C CB   . SER A 1 38  ? 5.021   9.588   -11.792 1.00 0.00 ? 38  SER A CB   6  
ATOM 9286  O OG   . SER A 1 38  ? 4.501   8.794   -12.855 1.00 0.00 ? 38  SER A OG   6  
ATOM 9287  H H    . SER A 1 38  ? 6.577   10.264  -9.797  1.00 0.00 ? 38  SER A H    6  
ATOM 9288  H HA   . SER A 1 38  ? 4.471   8.301   -10.156 1.00 0.00 ? 38  SER A HA   6  
ATOM 9289  H HB2  . SER A 1 38  ? 4.286   10.343  -11.511 1.00 0.00 ? 38  SER A HB2  6  
ATOM 9290  H HB3  . SER A 1 38  ? 5.908   10.120  -12.137 1.00 0.00 ? 38  SER A HB3  6  
ATOM 9291  H HG   . SER A 1 38  ? 3.650   9.193   -13.196 1.00 0.00 ? 38  SER A HG   6  
ATOM 9292  N N    . GLY A 1 39  ? 5.848   6.509   -11.335 1.00 0.00 ? 39  GLY A N    6  
ATOM 9293  C CA   . GLY A 1 39  ? 6.684   5.386   -11.725 1.00 0.00 ? 39  GLY A CA   6  
ATOM 9294  C C    . GLY A 1 39  ? 6.451   5.012   -13.190 1.00 0.00 ? 39  GLY A C    6  
ATOM 9295  O O    . GLY A 1 39  ? 5.319   5.047   -13.671 1.00 0.00 ? 39  GLY A O    6  
ATOM 9296  H H    . GLY A 1 39  ? 4.863   6.340   -11.385 1.00 0.00 ? 39  GLY A H    6  
ATOM 9297  H HA2  . GLY A 1 39  ? 7.733   5.639   -11.573 1.00 0.00 ? 39  GLY A HA2  6  
ATOM 9298  H HA3  . GLY A 1 39  ? 6.467   4.528   -11.088 1.00 0.00 ? 39  GLY A HA3  6  
ATOM 9299  N N    . GLU A 1 40  ? 7.540   4.664   -13.859 1.00 0.00 ? 40  GLU A N    6  
ATOM 9300  C CA   . GLU A 1 40  ? 7.469   4.284   -15.260 1.00 0.00 ? 40  GLU A CA   6  
ATOM 9301  C C    . GLU A 1 40  ? 6.303   3.320   -15.490 1.00 0.00 ? 40  GLU A C    6  
ATOM 9302  O O    . GLU A 1 40  ? 5.446   3.568   -16.337 1.00 0.00 ? 40  GLU A O    6  
ATOM 9303  C CB   . GLU A 1 40  ? 8.789   3.670   -15.729 1.00 0.00 ? 40  GLU A CB   6  
ATOM 9304  C CG   . GLU A 1 40  ? 9.224   4.264   -17.071 1.00 0.00 ? 40  GLU A CG   6  
ATOM 9305  C CD   . GLU A 1 40  ? 9.609   3.161   -18.059 1.00 0.00 ? 40  GLU A CD   6  
ATOM 9306  O OE1  . GLU A 1 40  ? 10.489  2.353   -17.693 1.00 0.00 ? 40  GLU A OE1  6  
ATOM 9307  O OE2  . GLU A 1 40  ? 9.014   3.152   -19.159 1.00 0.00 ? 40  GLU A OE2  6  
ATOM 9308  H H    . GLU A 1 40  ? 8.457   4.639   -13.461 1.00 0.00 ? 40  GLU A H    6  
ATOM 9309  H HA   . GLU A 1 40  ? 7.294   5.213   -15.803 1.00 0.00 ? 40  GLU A HA   6  
ATOM 9310  H HB2  . GLU A 1 40  ? 9.563   3.846   -14.982 1.00 0.00 ? 40  GLU A HB2  6  
ATOM 9311  H HB3  . GLU A 1 40  ? 8.678   2.590   -15.825 1.00 0.00 ? 40  GLU A HB3  6  
ATOM 9312  H HG2  . GLU A 1 40  ? 8.414   4.864   -17.486 1.00 0.00 ? 40  GLU A HG2  6  
ATOM 9313  H HG3  . GLU A 1 40  ? 10.071  4.933   -16.919 1.00 0.00 ? 40  GLU A HG3  6  
ATOM 9314  N N    . LYS A 1 41  ? 6.309   2.241   -14.721 1.00 0.00 ? 41  LYS A N    6  
ATOM 9315  C CA   . LYS A 1 41  ? 5.263   1.239   -14.830 1.00 0.00 ? 41  LYS A CA   6  
ATOM 9316  C C    . LYS A 1 41  ? 3.898   1.930   -14.834 1.00 0.00 ? 41  LYS A C    6  
ATOM 9317  O O    . LYS A 1 41  ? 3.029   1.593   -15.637 1.00 0.00 ? 41  LYS A O    6  
ATOM 9318  C CB   . LYS A 1 41  ? 5.415   0.184   -13.733 1.00 0.00 ? 41  LYS A CB   6  
ATOM 9319  C CG   . LYS A 1 41  ? 4.722   -1.122  -14.128 1.00 0.00 ? 41  LYS A CG   6  
ATOM 9320  C CD   . LYS A 1 41  ? 3.436   -1.326  -13.323 1.00 0.00 ? 41  LYS A CD   6  
ATOM 9321  C CE   . LYS A 1 41  ? 2.960   -2.777  -13.409 1.00 0.00 ? 41  LYS A CE   6  
ATOM 9322  N NZ   . LYS A 1 41  ? 1.645   -2.853  -14.084 1.00 0.00 ? 41  LYS A NZ   6  
ATOM 9323  H H    . LYS A 1 41  ? 7.010   2.047   -14.035 1.00 0.00 ? 41  LYS A H    6  
ATOM 9324  H HA   . LYS A 1 41  ? 5.395   0.731   -15.786 1.00 0.00 ? 41  LYS A HA   6  
ATOM 9325  H HB2  . LYS A 1 41  ? 6.472   -0.003  -13.546 1.00 0.00 ? 41  LYS A HB2  6  
ATOM 9326  H HB3  . LYS A 1 41  ? 4.989   0.558   -12.802 1.00 0.00 ? 41  LYS A HB3  6  
ATOM 9327  H HG2  . LYS A 1 41  ? 4.490   -1.107  -15.193 1.00 0.00 ? 41  LYS A HG2  6  
ATOM 9328  H HG3  . LYS A 1 41  ? 5.397   -1.961  -13.960 1.00 0.00 ? 41  LYS A HG3  6  
ATOM 9329  H HD2  . LYS A 1 41  ? 3.609   -1.057  -12.281 1.00 0.00 ? 41  LYS A HD2  6  
ATOM 9330  H HD3  . LYS A 1 41  ? 2.659   -0.661  -13.700 1.00 0.00 ? 41  LYS A HD3  6  
ATOM 9331  H HE2  . LYS A 1 41  ? 3.691   -3.374  -13.955 1.00 0.00 ? 41  LYS A HE2  6  
ATOM 9332  H HE3  . LYS A 1 41  ? 2.887   -3.202  -12.408 1.00 0.00 ? 41  LYS A HE3  6  
ATOM 9333  H HZ1  . LYS A 1 41  ? 1.228   -3.743  -13.903 1.00 0.00 ? 41  LYS A HZ1  6  
ATOM 9334  H HZ2  . LYS A 1 41  ? 1.050   -2.129  -13.735 1.00 0.00 ? 41  LYS A HZ2  6  
ATOM 9335  H HZ3  . LYS A 1 41  ? 1.769   -2.737  -15.069 1.00 0.00 ? 41  LYS A HZ3  6  
ATOM 9336  N N    . GLY A 1 42  ? 3.752   2.885   -13.927 1.00 0.00 ? 42  GLY A N    6  
ATOM 9337  C CA   . GLY A 1 42  ? 2.508   3.627   -13.815 1.00 0.00 ? 42  GLY A CA   6  
ATOM 9338  C C    . GLY A 1 42  ? 1.995   3.624   -12.374 1.00 0.00 ? 42  GLY A C    6  
ATOM 9339  O O    . GLY A 1 42  ? 2.193   2.655   -11.643 1.00 0.00 ? 42  GLY A O    6  
ATOM 9340  H H    . GLY A 1 42  ? 4.464   3.153   -13.277 1.00 0.00 ? 42  GLY A H    6  
ATOM 9341  H HA2  . GLY A 1 42  ? 2.661   4.654   -14.148 1.00 0.00 ? 42  GLY A HA2  6  
ATOM 9342  H HA3  . GLY A 1 42  ? 1.758   3.188   -14.473 1.00 0.00 ? 42  GLY A HA3  6  
ATOM 9343  N N    . GLY A 1 43  ? 1.345   4.719   -12.008 1.00 0.00 ? 43  GLY A N    6  
ATOM 9344  C CA   . GLY A 1 43  ? 0.802   4.854   -10.667 1.00 0.00 ? 43  GLY A CA   6  
ATOM 9345  C C    . GLY A 1 43  ? 1.512   5.970   -9.898  1.00 0.00 ? 43  GLY A C    6  
ATOM 9346  O O    . GLY A 1 43  ? 2.489   6.539   -10.383 1.00 0.00 ? 43  GLY A O    6  
ATOM 9347  H H    . GLY A 1 43  ? 1.188   5.503   -12.609 1.00 0.00 ? 43  GLY A H    6  
ATOM 9348  H HA2  . GLY A 1 43  ? -0.266  5.069   -10.723 1.00 0.00 ? 43  GLY A HA2  6  
ATOM 9349  H HA3  . GLY A 1 43  ? 0.909   3.912   -10.131 1.00 0.00 ? 43  GLY A HA3  6  
ATOM 9350  N N    . ILE A 1 44  ? 0.994   6.249   -8.711  1.00 0.00 ? 44  ILE A N    6  
ATOM 9351  C CA   . ILE A 1 44  ? 1.567   7.286   -7.870  1.00 0.00 ? 44  ILE A CA   6  
ATOM 9352  C C    . ILE A 1 44  ? 1.904   6.696   -6.499  1.00 0.00 ? 44  ILE A C    6  
ATOM 9353  O O    . ILE A 1 44  ? 1.133   5.911   -5.950  1.00 0.00 ? 44  ILE A O    6  
ATOM 9354  C CB   . ILE A 1 44  ? 0.636   8.498   -7.805  1.00 0.00 ? 44  ILE A CB   6  
ATOM 9355  C CG1  . ILE A 1 44  ? 0.346   9.042   -9.206  1.00 0.00 ? 44  ILE A CG1  6  
ATOM 9356  C CG2  . ILE A 1 44  ? 1.202   9.575   -6.877  1.00 0.00 ? 44  ILE A CG2  6  
ATOM 9357  C CD1  . ILE A 1 44  ? 1.552   9.807   -9.757  1.00 0.00 ? 44  ILE A CD1  6  
ATOM 9358  H H    . ILE A 1 44  ? 0.200   5.781   -8.323  1.00 0.00 ? 44  ILE A H    6  
ATOM 9359  H HA   . ILE A 1 44  ? 2.493   7.615   -8.342  1.00 0.00 ? 44  ILE A HA   6  
ATOM 9360  H HB   . ILE A 1 44  ? -0.315  8.176   -7.382  1.00 0.00 ? 44  ILE A HB   6  
ATOM 9361  H HG12 . ILE A 1 44  ? 0.096   8.219   -9.875  1.00 0.00 ? 44  ILE A HG12 6  
ATOM 9362  H HG13 . ILE A 1 44  ? -0.522  9.700   -9.172  1.00 0.00 ? 44  ILE A HG13 6  
ATOM 9363  H HG21 . ILE A 1 44  ? 1.419   10.474  -7.454  1.00 0.00 ? 44  ILE A HG21 6  
ATOM 9364  H HG22 . ILE A 1 44  ? 0.471   9.808   -6.103  1.00 0.00 ? 44  ILE A HG22 6  
ATOM 9365  H HG23 . ILE A 1 44  ? 2.118   9.211   -6.414  1.00 0.00 ? 44  ILE A HG23 6  
ATOM 9366  H HD11 . ILE A 1 44  ? 1.424   10.873  -9.566  1.00 0.00 ? 44  ILE A HD11 6  
ATOM 9367  H HD12 . ILE A 1 44  ? 2.460   9.456   -9.266  1.00 0.00 ? 44  ILE A HD12 6  
ATOM 9368  H HD13 . ILE A 1 44  ? 1.630   9.637   -10.831 1.00 0.00 ? 44  ILE A HD13 6  
ATOM 9369  N N    . TYR A 1 45  ? 3.058   7.097   -5.986  1.00 0.00 ? 45  TYR A N    6  
ATOM 9370  C CA   . TYR A 1 45  ? 3.507   6.618   -4.689  1.00 0.00 ? 45  TYR A CA   6  
ATOM 9371  C C    . TYR A 1 45  ? 3.903   7.784   -3.781  1.00 0.00 ? 45  TYR A C    6  
ATOM 9372  O O    . TYR A 1 45  ? 4.496   8.759   -4.239  1.00 0.00 ? 45  TYR A O    6  
ATOM 9373  C CB   . TYR A 1 45  ? 4.743   5.758   -4.962  1.00 0.00 ? 45  TYR A CB   6  
ATOM 9374  C CG   . TYR A 1 45  ? 4.476   4.556   -5.870  1.00 0.00 ? 45  TYR A CG   6  
ATOM 9375  C CD1  . TYR A 1 45  ? 4.491   4.710   -7.242  1.00 0.00 ? 45  TYR A CD1  6  
ATOM 9376  C CD2  . TYR A 1 45  ? 4.221   3.317   -5.318  1.00 0.00 ? 45  TYR A CD2  6  
ATOM 9377  C CE1  . TYR A 1 45  ? 4.240   3.578   -8.096  1.00 0.00 ? 45  TYR A CE1  6  
ATOM 9378  C CE2  . TYR A 1 45  ? 3.970   2.186   -6.172  1.00 0.00 ? 45  TYR A CE2  6  
ATOM 9379  C CZ   . TYR A 1 45  ? 3.992   2.372   -7.519  1.00 0.00 ? 45  TYR A CZ   6  
ATOM 9380  O OH   . TYR A 1 45  ? 3.755   1.303   -8.326  1.00 0.00 ? 45  TYR A OH   6  
ATOM 9381  H H    . TYR A 1 45  ? 3.680   7.736   -6.439  1.00 0.00 ? 45  TYR A H    6  
ATOM 9382  H HA   . TYR A 1 45  ? 2.684   6.071   -4.229  1.00 0.00 ? 45  TYR A HA   6  
ATOM 9383  H HB2  . TYR A 1 45  ? 5.513   6.381   -5.418  1.00 0.00 ? 45  TYR A HB2  6  
ATOM 9384  H HB3  . TYR A 1 45  ? 5.142   5.402   -4.013  1.00 0.00 ? 45  TYR A HB3  6  
ATOM 9385  H HD1  . TYR A 1 45  ? 4.693   5.688   -7.678  1.00 0.00 ? 45  TYR A HD1  6  
ATOM 9386  H HD2  . TYR A 1 45  ? 4.209   3.196   -4.235  1.00 0.00 ? 45  TYR A HD2  6  
ATOM 9387  H HE1  . TYR A 1 45  ? 4.249   3.686   -9.181  1.00 0.00 ? 45  TYR A HE1  6  
ATOM 9388  H HE2  . TYR A 1 45  ? 3.767   1.202   -5.749  1.00 0.00 ? 45  TYR A HE2  6  
ATOM 9389  H HH   . TYR A 1 45  ? 3.928   0.453   -7.828  1.00 0.00 ? 45  TYR A HH   6  
ATOM 9390  N N    . VAL A 1 46  ? 3.557   7.645   -2.509  1.00 0.00 ? 46  VAL A N    6  
ATOM 9391  C CA   . VAL A 1 46  ? 3.869   8.674   -1.532  1.00 0.00 ? 46  VAL A CA   6  
ATOM 9392  C C    . VAL A 1 46  ? 5.386   8.758   -1.352  1.00 0.00 ? 46  VAL A C    6  
ATOM 9393  O O    . VAL A 1 46  ? 6.035   7.757   -1.053  1.00 0.00 ? 46  VAL A O    6  
ATOM 9394  C CB   . VAL A 1 46  ? 3.126   8.396   -0.224  1.00 0.00 ? 46  VAL A CB   6  
ATOM 9395  C CG1  . VAL A 1 46  ? 3.581   9.353   0.880   1.00 0.00 ? 46  VAL A CG1  6  
ATOM 9396  C CG2  . VAL A 1 46  ? 1.611   8.474   -0.427  1.00 0.00 ? 46  VAL A CG2  6  
ATOM 9397  H H    . VAL A 1 46  ? 3.075   6.848   -2.145  1.00 0.00 ? 46  VAL A H    6  
ATOM 9398  H HA   . VAL A 1 46  ? 3.509   9.624   -1.929  1.00 0.00 ? 46  VAL A HA   6  
ATOM 9399  H HB   . VAL A 1 46  ? 3.370   7.381   0.091   1.00 0.00 ? 46  VAL A HB   6  
ATOM 9400  H HG11 . VAL A 1 46  ? 4.667   9.315   0.967   1.00 0.00 ? 46  VAL A HG11 6  
ATOM 9401  H HG12 . VAL A 1 46  ? 3.272   10.368  0.631   1.00 0.00 ? 46  VAL A HG12 6  
ATOM 9402  H HG13 . VAL A 1 46  ? 3.130   9.057   1.826   1.00 0.00 ? 46  VAL A HG13 6  
ATOM 9403  H HG21 . VAL A 1 46  ? 1.255   7.542   -0.866  1.00 0.00 ? 46  VAL A HG21 6  
ATOM 9404  H HG22 . VAL A 1 46  ? 1.124   8.631   0.536   1.00 0.00 ? 46  VAL A HG22 6  
ATOM 9405  H HG23 . VAL A 1 46  ? 1.376   9.304   -1.093  1.00 0.00 ? 46  VAL A HG23 6  
ATOM 9406  N N    . SER A 1 47  ? 5.906   9.961   -1.541  1.00 0.00 ? 47  SER A N    6  
ATOM 9407  C CA   . SER A 1 47  ? 7.335   10.189  -1.403  1.00 0.00 ? 47  SER A CA   6  
ATOM 9408  C C    . SER A 1 47  ? 7.653   10.671  0.013   1.00 0.00 ? 47  SER A C    6  
ATOM 9409  O O    . SER A 1 47  ? 8.783   10.533  0.481   1.00 0.00 ? 47  SER A O    6  
ATOM 9410  C CB   . SER A 1 47  ? 7.833   11.204  -2.434  1.00 0.00 ? 47  SER A CB   6  
ATOM 9411  O OG   . SER A 1 47  ? 8.546   12.277  -1.826  1.00 0.00 ? 47  SER A OG   6  
ATOM 9412  H H    . SER A 1 47  ? 5.371   10.770  -1.784  1.00 0.00 ? 47  SER A H    6  
ATOM 9413  H HA   . SER A 1 47  ? 7.801   9.222   -1.592  1.00 0.00 ? 47  SER A HA   6  
ATOM 9414  H HB2  . SER A 1 47  ? 8.479   10.701  -3.154  1.00 0.00 ? 47  SER A HB2  6  
ATOM 9415  H HB3  . SER A 1 47  ? 6.985   11.601  -2.991  1.00 0.00 ? 47  SER A HB3  6  
ATOM 9416  H HG   . SER A 1 47  ? 8.506   13.088  -2.409  1.00 0.00 ? 47  SER A HG   6  
ATOM 9417  N N    . LYS A 1 48  ? 6.638   11.229  0.657   1.00 0.00 ? 48  LYS A N    6  
ATOM 9418  C CA   . LYS A 1 48  ? 6.796   11.732  2.010   1.00 0.00 ? 48  LYS A CA   6  
ATOM 9419  C C    . LYS A 1 48  ? 5.450   12.259  2.514   1.00 0.00 ? 48  LYS A C    6  
ATOM 9420  O O    . LYS A 1 48  ? 4.489   12.346  1.751   1.00 0.00 ? 48  LYS A O    6  
ATOM 9421  C CB   . LYS A 1 48  ? 7.922   12.767  2.069   1.00 0.00 ? 48  LYS A CB   6  
ATOM 9422  C CG   . LYS A 1 48  ? 8.626   12.734  3.427   1.00 0.00 ? 48  LYS A CG   6  
ATOM 9423  C CD   . LYS A 1 48  ? 10.099  12.352  3.272   1.00 0.00 ? 48  LYS A CD   6  
ATOM 9424  C CE   . LYS A 1 48  ? 10.353  10.929  3.773   1.00 0.00 ? 48  LYS A CE   6  
ATOM 9425  N NZ   . LYS A 1 48  ? 11.788  10.736  4.081   1.00 0.00 ? 48  LYS A NZ   6  
ATOM 9426  H H    . LYS A 1 48  ? 5.723   11.338  0.269   1.00 0.00 ? 48  LYS A H    6  
ATOM 9427  H HA   . LYS A 1 48  ? 7.095   10.893  2.638   1.00 0.00 ? 48  LYS A HA   6  
ATOM 9428  H HB2  . LYS A 1 48  ? 8.644   12.570  1.277   1.00 0.00 ? 48  LYS A HB2  6  
ATOM 9429  H HB3  . LYS A 1 48  ? 7.516   13.762  1.890   1.00 0.00 ? 48  LYS A HB3  6  
ATOM 9430  H HG2  . LYS A 1 48  ? 8.547   13.710  3.905   1.00 0.00 ? 48  LYS A HG2  6  
ATOM 9431  H HG3  . LYS A 1 48  ? 8.128   12.018  4.082   1.00 0.00 ? 48  LYS A HG3  6  
ATOM 9432  H HD2  . LYS A 1 48  ? 10.390  12.430  2.225   1.00 0.00 ? 48  LYS A HD2  6  
ATOM 9433  H HD3  . LYS A 1 48  ? 10.721  13.054  3.829   1.00 0.00 ? 48  LYS A HD3  6  
ATOM 9434  H HE2  . LYS A 1 48  ? 9.755   10.739  4.665   1.00 0.00 ? 48  LYS A HE2  6  
ATOM 9435  H HE3  . LYS A 1 48  ? 10.037  10.210  3.018   1.00 0.00 ? 48  LYS A HE3  6  
ATOM 9436  H HZ1  . LYS A 1 48  ? 12.325  11.444  3.623   1.00 0.00 ? 48  LYS A HZ1  6  
ATOM 9437  H HZ2  . LYS A 1 48  ? 11.928  10.799  5.070   1.00 0.00 ? 48  LYS A HZ2  6  
ATOM 9438  H HZ3  . LYS A 1 48  ? 12.080  9.836   3.760   1.00 0.00 ? 48  LYS A HZ3  6  
ATOM 9439  N N    . VAL A 1 49  ? 5.425   12.597  3.795   1.00 0.00 ? 49  VAL A N    6  
ATOM 9440  C CA   . VAL A 1 49  ? 4.214   13.113  4.409   1.00 0.00 ? 49  VAL A CA   6  
ATOM 9441  C C    . VAL A 1 49  ? 4.589   14.054  5.556   1.00 0.00 ? 49  VAL A C    6  
ATOM 9442  O O    . VAL A 1 49  ? 5.139   13.618  6.566   1.00 0.00 ? 49  VAL A O    6  
ATOM 9443  C CB   . VAL A 1 49  ? 3.319   11.954  4.855   1.00 0.00 ? 49  VAL A CB   6  
ATOM 9444  C CG1  . VAL A 1 49  ? 4.130   10.889  5.595   1.00 0.00 ? 49  VAL A CG1  6  
ATOM 9445  C CG2  . VAL A 1 49  ? 2.159   12.457  5.717   1.00 0.00 ? 49  VAL A CG2  6  
ATOM 9446  H H    . VAL A 1 49  ? 6.212   12.524  4.408   1.00 0.00 ? 49  VAL A H    6  
ATOM 9447  H HA   . VAL A 1 49  ? 3.676   13.681  3.650   1.00 0.00 ? 49  VAL A HA   6  
ATOM 9448  H HB   . VAL A 1 49  ? 2.897   11.494  3.962   1.00 0.00 ? 49  VAL A HB   6  
ATOM 9449  H HG11 . VAL A 1 49  ? 5.019   11.346  6.029   1.00 0.00 ? 49  VAL A HG11 6  
ATOM 9450  H HG12 . VAL A 1 49  ? 3.521   10.454  6.387   1.00 0.00 ? 49  VAL A HG12 6  
ATOM 9451  H HG13 . VAL A 1 49  ? 4.428   10.108  4.895   1.00 0.00 ? 49  VAL A HG13 6  
ATOM 9452  H HG21 . VAL A 1 49  ? 1.789   11.643  6.339   1.00 0.00 ? 49  VAL A HG21 6  
ATOM 9453  H HG22 . VAL A 1 49  ? 2.506   13.272  6.353   1.00 0.00 ? 49  VAL A HG22 6  
ATOM 9454  H HG23 . VAL A 1 49  ? 1.357   12.816  5.072   1.00 0.00 ? 49  VAL A HG23 6  
ATOM 9455  N N    . THR A 1 50  ? 4.276   15.326  5.361   1.00 0.00 ? 50  THR A N    6  
ATOM 9456  C CA   . THR A 1 50  ? 4.574   16.333  6.366   1.00 0.00 ? 50  THR A CA   6  
ATOM 9457  C C    . THR A 1 50  ? 3.949   15.947  7.708   1.00 0.00 ? 50  THR A C    6  
ATOM 9458  O O    . THR A 1 50  ? 2.910   15.291  7.747   1.00 0.00 ? 50  THR A O    6  
ATOM 9459  C CB   . THR A 1 50  ? 4.092   17.685  5.838   1.00 0.00 ? 50  THR A CB   6  
ATOM 9460  O OG1  . THR A 1 50  ? 5.015   18.002  4.800   1.00 0.00 ? 50  THR A OG1  6  
ATOM 9461  C CG2  . THR A 1 50  ? 4.277   18.811  6.857   1.00 0.00 ? 50  THR A CG2  6  
ATOM 9462  H H    . THR A 1 50  ? 3.829   15.672  4.536   1.00 0.00 ? 50  THR A H    6  
ATOM 9463  H HA   . THR A 1 50  ? 5.654   16.363  6.512   1.00 0.00 ? 50  THR A HA   6  
ATOM 9464  H HB   . THR A 1 50  ? 3.055   17.627  5.506   1.00 0.00 ? 50  THR A HB   6  
ATOM 9465  H HG1  . THR A 1 50  ? 5.116   17.222  4.182   1.00 0.00 ? 50  THR A HG1  6  
ATOM 9466  H HG21 . THR A 1 50  ? 4.899   19.595  6.424   1.00 0.00 ? 50  THR A HG21 6  
ATOM 9467  H HG22 . THR A 1 50  ? 3.304   19.225  7.122   1.00 0.00 ? 50  THR A HG22 6  
ATOM 9468  H HG23 . THR A 1 50  ? 4.760   18.417  7.751   1.00 0.00 ? 50  THR A HG23 6  
ATOM 9469  N N    . VAL A 1 51  ? 4.610   16.370  8.775   1.00 0.00 ? 51  VAL A N    6  
ATOM 9470  C CA   . VAL A 1 51  ? 4.133   16.077  10.116  1.00 0.00 ? 51  VAL A CA   6  
ATOM 9471  C C    . VAL A 1 51  ? 3.267   17.238  10.610  1.00 0.00 ? 51  VAL A C    6  
ATOM 9472  O O    . VAL A 1 51  ? 3.628   18.402  10.440  1.00 0.00 ? 51  VAL A O    6  
ATOM 9473  C CB   . VAL A 1 51  ? 5.316   15.778  11.039  1.00 0.00 ? 51  VAL A CB   6  
ATOM 9474  C CG1  . VAL A 1 51  ? 6.007   17.070  11.480  1.00 0.00 ? 51  VAL A CG1  6  
ATOM 9475  C CG2  . VAL A 1 51  ? 4.873   14.953  12.249  1.00 0.00 ? 51  VAL A CG2  6  
ATOM 9476  H H    . VAL A 1 51  ? 5.455   16.903  8.735   1.00 0.00 ? 51  VAL A H    6  
ATOM 9477  H HA   . VAL A 1 51  ? 3.516   15.180  10.057  1.00 0.00 ? 51  VAL A HA   6  
ATOM 9478  H HB   . VAL A 1 51  ? 6.039   15.187  10.477  1.00 0.00 ? 51  VAL A HB   6  
ATOM 9479  H HG11 . VAL A 1 51  ? 6.451   17.559  10.613  1.00 0.00 ? 51  VAL A HG11 6  
ATOM 9480  H HG12 . VAL A 1 51  ? 5.275   17.736  11.937  1.00 0.00 ? 51  VAL A HG12 6  
ATOM 9481  H HG13 . VAL A 1 51  ? 6.787   16.836  12.204  1.00 0.00 ? 51  VAL A HG13 6  
ATOM 9482  H HG21 . VAL A 1 51  ? 4.907   13.893  11.998  1.00 0.00 ? 51  VAL A HG21 6  
ATOM 9483  H HG22 . VAL A 1 51  ? 5.541   15.150  13.087  1.00 0.00 ? 51  VAL A HG22 6  
ATOM 9484  H HG23 . VAL A 1 51  ? 3.855   15.229  12.524  1.00 0.00 ? 51  VAL A HG23 6  
ATOM 9485  N N    . GLY A 1 52  ? 2.142   16.881  11.212  1.00 0.00 ? 52  GLY A N    6  
ATOM 9486  C CA   . GLY A 1 52  ? 1.223   17.879  11.731  1.00 0.00 ? 52  GLY A CA   6  
ATOM 9487  C C    . GLY A 1 52  ? 0.212   18.302  10.663  1.00 0.00 ? 52  GLY A C    6  
ATOM 9488  O O    . GLY A 1 52  ? -0.879  18.768  10.986  1.00 0.00 ? 52  GLY A O    6  
ATOM 9489  H H    . GLY A 1 52  ? 1.857   15.932  11.346  1.00 0.00 ? 52  GLY A H    6  
ATOM 9490  H HA2  . GLY A 1 52  ? 0.696   17.477  12.597  1.00 0.00 ? 52  GLY A HA2  6  
ATOM 9491  H HA3  . GLY A 1 52  ? 1.781   18.750  12.074  1.00 0.00 ? 52  GLY A HA3  6  
ATOM 9492  N N    . SER A 1 53  ? 0.612   18.125  9.413   1.00 0.00 ? 53  SER A N    6  
ATOM 9493  C CA   . SER A 1 53  ? -0.245  18.482  8.295   1.00 0.00 ? 53  SER A CA   6  
ATOM 9494  C C    . SER A 1 53  ? -1.444  17.534  8.231   1.00 0.00 ? 53  SER A C    6  
ATOM 9495  O O    . SER A 1 53  ? -1.400  16.434  8.779   1.00 0.00 ? 53  SER A O    6  
ATOM 9496  C CB   . SER A 1 53  ? 0.528   18.450  6.976   1.00 0.00 ? 53  SER A CB   6  
ATOM 9497  O OG   . SER A 1 53  ? 0.669   19.749  6.407   1.00 0.00 ? 53  SER A OG   6  
ATOM 9498  H H    . SER A 1 53  ? 1.501   17.745  9.159   1.00 0.00 ? 53  SER A H    6  
ATOM 9499  H HA   . SER A 1 53  ? -0.574  19.502  8.498   1.00 0.00 ? 53  SER A HA   6  
ATOM 9500  H HB2  . SER A 1 53  ? 1.515   18.020  7.144   1.00 0.00 ? 53  SER A HB2  6  
ATOM 9501  H HB3  . SER A 1 53  ? 0.013   17.799  6.269   1.00 0.00 ? 53  SER A HB3  6  
ATOM 9502  H HG   . SER A 1 53  ? 0.029   19.861  5.647   1.00 0.00 ? 53  SER A HG   6  
ATOM 9503  N N    . ILE A 1 54  ? -2.487  17.996  7.557   1.00 0.00 ? 54  ILE A N    6  
ATOM 9504  C CA   . ILE A 1 54  ? -3.696  17.202  7.414   1.00 0.00 ? 54  ILE A CA   6  
ATOM 9505  C C    . ILE A 1 54  ? -3.316  15.740  7.173   1.00 0.00 ? 54  ILE A C    6  
ATOM 9506  O O    . ILE A 1 54  ? -3.689  14.862  7.949   1.00 0.00 ? 54  ILE A O    6  
ATOM 9507  C CB   . ILE A 1 54  ? -4.598  17.791  6.326   1.00 0.00 ? 54  ILE A CB   6  
ATOM 9508  C CG1  . ILE A 1 54  ? -5.049  19.206  6.694   1.00 0.00 ? 54  ILE A CG1  6  
ATOM 9509  C CG2  . ILE A 1 54  ? -5.783  16.867  6.038   1.00 0.00 ? 54  ILE A CG2  6  
ATOM 9510  C CD1  . ILE A 1 54  ? -5.998  19.184  7.894   1.00 0.00 ? 54  ILE A CD1  6  
ATOM 9511  H H    . ILE A 1 54  ? -2.515  18.892  7.114   1.00 0.00 ? 54  ILE A H    6  
ATOM 9512  H HA   . ILE A 1 54  ? -4.243  17.267  8.355   1.00 0.00 ? 54  ILE A HA   6  
ATOM 9513  H HB   . ILE A 1 54  ? -4.018  17.866  5.406   1.00 0.00 ? 54  ILE A HB   6  
ATOM 9514  H HG12 . ILE A 1 54  ? -4.179  19.820  6.926   1.00 0.00 ? 54  ILE A HG12 6  
ATOM 9515  H HG13 . ILE A 1 54  ? -5.546  19.666  5.841   1.00 0.00 ? 54  ILE A HG13 6  
ATOM 9516  H HG21 . ILE A 1 54  ? -6.526  17.403  5.447   1.00 0.00 ? 54  ILE A HG21 6  
ATOM 9517  H HG22 . ILE A 1 54  ? -5.438  15.995  5.483   1.00 0.00 ? 54  ILE A HG22 6  
ATOM 9518  H HG23 . ILE A 1 54  ? -6.231  16.546  6.979   1.00 0.00 ? 54  ILE A HG23 6  
ATOM 9519  H HD11 . ILE A 1 54  ? -6.638  18.303  7.835   1.00 0.00 ? 54  ILE A HD11 6  
ATOM 9520  H HD12 . ILE A 1 54  ? -5.418  19.149  8.816   1.00 0.00 ? 54  ILE A HD12 6  
ATOM 9521  H HD13 . ILE A 1 54  ? -6.615  20.083  7.886   1.00 0.00 ? 54  ILE A HD13 6  
ATOM 9522  N N    . ALA A 1 55  ? -2.578  15.524  6.094   1.00 0.00 ? 55  ALA A N    6  
ATOM 9523  C CA   . ALA A 1 55  ? -2.143  14.183  5.741   1.00 0.00 ? 55  ALA A CA   6  
ATOM 9524  C C    . ALA A 1 55  ? -1.797  13.412  7.016   1.00 0.00 ? 55  ALA A C    6  
ATOM 9525  O O    . ALA A 1 55  ? -2.513  12.490  7.402   1.00 0.00 ? 55  ALA A O    6  
ATOM 9526  C CB   . ALA A 1 55  ? -0.963  14.268  4.771   1.00 0.00 ? 55  ALA A CB   6  
ATOM 9527  H H    . ALA A 1 55  ? -2.279  16.244  5.467   1.00 0.00 ? 55  ALA A H    6  
ATOM 9528  H HA   . ALA A 1 55  ? -2.974  13.686  5.240   1.00 0.00 ? 55  ALA A HA   6  
ATOM 9529  H HB1  . ALA A 1 55  ? -0.208  14.942  5.176   1.00 0.00 ? 55  ALA A HB1  6  
ATOM 9530  H HB2  . ALA A 1 55  ? -0.530  13.276  4.638   1.00 0.00 ? 55  ALA A HB2  6  
ATOM 9531  H HB3  . ALA A 1 55  ? -1.309  14.645  3.809   1.00 0.00 ? 55  ALA A HB3  6  
ATOM 9532  N N    . HIS A 1 56  ? -0.697  13.818  7.634   1.00 0.00 ? 56  HIS A N    6  
ATOM 9533  C CA   . HIS A 1 56  ? -0.247  13.176  8.858   1.00 0.00 ? 56  HIS A CA   6  
ATOM 9534  C C    . HIS A 1 56  ? -1.457  12.795  9.713   1.00 0.00 ? 56  HIS A C    6  
ATOM 9535  O O    . HIS A 1 56  ? -1.640  11.626  10.050  1.00 0.00 ? 56  HIS A O    6  
ATOM 9536  C CB   . HIS A 1 56  ? 0.749   14.067  9.603   1.00 0.00 ? 56  HIS A CB   6  
ATOM 9537  C CG   . HIS A 1 56  ? 1.933   13.322  10.172  1.00 0.00 ? 56  HIS A CG   6  
ATOM 9538  N ND1  . HIS A 1 56  ? 2.024   12.967  11.507  1.00 0.00 ? 56  HIS A ND1  6  
ATOM 9539  C CD2  . HIS A 1 56  ? 3.071   12.868  9.574   1.00 0.00 ? 56  HIS A CD2  6  
ATOM 9540  C CE1  . HIS A 1 56  ? 3.171   12.330  11.693  1.00 0.00 ? 56  HIS A CE1  6  
ATOM 9541  N NE2  . HIS A 1 56  ? 3.819   12.270  10.494  1.00 0.00 ? 56  HIS A NE2  6  
ATOM 9542  H H    . HIS A 1 56  ? -0.120  14.568  7.313   1.00 0.00 ? 56  HIS A H    6  
ATOM 9543  H HA   . HIS A 1 56  ? 0.277   12.268  8.560   1.00 0.00 ? 56  HIS A HA   6  
ATOM 9544  H HB2  . HIS A 1 56  ? 1.110   14.838  8.924   1.00 0.00 ? 56  HIS A HB2  6  
ATOM 9545  H HB3  . HIS A 1 56  ? 0.228   14.576  10.415  1.00 0.00 ? 56  HIS A HB3  6  
ATOM 9546  H HD1  . HIS A 1 56  ? 1.341   13.159  12.212  1.00 0.00 ? 56  HIS A HD1  6  
ATOM 9547  H HD2  . HIS A 1 56  ? 3.324   12.979  8.520   1.00 0.00 ? 56  HIS A HD2  6  
ATOM 9548  H HE1  . HIS A 1 56  ? 3.533   11.925  12.637  1.00 0.00 ? 56  HIS A HE1  6  
ATOM 9549  N N    . GLN A 1 57  ? -2.252  13.803  10.039  1.00 0.00 ? 57  GLN A N    6  
ATOM 9550  C CA   . GLN A 1 57  ? -3.440  13.588  10.848  1.00 0.00 ? 57  GLN A CA   6  
ATOM 9551  C C    . GLN A 1 57  ? -4.215  12.371  10.340  1.00 0.00 ? 57  GLN A C    6  
ATOM 9552  O O    . GLN A 1 57  ? -4.610  11.510  11.125  1.00 0.00 ? 57  GLN A O    6  
ATOM 9553  C CB   . GLN A 1 57  ? -4.326  14.835  10.863  1.00 0.00 ? 57  GLN A CB   6  
ATOM 9554  C CG   . GLN A 1 57  ? -3.508  16.085  11.194  1.00 0.00 ? 57  GLN A CG   6  
ATOM 9555  C CD   . GLN A 1 57  ? -4.413  17.221  11.676  1.00 0.00 ? 57  GLN A CD   6  
ATOM 9556  O OE1  . GLN A 1 57  ? -5.168  17.088  12.626  1.00 0.00 ? 57  GLN A OE1  6  
ATOM 9557  N NE2  . GLN A 1 57  ? -4.296  18.342  10.971  1.00 0.00 ? 57  GLN A NE2  6  
ATOM 9558  H H    . GLN A 1 57  ? -2.097  14.751  9.760   1.00 0.00 ? 57  GLN A H    6  
ATOM 9559  H HA   . GLN A 1 57  ? -3.073  13.399  11.857  1.00 0.00 ? 57  GLN A HA   6  
ATOM 9560  H HB2  . GLN A 1 57  ? -4.806  14.957  9.892   1.00 0.00 ? 57  GLN A HB2  6  
ATOM 9561  H HB3  . GLN A 1 57  ? -5.122  14.712  11.598  1.00 0.00 ? 57  GLN A HB3  6  
ATOM 9562  H HG2  . GLN A 1 57  ? -2.773  15.850  11.963  1.00 0.00 ? 57  GLN A HG2  6  
ATOM 9563  H HG3  . GLN A 1 57  ? -2.955  16.406  10.312  1.00 0.00 ? 57  GLN A HG3  6  
ATOM 9564  H HE21 . GLN A 1 57  ? -3.658  18.385  10.202  1.00 0.00 ? 57  GLN A HE21 6  
ATOM 9565  H HE22 . GLN A 1 57  ? -4.847  19.142  11.209  1.00 0.00 ? 57  GLN A HE22 6  
ATOM 9566  N N    . ALA A 1 58  ? -4.410  12.338  9.030   1.00 0.00 ? 58  ALA A N    6  
ATOM 9567  C CA   . ALA A 1 58  ? -5.131  11.240  8.408   1.00 0.00 ? 58  ALA A CA   6  
ATOM 9568  C C    . ALA A 1 58  ? -4.409  9.925   8.710   1.00 0.00 ? 58  ALA A C    6  
ATOM 9569  O O    . ALA A 1 58  ? -5.047  8.887   8.876   1.00 0.00 ? 58  ALA A O    6  
ATOM 9570  C CB   . ALA A 1 58  ? -5.262  11.501  6.906   1.00 0.00 ? 58  ALA A CB   6  
ATOM 9571  H H    . ALA A 1 58  ? -4.086  13.042  8.398   1.00 0.00 ? 58  ALA A H    6  
ATOM 9572  H HA   . ALA A 1 58  ? -6.128  11.207  8.847   1.00 0.00 ? 58  ALA A HA   6  
ATOM 9573  H HB1  . ALA A 1 58  ? -6.305  11.708  6.663   1.00 0.00 ? 58  ALA A HB1  6  
ATOM 9574  H HB2  . ALA A 1 58  ? -4.648  12.359  6.631   1.00 0.00 ? 58  ALA A HB2  6  
ATOM 9575  H HB3  . ALA A 1 58  ? -4.928  10.623  6.354   1.00 0.00 ? 58  ALA A HB3  6  
ATOM 9576  N N    . GLY A 1 59  ? -3.088  10.013  8.772   1.00 0.00 ? 59  GLY A N    6  
ATOM 9577  C CA   . GLY A 1 59  ? -2.273  8.843   9.051   1.00 0.00 ? 59  GLY A CA   6  
ATOM 9578  C C    . GLY A 1 59  ? -1.706  8.249   7.760   1.00 0.00 ? 59  GLY A C    6  
ATOM 9579  O O    . GLY A 1 59  ? -1.686  7.031   7.589   1.00 0.00 ? 59  GLY A O    6  
ATOM 9580  H H    . GLY A 1 59  ? -2.577  10.862  8.636   1.00 0.00 ? 59  GLY A H    6  
ATOM 9581  H HA2  . GLY A 1 59  ? -1.456  9.116   9.719   1.00 0.00 ? 59  GLY A HA2  6  
ATOM 9582  H HA3  . GLY A 1 59  ? -2.871  8.094   9.569   1.00 0.00 ? 59  GLY A HA3  6  
ATOM 9583  N N    . LEU A 1 60  ? -1.259  9.137   6.884   1.00 0.00 ? 60  LEU A N    6  
ATOM 9584  C CA   . LEU A 1 60  ? -0.694  8.716   5.614   1.00 0.00 ? 60  LEU A CA   6  
ATOM 9585  C C    . LEU A 1 60  ? 0.753   8.268   5.828   1.00 0.00 ? 60  LEU A C    6  
ATOM 9586  O O    . LEU A 1 60  ? 1.396   8.674   6.795   1.00 0.00 ? 60  LEU A O    6  
ATOM 9587  C CB   . LEU A 1 60  ? -0.847  9.821   4.566   1.00 0.00 ? 60  LEU A CB   6  
ATOM 9588  C CG   . LEU A 1 60  ? -2.210  9.909   3.878   1.00 0.00 ? 60  LEU A CG   6  
ATOM 9589  C CD1  . LEU A 1 60  ? -2.335  11.203  3.072   1.00 0.00 ? 60  LEU A CD1  6  
ATOM 9590  C CD2  . LEU A 1 60  ? -2.471  8.670   3.018   1.00 0.00 ? 60  LEU A CD2  6  
ATOM 9591  H H    . LEU A 1 60  ? -1.279  10.126  7.031   1.00 0.00 ? 60  LEU A H    6  
ATOM 9592  H HA   . LEU A 1 60  ? -1.273  7.860   5.266   1.00 0.00 ? 60  LEU A HA   6  
ATOM 9593  H HB2  . LEU A 1 60  ? -0.642  10.779  5.045   1.00 0.00 ? 60  LEU A HB2  6  
ATOM 9594  H HB3  . LEU A 1 60  ? -0.084  9.677   3.801   1.00 0.00 ? 60  LEU A HB3  6  
ATOM 9595  H HG   . LEU A 1 60  ? -2.981  9.933   4.648   1.00 0.00 ? 60  LEU A HG   6  
ATOM 9596  H HD11 . LEU A 1 60  ? -3.276  11.199  2.522   1.00 0.00 ? 60  LEU A HD11 6  
ATOM 9597  H HD12 . LEU A 1 60  ? -2.314  12.056  3.749   1.00 0.00 ? 60  LEU A HD12 6  
ATOM 9598  H HD13 . LEU A 1 60  ? -1.505  11.275  2.370   1.00 0.00 ? 60  LEU A HD13 6  
ATOM 9599  H HD21 . LEU A 1 60  ? -2.572  8.967   1.974   1.00 0.00 ? 60  LEU A HD21 6  
ATOM 9600  H HD22 . LEU A 1 60  ? -1.636  7.976   3.118   1.00 0.00 ? 60  LEU A HD22 6  
ATOM 9601  H HD23 . LEU A 1 60  ? -3.389  8.185   3.348   1.00 0.00 ? 60  LEU A HD23 6  
ATOM 9602  N N    . GLU A 1 61  ? 1.224   7.436   4.910   1.00 0.00 ? 61  GLU A N    6  
ATOM 9603  C CA   . GLU A 1 61  ? 2.583   6.929   4.986   1.00 0.00 ? 61  GLU A CA   6  
ATOM 9604  C C    . GLU A 1 61  ? 3.162   6.749   3.582   1.00 0.00 ? 61  GLU A C    6  
ATOM 9605  O O    . GLU A 1 61  ? 2.425   6.754   2.597   1.00 0.00 ? 61  GLU A O    6  
ATOM 9606  C CB   . GLU A 1 61  ? 2.635   5.618   5.773   1.00 0.00 ? 61  GLU A CB   6  
ATOM 9607  C CG   . GLU A 1 61  ? 1.832   4.523   5.068   1.00 0.00 ? 61  GLU A CG   6  
ATOM 9608  C CD   . GLU A 1 61  ? 2.494   3.155   5.248   1.00 0.00 ? 61  GLU A CD   6  
ATOM 9609  O OE1  . GLU A 1 61  ? 3.449   2.883   4.489   1.00 0.00 ? 61  GLU A OE1  6  
ATOM 9610  O OE2  . GLU A 1 61  ? 2.029   2.413   6.139   1.00 0.00 ? 61  GLU A OE2  6  
ATOM 9611  H H    . GLU A 1 61  ? 0.694   7.111   4.127   1.00 0.00 ? 61  GLU A H    6  
ATOM 9612  H HA   . GLU A 1 61  ? 3.147   7.691   5.524   1.00 0.00 ? 61  GLU A HA   6  
ATOM 9613  H HB2  . GLU A 1 61  ? 3.671   5.298   5.886   1.00 0.00 ? 61  GLU A HB2  6  
ATOM 9614  H HB3  . GLU A 1 61  ? 2.239   5.775   6.777   1.00 0.00 ? 61  GLU A HB3  6  
ATOM 9615  H HG2  . GLU A 1 61  ? 0.818   4.496   5.469   1.00 0.00 ? 61  GLU A HG2  6  
ATOM 9616  H HG3  . GLU A 1 61  ? 1.749   4.754   4.006   1.00 0.00 ? 61  GLU A HG3  6  
ATOM 9617  N N    . TYR A 1 62  ? 4.477   6.593   3.534   1.00 0.00 ? 62  TYR A N    6  
ATOM 9618  C CA   . TYR A 1 62  ? 5.164   6.412   2.266   1.00 0.00 ? 62  TYR A CA   6  
ATOM 9619  C C    . TYR A 1 62  ? 4.999   4.980   1.753   1.00 0.00 ? 62  TYR A C    6  
ATOM 9620  O O    . TYR A 1 62  ? 4.832   4.050   2.541   1.00 0.00 ? 62  TYR A O    6  
ATOM 9621  C CB   . TYR A 1 62  ? 6.645   6.673   2.547   1.00 0.00 ? 62  TYR A CB   6  
ATOM 9622  C CG   . TYR A 1 62  ? 7.546   6.528   1.320   1.00 0.00 ? 62  TYR A CG   6  
ATOM 9623  C CD1  . TYR A 1 62  ? 7.765   5.282   0.768   1.00 0.00 ? 62  TYR A CD1  6  
ATOM 9624  C CD2  . TYR A 1 62  ? 8.140   7.643   0.764   1.00 0.00 ? 62  TYR A CD2  6  
ATOM 9625  C CE1  . TYR A 1 62  ? 8.614   5.145   -0.387  1.00 0.00 ? 62  TYR A CE1  6  
ATOM 9626  C CE2  . TYR A 1 62  ? 8.989   7.506   -0.391  1.00 0.00 ? 62  TYR A CE2  6  
ATOM 9627  C CZ   . TYR A 1 62  ? 9.184   6.264   -0.910  1.00 0.00 ? 62  TYR A CZ   6  
ATOM 9628  O OH   . TYR A 1 62  ? 9.985   6.135   -2.001  1.00 0.00 ? 62  TYR A OH   6  
ATOM 9629  H H    . TYR A 1 62  ? 5.069   6.590   4.339   1.00 0.00 ? 62  TYR A H    6  
ATOM 9630  H HA   . TYR A 1 62  ? 4.725   7.101   1.545   1.00 0.00 ? 62  TYR A HA   6  
ATOM 9631  H HB2  . TYR A 1 62  ? 6.756   7.680   2.950   1.00 0.00 ? 62  TYR A HB2  6  
ATOM 9632  H HB3  . TYR A 1 62  ? 6.985   5.982   3.319   1.00 0.00 ? 62  TYR A HB3  6  
ATOM 9633  H HD1  . TYR A 1 62  ? 7.296   4.401   1.207   1.00 0.00 ? 62  TYR A HD1  6  
ATOM 9634  H HD2  . TYR A 1 62  ? 7.967   8.627   1.200   1.00 0.00 ? 62  TYR A HD2  6  
ATOM 9635  H HE1  . TYR A 1 62  ? 8.795   4.167   -0.833  1.00 0.00 ? 62  TYR A HE1  6  
ATOM 9636  H HE2  . TYR A 1 62  ? 9.464   8.378   -0.840  1.00 0.00 ? 62  TYR A HE2  6  
ATOM 9637  H HH   . TYR A 1 62  ? 9.748   5.303   -2.502  1.00 0.00 ? 62  TYR A HH   6  
ATOM 9638  N N    . GLY A 1 63  ? 5.051   4.848   0.436   1.00 0.00 ? 63  GLY A N    6  
ATOM 9639  C CA   . GLY A 1 63  ? 4.910   3.545   -0.191  1.00 0.00 ? 63  GLY A CA   6  
ATOM 9640  C C    . GLY A 1 63  ? 3.435   3.192   -0.397  1.00 0.00 ? 63  GLY A C    6  
ATOM 9641  O O    . GLY A 1 63  ? 3.113   2.255   -1.126  1.00 0.00 ? 63  GLY A O    6  
ATOM 9642  H H    . GLY A 1 63  ? 5.187   5.609   -0.198  1.00 0.00 ? 63  GLY A H    6  
ATOM 9643  H HA2  . GLY A 1 63  ? 5.426   3.541   -1.151  1.00 0.00 ? 63  GLY A HA2  6  
ATOM 9644  H HA3  . GLY A 1 63  ? 5.386   2.785   0.429   1.00 0.00 ? 63  GLY A HA3  6  
ATOM 9645  N N    . ASP A 1 64  ? 2.579   3.963   0.257   1.00 0.00 ? 64  ASP A N    6  
ATOM 9646  C CA   . ASP A 1 64  ? 1.146   3.744   0.155   1.00 0.00 ? 64  ASP A CA   6  
ATOM 9647  C C    . ASP A 1 64  ? 0.666   4.177   -1.232  1.00 0.00 ? 64  ASP A C    6  
ATOM 9648  O O    . ASP A 1 64  ? 0.357   5.348   -1.448  1.00 0.00 ? 64  ASP A O    6  
ATOM 9649  C CB   . ASP A 1 64  ? 0.387   4.568   1.197   1.00 0.00 ? 64  ASP A CB   6  
ATOM 9650  C CG   . ASP A 1 64  ? -0.509  3.757   2.136   1.00 0.00 ? 64  ASP A CG   6  
ATOM 9651  O OD1  . ASP A 1 64  ? -0.231  2.547   2.280   1.00 0.00 ? 64  ASP A OD1  6  
ATOM 9652  O OD2  . ASP A 1 64  ? -1.450  4.366   2.688   1.00 0.00 ? 64  ASP A OD2  6  
ATOM 9653  H H    . ASP A 1 64  ? 2.849   4.723   0.848   1.00 0.00 ? 64  ASP A H    6  
ATOM 9654  H HA   . ASP A 1 64  ? 1.006   2.677   0.331   1.00 0.00 ? 64  ASP A HA   6  
ATOM 9655  H HB2  . ASP A 1 64  ? 1.109   5.122   1.796   1.00 0.00 ? 64  ASP A HB2  6  
ATOM 9656  H HB3  . ASP A 1 64  ? -0.228  5.304   0.678   1.00 0.00 ? 64  ASP A HB3  6  
ATOM 9657  N N    . GLN A 1 65  ? 0.619   3.209   -2.135  1.00 0.00 ? 65  GLN A N    6  
ATOM 9658  C CA   . GLN A 1 65  ? 0.182   3.476   -3.495  1.00 0.00 ? 65  GLN A CA   6  
ATOM 9659  C C    . GLN A 1 65  ? -1.259  3.992   -3.498  1.00 0.00 ? 65  GLN A C    6  
ATOM 9660  O O    . GLN A 1 65  ? -2.177  3.284   -3.087  1.00 0.00 ? 65  GLN A O    6  
ATOM 9661  C CB   . GLN A 1 65  ? 0.318   2.228   -4.369  1.00 0.00 ? 65  GLN A CB   6  
ATOM 9662  C CG   . GLN A 1 65  ? 0.530   2.607   -5.837  1.00 0.00 ? 65  GLN A CG   6  
ATOM 9663  C CD   . GLN A 1 65  ? 0.026   1.501   -6.767  1.00 0.00 ? 65  GLN A CD   6  
ATOM 9664  O OE1  . GLN A 1 65  ? 0.412   0.348   -6.669  1.00 0.00 ? 65  GLN A OE1  6  
ATOM 9665  N NE2  . GLN A 1 65  ? -0.857  1.916   -7.671  1.00 0.00 ? 65  GLN A NE2  6  
ATOM 9666  H H    . GLN A 1 65  ? 0.872   2.259   -1.951  1.00 0.00 ? 65  GLN A H    6  
ATOM 9667  H HA   . GLN A 1 65  ? 0.853   4.249   -3.869  1.00 0.00 ? 65  GLN A HA   6  
ATOM 9668  H HB2  . GLN A 1 65  ? 1.157   1.625   -4.021  1.00 0.00 ? 65  GLN A HB2  6  
ATOM 9669  H HB3  . GLN A 1 65  ? -0.577  1.613   -4.274  1.00 0.00 ? 65  GLN A HB3  6  
ATOM 9670  H HG2  . GLN A 1 65  ? 0.006   3.537   -6.055  1.00 0.00 ? 65  GLN A HG2  6  
ATOM 9671  H HG3  . GLN A 1 65  ? 1.589   2.786   -6.020  1.00 0.00 ? 65  GLN A HG3  6  
ATOM 9672  H HE21 . GLN A 1 65  ? -1.132  2.877   -7.697  1.00 0.00 ? 65  GLN A HE21 6  
ATOM 9673  H HE22 . GLN A 1 65  ? -1.245  1.267   -8.325  1.00 0.00 ? 65  GLN A HE22 6  
ATOM 9674  N N    . LEU A 1 66  ? -1.411  5.222   -3.966  1.00 0.00 ? 66  LEU A N    6  
ATOM 9675  C CA   . LEU A 1 66  ? -2.724  5.842   -4.028  1.00 0.00 ? 66  LEU A CA   6  
ATOM 9676  C C    . LEU A 1 66  ? -3.518  5.230   -5.183  1.00 0.00 ? 66  LEU A C    6  
ATOM 9677  O O    . LEU A 1 66  ? -3.226  5.491   -6.349  1.00 0.00 ? 66  LEU A O    6  
ATOM 9678  C CB   . LEU A 1 66  ? -2.595  7.364   -4.109  1.00 0.00 ? 66  LEU A CB   6  
ATOM 9679  C CG   . LEU A 1 66  ? -1.762  8.026   -3.009  1.00 0.00 ? 66  LEU A CG   6  
ATOM 9680  C CD1  . LEU A 1 66  ? -1.560  9.515   -3.297  1.00 0.00 ? 66  LEU A CD1  6  
ATOM 9681  C CD2  . LEU A 1 66  ? -2.384  7.788   -1.632  1.00 0.00 ? 66  LEU A CD2  6  
ATOM 9682  H H    . LEU A 1 66  ? -0.659  5.792   -4.298  1.00 0.00 ? 66  LEU A H    6  
ATOM 9683  H HA   . LEU A 1 66  ? -3.238  5.612   -3.095  1.00 0.00 ? 66  LEU A HA   6  
ATOM 9684  H HB2  . LEU A 1 66  ? -2.156  7.621   -5.074  1.00 0.00 ? 66  LEU A HB2  6  
ATOM 9685  H HB3  . LEU A 1 66  ? -3.596  7.796   -4.089  1.00 0.00 ? 66  LEU A HB3  6  
ATOM 9686  H HG   . LEU A 1 66  ? -0.776  7.563   -3.002  1.00 0.00 ? 66  LEU A HG   6  
ATOM 9687  H HD11 . LEU A 1 66  ? -2.457  10.066  -3.012  1.00 0.00 ? 66  LEU A HD11 6  
ATOM 9688  H HD12 . LEU A 1 66  ? -0.710  9.884   -2.722  1.00 0.00 ? 66  LEU A HD12 6  
ATOM 9689  H HD13 . LEU A 1 66  ? -1.368  9.658   -4.360  1.00 0.00 ? 66  LEU A HD13 6  
ATOM 9690  H HD21 . LEU A 1 66  ? -2.476  8.738   -1.105  1.00 0.00 ? 66  LEU A HD21 6  
ATOM 9691  H HD22 . LEU A 1 66  ? -3.372  7.341   -1.752  1.00 0.00 ? 66  LEU A HD22 6  
ATOM 9692  H HD23 . LEU A 1 66  ? -1.748  7.114   -1.058  1.00 0.00 ? 66  LEU A HD23 6  
ATOM 9693  N N    . LEU A 1 67  ? -4.507  4.426   -4.819  1.00 0.00 ? 67  LEU A N    6  
ATOM 9694  C CA   . LEU A 1 67  ? -5.345  3.774   -5.811  1.00 0.00 ? 67  LEU A CA   6  
ATOM 9695  C C    . LEU A 1 67  ? -6.341  4.789   -6.377  1.00 0.00 ? 67  LEU A C    6  
ATOM 9696  O O    . LEU A 1 67  ? -6.366  5.034   -7.583  1.00 0.00 ? 67  LEU A O    6  
ATOM 9697  C CB   . LEU A 1 67  ? -6.007  2.529   -5.219  1.00 0.00 ? 67  LEU A CB   6  
ATOM 9698  C CG   . LEU A 1 67  ? -5.081  1.341   -4.951  1.00 0.00 ? 67  LEU A CG   6  
ATOM 9699  C CD1  . LEU A 1 67  ? -5.854  0.168   -4.344  1.00 0.00 ? 67  LEU A CD1  6  
ATOM 9700  C CD2  . LEU A 1 67  ? -4.328  0.935   -6.219  1.00 0.00 ? 67  LEU A CD2  6  
ATOM 9701  H H    . LEU A 1 67  ? -4.738  4.218   -3.869  1.00 0.00 ? 67  LEU A H    6  
ATOM 9702  H HA   . LEU A 1 67  ? -4.695  3.440   -6.620  1.00 0.00 ? 67  LEU A HA   6  
ATOM 9703  H HB2  . LEU A 1 67  ? -6.488  2.808   -4.281  1.00 0.00 ? 67  LEU A HB2  6  
ATOM 9704  H HB3  . LEU A 1 67  ? -6.796  2.203   -5.897  1.00 0.00 ? 67  LEU A HB3  6  
ATOM 9705  H HG   . LEU A 1 67  ? -4.335  1.648   -4.218  1.00 0.00 ? 67  LEU A HG   6  
ATOM 9706  H HD11 . LEU A 1 67  ? -6.451  -0.313  -5.119  1.00 0.00 ? 67  LEU A HD11 6  
ATOM 9707  H HD12 . LEU A 1 67  ? -5.152  -0.553  -3.925  1.00 0.00 ? 67  LEU A HD12 6  
ATOM 9708  H HD13 . LEU A 1 67  ? -6.511  0.536   -3.555  1.00 0.00 ? 67  LEU A HD13 6  
ATOM 9709  H HD21 . LEU A 1 67  ? -3.330  1.374   -6.205  1.00 0.00 ? 67  LEU A HD21 6  
ATOM 9710  H HD22 . LEU A 1 67  ? -4.247  -0.151  -6.262  1.00 0.00 ? 67  LEU A HD22 6  
ATOM 9711  H HD23 . LEU A 1 67  ? -4.870  1.294   -7.094  1.00 0.00 ? 67  LEU A HD23 6  
ATOM 9712  N N    . GLU A 1 68  ? -7.137  5.352   -5.481  1.00 0.00 ? 68  GLU A N    6  
ATOM 9713  C CA   . GLU A 1 68  ? -8.132  6.335   -5.876  1.00 0.00 ? 68  GLU A CA   6  
ATOM 9714  C C    . GLU A 1 68  ? -8.312  7.381   -4.773  1.00 0.00 ? 68  GLU A C    6  
ATOM 9715  O O    . GLU A 1 68  ? -8.651  7.042   -3.641  1.00 0.00 ? 68  GLU A O    6  
ATOM 9716  C CB   . GLU A 1 68  ? -9.463  5.661   -6.215  1.00 0.00 ? 68  GLU A CB   6  
ATOM 9717  C CG   . GLU A 1 68  ? -9.422  5.039   -7.612  1.00 0.00 ? 68  GLU A CG   6  
ATOM 9718  C CD   . GLU A 1 68  ? -10.628 4.125   -7.841  1.00 0.00 ? 68  GLU A CD   6  
ATOM 9719  O OE1  . GLU A 1 68  ? -11.711 4.475   -7.324  1.00 0.00 ? 68  GLU A OE1  6  
ATOM 9720  O OE2  . GLU A 1 68  ? -10.439 3.098   -8.527  1.00 0.00 ? 68  GLU A OE2  6  
ATOM 9721  H H    . GLU A 1 68  ? -7.110  5.148   -4.502  1.00 0.00 ? 68  GLU A H    6  
ATOM 9722  H HA   . GLU A 1 68  ? -7.732  6.808   -6.773  1.00 0.00 ? 68  GLU A HA   6  
ATOM 9723  H HB2  . GLU A 1 68  ? -9.684  4.891   -5.476  1.00 0.00 ? 68  GLU A HB2  6  
ATOM 9724  H HB3  . GLU A 1 68  ? -10.269 6.394   -6.162  1.00 0.00 ? 68  GLU A HB3  6  
ATOM 9725  H HG2  . GLU A 1 68  ? -9.411  5.827   -8.365  1.00 0.00 ? 68  GLU A HG2  6  
ATOM 9726  H HG3  . GLU A 1 68  ? -8.501  4.469   -7.733  1.00 0.00 ? 68  GLU A HG3  6  
ATOM 9727  N N    . PHE A 1 69  ? -8.076  8.631   -5.144  1.00 0.00 ? 69  PHE A N    6  
ATOM 9728  C CA   . PHE A 1 69  ? -8.208  9.728   -4.201  1.00 0.00 ? 69  PHE A CA   6  
ATOM 9729  C C    . PHE A 1 69  ? -9.598  10.362  -4.288  1.00 0.00 ? 69  PHE A C    6  
ATOM 9730  O O    . PHE A 1 69  ? -9.952  10.952  -5.308  1.00 0.00 ? 69  PHE A O    6  
ATOM 9731  C CB   . PHE A 1 69  ? -7.159  10.774  -4.582  1.00 0.00 ? 69  PHE A CB   6  
ATOM 9732  C CG   . PHE A 1 69  ? -7.377  12.141  -3.931  1.00 0.00 ? 69  PHE A CG   6  
ATOM 9733  C CD1  . PHE A 1 69  ? -8.231  13.036  -4.498  1.00 0.00 ? 69  PHE A CD1  6  
ATOM 9734  C CD2  . PHE A 1 69  ? -6.719  12.462  -2.785  1.00 0.00 ? 69  PHE A CD2  6  
ATOM 9735  C CE1  . PHE A 1 69  ? -8.434  14.305  -3.894  1.00 0.00 ? 69  PHE A CE1  6  
ATOM 9736  C CE2  . PHE A 1 69  ? -6.922  13.731  -2.181  1.00 0.00 ? 69  PHE A CE2  6  
ATOM 9737  C CZ   . PHE A 1 69  ? -7.775  14.625  -2.748  1.00 0.00 ? 69  PHE A CZ   6  
ATOM 9738  H H    . PHE A 1 69  ? -7.801  8.898   -6.067  1.00 0.00 ? 69  PHE A H    6  
ATOM 9739  H HA   . PHE A 1 69  ? -8.061  9.316   -3.202  1.00 0.00 ? 69  PHE A HA   6  
ATOM 9740  H HB2  . PHE A 1 69  ? -6.173  10.403  -4.302  1.00 0.00 ? 69  PHE A HB2  6  
ATOM 9741  H HB3  . PHE A 1 69  ? -7.158  10.895  -5.665  1.00 0.00 ? 69  PHE A HB3  6  
ATOM 9742  H HD1  . PHE A 1 69  ? -8.758  12.779  -5.416  1.00 0.00 ? 69  PHE A HD1  6  
ATOM 9743  H HD2  . PHE A 1 69  ? -6.035  11.745  -2.330  1.00 0.00 ? 69  PHE A HD2  6  
ATOM 9744  H HE1  . PHE A 1 69  ? -9.117  15.022  -4.348  1.00 0.00 ? 69  PHE A HE1  6  
ATOM 9745  H HE2  . PHE A 1 69  ? -6.394  13.988  -1.262  1.00 0.00 ? 69  PHE A HE2  6  
ATOM 9746  H HZ   . PHE A 1 69  ? -7.931  15.599  -2.284  1.00 0.00 ? 69  PHE A HZ   6  
ATOM 9747  N N    . ASN A 1 70  ? -10.348 10.219  -3.205  1.00 0.00 ? 70  ASN A N    6  
ATOM 9748  C CA   . ASN A 1 70  ? -11.691 10.771  -3.146  1.00 0.00 ? 70  ASN A CA   6  
ATOM 9749  C C    . ASN A 1 70  ? -12.548 10.132  -4.241  1.00 0.00 ? 70  ASN A C    6  
ATOM 9750  O O    . ASN A 1 70  ? -13.627 10.629  -4.558  1.00 0.00 ? 70  ASN A O    6  
ATOM 9751  C CB   . ASN A 1 70  ? -11.676 12.283  -3.379  1.00 0.00 ? 70  ASN A CB   6  
ATOM 9752  C CG   . ASN A 1 70  ? -12.515 13.008  -2.325  1.00 0.00 ? 70  ASN A CG   6  
ATOM 9753  O OD1  . ASN A 1 70  ? -13.302 12.415  -1.605  1.00 0.00 ? 70  ASN A OD1  6  
ATOM 9754  N ND2  . ASN A 1 70  ? -12.304 14.320  -2.274  1.00 0.00 ? 70  ASN A ND2  6  
ATOM 9755  H H    . ASN A 1 70  ? -10.052 9.738   -2.380  1.00 0.00 ? 70  ASN A H    6  
ATOM 9756  H HA   . ASN A 1 70  ? -12.052 10.538  -2.145  1.00 0.00 ? 70  ASN A HA   6  
ATOM 9757  H HB2  . ASN A 1 70  ? -10.650 12.649  -3.347  1.00 0.00 ? 70  ASN A HB2  6  
ATOM 9758  H HB3  . ASN A 1 70  ? -12.063 12.505  -4.373  1.00 0.00 ? 70  ASN A HB3  6  
ATOM 9759  H HD21 . ASN A 1 70  ? -11.644 14.745  -2.894  1.00 0.00 ? 70  ASN A HD21 6  
ATOM 9760  H HD22 . ASN A 1 70  ? -12.806 14.882  -1.617  1.00 0.00 ? 70  ASN A HD22 6  
ATOM 9761  N N    . GLY A 1 71  ? -12.034 9.041   -4.789  1.00 0.00 ? 71  GLY A N    6  
ATOM 9762  C CA   . GLY A 1 71  ? -12.739 8.329   -5.842  1.00 0.00 ? 71  GLY A CA   6  
ATOM 9763  C C    . GLY A 1 71  ? -12.281 8.801   -7.223  1.00 0.00 ? 71  GLY A C    6  
ATOM 9764  O O    . GLY A 1 71  ? -13.087 8.902   -8.147  1.00 0.00 ? 71  GLY A O    6  
ATOM 9765  H H    . GLY A 1 71  ? -11.155 8.643   -4.525  1.00 0.00 ? 71  GLY A H    6  
ATOM 9766  H HA2  . GLY A 1 71  ? -12.564 7.258   -5.742  1.00 0.00 ? 71  GLY A HA2  6  
ATOM 9767  H HA3  . GLY A 1 71  ? -13.812 8.488   -5.737  1.00 0.00 ? 71  GLY A HA3  6  
ATOM 9768  N N    . ILE A 1 72  ? -10.989 9.076   -7.321  1.00 0.00 ? 72  ILE A N    6  
ATOM 9769  C CA   . ILE A 1 72  ? -10.414 9.534   -8.575  1.00 0.00 ? 72  ILE A CA   6  
ATOM 9770  C C    . ILE A 1 72  ? -9.406  8.499   -9.077  1.00 0.00 ? 72  ILE A C    6  
ATOM 9771  O O    . ILE A 1 72  ? -8.476  8.133   -8.359  1.00 0.00 ? 72  ILE A O    6  
ATOM 9772  C CB   . ILE A 1 72  ? -9.826  10.937  -8.413  1.00 0.00 ? 72  ILE A CB   6  
ATOM 9773  C CG1  . ILE A 1 72  ? -10.915 12.005  -8.534  1.00 0.00 ? 72  ILE A CG1  6  
ATOM 9774  C CG2  . ILE A 1 72  ? -8.682  11.169  -9.403  1.00 0.00 ? 72  ILE A CG2  6  
ATOM 9775  C CD1  . ILE A 1 72  ? -10.640 13.178  -7.591  1.00 0.00 ? 72  ILE A CD1  6  
ATOM 9776  H H    . ILE A 1 72  ? -10.340 8.991   -6.565  1.00 0.00 ? 72  ILE A H    6  
ATOM 9777  H HA   . ILE A 1 72  ? -11.225 9.606   -9.299  1.00 0.00 ? 72  ILE A HA   6  
ATOM 9778  H HB   . ILE A 1 72  ? -9.405  11.018  -7.411  1.00 0.00 ? 72  ILE A HB   6  
ATOM 9779  H HG12 . ILE A 1 72  ? -10.964 12.365  -9.562  1.00 0.00 ? 72  ILE A HG12 6  
ATOM 9780  H HG13 . ILE A 1 72  ? -11.886 11.567  -8.303  1.00 0.00 ? 72  ILE A HG13 6  
ATOM 9781  H HG21 . ILE A 1 72  ? -8.973  10.801  -10.387 1.00 0.00 ? 72  ILE A HG21 6  
ATOM 9782  H HG22 . ILE A 1 72  ? -8.466  12.236  -9.464  1.00 0.00 ? 72  ILE A HG22 6  
ATOM 9783  H HG23 . ILE A 1 72  ? -7.794  10.637  -9.063  1.00 0.00 ? 72  ILE A HG23 6  
ATOM 9784  H HD11 . ILE A 1 72  ? -10.726 14.115  -8.141  1.00 0.00 ? 72  ILE A HD11 6  
ATOM 9785  H HD12 . ILE A 1 72  ? -11.365 13.166  -6.777  1.00 0.00 ? 72  ILE A HD12 6  
ATOM 9786  H HD13 . ILE A 1 72  ? -9.633  13.087  -7.183  1.00 0.00 ? 72  ILE A HD13 6  
ATOM 9787  N N    . ASN A 1 73  ? -9.623  8.056   -10.306 1.00 0.00 ? 73  ASN A N    6  
ATOM 9788  C CA   . ASN A 1 73  ? -8.745  7.070   -10.913 1.00 0.00 ? 73  ASN A CA   6  
ATOM 9789  C C    . ASN A 1 73  ? -7.310  7.602   -10.912 1.00 0.00 ? 73  ASN A C    6  
ATOM 9790  O O    . ASN A 1 73  ? -6.927  8.365   -11.797 1.00 0.00 ? 73  ASN A O    6  
ATOM 9791  C CB   . ASN A 1 73  ? -9.145  6.793   -12.363 1.00 0.00 ? 73  ASN A CB   6  
ATOM 9792  C CG   . ASN A 1 73  ? -8.658  5.414   -12.813 1.00 0.00 ? 73  ASN A CG   6  
ATOM 9793  O OD1  . ASN A 1 73  ? -7.963  4.710   -12.100 1.00 0.00 ? 73  ASN A OD1  6  
ATOM 9794  N ND2  . ASN A 1 73  ? -9.061  5.070   -14.033 1.00 0.00 ? 73  ASN A ND2  6  
ATOM 9795  H H    . ASN A 1 73  ? -10.381 8.358   -10.884 1.00 0.00 ? 73  ASN A H    6  
ATOM 9796  H HA   . ASN A 1 73  ? -8.857  6.173   -10.304 1.00 0.00 ? 73  ASN A HA   6  
ATOM 9797  H HB2  . ASN A 1 73  ? -10.230 6.850   -12.462 1.00 0.00 ? 73  ASN A HB2  6  
ATOM 9798  H HB3  . ASN A 1 73  ? -8.726  7.561   -13.013 1.00 0.00 ? 73  ASN A HB3  6  
ATOM 9799  H HD21 . ASN A 1 73  ? -9.631  5.695   -14.567 1.00 0.00 ? 73  ASN A HD21 6  
ATOM 9800  H HD22 . ASN A 1 73  ? -8.794  4.186   -14.417 1.00 0.00 ? 73  ASN A HD22 6  
ATOM 9801  N N    . LEU A 1 74  ? -6.556  7.178   -9.909  1.00 0.00 ? 74  LEU A N    6  
ATOM 9802  C CA   . LEU A 1 74  ? -5.172  7.602   -9.781  1.00 0.00 ? 74  LEU A CA   6  
ATOM 9803  C C    . LEU A 1 74  ? -4.261  6.557   -10.429 1.00 0.00 ? 74  LEU A C    6  
ATOM 9804  O O    . LEU A 1 74  ? -3.163  6.880   -10.878 1.00 0.00 ? 74  LEU A O    6  
ATOM 9805  C CB   . LEU A 1 74  ? -4.833  7.891   -8.317  1.00 0.00 ? 74  LEU A CB   6  
ATOM 9806  C CG   . LEU A 1 74  ? -5.118  9.313   -7.831  1.00 0.00 ? 74  LEU A CG   6  
ATOM 9807  C CD1  . LEU A 1 74  ? -5.036  9.397   -6.305  1.00 0.00 ? 74  LEU A CD1  6  
ATOM 9808  C CD2  . LEU A 1 74  ? -4.190  10.321  -8.512  1.00 0.00 ? 74  LEU A CD2  6  
ATOM 9809  H H    . LEU A 1 74  ? -6.875  6.557   -9.193  1.00 0.00 ? 74  LEU A H    6  
ATOM 9810  H HA   . LEU A 1 74  ? -5.066  8.539   -10.327 1.00 0.00 ? 74  LEU A HA   6  
ATOM 9811  H HB2  . LEU A 1 74  ? -5.392  7.195   -7.691  1.00 0.00 ? 74  LEU A HB2  6  
ATOM 9812  H HB3  . LEU A 1 74  ? -3.775  7.680   -8.162  1.00 0.00 ? 74  LEU A HB3  6  
ATOM 9813  H HG   . LEU A 1 74  ? -6.138  9.573   -8.113  1.00 0.00 ? 74  LEU A HG   6  
ATOM 9814  H HD11 . LEU A 1 74  ? -4.091  8.970   -5.968  1.00 0.00 ? 74  LEU A HD11 6  
ATOM 9815  H HD12 . LEU A 1 74  ? -5.093  10.441  -5.996  1.00 0.00 ? 74  LEU A HD12 6  
ATOM 9816  H HD13 . LEU A 1 74  ? -5.864  8.841   -5.865  1.00 0.00 ? 74  LEU A HD13 6  
ATOM 9817  H HD21 . LEU A 1 74  ? -3.524  10.760  -7.769  1.00 0.00 ? 74  LEU A HD21 6  
ATOM 9818  H HD22 . LEU A 1 74  ? -3.601  9.814   -9.275  1.00 0.00 ? 74  LEU A HD22 6  
ATOM 9819  H HD23 . LEU A 1 74  ? -4.786  11.108  -8.975  1.00 0.00 ? 74  LEU A HD23 6  
ATOM 9820  N N    . ARG A 1 75  ? -4.752  5.326   -10.456 1.00 0.00 ? 75  ARG A N    6  
ATOM 9821  C CA   . ARG A 1 75  ? -3.995  4.233   -11.041 1.00 0.00 ? 75  ARG A CA   6  
ATOM 9822  C C    . ARG A 1 75  ? -3.457  4.635   -12.416 1.00 0.00 ? 75  ARG A C    6  
ATOM 9823  O O    . ARG A 1 75  ? -2.470  4.073   -12.889 1.00 0.00 ? 75  ARG A O    6  
ATOM 9824  C CB   . ARG A 1 75  ? -4.862  2.980   -11.188 1.00 0.00 ? 75  ARG A CB   6  
ATOM 9825  C CG   . ARG A 1 75  ? -5.170  2.364   -9.821  1.00 0.00 ? 75  ARG A CG   6  
ATOM 9826  C CD   . ARG A 1 75  ? -6.208  1.247   -9.945  1.00 0.00 ? 75  ARG A CD   6  
ATOM 9827  N NE   . ARG A 1 75  ? -7.071  1.222   -8.743  1.00 0.00 ? 75  ARG A NE   6  
ATOM 9828  C CZ   . ARG A 1 75  ? -8.219  0.536   -8.657  1.00 0.00 ? 75  ARG A CZ   6  
ATOM 9829  N NH1  . ARG A 1 75  ? -8.648  -0.186  -9.701  1.00 0.00 ? 75  ARG A NH1  6  
ATOM 9830  N NH2  . ARG A 1 75  ? -8.937  0.571   -7.526  1.00 0.00 ? 75  ARG A NH2  6  
ATOM 9831  H H    . ARG A 1 75  ? -5.646  5.073   -10.088 1.00 0.00 ? 75  ARG A H    6  
ATOM 9832  H HA   . ARG A 1 75  ? -3.182  4.049   -10.340 1.00 0.00 ? 75  ARG A HA   6  
ATOM 9833  H HB2  . ARG A 1 75  ? -5.793  3.235   -11.694 1.00 0.00 ? 75  ARG A HB2  6  
ATOM 9834  H HB3  . ARG A 1 75  ? -4.349  2.249   -11.812 1.00 0.00 ? 75  ARG A HB3  6  
ATOM 9835  H HG2  . ARG A 1 75  ? -4.255  1.968   -9.382  1.00 0.00 ? 75  ARG A HG2  6  
ATOM 9836  H HG3  . ARG A 1 75  ? -5.540  3.136   -9.146  1.00 0.00 ? 75  ARG A HG3  6  
ATOM 9837  H HD2  . ARG A 1 75  ? -6.816  1.401   -10.837 1.00 0.00 ? 75  ARG A HD2  6  
ATOM 9838  H HD3  . ARG A 1 75  ? -5.707  0.286   -10.064 1.00 0.00 ? 75  ARG A HD3  6  
ATOM 9839  H HE   . ARG A 1 75  ? -6.780  1.751   -7.946  1.00 0.00 ? 75  ARG A HE   6  
ATOM 9840  H HH11 . ARG A 1 75  ? -8.112  -0.213  -10.544 1.00 0.00 ? 75  ARG A HH11 6  
ATOM 9841  H HH12 . ARG A 1 75  ? -9.505  -0.699  -9.636  1.00 0.00 ? 75  ARG A HH12 6  
ATOM 9842  H HH21 . ARG A 1 75  ? -8.617  1.110   -6.747  1.00 0.00 ? 75  ARG A HH21 6  
ATOM 9843  H HH22 . ARG A 1 75  ? -9.793  0.059   -7.461  1.00 0.00 ? 75  ARG A HH22 6  
ATOM 9844  N N    . SER A 1 76  ? -4.129  5.605   -13.019 1.00 0.00 ? 76  SER A N    6  
ATOM 9845  C CA   . SER A 1 76  ? -3.730  6.089   -14.329 1.00 0.00 ? 76  SER A CA   6  
ATOM 9846  C C    . SER A 1 76  ? -3.581  7.611   -14.301 1.00 0.00 ? 76  SER A C    6  
ATOM 9847  O O    . SER A 1 76  ? -4.176  8.312   -15.119 1.00 0.00 ? 76  SER A O    6  
ATOM 9848  C CB   . SER A 1 76  ? -4.741  5.674   -15.400 1.00 0.00 ? 76  SER A CB   6  
ATOM 9849  O OG   . SER A 1 76  ? -4.678  4.279   -15.683 1.00 0.00 ? 76  SER A OG   6  
ATOM 9850  H H    . SER A 1 76  ? -4.931  6.056   -12.627 1.00 0.00 ? 76  SER A H    6  
ATOM 9851  H HA   . SER A 1 76  ? -2.771  5.614   -14.533 1.00 0.00 ? 76  SER A HA   6  
ATOM 9852  H HB2  . SER A 1 76  ? -5.747  5.932   -15.069 1.00 0.00 ? 76  SER A HB2  6  
ATOM 9853  H HB3  . SER A 1 76  ? -4.553  6.238   -16.314 1.00 0.00 ? 76  SER A HB3  6  
ATOM 9854  H HG   . SER A 1 76  ? -5.183  3.766   -14.988 1.00 0.00 ? 76  SER A HG   6  
ATOM 9855  N N    . ALA A 1 77  ? -2.783  8.079   -13.353 1.00 0.00 ? 77  ALA A N    6  
ATOM 9856  C CA   . ALA A 1 77  ? -2.548  9.505   -13.208 1.00 0.00 ? 77  ALA A CA   6  
ATOM 9857  C C    . ALA A 1 77  ? -1.041  9.766   -13.146 1.00 0.00 ? 77  ALA A C    6  
ATOM 9858  O O    . ALA A 1 77  ? -0.263  8.860   -12.850 1.00 0.00 ? 77  ALA A O    6  
ATOM 9859  C CB   . ALA A 1 77  ? -3.280  10.020  -11.967 1.00 0.00 ? 77  ALA A CB   6  
ATOM 9860  H H    . ALA A 1 77  ? -2.303  7.502   -12.692 1.00 0.00 ? 77  ALA A H    6  
ATOM 9861  H HA   . ALA A 1 77  ? -2.958  10.000  -14.088 1.00 0.00 ? 77  ALA A HA   6  
ATOM 9862  H HB1  . ALA A 1 77  ? -4.284  9.596   -11.935 1.00 0.00 ? 77  ALA A HB1  6  
ATOM 9863  H HB2  . ALA A 1 77  ? -2.732  9.723   -11.072 1.00 0.00 ? 77  ALA A HB2  6  
ATOM 9864  H HB3  . ALA A 1 77  ? -3.345  11.107  -12.008 1.00 0.00 ? 77  ALA A HB3  6  
ATOM 9865  N N    . THR A 1 78  ? -0.676  11.007  -13.431 1.00 0.00 ? 78  THR A N    6  
ATOM 9866  C CA   . THR A 1 78  ? 0.724   11.398  -13.411 1.00 0.00 ? 78  THR A CA   6  
ATOM 9867  C C    . THR A 1 78  ? 1.073   12.065  -12.079 1.00 0.00 ? 78  THR A C    6  
ATOM 9868  O O    . THR A 1 78  ? 0.232   12.152  -11.185 1.00 0.00 ? 78  THR A O    6  
ATOM 9869  C CB   . THR A 1 78  ? 0.981   12.293  -14.625 1.00 0.00 ? 78  THR A CB   6  
ATOM 9870  O OG1  . THR A 1 78  ? 0.113   13.405  -14.427 1.00 0.00 ? 78  THR A OG1  6  
ATOM 9871  C CG2  . THR A 1 78  ? 0.490   11.665  -15.931 1.00 0.00 ? 78  THR A CG2  6  
ATOM 9872  H H    . THR A 1 78  ? -1.315  11.737  -13.671 1.00 0.00 ? 78  THR A H    6  
ATOM 9873  H HA   . THR A 1 78  ? 1.333   10.497  -13.487 1.00 0.00 ? 78  THR A HA   6  
ATOM 9874  H HB   . THR A 1 78  ? 2.036   12.560  -14.694 1.00 0.00 ? 78  THR A HB   6  
ATOM 9875  H HG1  . THR A 1 78  ? 0.050   13.944  -15.267 1.00 0.00 ? 78  THR A HG1  6  
ATOM 9876  H HG21 . THR A 1 78  ? 0.195   12.452  -16.624 1.00 0.00 ? 78  THR A HG21 6  
ATOM 9877  H HG22 . THR A 1 78  ? 1.291   11.072  -16.373 1.00 0.00 ? 78  THR A HG22 6  
ATOM 9878  H HG23 . THR A 1 78  ? -0.367  11.022  -15.725 1.00 0.00 ? 78  THR A HG23 6  
ATOM 9879  N N    . GLU A 1 79  ? 2.314   12.519  -11.989 1.00 0.00 ? 79  GLU A N    6  
ATOM 9880  C CA   . GLU A 1 79  ? 2.784   13.176  -10.781 1.00 0.00 ? 79  GLU A CA   6  
ATOM 9881  C C    . GLU A 1 79  ? 2.224   14.597  -10.696 1.00 0.00 ? 79  GLU A C    6  
ATOM 9882  O O    . GLU A 1 79  ? 1.884   15.070  -9.613  1.00 0.00 ? 79  GLU A O    6  
ATOM 9883  C CB   . GLU A 1 79  ? 4.313   13.185  -10.722 1.00 0.00 ? 79  GLU A CB   6  
ATOM 9884  C CG   . GLU A 1 79  ? 4.913   13.480  -12.098 1.00 0.00 ? 79  GLU A CG   6  
ATOM 9885  C CD   . GLU A 1 79  ? 6.297   14.119  -11.968 1.00 0.00 ? 79  GLU A CD   6  
ATOM 9886  O OE1  . GLU A 1 79  ? 6.368   15.193  -11.332 1.00 0.00 ? 79  GLU A OE1  6  
ATOM 9887  O OE2  . GLU A 1 79  ? 7.252   13.520  -12.507 1.00 0.00 ? 79  GLU A OE2  6  
ATOM 9888  H H    . GLU A 1 79  ? 2.992   12.444  -12.720 1.00 0.00 ? 79  GLU A H    6  
ATOM 9889  H HA   . GLU A 1 79  ? 2.399   12.576  -9.956  1.00 0.00 ? 79  GLU A HA   6  
ATOM 9890  H HB2  . GLU A 1 79  ? 4.649   13.936  -10.007 1.00 0.00 ? 79  GLU A HB2  6  
ATOM 9891  H HB3  . GLU A 1 79  ? 4.673   12.221  -10.363 1.00 0.00 ? 79  GLU A HB3  6  
ATOM 9892  H HG2  . GLU A 1 79  ? 4.988   12.556  -12.672 1.00 0.00 ? 79  GLU A HG2  6  
ATOM 9893  H HG3  . GLU A 1 79  ? 4.252   14.146  -12.652 1.00 0.00 ? 79  GLU A HG3  6  
ATOM 9894  N N    . GLN A 1 80  ? 2.144   15.237  -11.854 1.00 0.00 ? 80  GLN A N    6  
ATOM 9895  C CA   . GLN A 1 80  ? 1.631   16.594  -11.924 1.00 0.00 ? 80  GLN A CA   6  
ATOM 9896  C C    . GLN A 1 80  ? 0.141   16.617  -11.577 1.00 0.00 ? 80  GLN A C    6  
ATOM 9897  O O    . GLN A 1 80  ? -0.324  17.515  -10.878 1.00 0.00 ? 80  GLN A O    6  
ATOM 9898  C CB   . GLN A 1 80  ? 1.881   17.204  -13.305 1.00 0.00 ? 80  GLN A CB   6  
ATOM 9899  C CG   . GLN A 1 80  ? 1.145   16.420  -14.393 1.00 0.00 ? 80  GLN A CG   6  
ATOM 9900  C CD   . GLN A 1 80  ? 1.895   16.494  -15.724 1.00 0.00 ? 80  GLN A CD   6  
ATOM 9901  O OE1  . GLN A 1 80  ? 3.088   16.253  -15.809 1.00 0.00 ? 80  GLN A OE1  6  
ATOM 9902  N NE2  . GLN A 1 80  ? 1.131   16.841  -16.757 1.00 0.00 ? 80  GLN A NE2  6  
ATOM 9903  H H    . GLN A 1 80  ? 2.423   14.845  -12.730 1.00 0.00 ? 80  GLN A H    6  
ATOM 9904  H HA   . GLN A 1 80  ? 2.193   17.156  -11.178 1.00 0.00 ? 80  GLN A HA   6  
ATOM 9905  H HB2  . GLN A 1 80  ? 1.550   18.243  -13.313 1.00 0.00 ? 80  GLN A HB2  6  
ATOM 9906  H HB3  . GLN A 1 80  ? 2.951   17.209  -13.515 1.00 0.00 ? 80  GLN A HB3  6  
ATOM 9907  H HG2  . GLN A 1 80  ? 1.041   15.379  -14.088 1.00 0.00 ? 80  GLN A HG2  6  
ATOM 9908  H HG3  . GLN A 1 80  ? 0.138   16.819  -14.515 1.00 0.00 ? 80  GLN A HG3  6  
ATOM 9909  H HE21 . GLN A 1 80  ? 0.158   17.026  -16.619 1.00 0.00 ? 80  GLN A HE21 6  
ATOM 9910  H HE22 . GLN A 1 80  ? 1.530   16.917  -17.670 1.00 0.00 ? 80  GLN A HE22 6  
ATOM 9911  N N    . GLN A 1 81  ? -0.567  15.617  -12.082 1.00 0.00 ? 81  GLN A N    6  
ATOM 9912  C CA   . GLN A 1 81  ? -1.995  15.510  -11.835 1.00 0.00 ? 81  GLN A CA   6  
ATOM 9913  C C    . GLN A 1 81  ? -2.257  15.233  -10.353 1.00 0.00 ? 81  GLN A C    6  
ATOM 9914  O O    . GLN A 1 81  ? -3.104  15.878  -9.738  1.00 0.00 ? 81  GLN A O    6  
ATOM 9915  C CB   . GLN A 1 81  ? -2.625  14.429  -12.715 1.00 0.00 ? 81  GLN A CB   6  
ATOM 9916  C CG   . GLN A 1 81  ? -3.303  15.046  -13.940 1.00 0.00 ? 81  GLN A CG   6  
ATOM 9917  C CD   . GLN A 1 81  ? -2.416  14.917  -15.181 1.00 0.00 ? 81  GLN A CD   6  
ATOM 9918  O OE1  . GLN A 1 81  ? -2.035  15.893  -15.807 1.00 0.00 ? 81  GLN A OE1  6  
ATOM 9919  N NE2  . GLN A 1 81  ? -2.110  13.663  -15.499 1.00 0.00 ? 81  GLN A NE2  6  
ATOM 9920  H H    . GLN A 1 81  ? -0.181  14.890  -12.651 1.00 0.00 ? 81  GLN A H    6  
ATOM 9921  H HA   . GLN A 1 81  ? -2.409  16.481  -12.109 1.00 0.00 ? 81  GLN A HA   6  
ATOM 9922  H HB2  . GLN A 1 81  ? -1.858  13.724  -13.036 1.00 0.00 ? 81  GLN A HB2  6  
ATOM 9923  H HB3  . GLN A 1 81  ? -3.356  13.864  -12.137 1.00 0.00 ? 81  GLN A HB3  6  
ATOM 9924  H HG2  . GLN A 1 81  ? -4.258  14.552  -14.119 1.00 0.00 ? 81  GLN A HG2  6  
ATOM 9925  H HG3  . GLN A 1 81  ? -3.518  16.097  -13.750 1.00 0.00 ? 81  GLN A HG3  6  
ATOM 9926  H HE21 . GLN A 1 81  ? -2.456  12.907  -14.942 1.00 0.00 ? 81  GLN A HE21 6  
ATOM 9927  H HE22 . GLN A 1 81  ? -1.534  13.475  -16.295 1.00 0.00 ? 81  GLN A HE22 6  
ATOM 9928  N N    . ALA A 1 82  ? -1.515  14.272  -9.823  1.00 0.00 ? 82  ALA A N    6  
ATOM 9929  C CA   . ALA A 1 82  ? -1.657  13.901  -8.426  1.00 0.00 ? 82  ALA A CA   6  
ATOM 9930  C C    . ALA A 1 82  ? -1.589  15.160  -7.559  1.00 0.00 ? 82  ALA A C    6  
ATOM 9931  O O    . ALA A 1 82  ? -2.562  15.514  -6.895  1.00 0.00 ? 82  ALA A O    6  
ATOM 9932  C CB   . ALA A 1 82  ? -0.578  12.880  -8.056  1.00 0.00 ? 82  ALA A CB   6  
ATOM 9933  H H    . ALA A 1 82  ? -0.828  13.752  -10.331 1.00 0.00 ? 82  ALA A H    6  
ATOM 9934  H HA   . ALA A 1 82  ? -2.635  13.437  -8.303  1.00 0.00 ? 82  ALA A HA   6  
ATOM 9935  H HB1  . ALA A 1 82  ? 0.226   12.919  -8.791  1.00 0.00 ? 82  ALA A HB1  6  
ATOM 9936  H HB2  . ALA A 1 82  ? -0.180  13.114  -7.069  1.00 0.00 ? 82  ALA A HB2  6  
ATOM 9937  H HB3  . ALA A 1 82  ? -1.013  11.881  -8.046  1.00 0.00 ? 82  ALA A HB3  6  
ATOM 9938  N N    . ARG A 1 83  ? -0.431  15.802  -7.593  1.00 0.00 ? 83  ARG A N    6  
ATOM 9939  C CA   . ARG A 1 83  ? -0.224  17.014  -6.819  1.00 0.00 ? 83  ARG A CA   6  
ATOM 9940  C C    . ARG A 1 83  ? -1.473  17.895  -6.869  1.00 0.00 ? 83  ARG A C    6  
ATOM 9941  O O    . ARG A 1 83  ? -1.764  18.621  -5.919  1.00 0.00 ? 83  ARG A O    6  
ATOM 9942  C CB   . ARG A 1 83  ? 0.973   17.808  -7.348  1.00 0.00 ? 83  ARG A CB   6  
ATOM 9943  C CG   . ARG A 1 83  ? 2.292   17.166  -6.912  1.00 0.00 ? 83  ARG A CG   6  
ATOM 9944  C CD   . ARG A 1 83  ? 3.396   18.218  -6.780  1.00 0.00 ? 83  ARG A CD   6  
ATOM 9945  N NE   . ARG A 1 83  ? 3.887   18.263  -5.385  1.00 0.00 ? 83  ARG A NE   6  
ATOM 9946  C CZ   . ARG A 1 83  ? 4.665   17.323  -4.832  1.00 0.00 ? 83  ARG A CZ   6  
ATOM 9947  N NH1  . ARG A 1 83  ? 5.044   16.258  -5.552  1.00 0.00 ? 83  ARG A NH1  6  
ATOM 9948  N NH2  . ARG A 1 83  ? 5.063   17.447  -3.558  1.00 0.00 ? 83  ARG A NH2  6  
ATOM 9949  H H    . ARG A 1 83  ? 0.356   15.507  -8.136  1.00 0.00 ? 83  ARG A H    6  
ATOM 9950  H HA   . ARG A 1 83  ? -0.028  16.667  -5.805  1.00 0.00 ? 83  ARG A HA   6  
ATOM 9951  H HB2  . ARG A 1 83  ? 0.930   17.856  -8.436  1.00 0.00 ? 83  ARG A HB2  6  
ATOM 9952  H HB3  . ARG A 1 83  ? 0.925   18.833  -6.982  1.00 0.00 ? 83  ARG A HB3  6  
ATOM 9953  H HG2  . ARG A 1 83  ? 2.155   16.656  -5.959  1.00 0.00 ? 83  ARG A HG2  6  
ATOM 9954  H HG3  . ARG A 1 83  ? 2.590   16.410  -7.639  1.00 0.00 ? 83  ARG A HG3  6  
ATOM 9955  H HD2  . ARG A 1 83  ? 4.217   17.982  -7.457  1.00 0.00 ? 83  ARG A HD2  6  
ATOM 9956  H HD3  . ARG A 1 83  ? 3.014   19.196  -7.072  1.00 0.00 ? 83  ARG A HD3  6  
ATOM 9957  H HE   . ARG A 1 83  ? 3.623   19.045  -4.820  1.00 0.00 ? 83  ARG A HE   6  
ATOM 9958  H HH11 . ARG A 1 83  ? 4.746   16.165  -6.502  1.00 0.00 ? 83  ARG A HH11 6  
ATOM 9959  H HH12 . ARG A 1 83  ? 5.624   15.556  -5.138  1.00 0.00 ? 83  ARG A HH12 6  
ATOM 9960  H HH21 . ARG A 1 83  ? 4.780   18.241  -3.021  1.00 0.00 ? 83  ARG A HH21 6  
ATOM 9961  H HH22 . ARG A 1 83  ? 5.643   16.745  -3.145  1.00 0.00 ? 83  ARG A HH22 6  
ATOM 9962  N N    . LEU A 1 84  ? -2.179  17.804  -7.986  1.00 0.00 ? 84  LEU A N    6  
ATOM 9963  C CA   . LEU A 1 84  ? -3.391  18.584  -8.172  1.00 0.00 ? 84  LEU A CA   6  
ATOM 9964  C C    . LEU A 1 84  ? -4.569  17.848  -7.531  1.00 0.00 ? 84  LEU A C    6  
ATOM 9965  O O    . LEU A 1 84  ? -5.299  18.421  -6.723  1.00 0.00 ? 84  LEU A O    6  
ATOM 9966  C CB   . LEU A 1 84  ? -3.599  18.906  -9.653  1.00 0.00 ? 84  LEU A CB   6  
ATOM 9967  C CG   . LEU A 1 84  ? -2.681  19.979  -10.241 1.00 0.00 ? 84  LEU A CG   6  
ATOM 9968  C CD1  . LEU A 1 84  ? -2.394  19.705  -11.719 1.00 0.00 ? 84  LEU A CD1  6  
ATOM 9969  C CD2  . LEU A 1 84  ? -3.261  21.378  -10.020 1.00 0.00 ? 84  LEU A CD2  6  
ATOM 9970  H H    . LEU A 1 84  ? -1.936  17.211  -8.754  1.00 0.00 ? 84  LEU A H    6  
ATOM 9971  H HA   . LEU A 1 84  ? -3.252  19.532  -7.652  1.00 0.00 ? 84  LEU A HA   6  
ATOM 9972  H HB2  . LEU A 1 84  ? -3.466  17.988  -10.226 1.00 0.00 ? 84  LEU A HB2  6  
ATOM 9973  H HB3  . LEU A 1 84  ? -4.633  19.223  -9.793  1.00 0.00 ? 84  LEU A HB3  6  
ATOM 9974  H HG   . LEU A 1 84  ? -1.728  19.939  -9.715  1.00 0.00 ? 84  LEU A HG   6  
ATOM 9975  H HD11 . LEU A 1 84  ? -1.760  20.496  -12.119 1.00 0.00 ? 84  LEU A HD11 6  
ATOM 9976  H HD12 . LEU A 1 84  ? -1.886  18.746  -11.818 1.00 0.00 ? 84  LEU A HD12 6  
ATOM 9977  H HD13 . LEU A 1 84  ? -3.333  19.677  -12.272 1.00 0.00 ? 84  LEU A HD13 6  
ATOM 9978  H HD21 . LEU A 1 84  ? -2.495  22.125  -10.227 1.00 0.00 ? 84  LEU A HD21 6  
ATOM 9979  H HD22 . LEU A 1 84  ? -4.108  21.530  -10.689 1.00 0.00 ? 84  LEU A HD22 6  
ATOM 9980  H HD23 . LEU A 1 84  ? -3.592  21.474  -8.986  1.00 0.00 ? 84  LEU A HD23 6  
ATOM 9981  N N    . ILE A 1 85  ? -4.719  16.589  -7.915  1.00 0.00 ? 85  ILE A N    6  
ATOM 9982  C CA   . ILE A 1 85  ? -5.796  15.768  -7.388  1.00 0.00 ? 85  ILE A CA   6  
ATOM 9983  C C    . ILE A 1 85  ? -5.738  15.778  -5.860  1.00 0.00 ? 85  ILE A C    6  
ATOM 9984  O O    . ILE A 1 85  ? -6.720  16.111  -5.199  1.00 0.00 ? 85  ILE A O    6  
ATOM 9985  C CB   . ILE A 1 85  ? -5.749  14.366  -7.997  1.00 0.00 ? 85  ILE A CB   6  
ATOM 9986  C CG1  . ILE A 1 85  ? -5.926  14.421  -9.516  1.00 0.00 ? 85  ILE A CG1  6  
ATOM 9987  C CG2  . ILE A 1 85  ? -6.775  13.445  -7.334  1.00 0.00 ? 85  ILE A CG2  6  
ATOM 9988  C CD1  . ILE A 1 85  ? -5.956  13.014  -10.116 1.00 0.00 ? 85  ILE A CD1  6  
ATOM 9989  H H    . ILE A 1 85  ? -4.122  16.130  -8.573  1.00 0.00 ? 85  ILE A H    6  
ATOM 9990  H HA   . ILE A 1 85  ? -6.736  16.223  -7.701  1.00 0.00 ? 85  ILE A HA   6  
ATOM 9991  H HB   . ILE A 1 85  ? -4.763  13.942  -7.803  1.00 0.00 ? 85  ILE A HB   6  
ATOM 9992  H HG12 . ILE A 1 85  ? -6.851  14.944  -9.759  1.00 0.00 ? 85  ILE A HG12 6  
ATOM 9993  H HG13 . ILE A 1 85  ? -5.111  14.992  -9.960  1.00 0.00 ? 85  ILE A HG13 6  
ATOM 9994  H HG21 . ILE A 1 85  ? -6.453  12.408  -7.437  1.00 0.00 ? 85  ILE A HG21 6  
ATOM 9995  H HG22 . ILE A 1 85  ? -6.858  13.696  -6.276  1.00 0.00 ? 85  ILE A HG22 6  
ATOM 9996  H HG23 . ILE A 1 85  ? -7.744  13.574  -7.815  1.00 0.00 ? 85  ILE A HG23 6  
ATOM 9997  H HD11 . ILE A 1 85  ? -6.475  12.339  -9.435  1.00 0.00 ? 85  ILE A HD11 6  
ATOM 9998  H HD12 . ILE A 1 85  ? -6.479  13.037  -11.072 1.00 0.00 ? 85  ILE A HD12 6  
ATOM 9999  H HD13 . ILE A 1 85  ? -4.936  12.662  -10.269 1.00 0.00 ? 85  ILE A HD13 6  
ATOM 10000 N N    . ILE A 1 86  ? -4.576  15.407  -5.342  1.00 0.00 ? 86  ILE A N    6  
ATOM 10001 C CA   . ILE A 1 86  ? -4.376  15.369  -3.903  1.00 0.00 ? 86  ILE A CA   6  
ATOM 10002 C C    . ILE A 1 86  ? -4.427  16.793  -3.347  1.00 0.00 ? 86  ILE A C    6  
ATOM 10003 O O    . ILE A 1 86  ? -4.935  17.017  -2.249  1.00 0.00 ? 86  ILE A O    6  
ATOM 10004 C CB   . ILE A 1 86  ? -3.085  14.621  -3.561  1.00 0.00 ? 86  ILE A CB   6  
ATOM 10005 C CG1  . ILE A 1 86  ? -1.857  15.480  -3.867  1.00 0.00 ? 86  ILE A CG1  6  
ATOM 10006 C CG2  . ILE A 1 86  ? -3.031  13.268  -4.273  1.00 0.00 ? 86  ILE A CG2  6  
ATOM 10007 C CD1  . ILE A 1 86  ? -0.587  14.627  -3.904  1.00 0.00 ? 86  ILE A CD1  6  
ATOM 10008 H H    . ILE A 1 86  ? -3.781  15.137  -5.886  1.00 0.00 ? 86  ILE A H    6  
ATOM 10009 H HA   . ILE A 1 86  ? -5.201  14.800  -3.474  1.00 0.00 ? 86  ILE A HA   6  
ATOM 10010 H HB   . ILE A 1 86  ? -3.080  14.422  -2.490  1.00 0.00 ? 86  ILE A HB   6  
ATOM 10011 H HG12 . ILE A 1 86  ? -1.989  15.982  -4.826  1.00 0.00 ? 86  ILE A HG12 6  
ATOM 10012 H HG13 . ILE A 1 86  ? -1.755  16.258  -3.111  1.00 0.00 ? 86  ILE A HG13 6  
ATOM 10013 H HG21 . ILE A 1 86  ? -2.676  12.506  -3.578  1.00 0.00 ? 86  ILE A HG21 6  
ATOM 10014 H HG22 . ILE A 1 86  ? -4.028  13.002  -4.625  1.00 0.00 ? 86  ILE A HG22 6  
ATOM 10015 H HG23 . ILE A 1 86  ? -2.350  13.331  -5.122  1.00 0.00 ? 86  ILE A HG23 6  
ATOM 10016 H HD11 . ILE A 1 86  ? 0.193   15.111  -3.316  1.00 0.00 ? 86  ILE A HD11 6  
ATOM 10017 H HD12 . ILE A 1 86  ? -0.798  13.643  -3.486  1.00 0.00 ? 86  ILE A HD12 6  
ATOM 10018 H HD13 . ILE A 1 86  ? -0.251  14.519  -4.935  1.00 0.00 ? 86  ILE A HD13 6  
ATOM 10019 N N    . GLY A 1 87  ? -3.895  17.719  -4.130  1.00 0.00 ? 87  GLY A N    6  
ATOM 10020 C CA   . GLY A 1 87  ? -3.873  19.116  -3.730  1.00 0.00 ? 87  GLY A CA   6  
ATOM 10021 C C    . GLY A 1 87  ? -5.170  19.822  -4.132  1.00 0.00 ? 87  GLY A C    6  
ATOM 10022 O O    . GLY A 1 87  ? -5.142  20.957  -4.606  1.00 0.00 ? 87  GLY A O    6  
ATOM 10023 H H    . GLY A 1 87  ? -3.484  17.529  -5.022  1.00 0.00 ? 87  GLY A H    6  
ATOM 10024 H HA2  . GLY A 1 87  ? -3.736  19.187  -2.651  1.00 0.00 ? 87  GLY A HA2  6  
ATOM 10025 H HA3  . GLY A 1 87  ? -3.023  19.618  -4.192  1.00 0.00 ? 87  GLY A HA3  6  
ATOM 10026 N N    . GLN A 1 88  ? -6.275  19.120  -3.929  1.00 0.00 ? 88  GLN A N    6  
ATOM 10027 C CA   . GLN A 1 88  ? -7.580  19.665  -4.265  1.00 0.00 ? 88  GLN A CA   6  
ATOM 10028 C C    . GLN A 1 88  ? -8.217  20.314  -3.035  1.00 0.00 ? 88  GLN A C    6  
ATOM 10029 O O    . GLN A 1 88  ? -7.582  20.422  -1.987  1.00 0.00 ? 88  GLN A O    6  
ATOM 10030 C CB   . GLN A 1 88  ? -8.492  18.585  -4.849  1.00 0.00 ? 88  GLN A CB   6  
ATOM 10031 C CG   . GLN A 1 88  ? -8.286  18.452  -6.360  1.00 0.00 ? 88  GLN A CG   6  
ATOM 10032 C CD   . GLN A 1 88  ? -9.619  18.227  -7.077  1.00 0.00 ? 88  GLN A CD   6  
ATOM 10033 O OE1  . GLN A 1 88  ? -10.688 18.312  -6.495  1.00 0.00 ? 88  GLN A OE1  6  
ATOM 10034 N NE2  . GLN A 1 88  ? -9.496  17.935  -8.369  1.00 0.00 ? 88  GLN A NE2  6  
ATOM 10035 H H    . GLN A 1 88  ? -6.289  18.198  -3.544  1.00 0.00 ? 88  GLN A H    6  
ATOM 10036 H HA   . GLN A 1 88  ? -7.390  20.422  -5.026  1.00 0.00 ? 88  GLN A HA   6  
ATOM 10037 H HB2  . GLN A 1 88  ? -8.286  17.630  -4.365  1.00 0.00 ? 88  GLN A HB2  6  
ATOM 10038 H HB3  . GLN A 1 88  ? -9.533  18.830  -4.641  1.00 0.00 ? 88  GLN A HB3  6  
ATOM 10039 H HG2  . GLN A 1 88  ? -7.809  19.352  -6.746  1.00 0.00 ? 88  GLN A HG2  6  
ATOM 10040 H HG3  . GLN A 1 88  ? -7.613  17.620  -6.567  1.00 0.00 ? 88  GLN A HG3  6  
ATOM 10041 H HE21 . GLN A 1 88  ? -8.588  17.881  -8.785  1.00 0.00 ? 88  GLN A HE21 6  
ATOM 10042 H HE22 . GLN A 1 88  ? -10.311 17.771  -8.924  1.00 0.00 ? 88  GLN A HE22 6  
ATOM 10043 N N    . GLN A 1 89  ? -9.464  20.729  -3.203  1.00 0.00 ? 89  GLN A N    6  
ATOM 10044 C CA   . GLN A 1 89  ? -10.194 21.364  -2.119  1.00 0.00 ? 89  GLN A CA   6  
ATOM 10045 C C    . GLN A 1 89  ? -11.357 20.477  -1.671  1.00 0.00 ? 89  GLN A C    6  
ATOM 10046 O O    . GLN A 1 89  ? -11.988 19.813  -2.492  1.00 0.00 ? 89  GLN A O    6  
ATOM 10047 C CB   . GLN A 1 89  ? -10.689 22.752  -2.530  1.00 0.00 ? 89  GLN A CB   6  
ATOM 10048 C CG   . GLN A 1 89  ? -11.052 22.786  -4.016  1.00 0.00 ? 89  GLN A CG   6  
ATOM 10049 C CD   . GLN A 1 89  ? -9.802  22.945  -4.883  1.00 0.00 ? 89  GLN A CD   6  
ATOM 10050 O OE1  . GLN A 1 89  ? -8.951  23.785  -4.642  1.00 0.00 ? 89  GLN A OE1  6  
ATOM 10051 N NE2  . GLN A 1 89  ? -9.739  22.094  -5.903  1.00 0.00 ? 89  GLN A NE2  6  
ATOM 10052 H H    . GLN A 1 89  ? -9.973  20.637  -4.058  1.00 0.00 ? 89  GLN A H    6  
ATOM 10053 H HA   . GLN A 1 89  ? -9.474  21.468  -1.307  1.00 0.00 ? 89  GLN A HA   6  
ATOM 10054 H HB2  . GLN A 1 89  ? -11.560 23.023  -1.933  1.00 0.00 ? 89  GLN A HB2  6  
ATOM 10055 H HB3  . GLN A 1 89  ? -9.917  23.493  -2.324  1.00 0.00 ? 89  GLN A HB3  6  
ATOM 10056 H HG2  . GLN A 1 89  ? -11.573 21.868  -4.288  1.00 0.00 ? 89  GLN A HG2  6  
ATOM 10057 H HG3  . GLN A 1 89  ? -11.739 23.610  -4.207  1.00 0.00 ? 89  GLN A HG3  6  
ATOM 10058 H HE21 . GLN A 1 89  ? -10.471 21.428  -6.045  1.00 0.00 ? 89  GLN A HE21 6  
ATOM 10059 H HE22 . GLN A 1 89  ? -8.958  22.119  -6.528  1.00 0.00 ? 89  GLN A HE22 6  
ATOM 10060 N N    . CYS A 1 90  ? -11.606 20.494  -0.370  1.00 0.00 ? 90  CYS A N    6  
ATOM 10061 C CA   . CYS A 1 90  ? -12.683 19.700  0.197   1.00 0.00 ? 90  CYS A CA   6  
ATOM 10062 C C    . CYS A 1 90  ? -12.438 19.562  1.701   1.00 0.00 ? 90  CYS A C    6  
ATOM 10063 O O    . CYS A 1 90  ? -11.399 19.054  2.120   1.00 0.00 ? 90  CYS A O    6  
ATOM 10064 C CB   . CYS A 1 90  ? -12.802 18.337  -0.490  1.00 0.00 ? 90  CYS A CB   6  
ATOM 10065 S SG   . CYS A 1 90  ? -14.222 18.340  -1.644  1.00 0.00 ? 90  CYS A SG   6  
ATOM 10066 H H    . CYS A 1 90  ? -11.089 21.037  0.291   1.00 0.00 ? 90  CYS A H    6  
ATOM 10067 H HA   . CYS A 1 90  ? -13.608 20.243  0.003   1.00 0.00 ? 90  CYS A HA   6  
ATOM 10068 H HB2  . CYS A 1 90  ? -11.883 18.112  -1.031  1.00 0.00 ? 90  CYS A HB2  6  
ATOM 10069 H HB3  . CYS A 1 90  ? -12.932 17.555  0.258   1.00 0.00 ? 90  CYS A HB3  6  
ATOM 10070 H HG   . CYS A 1 90  ? -14.949 17.453  -0.973  1.00 0.00 ? 90  CYS A HG   6  
ATOM 10071 N N    . ASP A 1 91  ? -13.412 20.023  2.471   1.00 0.00 ? 91  ASP A N    6  
ATOM 10072 C CA   . ASP A 1 91  ? -13.316 19.957  3.919   1.00 0.00 ? 91  ASP A CA   6  
ATOM 10073 C C    . ASP A 1 91  ? -12.915 18.540  4.336   1.00 0.00 ? 91  ASP A C    6  
ATOM 10074 O O    . ASP A 1 91  ? -11.981 18.359  5.115   1.00 0.00 ? 91  ASP A O    6  
ATOM 10075 C CB   . ASP A 1 91  ? -14.659 20.281  4.576   1.00 0.00 ? 91  ASP A CB   6  
ATOM 10076 C CG   . ASP A 1 91  ? -14.928 21.771  4.796   1.00 0.00 ? 91  ASP A CG   6  
ATOM 10077 O OD1  . ASP A 1 91  ? -14.010 22.564  4.495   1.00 0.00 ? 91  ASP A OD1  6  
ATOM 10078 O OD2  . ASP A 1 91  ? -16.046 22.083  5.261   1.00 0.00 ? 91  ASP A OD2  6  
ATOM 10079 H H    . ASP A 1 91  ? -14.254 20.434  2.122   1.00 0.00 ? 91  ASP A H    6  
ATOM 10080 H HA   . ASP A 1 91  ? -12.565 20.699  4.190   1.00 0.00 ? 91  ASP A HA   6  
ATOM 10081 H HB2  . ASP A 1 91  ? -15.457 19.870  3.958   1.00 0.00 ? 91  ASP A HB2  6  
ATOM 10082 H HB3  . ASP A 1 91  ? -14.707 19.773  5.539   1.00 0.00 ? 91  ASP A HB3  6  
ATOM 10083 N N    . THR A 1 92  ? -13.642 17.572  3.798   1.00 0.00 ? 92  THR A N    6  
ATOM 10084 C CA   . THR A 1 92  ? -13.375 16.177  4.104   1.00 0.00 ? 92  THR A CA   6  
ATOM 10085 C C    . THR A 1 92  ? -13.254 15.362  2.815   1.00 0.00 ? 92  THR A C    6  
ATOM 10086 O O    . THR A 1 92  ? -14.175 15.342  1.999   1.00 0.00 ? 92  THR A O    6  
ATOM 10087 C CB   . THR A 1 92  ? -14.480 15.677  5.037   1.00 0.00 ? 92  THR A CB   6  
ATOM 10088 O OG1  . THR A 1 92  ? -14.406 16.550  6.161   1.00 0.00 ? 92  THR A OG1  6  
ATOM 10089 C CG2  . THR A 1 92  ? -14.175 14.295  5.618   1.00 0.00 ? 92  THR A CG2  6  
ATOM 10090 H H    . THR A 1 92  ? -14.401 17.728  3.165   1.00 0.00 ? 92  THR A H    6  
ATOM 10091 H HA   . THR A 1 92  ? -12.413 16.115  4.613   1.00 0.00 ? 92  THR A HA   6  
ATOM 10092 H HB   . THR A 1 92  ? -15.447 15.684  4.533   1.00 0.00 ? 92  THR A HB   6  
ATOM 10093 H HG1  . THR A 1 92  ? -14.780 17.447  5.923   1.00 0.00 ? 92  THR A HG1  6  
ATOM 10094 H HG21 . THR A 1 92  ? -14.452 14.275  6.672   1.00 0.00 ? 92  THR A HG21 6  
ATOM 10095 H HG22 . THR A 1 92  ? -14.746 13.540  5.078   1.00 0.00 ? 92  THR A HG22 6  
ATOM 10096 H HG23 . THR A 1 92  ? -13.110 14.086  5.518   1.00 0.00 ? 92  THR A HG23 6  
ATOM 10097 N N    . ILE A 1 93  ? -12.110 14.709  2.670   1.00 0.00 ? 93  ILE A N    6  
ATOM 10098 C CA   . ILE A 1 93  ? -11.856 13.895  1.494   1.00 0.00 ? 93  ILE A CA   6  
ATOM 10099 C C    . ILE A 1 93  ? -11.310 12.534  1.930   1.00 0.00 ? 93  ILE A C    6  
ATOM 10100 O O    . ILE A 1 93  ? -10.560 12.444  2.901   1.00 0.00 ? 93  ILE A O    6  
ATOM 10101 C CB   . ILE A 1 93  ? -10.946 14.638  0.514   1.00 0.00 ? 93  ILE A CB   6  
ATOM 10102 C CG1  . ILE A 1 93  ? -10.171 13.655  -0.366  1.00 0.00 ? 93  ILE A CG1  6  
ATOM 10103 C CG2  . ILE A 1 93  ? -10.016 15.602  1.253   1.00 0.00 ? 93  ILE A CG2  6  
ATOM 10104 C CD1  . ILE A 1 93  ? -8.830  13.286  0.272   1.00 0.00 ? 93  ILE A CD1  6  
ATOM 10105 H H    . ILE A 1 93  ? -11.366 14.731  3.338   1.00 0.00 ? 93  ILE A H    6  
ATOM 10106 H HA   . ILE A 1 93  ? -12.811 13.739  0.992   1.00 0.00 ? 93  ILE A HA   6  
ATOM 10107 H HB   . ILE A 1 93  ? -11.572 15.237  -0.146  1.00 0.00 ? 93  ILE A HB   6  
ATOM 10108 H HG12 . ILE A 1 93  ? -10.764 12.754  -0.521  1.00 0.00 ? 93  ILE A HG12 6  
ATOM 10109 H HG13 . ILE A 1 93  ? -10.000 14.098  -1.348  1.00 0.00 ? 93  ILE A HG13 6  
ATOM 10110 H HG21 . ILE A 1 93  ? -10.602 16.416  1.680   1.00 0.00 ? 93  ILE A HG21 6  
ATOM 10111 H HG22 . ILE A 1 93  ? -9.499  15.069  2.051   1.00 0.00 ? 93  ILE A HG22 6  
ATOM 10112 H HG23 . ILE A 1 93  ? -9.284  16.008  0.554   1.00 0.00 ? 93  ILE A HG23 6  
ATOM 10113 H HD11 . ILE A 1 93  ? -9.004  12.859  1.260   1.00 0.00 ? 93  ILE A HD11 6  
ATOM 10114 H HD12 . ILE A 1 93  ? -8.317  12.557  -0.354  1.00 0.00 ? 93  ILE A HD12 6  
ATOM 10115 H HD13 . ILE A 1 93  ? -8.214  14.181  0.367   1.00 0.00 ? 93  ILE A HD13 6  
ATOM 10116 N N    . THR A 1 94  ? -11.707 11.508  1.191   1.00 0.00 ? 94  THR A N    6  
ATOM 10117 C CA   . THR A 1 94  ? -11.266 10.156  1.489   1.00 0.00 ? 94  THR A CA   6  
ATOM 10118 C C    . THR A 1 94  ? -10.184 9.718   0.500   1.00 0.00 ? 94  THR A C    6  
ATOM 10119 O O    . THR A 1 94  ? -10.102 10.243  -0.609  1.00 0.00 ? 94  THR A O    6  
ATOM 10120 C CB   . THR A 1 94  ? -12.497 9.247   1.486   1.00 0.00 ? 94  THR A CB   6  
ATOM 10121 O OG1  . THR A 1 94  ? -13.367 9.837   2.448   1.00 0.00 ? 94  THR A OG1  6  
ATOM 10122 C CG2  . THR A 1 94  ? -12.200 7.858   2.054   1.00 0.00 ? 94  THR A CG2  6  
ATOM 10123 H H    . THR A 1 94  ? -12.317 11.590  0.403   1.00 0.00 ? 94  THR A H    6  
ATOM 10124 H HA   . THR A 1 94  ? -10.814 10.153  2.480   1.00 0.00 ? 94  THR A HA   6  
ATOM 10125 H HB   . THR A 1 94  ? -12.925 9.175   0.486   1.00 0.00 ? 94  THR A HB   6  
ATOM 10126 H HG1  . THR A 1 94  ? -14.298 9.878   2.087   1.00 0.00 ? 94  THR A HG1  6  
ATOM 10127 H HG21 . THR A 1 94  ? -13.122 7.414   2.430   1.00 0.00 ? 94  THR A HG21 6  
ATOM 10128 H HG22 . THR A 1 94  ? -11.785 7.225   1.270   1.00 0.00 ? 94  THR A HG22 6  
ATOM 10129 H HG23 . THR A 1 94  ? -11.481 7.945   2.869   1.00 0.00 ? 94  THR A HG23 6  
ATOM 10130 N N    . ILE A 1 95  ? -9.381  8.759   0.937   1.00 0.00 ? 95  ILE A N    6  
ATOM 10131 C CA   . ILE A 1 95  ? -8.308  8.244   0.104   1.00 0.00 ? 95  ILE A CA   6  
ATOM 10132 C C    . ILE A 1 95  ? -8.340  6.714   0.127   1.00 0.00 ? 95  ILE A C    6  
ATOM 10133 O O    . ILE A 1 95  ? -8.595  6.110   1.168   1.00 0.00 ? 95  ILE A O    6  
ATOM 10134 C CB   . ILE A 1 95  ? -6.965  8.837   0.534   1.00 0.00 ? 95  ILE A CB   6  
ATOM 10135 C CG1  . ILE A 1 95  ? -6.892  10.329  0.201   1.00 0.00 ? 95  ILE A CG1  6  
ATOM 10136 C CG2  . ILE A 1 95  ? -5.800  8.056   -0.077  1.00 0.00 ? 95  ILE A CG2  6  
ATOM 10137 C CD1  . ILE A 1 95  ? -5.701  10.989  0.898   1.00 0.00 ? 95  ILE A CD1  6  
ATOM 10138 H H    . ILE A 1 95  ? -9.455  8.337   1.841   1.00 0.00 ? 95  ILE A H    6  
ATOM 10139 H HA   . ILE A 1 95  ? -8.496  8.578   -0.916  1.00 0.00 ? 95  ILE A HA   6  
ATOM 10140 H HB   . ILE A 1 95  ? -6.881  8.745   1.617   1.00 0.00 ? 95  ILE A HB   6  
ATOM 10141 H HG12 . ILE A 1 95  ? -6.805  10.460  -0.878  1.00 0.00 ? 95  ILE A HG12 6  
ATOM 10142 H HG13 . ILE A 1 95  ? -7.816  10.819  0.508   1.00 0.00 ? 95  ILE A HG13 6  
ATOM 10143 H HG21 . ILE A 1 95  ? -4.942  8.718   -0.198  1.00 0.00 ? 95  ILE A HG21 6  
ATOM 10144 H HG22 . ILE A 1 95  ? -5.531  7.230   0.581   1.00 0.00 ? 95  ILE A HG22 6  
ATOM 10145 H HG23 . ILE A 1 95  ? -6.096  7.663   -1.050  1.00 0.00 ? 95  ILE A HG23 6  
ATOM 10146 H HD11 . ILE A 1 95  ? -4.832  10.956  0.242   1.00 0.00 ? 95  ILE A HD11 6  
ATOM 10147 H HD12 . ILE A 1 95  ? -5.944  12.027  1.127   1.00 0.00 ? 95  ILE A HD12 6  
ATOM 10148 H HD13 . ILE A 1 95  ? -5.480  10.455  1.822   1.00 0.00 ? 95  ILE A HD13 6  
ATOM 10149 N N    . LEU A 1 96  ? -8.077  6.132   -1.034  1.00 0.00 ? 96  LEU A N    6  
ATOM 10150 C CA   . LEU A 1 96  ? -8.073  4.684   -1.160  1.00 0.00 ? 96  LEU A CA   6  
ATOM 10151 C C    . LEU A 1 96  ? -6.636  4.199   -1.365  1.00 0.00 ? 96  LEU A C    6  
ATOM 10152 O O    . LEU A 1 96  ? -6.165  4.103   -2.497  1.00 0.00 ? 96  LEU A O    6  
ATOM 10153 C CB   . LEU A 1 96  ? -9.035  4.240   -2.264  1.00 0.00 ? 96  LEU A CB   6  
ATOM 10154 C CG   . LEU A 1 96  ? -9.130  2.732   -2.504  1.00 0.00 ? 96  LEU A CG   6  
ATOM 10155 C CD1  . LEU A 1 96  ? -9.726  2.019   -1.289  1.00 0.00 ? 96  LEU A CD1  6  
ATOM 10156 C CD2  . LEU A 1 96  ? -9.908  2.429   -3.786  1.00 0.00 ? 96  LEU A CD2  6  
ATOM 10157 H H    . LEU A 1 96  ? -7.871  6.630   -1.876  1.00 0.00 ? 96  LEU A H    6  
ATOM 10158 H HA   . LEU A 1 96  ? -8.446  4.273   -0.222  1.00 0.00 ? 96  LEU A HA   6  
ATOM 10159 H HB2  . LEU A 1 96  ? -10.031 4.612   -2.022  1.00 0.00 ? 96  LEU A HB2  6  
ATOM 10160 H HB3  . LEU A 1 96  ? -8.734  4.718   -3.196  1.00 0.00 ? 96  LEU A HB3  6  
ATOM 10161 H HG   . LEU A 1 96  ? -8.120  2.344   -2.641  1.00 0.00 ? 96  LEU A HG   6  
ATOM 10162 H HD11 . LEU A 1 96  ? -10.443 1.269   -1.624  1.00 0.00 ? 96  LEU A HD11 6  
ATOM 10163 H HD12 . LEU A 1 96  ? -8.930  1.534   -0.725  1.00 0.00 ? 96  LEU A HD12 6  
ATOM 10164 H HD13 . LEU A 1 96  ? -10.231 2.746   -0.653  1.00 0.00 ? 96  LEU A HD13 6  
ATOM 10165 H HD21 . LEU A 1 96  ? -9.723  1.398   -4.089  1.00 0.00 ? 96  LEU A HD21 6  
ATOM 10166 H HD22 . LEU A 1 96  ? -10.974 2.569   -3.606  1.00 0.00 ? 96  LEU A HD22 6  
ATOM 10167 H HD23 . LEU A 1 96  ? -9.582  3.104   -4.578  1.00 0.00 ? 96  LEU A HD23 6  
ATOM 10168 N N    . ALA A 1 97  ? -5.981  3.905   -0.252  1.00 0.00 ? 97  ALA A N    6  
ATOM 10169 C CA   . ALA A 1 97  ? -4.608  3.432   -0.295  1.00 0.00 ? 97  ALA A CA   6  
ATOM 10170 C C    . ALA A 1 97  ? -4.597  1.903   -0.227  1.00 0.00 ? 97  ALA A C    6  
ATOM 10171 O O    . ALA A 1 97  ? -5.584  1.289   0.175   1.00 0.00 ? 97  ALA A O    6  
ATOM 10172 C CB   . ALA A 1 97  ? -3.811  4.071   0.845   1.00 0.00 ? 97  ALA A CB   6  
ATOM 10173 H H    . ALA A 1 97  ? -6.372  3.985   0.665   1.00 0.00 ? 97  ALA A H    6  
ATOM 10174 H HA   . ALA A 1 97  ? -4.177  3.748   -1.245  1.00 0.00 ? 97  ALA A HA   6  
ATOM 10175 H HB1  . ALA A 1 97  ? -4.331  3.906   1.788   1.00 0.00 ? 97  ALA A HB1  6  
ATOM 10176 H HB2  . ALA A 1 97  ? -2.820  3.621   0.892   1.00 0.00 ? 97  ALA A HB2  6  
ATOM 10177 H HB3  . ALA A 1 97  ? -3.716  5.142   0.665   1.00 0.00 ? 97  ALA A HB3  6  
ATOM 10178 N N    . GLN A 1 98  ? -3.470  1.333   -0.626  1.00 0.00 ? 98  GLN A N    6  
ATOM 10179 C CA   . GLN A 1 98  ? -3.318  -0.112  -0.616  1.00 0.00 ? 98  GLN A CA   6  
ATOM 10180 C C    . GLN A 1 98  ? -1.835  -0.490  -0.617  1.00 0.00 ? 98  GLN A C    6  
ATOM 10181 O O    . GLN A 1 98  ? -1.298  -0.910  -1.640  1.00 0.00 ? 98  GLN A O    6  
ATOM 10182 C CB   . GLN A 1 98  ? -4.046  -0.748  -1.802  1.00 0.00 ? 98  GLN A CB   6  
ATOM 10183 C CG   . GLN A 1 98  ? -4.273  -2.243  -1.568  1.00 0.00 ? 98  GLN A CG   6  
ATOM 10184 C CD   . GLN A 1 98  ? -4.522  -2.974  -2.889  1.00 0.00 ? 98  GLN A CD   6  
ATOM 10185 O OE1  . GLN A 1 98  ? -4.103  -2.547  -3.952  1.00 0.00 ? 98  GLN A OE1  6  
ATOM 10186 N NE2  . GLN A 1 98  ? -5.226  -4.095  -2.763  1.00 0.00 ? 98  GLN A NE2  6  
ATOM 10187 H H    . GLN A 1 98  ? -2.672  1.839   -0.952  1.00 0.00 ? 98  GLN A H    6  
ATOM 10188 H HA   . GLN A 1 98  ? -3.785  -0.446  0.310   1.00 0.00 ? 98  GLN A HA   6  
ATOM 10189 H HB2  . GLN A 1 98  ? -5.004  -0.251  -1.955  1.00 0.00 ? 98  GLN A HB2  6  
ATOM 10190 H HB3  . GLN A 1 98  ? -3.463  -0.604  -2.711  1.00 0.00 ? 98  GLN A HB3  6  
ATOM 10191 H HG2  . GLN A 1 98  ? -3.405  -2.673  -1.068  1.00 0.00 ? 98  GLN A HG2  6  
ATOM 10192 H HG3  . GLN A 1 98  ? -5.126  -2.385  -0.903  1.00 0.00 ? 98  GLN A HG3  6  
ATOM 10193 H HE21 . GLN A 1 98  ? -5.541  -4.389  -1.860  1.00 0.00 ? 98  GLN A HE21 6  
ATOM 10194 H HE22 . GLN A 1 98  ? -5.441  -4.644  -3.570  1.00 0.00 ? 98  GLN A HE22 6  
ATOM 10195 N N    . TYR A 1 99  ? -1.215  -0.326  0.543   1.00 0.00 ? 99  TYR A N    6  
ATOM 10196 C CA   . TYR A 1 99  ? 0.195   -0.645  0.689   1.00 0.00 ? 99  TYR A CA   6  
ATOM 10197 C C    . TYR A 1 99  ? 0.560   -1.896  -0.113  1.00 0.00 ? 99  TYR A C    6  
ATOM 10198 O O    . TYR A 1 99  ? -0.270  -2.784  -0.298  1.00 0.00 ? 99  TYR A O    6  
ATOM 10199 C CB   . TYR A 1 99  ? 0.411   -0.927  2.177   1.00 0.00 ? 99  TYR A CB   6  
ATOM 10200 C CG   . TYR A 1 99  ? 1.863   -1.236  2.547   1.00 0.00 ? 99  TYR A CG   6  
ATOM 10201 C CD1  . TYR A 1 99  ? 2.404   -2.470  2.246   1.00 0.00 ? 99  TYR A CD1  6  
ATOM 10202 C CD2  . TYR A 1 99  ? 2.632   -0.282  3.182   1.00 0.00 ? 99  TYR A CD2  6  
ATOM 10203 C CE1  . TYR A 1 99  ? 3.771   -2.761  2.594   1.00 0.00 ? 99  TYR A CE1  6  
ATOM 10204 C CE2  . TYR A 1 99  ? 3.998   -0.574  3.530   1.00 0.00 ? 99  TYR A CE2  6  
ATOM 10205 C CZ   . TYR A 1 99  ? 4.500   -1.798  3.219   1.00 0.00 ? 99  TYR A CZ   6  
ATOM 10206 O OH   . TYR A 1 99  ? 5.791   -2.074  3.548   1.00 0.00 ? 99  TYR A OH   6  
ATOM 10207 H H    . TYR A 1 99  ? -1.659  0.016   1.371   1.00 0.00 ? 99  TYR A H    6  
ATOM 10208 H HA   . TYR A 1 99  ? 0.771   0.200   0.313   1.00 0.00 ? 99  TYR A HA   6  
ATOM 10209 H HB2  . TYR A 1 99  ? 0.077   -0.063  2.753   1.00 0.00 ? 99  TYR A HB2  6  
ATOM 10210 H HB3  . TYR A 1 99  ? -0.215  -1.768  2.472   1.00 0.00 ? 99  TYR A HB3  6  
ATOM 10211 H HD1  . TYR A 1 99  ? 1.797   -3.223  1.744   1.00 0.00 ? 99  TYR A HD1  6  
ATOM 10212 H HD2  . TYR A 1 99  ? 2.205   0.692   3.420   1.00 0.00 ? 99  TYR A HD2  6  
ATOM 10213 H HE1  . TYR A 1 99  ? 4.210   -3.731  2.362   1.00 0.00 ? 99  TYR A HE1  6  
ATOM 10214 H HE2  . TYR A 1 99  ? 4.617   0.171   4.032   1.00 0.00 ? 99  TYR A HE2  6  
ATOM 10215 H HH   . TYR A 1 99  ? 6.013   -3.017  3.303   1.00 0.00 ? 99  TYR A HH   6  
ATOM 10216 N N    . ASN A 1 100 ? 1.804   -1.925  -0.568  1.00 0.00 ? 100 ASN A N    6  
ATOM 10217 C CA   . ASN A 1 100 ? 2.290   -3.052  -1.346  1.00 0.00 ? 100 ASN A CA   6  
ATOM 10218 C C    . ASN A 1 100 ? 3.769   -3.284  -1.031  1.00 0.00 ? 100 ASN A C    6  
ATOM 10219 O O    . ASN A 1 100 ? 4.604   -2.414  -1.275  1.00 0.00 ? 100 ASN A O    6  
ATOM 10220 C CB   . ASN A 1 100 ? 2.163   -2.781  -2.846  1.00 0.00 ? 100 ASN A CB   6  
ATOM 10221 C CG   . ASN A 1 100 ? 0.768   -3.148  -3.354  1.00 0.00 ? 100 ASN A CG   6  
ATOM 10222 O OD1  . ASN A 1 100 ? -0.055  -3.698  -2.641  1.00 0.00 ? 100 ASN A OD1  6  
ATOM 10223 N ND2  . ASN A 1 100 ? 0.548   -2.814  -4.623  1.00 0.00 ? 100 ASN A ND2  6  
ATOM 10224 H H    . ASN A 1 100 ? 2.474   -1.198  -0.413  1.00 0.00 ? 100 ASN A H    6  
ATOM 10225 H HA   . ASN A 1 100 ? 1.664   -3.894  -1.052  1.00 0.00 ? 100 ASN A HA   6  
ATOM 10226 H HB2  . ASN A 1 100 ? 2.362   -1.728  -3.048  1.00 0.00 ? 100 ASN A HB2  6  
ATOM 10227 H HB3  . ASN A 1 100 ? 2.914   -3.356  -3.388  1.00 0.00 ? 100 ASN A HB3  6  
ATOM 10228 H HD21 . ASN A 1 100 ? 1.267   -2.364  -5.153  1.00 0.00 ? 100 ASN A HD21 6  
ATOM 10229 H HD22 . ASN A 1 100 ? -0.336  -3.013  -5.046  1.00 0.00 ? 100 ASN A HD22 6  
ATOM 10230 N N    . PRO A 1 101 ? 4.056   -4.493  -0.479  1.00 0.00 ? 101 PRO A N    6  
ATOM 10231 C CA   . PRO A 1 101 ? 5.420   -4.850  -0.127  1.00 0.00 ? 101 PRO A CA   6  
ATOM 10232 C C    . PRO A 1 101 ? 6.237   -5.188  -1.376  1.00 0.00 ? 101 PRO A C    6  
ATOM 10233 O O    . PRO A 1 101 ? 6.829   -6.263  -1.463  1.00 0.00 ? 101 PRO A O    6  
ATOM 10234 C CB   . PRO A 1 101 ? 5.285   -6.024  0.829   1.00 0.00 ? 101 PRO A CB   6  
ATOM 10235 C CG   . PRO A 1 101 ? 3.885   -6.576  0.617   1.00 0.00 ? 101 PRO A CG   6  
ATOM 10236 C CD   . PRO A 1 101 ? 3.094   -5.548  -0.175  1.00 0.00 ? 101 PRO A CD   6  
ATOM 10237 H HA   . PRO A 1 101 ? 5.883   -4.074  0.301   1.00 0.00 ? 101 PRO A HA   6  
ATOM 10238 H HB2  . PRO A 1 101 ? 6.040   -6.783  0.625   1.00 0.00 ? 101 PRO A HB2  6  
ATOM 10239 H HB3  . PRO A 1 101 ? 5.427   -5.704  1.862   1.00 0.00 ? 101 PRO A HB3  6  
ATOM 10240 H HG2  . PRO A 1 101 ? 3.926   -7.523  0.080   1.00 0.00 ? 101 PRO A HG2  6  
ATOM 10241 H HG3  . PRO A 1 101 ? 3.403   -6.773  1.575   1.00 0.00 ? 101 PRO A HG3  6  
ATOM 10242 H HD2  . PRO A 1 101 ? 2.681   -5.982  -1.086  1.00 0.00 ? 101 PRO A HD2  6  
ATOM 10243 H HD3  . PRO A 1 101 ? 2.254   -5.163  0.403   1.00 0.00 ? 101 PRO A HD3  6  
ATOM 10244 N N    . HIS A 1 102 ? 6.244   -4.250  -2.311  1.00 0.00 ? 102 HIS A N    6  
ATOM 10245 C CA   . HIS A 1 102 ? 6.979   -4.434  -3.551  1.00 0.00 ? 102 HIS A CA   6  
ATOM 10246 C C    . HIS A 1 102 ? 7.344   -3.070  -4.139  1.00 0.00 ? 102 HIS A C    6  
ATOM 10247 O O    . HIS A 1 102 ? 7.151   -2.831  -5.330  1.00 0.00 ? 102 HIS A O    6  
ATOM 10248 C CB   . HIS A 1 102 ? 6.187   -5.307  -4.527  1.00 0.00 ? 102 HIS A CB   6  
ATOM 10249 C CG   . HIS A 1 102 ? 6.992   -5.791  -5.710  1.00 0.00 ? 102 HIS A CG   6  
ATOM 10250 N ND1  . HIS A 1 102 ? 6.412   -6.149  -6.915  1.00 0.00 ? 102 HIS A ND1  6  
ATOM 10251 C CD2  . HIS A 1 102 ? 8.336   -5.970  -5.860  1.00 0.00 ? 102 HIS A CD2  6  
ATOM 10252 C CE1  . HIS A 1 102 ? 7.373   -6.527  -7.745  1.00 0.00 ? 102 HIS A CE1  6  
ATOM 10253 N NE2  . HIS A 1 102 ? 8.565   -6.416  -7.090  1.00 0.00 ? 102 HIS A NE2  6  
ATOM 10254 H H    . HIS A 1 102 ? 5.760   -3.378  -2.233  1.00 0.00 ? 102 HIS A H    6  
ATOM 10255 H HA   . HIS A 1 102 ? 7.894   -4.967  -3.296  1.00 0.00 ? 102 HIS A HA   6  
ATOM 10256 H HB2  . HIS A 1 102 ? 5.795   -6.171  -3.990  1.00 0.00 ? 102 HIS A HB2  6  
ATOM 10257 H HB3  . HIS A 1 102 ? 5.329   -4.742  -4.891  1.00 0.00 ? 102 HIS A HB3  6  
ATOM 10258 H HD1  . HIS A 1 102 ? 5.435   -6.127  -7.123  1.00 0.00 ? 102 HIS A HD1  6  
ATOM 10259 H HD2  . HIS A 1 102 ? 9.093   -5.780  -5.100  1.00 0.00 ? 102 HIS A HD2  6  
ATOM 10260 H HE1  . HIS A 1 102 ? 7.236   -6.866  -8.772  1.00 0.00 ? 102 HIS A HE1  6  
ATOM 10261 N N    . VAL A 1 103 ? 7.866   -2.210  -3.276  1.00 0.00 ? 103 VAL A N    6  
ATOM 10262 C CA   . VAL A 1 103 ? 8.261   -0.876  -3.695  1.00 0.00 ? 103 VAL A CA   6  
ATOM 10263 C C    . VAL A 1 103 ? 9.573   -0.497  -3.005  1.00 0.00 ? 103 VAL A C    6  
ATOM 10264 O O    . VAL A 1 103 ? 9.808   -0.877  -1.859  1.00 0.00 ? 103 VAL A O    6  
ATOM 10265 C CB   . VAL A 1 103 ? 7.130   0.116   -3.415  1.00 0.00 ? 103 VAL A CB   6  
ATOM 10266 C CG1  . VAL A 1 103 ? 7.598   1.556   -3.631  1.00 0.00 ? 103 VAL A CG1  6  
ATOM 10267 C CG2  . VAL A 1 103 ? 5.902   -0.196  -4.273  1.00 0.00 ? 103 VAL A CG2  6  
ATOM 10268 H H    . VAL A 1 103 ? 8.020   -2.412  -2.309  1.00 0.00 ? 103 VAL A H    6  
ATOM 10269 H HA   . VAL A 1 103 ? 8.426   -0.905  -4.772  1.00 0.00 ? 103 VAL A HA   6  
ATOM 10270 H HB   . VAL A 1 103 ? 6.843   0.011   -2.369  1.00 0.00 ? 103 VAL A HB   6  
ATOM 10271 H HG11 . VAL A 1 103 ? 7.753   2.037   -2.665  1.00 0.00 ? 103 VAL A HG11 6  
ATOM 10272 H HG12 . VAL A 1 103 ? 8.534   1.554   -4.190  1.00 0.00 ? 103 VAL A HG12 6  
ATOM 10273 H HG13 . VAL A 1 103 ? 6.841   2.104   -4.192  1.00 0.00 ? 103 VAL A HG13 6  
ATOM 10274 H HG21 . VAL A 1 103 ? 5.262   0.685   -4.325  1.00 0.00 ? 103 VAL A HG21 6  
ATOM 10275 H HG22 . VAL A 1 103 ? 6.222   -0.473  -5.278  1.00 0.00 ? 103 VAL A HG22 6  
ATOM 10276 H HG23 . VAL A 1 103 ? 5.348   -1.022  -3.828  1.00 0.00 ? 103 VAL A HG23 6  
ATOM 10277 N N    . HIS A 1 104 ? 10.393  0.248   -3.732  1.00 0.00 ? 104 HIS A N    6  
ATOM 10278 C CA   . HIS A 1 104 ? 11.675  0.682   -3.204  1.00 0.00 ? 104 HIS A CA   6  
ATOM 10279 C C    . HIS A 1 104 ? 12.388  1.554   -4.241  1.00 0.00 ? 104 HIS A C    6  
ATOM 10280 O O    . HIS A 1 104 ? 12.672  2.723   -3.985  1.00 0.00 ? 104 HIS A O    6  
ATOM 10281 C CB   . HIS A 1 104 ? 12.514  -0.517  -2.760  1.00 0.00 ? 104 HIS A CB   6  
ATOM 10282 C CG   . HIS A 1 104 ? 13.247  -0.305  -1.457  1.00 0.00 ? 104 HIS A CG   6  
ATOM 10283 N ND1  . HIS A 1 104 ? 12.725  -0.683  -0.233  1.00 0.00 ? 104 HIS A ND1  6  
ATOM 10284 C CD2  . HIS A 1 104 ? 14.467  0.249   -1.201  1.00 0.00 ? 104 HIS A CD2  6  
ATOM 10285 C CE1  . HIS A 1 104 ? 13.599  -0.365  0.711   1.00 0.00 ? 104 HIS A CE1  6  
ATOM 10286 N NE2  . HIS A 1 104 ? 14.678  0.213   0.109   1.00 0.00 ? 104 HIS A NE2  6  
ATOM 10287 H H    . HIS A 1 104 ? 10.194  0.553   -4.663  1.00 0.00 ? 104 HIS A H    6  
ATOM 10288 H HA   . HIS A 1 104 ? 11.462  1.284   -2.321  1.00 0.00 ? 104 HIS A HA   6  
ATOM 10289 H HB2  . HIS A 1 104 ? 11.864  -1.386  -2.662  1.00 0.00 ? 104 HIS A HB2  6  
ATOM 10290 H HB3  . HIS A 1 104 ? 13.240  -0.748  -3.540  1.00 0.00 ? 104 HIS A HB3  6  
ATOM 10291 H HD1  . HIS A 1 104 ? 11.839  -1.121  -0.085  1.00 0.00 ? 104 HIS A HD1  6  
ATOM 10292 H HD2  . HIS A 1 104 ? 15.153  0.654   -1.946  1.00 0.00 ? 104 HIS A HD2  6  
ATOM 10293 H HE1  . HIS A 1 104 ? 13.478  -0.536  1.781   1.00 0.00 ? 104 HIS A HE1  6  
ATOM 10294 N N    . GLN A 1 105 ? 12.656  0.951   -5.390  1.00 0.00 ? 105 GLN A N    6  
ATOM 10295 C CA   . GLN A 1 105 ? 13.330  1.657   -6.466  1.00 0.00 ? 105 GLN A CA   6  
ATOM 10296 C C    . GLN A 1 105 ? 12.601  2.964   -6.781  1.00 0.00 ? 105 GLN A C    6  
ATOM 10297 O O    . GLN A 1 105 ? 11.397  2.963   -7.032  1.00 0.00 ? 105 GLN A O    6  
ATOM 10298 C CB   . GLN A 1 105 ? 13.442  0.777   -7.713  1.00 0.00 ? 105 GLN A CB   6  
ATOM 10299 C CG   . GLN A 1 105 ? 14.767  1.020   -8.438  1.00 0.00 ? 105 GLN A CG   6  
ATOM 10300 C CD   . GLN A 1 105 ? 14.690  0.554   -9.893  1.00 0.00 ? 105 GLN A CD   6  
ATOM 10301 O OE1  . GLN A 1 105 ? 14.373  1.309   -10.798 1.00 0.00 ? 105 GLN A OE1  6  
ATOM 10302 N NE2  . GLN A 1 105 ? 14.996  -0.728  -10.068 1.00 0.00 ? 105 GLN A NE2  6  
ATOM 10303 H H    . GLN A 1 105 ? 12.421  -0.001  -5.590  1.00 0.00 ? 105 GLN A H    6  
ATOM 10304 H HA   . GLN A 1 105 ? 14.330  1.872   -6.090  1.00 0.00 ? 105 GLN A HA   6  
ATOM 10305 H HB2  . GLN A 1 105 ? 13.365  -0.273  -7.430  1.00 0.00 ? 105 GLN A HB2  6  
ATOM 10306 H HB3  . GLN A 1 105 ? 12.611  0.987   -8.387  1.00 0.00 ? 105 GLN A HB3  6  
ATOM 10307 H HG2  . GLN A 1 105 ? 15.015  2.081   -8.405  1.00 0.00 ? 105 GLN A HG2  6  
ATOM 10308 H HG3  . GLN A 1 105 ? 15.569  0.490   -7.925  1.00 0.00 ? 105 GLN A HG3  6  
ATOM 10309 H HE21 . GLN A 1 105 ? 15.248  -1.293  -9.282  1.00 0.00 ? 105 GLN A HE21 6  
ATOM 10310 H HE22 . GLN A 1 105 ? 14.974  -1.127  -10.984 1.00 0.00 ? 105 GLN A HE22 6  
ATOM 10311 N N    . LEU A 1 106 ? 13.361  4.049   -6.758  1.00 0.00 ? 106 LEU A N    6  
ATOM 10312 C CA   . LEU A 1 106 ? 12.803  5.361   -7.038  1.00 0.00 ? 106 LEU A CA   6  
ATOM 10313 C C    . LEU A 1 106 ? 13.121  5.748   -8.483  1.00 0.00 ? 106 LEU A C    6  
ATOM 10314 O O    . LEU A 1 106 ? 13.900  5.072   -9.154  1.00 0.00 ? 106 LEU A O    6  
ATOM 10315 C CB   . LEU A 1 106 ? 13.289  6.382   -6.007  1.00 0.00 ? 106 LEU A CB   6  
ATOM 10316 C CG   . LEU A 1 106 ? 12.633  6.306   -4.627  1.00 0.00 ? 106 LEU A CG   6  
ATOM 10317 C CD1  . LEU A 1 106 ? 13.459  7.062   -3.585  1.00 0.00 ? 106 LEU A CD1  6  
ATOM 10318 C CD2  . LEU A 1 106 ? 11.186  6.801   -4.680  1.00 0.00 ? 106 LEU A CD2  6  
ATOM 10319 H H    . LEU A 1 106 ? 14.340  4.042   -6.552  1.00 0.00 ? 106 LEU A H    6  
ATOM 10320 H HA   . LEU A 1 106 ? 11.721  5.285   -6.930  1.00 0.00 ? 106 LEU A HA   6  
ATOM 10321 H HB2  . LEU A 1 106 ? 14.365  6.259   -5.883  1.00 0.00 ? 106 LEU A HB2  6  
ATOM 10322 H HB3  . LEU A 1 106 ? 13.127  7.381   -6.410  1.00 0.00 ? 106 LEU A HB3  6  
ATOM 10323 H HG   . LEU A 1 106 ? 12.604  5.261   -4.319  1.00 0.00 ? 106 LEU A HG   6  
ATOM 10324 H HD11 . LEU A 1 106 ? 13.677  6.402   -2.745  1.00 0.00 ? 106 LEU A HD11 6  
ATOM 10325 H HD12 . LEU A 1 106 ? 14.393  7.398   -4.035  1.00 0.00 ? 106 LEU A HD12 6  
ATOM 10326 H HD13 . LEU A 1 106 ? 12.895  7.926   -3.231  1.00 0.00 ? 106 LEU A HD13 6  
ATOM 10327 H HD21 . LEU A 1 106 ? 10.515  5.995   -4.381  1.00 0.00 ? 106 LEU A HD21 6  
ATOM 10328 H HD22 . LEU A 1 106 ? 11.065  7.645   -4.002  1.00 0.00 ? 106 LEU A HD22 6  
ATOM 10329 H HD23 . LEU A 1 106 ? 10.946  7.114   -5.697  1.00 0.00 ? 106 LEU A HD23 6  
ATOM 10330 N N    . SER A 1 107 ? 12.502  6.834   -8.922  1.00 0.00 ? 107 SER A N    6  
ATOM 10331 C CA   . SER A 1 107 ? 12.709  7.319   -10.275 1.00 0.00 ? 107 SER A CA   6  
ATOM 10332 C C    . SER A 1 107 ? 14.182  7.675   -10.484 1.00 0.00 ? 107 SER A C    6  
ATOM 10333 O O    . SER A 1 107 ? 14.819  8.244   -9.598  1.00 0.00 ? 107 SER A O    6  
ATOM 10334 C CB   . SER A 1 107 ? 11.824  8.532   -10.568 1.00 0.00 ? 107 SER A CB   6  
ATOM 10335 O OG   . SER A 1 107 ? 10.458  8.288   -10.241 1.00 0.00 ? 107 SER A OG   6  
ATOM 10336 H H    . SER A 1 107 ? 11.870  7.378   -8.370  1.00 0.00 ? 107 SER A H    6  
ATOM 10337 H HA   . SER A 1 107 ? 12.419  6.493   -10.925 1.00 0.00 ? 107 SER A HA   6  
ATOM 10338 H HB2  . SER A 1 107 ? 12.184  9.390   -10.000 1.00 0.00 ? 107 SER A HB2  6  
ATOM 10339 H HB3  . SER A 1 107 ? 11.903  8.793   -11.623 1.00 0.00 ? 107 SER A HB3  6  
ATOM 10340 H HG   . SER A 1 107 ? 9.922   8.173   -11.077 1.00 0.00 ? 107 SER A HG   6  
ATOM 10341 N N    . SER A 1 108 ? 14.682  7.325   -11.660 1.00 0.00 ? 108 SER A N    6  
ATOM 10342 C CA   . SER A 1 108 ? 16.068  7.600   -11.996 1.00 0.00 ? 108 SER A CA   6  
ATOM 10343 C C    . SER A 1 108 ? 16.252  9.093   -12.278 1.00 0.00 ? 108 SER A C    6  
ATOM 10344 O O    . SER A 1 108 ? 16.141  9.530   -13.422 1.00 0.00 ? 108 SER A O    6  
ATOM 10345 C CB   . SER A 1 108 ? 16.518  6.773   -13.203 1.00 0.00 ? 108 SER A CB   6  
ATOM 10346 O OG   . SER A 1 108 ? 17.824  6.233   -13.023 1.00 0.00 ? 108 SER A OG   6  
ATOM 10347 H H    . SER A 1 108 ? 14.158  6.862   -12.375 1.00 0.00 ? 108 SER A H    6  
ATOM 10348 H HA   . SER A 1 108 ? 16.643  7.303   -11.119 1.00 0.00 ? 108 SER A HA   6  
ATOM 10349 H HB2  . SER A 1 108 ? 15.809  5.961   -13.369 1.00 0.00 ? 108 SER A HB2  6  
ATOM 10350 H HB3  . SER A 1 108 ? 16.503  7.397   -14.096 1.00 0.00 ? 108 SER A HB3  6  
ATOM 10351 H HG   . SER A 1 108 ? 17.860  5.698   -12.179 1.00 0.00 ? 108 SER A HG   6  
ATOM 10352 N N    . HIS A 1 109 ? 16.530  9.833   -11.215 1.00 0.00 ? 109 HIS A N    6  
ATOM 10353 C CA   . HIS A 1 109 ? 16.730  11.268  -11.334 1.00 0.00 ? 109 HIS A CA   6  
ATOM 10354 C C    . HIS A 1 109 ? 15.480  11.912  -11.936 1.00 0.00 ? 109 HIS A C    6  
ATOM 10355 O O    . HIS A 1 109 ? 15.318  11.942  -13.155 1.00 0.00 ? 109 HIS A O    6  
ATOM 10356 C CB   . HIS A 1 109 ? 17.998  11.575  -12.132 1.00 0.00 ? 109 HIS A CB   6  
ATOM 10357 C CG   . HIS A 1 109 ? 19.261  11.570  -11.304 1.00 0.00 ? 109 HIS A CG   6  
ATOM 10358 N ND1  . HIS A 1 109 ? 20.488  11.174  -11.810 1.00 0.00 ? 109 HIS A ND1  6  
ATOM 10359 C CD2  . HIS A 1 109 ? 19.475  11.916  -10.003 1.00 0.00 ? 109 HIS A CD2  6  
ATOM 10360 C CE1  . HIS A 1 109 ? 21.391  11.281  -10.847 1.00 0.00 ? 109 HIS A CE1  6  
ATOM 10361 N NE2  . HIS A 1 109 ? 20.762  11.740  -9.728  1.00 0.00 ? 109 HIS A NE2  6  
ATOM 10362 H H    . HIS A 1 109 ? 16.618  9.470   -10.288 1.00 0.00 ? 109 HIS A H    6  
ATOM 10363 H HA   . HIS A 1 109 ? 16.873  11.648  -10.323 1.00 0.00 ? 109 HIS A HA   6  
ATOM 10364 H HB2  . HIS A 1 109 ? 18.098  10.842  -12.933 1.00 0.00 ? 109 HIS A HB2  6  
ATOM 10365 H HB3  . HIS A 1 109 ? 17.890  12.551  -12.605 1.00 0.00 ? 109 HIS A HB3  6  
ATOM 10366 H HD1  . HIS A 1 109 ? 20.662  10.861  -12.744 1.00 0.00 ? 109 HIS A HD1  6  
ATOM 10367 H HD2  . HIS A 1 109 ? 18.718  12.276  -9.306  1.00 0.00 ? 109 HIS A HD2  6  
ATOM 10368 H HE1  . HIS A 1 109 ? 22.451  11.043  -10.934 1.00 0.00 ? 109 HIS A HE1  6  
ATOM 10369 N N    . SER A 1 110 ? 14.627  12.412  -11.054 1.00 0.00 ? 110 SER A N    6  
ATOM 10370 C CA   . SER A 1 110 ? 13.397  13.054  -11.483 1.00 0.00 ? 110 SER A CA   6  
ATOM 10371 C C    . SER A 1 110 ? 13.434  14.544  -11.134 1.00 0.00 ? 110 SER A C    6  
ATOM 10372 O O    . SER A 1 110 ? 12.836  14.968  -10.146 1.00 0.00 ? 110 SER A O    6  
ATOM 10373 C CB   . SER A 1 110 ? 12.176  12.390  -10.843 1.00 0.00 ? 110 SER A CB   6  
ATOM 10374 O OG   . SER A 1 110 ? 11.010  12.523  -11.651 1.00 0.00 ? 110 SER A OG   6  
ATOM 10375 H H    . SER A 1 110 ? 14.766  12.384  -10.064 1.00 0.00 ? 110 SER A H    6  
ATOM 10376 H HA   . SER A 1 110 ? 13.360  12.916  -12.563 1.00 0.00 ? 110 SER A HA   6  
ATOM 10377 H HB2  . SER A 1 110 ? 12.384  11.332  -10.678 1.00 0.00 ? 110 SER A HB2  6  
ATOM 10378 H HB3  . SER A 1 110 ? 11.993  12.834  -9.865  1.00 0.00 ? 110 SER A HB3  6  
ATOM 10379 H HG   . SER A 1 110 ? 10.797  11.651  -12.090 1.00 0.00 ? 110 SER A HG   6  
ATOM 10380 N N    . ARG A 1 111 ? 14.142  15.296  -11.963 1.00 0.00 ? 111 ARG A N    6  
ATOM 10381 C CA   . ARG A 1 111 ? 14.265  16.728  -11.754 1.00 0.00 ? 111 ARG A CA   6  
ATOM 10382 C C    . ARG A 1 111 ? 14.545  17.028  -10.280 1.00 0.00 ? 111 ARG A C    6  
ATOM 10383 O O    . ARG A 1 111 ? 14.848  16.122  -9.506  1.00 0.00 ? 111 ARG A O    6  
ATOM 10384 C CB   . ARG A 1 111 ? 12.991  17.459  -12.184 1.00 0.00 ? 111 ARG A CB   6  
ATOM 10385 C CG   . ARG A 1 111 ? 11.816  17.091  -11.276 1.00 0.00 ? 111 ARG A CG   6  
ATOM 10386 C CD   . ARG A 1 111 ? 10.670  18.093  -11.429 1.00 0.00 ? 111 ARG A CD   6  
ATOM 10387 N NE   . ARG A 1 111 ? 9.443   17.559  -10.798 1.00 0.00 ? 111 ARG A NE   6  
ATOM 10388 C CZ   . ARG A 1 111 ? 8.206   17.993  -11.075 1.00 0.00 ? 111 ARG A CZ   6  
ATOM 10389 N NH1  . ARG A 1 111 ? 8.024   18.970  -11.974 1.00 0.00 ? 111 ARG A NH1  6  
ATOM 10390 N NH2  . ARG A 1 111 ? 7.150   17.450  -10.453 1.00 0.00 ? 111 ARG A NH2  6  
ATOM 10391 H H    . ARG A 1 111 ? 14.625  14.942  -12.764 1.00 0.00 ? 111 ARG A H    6  
ATOM 10392 H HA   . ARG A 1 111 ? 15.104  17.030  -12.382 1.00 0.00 ? 111 ARG A HA   6  
ATOM 10393 H HB2  . ARG A 1 111 ? 13.157  18.536  -12.151 1.00 0.00 ? 111 ARG A HB2  6  
ATOM 10394 H HB3  . ARG A 1 111 ? 12.752  17.204  -13.216 1.00 0.00 ? 111 ARG A HB3  6  
ATOM 10395 H HG2  . ARG A 1 111 ? 11.463  16.089  -11.520 1.00 0.00 ? 111 ARG A HG2  6  
ATOM 10396 H HG3  . ARG A 1 111 ? 12.147  17.068  -10.237 1.00 0.00 ? 111 ARG A HG3  6  
ATOM 10397 H HD2  . ARG A 1 111 ? 10.942  19.043  -10.969 1.00 0.00 ? 111 ARG A HD2  6  
ATOM 10398 H HD3  . ARG A 1 111 ? 10.489  18.292  -12.486 1.00 0.00 ? 111 ARG A HD3  6  
ATOM 10399 H HE   . ARG A 1 111 ? 9.543   16.829  -10.122 1.00 0.00 ? 111 ARG A HE   6  
ATOM 10400 H HH11 . ARG A 1 111 ? 8.812   19.376  -12.438 1.00 0.00 ? 111 ARG A HH11 6  
ATOM 10401 H HH12 . ARG A 1 111 ? 7.101   19.294  -12.180 1.00 0.00 ? 111 ARG A HH12 6  
ATOM 10402 H HH21 . ARG A 1 111 ? 7.286   16.721  -9.783  1.00 0.00 ? 111 ARG A HH21 6  
ATOM 10403 H HH22 . ARG A 1 111 ? 6.227   17.774  -10.660 1.00 0.00 ? 111 ARG A HH22 6  
ATOM 10404 N N    . SER A 1 112 ? 14.432  18.303  -9.937  1.00 0.00 ? 112 SER A N    6  
ATOM 10405 C CA   . SER A 1 112 ? 14.669  18.733  -8.569  1.00 0.00 ? 112 SER A CA   6  
ATOM 10406 C C    . SER A 1 112 ? 13.343  19.094  -7.897  1.00 0.00 ? 112 SER A C    6  
ATOM 10407 O O    . SER A 1 112 ? 13.008  18.551  -6.845  1.00 0.00 ? 112 SER A O    6  
ATOM 10408 C CB   . SER A 1 112 ? 15.628  19.924  -8.525  1.00 0.00 ? 112 SER A CB   6  
ATOM 10409 O OG   . SER A 1 112 ? 15.154  21.021  -9.301  1.00 0.00 ? 112 SER A OG   6  
ATOM 10410 H H    . SER A 1 112 ? 14.185  19.033  -10.573 1.00 0.00 ? 112 SER A H    6  
ATOM 10411 H HA   . SER A 1 112 ? 15.129  17.878  -8.073  1.00 0.00 ? 112 SER A HA   6  
ATOM 10412 H HB2  . SER A 1 112 ? 15.763  20.243  -7.491  1.00 0.00 ? 112 SER A HB2  6  
ATOM 10413 H HB3  . SER A 1 112 ? 16.607  19.615  -8.893  1.00 0.00 ? 112 SER A HB3  6  
ATOM 10414 H HG   . SER A 1 112 ? 15.864  21.722  -9.372  1.00 0.00 ? 112 SER A HG   6  
ATOM 10415 N N    . GLY A 1 113 ? 12.624  20.008  -8.532  1.00 0.00 ? 113 GLY A N    6  
ATOM 10416 C CA   . GLY A 1 113 ? 11.342  20.448  -8.009  1.00 0.00 ? 113 GLY A CA   6  
ATOM 10417 C C    . GLY A 1 113 ? 11.524  21.566  -6.981  1.00 0.00 ? 113 GLY A C    6  
ATOM 10418 O O    . GLY A 1 113 ? 12.493  21.566  -6.223  1.00 0.00 ? 113 GLY A O    6  
ATOM 10419 H H    . GLY A 1 113 ? 12.904  20.444  -9.387  1.00 0.00 ? 113 GLY A H    6  
ATOM 10420 H HA2  . GLY A 1 113 ? 10.713  20.800  -8.827  1.00 0.00 ? 113 GLY A HA2  6  
ATOM 10421 H HA3  . GLY A 1 113 ? 10.825  19.606  -7.549  1.00 0.00 ? 113 GLY A HA3  6  
ATOM 10422 N N    . PRO A 1 114 ? 10.551  22.516  -6.987  1.00 0.00 ? 114 PRO A N    6  
ATOM 10423 C CA   . PRO A 1 114 ? 10.595  23.638  -6.064  1.00 0.00 ? 114 PRO A CA   6  
ATOM 10424 C C    . PRO A 1 114 ? 10.206  23.200  -4.650  1.00 0.00 ? 114 PRO A C    6  
ATOM 10425 O O    . PRO A 1 114 ? 9.613   22.138  -4.467  1.00 0.00 ? 114 PRO A O    6  
ATOM 10426 C CB   . PRO A 1 114 ? 9.642   24.667  -6.650  1.00 0.00 ? 114 PRO A CB   6  
ATOM 10427 C CG   . PRO A 1 114 ? 8.753   23.907  -7.621  1.00 0.00 ? 114 PRO A CG   6  
ATOM 10428 C CD   . PRO A 1 114 ? 9.389   22.549  -7.869  1.00 0.00 ? 114 PRO A CD   6  
ATOM 10429 H HA   . PRO A 1 114 ? 11.527  23.993  -5.993  1.00 0.00 ? 114 PRO A HA   6  
ATOM 10430 H HB2  . PRO A 1 114 ? 9.050   25.142  -5.868  1.00 0.00 ? 114 PRO A HB2  6  
ATOM 10431 H HB3  . PRO A 1 114 ? 10.189  25.460  -7.161  1.00 0.00 ? 114 PRO A HB3  6  
ATOM 10432 H HG2  . PRO A 1 114 ? 7.751   23.789  -7.208  1.00 0.00 ? 114 PRO A HG2  6  
ATOM 10433 H HG3  . PRO A 1 114 ? 8.650   24.457  -8.556  1.00 0.00 ? 114 PRO A HG3  6  
ATOM 10434 H HD2  . PRO A 1 114 ? 8.696   21.739  -7.641  1.00 0.00 ? 114 PRO A HD2  6  
ATOM 10435 H HD3  . PRO A 1 114 ? 9.681   22.433  -8.913  1.00 0.00 ? 114 PRO A HD3  6  
ATOM 10436 N N    . SER A 1 115 ? 10.555  24.041  -3.688  1.00 0.00 ? 115 SER A N    6  
ATOM 10437 C CA   . SER A 1 115 ? 10.250  23.754  -2.297  1.00 0.00 ? 115 SER A CA   6  
ATOM 10438 C C    . SER A 1 115 ? 9.336   24.840  -1.727  1.00 0.00 ? 115 SER A C    6  
ATOM 10439 O O    . SER A 1 115 ? 9.800   25.752  -1.044  1.00 0.00 ? 115 SER A O    6  
ATOM 10440 C CB   . SER A 1 115 ? 11.529  23.645  -1.463  1.00 0.00 ? 115 SER A CB   6  
ATOM 10441 O OG   . SER A 1 115 ? 11.989  22.300  -1.364  1.00 0.00 ? 115 SER A OG   6  
ATOM 10442 H H    . SER A 1 115 ? 11.037  24.903  -3.846  1.00 0.00 ? 115 SER A H    6  
ATOM 10443 H HA   . SER A 1 115 ? 9.740   22.791  -2.306  1.00 0.00 ? 115 SER A HA   6  
ATOM 10444 H HB2  . SER A 1 115 ? 12.307  24.262  -1.912  1.00 0.00 ? 115 SER A HB2  6  
ATOM 10445 H HB3  . SER A 1 115 ? 11.345  24.041  -0.464  1.00 0.00 ? 115 SER A HB3  6  
ATOM 10446 H HG   . SER A 1 115 ? 12.175  21.934  -2.276  1.00 0.00 ? 115 SER A HG   6  
ATOM 10447 N N    . SER A 1 116 ? 8.053   24.707  -2.028  1.00 0.00 ? 116 SER A N    6  
ATOM 10448 C CA   . SER A 1 116 ? 7.069   25.666  -1.554  1.00 0.00 ? 116 SER A CA   6  
ATOM 10449 C C    . SER A 1 116 ? 5.712   24.981  -1.382  1.00 0.00 ? 116 SER A C    6  
ATOM 10450 O O    . SER A 1 116 ? 5.134   25.003  -0.296  1.00 0.00 ? 116 SER A O    6  
ATOM 10451 C CB   . SER A 1 116 ? 6.949   26.851  -2.513  1.00 0.00 ? 116 SER A CB   6  
ATOM 10452 O OG   . SER A 1 116 ? 6.109   27.877  -1.992  1.00 0.00 ? 116 SER A OG   6  
ATOM 10453 H H    . SER A 1 116 ? 7.683   23.962  -2.583  1.00 0.00 ? 116 SER A H    6  
ATOM 10454 H HA   . SER A 1 116 ? 7.446   26.014  -0.592  1.00 0.00 ? 116 SER A HA   6  
ATOM 10455 H HB2  . SER A 1 116 ? 7.940   27.259  -2.711  1.00 0.00 ? 116 SER A HB2  6  
ATOM 10456 H HB3  . SER A 1 116 ? 6.550   26.506  -3.467  1.00 0.00 ? 116 SER A HB3  6  
ATOM 10457 H HG   . SER A 1 116 ? 5.148   27.621  -2.099  1.00 0.00 ? 116 SER A HG   6  
ATOM 10458 N N    . GLY A 1 117 ? 5.241   24.390  -2.471  1.00 0.00 ? 117 GLY A N    6  
ATOM 10459 C CA   . GLY A 1 117 ? 3.962   23.701  -2.454  1.00 0.00 ? 117 GLY A CA   6  
ATOM 10460 C C    . GLY A 1 117 ? 2.945   24.411  -3.349  1.00 0.00 ? 117 GLY A C    6  
ATOM 10461 O O    . GLY A 1 117 ? 2.670   25.596  -3.164  1.00 0.00 ? 117 GLY A O    6  
ATOM 10462 H H    . GLY A 1 117 ? 5.717   24.377  -3.350  1.00 0.00 ? 117 GLY A H    6  
ATOM 10463 H HA2  . GLY A 1 117 ? 4.094   22.673  -2.793  1.00 0.00 ? 117 GLY A HA2  6  
ATOM 10464 H HA3  . GLY A 1 117 ? 3.583   23.654  -1.433  1.00 0.00 ? 117 GLY A HA3  6  
ATOM 10465 N N    . GLY A 1 1   ? -17.415 -14.779 -8.929  1.00 0.00 ? 1   GLY A N    7  
ATOM 10466 C CA   . GLY A 1 1   ? -16.664 -15.975 -8.588  1.00 0.00 ? 1   GLY A CA   7  
ATOM 10467 C C    . GLY A 1 1   ? -16.343 -16.013 -7.092  1.00 0.00 ? 1   GLY A C    7  
ATOM 10468 O O    . GLY A 1 1   ? -15.495 -15.261 -6.616  1.00 0.00 ? 1   GLY A O    7  
ATOM 10469 H H1   . GLY A 1 1   ? -18.388 -14.927 -9.103  1.00 0.00 ? 1   GLY A H1   7  
ATOM 10470 H HA2  . GLY A 1 1   ? -17.238 -16.860 -8.863  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10471 H HA3  . GLY A 1 1   ? -15.738 -16.004 -9.163  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10472 N N    . SER A 1 2   ? -17.040 -16.897 -6.393  1.00 0.00 ? 2   SER A N    7  
ATOM 10473 C CA   . SER A 1 2   ? -16.840 -17.043 -4.961  1.00 0.00 ? 2   SER A CA   7  
ATOM 10474 C C    . SER A 1 2   ? -16.893 -18.522 -4.573  1.00 0.00 ? 2   SER A C    7  
ATOM 10475 O O    . SER A 1 2   ? -17.973 -19.099 -4.459  1.00 0.00 ? 2   SER A O    7  
ATOM 10476 C CB   . SER A 1 2   ? -17.886 -16.250 -4.175  1.00 0.00 ? 2   SER A CB   7  
ATOM 10477 O OG   . SER A 1 2   ? -19.196 -16.786 -4.340  1.00 0.00 ? 2   SER A OG   7  
ATOM 10478 H H    . SER A 1 2   ? -17.728 -17.506 -6.787  1.00 0.00 ? 2   SER A H    7  
ATOM 10479 H HA   . SER A 1 2   ? -15.850 -16.631 -4.764  1.00 0.00 ? 2   SER A HA   7  
ATOM 10480 H HB2  . SER A 1 2   ? -17.624 -16.253 -3.117  1.00 0.00 ? 2   SER A HB2  7  
ATOM 10481 H HB3  . SER A 1 2   ? -17.876 -15.211 -4.504  1.00 0.00 ? 2   SER A HB3  7  
ATOM 10482 H HG   . SER A 1 2   ? -19.255 -17.686 -3.907  1.00 0.00 ? 2   SER A HG   7  
ATOM 10483 N N    . SER A 1 3   ? -15.713 -19.094 -4.382  1.00 0.00 ? 3   SER A N    7  
ATOM 10484 C CA   . SER A 1 3   ? -15.612 -20.494 -4.009  1.00 0.00 ? 3   SER A CA   7  
ATOM 10485 C C    . SER A 1 3   ? -14.565 -20.668 -2.907  1.00 0.00 ? 3   SER A C    7  
ATOM 10486 O O    . SER A 1 3   ? -13.664 -19.843 -2.766  1.00 0.00 ? 3   SER A O    7  
ATOM 10487 C CB   . SER A 1 3   ? -15.258 -21.362 -5.219  1.00 0.00 ? 3   SER A CB   7  
ATOM 10488 O OG   . SER A 1 3   ? -13.905 -21.180 -5.629  1.00 0.00 ? 3   SER A OG   7  
ATOM 10489 H H    . SER A 1 3   ? -14.839 -18.617 -4.477  1.00 0.00 ? 3   SER A H    7  
ATOM 10490 H HA   . SER A 1 3   ? -16.601 -20.768 -3.643  1.00 0.00 ? 3   SER A HA   7  
ATOM 10491 H HB2  . SER A 1 3   ? -15.425 -22.411 -4.974  1.00 0.00 ? 3   SER A HB2  7  
ATOM 10492 H HB3  . SER A 1 3   ? -15.924 -21.118 -6.047  1.00 0.00 ? 3   SER A HB3  7  
ATOM 10493 H HG   . SER A 1 3   ? -13.576 -20.283 -5.334  1.00 0.00 ? 3   SER A HG   7  
ATOM 10494 N N    . GLY A 1 4   ? -14.718 -21.748 -2.154  1.00 0.00 ? 4   GLY A N    7  
ATOM 10495 C CA   . GLY A 1 4   ? -13.797 -22.041 -1.069  1.00 0.00 ? 4   GLY A CA   7  
ATOM 10496 C C    . GLY A 1 4   ? -14.430 -22.997 -0.056  1.00 0.00 ? 4   GLY A C    7  
ATOM 10497 O O    . GLY A 1 4   ? -15.551 -23.462 -0.253  1.00 0.00 ? 4   GLY A O    7  
ATOM 10498 H H    . GLY A 1 4   ? -15.453 -22.414 -2.276  1.00 0.00 ? 4   GLY A H    7  
ATOM 10499 H HA2  . GLY A 1 4   ? -12.885 -22.482 -1.471  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10500 H HA3  . GLY A 1 4   ? -13.510 -21.114 -0.571  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10501 N N    . SER A 1 5   ? -13.683 -23.261 1.006   1.00 0.00 ? 5   SER A N    7  
ATOM 10502 C CA   . SER A 1 5   ? -14.157 -24.153 2.050   1.00 0.00 ? 5   SER A CA   7  
ATOM 10503 C C    . SER A 1 5   ? -13.437 -23.848 3.366   1.00 0.00 ? 5   SER A C    7  
ATOM 10504 O O    . SER A 1 5   ? -12.308 -23.359 3.361   1.00 0.00 ? 5   SER A O    7  
ATOM 10505 C CB   . SER A 1 5   ? -13.950 -25.618 1.659   1.00 0.00 ? 5   SER A CB   7  
ATOM 10506 O OG   . SER A 1 5   ? -15.006 -26.105 0.836   1.00 0.00 ? 5   SER A OG   7  
ATOM 10507 H H    . SER A 1 5   ? -12.772 -22.878 1.158   1.00 0.00 ? 5   SER A H    7  
ATOM 10508 H HA   . SER A 1 5   ? -15.223 -23.949 2.142   1.00 0.00 ? 5   SER A HA   7  
ATOM 10509 H HB2  . SER A 1 5   ? -13.001 -25.722 1.132   1.00 0.00 ? 5   SER A HB2  7  
ATOM 10510 H HB3  . SER A 1 5   ? -13.882 -26.228 2.560   1.00 0.00 ? 5   SER A HB3  7  
ATOM 10511 H HG   . SER A 1 5   ? -15.580 -26.738 1.354   1.00 0.00 ? 5   SER A HG   7  
ATOM 10512 N N    . SER A 1 6   ? -14.119 -24.150 4.461   1.00 0.00 ? 6   SER A N    7  
ATOM 10513 C CA   . SER A 1 6   ? -13.558 -23.915 5.780   1.00 0.00 ? 6   SER A CA   7  
ATOM 10514 C C    . SER A 1 6   ? -13.251 -22.427 5.960   1.00 0.00 ? 6   SER A C    7  
ATOM 10515 O O    . SER A 1 6   ? -12.325 -21.901 5.344   1.00 0.00 ? 6   SER A O    7  
ATOM 10516 C CB   . SER A 1 6   ? -12.294 -24.748 5.999   1.00 0.00 ? 6   SER A CB   7  
ATOM 10517 O OG   . SER A 1 6   ? -12.578 -26.143 6.060   1.00 0.00 ? 6   SER A OG   7  
ATOM 10518 H H    . SER A 1 6   ? -15.036 -24.548 4.456   1.00 0.00 ? 6   SER A H    7  
ATOM 10519 H HA   . SER A 1 6   ? -14.329 -24.234 6.482   1.00 0.00 ? 6   SER A HA   7  
ATOM 10520 H HB2  . SER A 1 6   ? -11.590 -24.557 5.189   1.00 0.00 ? 6   SER A HB2  7  
ATOM 10521 H HB3  . SER A 1 6   ? -11.809 -24.435 6.923   1.00 0.00 ? 6   SER A HB3  7  
ATOM 10522 H HG   . SER A 1 6   ? -13.452 -26.334 5.614   1.00 0.00 ? 6   SER A HG   7  
ATOM 10523 N N    . GLY A 1 7   ? -14.046 -21.789 6.807   1.00 0.00 ? 7   GLY A N    7  
ATOM 10524 C CA   . GLY A 1 7   ? -13.871 -20.372 7.076   1.00 0.00 ? 7   GLY A CA   7  
ATOM 10525 C C    . GLY A 1 7   ? -13.199 -20.150 8.433   1.00 0.00 ? 7   GLY A C    7  
ATOM 10526 O O    . GLY A 1 7   ? -12.796 -21.106 9.093   1.00 0.00 ? 7   GLY A O    7  
ATOM 10527 H H    . GLY A 1 7   ? -14.797 -22.224 7.304   1.00 0.00 ? 7   GLY A H    7  
ATOM 10528 H HA2  . GLY A 1 7   ? -13.266 -19.921 6.289   1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10529 H HA3  . GLY A 1 7   ? -14.839 -19.873 7.059   1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10530 N N    . GLY A 1 8   ? -13.100 -18.883 8.808   1.00 0.00 ? 8   GLY A N    7  
ATOM 10531 C CA   . GLY A 1 8   ? -12.484 -18.524 10.074  1.00 0.00 ? 8   GLY A CA   7  
ATOM 10532 C C    . GLY A 1 8   ? -11.223 -17.687 9.852   1.00 0.00 ? 8   GLY A C    7  
ATOM 10533 O O    . GLY A 1 8   ? -11.305 -16.482 9.619   1.00 0.00 ? 8   GLY A O    7  
ATOM 10534 H H    . GLY A 1 8   ? -13.431 -18.112 8.265   1.00 0.00 ? 8   GLY A H    7  
ATOM 10535 H HA2  . GLY A 1 8   ? -13.195 -17.963 10.682  1.00 0.00 ? 8   GLY A HA2  7  
ATOM 10536 H HA3  . GLY A 1 8   ? -12.233 -19.427 10.630  1.00 0.00 ? 8   GLY A HA3  7  
ATOM 10537 N N    . GLU A 1 9   ? -10.084 -18.360 9.933   1.00 0.00 ? 9   GLU A N    7  
ATOM 10538 C CA   . GLU A 1 9   ? -8.807  -17.694 9.744   1.00 0.00 ? 9   GLU A CA   7  
ATOM 10539 C C    . GLU A 1 9   ? -8.426  -17.685 8.262   1.00 0.00 ? 9   GLU A C    7  
ATOM 10540 O O    . GLU A 1 9   ? -8.741  -18.624 7.532   1.00 0.00 ? 9   GLU A O    7  
ATOM 10541 C CB   . GLU A 1 9   ? -7.714  -18.354 10.587  1.00 0.00 ? 9   GLU A CB   7  
ATOM 10542 C CG   . GLU A 1 9   ? -7.453  -19.788 10.121  1.00 0.00 ? 9   GLU A CG   7  
ATOM 10543 C CD   . GLU A 1 9   ? -7.364  -20.744 11.312  1.00 0.00 ? 9   GLU A CD   7  
ATOM 10544 O OE1  . GLU A 1 9   ? -8.191  -20.579 12.235  1.00 0.00 ? 9   GLU A OE1  7  
ATOM 10545 O OE2  . GLU A 1 9   ? -6.471  -21.618 11.274  1.00 0.00 ? 9   GLU A OE2  7  
ATOM 10546 H H    . GLU A 1 9   ? -10.025 -19.340 10.123  1.00 0.00 ? 9   GLU A H    7  
ATOM 10547 H HA   . GLU A 1 9   ? -8.958  -16.672 10.093  1.00 0.00 ? 9   GLU A HA   7  
ATOM 10548 H HB2  . GLU A 1 9   ? -6.794  -17.773 10.517  1.00 0.00 ? 9   GLU A HB2  7  
ATOM 10549 H HB3  . GLU A 1 9   ? -8.010  -18.357 11.636  1.00 0.00 ? 9   GLU A HB3  7  
ATOM 10550 H HG2  . GLU A 1 9   ? -8.253  -20.108 9.453   1.00 0.00 ? 9   GLU A HG2  7  
ATOM 10551 H HG3  . GLU A 1 9   ? -6.526  -19.826 9.550   1.00 0.00 ? 9   GLU A HG3  7  
ATOM 10552 N N    . ARG A 1 10  ? -7.755  -16.615 7.862   1.00 0.00 ? 10  ARG A N    7  
ATOM 10553 C CA   . ARG A 1 10  ? -7.328  -16.473 6.481   1.00 0.00 ? 10  ARG A CA   7  
ATOM 10554 C C    . ARG A 1 10  ? -6.438  -17.649 6.076   1.00 0.00 ? 10  ARG A C    7  
ATOM 10555 O O    . ARG A 1 10  ? -5.246  -17.662 6.379   1.00 0.00 ? 10  ARG A O    7  
ATOM 10556 C CB   . ARG A 1 10  ? -6.561  -15.165 6.273   1.00 0.00 ? 10  ARG A CB   7  
ATOM 10557 C CG   . ARG A 1 10  ? -7.501  -13.961 6.342   1.00 0.00 ? 10  ARG A CG   7  
ATOM 10558 C CD   . ARG A 1 10  ? -7.353  -13.078 5.101   1.00 0.00 ? 10  ARG A CD   7  
ATOM 10559 N NE   . ARG A 1 10  ? -8.682  -12.593 4.664   1.00 0.00 ? 10  ARG A NE   7  
ATOM 10560 C CZ   . ARG A 1 10  ? -9.394  -11.664 5.317   1.00 0.00 ? 10  ARG A CZ   7  
ATOM 10561 N NH1  . ARG A 1 10  ? -8.911  -11.116 6.440   1.00 0.00 ? 10  ARG A NH1  7  
ATOM 10562 N NH2  . ARG A 1 10  ? -10.590 -11.285 4.847   1.00 0.00 ? 10  ARG A NH2  7  
ATOM 10563 H H    . ARG A 1 10  ? -7.503  -15.856 8.463   1.00 0.00 ? 10  ARG A H    7  
ATOM 10564 H HA   . ARG A 1 10  ? -8.253  -16.464 5.903   1.00 0.00 ? 10  ARG A HA   7  
ATOM 10565 H HB2  . ARG A 1 10  ? -5.786  -15.070 7.034   1.00 0.00 ? 10  ARG A HB2  7  
ATOM 10566 H HB3  . ARG A 1 10  ? -6.058  -15.184 5.306   1.00 0.00 ? 10  ARG A HB3  7  
ATOM 10567 H HG2  . ARG A 1 10  ? -8.532  -14.304 6.428   1.00 0.00 ? 10  ARG A HG2  7  
ATOM 10568 H HG3  . ARG A 1 10  ? -7.284  -13.376 7.236   1.00 0.00 ? 10  ARG A HG3  7  
ATOM 10569 H HD2  . ARG A 1 10  ? -6.702  -12.232 5.321   1.00 0.00 ? 10  ARG A HD2  7  
ATOM 10570 H HD3  . ARG A 1 10  ? -6.881  -13.643 4.297   1.00 0.00 ? 10  ARG A HD3  7  
ATOM 10571 H HE   . ARG A 1 10  ? -9.072  -12.982 3.830   1.00 0.00 ? 10  ARG A HE   7  
ATOM 10572 H HH11 . ARG A 1 10  ? -8.018  -11.399 6.791   1.00 0.00 ? 10  ARG A HH11 7  
ATOM 10573 H HH12 . ARG A 1 10  ? -9.442  -10.423 6.927   1.00 0.00 ? 10  ARG A HH12 7  
ATOM 10574 H HH21 . ARG A 1 10  ? -10.951 -11.694 4.009   1.00 0.00 ? 10  ARG A HH21 7  
ATOM 10575 H HH22 . ARG A 1 10  ? -11.122 -10.592 5.335   1.00 0.00 ? 10  ARG A HH22 7  
ATOM 10576 N N    . ARG A 1 11  ? -7.050  -18.608 5.397   1.00 0.00 ? 11  ARG A N    7  
ATOM 10577 C CA   . ARG A 1 11  ? -6.328  -19.786 4.948   1.00 0.00 ? 11  ARG A CA   7  
ATOM 10578 C C    . ARG A 1 11  ? -6.766  -20.170 3.533   1.00 0.00 ? 11  ARG A C    7  
ATOM 10579 O O    . ARG A 1 11  ? -7.828  -19.752 3.074   1.00 0.00 ? 11  ARG A O    7  
ATOM 10580 C CB   . ARG A 1 11  ? -6.566  -20.970 5.888   1.00 0.00 ? 11  ARG A CB   7  
ATOM 10581 C CG   . ARG A 1 11  ? -5.257  -21.705 6.185   1.00 0.00 ? 11  ARG A CG   7  
ATOM 10582 C CD   . ARG A 1 11  ? -5.479  -23.218 6.239   1.00 0.00 ? 11  ARG A CD   7  
ATOM 10583 N NE   . ARG A 1 11  ? -5.722  -23.644 7.635   1.00 0.00 ? 11  ARG A NE   7  
ATOM 10584 C CZ   . ARG A 1 11  ? -4.804  -23.585 8.609   1.00 0.00 ? 11  ARG A CZ   7  
ATOM 10585 N NH1  . ARG A 1 11  ? -3.576  -23.117 8.346   1.00 0.00 ? 11  ARG A NH1  7  
ATOM 10586 N NH2  . ARG A 1 11  ? -5.113  -23.994 9.847   1.00 0.00 ? 11  ARG A NH2  7  
ATOM 10587 H H    . ARG A 1 11  ? -8.020  -18.589 5.155   1.00 0.00 ? 11  ARG A H    7  
ATOM 10588 H HA   . ARG A 1 11  ? -5.278  -19.493 4.967   1.00 0.00 ? 11  ARG A HA   7  
ATOM 10589 H HB2  . ARG A 1 11  ? -7.008  -20.616 6.819   1.00 0.00 ? 11  ARG A HB2  7  
ATOM 10590 H HB3  . ARG A 1 11  ? -7.280  -21.658 5.437   1.00 0.00 ? 11  ARG A HB3  7  
ATOM 10591 H HG2  . ARG A 1 11  ? -4.521  -21.469 5.417   1.00 0.00 ? 11  ARG A HG2  7  
ATOM 10592 H HG3  . ARG A 1 11  ? -4.850  -21.359 7.135   1.00 0.00 ? 11  ARG A HG3  7  
ATOM 10593 H HD2  . ARG A 1 11  ? -6.328  -23.492 5.613   1.00 0.00 ? 11  ARG A HD2  7  
ATOM 10594 H HD3  . ARG A 1 11  ? -4.607  -23.736 5.838   1.00 0.00 ? 11  ARG A HD3  7  
ATOM 10595 H HE   . ARG A 1 11  ? -6.628  -23.999 7.866   1.00 0.00 ? 11  ARG A HE   7  
ATOM 10596 H HH11 . ARG A 1 11  ? -3.345  -22.811 7.422   1.00 0.00 ? 11  ARG A HH11 7  
ATOM 10597 H HH12 . ARG A 1 11  ? -2.891  -23.072 9.073   1.00 0.00 ? 11  ARG A HH12 7  
ATOM 10598 H HH21 . ARG A 1 11  ? -6.029  -24.344 10.044  1.00 0.00 ? 11  ARG A HH21 7  
ATOM 10599 H HH22 . ARG A 1 11  ? -4.428  -23.950 10.574  1.00 0.00 ? 11  ARG A HH22 7  
ATOM 10600 N N    . LYS A 1 12  ? -5.927  -20.962 2.883   1.00 0.00 ? 12  LYS A N    7  
ATOM 10601 C CA   . LYS A 1 12  ? -6.215  -21.407 1.530   1.00 0.00 ? 12  LYS A CA   7  
ATOM 10602 C C    . LYS A 1 12  ? -6.118  -20.217 0.574   1.00 0.00 ? 12  LYS A C    7  
ATOM 10603 O O    . LYS A 1 12  ? -5.215  -20.157 -0.259  1.00 0.00 ? 12  LYS A O    7  
ATOM 10604 C CB   . LYS A 1 12  ? -7.563  -22.129 1.479   1.00 0.00 ? 12  LYS A CB   7  
ATOM 10605 C CG   . LYS A 1 12  ? -7.372  -23.646 1.430   1.00 0.00 ? 12  LYS A CG   7  
ATOM 10606 C CD   . LYS A 1 12  ? -8.272  -24.345 2.451   1.00 0.00 ? 12  LYS A CD   7  
ATOM 10607 C CE   . LYS A 1 12  ? -8.720  -25.715 1.939   1.00 0.00 ? 12  LYS A CE   7  
ATOM 10608 N NZ   . LYS A 1 12  ? -10.004 -25.603 1.211   1.00 0.00 ? 12  LYS A NZ   7  
ATOM 10609 H H    . LYS A 1 12  ? -5.066  -21.298 3.264   1.00 0.00 ? 12  LYS A H    7  
ATOM 10610 H HA   . LYS A 1 12  ? -5.450  -22.134 1.255   1.00 0.00 ? 12  LYS A HA   7  
ATOM 10611 H HB2  . LYS A 1 12  ? -8.157  -21.861 2.353   1.00 0.00 ? 12  LYS A HB2  7  
ATOM 10612 H HB3  . LYS A 1 12  ? -8.122  -21.801 0.602   1.00 0.00 ? 12  LYS A HB3  7  
ATOM 10613 H HG2  . LYS A 1 12  ? -7.597  -24.013 0.429   1.00 0.00 ? 12  LYS A HG2  7  
ATOM 10614 H HG3  . LYS A 1 12  ? -6.329  -23.891 1.632   1.00 0.00 ? 12  LYS A HG3  7  
ATOM 10615 H HD2  . LYS A 1 12  ? -7.737  -24.462 3.393   1.00 0.00 ? 12  LYS A HD2  7  
ATOM 10616 H HD3  . LYS A 1 12  ? -9.146  -23.726 2.655   1.00 0.00 ? 12  LYS A HD3  7  
ATOM 10617 H HE2  . LYS A 1 12  ? -7.957  -26.131 1.280   1.00 0.00 ? 12  LYS A HE2  7  
ATOM 10618 H HE3  . LYS A 1 12  ? -8.829  -26.405 2.776   1.00 0.00 ? 12  LYS A HE3  7  
ATOM 10619 H HZ1  . LYS A 1 12  ? -10.395 -26.514 1.082   1.00 0.00 ? 12  LYS A HZ1  7  
ATOM 10620 H HZ2  . LYS A 1 12  ? -10.639 -25.039 1.740   1.00 0.00 ? 12  LYS A HZ2  7  
ATOM 10621 H HZ3  . LYS A 1 12  ? -9.845  -25.178 0.319   1.00 0.00 ? 12  LYS A HZ3  7  
ATOM 10622 N N    . ASP A 1 13  ? -7.061  -19.298 0.726   1.00 0.00 ? 13  ASP A N    7  
ATOM 10623 C CA   . ASP A 1 13  ? -7.093  -18.112 -0.113  1.00 0.00 ? 13  ASP A CA   7  
ATOM 10624 C C    . ASP A 1 13  ? -6.211  -17.028 0.509   1.00 0.00 ? 13  ASP A C    7  
ATOM 10625 O O    . ASP A 1 13  ? -6.529  -16.499 1.573   1.00 0.00 ? 13  ASP A O    7  
ATOM 10626 C CB   . ASP A 1 13  ? -8.514  -17.557 -0.227  1.00 0.00 ? 13  ASP A CB   7  
ATOM 10627 C CG   . ASP A 1 13  ? -9.002  -17.320 -1.658  1.00 0.00 ? 13  ASP A CG   7  
ATOM 10628 O OD1  . ASP A 1 13  ? -8.273  -16.625 -2.398  1.00 0.00 ? 13  ASP A OD1  7  
ATOM 10629 O OD2  . ASP A 1 13  ? -10.093 -17.838 -1.978  1.00 0.00 ? 13  ASP A OD2  7  
ATOM 10630 H H    . ASP A 1 13  ? -7.792  -19.354 1.407   1.00 0.00 ? 13  ASP A H    7  
ATOM 10631 H HA   . ASP A 1 13  ? -6.727  -18.440 -1.086  1.00 0.00 ? 13  ASP A HA   7  
ATOM 10632 H HB2  . ASP A 1 13  ? -9.199  -18.248 0.264   1.00 0.00 ? 13  ASP A HB2  7  
ATOM 10633 H HB3  . ASP A 1 13  ? -8.565  -16.615 0.319   1.00 0.00 ? 13  ASP A HB3  7  
ATOM 10634 N N    . ARG A 1 14  ? -5.119  -16.731 -0.180  1.00 0.00 ? 14  ARG A N    7  
ATOM 10635 C CA   . ARG A 1 14  ? -4.189  -15.719 0.291   1.00 0.00 ? 14  ARG A CA   7  
ATOM 10636 C C    . ARG A 1 14  ? -4.640  -14.330 -0.162  1.00 0.00 ? 14  ARG A C    7  
ATOM 10637 O O    . ARG A 1 14  ? -5.193  -14.177 -1.250  1.00 0.00 ? 14  ARG A O    7  
ATOM 10638 C CB   . ARG A 1 14  ? -2.775  -15.985 -0.231  1.00 0.00 ? 14  ARG A CB   7  
ATOM 10639 C CG   . ARG A 1 14  ? -1.826  -16.343 0.914   1.00 0.00 ? 14  ARG A CG   7  
ATOM 10640 C CD   . ARG A 1 14  ? -0.775  -17.357 0.458   1.00 0.00 ? 14  ARG A CD   7  
ATOM 10641 N NE   . ARG A 1 14  ? 0.570   -16.926 0.901   1.00 0.00 ? 14  ARG A NE   7  
ATOM 10642 C CZ   . ARG A 1 14  ? 1.701   -17.586 0.618   1.00 0.00 ? 14  ARG A CZ   7  
ATOM 10643 N NH1  . ARG A 1 14  ? 1.657   -18.711 -0.109  1.00 0.00 ? 14  ARG A NH1  7  
ATOM 10644 N NH2  . ARG A 1 14  ? 2.877   -17.122 1.062   1.00 0.00 ? 14  ARG A NH2  7  
ATOM 10645 H H    . ARG A 1 14  ? -4.868  -17.166 -1.045  1.00 0.00 ? 14  ARG A H    7  
ATOM 10646 H HA   . ARG A 1 14  ? -4.212  -15.804 1.378   1.00 0.00 ? 14  ARG A HA   7  
ATOM 10647 H HB2  . ARG A 1 14  ? -2.799  -16.798 -0.957  1.00 0.00 ? 14  ARG A HB2  7  
ATOM 10648 H HB3  . ARG A 1 14  ? -2.405  -15.103 -0.753  1.00 0.00 ? 14  ARG A HB3  7  
ATOM 10649 H HG2  . ARG A 1 14  ? -1.332  -15.441 1.277   1.00 0.00 ? 14  ARG A HG2  7  
ATOM 10650 H HG3  . ARG A 1 14  ? -2.395  -16.753 1.748   1.00 0.00 ? 14  ARG A HG3  7  
ATOM 10651 H HD2  . ARG A 1 14  ? -1.004  -18.340 0.868   1.00 0.00 ? 14  ARG A HD2  7  
ATOM 10652 H HD3  . ARG A 1 14  ? -0.796  -17.452 -0.628  1.00 0.00 ? 14  ARG A HD3  7  
ATOM 10653 H HE   . ARG A 1 14  ? 0.639   -16.090 1.446   1.00 0.00 ? 14  ARG A HE   7  
ATOM 10654 H HH11 . ARG A 1 14  ? 0.779   -19.058 -0.440  1.00 0.00 ? 14  ARG A HH11 7  
ATOM 10655 H HH12 . ARG A 1 14  ? 2.501   -19.204 -0.320  1.00 0.00 ? 14  ARG A HH12 7  
ATOM 10656 H HH21 . ARG A 1 14  ? 2.910   -16.282 1.604   1.00 0.00 ? 14  ARG A HH21 7  
ATOM 10657 H HH22 . ARG A 1 14  ? 3.721   -17.614 0.851   1.00 0.00 ? 14  ARG A HH22 7  
ATOM 10658 N N    . PRO A 1 15  ? -4.380  -13.325 0.717   1.00 0.00 ? 15  PRO A N    7  
ATOM 10659 C CA   . PRO A 1 15  ? -4.754  -11.953 0.418   1.00 0.00 ? 15  PRO A CA   7  
ATOM 10660 C C    . PRO A 1 15  ? -3.807  -11.340 -0.615  1.00 0.00 ? 15  PRO A C    7  
ATOM 10661 O O    . PRO A 1 15  ? -4.128  -10.326 -1.232  1.00 0.00 ? 15  PRO A O    7  
ATOM 10662 C CB   . PRO A 1 15  ? -4.718  -11.235 1.757   1.00 0.00 ? 15  PRO A CB   7  
ATOM 10663 C CG   . PRO A 1 15  ? -3.881  -12.109 2.676   1.00 0.00 ? 15  PRO A CG   7  
ATOM 10664 C CD   . PRO A 1 15  ? -3.727  -13.469 2.015   1.00 0.00 ? 15  PRO A CD   7  
ATOM 10665 H HA   . PRO A 1 15  ? -5.664  -11.924 0.005   1.00 0.00 ? 15  PRO A HA   7  
ATOM 10666 H HB2  . PRO A 1 15  ? -4.280  -10.242 1.656   1.00 0.00 ? 15  PRO A HB2  7  
ATOM 10667 H HB3  . PRO A 1 15  ? -5.724  -11.100 2.155   1.00 0.00 ? 15  PRO A HB3  7  
ATOM 10668 H HG2  . PRO A 1 15  ? -2.905  -11.656 2.849   1.00 0.00 ? 15  PRO A HG2  7  
ATOM 10669 H HG3  . PRO A 1 15  ? -4.362  -12.210 3.649   1.00 0.00 ? 15  PRO A HG3  7  
ATOM 10670 H HD2  . PRO A 1 15  ? -2.677  -13.738 1.902   1.00 0.00 ? 15  PRO A HD2  7  
ATOM 10671 H HD3  . PRO A 1 15  ? -4.195  -14.253 2.609   1.00 0.00 ? 15  PRO A HD3  7  
ATOM 10672 N N    . TYR A 1 16  ? -2.658  -11.981 -0.772  1.00 0.00 ? 16  TYR A N    7  
ATOM 10673 C CA   . TYR A 1 16  ? -1.662  -11.512 -1.720  1.00 0.00 ? 16  TYR A CA   7  
ATOM 10674 C C    . TYR A 1 16  ? -1.053  -10.184 -1.263  1.00 0.00 ? 16  TYR A C    7  
ATOM 10675 O O    . TYR A 1 16  ? 0.148   -10.102 -1.013  1.00 0.00 ? 16  TYR A O    7  
ATOM 10676 C CB   . TYR A 1 16  ? -2.405  -11.291 -3.038  1.00 0.00 ? 16  TYR A CB   7  
ATOM 10677 C CG   . TYR A 1 16  ? -3.491  -12.331 -3.322  1.00 0.00 ? 16  TYR A CG   7  
ATOM 10678 C CD1  . TYR A 1 16  ? -3.165  -13.671 -3.379  1.00 0.00 ? 16  TYR A CD1  7  
ATOM 10679 C CD2  . TYR A 1 16  ? -4.796  -11.930 -3.521  1.00 0.00 ? 16  TYR A CD2  7  
ATOM 10680 C CE1  . TYR A 1 16  ? -4.187  -14.650 -3.646  1.00 0.00 ? 16  TYR A CE1  7  
ATOM 10681 C CE2  . TYR A 1 16  ? -5.818  -12.908 -3.788  1.00 0.00 ? 16  TYR A CE2  7  
ATOM 10682 C CZ   . TYR A 1 16  ? -5.463  -14.220 -3.838  1.00 0.00 ? 16  TYR A CZ   7  
ATOM 10683 O OH   . TYR A 1 16  ? -6.428  -15.145 -4.090  1.00 0.00 ? 16  TYR A OH   7  
ATOM 10684 H H    . TYR A 1 16  ? -2.404  -12.806 -0.266  1.00 0.00 ? 16  TYR A H    7  
ATOM 10685 H HA   . TYR A 1 16  ? -0.874  -12.263 -1.779  1.00 0.00 ? 16  TYR A HA   7  
ATOM 10686 H HB2  . TYR A 1 16  ? -2.860  -10.301 -3.026  1.00 0.00 ? 16  TYR A HB2  7  
ATOM 10687 H HB3  . TYR A 1 16  ? -1.684  -11.301 -3.856  1.00 0.00 ? 16  TYR A HB3  7  
ATOM 10688 H HD1  . TYR A 1 16  ? -2.134  -13.988 -3.222  1.00 0.00 ? 16  TYR A HD1  7  
ATOM 10689 H HD2  . TYR A 1 16  ? -5.054  -10.871 -3.476  1.00 0.00 ? 16  TYR A HD2  7  
ATOM 10690 H HE1  . TYR A 1 16  ? -3.943  -15.711 -3.694  1.00 0.00 ? 16  TYR A HE1  7  
ATOM 10691 H HE2  . TYR A 1 16  ? -6.853  -12.605 -3.947  1.00 0.00 ? 16  TYR A HE2  7  
ATOM 10692 H HH   . TYR A 1 16  ? -6.593  -15.206 -5.074  1.00 0.00 ? 16  TYR A HH   7  
ATOM 10693 N N    . VAL A 1 17  ? -1.910  -9.179  -1.168  1.00 0.00 ? 17  VAL A N    7  
ATOM 10694 C CA   . VAL A 1 17  ? -1.472  -7.859  -0.745  1.00 0.00 ? 17  VAL A CA   7  
ATOM 10695 C C    . VAL A 1 17  ? -2.571  -7.207  0.097   1.00 0.00 ? 17  VAL A C    7  
ATOM 10696 O O    . VAL A 1 17  ? -3.744  -7.241  -0.272  1.00 0.00 ? 17  VAL A O    7  
ATOM 10697 C CB   . VAL A 1 17  ? -1.079  -7.023  -1.965  1.00 0.00 ? 17  VAL A CB   7  
ATOM 10698 C CG1  . VAL A 1 17  ? -2.288  -6.770  -2.869  1.00 0.00 ? 17  VAL A CG1  7  
ATOM 10699 C CG2  . VAL A 1 17  ? -0.427  -5.706  -1.540  1.00 0.00 ? 17  VAL A CG2  7  
ATOM 10700 H H    . VAL A 1 17  ? -2.886  -9.254  -1.373  1.00 0.00 ? 17  VAL A H    7  
ATOM 10701 H HA   . VAL A 1 17  ? -0.585  -7.990  -0.126  1.00 0.00 ? 17  VAL A HA   7  
ATOM 10702 H HB   . VAL A 1 17  ? -0.346  -7.591  -2.538  1.00 0.00 ? 17  VAL A HB   7  
ATOM 10703 H HG11 . VAL A 1 17  ? -2.505  -7.669  -3.445  1.00 0.00 ? 17  VAL A HG11 7  
ATOM 10704 H HG12 . VAL A 1 17  ? -3.152  -6.512  -2.256  1.00 0.00 ? 17  VAL A HG12 7  
ATOM 10705 H HG13 . VAL A 1 17  ? -2.066  -5.947  -3.549  1.00 0.00 ? 17  VAL A HG13 7  
ATOM 10706 H HG21 . VAL A 1 17  ? 0.115   -5.280  -2.384  1.00 0.00 ? 17  VAL A HG21 7  
ATOM 10707 H HG22 . VAL A 1 17  ? -1.197  -5.008  -1.213  1.00 0.00 ? 17  VAL A HG22 7  
ATOM 10708 H HG23 . VAL A 1 17  ? 0.267   -5.893  -0.720  1.00 0.00 ? 17  VAL A HG23 7  
ATOM 10709 N N    . GLU A 1 18  ? -2.151  -6.629  1.213   1.00 0.00 ? 18  GLU A N    7  
ATOM 10710 C CA   . GLU A 1 18  ? -3.085  -5.971  2.111   1.00 0.00 ? 18  GLU A CA   7  
ATOM 10711 C C    . GLU A 1 18  ? -4.119  -5.176  1.312   1.00 0.00 ? 18  GLU A C    7  
ATOM 10712 O O    . GLU A 1 18  ? -3.801  -4.134  0.741   1.00 0.00 ? 18  GLU A O    7  
ATOM 10713 C CB   . GLU A 1 18  ? -2.347  -5.069  3.103   1.00 0.00 ? 18  GLU A CB   7  
ATOM 10714 C CG   . GLU A 1 18  ? -1.143  -5.791  3.710   1.00 0.00 ? 18  GLU A CG   7  
ATOM 10715 C CD   . GLU A 1 18  ? -0.922  -5.363  5.163   1.00 0.00 ? 18  GLU A CD   7  
ATOM 10716 O OE1  . GLU A 1 18  ? -0.838  -4.136  5.386   1.00 0.00 ? 18  GLU A OE1  7  
ATOM 10717 O OE2  . GLU A 1 18  ? -0.842  -6.272  6.017   1.00 0.00 ? 18  GLU A OE2  7  
ATOM 10718 H H    . GLU A 1 18  ? -1.195  -6.606  1.506   1.00 0.00 ? 18  GLU A H    7  
ATOM 10719 H HA   . GLU A 1 18  ? -3.577  -6.775  2.658   1.00 0.00 ? 18  GLU A HA   7  
ATOM 10720 H HB2  . GLU A 1 18  ? -2.015  -4.162  2.598   1.00 0.00 ? 18  GLU A HB2  7  
ATOM 10721 H HB3  . GLU A 1 18  ? -3.029  -4.761  3.896   1.00 0.00 ? 18  GLU A HB3  7  
ATOM 10722 H HG2  . GLU A 1 18  ? -1.300  -6.869  3.665   1.00 0.00 ? 18  GLU A HG2  7  
ATOM 10723 H HG3  . GLU A 1 18  ? -0.251  -5.574  3.123   1.00 0.00 ? 18  GLU A HG3  7  
ATOM 10724 N N    . GLU A 1 19  ? -5.337  -5.699  1.297   1.00 0.00 ? 19  GLU A N    7  
ATOM 10725 C CA   . GLU A 1 19  ? -6.420  -5.051  0.577   1.00 0.00 ? 19  GLU A CA   7  
ATOM 10726 C C    . GLU A 1 19  ? -6.311  -3.530  0.709   1.00 0.00 ? 19  GLU A C    7  
ATOM 10727 O O    . GLU A 1 19  ? -5.714  -3.028  1.659   1.00 0.00 ? 19  GLU A O    7  
ATOM 10728 C CB   . GLU A 1 19  ? -7.780  -5.547  1.070   1.00 0.00 ? 19  GLU A CB   7  
ATOM 10729 C CG   . GLU A 1 19  ? -7.967  -7.034  0.760   1.00 0.00 ? 19  GLU A CG   7  
ATOM 10730 C CD   . GLU A 1 19  ? -8.328  -7.817  2.024   1.00 0.00 ? 19  GLU A CD   7  
ATOM 10731 O OE1  . GLU A 1 19  ? -9.309  -7.409  2.683   1.00 0.00 ? 19  GLU A OE1  7  
ATOM 10732 O OE2  . GLU A 1 19  ? -7.616  -8.806  2.302   1.00 0.00 ? 19  GLU A OE2  7  
ATOM 10733 H H    . GLU A 1 19  ? -5.587  -6.547  1.764   1.00 0.00 ? 19  GLU A H    7  
ATOM 10734 H HA   . GLU A 1 19  ? -6.290  -5.342  -0.466  1.00 0.00 ? 19  GLU A HA   7  
ATOM 10735 H HB2  . GLU A 1 19  ? -7.864  -5.384  2.145   1.00 0.00 ? 19  GLU A HB2  7  
ATOM 10736 H HB3  . GLU A 1 19  ? -8.575  -4.971  0.598   1.00 0.00 ? 19  GLU A HB3  7  
ATOM 10737 H HG2  . GLU A 1 19  ? -8.752  -7.158  0.014   1.00 0.00 ? 19  GLU A HG2  7  
ATOM 10738 H HG3  . GLU A 1 19  ? -7.051  -7.437  0.328   1.00 0.00 ? 19  GLU A HG3  7  
ATOM 10739 N N    . PRO A 1 20  ? -6.912  -2.822  -0.285  1.00 0.00 ? 20  PRO A N    7  
ATOM 10740 C CA   . PRO A 1 20  ? -6.888  -1.370  -0.288  1.00 0.00 ? 20  PRO A CA   7  
ATOM 10741 C C    . PRO A 1 20  ? -7.858  -0.802  0.750   1.00 0.00 ? 20  PRO A C    7  
ATOM 10742 O O    . PRO A 1 20  ? -9.017  -1.210  0.810   1.00 0.00 ? 20  PRO A O    7  
ATOM 10743 C CB   . PRO A 1 20  ? -7.244  -0.974  -1.712  1.00 0.00 ? 20  PRO A CB   7  
ATOM 10744 C CG   . PRO A 1 20  ? -7.906  -2.195  -2.331  1.00 0.00 ? 20  PRO A CG   7  
ATOM 10745 C CD   . PRO A 1 20  ? -7.628  -3.384  -1.426  1.00 0.00 ? 20  PRO A CD   7  
ATOM 10746 H HA   . PRO A 1 20  ? -5.982  -1.037  -0.027  1.00 0.00 ? 20  PRO A HA   7  
ATOM 10747 H HB2  . PRO A 1 20  ? -7.918  -0.117  -1.722  1.00 0.00 ? 20  PRO A HB2  7  
ATOM 10748 H HB3  . PRO A 1 20  ? -6.354  -0.687  -2.272  1.00 0.00 ? 20  PRO A HB3  7  
ATOM 10749 H HG2  . PRO A 1 20  ? -8.979  -2.036  -2.434  1.00 0.00 ? 20  PRO A HG2  7  
ATOM 10750 H HG3  . PRO A 1 20  ? -7.513  -2.376  -3.331  1.00 0.00 ? 20  PRO A HG3  7  
ATOM 10751 H HD2  . PRO A 1 20  ? -8.553  -3.869  -1.114  1.00 0.00 ? 20  PRO A HD2  7  
ATOM 10752 H HD3  . PRO A 1 20  ? -7.030  -4.139  -1.937  1.00 0.00 ? 20  PRO A HD3  7  
ATOM 10753 N N    . ARG A 1 21  ? -7.347  0.129   1.543   1.00 0.00 ? 21  ARG A N    7  
ATOM 10754 C CA   . ARG A 1 21  ? -8.154  0.756   2.576   1.00 0.00 ? 21  ARG A CA   7  
ATOM 10755 C C    . ARG A 1 21  ? -8.537  2.178   2.160   1.00 0.00 ? 21  ARG A C    7  
ATOM 10756 O O    . ARG A 1 21  ? -8.011  2.705   1.181   1.00 0.00 ? 21  ARG A O    7  
ATOM 10757 C CB   . ARG A 1 21  ? -7.402  0.807   3.907   1.00 0.00 ? 21  ARG A CB   7  
ATOM 10758 C CG   . ARG A 1 21  ? -6.345  1.914   3.898   1.00 0.00 ? 21  ARG A CG   7  
ATOM 10759 C CD   . ARG A 1 21  ? -5.339  1.720   5.034   1.00 0.00 ? 21  ARG A CD   7  
ATOM 10760 N NE   . ARG A 1 21  ? -5.693  2.591   6.178   1.00 0.00 ? 21  ARG A NE   7  
ATOM 10761 C CZ   . ARG A 1 21  ? -4.969  2.687   7.301   1.00 0.00 ? 21  ARG A CZ   7  
ATOM 10762 N NH1  . ARG A 1 21  ? -3.847  1.967   7.439   1.00 0.00 ? 21  ARG A NH1  7  
ATOM 10763 N NH2  . ARG A 1 21  ? -5.367  3.503   8.287   1.00 0.00 ? 21  ARG A NH2  7  
ATOM 10764 H H    . ARG A 1 21  ? -6.404  0.454   1.488   1.00 0.00 ? 21  ARG A H    7  
ATOM 10765 H HA   . ARG A 1 21  ? -9.036  0.122   2.664   1.00 0.00 ? 21  ARG A HA   7  
ATOM 10766 H HB2  . ARG A 1 21  ? -8.106  0.978   4.721   1.00 0.00 ? 21  ARG A HB2  7  
ATOM 10767 H HB3  . ARG A 1 21  ? -6.924  -0.155  4.096   1.00 0.00 ? 21  ARG A HB3  7  
ATOM 10768 H HG2  . ARG A 1 21  ? -5.823  1.915   2.941   1.00 0.00 ? 21  ARG A HG2  7  
ATOM 10769 H HG3  . ARG A 1 21  ? -6.830  2.885   3.998   1.00 0.00 ? 21  ARG A HG3  7  
ATOM 10770 H HD2  . ARG A 1 21  ? -5.330  0.677   5.350   1.00 0.00 ? 21  ARG A HD2  7  
ATOM 10771 H HD3  . ARG A 1 21  ? -4.334  1.956   4.685   1.00 0.00 ? 21  ARG A HD3  7  
ATOM 10772 H HE   . ARG A 1 21  ? -6.525  3.141   6.108   1.00 0.00 ? 21  ARG A HE   7  
ATOM 10773 H HH11 . ARG A 1 21  ? -3.550  1.359   6.703   1.00 0.00 ? 21  ARG A HH11 7  
ATOM 10774 H HH12 . ARG A 1 21  ? -3.307  2.039   8.277   1.00 0.00 ? 21  ARG A HH12 7  
ATOM 10775 H HH21 . ARG A 1 21  ? -6.204  4.040   8.184   1.00 0.00 ? 21  ARG A HH21 7  
ATOM 10776 H HH22 . ARG A 1 21  ? -4.827  3.575   9.125   1.00 0.00 ? 21  ARG A HH22 7  
ATOM 10777 N N    . HIS A 1 22  ? -9.450  2.758   2.925   1.00 0.00 ? 22  HIS A N    7  
ATOM 10778 C CA   . HIS A 1 22  ? -9.910  4.108   2.648   1.00 0.00 ? 22  HIS A CA   7  
ATOM 10779 C C    . HIS A 1 22  ? -9.581  5.016   3.835   1.00 0.00 ? 22  HIS A C    7  
ATOM 10780 O O    . HIS A 1 22  ? -10.208 4.919   4.888   1.00 0.00 ? 22  HIS A O    7  
ATOM 10781 C CB   . HIS A 1 22  ? -11.398 4.113   2.293   1.00 0.00 ? 22  HIS A CB   7  
ATOM 10782 C CG   . HIS A 1 22  ? -11.755 3.220   1.129   1.00 0.00 ? 22  HIS A CG   7  
ATOM 10783 N ND1  . HIS A 1 22  ? -11.303 1.917   1.017   1.00 0.00 ? 22  HIS A ND1  7  
ATOM 10784 C CD2  . HIS A 1 22  ? -12.525 3.456   0.028   1.00 0.00 ? 22  HIS A CD2  7  
ATOM 10785 C CE1  . HIS A 1 22  ? -11.784 1.402   -0.104  1.00 0.00 ? 22  HIS A CE1  7  
ATOM 10786 N NE2  . HIS A 1 22  ? -12.541 2.357   -0.717  1.00 0.00 ? 22  HIS A NE2  7  
ATOM 10787 H H    . HIS A 1 22  ? -9.873  2.322   3.719   1.00 0.00 ? 22  HIS A H    7  
ATOM 10788 H HA   . HIS A 1 22  ? -9.358  4.453   1.774   1.00 0.00 ? 22  HIS A HA   7  
ATOM 10789 H HB2  . HIS A 1 22  ? -11.971 3.801   3.166   1.00 0.00 ? 22  HIS A HB2  7  
ATOM 10790 H HB3  . HIS A 1 22  ? -11.702 5.134   2.061   1.00 0.00 ? 22  HIS A HB3  7  
ATOM 10791 H HD1  . HIS A 1 22  ? -10.713 1.445   1.672   1.00 0.00 ? 22  HIS A HD1  7  
ATOM 10792 H HD2  . HIS A 1 22  ? -13.039 4.389   -0.202  1.00 0.00 ? 22  HIS A HD2  7  
ATOM 10793 H HE1  . HIS A 1 22  ? -11.607 0.391   -0.473  1.00 0.00 ? 22  HIS A HE1  7  
ATOM 10794 N N    . VAL A 1 23  ? -8.596  5.878   3.624   1.00 0.00 ? 23  VAL A N    7  
ATOM 10795 C CA   . VAL A 1 23  ? -8.176  6.802   4.663   1.00 0.00 ? 23  VAL A CA   7  
ATOM 10796 C C    . VAL A 1 23  ? -8.904  8.135   4.480   1.00 0.00 ? 23  VAL A C    7  
ATOM 10797 O O    . VAL A 1 23  ? -8.776  8.778   3.439   1.00 0.00 ? 23  VAL A O    7  
ATOM 10798 C CB   . VAL A 1 23  ? -6.653  6.946   4.651   1.00 0.00 ? 23  VAL A CB   7  
ATOM 10799 C CG1  . VAL A 1 23  ? -6.198  8.051   5.607   1.00 0.00 ? 23  VAL A CG1  7  
ATOM 10800 C CG2  . VAL A 1 23  ? -5.973  5.617   4.986   1.00 0.00 ? 23  VAL A CG2  7  
ATOM 10801 H H    . VAL A 1 23  ? -8.091  5.950   2.764   1.00 0.00 ? 23  VAL A H    7  
ATOM 10802 H HA   . VAL A 1 23  ? -8.466  6.373   5.622   1.00 0.00 ? 23  VAL A HA   7  
ATOM 10803 H HB   . VAL A 1 23  ? -6.352  7.231   3.642   1.00 0.00 ? 23  VAL A HB   7  
ATOM 10804 H HG11 . VAL A 1 23  ? -6.288  7.701   6.635   1.00 0.00 ? 23  VAL A HG11 7  
ATOM 10805 H HG12 . VAL A 1 23  ? -5.159  8.307   5.399   1.00 0.00 ? 23  VAL A HG12 7  
ATOM 10806 H HG13 . VAL A 1 23  ? -6.825  8.932   5.467   1.00 0.00 ? 23  VAL A HG13 7  
ATOM 10807 H HG21 . VAL A 1 23  ? -4.892  5.751   4.984   1.00 0.00 ? 23  VAL A HG21 7  
ATOM 10808 H HG22 . VAL A 1 23  ? -6.296  5.283   5.973   1.00 0.00 ? 23  VAL A HG22 7  
ATOM 10809 H HG23 . VAL A 1 23  ? -6.249  4.870   4.242   1.00 0.00 ? 23  VAL A HG23 7  
ATOM 10810 N N    . LYS A 1 24  ? -9.653  8.510   5.506   1.00 0.00 ? 24  LYS A N    7  
ATOM 10811 C CA   . LYS A 1 24  ? -10.401 9.755   5.471   1.00 0.00 ? 24  LYS A CA   7  
ATOM 10812 C C    . LYS A 1 24  ? -9.476  10.913  5.851   1.00 0.00 ? 24  LYS A C    7  
ATOM 10813 O O    . LYS A 1 24  ? -8.490  10.717  6.560   1.00 0.00 ? 24  LYS A O    7  
ATOM 10814 C CB   . LYS A 1 24  ? -11.651 9.653   6.347   1.00 0.00 ? 24  LYS A CB   7  
ATOM 10815 C CG   . LYS A 1 24  ? -12.922 9.668   5.494   1.00 0.00 ? 24  LYS A CG   7  
ATOM 10816 C CD   . LYS A 1 24  ? -13.620 11.028  5.574   1.00 0.00 ? 24  LYS A CD   7  
ATOM 10817 C CE   . LYS A 1 24  ? -15.126 10.884  5.346   1.00 0.00 ? 24  LYS A CE   7  
ATOM 10818 N NZ   . LYS A 1 24  ? -15.536 11.609  4.123   1.00 0.00 ? 24  LYS A NZ   7  
ATOM 10819 H H    . LYS A 1 24  ? -9.752  7.981   6.349   1.00 0.00 ? 24  LYS A H    7  
ATOM 10820 H HA   . LYS A 1 24  ? -10.738 9.905   4.445   1.00 0.00 ? 24  LYS A HA   7  
ATOM 10821 H HB2  . LYS A 1 24  ? -11.615 8.737   6.935   1.00 0.00 ? 24  LYS A HB2  7  
ATOM 10822 H HB3  . LYS A 1 24  ? -11.673 10.484  7.053   1.00 0.00 ? 24  LYS A HB3  7  
ATOM 10823 H HG2  . LYS A 1 24  ? -12.670 9.445   4.458   1.00 0.00 ? 24  LYS A HG2  7  
ATOM 10824 H HG3  . LYS A 1 24  ? -13.601 8.886   5.833   1.00 0.00 ? 24  LYS A HG3  7  
ATOM 10825 H HD2  . LYS A 1 24  ? -13.436 11.478  6.549   1.00 0.00 ? 24  LYS A HD2  7  
ATOM 10826 H HD3  . LYS A 1 24  ? -13.198 11.701  4.828   1.00 0.00 ? 24  LYS A HD3  7  
ATOM 10827 H HE2  . LYS A 1 24  ? -15.388 9.830   5.257   1.00 0.00 ? 24  LYS A HE2  7  
ATOM 10828 H HE3  . LYS A 1 24  ? -15.668 11.276  6.207   1.00 0.00 ? 24  LYS A HE3  7  
ATOM 10829 H HZ1  . LYS A 1 24  ? -14.724 11.948  3.648   1.00 0.00 ? 24  LYS A HZ1  7  
ATOM 10830 H HZ2  . LYS A 1 24  ? -16.040 10.989  3.522   1.00 0.00 ? 24  LYS A HZ2  7  
ATOM 10831 H HZ3  . LYS A 1 24  ? -16.122 12.380  4.373   1.00 0.00 ? 24  LYS A HZ3  7  
ATOM 10832 N N    . VAL A 1 25  ? -9.827  12.093  5.363   1.00 0.00 ? 25  VAL A N    7  
ATOM 10833 C CA   . VAL A 1 25  ? -9.040  13.283  5.643   1.00 0.00 ? 25  VAL A CA   7  
ATOM 10834 C C    . VAL A 1 25  ? -9.976  14.428  6.035   1.00 0.00 ? 25  VAL A C    7  
ATOM 10835 O O    . VAL A 1 25  ? -11.009 14.634  5.399   1.00 0.00 ? 25  VAL A O    7  
ATOM 10836 C CB   . VAL A 1 25  ? -8.154  13.619  4.442   1.00 0.00 ? 25  VAL A CB   7  
ATOM 10837 C CG1  . VAL A 1 25  ? -7.202  14.771  4.768   1.00 0.00 ? 25  VAL A CG1  7  
ATOM 10838 C CG2  . VAL A 1 25  ? -7.382  12.386  3.968   1.00 0.00 ? 25  VAL A CG2  7  
ATOM 10839 H H    . VAL A 1 25  ? -10.630 12.244  4.787   1.00 0.00 ? 25  VAL A H    7  
ATOM 10840 H HA   . VAL A 1 25  ? -8.390  13.056  6.488   1.00 0.00 ? 25  VAL A HA   7  
ATOM 10841 H HB   . VAL A 1 25  ? -8.803  13.941  3.627   1.00 0.00 ? 25  VAL A HB   7  
ATOM 10842 H HG11 . VAL A 1 25  ? -7.622  15.373  5.574   1.00 0.00 ? 25  VAL A HG11 7  
ATOM 10843 H HG12 . VAL A 1 25  ? -6.238  14.368  5.080   1.00 0.00 ? 25  VAL A HG12 7  
ATOM 10844 H HG13 . VAL A 1 25  ? -7.067  15.392  3.883   1.00 0.00 ? 25  VAL A HG13 7  
ATOM 10845 H HG21 . VAL A 1 25  ? -7.445  11.604  4.725   1.00 0.00 ? 25  VAL A HG21 7  
ATOM 10846 H HG22 . VAL A 1 25  ? -7.813  12.024  3.035   1.00 0.00 ? 25  VAL A HG22 7  
ATOM 10847 H HG23 . VAL A 1 25  ? -6.337  12.652  3.807   1.00 0.00 ? 25  VAL A HG23 7  
ATOM 10848 N N    . GLN A 1 26  ? -9.581  15.142  7.079   1.00 0.00 ? 26  GLN A N    7  
ATOM 10849 C CA   . GLN A 1 26  ? -10.372 16.261  7.562   1.00 0.00 ? 26  GLN A CA   7  
ATOM 10850 C C    . GLN A 1 26  ? -9.628  17.577  7.328   1.00 0.00 ? 26  GLN A C    7  
ATOM 10851 O O    . GLN A 1 26  ? -9.126  18.187  8.270   1.00 0.00 ? 26  GLN A O    7  
ATOM 10852 C CB   . GLN A 1 26  ? -10.723 16.085  9.041   1.00 0.00 ? 26  GLN A CB   7  
ATOM 10853 C CG   . GLN A 1 26  ? -12.207 15.757  9.217   1.00 0.00 ? 26  GLN A CG   7  
ATOM 10854 C CD   . GLN A 1 26  ? -12.751 16.358  10.515  1.00 0.00 ? 26  GLN A CD   7  
ATOM 10855 O OE1  . GLN A 1 26  ? -12.702 17.555  10.743  1.00 0.00 ? 26  GLN A OE1  7  
ATOM 10856 N NE2  . GLN A 1 26  ? -13.271 15.462  11.349  1.00 0.00 ? 26  GLN A NE2  7  
ATOM 10857 H H    . GLN A 1 26  ? -8.740  14.967  7.590   1.00 0.00 ? 26  GLN A H    7  
ATOM 10858 H HA   . GLN A 1 26  ? -11.289 16.243  6.973   1.00 0.00 ? 26  GLN A HA   7  
ATOM 10859 H HB2  . GLN A 1 26  ? -10.117 15.287  9.470   1.00 0.00 ? 26  GLN A HB2  7  
ATOM 10860 H HB3  . GLN A 1 26  ? -10.481 16.997  9.587   1.00 0.00 ? 26  GLN A HB3  7  
ATOM 10861 H HG2  . GLN A 1 26  ? -12.772 16.144  8.369   1.00 0.00 ? 26  GLN A HG2  7  
ATOM 10862 H HG3  . GLN A 1 26  ? -12.346 14.676  9.226   1.00 0.00 ? 26  GLN A HG3  7  
ATOM 10863 H HE21 . GLN A 1 26  ? -13.280 14.493  11.101  1.00 0.00 ? 26  GLN A HE21 7  
ATOM 10864 H HE22 . GLN A 1 26  ? -13.653 15.757  12.225  1.00 0.00 ? 26  GLN A HE22 7  
ATOM 10865 N N    . LYS A 1 27  ? -9.582  17.977  6.065   1.00 0.00 ? 27  LYS A N    7  
ATOM 10866 C CA   . LYS A 1 27  ? -8.908  19.209  5.695   1.00 0.00 ? 27  LYS A CA   7  
ATOM 10867 C C    . LYS A 1 27  ? -9.631  20.394  6.339   1.00 0.00 ? 27  LYS A C    7  
ATOM 10868 O O    . LYS A 1 27  ? -9.446  20.669  7.524   1.00 0.00 ? 27  LYS A O    7  
ATOM 10869 C CB   . LYS A 1 27  ? -8.786  19.317  4.173   1.00 0.00 ? 27  LYS A CB   7  
ATOM 10870 C CG   . LYS A 1 27  ? -7.481  18.688  3.682   1.00 0.00 ? 27  LYS A CG   7  
ATOM 10871 C CD   . LYS A 1 27  ? -7.672  18.025  2.316   1.00 0.00 ? 27  LYS A CD   7  
ATOM 10872 C CE   . LYS A 1 27  ? -6.388  18.099  1.487   1.00 0.00 ? 27  LYS A CE   7  
ATOM 10873 N NZ   . LYS A 1 27  ? -6.534  17.323  0.235   1.00 0.00 ? 27  LYS A NZ   7  
ATOM 10874 H H    . LYS A 1 27  ? -9.993  17.475  5.304   1.00 0.00 ? 27  LYS A H    7  
ATOM 10875 H HA   . LYS A 1 27  ? -7.896  19.162  6.097   1.00 0.00 ? 27  LYS A HA   7  
ATOM 10876 H HB2  . LYS A 1 27  ? -9.634  18.821  3.700   1.00 0.00 ? 27  LYS A HB2  7  
ATOM 10877 H HB3  . LYS A 1 27  ? -8.824  20.365  3.875   1.00 0.00 ? 27  LYS A HB3  7  
ATOM 10878 H HG2  . LYS A 1 27  ? -6.707  19.453  3.615   1.00 0.00 ? 27  LYS A HG2  7  
ATOM 10879 H HG3  . LYS A 1 27  ? -7.135  17.948  4.404   1.00 0.00 ? 27  LYS A HG3  7  
ATOM 10880 H HD2  . LYS A 1 27  ? -7.963  16.984  2.451   1.00 0.00 ? 27  LYS A HD2  7  
ATOM 10881 H HD3  . LYS A 1 27  ? -8.484  18.517  1.780   1.00 0.00 ? 27  LYS A HD3  7  
ATOM 10882 H HE2  . LYS A 1 27  ? -6.158  19.138  1.254   1.00 0.00 ? 27  LYS A HE2  7  
ATOM 10883 H HE3  . LYS A 1 27  ? -5.551  17.709  2.067   1.00 0.00 ? 27  LYS A HE3  7  
ATOM 10884 H HZ1  . LYS A 1 27  ? -7.483  17.372  -0.078  1.00 0.00 ? 27  LYS A HZ1  7  
ATOM 10885 H HZ2  . LYS A 1 27  ? -5.932  17.705  -0.466  1.00 0.00 ? 27  LYS A HZ2  7  
ATOM 10886 H HZ3  . LYS A 1 27  ? -6.287  16.369  0.403   1.00 0.00 ? 27  LYS A HZ3  7  
ATOM 10887 N N    . GLY A 1 28  ? -10.440 21.063  5.531   1.00 0.00 ? 28  GLY A N    7  
ATOM 10888 C CA   . GLY A 1 28  ? -11.191 22.212  6.007   1.00 0.00 ? 28  GLY A CA   7  
ATOM 10889 C C    . GLY A 1 28  ? -10.736 23.494  5.307   1.00 0.00 ? 28  GLY A C    7  
ATOM 10890 O O    . GLY A 1 28  ? -11.470 24.056  4.496   1.00 0.00 ? 28  GLY A O    7  
ATOM 10891 H H    . GLY A 1 28  ? -10.585 20.833  4.569   1.00 0.00 ? 28  GLY A H    7  
ATOM 10892 H HA2  . GLY A 1 28  ? -12.255 22.054  5.830   1.00 0.00 ? 28  GLY A HA2  7  
ATOM 10893 H HA3  . GLY A 1 28  ? -11.060 22.316  7.084   1.00 0.00 ? 28  GLY A HA3  7  
ATOM 10894 N N    . SER A 1 29  ? -9.528  23.918  5.646   1.00 0.00 ? 29  SER A N    7  
ATOM 10895 C CA   . SER A 1 29  ? -8.966  25.123  5.059   1.00 0.00 ? 29  SER A CA   7  
ATOM 10896 C C    . SER A 1 29  ? -7.444  25.001  4.969   1.00 0.00 ? 29  SER A C    7  
ATOM 10897 O O    . SER A 1 29  ? -6.730  25.996  5.087   1.00 0.00 ? 29  SER A O    7  
ATOM 10898 C CB   . SER A 1 29  ? -9.352  26.362  5.870   1.00 0.00 ? 29  SER A CB   7  
ATOM 10899 O OG   . SER A 1 29  ? -10.409 27.095  5.255   1.00 0.00 ? 29  SER A OG   7  
ATOM 10900 H H    . SER A 1 29  ? -8.937  23.455  6.306   1.00 0.00 ? 29  SER A H    7  
ATOM 10901 H HA   . SER A 1 29  ? -9.404  25.191  4.063   1.00 0.00 ? 29  SER A HA   7  
ATOM 10902 H HB2  . SER A 1 29  ? -9.657  26.059  6.872   1.00 0.00 ? 29  SER A HB2  7  
ATOM 10903 H HB3  . SER A 1 29  ? -8.481  27.007  5.983   1.00 0.00 ? 29  SER A HB3  7  
ATOM 10904 H HG   . SER A 1 29  ? -11.140 26.472  4.977   1.00 0.00 ? 29  SER A HG   7  
ATOM 10905 N N    . GLU A 1 30  ? -6.992  23.773  4.761   1.00 0.00 ? 30  GLU A N    7  
ATOM 10906 C CA   . GLU A 1 30  ? -5.567  23.508  4.654   1.00 0.00 ? 30  GLU A CA   7  
ATOM 10907 C C    . GLU A 1 30  ? -5.311  22.380  3.653   1.00 0.00 ? 30  GLU A C    7  
ATOM 10908 O O    . GLU A 1 30  ? -6.200  21.574  3.380   1.00 0.00 ? 30  GLU A O    7  
ATOM 10909 C CB   . GLU A 1 30  ? -4.967  23.175  6.021   1.00 0.00 ? 30  GLU A CB   7  
ATOM 10910 C CG   . GLU A 1 30  ? -4.540  24.447  6.757   1.00 0.00 ? 30  GLU A CG   7  
ATOM 10911 C CD   . GLU A 1 30  ? -3.033  24.676  6.626   1.00 0.00 ? 30  GLU A CD   7  
ATOM 10912 O OE1  . GLU A 1 30  ? -2.282  23.835  7.166   1.00 0.00 ? 30  GLU A OE1  7  
ATOM 10913 O OE2  . GLU A 1 30  ? -2.666  25.687  5.988   1.00 0.00 ? 30  GLU A OE2  7  
ATOM 10914 H H    . GLU A 1 30  ? -7.580  22.970  4.666   1.00 0.00 ? 30  GLU A H    7  
ATOM 10915 H HA   . GLU A 1 30  ? -5.127  24.435  4.286   1.00 0.00 ? 30  GLU A HA   7  
ATOM 10916 H HB2  . GLU A 1 30  ? -5.698  22.632  6.620   1.00 0.00 ? 30  GLU A HB2  7  
ATOM 10917 H HB3  . GLU A 1 30  ? -4.107  22.518  5.894   1.00 0.00 ? 30  GLU A HB3  7  
ATOM 10918 H HG2  . GLU A 1 30  ? -5.078  25.304  6.352   1.00 0.00 ? 30  GLU A HG2  7  
ATOM 10919 H HG3  . GLU A 1 30  ? -4.809  24.370  7.810   1.00 0.00 ? 30  GLU A HG3  7  
ATOM 10920 N N    . PRO A 1 31  ? -4.061  22.357  3.119   1.00 0.00 ? 31  PRO A N    7  
ATOM 10921 C CA   . PRO A 1 31  ? -3.676  21.341  2.155   1.00 0.00 ? 31  PRO A CA   7  
ATOM 10922 C C    . PRO A 1 31  ? -3.445  19.993  2.841   1.00 0.00 ? 31  PRO A C    7  
ATOM 10923 O O    . PRO A 1 31  ? -3.509  19.897  4.066   1.00 0.00 ? 31  PRO A O    7  
ATOM 10924 C CB   . PRO A 1 31  ? -2.427  21.887  1.484   1.00 0.00 ? 31  PRO A CB   7  
ATOM 10925 C CG   . PRO A 1 31  ? -1.893  22.966  2.412   1.00 0.00 ? 31  PRO A CG   7  
ATOM 10926 C CD   . PRO A 1 31  ? -2.983  23.295  3.419   1.00 0.00 ? 31  PRO A CD   7  
ATOM 10927 H HA   . PRO A 1 31  ? -4.415  21.189  1.497   1.00 0.00 ? 31  PRO A HA   7  
ATOM 10928 H HB2  . PRO A 1 31  ? -1.688  21.100  1.334   1.00 0.00 ? 31  PRO A HB2  7  
ATOM 10929 H HB3  . PRO A 1 31  ? -2.659  22.298  0.501   1.00 0.00 ? 31  PRO A HB3  7  
ATOM 10930 H HG2  . PRO A 1 31  ? -0.994  22.620  2.922   1.00 0.00 ? 31  PRO A HG2  7  
ATOM 10931 H HG3  . PRO A 1 31  ? -1.616  23.855  1.845   1.00 0.00 ? 31  PRO A HG3  7  
ATOM 10932 H HD2  . PRO A 1 31  ? -2.626  23.175  4.442   1.00 0.00 ? 31  PRO A HD2  7  
ATOM 10933 H HD3  . PRO A 1 31  ? -3.317  24.328  3.318   1.00 0.00 ? 31  PRO A HD3  7  
ATOM 10934 N N    . LEU A 1 32  ? -3.182  18.985  2.022   1.00 0.00 ? 32  LEU A N    7  
ATOM 10935 C CA   . LEU A 1 32  ? -2.941  17.647  2.535   1.00 0.00 ? 32  LEU A CA   7  
ATOM 10936 C C    . LEU A 1 32  ? -1.539  17.584  3.144   1.00 0.00 ? 32  LEU A C    7  
ATOM 10937 O O    . LEU A 1 32  ? -1.377  17.194  4.300   1.00 0.00 ? 32  LEU A O    7  
ATOM 10938 C CB   . LEU A 1 32  ? -3.185  16.603  1.444   1.00 0.00 ? 32  LEU A CB   7  
ATOM 10939 C CG   . LEU A 1 32  ? -3.383  15.164  1.925   1.00 0.00 ? 32  LEU A CG   7  
ATOM 10940 C CD1  . LEU A 1 32  ? -4.448  15.094  3.021   1.00 0.00 ? 32  LEU A CD1  7  
ATOM 10941 C CD2  . LEU A 1 32  ? -3.704  14.234  0.753   1.00 0.00 ? 32  LEU A CD2  7  
ATOM 10942 H H    . LEU A 1 32  ? -3.132  19.072  1.027   1.00 0.00 ? 32  LEU A H    7  
ATOM 10943 H HA   . LEU A 1 32  ? -3.669  17.464  3.325   1.00 0.00 ? 32  LEU A HA   7  
ATOM 10944 H HB2  . LEU A 1 32  ? -4.066  16.900  0.875   1.00 0.00 ? 32  LEU A HB2  7  
ATOM 10945 H HB3  . LEU A 1 32  ? -2.340  16.622  0.755   1.00 0.00 ? 32  LEU A HB3  7  
ATOM 10946 H HG   . LEU A 1 32  ? -2.447  14.818  2.363   1.00 0.00 ? 32  LEU A HG   7  
ATOM 10947 H HD11 . LEU A 1 32  ? -3.997  15.342  3.982   1.00 0.00 ? 32  LEU A HD11 7  
ATOM 10948 H HD12 . LEU A 1 32  ? -5.245  15.804  2.799   1.00 0.00 ? 32  LEU A HD12 7  
ATOM 10949 H HD13 . LEU A 1 32  ? -4.861  14.086  3.062   1.00 0.00 ? 32  LEU A HD13 7  
ATOM 10950 H HD21 . LEU A 1 32  ? -3.193  14.588  -0.142  1.00 0.00 ? 32  LEU A HD21 7  
ATOM 10951 H HD22 . LEU A 1 32  ? -3.367  13.224  0.988   1.00 0.00 ? 32  LEU A HD22 7  
ATOM 10952 H HD23 . LEU A 1 32  ? -4.780  14.227  0.579   1.00 0.00 ? 32  LEU A HD23 7  
ATOM 10953 N N    . GLY A 1 33  ? -0.561  17.974  2.340   1.00 0.00 ? 33  GLY A N    7  
ATOM 10954 C CA   . GLY A 1 33  ? 0.822   17.967  2.786   1.00 0.00 ? 33  GLY A CA   7  
ATOM 10955 C C    . GLY A 1 33  ? 1.438   16.574  2.638   1.00 0.00 ? 33  GLY A C    7  
ATOM 10956 O O    . GLY A 1 33  ? 1.796   15.941  3.630   1.00 0.00 ? 33  GLY A O    7  
ATOM 10957 H H    . GLY A 1 33  ? -0.701  18.290  1.402   1.00 0.00 ? 33  GLY A H    7  
ATOM 10958 H HA2  . GLY A 1 33  ? 1.399   18.687  2.205   1.00 0.00 ? 33  GLY A HA2  7  
ATOM 10959 H HA3  . GLY A 1 33  ? 0.874   18.283  3.828   1.00 0.00 ? 33  GLY A HA3  7  
ATOM 10960 N N    . ILE A 1 34  ? 1.543   16.137  1.391   1.00 0.00 ? 34  ILE A N    7  
ATOM 10961 C CA   . ILE A 1 34  ? 2.110   14.831  1.101   1.00 0.00 ? 34  ILE A CA   7  
ATOM 10962 C C    . ILE A 1 34  ? 2.836   14.883  -0.245  1.00 0.00 ? 34  ILE A C    7  
ATOM 10963 O O    . ILE A 1 34  ? 2.411   15.591  -1.156  1.00 0.00 ? 34  ILE A O    7  
ATOM 10964 C CB   . ILE A 1 34  ? 1.030   13.750  1.176   1.00 0.00 ? 34  ILE A CB   7  
ATOM 10965 C CG1  . ILE A 1 34  ? -0.204  14.150  0.365   1.00 0.00 ? 34  ILE A CG1  7  
ATOM 10966 C CG2  . ILE A 1 34  ? 0.680   13.425  2.630   1.00 0.00 ? 34  ILE A CG2  7  
ATOM 10967 C CD1  . ILE A 1 34  ? -0.693  12.986  -0.500  1.00 0.00 ? 34  ILE A CD1  7  
ATOM 10968 H H    . ILE A 1 34  ? 1.250   16.658  0.590   1.00 0.00 ? 34  ILE A H    7  
ATOM 10969 H HA   . ILE A 1 34  ? 2.840   14.612  1.880   1.00 0.00 ? 34  ILE A HA   7  
ATOM 10970 H HB   . ILE A 1 34  ? 1.428   12.839  0.729   1.00 0.00 ? 34  ILE A HB   7  
ATOM 10971 H HG12 . ILE A 1 34  ? -1.000  14.466  1.039   1.00 0.00 ? 34  ILE A HG12 7  
ATOM 10972 H HG13 . ILE A 1 34  ? 0.034   15.004  -0.269  1.00 0.00 ? 34  ILE A HG13 7  
ATOM 10973 H HG21 . ILE A 1 34  ? 1.547   12.987  3.123   1.00 0.00 ? 34  ILE A HG21 7  
ATOM 10974 H HG22 . ILE A 1 34  ? 0.391   14.340  3.147   1.00 0.00 ? 34  ILE A HG22 7  
ATOM 10975 H HG23 . ILE A 1 34  ? -0.148  12.717  2.654   1.00 0.00 ? 34  ILE A HG23 7  
ATOM 10976 H HD11 . ILE A 1 34  ? -1.717  13.177  -0.820  1.00 0.00 ? 34  ILE A HD11 7  
ATOM 10977 H HD12 . ILE A 1 34  ? -0.050  12.889  -1.375  1.00 0.00 ? 34  ILE A HD12 7  
ATOM 10978 H HD13 . ILE A 1 34  ? -0.659  12.064  0.080   1.00 0.00 ? 34  ILE A HD13 7  
ATOM 10979 N N    . SER A 1 35  ? 3.919   14.124  -0.326  1.00 0.00 ? 35  SER A N    7  
ATOM 10980 C CA   . SER A 1 35  ? 4.708   14.074  -1.545  1.00 0.00 ? 35  SER A CA   7  
ATOM 10981 C C    . SER A 1 35  ? 4.335   12.834  -2.360  1.00 0.00 ? 35  SER A C    7  
ATOM 10982 O O    . SER A 1 35  ? 4.068   11.773  -1.796  1.00 0.00 ? 35  SER A O    7  
ATOM 10983 C CB   . SER A 1 35  ? 6.205   14.073  -1.233  1.00 0.00 ? 35  SER A CB   7  
ATOM 10984 O OG   . SER A 1 35  ? 6.987   14.446  -2.364  1.00 0.00 ? 35  SER A OG   7  
ATOM 10985 H H    . SER A 1 35  ? 4.257   13.551  0.420   1.00 0.00 ? 35  SER A H    7  
ATOM 10986 H HA   . SER A 1 35  ? 4.452   14.982  -2.092  1.00 0.00 ? 35  SER A HA   7  
ATOM 10987 H HB2  . SER A 1 35  ? 6.404   14.761  -0.411  1.00 0.00 ? 35  SER A HB2  7  
ATOM 10988 H HB3  . SER A 1 35  ? 6.505   13.080  -0.896  1.00 0.00 ? 35  SER A HB3  7  
ATOM 10989 H HG   . SER A 1 35  ? 6.574   14.085  -3.200  1.00 0.00 ? 35  SER A HG   7  
ATOM 10990 N N    . ILE A 1 36  ? 4.328   13.007  -3.673  1.00 0.00 ? 36  ILE A N    7  
ATOM 10991 C CA   . ILE A 1 36  ? 3.992   11.915  -4.571  1.00 0.00 ? 36  ILE A CA   7  
ATOM 10992 C C    . ILE A 1 36  ? 5.036   11.839  -5.687  1.00 0.00 ? 36  ILE A C    7  
ATOM 10993 O O    . ILE A 1 36  ? 5.748   12.809  -5.943  1.00 0.00 ? 36  ILE A O    7  
ATOM 10994 C CB   . ILE A 1 36  ? 2.557   12.062  -5.080  1.00 0.00 ? 36  ILE A CB   7  
ATOM 10995 C CG1  . ILE A 1 36  ? 2.393   13.346  -5.896  1.00 0.00 ? 36  ILE A CG1  7  
ATOM 10996 C CG2  . ILE A 1 36  ? 1.555   11.984  -3.926  1.00 0.00 ? 36  ILE A CG2  7  
ATOM 10997 C CD1  . ILE A 1 36  ? 2.636   13.085  -7.384  1.00 0.00 ? 36  ILE A CD1  7  
ATOM 10998 H H    . ILE A 1 36  ? 4.546   13.873  -4.124  1.00 0.00 ? 36  ILE A H    7  
ATOM 10999 H HA   . ILE A 1 36  ? 4.036   10.992  -3.993  1.00 0.00 ? 36  ILE A HA   7  
ATOM 11000 H HB   . ILE A 1 36  ? 2.344   11.227  -5.748  1.00 0.00 ? 36  ILE A HB   7  
ATOM 11001 H HG12 . ILE A 1 36  ? 1.389   13.747  -5.752  1.00 0.00 ? 36  ILE A HG12 7  
ATOM 11002 H HG13 . ILE A 1 36  ? 3.092   14.101  -5.536  1.00 0.00 ? 36  ILE A HG13 7  
ATOM 11003 H HG21 . ILE A 1 36  ? 0.567   12.277  -4.282  1.00 0.00 ? 36  ILE A HG21 7  
ATOM 11004 H HG22 . ILE A 1 36  ? 1.516   10.963  -3.547  1.00 0.00 ? 36  ILE A HG22 7  
ATOM 11005 H HG23 . ILE A 1 36  ? 1.868   12.657  -3.128  1.00 0.00 ? 36  ILE A HG23 7  
ATOM 11006 H HD11 . ILE A 1 36  ? 2.946   14.011  -7.869  1.00 0.00 ? 36  ILE A HD11 7  
ATOM 11007 H HD12 . ILE A 1 36  ? 3.418   12.335  -7.498  1.00 0.00 ? 36  ILE A HD12 7  
ATOM 11008 H HD13 . ILE A 1 36  ? 1.716   12.724  -7.844  1.00 0.00 ? 36  ILE A HD13 7  
ATOM 11009 N N    . VAL A 1 37  ? 5.093   10.677  -6.322  1.00 0.00 ? 37  VAL A N    7  
ATOM 11010 C CA   . VAL A 1 37  ? 6.038   10.462  -7.404  1.00 0.00 ? 37  VAL A CA   7  
ATOM 11011 C C    . VAL A 1 37  ? 5.457   9.443   -8.387  1.00 0.00 ? 37  VAL A C    7  
ATOM 11012 O O    . VAL A 1 37  ? 4.716   8.545   -7.990  1.00 0.00 ? 37  VAL A O    7  
ATOM 11013 C CB   . VAL A 1 37  ? 7.395   10.040  -6.838  1.00 0.00 ? 37  VAL A CB   7  
ATOM 11014 C CG1  . VAL A 1 37  ? 7.784   10.909  -5.641  1.00 0.00 ? 37  VAL A CG1  7  
ATOM 11015 C CG2  . VAL A 1 37  ? 7.396   8.557   -6.463  1.00 0.00 ? 37  VAL A CG2  7  
ATOM 11016 H H    . VAL A 1 37  ? 4.510   9.894   -6.107  1.00 0.00 ? 37  VAL A H    7  
ATOM 11017 H HA   . VAL A 1 37  ? 6.168   11.413  -7.921  1.00 0.00 ? 37  VAL A HA   7  
ATOM 11018 H HB   . VAL A 1 37  ? 8.143   10.188  -7.617  1.00 0.00 ? 37  VAL A HB   7  
ATOM 11019 H HG11 . VAL A 1 37  ? 7.844   11.952  -5.953  1.00 0.00 ? 37  VAL A HG11 7  
ATOM 11020 H HG12 . VAL A 1 37  ? 7.032   10.807  -4.858  1.00 0.00 ? 37  VAL A HG12 7  
ATOM 11021 H HG13 . VAL A 1 37  ? 8.752   10.588  -5.258  1.00 0.00 ? 37  VAL A HG13 7  
ATOM 11022 H HG21 . VAL A 1 37  ? 6.999   7.972   -7.293  1.00 0.00 ? 37  VAL A HG21 7  
ATOM 11023 H HG22 . VAL A 1 37  ? 8.415   8.237   -6.247  1.00 0.00 ? 37  VAL A HG22 7  
ATOM 11024 H HG23 . VAL A 1 37  ? 6.773   8.405   -5.581  1.00 0.00 ? 37  VAL A HG23 7  
ATOM 11025 N N    . SER A 1 38  ? 5.815   9.617   -9.651  1.00 0.00 ? 38  SER A N    7  
ATOM 11026 C CA   . SER A 1 38  ? 5.338   8.724   -10.693 1.00 0.00 ? 38  SER A CA   7  
ATOM 11027 C C    . SER A 1 38  ? 6.419   7.695   -11.035 1.00 0.00 ? 38  SER A C    7  
ATOM 11028 O O    . SER A 1 38  ? 7.610   7.987   -10.942 1.00 0.00 ? 38  SER A O    7  
ATOM 11029 C CB   . SER A 1 38  ? 4.934   9.505   -11.945 1.00 0.00 ? 38  SER A CB   7  
ATOM 11030 O OG   . SER A 1 38  ? 4.528   8.642   -13.004 1.00 0.00 ? 38  SER A OG   7  
ATOM 11031 H H    . SER A 1 38  ? 6.418   10.350  -9.965  1.00 0.00 ? 38  SER A H    7  
ATOM 11032 H HA   . SER A 1 38  ? 4.461   8.232   -10.273 1.00 0.00 ? 38  SER A HA   7  
ATOM 11033 H HB2  . SER A 1 38  ? 4.119   10.186  -11.700 1.00 0.00 ? 38  SER A HB2  7  
ATOM 11034 H HB3  . SER A 1 38  ? 5.772   10.117  -12.277 1.00 0.00 ? 38  SER A HB3  7  
ATOM 11035 H HG   . SER A 1 38  ? 3.755   9.044   -13.496 1.00 0.00 ? 38  SER A HG   7  
ATOM 11036 N N    . GLY A 1 39  ? 5.963   6.513   -11.423 1.00 0.00 ? 39  GLY A N    7  
ATOM 11037 C CA   . GLY A 1 39  ? 6.876   5.440   -11.780 1.00 0.00 ? 39  GLY A CA   7  
ATOM 11038 C C    . GLY A 1 39  ? 6.590   4.924   -13.191 1.00 0.00 ? 39  GLY A C    7  
ATOM 11039 O O    . GLY A 1 39  ? 5.453   4.975   -13.657 1.00 0.00 ? 39  GLY A O    7  
ATOM 11040 H H    . GLY A 1 39  ? 4.993   6.284   -11.496 1.00 0.00 ? 39  GLY A H    7  
ATOM 11041 H HA2  . GLY A 1 39  ? 7.904   5.797   -11.720 1.00 0.00 ? 39  GLY A HA2  7  
ATOM 11042 H HA3  . GLY A 1 39  ? 6.780   4.624   -11.064 1.00 0.00 ? 39  GLY A HA3  7  
ATOM 11043 N N    . GLU A 1 40  ? 7.643   4.438   -13.833 1.00 0.00 ? 40  GLU A N    7  
ATOM 11044 C CA   . GLU A 1 40  ? 7.520   3.912   -15.182 1.00 0.00 ? 40  GLU A CA   7  
ATOM 11045 C C    . GLU A 1 40  ? 6.536   2.740   -15.208 1.00 0.00 ? 40  GLU A C    7  
ATOM 11046 O O    . GLU A 1 40  ? 6.034   2.370   -16.268 1.00 0.00 ? 40  GLU A O    7  
ATOM 11047 C CB   . GLU A 1 40  ? 8.884   3.495   -15.735 1.00 0.00 ? 40  GLU A CB   7  
ATOM 11048 C CG   . GLU A 1 40  ? 9.458   2.316   -14.947 1.00 0.00 ? 40  GLU A CG   7  
ATOM 11049 C CD   . GLU A 1 40  ? 10.759  1.816   -15.577 1.00 0.00 ? 40  GLU A CD   7  
ATOM 11050 O OE1  . GLU A 1 40  ? 11.817  2.373   -15.212 1.00 0.00 ? 40  GLU A OE1  7  
ATOM 11051 O OE2  . GLU A 1 40  ? 10.667  0.889   -16.410 1.00 0.00 ? 40  GLU A OE2  7  
ATOM 11052 H H    . GLU A 1 40  ? 8.564   4.399   -13.447 1.00 0.00 ? 40  GLU A H    7  
ATOM 11053 H HA   . GLU A 1 40  ? 7.129   4.736   -15.779 1.00 0.00 ? 40  GLU A HA   7  
ATOM 11054 H HB2  . GLU A 1 40  ? 8.787   3.222   -16.786 1.00 0.00 ? 40  GLU A HB2  7  
ATOM 11055 H HB3  . GLU A 1 40  ? 9.573   4.339   -15.687 1.00 0.00 ? 40  GLU A HB3  7  
ATOM 11056 H HG2  . GLU A 1 40  ? 9.641   2.618   -13.916 1.00 0.00 ? 40  GLU A HG2  7  
ATOM 11057 H HG3  . GLU A 1 40  ? 8.729   1.505   -14.917 1.00 0.00 ? 40  GLU A HG3  7  
ATOM 11058 N N    . LYS A 1 41  ? 6.291   2.189   -14.028 1.00 0.00 ? 41  LYS A N    7  
ATOM 11059 C CA   . LYS A 1 41  ? 5.377   1.067   -13.902 1.00 0.00 ? 41  LYS A CA   7  
ATOM 11060 C C    . LYS A 1 41  ? 3.940   1.564   -14.069 1.00 0.00 ? 41  LYS A C    7  
ATOM 11061 O O    . LYS A 1 41  ? 3.120   0.904   -14.705 1.00 0.00 ? 41  LYS A O    7  
ATOM 11062 C CB   . LYS A 1 41  ? 5.621   0.322   -12.588 1.00 0.00 ? 41  LYS A CB   7  
ATOM 11063 C CG   . LYS A 1 41  ? 5.564   -1.193  -12.798 1.00 0.00 ? 41  LYS A CG   7  
ATOM 11064 C CD   . LYS A 1 41  ? 4.218   -1.759  -12.344 1.00 0.00 ? 41  LYS A CD   7  
ATOM 11065 C CE   . LYS A 1 41  ? 4.404   -2.787  -11.226 1.00 0.00 ? 41  LYS A CE   7  
ATOM 11066 N NZ   . LYS A 1 41  ? 3.225   -3.677  -11.138 1.00 0.00 ? 41  LYS A NZ   7  
ATOM 11067 H H    . LYS A 1 41  ? 6.704   2.496   -13.171 1.00 0.00 ? 41  LYS A H    7  
ATOM 11068 H HA   . LYS A 1 41  ? 5.598   0.372   -14.712 1.00 0.00 ? 41  LYS A HA   7  
ATOM 11069 H HB2  . LYS A 1 41  ? 6.594   0.600   -12.183 1.00 0.00 ? 41  LYS A HB2  7  
ATOM 11070 H HB3  . LYS A 1 41  ? 4.874   0.619   -11.853 1.00 0.00 ? 41  LYS A HB3  7  
ATOM 11071 H HG2  . LYS A 1 41  ? 5.723   -1.424  -13.852 1.00 0.00 ? 41  LYS A HG2  7  
ATOM 11072 H HG3  . LYS A 1 41  ? 6.370   -1.671  -12.242 1.00 0.00 ? 41  LYS A HG3  7  
ATOM 11073 H HD2  . LYS A 1 41  ? 3.578   -0.949  -11.994 1.00 0.00 ? 41  LYS A HD2  7  
ATOM 11074 H HD3  . LYS A 1 41  ? 3.710   -2.223  -13.189 1.00 0.00 ? 41  LYS A HD3  7  
ATOM 11075 H HE2  . LYS A 1 41  ? 5.300   -3.379  -11.414 1.00 0.00 ? 41  LYS A HE2  7  
ATOM 11076 H HE3  . LYS A 1 41  ? 4.554   -2.277  -10.275 1.00 0.00 ? 41  LYS A HE3  7  
ATOM 11077 H HZ1  . LYS A 1 41  ? 3.527   -4.630  -11.115 1.00 0.00 ? 41  LYS A HZ1  7  
ATOM 11078 H HZ2  . LYS A 1 41  ? 2.712   -3.470  -10.305 1.00 0.00 ? 41  LYS A HZ2  7  
ATOM 11079 H HZ3  . LYS A 1 41  ? 2.638   -3.533  -11.935 1.00 0.00 ? 41  LYS A HZ3  7  
ATOM 11080 N N    . GLY A 1 42  ? 3.678   2.725   -13.486 1.00 0.00 ? 42  GLY A N    7  
ATOM 11081 C CA   . GLY A 1 42  ? 2.353   3.318   -13.562 1.00 0.00 ? 42  GLY A CA   7  
ATOM 11082 C C    . GLY A 1 42  ? 1.731   3.449   -12.170 1.00 0.00 ? 42  GLY A C    7  
ATOM 11083 O O    . GLY A 1 42  ? 1.800   2.522   -11.365 1.00 0.00 ? 42  GLY A O    7  
ATOM 11084 H H    . GLY A 1 42  ? 4.350   3.256   -12.970 1.00 0.00 ? 42  GLY A H    7  
ATOM 11085 H HA2  . GLY A 1 42  ? 2.418   4.301   -14.029 1.00 0.00 ? 42  GLY A HA2  7  
ATOM 11086 H HA3  . GLY A 1 42  ? 1.712   2.705   -14.195 1.00 0.00 ? 42  GLY A HA3  7  
ATOM 11087 N N    . GLY A 1 43  ? 1.136   4.608   -11.930 1.00 0.00 ? 43  GLY A N    7  
ATOM 11088 C CA   . GLY A 1 43  ? 0.501   4.873   -10.650 1.00 0.00 ? 43  GLY A CA   7  
ATOM 11089 C C    . GLY A 1 43  ? 1.212   6.007   -9.909  1.00 0.00 ? 43  GLY A C    7  
ATOM 11090 O O    . GLY A 1 43  ? 2.142   6.613   -10.439 1.00 0.00 ? 43  GLY A O    7  
ATOM 11091 H H    . GLY A 1 43  ? 1.084   5.358   -12.590 1.00 0.00 ? 43  GLY A H    7  
ATOM 11092 H HA2  . GLY A 1 43  ? -0.545  5.136   -10.806 1.00 0.00 ? 43  GLY A HA2  7  
ATOM 11093 H HA3  . GLY A 1 43  ? 0.515   3.970   -10.040 1.00 0.00 ? 43  GLY A HA3  7  
ATOM 11094 N N    . ILE A 1 44  ? 0.748   6.259   -8.694  1.00 0.00 ? 44  ILE A N    7  
ATOM 11095 C CA   . ILE A 1 44  ? 1.329   7.309   -7.875  1.00 0.00 ? 44  ILE A CA   7  
ATOM 11096 C C    . ILE A 1 44  ? 1.714   6.732   -6.511  1.00 0.00 ? 44  ILE A C    7  
ATOM 11097 O O    . ILE A 1 44  ? 0.924   6.026   -5.886  1.00 0.00 ? 44  ILE A O    7  
ATOM 11098 C CB   . ILE A 1 44  ? 0.381   8.508   -7.789  1.00 0.00 ? 44  ILE A CB   7  
ATOM 11099 C CG1  . ILE A 1 44  ? 0.109   9.091   -9.177  1.00 0.00 ? 44  ILE A CG1  7  
ATOM 11100 C CG2  . ILE A 1 44  ? 0.917   9.562   -6.819  1.00 0.00 ? 44  ILE A CG2  7  
ATOM 11101 C CD1  . ILE A 1 44  ? 1.318   9.876   -9.689  1.00 0.00 ? 44  ILE A CD1  7  
ATOM 11102 H H    . ILE A 1 44  ? -0.008  5.761   -8.270  1.00 0.00 ? 44  ILE A H    7  
ATOM 11103 H HA   . ILE A 1 44  ? 2.235   7.650   -8.374  1.00 0.00 ? 44  ILE A HA   7  
ATOM 11104 H HB   . ILE A 1 44  ? -0.573  8.161   -7.393  1.00 0.00 ? 44  ILE A HB   7  
ATOM 11105 H HG12 . ILE A 1 44  ? -0.129  8.287   -9.874  1.00 0.00 ? 44  ILE A HG12 7  
ATOM 11106 H HG13 . ILE A 1 44  ? -0.763  9.744   -9.137  1.00 0.00 ? 44  ILE A HG13 7  
ATOM 11107 H HG21 . ILE A 1 44  ? 0.150   9.800   -6.081  1.00 0.00 ? 44  ILE A HG21 7  
ATOM 11108 H HG22 . ILE A 1 44  ? 1.801   9.175   -6.313  1.00 0.00 ? 44  ILE A HG22 7  
ATOM 11109 H HG23 . ILE A 1 44  ? 1.180   10.464  -7.372  1.00 0.00 ? 44  ILE A HG23 7  
ATOM 11110 H HD11 . ILE A 1 44  ? 2.233   9.419   -9.313  1.00 0.00 ? 44  ILE A HD11 7  
ATOM 11111 H HD12 . ILE A 1 44  ? 1.326   9.861   -10.779 1.00 0.00 ? 44  ILE A HD12 7  
ATOM 11112 H HD13 . ILE A 1 44  ? 1.256   10.907  -9.341  1.00 0.00 ? 44  ILE A HD13 7  
ATOM 11113 N N    . TYR A 1 45  ? 2.928   7.054   -6.090  1.00 0.00 ? 45  TYR A N    7  
ATOM 11114 C CA   . TYR A 1 45  ? 3.428   6.577   -4.812  1.00 0.00 ? 45  TYR A CA   7  
ATOM 11115 C C    . TYR A 1 45  ? 3.768   7.746   -3.885  1.00 0.00 ? 45  TYR A C    7  
ATOM 11116 O O    . TYR A 1 45  ? 4.198   8.803   -4.344  1.00 0.00 ? 45  TYR A O    7  
ATOM 11117 C CB   . TYR A 1 45  ? 4.709   5.800   -5.124  1.00 0.00 ? 45  TYR A CB   7  
ATOM 11118 C CG   . TYR A 1 45  ? 4.498   4.600   -6.050  1.00 0.00 ? 45  TYR A CG   7  
ATOM 11119 C CD1  . TYR A 1 45  ? 4.191   3.364   -5.519  1.00 0.00 ? 45  TYR A CD1  7  
ATOM 11120 C CD2  . TYR A 1 45  ? 4.616   4.754   -7.416  1.00 0.00 ? 45  TYR A CD2  7  
ATOM 11121 C CE1  . TYR A 1 45  ? 3.993   2.235   -6.390  1.00 0.00 ? 45  TYR A CE1  7  
ATOM 11122 C CE2  . TYR A 1 45  ? 4.418   3.625   -8.288  1.00 0.00 ? 45  TYR A CE2  7  
ATOM 11123 C CZ   . TYR A 1 45  ? 4.116   2.421   -7.732  1.00 0.00 ? 45  TYR A CZ   7  
ATOM 11124 O OH   . TYR A 1 45  ? 3.929   1.355   -8.555  1.00 0.00 ? 45  TYR A OH   7  
ATOM 11125 H H    . TYR A 1 45  ? 3.565   7.629   -6.604  1.00 0.00 ? 45  TYR A H    7  
ATOM 11126 H HA   . TYR A 1 45  ? 2.648   5.972   -4.350  1.00 0.00 ? 45  TYR A HA   7  
ATOM 11127 H HB2  . TYR A 1 45  ? 5.430   6.477   -5.581  1.00 0.00 ? 45  TYR A HB2  7  
ATOM 11128 H HB3  . TYR A 1 45  ? 5.147   5.451   -4.189  1.00 0.00 ? 45  TYR A HB3  7  
ATOM 11129 H HD1  . TYR A 1 45  ? 4.097   3.242   -4.439  1.00 0.00 ? 45  TYR A HD1  7  
ATOM 11130 H HD2  . TYR A 1 45  ? 4.859   5.730   -7.836  1.00 0.00 ? 45  TYR A HD2  7  
ATOM 11131 H HE1  . TYR A 1 45  ? 3.749   1.253   -5.984  1.00 0.00 ? 45  TYR A HE1  7  
ATOM 11132 H HE2  . TYR A 1 45  ? 4.509   3.732   -9.369  1.00 0.00 ? 45  TYR A HE2  7  
ATOM 11133 H HH   . TYR A 1 45  ? 4.526   0.601   -8.279  1.00 0.00 ? 45  TYR A HH   7  
ATOM 11134 N N    . VAL A 1 46  ? 3.564   7.516   -2.596  1.00 0.00 ? 46  VAL A N    7  
ATOM 11135 C CA   . VAL A 1 46  ? 3.843   8.537   -1.600  1.00 0.00 ? 46  VAL A CA   7  
ATOM 11136 C C    . VAL A 1 46  ? 5.354   8.626   -1.379  1.00 0.00 ? 46  VAL A C    7  
ATOM 11137 O O    . VAL A 1 46  ? 5.992   7.639   -1.015  1.00 0.00 ? 46  VAL A O    7  
ATOM 11138 C CB   . VAL A 1 46  ? 3.067   8.241   -0.316  1.00 0.00 ? 46  VAL A CB   7  
ATOM 11139 C CG1  . VAL A 1 46  ? 3.497   9.179   0.814   1.00 0.00 ? 46  VAL A CG1  7  
ATOM 11140 C CG2  . VAL A 1 46  ? 1.558   8.326   -0.554  1.00 0.00 ? 46  VAL A CG2  7  
ATOM 11141 H H    . VAL A 1 46  ? 3.214   6.653   -2.230  1.00 0.00 ? 46  VAL A H    7  
ATOM 11142 H HA   . VAL A 1 46  ? 3.490   9.488   -1.997  1.00 0.00 ? 46  VAL A HA   7  
ATOM 11143 H HB   . VAL A 1 46  ? 3.300   7.221   -0.010  1.00 0.00 ? 46  VAL A HB   7  
ATOM 11144 H HG11 . VAL A 1 46  ? 3.192   10.198  0.576   1.00 0.00 ? 46  VAL A HG11 7  
ATOM 11145 H HG12 . VAL A 1 46  ? 3.026   8.867   1.745   1.00 0.00 ? 46  VAL A HG12 7  
ATOM 11146 H HG13 . VAL A 1 46  ? 4.581   9.142   0.924   1.00 0.00 ? 46  VAL A HG13 7  
ATOM 11147 H HG21 . VAL A 1 46  ? 1.120   9.043   0.141   1.00 0.00 ? 46  VAL A HG21 7  
ATOM 11148 H HG22 . VAL A 1 46  ? 1.370   8.651   -1.578  1.00 0.00 ? 46  VAL A HG22 7  
ATOM 11149 H HG23 . VAL A 1 46  ? 1.109   7.346   -0.396  1.00 0.00 ? 46  VAL A HG23 7  
ATOM 11150 N N    . SER A 1 47  ? 5.884   9.819   -1.607  1.00 0.00 ? 47  SER A N    7  
ATOM 11151 C CA   . SER A 1 47  ? 7.308   10.050  -1.436  1.00 0.00 ? 47  SER A CA   7  
ATOM 11152 C C    . SER A 1 47  ? 7.586   10.597  -0.035  1.00 0.00 ? 47  SER A C    7  
ATOM 11153 O O    . SER A 1 47  ? 8.715   10.532  0.448   1.00 0.00 ? 47  SER A O    7  
ATOM 11154 C CB   . SER A 1 47  ? 7.840   11.016  -2.497  1.00 0.00 ? 47  SER A CB   7  
ATOM 11155 O OG   . SER A 1 47  ? 8.836   11.890  -1.972  1.00 0.00 ? 47  SER A OG   7  
ATOM 11156 H H    . SER A 1 47  ? 5.359   10.617  -1.902  1.00 0.00 ? 47  SER A H    7  
ATOM 11157 H HA   . SER A 1 47  ? 7.777   9.075   -1.567  1.00 0.00 ? 47  SER A HA   7  
ATOM 11158 H HB2  . SER A 1 47  ? 8.258   10.448  -3.328  1.00 0.00 ? 47  SER A HB2  7  
ATOM 11159 H HB3  . SER A 1 47  ? 7.015   11.605  -2.897  1.00 0.00 ? 47  SER A HB3  7  
ATOM 11160 H HG   . SER A 1 47  ? 8.403   12.658  -1.500  1.00 0.00 ? 47  SER A HG   7  
ATOM 11161 N N    . LYS A 1 48  ? 6.536   11.122  0.580   1.00 0.00 ? 48  LYS A N    7  
ATOM 11162 C CA   . LYS A 1 48  ? 6.653   11.679  1.916   1.00 0.00 ? 48  LYS A CA   7  
ATOM 11163 C C    . LYS A 1 48  ? 5.284   12.188  2.374   1.00 0.00 ? 48  LYS A C    7  
ATOM 11164 O O    . LYS A 1 48  ? 4.349   12.265  1.578   1.00 0.00 ? 48  LYS A O    7  
ATOM 11165 C CB   . LYS A 1 48  ? 7.750   12.745  1.959   1.00 0.00 ? 48  LYS A CB   7  
ATOM 11166 C CG   . LYS A 1 48  ? 8.508   12.698  3.287   1.00 0.00 ? 48  LYS A CG   7  
ATOM 11167 C CD   . LYS A 1 48  ? 8.128   13.882  4.178   1.00 0.00 ? 48  LYS A CD   7  
ATOM 11168 C CE   . LYS A 1 48  ? 9.238   14.935  4.195   1.00 0.00 ? 48  LYS A CE   7  
ATOM 11169 N NZ   . LYS A 1 48  ? 8.686   16.274  3.892   1.00 0.00 ? 48  LYS A NZ   7  
ATOM 11170 H H    . LYS A 1 48  ? 5.621   11.171  0.180   1.00 0.00 ? 48  LYS A H    7  
ATOM 11171 H HA   . LYS A 1 48  ? 6.961   10.872  2.581   1.00 0.00 ? 48  LYS A HA   7  
ATOM 11172 H HB2  . LYS A 1 48  ? 8.445   12.591  1.134   1.00 0.00 ? 48  LYS A HB2  7  
ATOM 11173 H HB3  . LYS A 1 48  ? 7.308   13.732  1.823   1.00 0.00 ? 48  LYS A HB3  7  
ATOM 11174 H HG2  . LYS A 1 48  ? 8.287   11.764  3.803   1.00 0.00 ? 48  LYS A HG2  7  
ATOM 11175 H HG3  . LYS A 1 48  ? 9.582   12.711  3.097   1.00 0.00 ? 48  LYS A HG3  7  
ATOM 11176 H HD2  . LYS A 1 48  ? 7.202   14.330  3.818   1.00 0.00 ? 48  LYS A HD2  7  
ATOM 11177 H HD3  . LYS A 1 48  ? 7.938   13.531  5.193   1.00 0.00 ? 48  LYS A HD3  7  
ATOM 11178 H HE2  . LYS A 1 48  ? 9.721   14.946  5.172   1.00 0.00 ? 48  LYS A HE2  7  
ATOM 11179 H HE3  . LYS A 1 48  ? 10.003  14.676  3.463   1.00 0.00 ? 48  LYS A HE3  7  
ATOM 11180 H HZ1  . LYS A 1 48  ? 9.086   16.948  4.513   1.00 0.00 ? 48  LYS A HZ1  7  
ATOM 11181 H HZ2  . LYS A 1 48  ? 8.905   16.519  2.948   1.00 0.00 ? 48  LYS A HZ2  7  
ATOM 11182 H HZ3  . LYS A 1 48  ? 7.693   16.260  4.011   1.00 0.00 ? 48  LYS A HZ3  7  
ATOM 11183 N N    . VAL A 1 49  ? 5.209   12.521  3.654   1.00 0.00 ? 49  VAL A N    7  
ATOM 11184 C CA   . VAL A 1 49  ? 3.970   13.019  4.226   1.00 0.00 ? 49  VAL A CA   7  
ATOM 11185 C C    . VAL A 1 49  ? 4.293   13.991  5.363   1.00 0.00 ? 49  VAL A C    7  
ATOM 11186 O O    . VAL A 1 49  ? 4.650   13.569  6.462   1.00 0.00 ? 49  VAL A O    7  
ATOM 11187 C CB   . VAL A 1 49  ? 3.091   11.849  4.672   1.00 0.00 ? 49  VAL A CB   7  
ATOM 11188 C CG1  . VAL A 1 49  ? 3.887   10.860  5.526   1.00 0.00 ? 49  VAL A CG1  7  
ATOM 11189 C CG2  . VAL A 1 49  ? 1.853   12.347  5.420   1.00 0.00 ? 49  VAL A CG2  7  
ATOM 11190 H H    . VAL A 1 49  ? 5.974   12.455  4.294   1.00 0.00 ? 49  VAL A H    7  
ATOM 11191 H HA   . VAL A 1 49  ? 3.440   13.560  3.442   1.00 0.00 ? 49  VAL A HA   7  
ATOM 11192 H HB   . VAL A 1 49  ? 2.754   11.324  3.778   1.00 0.00 ? 49  VAL A HB   7  
ATOM 11193 H HG11 . VAL A 1 49  ? 4.664   10.397  4.916   1.00 0.00 ? 49  VAL A HG11 7  
ATOM 11194 H HG12 . VAL A 1 49  ? 4.347   11.388  6.360   1.00 0.00 ? 49  VAL A HG12 7  
ATOM 11195 H HG13 . VAL A 1 49  ? 3.218   10.089  5.908   1.00 0.00 ? 49  VAL A HG13 7  
ATOM 11196 H HG21 . VAL A 1 49  ? 1.942   12.096  6.477   1.00 0.00 ? 49  VAL A HG21 7  
ATOM 11197 H HG22 . VAL A 1 49  ? 1.772   13.428  5.309   1.00 0.00 ? 49  VAL A HG22 7  
ATOM 11198 H HG23 . VAL A 1 49  ? 0.963   11.872  5.007   1.00 0.00 ? 49  VAL A HG23 7  
ATOM 11199 N N    . THR A 1 50  ? 4.157   15.273  5.059   1.00 0.00 ? 50  THR A N    7  
ATOM 11200 C CA   . THR A 1 50  ? 4.431   16.308  6.042   1.00 0.00 ? 50  THR A CA   7  
ATOM 11201 C C    . THR A 1 50  ? 3.939   15.874  7.425   1.00 0.00 ? 50  THR A C    7  
ATOM 11202 O O    . THR A 1 50  ? 2.890   15.243  7.545   1.00 0.00 ? 50  THR A O    7  
ATOM 11203 C CB   . THR A 1 50  ? 3.790   17.608  5.551   1.00 0.00 ? 50  THR A CB   7  
ATOM 11204 O OG1  . THR A 1 50  ? 4.423   17.855  4.298   1.00 0.00 ? 50  THR A OG1  7  
ATOM 11205 C CG2  . THR A 1 50  ? 4.179   18.813  6.409   1.00 0.00 ? 50  THR A CG2  7  
ATOM 11206 H H    . THR A 1 50  ? 3.867   15.608  4.163   1.00 0.00 ? 50  THR A H    7  
ATOM 11207 H HA   . THR A 1 50  ? 5.510   16.439  6.113   1.00 0.00 ? 50  THR A HA   7  
ATOM 11208 H HB   . THR A 1 50  ? 2.707   17.508  5.487   1.00 0.00 ? 50  THR A HB   7  
ATOM 11209 H HG1  . THR A 1 50  ? 3.817   18.386  3.707   1.00 0.00 ? 50  THR A HG1  7  
ATOM 11210 H HG21 . THR A 1 50  ? 5.186   19.138  6.144   1.00 0.00 ? 50  THR A HG21 7  
ATOM 11211 H HG22 . THR A 1 50  ? 3.476   19.628  6.232   1.00 0.00 ? 50  THR A HG22 7  
ATOM 11212 H HG23 . THR A 1 50  ? 4.153   18.533  7.462   1.00 0.00 ? 50  THR A HG23 7  
ATOM 11213 N N    . VAL A 1 51  ? 4.722   16.229  8.434   1.00 0.00 ? 51  VAL A N    7  
ATOM 11214 C CA   . VAL A 1 51  ? 4.379   15.883  9.803   1.00 0.00 ? 51  VAL A CA   7  
ATOM 11215 C C    . VAL A 1 51  ? 3.595   17.036  10.434  1.00 0.00 ? 51  VAL A C    7  
ATOM 11216 O O    . VAL A 1 51  ? 4.046   18.180  10.418  1.00 0.00 ? 51  VAL A O    7  
ATOM 11217 C CB   . VAL A 1 51  ? 5.645   15.523  10.583  1.00 0.00 ? 51  VAL A CB   7  
ATOM 11218 C CG1  . VAL A 1 51  ? 5.340   15.352  12.073  1.00 0.00 ? 51  VAL A CG1  7  
ATOM 11219 C CG2  . VAL A 1 51  ? 6.304   14.267  10.010  1.00 0.00 ? 51  VAL A CG2  7  
ATOM 11220 H H    . VAL A 1 51  ? 5.573   16.742  8.327   1.00 0.00 ? 51  VAL A H    7  
ATOM 11221 H HA   . VAL A 1 51  ? 3.741   15.001  9.770   1.00 0.00 ? 51  VAL A HA   7  
ATOM 11222 H HB   . VAL A 1 51  ? 6.350   16.348  10.478  1.00 0.00 ? 51  VAL A HB   7  
ATOM 11223 H HG11 . VAL A 1 51  ? 4.338   15.725  12.284  1.00 0.00 ? 51  VAL A HG11 7  
ATOM 11224 H HG12 . VAL A 1 51  ? 5.398   14.296  12.337  1.00 0.00 ? 51  VAL A HG12 7  
ATOM 11225 H HG13 . VAL A 1 51  ? 6.068   15.913  12.660  1.00 0.00 ? 51  VAL A HG13 7  
ATOM 11226 H HG21 . VAL A 1 51  ? 5.532   13.574  9.673   1.00 0.00 ? 51  VAL A HG21 7  
ATOM 11227 H HG22 . VAL A 1 51  ? 6.938   14.541  9.168   1.00 0.00 ? 51  VAL A HG22 7  
ATOM 11228 H HG23 . VAL A 1 51  ? 6.909   13.790  10.781  1.00 0.00 ? 51  VAL A HG23 7  
ATOM 11229 N N    . GLY A 1 52  ? 2.436   16.693  10.976  1.00 0.00 ? 52  GLY A N    7  
ATOM 11230 C CA   . GLY A 1 52  ? 1.585   17.685  11.611  1.00 0.00 ? 52  GLY A CA   7  
ATOM 11231 C C    . GLY A 1 52  ? 0.572   18.256  10.617  1.00 0.00 ? 52  GLY A C    7  
ATOM 11232 O O    . GLY A 1 52  ? -0.299  19.040  10.993  1.00 0.00 ? 52  GLY A O    7  
ATOM 11233 H H    . GLY A 1 52  ? 2.076   15.760  10.985  1.00 0.00 ? 52  GLY A H    7  
ATOM 11234 H HA2  . GLY A 1 52  ? 1.059   17.233  12.452  1.00 0.00 ? 52  GLY A HA2  7  
ATOM 11235 H HA3  . GLY A 1 52  ? 2.198   18.491  12.014  1.00 0.00 ? 52  GLY A HA3  7  
ATOM 11236 N N    . SER A 1 53  ? 0.719   17.842  9.367   1.00 0.00 ? 53  SER A N    7  
ATOM 11237 C CA   . SER A 1 53  ? -0.172  18.303  8.316   1.00 0.00 ? 53  SER A CA   7  
ATOM 11238 C C    . SER A 1 53  ? -1.414  17.411  8.255   1.00 0.00 ? 53  SER A C    7  
ATOM 11239 O O    . SER A 1 53  ? -1.445  16.341  8.861   1.00 0.00 ? 53  SER A O    7  
ATOM 11240 C CB   . SER A 1 53  ? 0.537   18.319  6.960   1.00 0.00 ? 53  SER A CB   7  
ATOM 11241 O OG   . SER A 1 53  ? 0.782   19.645  6.502   1.00 0.00 ? 53  SER A OG   7  
ATOM 11242 H H    . SER A 1 53  ? 1.430   17.204  9.069   1.00 0.00 ? 53  SER A H    7  
ATOM 11243 H HA   . SER A 1 53  ? -0.445  19.320  8.594   1.00 0.00 ? 53  SER A HA   7  
ATOM 11244 H HB2  . SER A 1 53  ? 1.482   17.782  7.039   1.00 0.00 ? 53  SER A HB2  7  
ATOM 11245 H HB3  . SER A 1 53  ? -0.070  17.788  6.227   1.00 0.00 ? 53  SER A HB3  7  
ATOM 11246 H HG   . SER A 1 53  ? 0.392   19.769  5.589   1.00 0.00 ? 53  SER A HG   7  
ATOM 11247 N N    . ILE A 1 54  ? -2.408  17.885  7.518   1.00 0.00 ? 54  ILE A N    7  
ATOM 11248 C CA   . ILE A 1 54  ? -3.649  17.144  7.370   1.00 0.00 ? 54  ILE A CA   7  
ATOM 11249 C C    . ILE A 1 54  ? -3.336  15.651  7.250   1.00 0.00 ? 54  ILE A C    7  
ATOM 11250 O O    . ILE A 1 54  ? -3.710  14.864  8.118   1.00 0.00 ? 54  ILE A O    7  
ATOM 11251 C CB   . ILE A 1 54  ? -4.466  17.696  6.200   1.00 0.00 ? 54  ILE A CB   7  
ATOM 11252 C CG1  . ILE A 1 54  ? -4.858  19.155  6.445   1.00 0.00 ? 54  ILE A CG1  7  
ATOM 11253 C CG2  . ILE A 1 54  ? -5.685  16.815  5.918   1.00 0.00 ? 54  ILE A CG2  7  
ATOM 11254 C CD1  . ILE A 1 54  ? -5.725  19.287  7.698   1.00 0.00 ? 54  ILE A CD1  7  
ATOM 11255 H H    . ILE A 1 54  ? -2.375  18.756  7.028   1.00 0.00 ? 54  ILE A H    7  
ATOM 11256 H HA   . ILE A 1 54  ? -4.235  17.303  8.275   1.00 0.00 ? 54  ILE A HA   7  
ATOM 11257 H HB   . ILE A 1 54  ? -3.841  17.676  5.307   1.00 0.00 ? 54  ILE A HB   7  
ATOM 11258 H HG12 . ILE A 1 54  ? -3.960  19.763  6.554   1.00 0.00 ? 54  ILE A HG12 7  
ATOM 11259 H HG13 . ILE A 1 54  ? -5.400  19.539  5.581   1.00 0.00 ? 54  ILE A HG13 7  
ATOM 11260 H HG21 . ILE A 1 54  ? -5.591  15.878  6.467   1.00 0.00 ? 54  ILE A HG21 7  
ATOM 11261 H HG22 . ILE A 1 54  ? -6.590  17.333  6.236   1.00 0.00 ? 54  ILE A HG22 7  
ATOM 11262 H HG23 . ILE A 1 54  ? -5.743  16.606  4.850   1.00 0.00 ? 54  ILE A HG23 7  
ATOM 11263 H HD11 . ILE A 1 54  ? -6.172  18.321  7.934   1.00 0.00 ? 54  ILE A HD11 7  
ATOM 11264 H HD12 . ILE A 1 54  ? -5.108  19.615  8.534   1.00 0.00 ? 54  ILE A HD12 7  
ATOM 11265 H HD13 . ILE A 1 54  ? -6.513  20.018  7.520   1.00 0.00 ? 54  ILE A HD13 7  
ATOM 11266 N N    . ALA A 1 55  ? -2.653  15.307  6.169   1.00 0.00 ? 55  ALA A N    7  
ATOM 11267 C CA   . ALA A 1 55  ? -2.285  13.923  5.925   1.00 0.00 ? 55  ALA A CA   7  
ATOM 11268 C C    . ALA A 1 55  ? -1.907  13.259  7.251   1.00 0.00 ? 55  ALA A C    7  
ATOM 11269 O O    . ALA A 1 55  ? -2.587  12.341  7.705   1.00 0.00 ? 55  ALA A O    7  
ATOM 11270 C CB   . ALA A 1 55  ? -1.149  13.869  4.901   1.00 0.00 ? 55  ALA A CB   7  
ATOM 11271 H H    . ALA A 1 55  ? -2.352  15.954  5.468   1.00 0.00 ? 55  ALA A H    7  
ATOM 11272 H HA   . ALA A 1 55  ? -3.156  13.416  5.510   1.00 0.00 ? 55  ALA A HA   7  
ATOM 11273 H HB1  . ALA A 1 55  ? -1.196  14.749  4.259   1.00 0.00 ? 55  ALA A HB1  7  
ATOM 11274 H HB2  . ALA A 1 55  ? -0.192  13.849  5.421   1.00 0.00 ? 55  ALA A HB2  7  
ATOM 11275 H HB3  . ALA A 1 55  ? -1.251  12.970  4.293   1.00 0.00 ? 55  ALA A HB3  7  
ATOM 11276 N N    . HIS A 1 56  ? -0.823  13.750  7.833   1.00 0.00 ? 56  HIS A N    7  
ATOM 11277 C CA   . HIS A 1 56  ? -0.346  13.216  9.098   1.00 0.00 ? 56  HIS A CA   7  
ATOM 11278 C C    . HIS A 1 56  ? -1.538  12.885  9.997   1.00 0.00 ? 56  HIS A C    7  
ATOM 11279 O O    . HIS A 1 56  ? -1.643  11.772  10.511  1.00 0.00 ? 56  HIS A O    7  
ATOM 11280 C CB   . HIS A 1 56  ? 0.644   14.179  9.756   1.00 0.00 ? 56  HIS A CB   7  
ATOM 11281 C CG   . HIS A 1 56  ? 1.726   13.496  10.557  1.00 0.00 ? 56  HIS A CG   7  
ATOM 11282 N ND1  . HIS A 1 56  ? 1.790   13.560  11.938  1.00 0.00 ? 56  HIS A ND1  7  
ATOM 11283 C CD2  . HIS A 1 56  ? 2.784   12.733  10.158  1.00 0.00 ? 56  HIS A CD2  7  
ATOM 11284 C CE1  . HIS A 1 56  ? 2.843   12.865  12.341  1.00 0.00 ? 56  HIS A CE1  7  
ATOM 11285 N NE2  . HIS A 1 56  ? 3.458   12.353  11.236  1.00 0.00 ? 56  HIS A NE2  7  
ATOM 11286 H H    . HIS A 1 56  ? -0.275  14.497  7.457   1.00 0.00 ? 56  HIS A H    7  
ATOM 11287 H HA   . HIS A 1 56  ? 0.190   12.295  8.866   1.00 0.00 ? 56  HIS A HA   7  
ATOM 11288 H HB2  . HIS A 1 56  ? 1.110   14.790  8.982   1.00 0.00 ? 56  HIS A HB2  7  
ATOM 11289 H HB3  . HIS A 1 56  ? 0.095   14.857  10.409  1.00 0.00 ? 56  HIS A HB3  7  
ATOM 11290 H HD1  . HIS A 1 56  ? 1.150   14.048  12.531  1.00 0.00 ? 56  HIS A HD1  7  
ATOM 11291 H HD2  . HIS A 1 56  ? 3.033   12.478  9.128   1.00 0.00 ? 56  HIS A HD2  7  
ATOM 11292 H HE1  . HIS A 1 56  ? 3.162   12.726  13.374  1.00 0.00 ? 56  HIS A HE1  7  
ATOM 11293 N N    . GLN A 1 57  ? -2.407  13.871  10.160  1.00 0.00 ? 57  GLN A N    7  
ATOM 11294 C CA   . GLN A 1 57  ? -3.589  13.699  10.989  1.00 0.00 ? 57  GLN A CA   7  
ATOM 11295 C C    . GLN A 1 57  ? -4.406  12.500  10.505  1.00 0.00 ? 57  GLN A C    7  
ATOM 11296 O O    . GLN A 1 57  ? -4.840  11.675  11.307  1.00 0.00 ? 57  GLN A O    7  
ATOM 11297 C CB   . GLN A 1 57  ? -4.438  14.971  11.004  1.00 0.00 ? 57  GLN A CB   7  
ATOM 11298 C CG   . GLN A 1 57  ? -3.566  16.210  11.221  1.00 0.00 ? 57  GLN A CG   7  
ATOM 11299 C CD   . GLN A 1 57  ? -4.394  17.375  11.766  1.00 0.00 ? 57  GLN A CD   7  
ATOM 11300 O OE1  . GLN A 1 57  ? -5.408  17.764  11.209  1.00 0.00 ? 57  GLN A OE1  7  
ATOM 11301 N NE2  . GLN A 1 57  ? -3.908  17.909  12.883  1.00 0.00 ? 57  GLN A NE2  7  
ATOM 11302 H H    . GLN A 1 57  ? -2.315  14.773  9.738   1.00 0.00 ? 57  GLN A H    7  
ATOM 11303 H HA   . GLN A 1 57  ? -3.212  13.508  11.994  1.00 0.00 ? 57  GLN A HA   7  
ATOM 11304 H HB2  . GLN A 1 57  ? -4.979  15.063  10.063  1.00 0.00 ? 57  GLN A HB2  7  
ATOM 11305 H HB3  . GLN A 1 57  ? -5.184  14.905  11.796  1.00 0.00 ? 57  GLN A HB3  7  
ATOM 11306 H HG2  . GLN A 1 57  ? -2.760  15.975  11.916  1.00 0.00 ? 57  GLN A HG2  7  
ATOM 11307 H HG3  . GLN A 1 57  ? -3.100  16.500  10.279  1.00 0.00 ? 57  GLN A HG3  7  
ATOM 11308 H HE21 . GLN A 1 57  ? -3.071  17.542  13.289  1.00 0.00 ? 57  GLN A HE21 7  
ATOM 11309 H HE22 . GLN A 1 57  ? -4.380  18.677  13.317  1.00 0.00 ? 57  GLN A HE22 7  
ATOM 11310 N N    . ALA A 1 58  ? -4.592  12.441  9.194   1.00 0.00 ? 58  ALA A N    7  
ATOM 11311 C CA   . ALA A 1 58  ? -5.349  11.356  8.593   1.00 0.00 ? 58  ALA A CA   7  
ATOM 11312 C C    . ALA A 1 58  ? -4.668  10.025  8.914   1.00 0.00 ? 58  ALA A C    7  
ATOM 11313 O O    . ALA A 1 58  ? -5.331  9.058   9.286   1.00 0.00 ? 58  ALA A O    7  
ATOM 11314 C CB   . ALA A 1 58  ? -5.480  11.597  7.088   1.00 0.00 ? 58  ALA A CB   7  
ATOM 11315 H H    . ALA A 1 58  ? -4.235  13.116  8.548   1.00 0.00 ? 58  ALA A H    7  
ATOM 11316 H HA   . ALA A 1 58  ? -6.345  11.362  9.037   1.00 0.00 ? 58  ALA A HA   7  
ATOM 11317 H HB1  . ALA A 1 58  ? -5.029  10.765  6.547   1.00 0.00 ? 58  ALA A HB1  7  
ATOM 11318 H HB2  . ALA A 1 58  ? -6.534  11.675  6.822   1.00 0.00 ? 58  ALA A HB2  7  
ATOM 11319 H HB3  . ALA A 1 58  ? -4.968  12.522  6.822   1.00 0.00 ? 58  ALA A HB3  7  
ATOM 11320 N N    . GLY A 1 59  ? -3.352  10.017  8.759   1.00 0.00 ? 59  GLY A N    7  
ATOM 11321 C CA   . GLY A 1 59  ? -2.573  8.820   9.028   1.00 0.00 ? 59  GLY A CA   7  
ATOM 11322 C C    . GLY A 1 59  ? -2.010  8.231   7.733   1.00 0.00 ? 59  GLY A C    7  
ATOM 11323 O O    . GLY A 1 59  ? -2.135  7.032   7.487   1.00 0.00 ? 59  GLY A O    7  
ATOM 11324 H H    . GLY A 1 59  ? -2.820  10.808  8.456   1.00 0.00 ? 59  GLY A H    7  
ATOM 11325 H HA2  . GLY A 1 59  ? -1.756  9.059   9.708   1.00 0.00 ? 59  GLY A HA2  7  
ATOM 11326 H HA3  . GLY A 1 59  ? -3.198  8.080   9.527   1.00 0.00 ? 59  GLY A HA3  7  
ATOM 11327 N N    . LEU A 1 60  ? -1.403  9.100   6.939   1.00 0.00 ? 60  LEU A N    7  
ATOM 11328 C CA   . LEU A 1 60  ? -0.820  8.681   5.676   1.00 0.00 ? 60  LEU A CA   7  
ATOM 11329 C C    . LEU A 1 60  ? 0.646   8.304   5.896   1.00 0.00 ? 60  LEU A C    7  
ATOM 11330 O O    . LEU A 1 60  ? 1.291   8.812   6.812   1.00 0.00 ? 60  LEU A O    7  
ATOM 11331 C CB   . LEU A 1 60  ? -1.025  9.756   4.608   1.00 0.00 ? 60  LEU A CB   7  
ATOM 11332 C CG   . LEU A 1 60  ? -2.361  9.716   3.862   1.00 0.00 ? 60  LEU A CG   7  
ATOM 11333 C CD1  . LEU A 1 60  ? -2.450  10.845  2.834   1.00 0.00 ? 60  LEU A CD1  7  
ATOM 11334 C CD2  . LEU A 1 60  ? -2.593  8.343   3.228   1.00 0.00 ? 60  LEU A CD2  7  
ATOM 11335 H H    . LEU A 1 60  ? -1.306  10.074  7.147   1.00 0.00 ? 60  LEU A H    7  
ATOM 11336 H HA   . LEU A 1 60  ? -1.360  7.792   5.347   1.00 0.00 ? 60  LEU A HA   7  
ATOM 11337 H HB2  . LEU A 1 60  ? -0.925  10.733  5.080   1.00 0.00 ? 60  LEU A HB2  7  
ATOM 11338 H HB3  . LEU A 1 60  ? -0.221  9.672   3.877   1.00 0.00 ? 60  LEU A HB3  7  
ATOM 11339 H HG   . LEU A 1 60  ? -3.161  9.875   4.586   1.00 0.00 ? 60  LEU A HG   7  
ATOM 11340 H HD11 . LEU A 1 60  ? -1.445  11.147  2.539   1.00 0.00 ? 60  LEU A HD11 7  
ATOM 11341 H HD12 . LEU A 1 60  ? -2.997  10.497  1.958   1.00 0.00 ? 60  LEU A HD12 7  
ATOM 11342 H HD13 . LEU A 1 60  ? -2.970  11.696  3.273   1.00 0.00 ? 60  LEU A HD13 7  
ATOM 11343 H HD21 . LEU A 1 60  ? -2.803  8.465   2.165   1.00 0.00 ? 60  LEU A HD21 7  
ATOM 11344 H HD22 . LEU A 1 60  ? -1.701  7.729   3.354   1.00 0.00 ? 60  LEU A HD22 7  
ATOM 11345 H HD23 . LEU A 1 60  ? -3.440  7.857   3.712   1.00 0.00 ? 60  LEU A HD23 7  
ATOM 11346 N N    . GLU A 1 61  ? 1.130   7.416   5.040   1.00 0.00 ? 61  GLU A N    7  
ATOM 11347 C CA   . GLU A 1 61  ? 2.509   6.965   5.130   1.00 0.00 ? 61  GLU A CA   7  
ATOM 11348 C C    . GLU A 1 61  ? 3.116   6.832   3.731   1.00 0.00 ? 61  GLU A C    7  
ATOM 11349 O O    . GLU A 1 61  ? 2.413   6.966   2.730   1.00 0.00 ? 61  GLU A O    7  
ATOM 11350 C CB   . GLU A 1 61  ? 2.605   5.645   5.897   1.00 0.00 ? 61  GLU A CB   7  
ATOM 11351 C CG   . GLU A 1 61  ? 1.797   4.547   5.202   1.00 0.00 ? 61  GLU A CG   7  
ATOM 11352 C CD   . GLU A 1 61  ? 0.466   4.309   5.919   1.00 0.00 ? 61  GLU A CD   7  
ATOM 11353 O OE1  . GLU A 1 61  ? -0.450  5.131   5.701   1.00 0.00 ? 61  GLU A OE1  7  
ATOM 11354 O OE2  . GLU A 1 61  ? 0.396   3.312   6.669   1.00 0.00 ? 61  GLU A OE2  7  
ATOM 11355 H H    . GLU A 1 61  ? 0.599   7.007   4.298   1.00 0.00 ? 61  GLU A H    7  
ATOM 11356 H HA   . GLU A 1 61  ? 3.032   7.741   5.688   1.00 0.00 ? 61  GLU A HA   7  
ATOM 11357 H HB2  . GLU A 1 61  ? 3.649   5.340   5.973   1.00 0.00 ? 61  GLU A HB2  7  
ATOM 11358 H HB3  . GLU A 1 61  ? 2.239   5.783   6.914   1.00 0.00 ? 61  GLU A HB3  7  
ATOM 11359 H HG2  . GLU A 1 61  ? 1.611   4.828   4.166   1.00 0.00 ? 61  GLU A HG2  7  
ATOM 11360 H HG3  . GLU A 1 61  ? 2.374   3.622   5.183   1.00 0.00 ? 61  GLU A HG3  7  
ATOM 11361 N N    . TYR A 1 62  ? 4.414   6.572   3.707   1.00 0.00 ? 62  TYR A N    7  
ATOM 11362 C CA   . TYR A 1 62  ? 5.124   6.420   2.448   1.00 0.00 ? 62  TYR A CA   7  
ATOM 11363 C C    . TYR A 1 62  ? 5.038   4.978   1.941   1.00 0.00 ? 62  TYR A C    7  
ATOM 11364 O O    . TYR A 1 62  ? 4.862   4.049   2.728   1.00 0.00 ? 62  TYR A O    7  
ATOM 11365 C CB   . TYR A 1 62  ? 6.586   6.758   2.744   1.00 0.00 ? 62  TYR A CB   7  
ATOM 11366 C CG   . TYR A 1 62  ? 7.525   6.554   1.554   1.00 0.00 ? 62  TYR A CG   7  
ATOM 11367 C CD1  . TYR A 1 62  ? 7.794   5.279   1.097   1.00 0.00 ? 62  TYR A CD1  7  
ATOM 11368 C CD2  . TYR A 1 62  ? 8.104   7.644   0.936   1.00 0.00 ? 62  TYR A CD2  7  
ATOM 11369 C CE1  . TYR A 1 62  ? 8.678   5.087   -0.023  1.00 0.00 ? 62  TYR A CE1  7  
ATOM 11370 C CE2  . TYR A 1 62  ? 8.988   7.452   -0.184  1.00 0.00 ? 62  TYR A CE2  7  
ATOM 11371 C CZ   . TYR A 1 62  ? 9.231   6.183   -0.608  1.00 0.00 ? 62  TYR A CZ   7  
ATOM 11372 O OH   . TYR A 1 62  ? 10.067  6.001   -1.666  1.00 0.00 ? 62  TYR A OH   7  
ATOM 11373 H H    . TYR A 1 62  ? 4.979   6.465   4.525   1.00 0.00 ? 62  TYR A H    7  
ATOM 11374 H HA   . TYR A 1 62  ? 4.658   7.082   1.717   1.00 0.00 ? 62  TYR A HA   7  
ATOM 11375 H HB2  . TYR A 1 62  ? 6.649   7.796   3.069   1.00 0.00 ? 62  TYR A HB2  7  
ATOM 11376 H HB3  . TYR A 1 62  ? 6.930   6.142   3.575   1.00 0.00 ? 62  TYR A HB3  7  
ATOM 11377 H HD1  . TYR A 1 62  ? 7.337   4.418   1.585   1.00 0.00 ? 62  TYR A HD1  7  
ATOM 11378 H HD2  . TYR A 1 62  ? 7.892   8.651   1.297   1.00 0.00 ? 62  TYR A HD2  7  
ATOM 11379 H HE1  . TYR A 1 62  ? 8.899   4.086   -0.393  1.00 0.00 ? 62  TYR A HE1  7  
ATOM 11380 H HE2  . TYR A 1 62  ? 9.452   8.304   -0.681  1.00 0.00 ? 62  TYR A HE2  7  
ATOM 11381 H HH   . TYR A 1 62  ? 11.002  5.861   -1.343  1.00 0.00 ? 62  TYR A HH   7  
ATOM 11382 N N    . GLY A 1 63  ? 5.168   4.837   0.630   1.00 0.00 ? 63  GLY A N    7  
ATOM 11383 C CA   . GLY A 1 63  ? 5.109   3.525   0.009   1.00 0.00 ? 63  GLY A CA   7  
ATOM 11384 C C    . GLY A 1 63  ? 3.659   3.092   -0.220  1.00 0.00 ? 63  GLY A C    7  
ATOM 11385 O O    . GLY A 1 63  ? 3.404   2.089   -0.885  1.00 0.00 ? 63  GLY A O    7  
ATOM 11386 H H    . GLY A 1 63  ? 5.312   5.598   -0.003  1.00 0.00 ? 63  GLY A H    7  
ATOM 11387 H HA2  . GLY A 1 63  ? 5.641   3.544   -0.942  1.00 0.00 ? 63  GLY A HA2  7  
ATOM 11388 H HA3  . GLY A 1 63  ? 5.614   2.795   0.643   1.00 0.00 ? 63  GLY A HA3  7  
ATOM 11389 N N    . ASP A 1 64  ? 2.747   3.870   0.345   1.00 0.00 ? 64  ASP A N    7  
ATOM 11390 C CA   . ASP A 1 64  ? 1.329   3.580   0.211   1.00 0.00 ? 64  ASP A CA   7  
ATOM 11391 C C    . ASP A 1 64  ? 0.833   4.095   -1.142  1.00 0.00 ? 64  ASP A C    7  
ATOM 11392 O O    . ASP A 1 64  ? 0.442   5.255   -1.262  1.00 0.00 ? 64  ASP A O    7  
ATOM 11393 C CB   . ASP A 1 64  ? 0.519   4.274   1.307   1.00 0.00 ? 64  ASP A CB   7  
ATOM 11394 C CG   . ASP A 1 64  ? -0.300  3.337   2.197   1.00 0.00 ? 64  ASP A CG   7  
ATOM 11395 O OD1  . ASP A 1 64  ? -0.361  2.137   1.853   1.00 0.00 ? 64  ASP A OD1  7  
ATOM 11396 O OD2  . ASP A 1 64  ? -0.847  3.842   3.201   1.00 0.00 ? 64  ASP A OD2  7  
ATOM 11397 H H    . ASP A 1 64  ? 2.962   4.684   0.884   1.00 0.00 ? 64  ASP A H    7  
ATOM 11398 H HA   . ASP A 1 64  ? 1.249   2.496   0.299   1.00 0.00 ? 64  ASP A HA   7  
ATOM 11399 H HB2  . ASP A 1 64  ? 1.202   4.844   1.937   1.00 0.00 ? 64  ASP A HB2  7  
ATOM 11400 H HB3  . ASP A 1 64  ? -0.157  4.990   0.840   1.00 0.00 ? 64  ASP A HB3  7  
ATOM 11401 N N    . GLN A 1 65  ? 0.866   3.208   -2.125  1.00 0.00 ? 65  GLN A N    7  
ATOM 11402 C CA   . GLN A 1 65  ? 0.424   3.559   -3.464  1.00 0.00 ? 65  GLN A CA   7  
ATOM 11403 C C    . GLN A 1 65  ? -1.038  4.010   -3.440  1.00 0.00 ? 65  GLN A C    7  
ATOM 11404 O O    . GLN A 1 65  ? -1.882  3.358   -2.828  1.00 0.00 ? 65  GLN A O    7  
ATOM 11405 C CB   . GLN A 1 65  ? 0.621   2.389   -4.431  1.00 0.00 ? 65  GLN A CB   7  
ATOM 11406 C CG   . GLN A 1 65  ? 0.730   2.883   -5.875  1.00 0.00 ? 65  GLN A CG   7  
ATOM 11407 C CD   . GLN A 1 65  ? 0.022   1.927   -6.836  1.00 0.00 ? 65  GLN A CD   7  
ATOM 11408 O OE1  . GLN A 1 65  ? 0.197   0.720   -6.793  1.00 0.00 ? 65  GLN A OE1  7  
ATOM 11409 N NE2  . GLN A 1 65  ? -0.786  2.530   -7.703  1.00 0.00 ? 65  GLN A NE2  7  
ATOM 11410 H H    . GLN A 1 65  ? 1.185   2.267   -2.019  1.00 0.00 ? 65  GLN A H    7  
ATOM 11411 H HA   . GLN A 1 65  ? 1.062   4.388   -3.772  1.00 0.00 ? 65  GLN A HA   7  
ATOM 11412 H HB2  . GLN A 1 65  ? 1.523   1.839   -4.162  1.00 0.00 ? 65  GLN A HB2  7  
ATOM 11413 H HB3  . GLN A 1 65  ? -0.214  1.695   -4.342  1.00 0.00 ? 65  GLN A HB3  7  
ATOM 11414 H HG2  . GLN A 1 65  ? 0.291   3.878   -5.957  1.00 0.00 ? 65  GLN A HG2  7  
ATOM 11415 H HG3  . GLN A 1 65  ? 1.779   2.974   -6.154  1.00 0.00 ? 65  GLN A HG3  7  
ATOM 11416 H HE21 . GLN A 1 65  ? -0.885  3.525   -7.685  1.00 0.00 ? 65  GLN A HE21 7  
ATOM 11417 H HE22 . GLN A 1 65  ? -1.294  1.990   -8.374  1.00 0.00 ? 65  GLN A HE22 7  
ATOM 11418 N N    . LEU A 1 66  ? -1.292  5.122   -4.114  1.00 0.00 ? 66  LEU A N    7  
ATOM 11419 C CA   . LEU A 1 66  ? -2.637  5.668   -4.177  1.00 0.00 ? 66  LEU A CA   7  
ATOM 11420 C C    . LEU A 1 66  ? -3.354  5.104   -5.405  1.00 0.00 ? 66  LEU A C    7  
ATOM 11421 O O    . LEU A 1 66  ? -2.877  5.252   -6.529  1.00 0.00 ? 66  LEU A O    7  
ATOM 11422 C CB   . LEU A 1 66  ? -2.597  7.197   -4.136  1.00 0.00 ? 66  LEU A CB   7  
ATOM 11423 C CG   . LEU A 1 66  ? -1.608  7.816   -3.147  1.00 0.00 ? 66  LEU A CG   7  
ATOM 11424 C CD1  . LEU A 1 66  ? -1.327  9.279   -3.496  1.00 0.00 ? 66  LEU A CD1  7  
ATOM 11425 C CD2  . LEU A 1 66  ? -2.098  7.654   -1.707  1.00 0.00 ? 66  LEU A CD2  7  
ATOM 11426 H H    . LEU A 1 66  ? -0.599  5.647   -4.608  1.00 0.00 ? 66  LEU A H    7  
ATOM 11427 H HA   . LEU A 1 66  ? -3.167  5.336   -3.284  1.00 0.00 ? 66  LEU A HA   7  
ATOM 11428 H HB2  . LEU A 1 66  ? -2.358  7.561   -5.135  1.00 0.00 ? 66  LEU A HB2  7  
ATOM 11429 H HB3  . LEU A 1 66  ? -3.596  7.560   -3.896  1.00 0.00 ? 66  LEU A HB3  7  
ATOM 11430 H HG   . LEU A 1 66  ? -0.663  7.279   -3.228  1.00 0.00 ? 66  LEU A HG   7  
ATOM 11431 H HD11 . LEU A 1 66  ? -2.226  9.872   -3.324  1.00 0.00 ? 66  LEU A HD11 7  
ATOM 11432 H HD12 . LEU A 1 66  ? -0.519  9.654   -2.867  1.00 0.00 ? 66  LEU A HD12 7  
ATOM 11433 H HD13 . LEU A 1 66  ? -1.037  9.354   -4.544  1.00 0.00 ? 66  LEU A HD13 7  
ATOM 11434 H HD21 . LEU A 1 66  ? -3.103  7.233   -1.711  1.00 0.00 ? 66  LEU A HD21 7  
ATOM 11435 H HD22 . LEU A 1 66  ? -1.426  6.986   -1.168  1.00 0.00 ? 66  LEU A HD22 7  
ATOM 11436 H HD23 . LEU A 1 66  ? -2.114  8.627   -1.217  1.00 0.00 ? 66  LEU A HD23 7  
ATOM 11437 N N    . LEU A 1 67  ? -4.488  4.469   -5.149  1.00 0.00 ? 67  LEU A N    7  
ATOM 11438 C CA   . LEU A 1 67  ? -5.276  3.882   -6.219  1.00 0.00 ? 67  LEU A CA   7  
ATOM 11439 C C    . LEU A 1 67  ? -6.405  4.841   -6.601  1.00 0.00 ? 67  LEU A C    7  
ATOM 11440 O O    . LEU A 1 67  ? -6.706  5.014   -7.781  1.00 0.00 ? 67  LEU A O    7  
ATOM 11441 C CB   . LEU A 1 67  ? -5.762  2.486   -5.824  1.00 0.00 ? 67  LEU A CB   7  
ATOM 11442 C CG   . LEU A 1 67  ? -4.731  1.586   -5.141  1.00 0.00 ? 67  LEU A CG   7  
ATOM 11443 C CD1  . LEU A 1 67  ? -5.411  0.412   -4.433  1.00 0.00 ? 67  LEU A CD1  7  
ATOM 11444 C CD2  . LEU A 1 67  ? -3.667  1.117   -6.136  1.00 0.00 ? 67  LEU A CD2  7  
ATOM 11445 H H    . LEU A 1 67  ? -4.870  4.354   -4.231  1.00 0.00 ? 67  LEU A H    7  
ATOM 11446 H HA   . LEU A 1 67  ? -4.619  3.762   -7.081  1.00 0.00 ? 67  LEU A HA   7  
ATOM 11447 H HB2  . LEU A 1 67  ? -6.617  2.597   -5.157  1.00 0.00 ? 67  LEU A HB2  7  
ATOM 11448 H HB3  . LEU A 1 67  ? -6.120  1.980   -6.720  1.00 0.00 ? 67  LEU A HB3  7  
ATOM 11449 H HG   . LEU A 1 67  ? -4.220  2.170   -4.375  1.00 0.00 ? 67  LEU A HG   7  
ATOM 11450 H HD11 . LEU A 1 67  ? -6.487  0.458   -4.605  1.00 0.00 ? 67  LEU A HD11 7  
ATOM 11451 H HD12 . LEU A 1 67  ? -5.020  -0.526  -4.828  1.00 0.00 ? 67  LEU A HD12 7  
ATOM 11452 H HD13 . LEU A 1 67  ? -5.212  0.468   -3.363  1.00 0.00 ? 67  LEU A HD13 7  
ATOM 11453 H HD21 . LEU A 1 67  ? -2.715  1.593   -5.900  1.00 0.00 ? 67  LEU A HD21 7  
ATOM 11454 H HD22 . LEU A 1 67  ? -3.559  0.035   -6.069  1.00 0.00 ? 67  LEU A HD22 7  
ATOM 11455 H HD23 . LEU A 1 67  ? -3.970  1.390   -7.147  1.00 0.00 ? 67  LEU A HD23 7  
ATOM 11456 N N    . GLU A 1 68  ? -7.000  5.441   -5.580  1.00 0.00 ? 68  GLU A N    7  
ATOM 11457 C CA   . GLU A 1 68  ? -8.090  6.378   -5.793  1.00 0.00 ? 68  GLU A CA   7  
ATOM 11458 C C    . GLU A 1 68  ? -8.089  7.450   -4.701  1.00 0.00 ? 68  GLU A C    7  
ATOM 11459 O O    . GLU A 1 68  ? -7.866  7.148   -3.530  1.00 0.00 ? 68  GLU A O    7  
ATOM 11460 C CB   . GLU A 1 68  ? -9.435  5.651   -5.848  1.00 0.00 ? 68  GLU A CB   7  
ATOM 11461 C CG   . GLU A 1 68  ? -9.585  4.873   -7.156  1.00 0.00 ? 68  GLU A CG   7  
ATOM 11462 C CD   . GLU A 1 68  ? -10.963 4.215   -7.248  1.00 0.00 ? 68  GLU A CD   7  
ATOM 11463 O OE1  . GLU A 1 68  ? -11.924 4.838   -6.745  1.00 0.00 ? 68  GLU A OE1  7  
ATOM 11464 O OE2  . GLU A 1 68  ? -11.026 3.105   -7.818  1.00 0.00 ? 68  GLU A OE2  7  
ATOM 11465 H H    . GLU A 1 68  ? -6.749  5.295   -4.623  1.00 0.00 ? 68  GLU A H    7  
ATOM 11466 H HA   . GLU A 1 68  ? -7.892  6.836   -6.762  1.00 0.00 ? 68  GLU A HA   7  
ATOM 11467 H HB2  . GLU A 1 68  ? -9.518  4.969   -5.002  1.00 0.00 ? 68  GLU A HB2  7  
ATOM 11468 H HB3  . GLU A 1 68  ? -10.246 6.374   -5.755  1.00 0.00 ? 68  GLU A HB3  7  
ATOM 11469 H HG2  . GLU A 1 68  ? -9.442  5.545   -8.002  1.00 0.00 ? 68  GLU A HG2  7  
ATOM 11470 H HG3  . GLU A 1 68  ? -8.809  4.110   -7.220  1.00 0.00 ? 68  GLU A HG3  7  
ATOM 11471 N N    . PHE A 1 69  ? -8.342  8.680   -5.124  1.00 0.00 ? 69  PHE A N    7  
ATOM 11472 C CA   . PHE A 1 69  ? -8.374  9.798   -4.197  1.00 0.00 ? 69  PHE A CA   7  
ATOM 11473 C C    . PHE A 1 69  ? -9.772  10.415  -4.129  1.00 0.00 ? 69  PHE A C    7  
ATOM 11474 O O    . PHE A 1 69  ? -10.189 11.120  -5.047  1.00 0.00 ? 69  PHE A O    7  
ATOM 11475 C CB   . PHE A 1 69  ? -7.393  10.846  -4.727  1.00 0.00 ? 69  PHE A CB   7  
ATOM 11476 C CG   . PHE A 1 69  ? -7.330  12.122  -3.885  1.00 0.00 ? 69  PHE A CG   7  
ATOM 11477 C CD1  . PHE A 1 69  ? -8.266  13.095  -4.054  1.00 0.00 ? 69  PHE A CD1  7  
ATOM 11478 C CD2  . PHE A 1 69  ? -6.340  12.283  -2.967  1.00 0.00 ? 69  PHE A CD2  7  
ATOM 11479 C CE1  . PHE A 1 69  ? -8.208  14.279  -3.272  1.00 0.00 ? 69  PHE A CE1  7  
ATOM 11480 C CE2  . PHE A 1 69  ? -6.282  13.468  -2.185  1.00 0.00 ? 69  PHE A CE2  7  
ATOM 11481 C CZ   . PHE A 1 69  ? -7.217  14.440  -2.354  1.00 0.00 ? 69  PHE A CZ   7  
ATOM 11482 H H    . PHE A 1 69  ? -8.523  8.917   -6.079  1.00 0.00 ? 69  PHE A H    7  
ATOM 11483 H HA   . PHE A 1 69  ? -8.101  9.412   -3.215  1.00 0.00 ? 69  PHE A HA   7  
ATOM 11484 H HB2  . PHE A 1 69  ? -6.397  10.405  -4.774  1.00 0.00 ? 69  PHE A HB2  7  
ATOM 11485 H HB3  . PHE A 1 69  ? -7.673  11.109  -5.746  1.00 0.00 ? 69  PHE A HB3  7  
ATOM 11486 H HD1  . PHE A 1 69  ? -9.060  12.965  -4.789  1.00 0.00 ? 69  PHE A HD1  7  
ATOM 11487 H HD2  . PHE A 1 69  ? -5.590  11.504  -2.831  1.00 0.00 ? 69  PHE A HD2  7  
ATOM 11488 H HE1  . PHE A 1 69  ? -8.958  15.058  -3.408  1.00 0.00 ? 69  PHE A HE1  7  
ATOM 11489 H HE2  . PHE A 1 69  ? -5.488  13.597  -1.450  1.00 0.00 ? 69  PHE A HE2  7  
ATOM 11490 H HZ   . PHE A 1 69  ? -7.173  15.349  -1.755  1.00 0.00 ? 69  PHE A HZ   7  
ATOM 11491 N N    . ASN A 1 70  ? -10.459 10.126  -3.033  1.00 0.00 ? 70  ASN A N    7  
ATOM 11492 C CA   . ASN A 1 70  ? -11.802 10.643  -2.833  1.00 0.00 ? 70  ASN A CA   7  
ATOM 11493 C C    . ASN A 1 70  ? -12.700 10.173  -3.979  1.00 0.00 ? 70  ASN A C    7  
ATOM 11494 O O    . ASN A 1 70  ? -13.784 10.717  -4.186  1.00 0.00 ? 70  ASN A O    7  
ATOM 11495 C CB   . ASN A 1 70  ? -11.807 12.173  -2.826  1.00 0.00 ? 70  ASN A CB   7  
ATOM 11496 C CG   . ASN A 1 70  ? -12.752 12.713  -1.750  1.00 0.00 ? 70  ASN A CG   7  
ATOM 11497 O OD1  . ASN A 1 70  ? -13.445 11.975  -1.069  1.00 0.00 ? 70  ASN A OD1  7  
ATOM 11498 N ND2  . ASN A 1 70  ? -12.742 14.038  -1.637  1.00 0.00 ? 70  ASN A ND2  7  
ATOM 11499 H H    . ASN A 1 70  ? -10.112 9.552   -2.291  1.00 0.00 ? 70  ASN A H    7  
ATOM 11500 H HA   . ASN A 1 70  ? -12.119 10.252  -1.867  1.00 0.00 ? 70  ASN A HA   7  
ATOM 11501 H HB2  . ASN A 1 70  ? -10.798 12.543  -2.647  1.00 0.00 ? 70  ASN A HB2  7  
ATOM 11502 H HB3  . ASN A 1 70  ? -12.114 12.544  -3.804  1.00 0.00 ? 70  ASN A HB3  7  
ATOM 11503 H HD21 . ASN A 1 70  ? -12.149 14.586  -2.227  1.00 0.00 ? 70  ASN A HD21 7  
ATOM 11504 H HD22 . ASN A 1 70  ? -13.327 14.486  -0.961  1.00 0.00 ? 70  ASN A HD22 7  
ATOM 11505 N N    . GLY A 1 71  ? -12.217 9.167   -4.692  1.00 0.00 ? 71  GLY A N    7  
ATOM 11506 C CA   . GLY A 1 71  ? -12.963 8.617   -5.811  1.00 0.00 ? 71  GLY A CA   7  
ATOM 11507 C C    . GLY A 1 71  ? -12.142 8.679   -7.101  1.00 0.00 ? 71  GLY A C    7  
ATOM 11508 O O    . GLY A 1 71  ? -12.274 7.815   -7.967  1.00 0.00 ? 71  GLY A O    7  
ATOM 11509 H H    . GLY A 1 71  ? -11.335 8.730   -4.517  1.00 0.00 ? 71  GLY A H    7  
ATOM 11510 H HA2  . GLY A 1 71  ? -13.235 7.583   -5.599  1.00 0.00 ? 71  GLY A HA2  7  
ATOM 11511 H HA3  . GLY A 1 71  ? -13.893 9.171   -5.941  1.00 0.00 ? 71  GLY A HA3  7  
ATOM 11512 N N    . ILE A 1 72  ? -11.314 9.709   -7.188  1.00 0.00 ? 72  ILE A N    7  
ATOM 11513 C CA   . ILE A 1 72  ? -10.472 9.896   -8.358  1.00 0.00 ? 72  ILE A CA   7  
ATOM 11514 C C    . ILE A 1 72  ? -9.732  8.591   -8.661  1.00 0.00 ? 72  ILE A C    7  
ATOM 11515 O O    . ILE A 1 72  ? -9.633  7.716   -7.803  1.00 0.00 ? 72  ILE A O    7  
ATOM 11516 C CB   . ILE A 1 72  ? -9.546  11.098  -8.165  1.00 0.00 ? 72  ILE A CB   7  
ATOM 11517 C CG1  . ILE A 1 72  ? -10.280 12.408  -8.455  1.00 0.00 ? 72  ILE A CG1  7  
ATOM 11518 C CG2  . ILE A 1 72  ? -8.277  10.953  -9.008  1.00 0.00 ? 72  ILE A CG2  7  
ATOM 11519 C CD1  . ILE A 1 72  ? -10.045 13.427  -7.339  1.00 0.00 ? 72  ILE A CD1  7  
ATOM 11520 H H    . ILE A 1 72  ? -11.213 10.407  -6.480  1.00 0.00 ? 72  ILE A H    7  
ATOM 11521 H HA   . ILE A 1 72  ? -11.127 10.125  -9.199  1.00 0.00 ? 72  ILE A HA   7  
ATOM 11522 H HB   . ILE A 1 72  ? -9.236  11.127  -7.120  1.00 0.00 ? 72  ILE A HB   7  
ATOM 11523 H HG12 . ILE A 1 72  ? -9.937  12.819  -9.405  1.00 0.00 ? 72  ILE A HG12 7  
ATOM 11524 H HG